ELF>J@@_^AUATUSHHt&IIԉHH{HLLH;u[1]A\A]ffUSHHtHHH{HHH;u1[]@fATUSHHt!IHH{HLH;u[1]A\ff.fAVAUATUSHHt/IIAAHH{HADLLH;u[1]A\A]A^DfAUATUSHHt&IIԉHH{HLLH;u[1]A\A]fAVAUATUSHHt.IIADHH{HADLLH;u[1]A\A]A^fDfUSHHtHHH{HHH;u1[]@UHAUATISHLo`eH%(H]HHEEHGheL-H$HUHuHHHELMIIfAIǁHC(@GHSHWHC(LpAHAAHHHGHs(HNHHSHLHHF$!ЉGjAUUZYHEeH+%(uHe[A\A]]IEHfUHAVAUIATISHLw`eH%(H]؉HEEHGheL5H4HUHuHHHELMйIIfAIǁID$HH@(@GID$HH@HGID$Hf%f=@GID$ HG I$HuE_,ALG(4jAVUXZHEeH+%(u%He[A\A]A^]LMIH fUHAWIAVIAUAATSHH DEeH%(HE1HEHG`EeHIHGhH,HUHuHHtkHELMHپ,AIIfAIǁIG(@GIGLwHGEDo G$jATUZYHEeH+%(u"He[A\A]A^A_]I$HLfDUHAWAVAUIATISHHHG`eL4%(LuAHEEeHIHGhH4HUHuHHtrHELMHپ4AIIfAIǁIE(@GIEHGID$(HGID$8Dw(HG jAWUZYHEeH+%(u!He[A\A]A^A_]IHFfDUHAWIAVAAUATISHH DEeH%(HE1HEHG`EeHIHGhHLHUHuHHHELMLLAIIfAIǁIG(@GIGDwHGHC(HG HC HG(HC8HG0HC0HG8CDG@EGDjAUUZYHEeH+%(u"He[A\A]A^A_]IEH'UHAUATSHHLo`eL$%(LeIHEEHGheL-HHUHuHHt^HELMHپAIIfAIǁID$(@GID$HGjAUUZYHEeH+%(uHe[A\A]]IEH]f.ATUHSHH8eH%(HD$01HIHHEH HLHHS(RPHsHpHS(LzAHAHHHPHs(HNHH{HH :HVL!ʉPHD$0eH+%(u(H8[]A\@H0f.AUATIUHSH8eH%(HD$01HIHID$H0LLHtcHUHHR(RPHUHHRHPHUHff@҉PHU HP HUHu0҈X,LP(HD$0eH+%(u,H8[]A\A]^LNAWIAVAUIATA̹UDSHH8eH%(HD$01HIHHCHu^(HLHt&IW(LRPIWLhHPD` @h$HD$0eH+%(u&H8[]A\A]A^A_uHtAVIAUA͹ATIUSHH8eH%(HD$01HHHHCHuf0HHHt0IV(HRPIVHPIT$(HPIT$8Dh(HP HD$0eH+%(u$H8[]A\A]A^uHtff.fAWIAVAUA͹ATEUHSHH8eH%(HD$01HIHHEHHHLHtHIW(LRPIWDhHPHS(HP HS HP(HS8HP0HS0HP8SDD`DP@HD$0eH+%(u.H8[]A\A]A^A_wHgfATIUSHH8eH%(HD$01HHHHCHuNHHHtIT$(HRPIT$HPHD$0eH+%(u H8[]A\uHtff.@UHSHH@t[]uUHELEVHLLH X[]ff.@UHSHH@t[]EUHHDMLEPH X[]@UHSHH@t[]E$UHHLMLEPE PH XZ[]ff.UHSHH@t[]ULEHHH []ff.fAVHAUATUSHH@t []A\A]A^HcuDu,H{xHDm(Le ULEHAVIHAUATH H[]A\A]A^ff.fUHSHH@uGU(Hu@ULMHHLEPu H XZ[][]H{xHHff.AWHAVAUATUSHHH@tH[]A\A]A^A_U@H{xDmDHHH<$UL]8ILU0L}(IąLu H<$uGULEAUHATHASARAWAVH H@[]A\A]A^A_HHLT$L$LT$L$Iff.D@EEfUSHFhHHE  HHE t|HHEHHHHE @ubuyHHtHHHHtHH1[]H낺 HW HHE t HHn@SH~H1H{HtH{HCH;H1[UHoSHH tH{H=H[]HHff.HH= HHtH׹ 1HHHHff.ATUSLHI$tHH[]A\HŃt []A\H{pHtP1ҾID$hHH=w0H@(f%f=uHGH@pHxu[]A\H{he1H{ff.fSHHeH%(H\$HH0HL$HT$HD$D$tHHT$eH+%(u"H[H{hHt$HfIff.Iff.UHHHPHT$0HEH%HL$8LD$@LL$HeH %(HL$HHD$HD$ H$HD$$HD$eH+%(ufHHff.ATUHSHHLcxMt!1HLLLH1HHHH{hHtHHDž[]A\H{hniff.@fHWhHH=Hr`HH0HrHpHH@ HpH@H@(HH@@HHH0H9t&HH3HʉH щp8H<1H=H9uH11HtӋR4H<։  ։p81UHAWAVIAUATISH0MLz(eH%(HE1HEEM"LH ID$hMl$`eL-H,HUHuȉMIHHUHEIz LMLUHfHHǀAJIF(@HcHHMABIFIBLUHMދEAAD LLABjAULMȋUY^HEeH+%(u8He[A\A]A^A_]IEHϹ If.fDATHUSHH`H Lg eH,%(Hl$HHL$HHD$HD$x?kU4|$AD$  AD$ 1HT$eH+%(H []A\?H=0 HHH} HHID$xHxI|$x11A HD$ID$xHxD$-ID$x@@15HB $@B 1I$H} I$H|$AD$ tvAD$ 1D$H@=tjD$A$1I$H} I$H{1dAD$ 1UAD$ 1FB B 14*B $@B 1H;HD$HUHH=S HH=H HHCxHtaHH@HxHHHH@HK 0HHEHC1[]HꐐUSHHtLHkxHt!1HHHHHHH[][]fDATUSHHHHH}XHEXH}pLexHEpMt!1HLLLHExH[]A\@AWIAVAUA͹ATUHSH@eH%(HD$81Ld$LHHEHLr(MLXHcH HLHHt>XIG(H} L@HcHډEIGHED LDmHD$8eH+%(uLH@[]A\A]A^A_ 'IvHHH$H$0ff.@UHAUATSHHG@LHxhI$LI$%AD$ E‰I$IT$IE1IU[A\A]]AVIAUATIUHSHLHH=IExxDukH}HIHxhI}h1ҾIDIwNI}hIF(f%f=LuIHxht'C@E(SDU,I1I,$[]A\A]A^IuH}1HLH=wHE밀; @HHEHIHzhtiIExxDlI}hH}IV(1ɾIIgLHu 11HHEIuH4LAWAVAUATUSHHpH4$eH,%(Hl$hHHG`HHOPHG HG0ƅ HcHH11H1H|$(HHD$(LHD$0HD$8HD$@IH=L PA$AZAA$APA$ A A$ A$M@ILAD$A(AD$A,AD$A\AD$A[AD$AhAD$AD$AID$I`ID$IID$IID$A AD$ƃI0HI8HHHLLHLHD$LHD$ HD$HA$I|$xHD$PE$ D$I$O@HD$XHD$`AHHxhaH|$(8Kt5HHxhJH}hHcHsCE @t8H t!H$HeHp`Hxhe HCPHCHHǃHǃHH%HE HEHCPHHE@HEHH=ff@HHChHH  tHHkHuXHuLHHHHHHDHuH|$(D$HT$heH+%(ZHp[]A\A]A^A_HHGG HxhaHHLHcʺ HHHGHHL$HL$HI@AFLD$LD$D$9D$EVu(HH@hEHGDI|$x A9AEHHHȸHfA$AXHHD$ IT$xB@D$Lt$H8ID$xHL$ LHL@@D$D$D9H=0 I|$xIH11A HyLD$I|$xD$R1Lt$HLl$L|$ !LLH6IT$xHׅu%D$HLD$HHuI|$x1HD$LHD$Hzht;k,tH{0k,H{0HC H HC 1[][] 뾸HtHGSHHHt'H{tHCHGuLHT$LHH=vLAH$HHLH$HHALLd$HL8Aff.@AUATUSHH@HAuaE11HDH~{Hcؾ HIHthIHHDH1ۃtHc؅yLH[]A\A]AHcLHLHE1Hf.f.fDAWIAVAUATUSHL'Ht$H|$ eH%(H$1HD$HI$HD@`AG E1E11A1E1LNHt$Ht'H+HHHH HH9IEHA;Y IT$L<HD9r11A|$*u"H|$sM\$DEAIHCs!H>L~HC1VHK(CHISHIHTHLHHCHHHIljH=x@fCAWփ@sAO KAWAT$SI$ {O tdAx]1H|$ HLd$ HLAHCLt$/ fCHI3HCHCD$K1Lcǿ>L"LCL罡H뽨8HSHLH|$ 1 HHL$ HHAGfC'HL$ HHT$PHt^IL$HAH#D$@HH9rH7Cff8HSHLUHL罋AUAATUHSHfHC(HUPH9HH)HC8HEPCDHC(E1f[D]A\A]eHseHHtHxHHe uzeHseHHtHxEDHHe dZHAąu>E t#H}uHC(HEPCDHC8DHH:Aąt HC8CDH{0wH{8Aff.AW IAVIAUIպATUSLHPeH%(HD$H1HHHt$(LHHuKIF(HT$(HHSHC HD$8HCD$DtGHfsuHT$ H1fCHD$HeH+%(u;HP[]A\A]A^A_1HfKI;VP|K/H)HC1fCf.f.SHHHHHHHtH1[ff.fS1HH8HHtS5H;H=Hr[ff.@SHH;Ht HH@Hu[ff.UHo SHHt []HC$xPS$uH HH1DUHAWAVAUIATSHHVADЩuv tz;Q8tsH= L IUL LIIEIT$Ml$LI$LtMnMt$M|$L [A\A]A^A_]H HH8uIUHff.HGufu H@tHGH@UH1SىHH=wAHx(HHHH<tHH1[]HHH*fDGH 9BsH@HuHwH:fATUSHF@ t}IHHH @HH9t_H{xHtHGu|fH/ID$XH@0H9GuHCxH@tgHG(O4tBHH9uH1[]A\uH@tHGHHPHEHxH<$H<$H[]A\AVAUATUSHn$t[H~ ]A\A]A^u:AE1Hk L-HEtLH{HH[]A\A]A^Lw@HALtC$t$AE1Hk L[]A\A]A^HHOuHs0LHk E1Hff.ATUSHoxHt,HHH{ptHCptHCx[]A\HH} H@(Lu1HLff.@UI(HAWAVAUAATSHIMPeH%(H$1H$Ax@HH$H$H$H$H$uE1HI9 Dl$$MIH$IH|$(HD$HHD$AG D$8AGHHHD$AWAGHDŽ$HDŽ$DŽ$ $ $H$HH$ tƄ$$L$8H$ wHĀH$HH$H$NH$AHHS(HL$D;$rEt8ff.fDAIcIH$HHJ(HL$uH$I9tLAGKIG H|$(fAGIIGIIhAGH 9BH@HuD$0L|$DD$$D$$HI9H$H@HCHHPHEzE~5L1 ff.fHA9tH;uA9TIcAIL$1 t CLt1tHH9C0 }HVXE1l$`L|$hMHMHR0DD$pD$Tr@@|$H t$tIu IHt$ ff.II9)DHHLH@HuIt$011LLIHHD$ HHD$@LHI|xBH|$ IFDDAN4lL_HS(H|$81LDD$ DD$ H=THCHP_f@4HCxHSHPxC(HSxf%fBFLkxǃAE@ D$_AEsHC0HSxuH@tHPHHJHELspEH9 DT$TDD$@T$ IHT$ H=DD$@DT$TP@DAEqLHHIE CJHAE8AEpHǃIE(C0DD$@f%DT$ fAEDLEDT$ DD$@tIE0IE(LkxHiHD$Hl$ DT$THHC(DD$@H\$HHIE0HD$`Hx@H6IAIu H=HHHIu0L1A HHHuHH\$Hl$ DD$@Hff.AW AVAUATIUSHH/I\$eL4%(L$E1Ll$hI\$H$LUHIB(H$LHLH$HLADž$IT$I+T$HT$PH$$LL$HD$H$HD$LHH<$$LL$ADžH$eH+%(HD[]A\A]A^A_H4$H$H|$ HD$ L$HD$(HD$0HD$8HD$@HD$HHD$PHD$XHD$`IH=1HUAHH|$@ILLLLHT$@I9H|$ AH=` IHH@HI|$$L`PAD$$sP CHD$HHUI~ Ll$AFXIHD$I)I9LG1MHD$hH$LHH+$H8I^PI~XAǸAFXtrMl$Lt$Ll$@HU1HD$@HLHD$HMHD$PHD$XHD$`LLMt$IHt HLLHnA~Ht$@L)H|$ ID$T @ADG uAV( AUATAUI SHLoLwH=I HHL0LhL`@$s$C 9rN)HsC HstiHCHxHHǸ@tG`C$Ht!O4us$C 9s HEH9EsHtfE [H]A\A]A^C$[]A\A]A^ff.@AVAUAATUSHHH@tN@IH=Lc ( LsI HHtOL0L`Lh@$ HUH9UsHTtfE HD$PD$H[]A\A]A^Hff.ATUHH=SE11L``HHLHEHHCHCXHCPL[]A\@ATHLg1USHOpH@DC(Hs H{LH LTu []A\H߈CHC8[]A\ff.fAVAUAATIUHSHH9HLHHXH=tL;sHCHXH=uHDLHLHH=wt LHC0HAP L%LsHkHHLtIl$H-LcHC HH[]A\A]A^H{0L"Au2H{(C(tBP y[]A\A]A^IN LHHHvgLLHH/fHUSHHHH{(C(t~n[H]H{HktHSHC HBHHHHCH"HC oHHtH[][]M[]DAWAVAUATIUSHHHHHHXH=LHCHXH=H{ LuHHCHpP H1HHLH=w Hx1H[]A\A]A^A_H=( I$IH3H IE H LuH=twHpL=AEMuHLIELtMwL5M}IELH[]A\A]A^A_HH=w HiI} D$LHD$H[]A\A]A^A_HoH]LHzfSHHxHHt,HǃxHǃpHǃ[HpHt11HH=SH(eH%(HD$ 1H|$HHD$1 H$HHtNÅu7Åu'ÅuHÅtH=HD$ eH+%(tH([f.DSHHHHHÅu:H1HHÅtHH[US1HHt/H@Ņt r&HcHHtH@HHu1[]AVAUATUSH(eH%(HD$ 1ŅHE1DcLs HLDADAt$xH|$HD,$1LHD$HHtH@Hu5HHHH5H1 HHH5H;HÉs8H1IH=wHx(HHL E1I1ҿHHÅx.-H=HD$ eH+%(tH([]A\A]A^fD1HHHHtHHG1f.S5Ht9G‰ =HHHtm=tCSHHк HHHBHu1E1H=DH19sH1HH4 1҉[f.=USu5H1;-s]H= HHu 5HHHHH1[]@=u5H1UIHH`HT$@1HL$HLD$PILL$XLL$LeH%(HD$(1>HED$HD$HD$0HD$ uFt<7wHH*L$HHH|$(HHDHHHHxhtH|$(HƿL¾@1HXXuu_erofs_printk!$ @erofsreserved_pagesglobal_bufferslzma_streamsdeflate_streamsdev = (%d,%d), pnid = %llu, name:%s, flags:%x dev = (%d,%d), nid = %llu, blkaddr %u ofs %u dev = (%d,%d), nid = %llu, start = %lu nrpage = %u raw = %d dev = (%d,%d), nid = %llu, %s, index = %lu, uptodate = %d raw = %d dev = (%d,%d), nid = %llu, la %llu llen %llu flags %s dev = (%d,%d), nid = %llu, flags %s la %llu pa %llu llen %llu plen %llu mflags %s ret %d 6ignoring reconfiguration for fsid|domain_id. 3empty device tag @ pos %llu 3cannot read erofs superblock 3cannot find valid erofs superblock 3blkszbits %u isn't supported 3dirblkbits %u isn't supported 3invalid checksum 0x%08x, 0x%08x expected 3unidentified incompatible feature %x, please upgrade kernel 3invalid sb_extslots %u (more than a fs block) 3bad volume name without NIL terminator 3extra devices don't match (ondisk %u, given %u) 6[deprecated] fscache-based on-demand read feature in use. Use at your own risk! unsupported blksize for fscache modeDAX unsupported by block device. Turning off DAX.3rootino(nid %llu) is not a directory(i_mode %o) 6mounted with root inode @ nid %llu. 3failed to get inode (nid: %llu) page, err %ld 3unsupported i_format %u of nid %llu 3unsupported datalayout %u of nid %llu 3failed to get inode payload block (nid: %llu), err %ld 3bogus i_mode (%o) @ nid %llu 3unsupported chunk format %x of nid %llu 6EXPERIMENTAL EROFS subpage compressed block support in use. Use at your own risk! 3inline data across blocks @ nid %llu 3corrupted dir block %d @ nid %llu 3fail to readdir of logical block %u of nid %llu 3invalid de[0].nameoff %u @ nid %llu 3xattr_isize %d of nid %llu is not supported yet 3bogus xattr ibody @ nid %llu 3too large lz4 pclusterblks %u 3failed to decompress %d in[%u, %u] out[%u] 3insufficient space for decompressed data 3unidentified algorithms %x, please upgrade kernel 3algorithm %d isn't enabled on this kernel 3invalid logical cluster 0 at nid %llu 3unknown type %u @ lcn %lu of nid %llu 3bogus lookback distance %u @ lcn %lu of nid %llu 3unknown type %u @ offset %llu of nid %llu 3bogus CBLKCNT @ lcn %lu of nid %llu 3cannot found CBLKCNT @ lcn %lu of nid %llu 3inconsistent algorithmtype %u for nid %llu 3unknown type %u @ lcn %llu of nid %llu 3unknown HEAD%u format %u for nid %llu, please upgrade kernel 3per-inode big pcluster without sb feature for nid %llu 3big pcluster head1/2 of compact indexes should be consistent for nid %llu 3invalid tail-packing pclustersize %llu 3failed to get inline data %d 3readahead error at folio %lu @ nid %llu 3read error %d @ %lu of nid %llu 3failed to decompress %d in[%u] out[%u] 3unidentified lzma format %x, please check kernel version 3unsupported lzma dictionary size %u 3failed to decompress %d in[%u] out[%u] 3invalid deflate cfgs, size=%u 6EXPERIMENTAL DEFLATE feature in use. Use at your own risk! 3readahead error at folio %lu @ nid %llu 3failed to register volume for %s 3failed to get cookie for %s 3failed to get anon inode for %s 3prepare_ondemand_read failed (source %d) 3fscache_read failed (ret %d) 3%s already exists in domain %s dev = (%d,%d), nid = %llu NULL|,noacl,acl,nouser_xattr,user_xattr,dax=always,dax=never,fsid=%s,domain_id=%s,cache_strategy=%sNo source specifiederofs_inode(null)&sbi->devs->rwsem%c%cerofs (device %s): %pV%c%cerofs: %pVfailed to set initial blksizefailed to set erofs blksizeunsupported blocksize for DAX%s,%s%sfs/erofs/super.cFIEMAPREADMOREFINDTAILMIEFRPFILEDIRerofsuser_xattraclcache_strategydaxdevicefsiddomain_idalwaysneverdisabledreadaheadreadarounddev_tdeverofs_nid_tnidunsigned intflagserofs_off_tlapau64llenplenmflagsintretunsigned longstartnrpageboolrawdirindexuptodateerofs_blk_tblkaddrofs__data_loc char[]name3negative i_size @ nid %llu ./include/linux/rwsem.h3bogus dirent @ nid %llu sync_decompresssupported %u %d erofsfeatures&x->wait%sdedupefragmentsztailpackingsb_chksumcompr_head2device_tablechunked_filebig_pclustercompr_cfgszero_paddingdrop_cachessecurity.trusted.user.3invalid lz4 cfgs, size=%u 3invalid compressed data lz4interlacedshiftederofs_worker/%u./include/linux/bio.h./include/linux/highmem.h&pcl->lock&x->wait./include/linux/pagemap.herofs_pcluster-%uerofs_workerfs/erofs:onlineerofs-shrinker&sbi->umount_mutex3invalid lzma cfgs, size=%u lzma3unsupported windowbits %u deflate./include/linux/bio.h./include/linux/thread_info.h./include/linux/highmem.h./include/linux/pagemap.herofs,%sfs/erofs/fscache.c./include/linux/thread_info.h./include/linux/pagemap.hpseudo_erofslicense=GPLauthor=Gao Xiang, Chao Yu, Miao Xie, CONSUMER BG, HUAWEI Inc.description=Enhanced ROM File Systemalias=fs-erofsparmtype=reserved_pages:uintparmtype=global_buffers:uintparmtype=lzma_streams:uintparmtype=deflate_streams:uintsrcversion=A58AD05970A928778861B0Cdepends=netfs,libcrc32cintree=Yname=erofsretpoline=Yvermagic=6.13.0-rc1-MANJARO+ SMP preempt mod_unload erofs_destroy_inodeerofs_map_blocks_exiterofs_map_blocks_entererofs_readpageserofs_read_folioerofs_fill_inodeerofs_lookup$$$$ (   (0(  (  (0(  X X (`( ` (08p80( p (0h0( h (08p80( p X X   (  (0( 08@H0(  (  (08H80( HPX`hpx80( H    ((   @ @  (08x80( x (0( 0 (0880(  (08P80( P88 (0( 0( 0 (0X0( X (08H80( H (0880(  (0880(  (0880( 00 (0880(  (0@0( @ ( (  (08@80( @80(  (08`80( `80( ` (08P80( P (08H80( H80( H (080( 80( 80( 8 (00(  (0880(  (0880(  (08x80( x ( ( (0880(  (08P80( P (0880(  (08H80( H (08x80( x (08HH80( H80( HHH (0880(  (0880(  ( ( (0880(  (( (  (0( 0( 0( 0  (((((0(((0( (08@80( @80( @ (0880(  (080( 80(  (0( 0( 0 (08 80(     (0880(  (00(  (08P80( P (08@80( @ (08@80( @ ( (  (0880(  (0`0( ` (0880(  (08H`H80( H P P (0880(  ((   (0( 0 (080( 0( 0 (h( h( h( h (08X80( X (080( 8 (08(80( ( (0( 0(  (080( 8    (0( 0( 0 (08@80( @80( @80( @8 (0X0( 0P0GNUGNUaa5 s^ebLinuxLinux]2X;,[%$U         GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910!"dev = (%d,%d), nid = %llu", ((unsigned int) ((REC->dev) >> 20)), ((unsigned int) ((REC->dev) & ((1U << 20) - 1))), REC->nid"dev = (%d,%d), nid = %llu, flags %s la %llu pa %llu llen %llu plen %llu mflags %s ret %d", ((unsigned int) ((REC->dev) >> 20)), ((unsigned int) ((REC->dev) & ((1U << 20) - 1))), REC->nid, REC->flags ? __print_flags(REC->flags, "|", { 0x0001, "FIEMAP" }, { 0x0002, "READMORE" }, { 0x0004, "FINDTAIL" }) : "NULL", REC->la, REC->pa, REC->llen, REC->plen, __print_flags(REC->mflags, "", { 0x0001, "M" }, { 0x0002, "I" }, { 0x0004, "E" }, { 0x0008, "F" }, { 0x0010, "R" }, { 0x0020, "P" }), REC->ret"dev = (%d,%d), nid = %llu, la %llu llen %llu flags %s", ((unsigned int) ((REC->dev) >> 20)), ((unsigned int) ((REC->dev) & ((1U << 20) - 1))), REC->nid, REC->la, REC->llen, REC->flags ? __print_flags(REC->flags, "|", { 0x0001, "FIEMAP" }, { 0x0002, "READMORE" }, { 0x0004, "FINDTAIL" }) : "NULL""dev = (%d,%d), nid = %llu, start = %lu nrpage = %u raw = %d", ((unsigned int) ((REC->dev) >> 20)), ((unsigned int) ((REC->dev) & ((1U << 20) - 1))), REC->nid, (unsigned long)REC->start, REC->nrpage, REC->raw"dev = (%d,%d), nid = %llu, %s, index = %lu, uptodate = %d raw = %d", ((unsigned int) ((REC->dev) >> 20)), ((unsigned int) ((REC->dev) & ((1U << 20) - 1))), REC->nid, __print_symbolic(REC->dir, { 0, "FILE" }, { 1, "DIR" }), (unsigned long)REC->index, REC->uptodate, REC->raw"dev = (%d,%d), nid = %llu, blkaddr %u ofs %u", ((unsigned int) ((REC->dev) >> 20)), ((unsigned int) ((REC->dev) & ((1U << 20) - 1))), REC->nid, REC->blkaddr, REC->ofs"dev = (%d,%d), pnid = %llu, name:%s, flags:%x", ((unsigned int) ((REC->dev) >> 20)), ((unsigned int) ((REC->dev) & ((1U << 20) - 1))), REC->nid, __get_str(name), REC->flags$$$$$$$$$$@erofsli10< ,,S<<,<],<:LF<<S1,5 ,NYh+2+M+^MhWhc{hhhhintc,h*hxs8oxu8xs16xu16,xs32;xu32xs64xu64c8 #h+1c2cHI2O  valP+QX]^_`WWhh$&(<c  J    K #h % & *+ 4 =( B h; nJ } T ^ ^ c c c ^2   2  T       ? l$  l l qDlW+1   # x    ^ ^^ ^(^08@HPX+!+"cc0#e #f+#gU#h_ #uU#v;#w; key#x Z #U#V  %+W#jkey#kd#nkey#od~H  M  ) "    (  w0  8  $@   H   H  H H  H  H   H   HH@$ $ $$A $,P$Q h$ $M$M$r$ $ $c$=Akp$  $c($c,$ 0$ 8$@$A$B$cD$ H$Pmem$ @$ $+$ c$$ $ $5 $ $  $W($0$c8$@$cH$cL$ P$cX$ `$ch$ p$ Ux$c$c$|$$c$$c$c$$$ c$!$"c$%$&#$9c$:$?$A$D $F $P  $Qc($T0Y&='1 ''='U ',',0'u Uval' . .1 ' U ',u =( ((  +0( ( . (  ( ( ))  *> * *# + +> +++ ++c++ U fmtVM vaW ,BfmtMMMcMM$ ,6i,7,818,,M,M,M,MF,cF,cF,4c key,9G(:c,= 8,Uw,V mod,Ww,XM,Y| ,Z (,[ ,,\0M ,u,v,w,xc,yci+cW+ -/)-1c set-3  get-5 -7 y(   w       4   9(  90 8 !@ " H # P $ X %&` &?h 'Xp (?x ){ * + , - . /  0 > 1  2p 3  5 V 9  ;  >{ ? @. .!T.% .+ .-./ :c 3     1@/ x/W+0l+H-@1 "16=1c1c1  1TQ(1 c,1!c01( 41)>(81*cH1++P1,"X15 `16 d18 h1: l1; p1< t1=cxmse1?q\@Art1@]dl1Aq^1Bl^1F`J1IN1J+1Kc1O`1X`1]`J1`"Z@1d$1hc1kc 1l+1m 1na 1o a(1p$01q X1s`1ub1x d1y`h1zp1{a1+111 11 11 1 1`111 1Y11N(J1NPAmm10h10p1 bx1 1 1 1 1+1c1 c,1 c,1 c,1 c-1 c-1 c-1 c-1 c-1 c-1 c-1 c-1 c-1 c -1 c -1 c -1 c -1"c -1+1*Apid1 1 1+1"1 "111"(101@1bP1bX1 1"b1%01(01+ 1- ^1. ^13 ^14X16ZY1: (1=+01>+81A ^@1D ^H1G+P1H+X1KW`J1NW1T@d1W@d1Z@d1^0e1k 71m:e1pEN 1qjN(1t+81u+@Afs1xDeH1{NeP1~XeX1e`1}ih1 ip1 &Rx1 &R1 &R1U1+1 (1c11i1 X1c1P1`V1 ^ 1 ^ 1# 1>  1` 1O( 1"8 1i@ 1 H 1jP 1jX 1j` 1kh 1kp 1+x 1 k 1'W 1c 1 ^ 1 ^ 1 ^ 1#> 1@ 1 1ql 1 1 J 1 J 1"{l 1)l 1  1 l0 1 =8 1 cX 1l\ 1Fn` 1=h 1 1Pn 1 1 1 1  1!c 1"c 1# 1$+ 1& ^ 1' ^ 1( ^ J1) 13Zn 1C 1D+ 1L_n 1N+ 1Ron 1SJ( 1TJ, 1Y+0 1] 8 1^ < 1_ @ 1` D J1aH 1dVX 1gyn 1iV 1ln 1w 1x 1z+ 1} 1~n 1 ^1 ^1 1 1111 1 1+1c1[p1p1r1Ts 1c(1c,1`0rcu101TQ@1 D1"H1PP1sx1TQ1 1 "s1 s1s11 1 ^1 11>J11 1!"'1$"'J1.1<tJ1F/@@"+?;02"2# 2# "2"23 )#3 3"# 4 ]#4!; key4";04?#4A+4B#4C# 5#5# mod5w5##5# 4=#4> ]# (6 $6 $+$+6 ;#$6?3$#C$+7 c9$     $H@A@:'%:O@:$a!:&5:: #5:<+5:=+5:>+5:@6:A?6:B? 6:Eq86:G 6:H+6:K=6:M"6:N6:O~6:Q6:T6:U~6:V?6:W"7:X7:^+7:d+7:e+ 7J:i@@7:t@7:yc`7:{+h7:}cp7:ct7:+x7:7:+=:e=:—x>J:@?:$?:?:A:A 0;c';dM;e^;g|;i ;l e(' <8'<9( <<(<=('0=<>(==c=>  =:y(=;' ( src=A, dst=A ,~(#(?>?>?>:c?(2(?.)?.) val? J?!J ?"J?#^?$.) J0?*U)?+&})?,#) @})@'@ U) A)AuA ;)2?')?(?)( 3)?.^2 ?11*?2e*?3?4 ?5+?6+ B$e* fdB%B&B'1*0(?*?%(?/)?7) 8?*?+ fn? * j* **** C+C^ endC^ D;<+ccsD=^cslD?^cwfeDA^ DE+cssDG^cstiDI^BDK^cnmiDM^BDP^ BDS^0BDV^8clmDX^9BD]^:BDd^<0D,UcsD,UcsxD^D+0D.,UssD,UssxD^D<+ Dg4- r15Dm+ r14Dn+ r13Do+ r12Dp+ bpDq+ bxDr+( r11Du+0 r10Dv+8 r9Dw+@ r8Dx+H axDy+P cxDz+X dxD{+` siD|+h diD}+pD+x ipD+ +D+ spD+ , EB-EC,ED,BEE, BEE,(csEE,,cdplEE,-cpEE',/BEF,0cavlEF,4clEF,5cdEF,6cgEF%,7BEF+,8F+F+F+F+F+2F ?. pteF-F"(.2F b. pmdF-F"K.G%.G%%.^G%/n.5G' .pgdG'.^G'".5Gp .pudGp.^Gp".^G..1@HH8/HI+M Ȇ0H 4H+8. I;/I<"I="BI? c BI@ c$BIA c(BIB c+H@@J0Jz8spJ+esJ dsJ"J$J&J+(J+0J88J+XJ+`cr2J+hJ+pJ+xJ1=J+JcJJJ+J+J 7mfpuJ P7@#0"00H@@H#1M@H@.?.b.71ZHB2MH0H . H(H,H0%Hŋ8HXHhH%pH+xHH HHC$HPnHH. K t2K K t2.,?L ?L  pM3 cwdMJ swdMJ twdMJ fipMJ fcsMJ fooMJ fosMJM3MJlJ(3+=M*L3 ripM+^ rdpM,^=M.3 fipM/J fcsM0J fooM1J fosM2J 0M)3.(3.L300M@3MA3MB3J3+ dM$c4 cwdM%, swdM&, twdM', fopM(, 3M5JM6JM9c4 M<s4 M>33Js4+J4+? MQ`5 cwdMRJ swdMSJ twdMTJ fipMUJ fcsMVJ fooMWJ fosMXJMZ3M[lM\mM]nM^o rmM_pM`qMa`5xMbJL2u5+@M:5M; ^M< ^M= 5^5+H@@MO5%MP3MQu5MR5@ 6L+@M^`6M_2CM`3Ma4CMb5@Mc`6q6y+H@@Mf7MhcMkcMn^Mq^xfdMt^MwcMzcMcMc%M 6@@MP7M ^McMc fpu@M7McM+M7M7M7 M70%Mq6@@q6 N 7N ^N^W8+W8+? T8 F ! [ " y #8^i8+Wz8y+4-8+88+8H0,= %N0 ^HPD`p   c8pmu c% ^ ^ ^ r  ,`  ,b  ,dhw _hActxFn(!W0C$8@H"=P#p$8& Acpu' )*"-=. Arb0|12+3 6?7t:c;c<c =+(>{0?{PJ@pAcB%D G 2I!J+M8O JPAnsR@AidS ^UW "XЃY ZC[ ^^ _(a"jK0fjlt (,= O>x=O?+O@+OAJ cpuOCJ P =P  Q)=Q*C$Q+>  osqQ-x= Q/"R"R"R2S >S>+#>+S8=>>L+?T> ?T?T?T!?T%?T'?T,?T/#?T3?T5?T9?T<?TA?TD?TH?TL?TQ?TU?TYU !^? (U?UcU U?U U?? ??c^? U#?U$#U%U' ??V W"1@W#Y@ W&Y@W'Y@W' ^@1@Y@ X!~@X" cX&c@ XD@XD~@XD@ XE@XE~@XE@2XT @XY@XZ #X[@=Y,AY#Y qYGAeY.A1Y\AM,A=3A4J len4J02A.\A6^ 1A A8AY?A0iAjkA?zr$BsDt1@eu1RBTcU@V1@WCXA Y/F0[4F8_"G``Jha+pbxDdGA AmDn$[d_uvA$B$BHx {/F |  } ~ X  X c  8 8 !  J(  b0  8 +@ &H  L  P  LX  L`  Lh Jp Jt Jx J| #      u J z + + D    , ,    K0 @ H  P  T  X  \r` hJ ap 8H  P (X ` h  pCDF+'1@FKK+KSKgK {K( K0 K8 K@ KHKLPiLXL`DFFH@ J     +    ( !Z0 !_8 d@ "H +P +X +` Ch zp     &e #~  $   @    % / D c  Y(J y`   J L L !J "9 / > 0  1 4 N 6c <=  BM@ D"GH FyP IC$X L` O <d R |h S$p Zx ae bercu c d{ f= k0J n#@@ oH q#X r`GG:cJ KCcJ !K!K&KBA K NK!KcMNKA0K gK!KXK {KClK#KCK#KC/FK WKCWK ZELZFCZGJZHZI LLLKL [FL mnt[ L[ CLL dLdLFLPL CLCJnL\ \ L\ L\1 ] M]c]c]M]M]M ^2M^^^^1(^ZM[ct^L^&ZM  M:c_M1`EN idr` r[rcu``c(`"0`8` c@`!@H`#wP`%X`&U``'h ns`(#p`* a`Na eN`N b Nb (c Nc c c1dNd+dNdNN d Od N d7OdNdN1 e`ODe Ne ] e {OeO:cf O1@f'PDf(7Of) ] f*#P(f+P0f,8f-9f.:f/; {OPPOP1@@g/Pg0Vg1cg2  seqg3@g4Pg5`O g6`0g7 ]8(P (hPh Dh+h PhJ #PPPP i/Qii i4Q/Q jTQj j9Q k+Qk,k- xlQlQlc`l+h maxl+p+Q+ mRm ^m ^m2n &R sign>nRoRoSJR2RoUoVgRORpRp p p lR2p'Rp(p)2p-Sp.?p/p0 Rp12p52Sp6p7p8 R2 p<}Sp=p>p?p@3pA32pSSpT pUpV2 pYSpZ p[ 2p^Tp_+p` pa 0pJITpLpQ pW}Sp\SpbS2 pEfTpF T2pgTph _fdpi2pmTpnpoppc  p%Up*Rp2RU_rtp9SpB2SpdITpjfTpqT=0q \Uq q q q T 0q pU Uq\U ruUrvD nsrw uidrx Xry rzC r{J%|U q Vq!q" &R q%FVq'>Rq(+q.[Rq0 &R q3`V saq4V s Vs Ws + lens +s  (tVt # u$Vu%.u'u( 0uD'WuM#VuP(uW) 8v Wv^v^v^v^v^ v#^(v,^0 w)Ww*^w+`O Pw8Ww9Ww:cHw;cLWW+18wD3XDwEwF=wGc01 x>XxKxZxpxxx endxXWXL+2y X valyy X2y X valy y X1S*Y1U ^1V ^1W> Nc1[ZY01hY1i~@1j1k*Ycpu1lc1m^1n^ 1o^( 1Z1+1111=Z1+1 JZ@@1Z1 ^1 ^1 ^1 J1 J1+ 1+(1+01c8H@1q\1 ^1 ^1 ^1 ^1 ^ 1 ^(1 ^01 ^81 T@1 ^H1 ^P1 TX1 T`1 ^h1 ^p1 ^x1  ^1  ^1  ^1  ^1 ^1 ^1 ^1 ^1 ^1 ^1 ^1 ^1 ^H@1]1Z%1 N1! ^(1" ^01# ^81%@1&P1'Q1(R1)S1, ^X1- ^`1. ^h1/ ^p10 Tx11 ^13 ^16 17]19]1;]1=+mavg1G=Z@q\]01KF^1L1M+1N+1Oc 1P$1Q&1SF^(]^1]X^]^ l^l^q^Z1`_%1aN1h ^1i ^ 1j ^(1k ^01l ^81s T@1t ^H1ucP1c1c1c1c1c1c1c1c%1OX%1Orq1_1K^1_1l^^1^__ "_l^rq_1J`+1c +1c +1c+1c51`11111`tb1J`ts1J1`1``1```_a+"$$aZ  b /F ' z  @  D  H OP +`  +h )!p +x  < #  z  apidpz7bz9 TQz:cz; #z<C inoz=^z?E z@$@zB?H[rcuzC`zDUpbDb+ {b{c{xb1|o;d|pC$ uid|q X gid|r X |s X|t X|u X|v X|w X |x X$|y c(|z{0|{{8||{@|}{H|~{P|X|0e`|0eh|0ep|0ex| |M||U|RM,b;dkey}0e}TQ}ͥM^}Q sem}z(}[P} X `} Lh uid} Xp gid} Xt}٥x}|}~} }+ /}`Ed5e?eIeSe H~ e~! TQ~"#~#$~$$~%@ ~&$(~'&$0~(&$8~)q$@]edX^}i_TQ` ab ce? h"8kU@n$Xq`sdt"hwpxctzʫxFcFcc$$DO ] itϫ M W ߫h   b Vtty   @ ^  ^ ^ ^ ^ ^ X + + + '+ +  +( "+0 ,+8 +@ +H "+P ,+X +` +h 'Wp      c      0 = z0ei i#TQ?w iiiji@jb_ b_ ^  (*,-0 jj XckdC$e g k #m'n(o$0q{8jkpUdPql+ TQpqlxf   ژ"D(./09f :f(;ql0>8JA@%kvl llll+ZFn> =(8HX h l p t x | TQ" ^ ^ ^Fn ^ ^  % %lKnUn+on+3Xtn~nQn+d@[p[css( idA6З/@7@   #  {( +H P 0X   ( ( (H 7 7 7 +   p( p0 8(7HP5`7 xƑ78n10p[p M7 `pi0r> ,.'0@([HPX3`  + = cVbdi%  ( rh p [ Vev[ c c c  c # [   {  |Vcdi[ Vbb[   ^ lZ  (\(p1hyTsz|c}sM܁(P0+X#x`r @4s5s6 7+8+9 ;c(=c,>0?8Yss>sst2 !t It+M!t t  t!" B$c H'/u(M key)*/u+ ,(-0. 4u8 ext/9u@#Ntt31 8u tp9u: ;J<JtA;dhrJvrK%rL%@rM%rNrOrP XrQ X nsrR#rS+rV  r^ r_0e r`z re0e@ rg{Hsetriդh rj  rlU rm0% rn@ rqE%` xJ c Q ^^ ino)^ dev* (+ , uid, X0 gid- X4. 8/L@0LP1L`2Lp3^4^5J6J7^8^9J:J;J +Cx,> -ilxlxVmap>C$|x+?1x[rcuxxxL+Cx "y# nid&-+4+7[p1RySzUzXYZ cc TQ db([rcueHgXj` idmpptqMxrCu z +yyyyxyC$ )zQz QzQz#Vz)zQz vz TQ "vz0z#{z z zc (0+{1C$7C$ osq9x=;> <"z"""" }{{#{{{ {C$q{ Xq|r{sP wqv |H cpuwP|18zG|{{[rcu| wq |0 x|||( lenC$HPpG||++|+d@}}} D#@@ L|H!+"+#$P %{&  '~0 (+8Vcpu*@Vssp+c~HC$}+ `6~7#8|:|(;+H<~P=X>\} ec~fc sdagh i!~ixDE~FH I=(J#HK=PL+pM+xN+O+P+Q+R+S+TU+V=Wb Y  \+ ]+ ^{ _c~p~+|h~?0e5e52"!#;$%2'E()2+i,-0!&*!.E   opsȀ iÀ 24+6c7c :c@+:cHT pq+rs=̀+܁D+q.1@sT+++  (,s0[rcu8H  id}L+ ΂ӂ΂ (> T" 2 ^& )z ldt*8.+@9=H:h;DŽp= xC,|D"~ „+ alt+++ +(08@HPX`hpx !„F=H\H^ H`c0HX/UlruHY.؄HdHe0HiQHj +Hk+=(HR Hh b /Hs+ =(Hu˅Hz+ ppH{ЅH|+H}+H~C$ ˅=HH+=HHH   ref8bHhcl+p ops x q(HQȆ.Q..Յ.eH0HHcH 5H valH+^HOHM7HN HPc3HJTtlruHK.3HWyHX HYO@HGHI+ 7HU bHV + T(H[ 0H\ 4H^+8f@HF.yCHj.O(HmpHn+Ho+Hq Hr Hs Ht Hvc f@Hl.CHz.O0H}H~+H+H H H  H (O H#H+H+Hf@H|G..CH.ZHDkMMp@M#G^H+pZ  Y #       b    /F( c0 c4 @d8 L@ P  p  x # $ < % < 'MH5ctxH6H=H>[zH@X(HXHYz(H\ZHb+Hh+Ht=Hw H}$OHH+H+fH.ZCH3HŋH}Hp\ HmrbHNH+bc Fh Fj_ksq s@(t0u8w@{@H~@P X`6hTpmxH7H^cidHH @@H RH 5 HHH+H [p@@HeM7@Hz@H+PH+XH+`H+hH+ppgdH  #1xH) H5 H?eHE+HLcHS HZ> H]C$H_Ha#HpzHrHH+H+H+H+HH+ H+(H+0H+8H~@@H#DH+HH+PH'+XH3+`H+hAbrkH+pH!+xH+H+H%+H0+HjHz@HH̄H+hH#pHxH"HHH&H+H+HH H HHC$H{HH+H+HC$H R+z+3؂+u+ƑL+H+H-H/ #^H c.p/ 7(pmd9 -10pud; B28 @E.HF.PpteL (1XptlP>`T .hNcH @QQQQQ:c]              "6"9"<"G NC$ h:uv:vv:w+`+@:d:+:=:|:d8:::8:x:Ε:Ε:(Agen:)Aseg:*:)z0++++++++++Ε+++C$+++H:?seq:+:::?:O(O++e++::seq:+:+::::: :e:f:h#P:n+X:o+`:qC$h:s=p:u+:x:{:$:3+++—+:& seq:(+:*_n:, :. #z++/+H@:ژ: #::: :::::::ژ + @:#:#:  :3 3+ +C+1:n: :n ~+/Nc:H@:7:;|:<+ :>+(:?+0:J8:M`:O$h:P!)p:Q$.x:V:W:X:c+:C$:+:+:+:+:M:+: @:J:@:3:x:+:#J:@:+:+:=:+:+:c:c:: : J:@:C:S`)+/NC+ C$S+ C$c+::: ::c+ :: #::+(:O:+:+: +: +: + @a+q+?+CC$+/ 8 +22++ +(0 ~~^,`- #/ 0' 034678  xa9' e  " $#1@@- lru/0C$  z2@ nrz3 nsz4@M$U+dL+2 { val^d:c   H@@f%(+Akn((@,x,X,Z,\,^$+`,W-ژ ff$\- J@@f@+H+pX"#=&?){Apsi,w(Abpf/% 2>,5#s9a-"(@ x,' 8'M Y^ (0 sYt u?}11 DN 1X MYb Ф( set0,81@$HsP=Y qs.rcuc1ФDդYh }px1hE[dirդ1`,DNXc E6 YФJ#s sxXX^   åȥ+å}E}Q1}lcu}m}nTQ}o =}v?}x,}y v0}uX.Ux}+ (}r}t+ ?}}}M  }ۦ}} +} 0e$0eۦ }^} key}0e}q}ƀ}e}N0}} L} L=(}}+}+}}} W 0(}}X.O }/}} 3 }L}.LV)  TQ؂+0C$8D@ uid XPC$X `$J h || TQ| gid| X,L+q|M|rcu|ed@@ggVgh> cpugicgjcgkc BglcBgmcBgncBgocBgpcgrcgsgtgucg{ ] g|P(g} ]0g~P8Dge@@W~][(P@w+FV+? 8 ! "+#^#^ $+($+0 '(^)^ 0M1 2 3  ChD LM"Nh 8QʫR ShTb߫+b+`Q+d)/067 DIJQ R(U0V8^@fHk>PDlpn#qDoxq|rsuDvxyz{       ( 0 8 @ H P X ` h px       @"10?D 1` ӯ[rss @0%8?@ X   fn y( arg  +2  b Y,+ J0SjTUqWXDeY18Ḭ qJ iocKk HMj \c0H ^^_+ c(c,TQ0c4'8H X X X X _X#`drhrp \xAdevA(0 4_8!_@=HAid h+p+_xrP{ 5_ >!3"#=&0(#4)8*{H-?_Afq2I_35=6=7== >#0@4AtdDS_8JF@K?PP=hR]_SUCVCWC[=] ̰2 val2 Դ val<# i$n+v18_`C$abBc Bd [rcue reff0$:c)     2 > v +%) c!c'c=c AM y(NcT++ n: B2. Y0 4B 45c67÷+ͷ0 p6 q r  s g t  u  v,$ (0 X X 0 z X Դ P  c  6 X   L L( L8 Hб()D*+ ,0-=@. #`/ d0Jh1;p2 x3+4\2 ҹ val :c6B0E;UuidF XUgidG XH ҹ D\ J޹ Hߺ       ( 0 L8 L@ Hb+ c(c, 0 8@ !Twb@8-9F:F;F<F=Z >Z(?Z0@x8 FJ2 ZK sJs;_XD&EZF?G OHZIZ JZ(KF0N h8O@QHSxP} ?J+#OD cc/FT /Fҹm /FcxYZ[^\^]^^^ _^(`^0aT8cT@dHeLf^Pg^Xh^`iThjp8.cccc cccino  u( u0YcYi+ ccc ccccXFF (018@OHP JdL Jc Ji J; 1Js JJJ.6-8  c z 0 HAops! /F+ߺ+T+3 w }>  R83>4C56R? 9RC#gȷW  * H a  z   ?( q0  8  @  H  P  9X \` ph  p  x     l .i+*-/6 7 94 F; c F< c!F= c"F> c#F? c$F@ c%FA c&FI c'P 5(S0V48 W +8 X@Vwb[H \/FP _X `\ a` b (h c (p d (x CCG/ a bM z bCf#8D EF braG3YI +Jc Kc$L(M+0 : bc:zC q bccCD i biv#C(( C#C 9ȷ (+9,-./ ( ] x  \ bCC> pCa C((u#C  bC i# ȷ3 K j cf r $C 3  !   #/F3  yn   W  c18TQcD !YlH@ Z [ \2 ]P ^n `  b( d0 e8 f@ h1H jP kYX m` oh pp r x s! u: vb y { }   J=di bdij%l+m+op(q8rHs #Xu \vz` x+ y+ z+ {+ |+  +( +0 18 h 1l #p x { { 8 H 1X + +    -2( 0   )#pid b _Muid  X X  $   + c c  c c  3  =  ^f  )C * +' ,0 ->$^ PZ0 xt y )# z {  |t }% ~ H0      % + U          (  0  8 F@ H P X ` h =p  x V V V V  ~         U& PmWWWWW (W0X8X@+Hi 0(`)M*M+, wl get-l set0l(o`jtyed)* i+ i,r-.2 /+(0 09 4: b8< @=#D> H? P@2XA=`BCrE F=H*3IK DQFd`% id^DN +0+8[z@cDcHcLcPC$X+`[wbh ` 'p = z ?VdevA 8 A( P0 CX*4WN+W^+$^ kp M^c   ^pos  ^  c  9W(, 94M(, RȷRcW b_ Ua9   %&o'   c+ &21 ?/F+ XD {]   +++++t 9yn,(c 9>,yn(c aazfkC u# x V buf W  (  (  (  (   (  0 =8 op (X ` -h p 9(c[ c c Rc C/FCc M-C/F-ӯ P/F7 8n/FU CWs /FC C/FC /FC /FCM 1/FC Y/FC6 /FC/FCc^ Cz dLJcv 9CW( /F^^ :/F& b/FCc? /Fg 8C C8 C C 6mt z + EE/F 6Nc s /FJs#/F /F /F#J JO J C =J0W$ VCB 9~JW([ 9JM( /F Jy  Z) ops[&T\=](^ 0_ 8`C@aHb$Pc@dX logdS`eMpf xg hcicjcFkRFlRFm Fn Fo Fp  (})M*U opt+,0.} CM + @@mAMBCrD El( sdF0G[z8FIcFJcFKcFLcFMc  M M    ^L+bio( V3 /3 DN2 n3438 @3H;3P^X3` 3hpr  t 3x44T8 F,2#[K y,` ~R+ :cE NT ,Z@ec#,.! @1 c++E=h*L+0*.mO(0vma1212 3 +4+5+ 3>;? ?.@ b.#F21; _21+K s21d 21+++x c ++ +21 21+ M21 621Pn" PnT21+; .m21+Yidr'ccr +N rev+ 1  M[rbN ns0c8< > @ id^` h"p[rcux  ops! h "$ F% y & [(( 202 (89@: 2H= KP@dXA `0 Udir  kn = =@`h Wx  (  @  A % '# 92W( K7 d21P i:c 0'() * +.,8 - y((~ $$)~3 ;e;M; 0;m;n';o&1X;0";1=;2 (;3 ;4 ;5 (;7 0;9 8;; @;= +H;?NP,;"6 YrY=@ |r6c (r6Y~ b 9r,W( 9r6W( +r6 Nr6210;~; ; S 9rYW 9rYM( ` # X 0tgu |vw!x*y z ( g#|rq~' m #sxi }.~.> VbufN  W>+WN+?W_y+ _  M  MDNBOBP offQ immR:cqxNch      !"NcF      !Nc%      !"#$%&'()*+,-./0123456789:Nch,     <+OP'       7 , 0 4 8 < @ H LfOCC  mkeyM' \8 %%%%  $ ( 032    %%  %  ( , 70 @  D  H L%P X \%` h l p t%x% # ' *%+, - 4 38#9 : 3@HA B O 7 < = > ?  #D \PGH I J K %O%PQ R $S (T ,%X0%Y8Z @cpu[ D\ H3`a b c d e O _ g h \k5l m %n3rZs t 3z{ | \@q 5v w x %y Z% %(%0 8\@  %(mbtf%      $\0Hpid fd   mbuf    (3m  3  % 5 \ ) cnt %%%5P  5pf    3  5  \0G%%%%cnt  $pid (3l  5 G f0 C)PttcxCl\@@ H m  M3e 3  5 @  e 5 5 5  5 K   5!r" # V.<OC2.HC].CoCC @CC $Kr\% 5    5  5 3tmap57  5^tid pid 37\ %   ^5   5   5 5Rpf    \ %   %\0$%% %!%"# $ $% (pid& ,\,h%-. / 0 \(2%34 5 6 7 8 \:%;< > 5@3A B D f(+vC1$C9hC?E\0() M35HI J 5LM N 5P Q R f0C[C txdp CRC'CGvttcxKOSZ@idM <  jt jf k10(D)N+    77 d<  (i0BDEF,G;H`Id ' .!c"c '16=A] K (0:x@<.@0NO+PQ * ;. J+ w     M   (-E -FM mod-Gw ops-H! -I 6-J -K !      W  0-LO Uarg-M Ustr-N| Uarr-O  -Vw -Wc-XWO w  -\  max-^c-_c num-` ops-a! -b  )   + <  c 0 < =/WQ +7 `$- $. mod$/w@$0rH mp$1 P$2bX  8$5 $6=$7 ( $9 K $; `  $<t ($= 0 9  # W Q   9K  # M(- #` wMP  t we # wy Nc$> Z8$E mod$Fw%$GZP$p5 $q$r$s$tcmmtn$w  $| $ | $c$W$Ww   E   +5   >uc~Juxghi ʌo p W@ Hy P|X \`@&h,p  MM+  JL+012 3 < ) H?@,+A,+B,+C,+D,+E,+F,+G,+H,+I,+J,+K,+L,+M,+N,+O,PhQFlenRJ SJtagTOU"O V0(W80auxYc?8ZO@ {OH : cntJJ F"f (+++++ 10[rcu12[z3LL+ H<I<JK LM+N FHA@p"HMP Xbus` h p x=!%"# # Amsi!(#8!#@^H^P0#X 5#`h@#x J# T#^# AidJ# !!# $h#%r#'#w#)u!+ `, a- b. c/ d9 e< fF :1;<  !"# $(%0&8'@(H)P*X+`,h-p.x/012345= A#ANUNclHx{y #zc|c}=~0ρ@{H8ϗϘ1+ϙ  +Ϛ !+ϛ "+Ϝ #+ϝ $+Ϟ %+ϟ &+Ϡ '+ϡ (+Ϣ )ϣJϤ# Ϧϧb Ϩ@ϩ @Ϫ Aϫ BϬ Cϭ DϮ E%ϳOPϴ^ϵ{϶?Ϸϸ Ϲ Ϻcϻ ϼ Ͻ Ͼ Ͽ            c^^^^  (Aqos0 +,M id-./# 0(1P02+X3 ]`4 ]h5 ]p6 ]x7 ]8+9+:+;+<+ dev=AF> F? #A;yops=   #Ay Ac MNMOMP!Q!R! T(U0V8W @X HY P[X\`^h_paxcd  pmfh A `aM busbdweMg h $j (k 0m8n @oHp PqXr`s!ht!p pmvxw  py   A1 `23M5!6!89  ; (< 0>8@(@A HC - P pmEX# W#   #- sx  0X YMZ![\ !^  pm`(2  :c-      u W !sx κK!οcc+Ncu!Nc!8! K!0"!"""Nc1W"NcB{"NcO"c"d&"e2W"f4{"g lidh "###^&#+#!cma:#E#O#Y#c#m#"?"/#+  # C ops ## c TQ###$ $net$!$0q$ns#U ql(+$ r$rJrJrJ=@r$r$rJ<v$$+=r%r%r%v$0@r%.$.$ @r0% %@%+ @%C$Z%+"cw%+u@2 % a C$ %2 % a %%i70&90& @q&0 A&` D G@& J M{@&@&+%E&Zq&mrcu:R$&+%&+%1@T&[seqX ~@@[g%^Ja&d^8Di&@@J&+J'++iݢw(ݣw(ݤݧ=ݪ!|(0ݭY88ݮ^pݯ^xݲ{ݵݶ( ݹ(Vavgݺ(x ݽ"  ݾP( ݿ?P h l =p  ( J ^ Y8 ^ ^'&J(+^(+++(++ 8( kn+P1)f ssz+ 0@ idPcT^X `{hD|+z+ +/?/ O/ O/ O/  O/( d/0}/8}/@/H /P /X `/h /p 0x 0 0 O/idMMW- r..c)(+++ (D+EQH^J^ a>,fw%g+m+(u+P{+xff ,(,+,+ H@AW-BEcH KmrcuL %S@@VfY \c_i8b8,+fp-L+؃l.r8s+@y (H|cPcTssz+X`.px .. F y [./ 2 K  ^.+.p-. T.+.. .+.^. /+.T. ++/+/ ?/+0/#O/+D/#d/+T/ }/+i/ ////#/// /"ql/#/"ql/d@ 0C$D@@+@C$HC$P+XC$`C$h+p+x+D"@$ min%+ low&+'+ max(+)0/ x T1++++ # (=8{X 01؂ c(" ~@, 0,1.؂0c(1> ,:c,2 ?-2 cnt@ AAq N2{rcu1M2N iPcRc Tc2#22 C2D !aI 1aNEaSEa22 eA*3BNC"%3` V3^c03 b3c2333n4opcu#<6w +6x +6`z +6{ +6~c8#<i@{P |pDx34L+i4 nr i 4C4+:c!555 xo5 #T1P8+`+h+p{5 55#5 H!6 # z!6 &6(?0o55576 Ch6 idD refE TQ N6O[pQ d@W7Y[p\'7])7^.7Dl@@p@q@ r37 s!h6H7$7|x+I7++ (7^ at^2q7rcu@7e/@e/@7C$7+7I78+88L+6C&8+8 ^N8^^^^^DZ8_8 s8s8x8 8map G= mR RFy(8 c88D I9J(KN8L8MJ8iXQj;S;TL=U a=V q=W= X q=(Y =0Z=8\=@^=Ha>Pd=Xh =`i 4>hj M>pk k>xl M>m M>n >q >w >x>y>z ?|J?C C CD/DHD fD  D D &D D  D( *E0 ME8 aE@ 0H "fEP"9 ~;~;ro;Z3=opsRGG= x J J  J$^(J0idJ4:8@JDJHJLbtf)FPpX7`=p  MF# /G01234 5WG; G=G=~;;8=#a=G=Q=#q=G=f= =G=v= =G== =G==~;V= =G=^= >G==~;= 4>G=^> M>G=9> k>G=^R> >G=Jp> >G=>#>G=> >G=>> J>># ?G=> 0?0?5?E?E?3=@?btf:?<? c?G=c?h?HxC JJ JJJJidJ J$J(J,J0J4J8J<)F@ NHP=XCx#NhF^=-N zHE?M2N"7NANKNJJ {IAops PNp UNx=ZNCM^J_N7&8NNAbtf)FNN&O . z(/J00J45J8Amod6w@7JH8 PMXO?#CG=c?C#CG=JCCAC D0?!#JC /D0?^.)D HDG=214D fDG=MD DDJDkD#DDJD DDsD DG=^^D D0?0?D EE E EE%ED MEG=8^/E ^aE0?RE9:cE @QQ@QQQy( )F btf)FwEJ:? pF btf)FJJ :0 FE.F 0FJJkE pFFFL+f G {rcu!5)RG*E?+#,h -.j;T\GNc/H     QQ Q Q QLHjH/H jHC=~;QH#zHCoHH ICaGI   0 1 8J@ I5kI6789kI:kI{I+ HXI+end+ IJ  PWIy+f Jrcu{HJ%{IhxI50JI  (jKDKL= TQ8J<key^@JHCxPL`LpL]KL^z_KL`+a bz dR{(e{XfR{`g+h+ijk,{lKLn+jK$`L+pL+JL,++5LmapG=keyJ3LL8Maux L 01,2J4MJfGbtf)FJMMbtf)Fwf 9N:{rcu;MJ(NCL X2^V inoJ genJJJ 2 V ino^ genJ2V J , , J J  J=WV raw/>06WUi32 VUi64^VUudfV.VfidJW W hW/FhW0/FJW CWJW6WrW WCWCW CWCW WJG2.)!#W X/F^X.)X PbXc^d e^f,g,h iX(j 0k 8l a@m^HXW X/FXXX ( Y0.YX .YX^^Y0 @jYk lenl wpmnopqrYs tY(Y+Y+:mZ tlZuvYwxyz} c[ ___ _` `(4`0 _8W`@p`H _P `X`` `h`pwx`  axZ[[[5[[H\ @cD&^H[^  c^] chm^i\j\k+l+ncocpc qc$rc(sc,tc0uc4vc8wc<xc@ycDzcH{cL|cP}cT~cXc\c`cdchclcpctcxc|cccccccZ^z^^ ^^c8YP^ i@ iH^^L+^^^^___&_0_:_D_N_X__ _ _Nc_2 _Rc_ _rlZ_#_r_ `lZc+_ c4`rc ` M`M`R`9` p`\`#`+u` `ricm^` W`r` `rG2_``` ar`#!aa#1a&a Ea6a#UaRJa a-b Lb jbZaa Caaca -b/F pos  len^T c X(Xxa#Lb/FcC2b eb/FebXQb .b tag/"0 {@1 {D2bHb+7IbK oM o 7(d8 {9 {: {; < > o? A B { C {$D {(E {,F0G@H {P u1N bTO oVP oXQZR[S {\T `UhV(di8d+ `d  Xc*dOhdi ok o3edg {.dde dn osy& ^' ^) J 0+e,W-e./X0^ 2J(3J, 8]e^g_/Fbgc refd TQ(eW0ec6f <_f>@cBcCc HFfG rHzJc@KD OfQ,S, (V g refW TQXYgZW  ggf hLgi"Lgj8dim}i optnfqr= u'@wcPx,T{/FX lz4}f`h/Fp}ixX^^JJJJ"ic,JJ^ee^e5e5 J J   bP gp ex g W W_f$gci:ci j b.O -j  OTje3qj.-jeO j+ Tj3 j 'e.j.qjdnk nide+ccc j(%CHHLkbufMiOe Oe(P^0P^8R@SWBTcDr&U{&0+l X X Yl  l+lhlL+ wlChl ljC/FM(|l ljC/FM(lollY/+lY"#Y"tY<#Y<tYS#YStYt#YttY#YtY#YtY#Yt^m+ m("m g m gl ^m+m(<m g!m gm (Sm g9m g-m ^{n+kn(t{n gQm gEm ^n+n(n gim g]m ^ o+n( o gm gum ^Vo+Fo(Vo gm gm oo#oA oBJBJ !p W ( len (i fp fpVseqo  (  Wwpy+:cvp    :ceq     3q  3q  3q    3-r    Otr+ +++ 3r .-r v    eq   @ABCDEFGHIJKLMNOQRSTUVWXYZ[\]^_`abcdef q0 4 q8 q@HPX\`hlnp trtxOv+  + + + + +!+%+&+(+++.vtval. vwto++++++++++Ow   w .ww:c08x zx++ lenpmu8EzFHwdevIAJA K!(L!0MM8N @S DXcHZ0P[(X\ `] d^ haclg ph xzƀ ۀ ۀadd del     . B ƀ $ 9 \  y( $2 <ƀ C (H-0uzz#{++KL{zNc1,{^>9{>{ R{KL{0B{C{D{E={R{ {>( {%#{{{{  | abi  t2 C2| nrD ipE 2|A|L+ |PQ0Tt|U|UpadV+ S| R|XF|Y Z Jt| ]|^t|_ J {} nr| } ~}v}L+ a}^ regc idx=`} ^ ^++ idx $ ( ,}0}H=~ ^c@)~DO=@~=d~^^=(~8x=~,^^q`~.a}.}~.)~.@~.d~.~=$ ^%OK ^ ^0_.~.$1M~"` h+p x% ^ K"^ ^ ^ ^Zmepc \!Wx    > % O  ] c#zx ƀ8#ۀ80ˀ 8# 8#8#.c B3#WW\Zx$pmuctx#Fn 0ccDcHcL P%X h pG#9WW) \8z> z8z+8$%8rb&|'+(+) ^ (. 0a   -8^mkno> pcst+u+N{Ѓ|}~^݃#8t2H@w ^ ^ ^ ^]  ^(id ^08ip ^@A|HrawPX !#`whvptxn ^x{{ ^ ^ ^ ^ ^ ^ ^ ^wkZDmcssE(F$XN^3*+ ,+ =X> ^? ^@ ^A 5pidJtidJ5cpuJJ|| RSTU pidVi@`a trafbpczd e f=(gHh+Pi Xjc` fmtk Whlcpm tp!px r'$ u  x  Vseq{!p Vent|@ }+@ ~@ @Vcpu@Vts^@Vpos @Vidx @aku͈:c͈  %D  g g raw hex%:cO  M len3 ). 8 8)( `M HߊM   reg" $ %(&0' 8@ lߊ= 0-y.~/0/1 2c 3t2(yo`/ei trf(08+HrefTQP T Xc<~ cXʌ @QQ3jk Wttpmu3uv w` ,8c   cr @QQQQc3? ^O+?( O  "Ǝ ent" dev" nid"e"J"c"X ("` "   <M ent< dev< nid<e<'e ofs<c<X (<` <   0S entS devS nidSe dirSS+ S( rawS,SX-(S` S   (t entt devt nidtet+tc rawt$tX%(t` t   0 ent dev nide lae^ c(X,(`    Hۑ ent dev nidec lae pae(^0^8c@ retDXH(`    H ent dev nideX(`    ""J"u<uSutuuu("% (<% (S% (t% (% (% (% =u+("e (<e =+(S =ד+(tǓ (Ǔ =+ ( =9+() W_+("O (" W+(< (< Wؔy+(Sǔ (S W+(t (t WQy+((@ ( Wy+(} ( Wʕ+|( ( "#!/FCcz "Ee"Ju "("! <gl#|/Fz <e<Ju <[(<| S–ǖ#ܖCz SeSJu S(Sܖ t"'#F/F+cz tjetJu t(tF #/Fcnkz ԗeJu ( #/Fcz >eJu ( gz eJu T(` (  c noU+n z$ oU0+ n $0 }\+Ln '\ n (' n +T n P  ^͙+W͙ k  n  n  ^:+$*: ^e+=Ue ^+  (8 V ʚ8PMcJW 4 /FEB 6UUUE[UUUEUUU_ 8{_ 8{8,WME W+M8t M%8r8g>MlZ28e_JWc83WM(_ 8{ErrEzܜ0_ 8{9WM(8(E JXJcWkki8Jb8kJei8ACJW /FJ^J8DC+JWECA/F8g/FNKge8?/FhW0/F8JE1J8֞JWJEC/F8/FJeEX@!#@ Y8 aJ8 ^ xJ8J8 M_ӟlTMWMEc JE '_r C8{MC W + [JW , nJW8 U 8ѠWWe_ _%X_}7ExWW\a zWJW /F_2JWšJWءJ 9E q(_ wW_ x.M_ vGM82l(88(8?(W8ݢkeiEMW^^^^{QW>^^WV^Wx^^^E MM+!pItE Mǣ+Eݣ_?ME<8(/W:;;86a;/+ W U_ ;((_ =(( : < ѤM 844W$^t2"_.]8M8~YY0t28@ u8* lE/FEۥ/FcE/FcEt*/F+cESJCE<e/FE"/FCco Rseq 0rDCSsbiSopt>E SEE&Us>E EE&Us>E EE&UsT Q;>E yEE&UsT Q:.UsT .èUsT &.UsT Qgfo 3r(CRbuf @SsbJSsbiaS ɪT76T9dGT76T:GTIT9 +T{YI jIjwI7 I$II 0rU ))))noYSerr[~|zxaG9_ĬGGHH!H$G.HH&ʚU T QHRB<$>C ] CCCCCC DD*D9DHDWDfDuD)B)B)BSU ))))n)3Y < Rsb <1JSsbi>>O& K]|O!  ]7kU|T Q0%U|&U|šUsɯUsUs))`zUU ( Rsb (/JSsbi*>O& 1]|O!  ]7U|T Q0%U|&U|)[9T0zQUv)))Us)Ho Rfc 5Ssbi@? { G ,GG,G{:G  LGYGkfG-gG >vG  ԲGG&lT Q @ { G ,GG,G{:G  LGYGkfGgG>vG  GG&lT QH@Vn " &'T Q aD!DjDDDjHHHa#&Us2M  jORfc .Ssbi>O& &]|O!  ]7UvT Q0%Uv&Uv))v  k4 >}io O1Rid *Rptr 4r?Sdif1T0)))&Us3eRfc 4SsbJSsbi&hT o RRfc 1SsbiSret>S KS>F G>S  S ܸUUT ӟT Q1T Q0)&T0QeR ?Rsb ?4JRfc ?KA/FSsbiBSerrCabE$G %2?>S yS>C ""CaLPH]PhPsP$P*PPMRm_RiR$*uR*RRRRRR SS6S'S6SESTSSU~T@&ѤU2T@&U|T~>E# FEEE-F.F;FHFUFbFoF*pF|M e MNNN)N6NaJV4[f$r~G~GG~7MC z^C/kC $|C/I %IjJ9JjxJ J$Jb1j G ,GG,G{:G  LGYGkfGgG>vG  GG&lT Q0)ܜiU~TsQR~TQ0R0X UU~TsRT})X U~&hUsT Q}akCX|CjCCa# $)5AbMNZjK 1KKK$K&U}T~Q 8U T~U~&hUsT Q~R~>S  )SRUTsQ0R1ppUsT}XUXUXUXUhUsT XUh7UsT h\UsT hUsT hUsT hUsT hUsT X Uh.UsT &XUakCg|CICC>C lCaH,H{HHH>S aS>/C @Ca$>C 8 CaE< E${LP x ]PhPsP$P*PPMR_RiR$*uR*RRRRRR SSS'S6SESTSU|T &ѤU2T &U}T|$E1UsT $EVUsT )&$EUsT akCO|CjCC>S S>S  <SE[UsT ~TvQ0R0QeR Us)֞UsUsUs(Usa@Us)xrQeR UsEUsQeR QeR QeR )3YhCUsT ]U~&hUsT v / Psb /6Jlsbi 1oCr7Cnid e`n c\Serr >9I "GKI>S $ |SAQ`R\))+)3YoCmRsb >JRfid Wrr$`UUTTQQRRX oCRsb >JRfid Wrr$`UUTTQQRRX o/FRsb >JRino  ^r J`UUTTo Rfc 4rUSsbin UHSdif1SoptSret s  | G  ,GG,G|:G  LGYGfGgG>vG  iGG&lT Q0aDDDDD&UsT QvRH> Ta$T )TsQ0R0X ))T )DT )iUs)3Y&Us]  Pfc 64 Gclsbi v _ Psbi _9]  JPsb 6Jlsbi lbuf ildsb ; lret out Z6 ,sb 3J,dsb $psbi  cppos epbuf ipdif 1pid perr    "9buf 0k9sb IJ9dif #19pos 5"C7S rS7C C7F G7S S2UUT~R1PT Q0>mU~Q0_UsT@Q T1R0U~Tv Q0R0U~&hU~T eob b9sb b/J9buf bEk c" c 0' eG2%U}T|Q0&(U})3YTS%SSC,rawS S/ S S S  S SX<Q(<</F/Q(<C(^(j($v(*(G(((/i9<&{9$9&Uv7/<'// 0*0*"0.0/00010/B<'B$B7B*< (BB@-(U|TvQ &(U|)3YT<(<</F </ < < < < <X"!,"9dir"/F"C"c/,"u,,,,,$,*,G,,*,/i9"){9$9&Uv/80"%+U0m0I0a0$y0*0*000/0"*0/}Q"+Q$Q*Q&GYU~0b-A,-*-k'-(-4-@-L-X-d-,*e-IM "MNNN)N6N&=YUv T~Qs@_,U|Tv&(U|)3YT"-",dir"/F"C"c "/ "s " " "- " "W " "4 "4 "4 "4 "4 "- " " " " "6 . ./F   !!Ò6../F,mapc,ret   [!!!!!!!!!6../F,mapc   |!!!!!6tw/tw/t/Ft+tc,rawt t t t!!!!!6S/S/SC,rawS S S S !!!!!!6<30<30</F < < <!!!!6"0"0,dir"/F"C"c " " "!!!s6M0,str4M}S1wtUwt/FTwt+QwtcRrawtXt[0?tt/Ft+tc9rawt't4u't@>'t4uKts ?KtT~Q}R|XvSu?wSUwSCTrawSQSEi@SSC9rawS'S4u'S@3@'S4uKSsQ@KST|Qv<@<</F<<gA<</F'<4u'<@7A'<4uK<sUAK<Tv"A",dir"/F"C"c"NB"9dir"/F"C"c'"4u'"@uB'"4uK"sBK"T}Q|Rv]$eC4$4/Flsbi&;)6/C,sbi6MC,sbi6kC,sbi6C,sb>J6C,sbi?vDlfmhCCCC DD*D9DHDWDfDuD6GD,fcG/H'IUJUTD,idr)TE,idr.7T z$E,m z7,s zFM } ~ERsb } EJRfmt } UMn  wEUU#T%QTRw)3Yv v EPsb v @Jv ` FPsb ` 7J4 ` ERPlen ` Tc-F; b ; b ; e 4; e 4; e 4; e 4; e 4; e F; e ; e ; e ; e ; e ] FPsb 8FJ] c/F GPf c;-] %:G4 ;(4 G]|.vG4|D(4|P;c]%cG4<(4]z0G4zC4zX+]UI4TDC>67+I,n72+6J,nJ6c!J,l3+6JJ,nr+;JJ7TBsJ,vBIsJBS(]JPx(;flsiJPxi-clrk6J,nr+?JJ6+K,nr4VJJ 6TK,nr4VJJ]}KPh8}K ?_LPp ?4 I(Pgfp U; 4K K K L L !L !1L !AL !QL ! !MPp $Pq ?4 R; 4; 4L L L L L JM M !M !-M !=M ! !YM hM wM M M M !M !M !M ! !#zO4 #:4 $44 %44 &44 '44 (RN UaN UpN UN UN UNN U!N U!N U!N U! U!N WN W O WO W+O WP ! !9}QPp 9\Pq SR4 ](; 4; 4llen  (Pl__p ) W; ) (; ) 4; ) (P BQ BQ BQ B.Q B?Q B!OQ B!_Q B!oQ B! B!MRPp 9R; 4lret Q Q Q Q Q R !R !/R !?R ! ! "aS,p AR T 4 4pret (Rp__p W ( 4 (RK RK RK  SK SK 'SK !6SK !ESK !TSK !K !6!MS!9M6S0M6 A!S,ptr A<6 4!S,ptr 4=6 '#S '067T72T616T,v1/^61RT,p1;RTTT,ptrUUTT, :+v2+L+X:Q:] u: : : : int ] ,: *:Js8iJu8|Js16Ju16&Js325Ju32Js64Ju64d]/ { : +  1] 2] H I X ] ^ _ `Q:: $ & ( <]  D `      #: % & *+ 4 = B h5 nD } N  X  X  ]  ]  X  m N ###(#Q=+ee u=uejv2+W5'0   X+ z  &( *0-@ N3]] z G( ],!]0( 4)38*]H++P,X5 `6 d8 h: l; p< t=]x\se?fR@4rt@SedlAeTB`TFV;IDJ+K]OVXV]V;`"P@dh]k] l+m nV oV(p'0q zXs`ubx dyVhzp{W+    V OD(;DP4mmhpWx    +] ], ], ], ]- ]- ]- ]- ]- ]- ]- ]- ]- ] - ] - ] - ] -"] -+*4pid  + (0@XPXX "X%(+ z- X. X3 X4N6PO: (=+0>+8A X@D XHG+PH+XKM`;NMT1ZW1ZZ1Z^ [k 3m*[p?D qdD(t+8u+@4fsx4[H{>[P~H[X[`m_h _p Hx H HK+ ]e_ N]FVL X  X b4 x" V  E( 8 _@  zH _P |`X `` ah  ap +x a M ]  X  X  X ZG 7  a   D  D "$a )ba    la0  68  ]X qa\ a` 6h  a      !] "] # $+ & X ' X ( X ;)= 3a C$ D+ La N+ Ra SD( TD, Y+0 ] 8 ^ < _ @ ` D ;a=H dLX ga iL la w x z+ } ~a  X X  $  +]aa*dd ](],V0ercu=0G@ DHFP'exG z "1e ;eEez  X >;= !"3$"3;.=<Oe;F@@@ ,pad!+?@&@ J!5 key"5?x A+ B C mod$x"=>zJ# # W   z- # *X4H 3 L   "    c(  $0  8  @  M"H  M"H M"H H M"H M"H  M"H  M"H0@QOPhnLL ]64kp ](],0 8@AB]D H%Pemem@W+ ] (z0]8z@]H]LP]X#`]h(p x]]$2]q]]$z ]!$"]%&9]:{?AD /F P Q](T$0e f+ g huv5w5 keyx UV Qjkeyknkeyo;~<=(? ] (@ ]$(A ]((B ]+B6C&D&(E& (E&(5sE&,5dplE&-5pE'&/(F&05avlF&45lF&55dF&65gF%&7(F+&8 + + + + +   pte 6 "r   pmd B "!%!%%f-!%/W!' pgd!'Z-!'"W!p !pud!pN-!p"-!;@@"H"I+6vv0" 4"+80@@##3sp#+es# ds#"#$#&#+(#+0#*38#+X#+`cr2#+h#+p#+x#I3#+#]#D#+#+# 2\fpu# h2@]($ $ '0@@" 6}@"@4 K"?!6{"" { "(","{0<"{8"X"{h"%|p"+x"z" z"|"'"a"}"z!'%h!%%'%!%&%&%!,val%  D! h!%!! %,!'&!&&!"+&" &  !& <""&! &"o'o' (x"(! (]" )")x"))) ))])+,*P#fmt*L*L*L*]*L*L$+6s# +7 +88+#+L+L+L+L@+]@+]@+4] key+9P#(+]+=$8+U$+V mod+W$+XL+Y$ +Z (+[ ,+\#03L+u$+v$+w$+x]+y]s#$+Q$+ ,/.%,1] set,3& get,5?,7 (4$p ' $   D  g    (  0 8 !@ " "H # @P $ @X %Y` &rh 'p (rx ) *̯ + , -! . / I 0 q 1 i 2 3 ư 5  9  ; ? > ?b @3% -!X'-% -+ ---/ +]3'     +'+ $ ;' . d]0(     01c(1dL1e1g1i 1l ((f ]f t#3 #3 +]4T)(4)4) val4 D4!D 4"D4#X4$) D4*) 4+&) 4,#(*5)55 )6(*6f6 5*4'd*4(4)1))4.X 41*42*4344 45+46+ *(4* 4%T) 4/-* 47d*84+4+ fn4 (+*#+#+*+7U+7X end7X8;+5cs8=X5sl8?X5wfe8AX8E#,5ss8GX5sti8IX(8KX5nmi8MX(8PX (8SX0(8VX85lm8XX9(8]X:(8dX<8P,,cs8&,csx8X 8U+8},,ss8&,ssx8X 8+8g- r158m+ r148n+ r138o+ r128p+ bp8q+ bx8r+( r118u+0 r108v+8 r98w+@ r88x+H ax8y+P cx8z+X dx8{+` si8|+h di8}+p8+x ip8+#,8+ sp8+P,9 -9 9 -},p:3. cwd:D swd:D twd:D fip:D fcs:D foo:D fos:D:3.:DlDC.+':*g. rip:+X rdp:,X':.. fip:/D fcs:0D foo:1D fos:2D :). C. g.0:@. :A. :B.D.+ Q:$}/ cwd:%& swd:&& twd:'& fop:(&.:5D:6D:9}/ :</ :>.q.D/+D/+?:Qz0 cwd:RD swd:SD twd:TD fip:UD fcs:VD foo:WD fos:XD:Z3.:[l:\m:]n:^o rm:_p:`q:az0x:bD-0+@::0:; X:< X:= 0X0+0@@:O1<:P.:Q0:R1@$1D+@:^y1":_-L:`.":a/L:b0@":cy11w+0@@:f/2:h]:k]:nX:qXxfd:tX:w]:z]:]:]<:$1@@:h2: X:]:] fpu@:2:]:+:2:2:/2 :/20<:1@@1;  3; X;XQ3+~*3+:3:3+?3 D3<>3<3 >=] >> >:(4>;33 src>A& dst>A &-484z?N4 ?]"?b484 ?N4@ 4@<" @"n4#A#A#A#A!#A%#A'#A,#A/b4#A3#A5#A9#A<#AA#AD#AH#AL#AQ#AU#AY B !5(B5B]B zB5B  B55 6 6]z5B#76B$b4B% B' 6#CD"k6D#6D&6D'6D' 6k66E 6E  F)6F*'F+x" osqF-6 F/1Gɴ1Gʴ1G˴H!97H" ] H&7HD`7HD97 HDE7HE7HE97 HEl7HT 7HY7HZ b4 H[7'I7Ib4I RI8]I 7I867'3:84D len4D2U8 8 6X1v8:88U8i8 j k876r8 s tk6]u=R9T]U7Vk6W9XU8 Y<0[<8_"=``Aha+pbzx.d8{8mnAd_uv8880x {< |  } ~ N  N ]    !  A( W0  z8 +@H  lL  P  4CX  4C`  4Ch Dp Dt Dx D| b4     = D k + +     & &    0 @ H  P  T  X  \qץ` )h;  Wp 8qH  P (3X =` Gh  zp99<<+'@=AAABB (B( 8B0 8B8 MB@ kBHBPCX/C`<=0@ A   l  +    ( !{0 !8 @ "H +P +X +` 9h kp    z & #  $, 1  P6  q z {   ]  4(; `  z D 4C 4C !D " /  0  1 4  6] <6  BL@ D"=H FjP I'X L` O d RFlh Sp Zx aу bуercu c= dk f6 k0; nb4@@ oH qb4X r`=+]AA9]AAAA9U8AAA]LAv8ABAB(B9B8B9-BMB9<=BkB9RB JEBJF9JGAJHJIdBBBpBBKB mntK BK 9BBCCBB9/C9AC LL hCL 4CL MCM]M]MLMLMLNCNXNX(NDActNhCN&D C+]O:D PZDP _D ZDQ DQ(R DR R RSDS+SDSDDS  ES DS1ESDSD TZE.T DT %T uET E+]U E@U' F.U(1EU) % U*F(U+F0U,8U-9U.:U/;uEFFE F@@V/FV03V1]V2  seqV3`7V4FV5ZE V6=0V7 %8"F(WFW W+W FWD FFFFX)GXX X.G )GY JGYJG+ZG+ Y83GZGZ  ZfG[+G[,[-x\G\G\]`\+h max\+p+H+ ] H sig]JG ]H ^R{ ^SBH*H ^U4 ^V_HGHg_H _  _ z _ dH_'H_(_)_-H_._/_0 H_1_5)I_6_7_8 H _<tI_=_>_?_@_A_SI_T $_Uz_Vz _YI_Z $_[ _^I__+_` _a _J@J _L _Q _WtI _\I _bI _E]J_FzI_gJ_h _fd_i_mJ_nz_o_p] g _%K _*H _2H,_rt_9H _B)I _d@J _j]J _qJ'0` RK` ` ` ` J0` fKK `RKauKav nsaw uidax Nay az a{rK` K`!`" H `%NgKgZgpggg endgNQND+h N valh h Nh N valh  h NS OU XV XWx"=][PO0hOi97jk Ocpul]mXnX oX( P+3P+ DK@@P X X X D D+ +(+0]80@fR X X X X X  X( X0 X8 N@ XH XP NX N` Xh Xp Xx  X  X  X  X X X X X X X X X X0@SP< D! X(" X0# X8%@&P'Q(R)S, XX- X`. Xh/ Xp0 Nx1 X3 X6 7S9S;S=+\avgG3P@fR S0K:TLM+N+O] P$Q&S:T(S-]LTQT`T`TeTK`U<aDh Xi X j X(k X0l X8s N@t XHu]P]]]]]]]]<EX<ErqU?TU`T-^UUU`TrrqU=V7] 7] 7]7]WVVsb=VssDVVVo VV VUV+'' WK W <  k  I@  D  H  EP +`  +h )p +x   b4  k  z Wtpidpi7Xi9 Gi:]i; b4i<9 inoi=Xi? i@@iB76HArcuiC=`iDpXX+ jXj]j0iXko,Zkp' uidkq N gidkr N ks Nkt Nku Nkv Nkw N kx N$ky ](kz0k{8k|@k}Hk~PkXk [`k [hk [pk [xk zk*kkKk/6 X,Ztkeyl [lGl6=l/ semlk(l9Pl zX^`l 4Ch uidl Np gidl Ntlxl|l~l l+ˊ l>6Z %[ /[ 9[ C[Hm [m! Gm"Cm#Mm$Wm% m&a(m'k0m(k8m)u@M[QXn^m_n_Gn` nanb ncne76 nh8nkK@nnXnq`nsdnthnwpnx]tnzx@n]@n]n]nn.nEn % itn n) nM nh n  nX nMttynЎ nڎ n 7 nX n X nX nX nX nX nN n+ n+ n+ n'+ n+  n+( n"+0 n,+8 n+@ n+H n"+P n,+X n+` n+h nMp n nߎ nc n n ] n n n n n n6 nk0[^ n_nb4nGn76nS r_ _ _o_oo_@|`  X  (*,-0_ `Xpcapd'pe pg pk b4pmpnZ(po0pqk8` afK a a qbaqqq)a gaa+ a a a+a+)N a aGa+ a a^0*d ,.0q@(HUPzX`  + 6  ]Mbdi{  Ѷ( h p   Mev ] ] ] $ ] b4    k FlMcdi Mbb U" X   (3(ahrydrzqr|]r}r6qrq(rF0r+Xr#r`/d@s4'es5'es6 zs7+s8+s9܁ s;](s=],s>a0s?}8d ,e 6e @e Jecetetztztt et!%t" /(t$]Ht'Dft(L keyt)t*Dft+z t,z(t-z0t. If8 extt/Nf@cee t3 t8f tpt9ft: zt;Dt<De 65QhaJgaKqaLq@aMqaNaOaP NaQ N nsaRzaS+aV  a^ a_ [ a`k ae [@ agkHsetaih aj alK am anl@ aq`u0iuDu u]u  uXuX inou)X devu* l(u+ l, uidu, N0 gidu- N4u. 8u/@C@u0@CPu1@C`u2@Cpu3Xu4Xu5Du6Du7Xu8Xu9Du:Du;Dv+Xiv,x"v- w"iw#I nidw&w-+w4+w7awRwjwSjwUjwXwYwZ ]wc G wdX(Arcuwe=HwgzXwj` idwmpwptwqLxwr9wuj+jjjiXiwj'xjx Gxy y"jyj yb4 yjykjy]yzz(z0nkz1'z7' osqz96z;x"z<1z1z1z1z1z { kkkkk {l{'{{kX|qAl|rk|sF wq|vFlH cpu|wP Alex}l}e}l}l( len}'H}lP}pKll++l+l+Q@~m~m~m~ .~b4@@~ PlH~!+~"+~#~$F ~%k~&=  ~'0n0 ~(+8Mcpu~*@Mssp~+wnH'm+`~60n~7b4~8l~:l(~;+H~<0nP~=X~>\m~ewn~f] sda~go~hU"~io5n^x~Do~E0n~Fo~H ~I6(~Jb4H~K6P~L+p~M+x~N+~O+~P+~Q+~R+~S+~T~U+~V6~WX ~Y  ~\+ ~]+ ~^l ~_wnp0no+l|n#p 0 0"4p#5$%'Xp()+|p,-!p &p *4p .Xp po opsp|p pp2q4+6]7] +]r@>q+]rHgqrpqrq>qrrrsq q'rqrpr+rq.r=r+Rrr qq@rrrgqr+r+r+ r (r,rr0Arcur=8rrHrprrr idrrrD+rrrr r(0sx"N  sX& )k ldt*s8.+@96H:zh;tp= xC&|D~ s tz+ alt+++ +(}08@HPX`hpx !st F0s'"\u"^ z"`]"XEu,lru"Y t "d "e"igu "j + "k+'("Ruu"hWEu"s+ '("uu"z+ pp"{u"|+"}+"~' u'"v"+'"&v"v" zv ref˔8XHظh]l+p ops ڹxz&vR("Qv gu u u v]"="v "] " W" wval"+-"vE"MLw"N z"P]B"Jiwslru"K %wB"Ww""X z""YwE@"Gw"I+Lw"UW"V + iw("[ 0"\ 4"^+8Y@"Fx wL"j@E("mx"n+"o+"q "r "s "t "v] Y@"lx xL"z@E0"}y"~+"+" z" z" z " z(E "6y"+"+"Y@"|Yy x yL"@K"D}y6w6x@66y-"+}yK z 4 b4  U    W  z  <( ]0 ]4 1Z8 B@ P  p  zx # $  %  '6Ey"5zctx"6z z"=z">j"@N("X {"Yk("\b{"b+"h+"t<"w "}$E"{"+"+Y"{ b{L"=B"{""y""}y "{\rb"D"+z {b|c eh ej~kq s`(tκ0u8w@{`H~`P(X<`Uhspx||z {"@}"Xcid"" @@" [}" W "}""+" a@@"n6@}@"j@"+P"+X"+`"+h"+ppgd"  x") "5 "?n"E+"L]"S "Zx""]'"_"ab4"pk"r""+"+"+"+""+ "+("+0"+8"97@"b4D"+H"+P"'+X"3+`"+h4brk"+p"!+x"+"+"%+"0+"s"@""t"+h"b4p"x"""z"&"+"+"" " "r"'"k""+"+"'" [}}++3r+  f  +ρD+-" ];p/q07q(pmd9 * 0pud; ?!85@E;HF;PpteL % XptlP4`T .h=]"ւ @_____16191<1G'+ 8+22++ +(0 X,̃- b4/ I0z034|678  xa9  T " $b4@@-| lru/0' Ti2 nri3 nsi4:D+˄D+ valX ˄+]   P 1 @ mz\ 8 Lz =B z(z0 s=t u76a p.DX6=X ( set߇0 8@HVPp'= RV yrcu=d]oʲ.:h ^pwxoh߇&Adir` .pDXG&߇߇:+TTYNN?wc+  l  lllArculm=lnGlo 'lvlx&ly -lu8 ,xl+(lrlt+lllL ƈg l lz l zω+ lۉ [ [l=lω keyl [lRl^ l]lDl l 4C l 4C'(lˊl+l+lll  (l l8 E l ll |B l*"l * 4Ƌ Gr+0'8@ uid NP'X `$"hkk Gk gidk N D+Rk* kyrcuk=CƋQ@@Vg3Vhx" cpuVi]Vj]Vk] (Vl](Vm](Vn](Vo](Vp]Vr]VsVtVu]V{ % V|F(V} %0V~F8.VB@@4X%8h"F@S+b40@44tdD8;F=@K76PP6hRSU9V9W9[6] W _ val i val  <ƔƔ˔in+vc8_^`'a^b^(c (d Arcue= reffƔ0 } v + %h=]Tŕە++ Cnŕ+ . 40  4 4u5]6u7+  0 p qz r  s A t z u  v&$( 3 N  U N P Η ] 3   @C @C( @C8 zHӗЛ()*+ ,0-6@. b4`/ d0Ah1p2 x3+47  val +]6ܘ BE,uidF N,gidG N H D7JH ܘ ܘ ܘ ܘ ܘ  ܘ( ܘ0 4C8 4C@H=+ ](], ܘ0 ܘ8z@ !/$=@89!:!;!<!=5 >5(?50@S8!A 5Η&NAN:XDE5FG *H5I5 J5(K!0N C8Oa@QzHSSPXΗA*Η>><ܘ/\<\Hz<>fxYnZ[X\X]X^X _X(`X0aN8cN@dHeLfXPgXXhX`iNhjp8 ]]]] ]]]ino  =( =04]4nD+ Þ]]] ]]]]Xl!! ˟(0 8@*HPÞACqA]ƟAƟDAП AN%A% p8  ] k 0 H4ops! <++/+B wߠ" }"  ,834565ߠ,zA1 m   Ǣ    s  ( ף0  8  @  #H  3P  X ¤` ֤h  p  x , Y  i F; rzYyǢWW̢8DsEzFWraGI +J] K]$L(M+0zW]kxףzW]]z1W1ܣ #I3(LLQ(+,-./  8¤W֤Ǥۤ,WJJzTO 11iz^LnmB " d" ]Y ץ" L =B " !"  ' <B P" a" U"  "  ] PG]. =!/Z0@ Z [ \ ]߱ ^ `  bC( da0 ez8 f@ hH jzP kX m` o8h pep r x s uɳ v y {2 }U }  ٴ  $ . 8 B(  z  4pid X  Duid  N N  $    + ] ]  ] ]  B E" 6"  XY  )L *=" +3" ," -}L- Pz00      < ha+6 v       & ?  S(  0  c8 !@ |H P |X ` h ѵp  cx        : S  l  l  cvl 0()L*L+,  get- set0"(    "'@Q)q* 1+ 1,*d-U.u /+(0 09 l4:W8< @=b4D> zH? zP@XA6`BCE F6HIK z.Q6 v  Q+Q+$- ƭLX]   pos  -  ]Dz+gzIzLl]  zTz @z]+'Yz/ Er<z^zwz̯zz ѯ+z++++TeIaz]&qza]Nzk vưz۰۰z ˰zz]?zz]XX]] DX]g9<9]L9<߱d<Ʊ<9Cd<9 a9<9Hz<9fd<9Ld<9d<9lŲd<9<9]3d93U`dC`D]g=9j<XX ɳ<<9z]γd<z2d9Ud97sd9sx Z9s Ŵmt j +ԴԴ<Ŵ=] <A&<?<+S<DcAX|A޴hA9 ѵA۰9ֵA:ALNN<Η?lAjX q 9LzM"Ѷ+@@ALBCD E( sdF0Gj8@I]@J]@K]@L]@M]ѶѶtbio˸q  . 74Y8 z@cHPXXm` whpr  t |xLQC  %'+]EN<T LZ`eL;Aρ`Qv++ex'-+D+ڹ -+ <E(00vma1/ 2 I3 +4+5+ ߹B>Z"? "@ e/ Z~/ +j/ / +++ρκ]ρ++Ӻ+/ (/ +zL</ -U/ aAas/ +$Z;/ +xidrǻ]]  +D rev+  .  LArbD ns}0]8< >@ idX` zh;pArcu=x. / ops! h ("A$ Z% x & (( 02 89@: H= ɿP@XA `/  6,dirǻ   6 knz۰ z6 6@`h x    @  A %|@(A۰z-zZ۰Fzx۰z_۰z}Tɿ/ ο+](0'() * +, - (4((Xz} X}11L1 1m 1n 1o&X101112 13 z14' 15 T(17 019 T81; @1= H1?PXW"Tz,zYzz/ 11 1 ==L` b4Ѷ lXB0tu vw!x*'y; z U( ("};",U"TY@^ }~ Mbuf  ++?Qw++Dg&"&L?"0?]"]ZIbv 0JѶ{@pHLPaXbus`h zp zx6p<U 4msi(8@XHXPX `hx $. l4idDb4 !!# $8%B'#G)F+ `, a- b. c/ d9 e< f_+z_z B D E FO G^ H̃ IzJ ;!]"] J TY'AK : @_ cN O+ P Q  * 5 . D+qq    &2 >L!(,E!,FL mod,G$ ops,H!,I 0,J,KD ?+,Lr,arg,M z,str,N,arr,O,V,W],Xr ,\ max,^],_] num,` ops,a!,bz.%0(.)hD/+ W+ ]  Q+7`-.Ѷ mod/$@0H mp1P2XX 85U67 x9 ; <(= 0nnsUnsL}$L$$=]>K8E/modF$<GKPpqzrzst]\mtnw  ] ?h/+'  Sfwn_f 7-qLL+v<"/+] zIz $zzH b4 kz (760 $MN 1P]R] T](A+++++ 0vArcu1=2j3vD+ HIJK LM+N A:; <^r  !r"r#r $r(%r0&r8'r@(rH)rP*rX+r`,rh-rp.rx/r0r1r2r3r4r5r r{c{w=U=]lHxKy b4z]|]}6~0P@ K087  7 !7 "7 #7 $7 %7 &7 '7 (7 )Db4 X @ @ A B C D E<EPXk76  ]                ]XXXX  (4qos0+,L id-./b4 0(1F02+X3 %`4 %h5 %p6 %x7 %8+9+:+;+<+ dev={@> @?  {5 Hops r Xr  qX{Hq{]]MNLOLP!Q!R! T(U0Vr8W @X HY P[rX\r`^h_rparxcrd pmfhv{`aL busbd$eLg hf$j(k0mr8n @orHp PqXrr`s!ht!p pmvxw py]J{^`23L5!6!89 ; (< 0>r8@(@AHC P pmEX}TY0X\YLZ![\ ^ pm`(\+]-   TY]]+=]F=]p8 0!" =]1(=]BL=]Opcd&e2(f4Lg lidh   X rcma   ) 3 =p# ep p CD SI cNwSwzeABC% `X  ]Y + ]Y ^ h rponLooop]ou#eow ox `oz o{ o~]8ob4<o_@okPoFlpox`D+ `@jk lenl wpmn|o|p|q|rs t (| +|++mBtuvwxyz } ]  *M M(f0 *8@H *P X` hp$x% >  $  H3Ѷ @]D&H-  ]-] ]hi8jEk+l+n]o]p] q]$r](s],t]0u]4v]8w]<x]@y]Dz]H{]L|]P}]T~]X]\]`]d]h]l]p]t]x]|]]]]]]]B-]zjPѶ 1@ 1HD+  !& 0 : D N X b l v  ??=]e]*d**dMq]+/]f*d]Rq kqq+*d1]z*d*dH"  >*dT*SqCcqXwqh|d]b 0 0g!  <  <  <,c   0 0 0 0 < < i_u < 0 0 <@u 0 0 0 0 H i_u < < < H  <( <, ׏0 | N & X ' X ) D8]'^)_<b.c refd G(e0<n>@]B]C] HFG HkJ]@KDOQ&S&(V refW GXYZ  $h[i"[ju^m optn,qr6 u@w]Px&T{<X lz4}`zh<pxqXXDDDD"]&DDXX00 D D  Ѷ XP p 'x .  n3+]ͳ Wz;zE   ECB` "E +CB "  `Q] nid+]]] (<9HCt.mCu.mCv.mCw.mCy&Cz&C{&C|&C~%'C%'  N  N/ >D+ > H Rrnet\ f p  9 ops # ] G  aaDaDaD'@a$a$aD<4+'aXaXaX@aq 4@a]+ '+99<Lz"d9<L}1f1/f<f<eu\ uc uj F 4 L9<F  L9<F<XX`4 9`D2<N # TdD<`F3uLIF @C<@C`tN`sN!W8!Ui; i=$z:z]j@<jAqjB2C"zS@SCOTOumP &O7 U:IOu"PW  i82UURQ'<|sb.A|nid>j)<}err1S1 {T3[ Ik <UTV+0>J<\Pj ] |UP : Ul@  QU\li  zUGmK6GP><fG!Pk wmV\]iVuz$8Tl3<@PM m^G_3U fTr}w( #3A ST`>.>=3r3v~S p%Z3wO %Z>z[G8uU3 TG>3 E8TQ 3$> GOK &]P+ =3U3k}U>aO3eS %Z3f/O !%Z3iTG8uUI= >IJwO[kSO erO Y8UT Q@IhkmyINGkT!.$;$J$Y$h$wV'$$$$$8UAT@Q~ 8 UwQw>WIy  #/I;d G<k^!.$;$J$Y$h$wVO $$$$$8UA8 T~>X & Uw(T}R1&) U}T R~8Uw3X %T1=>/ & Uw(T}R1& U&) U}T & Uw(& Uw(&4 U&M Uw&)r U}T & Uw(&) U}T & Uw(& Uw(&) U}T & Uw(&)G U}T R~&)v U}T Qs & Uw(8Uw(>V $P V $*mafs$>.IIp5A8)T S}l3 S5&AMU&^eU8^U&qUZ&UUTTQ R XvZ% ~Qn*<Un7zT}nid 2#z~n)<Un6zT2 z%x?nid+[inox) P*+<9viP9errz ) *+<9sbA9sbi9viP !!"z9dic#9die$$%9iu%9buf&']9ofs']9err(=zMdhO O zTTTTTTTTTTT^^^^^^r^^^^^`!C) * -<* :z* ]9vi P9off  zb<*<<+<K<<}< <If<z<If<<z <<<<<<%1]!1@]%,]A,=]%$}$4<[sbi&2)z)/sb>A)/sbi?)]*:0)k*k@]%]Dq%]2?qL2P%]WIq%]u?qM2%%UIqcCW2,2,!,cHW?min]?max]62 2 ! a2 2 ! 2 2 ! 2 2 ! % !@C ?<?sec 4C [ts @C% !@C& E&[ts @C<% K =&% 4Ck @&% l!@C lE<?ts m@C% J!@C JE<?ts K@Cc  .<?gid ;c  .<?uid ;% u&3 uD&% ]S <&%|.z|D|PI2]%%]<!%z0zCIzX+% < :A).lJ/dev.1D0 ]1 ]% [j?cpu [5]% 8?cpu 8 86) %]/cpu @]b /cpu <]* N]#r#:$%&'(J!UY!Uh!Uw!U!U!UH!UH!UH!UH!UH!W!W!W!W#!W4!WHD!WHT!WHd!WH!WH)3!*3<)A!/ptrA<})4!/ptr4=})'#z*'0) /nr +* ;7bB;/vBI;*BS) i/nr +* ?) /nr 4* V ) /nr 4* V)"/key"J*"Z(%  .[_t  [_T . c M?_T .)\k9c^ bM/valM5OOODOb/ptr<;*H*)( /p(:;*(J]:.; /Z6/P/\; U; a y; ; ; ; int a ,; *;Rs8mRu8ZRs16Ru16 *Z*Rs32 >Ru32ZMRs64Ru64Zfa   ; /  1a 2a H I X ] ^ _ `U;; $ & <a  M g    $ # ; % & */ 4 = B h> nM } \  f  f  a  a  f z c z \  ###(#U=/#ee u=uejZ7/W>-0        f /  z   *(  *5-@! !2!a!a! z !F(! a,!!a0!( 4!)#38!*aH!+/P!,X!5 `!6 d!8 h!: l!; p!< t!=axese!?P@7rt!@Rndl!AR!BR!FU<!IBC!J/!Ka!OU!X"U!]"U<!`"N@!d!ha!ka !l/!m !n2U !o7U(!pq'0!q zX!s`!ub!x d!yTh!zp!{AU!/!!! !! !! ! !T!!! !M!! C(<!BCP7mm!h!p!5Vx! ! ! ! !/!a! a,! a,! a,! a-! a-! a-! a-! a-! a-! a-! a-! a-! a -! a -! a -! a -!"a -!/!)7pid! ! !/!! !!!(!0!@!VP!VX! !"W!%!(!+ z!- f!. f!3 f!4M!6M!: z(!=/0!>/8!A f@!D fH!G/P!H/X!KK`<!N+L!TjX!WjX!ZjX!^YY!k @2!mcY!pB !qB(!t/8!u/@7fs!xmYH!{wYP!~YX!Y`!(]h! o]p! Fx! F! F! J!/! !a!e!y]! L!a!E!J! f ! f !3 !" !T !C( !8 !]@ ! zH !]P !7^X !A^` !^h !^p !/x !^ !UK !a ! f ! f ! f !E !6 ! !^ ! ! M ! M !"^ !)_ !  ! '_0 ! 58 ! aX !,_\ !A_` !5h ! !K_ ! ! ! !  !!a !"a !# !$/ !& f !' f !( f <!)= !3U_ !C$ !D/ !LZ_ !N/ !Rj_ !SM( !TM, !Y/0 !] 8 !^ < !_ @ !` D <!a=H !d KX !gt_ !iJ !l~_ !w !x !z/ !} !~_ ! f! f! ! !$!!! z! z!/!a!_!_!a!Zb !a(!a,!U0nrcu!=0!F@! D!H!+EP!bx!F! z! "b! b!c!z! ! f! !!><!=! !!"2!$"2<!.=!< c<!F@@@  0pad !/?@  &@" J"!> key"">"?x"A/"B"C## mod#$#x""=">zJ$$[ z1$*\4H 3 P  9 "H k  ( $0 8 @ W"H W"H W"H pH W"H W"H W"H W"H5@$Q$$$?$P$Oh$$P$P$8$$ $a$57kp$ $a($a,$0$ 8$@$A$B$aD$ H$%Pnmem$@$$/$ a$$$$3$$ $0($z0$a8$z@$aH$aL$P$aX$`$ah$p$ x$a$a$$$$a$$a$a$$$z$ a$!$$"a$%$&$9a$:)$?$A$D /$F z$P 3 $Qa($T$0%e%f/%g%h%u%v>%w> key%x %U%V zQ%jkey%k%nkey%o&;~&< &= *&? a *&@ a$*&A a(*&B a+'B6'C*'D**'E* *'E*(8s'E*,8dpl'E*-8p'E'*/*'F*08avl'F*48l'F*58d'F*68g'F%*7*'F+*8 (/ (/ (/ (/ (/(  pte(6 ("r(  pmd(B (")%)%%f1)%/[)' pgd)'Z1)'"[)p !pud)pN1)p"1);@#@*H*I/=Xss0* z4*/8 @5@@++P2sp+/es+ ds+"+$+&+/(+/0+`28+/X+/`cr2+/h+/p+/x+2+/+a+M+/+/+ 2efpu+ 1@a(, , a' 5@@*% =>z@*n~@ > S*I!=7x** Ux *(*,*x0>*zx8*X*xh*%yp*/x*Gw* z*y*'*K_*y*Lw!--r!----!-*-*-!0val- z N! r!-!! -,!-.!..! "/.%". z !. F" ".! .%"v/v/ 0"0! 0g" 1"1"111 11a1/,2Z#fmt2P2P2P2a2P2P$36|#3738#83#3P3P3P3P@3a@3a@34a key39Z#(4a3=!$   83U$3V mod3W$3XP3Y$ 3Z (3[ ,3\#03P3u$3v$3w$3xa3ya|#!$/U$/ 4/7%41a set43 get4547 ^3 $w'$ͧ   9  ( 08!@" ѨH# P$ X%`&!h':p(!x)]*{+,˩-Щ./ 0 1 2R3 u5 9 ; >]?@/ <% 5!a'5% 5+ 5-5/ /q'/ , ; q'  '06c'6dP6e6g6i 6lŻ ( 'IaIt$8 $8 4a9B(  (9(9( val9 M9!M 9"M9#f9$( M9*(9+&(9,#):(:: (;);ed; >(9'R)9(9)((9.f 91)92)9394 95/96/ )(9)9%B(9/)97R)89*9/ fn9 *)**)*I/I/I/<g*<f end<f= ~* val=f =g*>;*8cs>=f8sl>?f8wfe>Af>EX+8ss>Gf8sti>If*>Kf8nmi>Mf*>Pf *>Sf0*>Vf88lm>Xf9*>]f:*>df<>+0cs>*0csx>f>*>+0ss>*0ssx>f>*>g, r15>m/ r14>n/ r13>o/ r12>p/ bp>q/ bx>r/( r11>u/0 r10>v/8 r9>w/@ r8>x/H ax>y/P cx>z/X dx>{/` si>|/h di>}/p>/x ip>/X+>/ sp>/+? ,? ? ,+p@h- cwd@M swd@M twd@M fip@M fcs@M foo@M fos@M@h-@MlMx-/-@*- rip@+f rdp@,f-@.- fip@/M fcs@0M foo@1M fos@2M @)- x- -0@@.@A.@B.M ./ ]@$. cwd@%* swd@&* twd@'* fop@(*-@5M@6M@9. @<.@>.x-M./M./?@Q/ cwd@RM swd@SM twd@TM fip@UM fcs@VM foo@WM fos@XM@Zh-@[l@\m@]n@^o rm@_p@`q@a/x@bM,//@@:/@; f@< f@= /f 0/5@@@OJ0>@P .@Q/@RJ0@Y0J/@@^0!@_,T@` .!@a.T@b 0@!@c00/5@@@fe1@ha@ka@nf@qfxfd@tf@wa@za@a@a>@Y0@@@1@ f@a@a fpu@@2@a@/@2@2@e1 @e10>@0@@0A @2A fAfUP2/~`2/p2p2/u2 z2B>2B?/B@/BAM cpuBCMC82C92C<2C=22D<#3D=aD> zD:^3D;23 srcDA* dstDA *c3n3zE3Eg"E3n3 E3F 3FF" F"3$G$G$G$G!$G%$G'$G,$G/3$G3$G5$G9$G<$GA$GD$GH$GL$GQ$GU$GY H !4(H5HaH zH5H  H5"5@5@5az4H#m5H$3H% H' E5$IJ"5J#5J&5J'5J' 555K 5K z L)06L*'L+" osqL-5 L/6Mɯ6Mʯ6M˯N!o6N" a N&T6ND6NDo6 ND{6NE6NEo6 NE6NT 6NY6NZ 3 N[6-O7O3O ^O77fO 6#OL7=7-P3p7P4M lenP4MP27 L7P6fP17p7P8 7Pi7PjPk7m5Pr8PsPt5fPu=#PR8PTaPU6PV5PW8PX7 PY<0P[<8P_"<`P`@hPa/pPbzxAPd777PmPnKd_uPv7 885x{<| }~ L Ma ! @(5V0 z8/@ПH sL P eBX eB` eBhMpMtMxM|3' 3Mg//%** 0@H zP zT zX z\x`/h<FUp8xUH P(9XC`Mh zp 88)</'#@P<P@P@P AP1APEA PYA(P iA0P iA8P ~A@P AHP)BPPGBXP`B` )<<5@@ s/  (!0!8@"H/P/X/`8hgp zz&#¥̥$ۥ5    Gw * 4a s(<` zMeBeB!M">/ C0 14 S6a<5 BP@D"<HF$gPI'XL`O dRhhSpZU~xabnrcuc=dohf5k0<n3@@oHq3Xr`<4aP@ @8a@@@A87@,A@aP,A7AEA@6AYA8JAiA8^A~A8<nA0A80A QEAQF8QG@QHQIAAAAAR$B mntR AR 8 AABBBB$B.B8`B8@LB SS BS eBS4aTB     UBU B BV  CV(W BCW W W#XwCX/XwCXwCBCX CX wCXCX|CXwC# YCAY BCY Y DYC4aZ D #@Z'DAZ(CZ)  Z*D(Z+&E0Z,8Z-9Z.:Z/;DDD DD#@@[/&E[0և[1a[2  seq[36[4D[5C [60[7 8D(\mE\ \/\ }E\M xExE+EmE]E]] z]E E^ E^E/E/ ^8E_F_ z _E`+CF`,`-xaFaFaa`a/h maxa/p/F/ b F sigbE bF cR cSFF cU4 cVFFydGd d z d Fd'HGd(d)d-Gd.d/d0 Gd1d5Gd6d7d8 G d<Hd=d>d?d@ dA dS3HdT $dUzdVz dYWHdZ $d[ d^Hd_/d` da dJHdLdQ dWHd\3HdbWH dEHdFzHdgIdh _fddidm@Idnzdodpa y d%Id*$Gd2HG0_rtd9GdBGddHdjHdqI-0e Ie e e e @I0e II eI Je 2Je!e" F e%tJe'Fe(/e.Fe0 F e3J sae42J f Jf 0f / lenf /f (gJg h$ Kh%;h'h( 0hDUKhM#JhP(hW)8i Kififififif i#f(i,f0j)Kj*fj+CPj8Lj9Lj:aHj;aLK+L/#8jDaLAjE=jF5jGa0# k>LkKkZkpkkk endkLULJ/l L vall l Ll M vall  l L!SXM!U f!V f!W"Ba![M    0!hM!io6!j!kXMcpu!la!mf!nf !of( !@N!/!!!!kN!/! MS@@!N! f! f! f! M! M!/ !/(!/0!a85@!P! f! f! f! f! f ! f(! f0! f8! \@! fH! fP! \X! \`! fh! fp! fx!  f!  f!  f!  f! f! f! f! f! f! f! f! f! f5@!Q!@N>! BC!! f(!" f0!# f8!%@!&P!'Q!(R!)S!, fX!- f`!. fh!/ fp!0 \x!1 f!3 f!6 !7Q!9Q!;Q!=/eavg!GkN@P Q0!KrR!L!M/!N/!Oa !P$!Q&!SrR(R1!]RRRRRS!`T>!aBC!h f!i f !j f(!k f0!l f8!s \@!t fH!uaP!a!a!a!a!a!a!a!a>! DX>! Drq!&T!wR!T!R1!^ TT!TRrq!T!vT9!a 9!a 9!a9!a[!T!!!!!Tzb!vTzs!M!T!TTv! UU U+T2U/}'q' W0w?}8_b b b b c6#cxXcxzxzxx cx!%x" /*x$aHx'dx(P keyx)x*dx+z x,z(x-z0x. d8 extx/d@#cXc x3# x8`d tpx9`dx: zx;Mx<Mc ;> yeyMy yay  yfyf inoy)f devy* s(y+ s, uidy, L0 gidy- M4y. 8y/qB@y0qBPy1qB`y2qBpy3fy4fy5My6My7fy8fy9My:My;Mz+ez,"z- {"@f{#? nid{&{-/{4/{7_#{Rg{S.g{U.g{X{Y{Z a{c F {dV(Krcu{e=H{gzX{j` id{mp{pt{qPx{r8{u3g/$g$g)g@feg'|Sg| F} }"Sg}g}3}Xg}gdg}a}zz(0h1'7' osq95;"< g6g6666 ~ Zh_hjhjhoh ~h~'~~NhXqhrohs+E wqvhH cpuwP hexPiePi`i( len'HpiPph`i//pi/i/]@[j[j[j A3@@ hH!/"/#$+E%oh&= 'j0(/8Ucpu*@Ussp+kH'kj/`6j738`i:`i(;/H<jP=X>\kjekfa sdagnlh_"isljgxD^lEjF^lH I5(J3HK5PL/pM/xN/O/P/Q/R/S/TU/V5WVY z\/]/^h_kpjnl/i k$l//"l#>$%'l()+ m,-!Nm&l*l.l uml opsm m umzm2m4/6a7a 4av@m   4avH n   vp@nvqmvrvsEn @n-vnnvmv/vnAv=v/^vn Jnnn#@v-ov nv/v/v/ v (v,v-o0Krcuv=8v^oHnNmv^ov idv7omoJ/vovo o(o"\  mpf& )g ldt*rp8./@95H:zh;qp= zxC*|D ~ mp |qz/ alt/// /(}08@HPX`hpx ! wp|q Fo-*\q*^ z*`a*Xq0lru*Y q*d*e*i r*j /*k/-(*R;rq*h5Vq*s/ -(*ur*z/ pp*{r*|/*}/*~' r-*r*/-*r*Ss* zSsǀ refi8VHzhal/p ops }xzbr^(*Qs r ;r r rf*=*s*a* z[* sval*/1*sF*Ms*N z*PaC*J tzlru*K sC*W2t!*X z!*YsF@*Gt*I/s*U5V*V /  t(*[ z0*\ z4*^/8_@*Ft 2tT*j@F(*m(u*n/*o/*q z*r z*s z*t z*va _@*lFu tT*z@F0*}u*~/*/* z* z* z * z(F *u*/*/*_@*|u Fu uT*@S*D!v=t=(u@=u u1*/ &vS Bw s 3 K  @5V z <(a0a4jX8A@&P p  zx#$ % '=K 8v8v*5iwctx*6nw iw*=w*>8g*@L(*Xw*Yg(*\x*b/*h/*t@*w *}$F*7x*/*/_*Ux xT*=C*zx!*3v!*&v *xerb*BC*/w xbyc h j!k5qX s(tq0u8w@{H~P˴Xߴ`hp/x xysww*y*fcid** @@*  z* z[ *>z**/* _@@*~=y@*g@*/P*/X*/`*/h*/ppgd*  * x*) z*5 z*?~*E/*La*S z*Z"*]'*_*a3*pg*r**/*/*/*/**/ */(*/0*/8*o6@*3D*/H*/P*'/X*3/`*/h7brk*/p*!/x*/*/*%/*0/*!~*1~@*F~*q*/h*3p*P~x**U~*Gw*&_~*/*/** z* z*mo*'*oh*i~*/*/*'*  zy/1~/3oA~/ A~ K~qd Z~ d~/}~J/1* a;~p/ӳ7(pmd9 4 0pud; I!8س@E;HF;PpteL / XptlP/4`T .hBa*      @ hhhhh4a ]                          I 66696<6G80/66// /(0 0\:,}- 3/ ?0zD03Ё4-678  xa9D   " $3#@@-- lru/Ё0' m2X nrm3 nsm4XBm/2|J/ valf |4a ‚   ‚  6LMDI/ D p p#plKrcupm=pnFpo -pvpx*py -pu؃ 0xp/(pr pt/p*p/pP  fy pZpzp _ 4zo/ p{YYYY%Zp݄po keypYYp*^ppfpBCp p eBp eB-(pkp/p/p*p/p 0 (pp؃ F ppp C pʅ!p4 ʅ ԅf Fo/0'8@ uid LP'X z`$"hoo Fo gido MJ/^o͆orcuo=f]@@[gև[h" cpu[ia[ja[ka *[la*[ma*[na*[oa*[pa[ra[s[t[ua[{  [|D([} 0[~D8A[@@׆\ۇoD@/tJ/?8qoq q! q"/q#fq#f q$/(q$/0q'q(fq)fq0̈q1 q2 q3 qCqDqLqMqN8qQIqR zqSqTVo^/Vn/ n xF/  #0m5A= #` SKrss 08m5@ zX z fn ^3 arg z/ bz   MtSيtTtUǂ^tWtXftY=#8tI: qtJ ioctK^=ي t\a05ss zssss/ sa(sa,sF0sa4sD8siHsW"Xs_"XsW"Xs_"XsXs3`sdsahs8psx7devs)(s0s z4s8s@s5H7ids hs/psxs8s+Esohs zsss Es!s"s#5s&0s(34s)8s*hHs-7fqs2s3s55s65s75s= s>30s@47tdsD8<sF=@sKm5PsP5hsRsSsU8sV8sW8s[5s] :   val  A val * <Yddiin/v#8_`'ab*c *d Krcue= reffd0M  v / %4 \     . s0  4\ 45a67ݐĐĐ/ΐ ɐ Ӑؐ0pPqGwr s t zu v*$(r L  M AP a Pr  qBqB(qB8 GwHН(ɒ)*+ ,0-5@. 3`/ zd0@h1Up2 x3/4v  val ɒ Ւ4a6   BEU0uidF L0gidG MH Dv'JH       ( 0 eB8 eB@H|Ô/ a(a, 0 8z@ Ô!n$Ô|@8G9`:`;`<`=t >t(?t0@8 Ȕ`@Lt e@UyXD@EtFYG iHtIt Jt(K`0N 8O@QHSP  Y@Ei ^}}<n<<}xYZ[f\f]f^f _f(`f0a\8c\@dHeLffPgfXhf`i\hjp8Haaaa aaaino  3( 30sas/ aaa aaaaXΙ``  (-0K8-@iHP Ι@BB@aә@(@U(K@(2d@dHPGw8 ɚ a g ɚ0 ٚH7ops! <ٚ//n/Cw!}W! k83W4564kz\pϜ  (0 /8 I@ bH rP X`h 8p Wxp Ɵ Ŝ;Ŝʜ GwuԜ5VŜ5V //48DEGwF5VraGEI /Ja Ka$L(M/0$ߝGw5VaߝgGw5Vaaz'/5V'I4b?Nrg(+ޞ,-./ .I w5V 8RRR=p5V\Gw 'uGwƟC!h!a_!T=C@!!@! P'P<EC!t_!! 0! a  5@Z[M\p]^`ʫ b(d0e)8fL@hoHj)PkXmĬ`ohppr 2xs_uxvyí{},E   * 4 > H(âGw 3pidVBuid LL $ & /aa aa C K!5! f_ )T*=!+2!,â!-R1Pz50  >o/6| P P ծ ( P0 8`@+H?P+X?`bhp x      |@    ǥ ѥ֥]) * '+ ',a-. //(0 z09 s4:5V8< z@=3D> zH? zP@)XA5`BC8E zF5HVIK zAQ. % / 9US/Uc/$1puPfaͧ cpos 1 aGwڧGw0 9GwP WWa\ ssss >Gw[ǨGwǨ̨ Gwa/֨Gw9 !<Gw :Gw&]Gw?{GwbGw /˩Gw////ct_Gw aթ Gw t_aCGwCgHM %uGwWGw zGwGwaGwGwaƪa /Wa8M<8a4Pk8<kSR<u<ʫ80<8ϫ8<8)<8L<8P.o<8Q<8stĬ<8<8a8ɬBBMavd280U<UffZ 7x<d<8Gwa}í<Gw8ȭ8"8"'  E8"1 tmt g /<JtBa   <@ծ<Ů<Ŝڮ<@+@?@0X8X] D@0g8@0@PƯ< @)g//4  >C8kPzMW"/@@3APBC8D, E( sdF0G8g8@Ia@Ja@Ka@La@Ma B{bioz=  '[ zA 48 z@HgPfX` hpr  zt x4aE     N޲T Ze% ;}~~%Ss//-S*S?*bJ/}?* /޲F(0ӳvma19 2 ?3 /4/5/ C>!? !@ 9 !9 / 59 &X9 ///:}~q~a]}~~//v/9 ˴9 /zPߴ9 д9 K_K_9 /$;/9 /idrjDaa 4 /|C rev/ ֵ# z zPKrbBC ns}0a8< >@ idf` zhpKrcu=xֵ ׶ ops! h и"$ % & 5(( X02 89@: XH= qP@XA ` ׶  ޷0diro ޷ knGw z5 5@`h 0x    @  A %yиŸzոz z z 5z%X0:[qǨ]9 v4aй  0',() ?* 6+T,^ - ^3( й\z1}JJO ;\}Y66P6 6m6nM6o&WX60H61c62 63 z64ϻ 65 (67 )069 86; )@6= QH6?tP RaH \8cf8\8\\5VʻGw8R0Ի)Gw8\0QGw8\.tGw8\9 V66 ¼6  y¼808PǼ`, 3 X0tu vw!x*Ͻy z ( 18'ŽŽʽ,3}ʽԽʽg }T~TdUbuft 0d/0t/?U/Ծ Ͼʽ ϾPʽپ ʽ  ~*.5)@p,HPPXbusO`h zp zx5>16@ 7msi(O8T@fHfPcX h`hsx } s7idM3 +!!# $%'#)+ `, a- b. c/ d9 e< f . /5z bz  :BDEFG H}Iz5b ;!a"a  -A.gK :I@ NwO/PQ  * > . M/uu    H hPh(4E4FP mod4G$ ops4H!4I 44J 4K mT0h4L 0arg4M z0str4NM0arr4O4VH4Wa4X0 H 4\ max4^a4_a num4` ops4a!4bz R7%#0(A)oBC/ /: a  :UO/7`$-$. mod$/$@$08H mp$1P$2WX 8$5$6c$7 &$9 I$; ^ $<r($= 0!0OI!P+^$PNr$c$wBa$>   S8$Emod$F$>$GSP$p3$qz$rz$s$taemtn$w $z$ z$a$0$0H Hm̂o/'3  dkd PP/$."1 Ԝâ Vzj?z vzzH 3 gz (m50Jj #MTN 'PaRa Ta(///// #0Krcu1=28g3TJ/ HCICJK LM/Nn~ :c; <H  !"# $(%0&8'@(H)P*X+`,h-p.x/012345 o))BU   BalJ    Hxy 3za|a}5~0@ 58c9  9 !9 "9 #9 $9 %9 &9 '9 (9 )M3 V @ @ A B C D E> DPfohm5 z za                affff  *(7qos40+,P id-./3 0(1+E02/X3 `4 h5 p6 x7 8/9/:/;/</ dev=)@> @?   J*)> /opso   ))aMNPOPP!Q!R! T(U,0V8W @X HY P[X\`^Eh_paxcd pmfJh ) ` aP busbOd$ePg h$j(k0m8n @oHp PqEXr`s!ht!p pmvJxw py ''E)c1`23P5!6!8,9  ; 0(< 0>8@(Ž@ADHC ^P pmEJX T0'++ }D'5^'I0XYPZ![,\ @^ pm`J( c4a-      0@'"~aa/Ba   Ba   8 ~0D!5"I DBa1      BaB  BaO  c'd&Ne2f4g lidh '9 ; EJf Y^Ecmam x    $ =  sC$sD sI sNsS $esAVsBSsC%. `f  a a   wrnroǂrparu#rw rx `rz r{ r~a8r3<r]@rohPrhprxJ/ @j\k lenl wpmnopqr\s tl(l/|/4sm   stsusv|swsxsysz s} ass Fsds}s s s(s0s 8s@sHs Ps XsB`s [hsyps$xss   " , ; EHsss @saDs&kHO1s  a1s] ashsisjsk/sl/snasoaspa sqa$sra(ssa,sta0sua4sva8swa<sxa@syaDszaHs{aLs|aPs}aTs~aXsa\sa`sadsahsalsapsatsaxsa|sasasassssasasasas1s--azPskss '@s 'H2zJ/ z           s"ssBasF   d=WaK}aia a/aaa    / Ba'az0[aGyaR""` ~a   WPbcfd eff*g*h i(j z0k z8l @mfH i   aжd< pos  lenf\ a (xz <an<2 <a2<a p  7au=dab       L I C C O & f ' f ) M0+,0-2.Gw/0f 2M(3M,8]2^4_<b9c refd F(e00<y>@aBaCa HFG 4HgJa@KDOQ*S*(V% refW FXY*Z0 % /hfi"fjgm optn7qr5 uD@waPx*T{<X lz4}`Gwh<pxffMMMM"a*MMfIIf//MM VP*p2x900y>4a;  5VGw;zF '  FNUCk '!UF /NC ! a k]h nidI/aaa (>8HHLbufMOU OU(Pf0Pf8R@SUBTaD8gXh2i jkGwlf nU(oa0|t.|~%'|6f6/IIcIIcf X' *y d 2 9Gw2 ZGw2E{<{2C<{2 2 {azp` {i .hi @h` }~j~a${2 Gw9 2 Gw t_a2K/Gw////2+{p,/{2G '05V'{2j L2/h?p02A<Uff{p2sr Gw`zz4i h`wz**/ji Ah`kz<kahi@P`z<ka25V/Gw82/pV*'.Gw';'Gq<Wops{/j%zL  DZUvTTkUU}9GUvV ')GwXvmaF9 L2#D#a"""E"":"a"""Ez##.$ F$.$ $r%%,%U%&&u &+& & &&\'  m'r%%M"P.P}jV}~Xvmf4~& Y@UUT0Q0R0X }~)vmf9~(aVg'3XtoJq<a2#>D#L!s!kQ0kQ GQ R0X0Y0V'H'25V'D'YUUTTQ  Xrac7/YUUT V}  '}*Gw'}>YUTT k,'k <'kBU'lfXlenlf/jn%zL n kUUTTQQRRX }VS S'S*<XposS8'SD'T 'T!a'T6WptrVz~EbufYHa!Z 0!.!% 2%:H<%G)UHP3.V (',<':'I'a'%':WretWsb@maph~q~WptrA zWbufBaE t3FY:3q :' +T  = e GU~Q1L(F(&(G (DUUT~D`U~T~P3. PI' *Xerr 5q Wv  Lo& *&+>'! P'&j(  {(a& 30&;&H&E& & ''Ex'  '''r''''r''YUU ,U&V&c&&%'2'&R( _(`+UU0o z0v zNu7Xlsb'@lmapAObdifOUOUid3w,2#iD#P3,2#D#PD/U~D#U|T}D;U~D/SU~DkU|DU~DU~DU~P3.m? map;dif#g %g$<lmapgDkbsbi@bvij%bidxk"*buflOmfnabposoUOpzberrqout/jz)AOUOU~^O /3s % s16.*  *,*:t8*cCH,G%,Y%&g%] y%%&(: ((+=)  N)Y)+f) w))H)Qc;Hh,L*H^*k*&**Q**ctb ucB MGTsQ|R0+~**&*Q*H*34} EQ:]hs3U#Ph g#3 X ) :6 GpT 3  ) :6 3  3F :,q :  +T  = e GU~Q1,(C (3s .* *,*:t8*c, 1,G%Y%&g%] y%%&(: ((+=)  N)Y)+f) w))H)QL9HQ,L*H^*k*&**Q**c] Z^jcv4{MGATsQ|R0Xv+~**&*Q*H*,( (D)U~P3.O"J %J4<mapK#kNviM%NsbN@OPaMzCzbufC,sbCE@%DU%D.5buf5+sb5D@Nsbi7kz)lbuf%6UO /O 3P$# 1a$:m$My$.$ $s$_$.*  *,*:t8*3( ((.=) N)Y).)$))Q$$M$3!$i&!3!E! "E# #E# M #E( 8 ((.=)  N)Y).)$)),%M, )    GT}Q0,(*M(,!-&!3!&!  "&# #&# M #&(  8 ((+=)  N)Y)+)$)), 6' !LA! S!L##L# C 6 $&( ((+=)  N)Y)+) $))&( D((+=) N)Y)+)$))GUsE!&"E# #E# M #E( 8 ((.=)  N)Y).) $)),{!/!+! !G)Uvolbuf*,M3P$ `a$:m$My$.$ $s$j$.*  *,*:t8*,( %((+=) N)Y)+)$))Q$$M$.$"1"L?"Q"&_" q"&# #H%#+%   &&&h &&*(  ;(QE(HF(P buf ,m?%<mapk%aret/,/L}/  dz/ dmz /? %<mapk%a/C/c}/  dz/ dmz /$UT ($4<sbi&j)z"q sb>@" sbi?"k %k@a (F5V( /(!Gw!(1(@/;A!(:(I//a!(1?{!%/}"z!%2;";!%/z1!)i1')v & \')v !&" \x'v A&"c(vc:&oldcAnewcJe e e /'e (/'e (/(e (e %(9Wp"AR(vA@&NcC ?3j(v37&"(v=&"A!(ptrA<}"4!(ptr4=}"(nr/%;(;?^)v^O)%^Y?B=)vBI)%BS"f)nr/%?(")nr4%V(")nr4%V("*nr/%@(Npc/Nval/" "B*key "JG*% "Z ( B* y*_t _Ty* d*)_Ty*"\*Nc^ ?M +valM5O/*OOMO?>+ptr<)%H%",f+p,;)%,Ka"(+p(:)%(Jau+Y@UUTTQ0R0X u0,UMuh,UT,q :, .T = e +q  up3.3F.:,q :- .T = e .q  k.UUYUUntS0.j5.O.[0T0` x0 0 0 0 uint ` ,0 *0;s8l;u8;s16;u16#;s322;u32;s64;u64k` x  0 .  1` 2` H I X ] ^ _ `T00 $ ( <`  A Q     #0 % & *. 4 = B h2 nA } K  U  U  `  `  U d M K pT.EE UUEJvawjax(.W20   U. Z  #( *'-@ 2`` Z E( `,!`0( 4)28*`H+.P,X5 `6 d8 h: l; p< t=`xHse?tP@,rt@QNdlAsRBnRFT1IBJ.K`OTXT]T1`"N@dh`k` l.m nU o U(pB'0q ZXs`ubx dyThzp{U.    T MB(1BP,mmhp Vx    .` `, `, `, `- `- `- `- `- `- `- `- `- ` - ` - ` - ` -"` -.),pid u u. (0@VPVX "V%(+ Z- U. U3 U4L6^M: d(=.0>.8A U@D UHG.PH.XKK`1NLT?XW?XZ?X^.Yk 1m8YpMB qrB(t.8u.@,fsxBYH{LYP~VYXY`{]h ]p ,Fx ,F ,FI. `E] L`EdJ U  U 3 S" T C( 8 ]@  ZH ^P ^X ^` _h _p .x _ +K `  U  U  U hE ?6  (_   A  A "2_ )p_    z_0  p58  `X _\ _` p5h  _      !` "` # $. & U ' U ( U 1) 3_ C$ D. L_ N. R_ SA( TA, Y.0 ] 8 ^ < _ @ ` D 1aH dJX g_ iJ l_ w x z. } ~_  U U  $ d d.`__8bb `(`,T0Nrcu0E@ DHDP5cxE Z "?c IcScZ  U >1 !"H2$"H21.<]c1F]@@@(pad!.?@y&@ &!2key"2?T A. B Cmod[$T=>Z&  D  Z%  EzH  O  4 "C f  ( [$0 8 @ ("H ("H ("H kH ("H ("H ("H ("H'@,6PhOO38 =`p5,kpB `(`,80 =8@AB`D GHPNmemL@. `]blv (Z0`8Z@`H`L{P`X``hp x```$```$Z `!$"`%&9`:?AD F dP Q`(Te$0eZ f. g huv2w2keyxZ UV d,jkeyknkeyo;Y<= ? ` @ `$ A `( B `+BC#D# E# E#(-sE#,-dplE#--pE'#/ F#0-avlF#4-lF#5-dF#6-gF%#7 F+#8 . . . . . dpte "M pmd "p%%%A%%/D' pgd'5%'"Dp pudp)%p"%@H]I..tt0 d4.8'@@1sp.es ds"$&.(.018.X.`cr2.h.p.x2.`A.. 1Hfpu !1@`(  2''@@.{@@d <!.y y (,z02y8X zh%{p.xx Z {S'_{xC!g!##!(val d!C!!g! ,!!!!.!  d! "!! !ZZ  S" ! 8" !"!S"!!! !!`!.,"+#fmt"O"O"O"`"O"O${#6M# #7 #88###O#O#O#O3#`3#`3#4`key#9+#()`#=#   8#U[$#Vmod#W[$#XO#Y`$ #Z (#[ ,#\#0O#u$#v$#w$#x`#y`M##.T$. $/%$1`set$3get$5$7 2$[&[$ȫ   4  I( I08!@" ̬H# P$ X%`&h'5p(x)X*v+,ƭ-˭./ 0 1 2M3 p5 9 ; >X? @* % %!2'%% %+ %-%/ .B'.  ;B' & 0'c''dO'eC'ga'i 'l J(_'O`Ot) ) )`*(  (*f(*f(val* A*!A *"A*#U*$f( A**( *+&( *,#(+(++ (,(,d, 2(*')*(*)'k(*.U *1i)*2n)*3*4 *5.*6. i)(*) *%( */( *7)8*)*.fn* )s)))))-*-Uend-U.;E*-cs.=U-sl.?U-wfe.AU.E*-ss.GU-sti.IU .KU-nmi.MU .PU .SU0 .VU8-lm.XU9 .]U: .dU<. +(cs.#(csx.U .*.7+(ss.#(ssx.U .E*.g=,r15.m.r14.n.r13.o.r12.p.bp.q. bx.r.(r11.u.0r10.v.8r9.w.@r8.x.Hax.y.Pcx.z.Xdx.{.`si.|.hdi.}.p..xip..*..sp.. +/ e,/ / e,7+p0,cwd0Aswd0Atwd0Afip0A fcs0Afoo0Afos0A0,0AlA,.0*!-rip0+Urdp0,U0._-fip0/Afcs00Afoo01Afos02A 0)s-,!-00@- 0A- 0B-A-. ?0$7.cwd0%#swd0&#twd0'#fop0(#_-05A06A097. 0<G. 0>-\s-AG..AW..?0Q4/cwd0RAswd0SAtwd0TAfip0UA fcs0VAfoo0WAfos0XA0Z,0[l0\m0]n0^orm0_p0`q0a4/x0bA=,I/.@0:/0; U0< U0= /U/.'@@0O/20P-0QI/0R/@/6.|@0^200_j,=0`-0aW.=0b/@0c20C0l.'@@0f00h`0k`0nU0qUxfd0tU0w`0z`0`0`20/@@0!10 U0`0` }fpu@010`0.010100 00020C0@@C01 11 U1UT1.Y1.11.1 12>H22?.2@.2AAcpu2CA38c239~23<~23=~2c24<2 4=` 4> d4:24;c22src4A# dst4A #22Z53 58"532 536 =36" 6"&37777!7%7'7,7/37375797<7A7D7H7L7Q7U7Y 8 !Q4(848`8 Z848  84444`ZQ48#48$38% 8' 49:"#5:#K5:&K5:'K5:' P5#5K5; p5; d <)5<*S'<+S"osq<-U5 !5>" ` >&5>D6>D5 >D5>E?6>E5 >E$6>T o6>Y?6>Z 3 >[K6?6?3? @?6I?{6?6.6@36@4Alen@4A@2 76 @6U@1.76@8z 7@iU7 @j @kU74~@r7 @s @t#5I@u@Ra8@T`@U?6@V#5@Wf8@X 7 @Y;0@[;8@_"e<`@`0@h@a.p@bZx&@d637@m@n7d_u@vZ777'x{;| i}~ L L` GG! 0@( V0 Z8.@6H ]L P AX A` AhApAtAxA|3 A-i..ɥ## [0@H dP dT dX d\\`ӥh1Up8\H P(ݥX`h Zpk8k8;.'@@`<@f@@f@@@@@@@ @@(@ @0@ @8@ @@@ AH@AP@AX@A`;`<'@0@ ].  (!%0!*8/@">H.P.X.`f8h-ip dZ&#ǩ$֩۩5   x % /` ޝ(1F` ZAAA!A"9/ >0 14 N6`<p5 BO@D"e<HFhPIS'XL`O dRTjhSpZxa߁b߁Nrcucdifp5k01n3@@oHq3Xr`j<)`@R@ f@f8`R@@@@a8 7k@@@`O@.7@@@@@f8@@f8@@f8;@Af8A AEcAAFf8AG0@AHAImrArAwA!A|ABAmntB rAB f8|AcAAAAAf8Af85@A CC BC AC)`DHB     EhBE mB hBF BF(G BG G GHBH.HBHBBH CH BH?CHBHB IhC&I BI I CIC)`J C @J'D&J(?CJ)  J*+D(J+D0J,8J-9J.:J/;C&D&DCD@@K/DK0AK1`K2  seqK36K4&DK5hC K6K0K7 80D(LDL L.L DLA DDDDM7EMM dMT?T@TATSGTT $TUZTVZ TYGTZ $T[ T^HT_.T` Ta TJNH TL TQ TWG T\G TbG TEkHTFZHTgHTh_fdTiTmHTnZToTp` ] T%"I T*F T2F(_rtT9G TB7G TdNH TjkH TqH0U `IU U U U H0U tI"I U`IVuIVvnsVwuidVx LVy dVz V{IU JU!U" ,F U%JJU'DFU(.U.aFU0 ,F U3dJsaU4J W JW W .lenW .W (XJX Y$JY%Y'Y( 0YD+KYM#JYP(YW)8Z KZUZUZUZUZU Z#U(Z,U0[)K[*U[+hCP[8K[9K[:`H[;`LKL.8[D7L&[E[Fp5[G`0 \>L\K\Z\p\\\end\LTL6.] Lval] ] L] Lval]  ] LS.MU UV UWS"4`[^M    0hMi5jk.Mcpul`mUnU oU( N.AN. A<@@N U U U A A. .(.0`8'@tP U U U U U  U( U0 U8 K@ UH UP KX K` Uh Up Ux  U  U  U  U U U U U U U U U U'@QN2 B! U(" U0# U8%@&P'Q(R)S, UX- U`. Uh/ Up0 Kx1 U3 U6 7Q9Q;Q=.HavgGAN@tP Q0KHRLM.N.O` P$Q&SHR(Q%]ZR_RnRnRsR<`S2aBh Ui U j U(k U0l U8s K@t UHu`P````````2CX2CrqSMRSnR%^SSSnR^rqSKT/` /` /`/`DTT_bKT_sATTTZ TT TTU.N'B' U< V;-i )@ dD dHCP.` .h)1p.x 3-i ZU`pidp^7V^9 E^:`^; 3^<f8ino^=U^? ^@@^B4H7rcu^C`^DʂpVV. _V_`_>gV`o:X`pS'uid`q Lgid`r L `s L`t L`u L`v L`w L `x L$`y `(`z0`{8`|@`}H`~P`X`.Y``.Yh`.Yp`.Yx` Z`8``I`=.V:X`keya.YaEa.Ka= sema-i(aGPa ZXl`a Ahuida Lpgida LtaȆxa|a~a a.وaLDX 3Y =Y GY QYHb Yb! Eb"4b#>b$Hb% b&R(b'\0b(\8b)f@[Y?Xc^{]c_Ec` dcacb ccce4 ch8ckI@cnXcq`csdcthcwpcx`tczx3c`3c`c`cc&cCc itc c7 cK cɌh c d cV c>ttycތ c c o6 cU c U cU cU cU cU cL c. c. c. c'. c.  c.( c".0 c,.8 c.@ c.H c".P c,.X c.` c.h c+Kp c c cq c c ` c  c c c c cp5 c-i0YP c]c3cEc4ca ] ] ]d^d8d8]@e^ee e U e (e*e,e-e0 ^ ^Xfc_fdS'fe dfg fk 3fmfnc(fo0fqi8^ _tI #_ -_ gp_gNg&g27_ u__. _ _ _._.7L _ _E_. _ _P0e8beeee> e,e.e0e@e(He^PeZXe` e e. ep5 e `>bdie%  e{( e3h ep e e d>eve e` e` e` e$ e` e3 e e4 e ei eTj>cdie e>bbe e0" eU e  e(7(_hhybhz#oh|`h}p.oho(hD0h.Xh#p`=b@i45ci55ci6 Zi7.i8.i9 i;`(i=`,i>A0i?\8b :c Dc Nc XcqcjcjZjZjj cj!j"  j$`Hj'Rdj(Okeyj)j*Rdj+Z j,Z(j-Z0j. Wd8extj/\d@qcc j3 j8dtpj9dj: Zj;Aj<Ac ,2?hVJeVKbVLb@VMbVNVOVP LVQ LnsVRkVS.VV  V^ V_.Y V`-i Ve.Y@ VgiHsetViŅh Vj VlI Vmv Vnj@ Vq`k>gkAk ik`k  kUkUinok)U devk* ](k+ ],uidk, L0gidk- L4k. 8k/A@k0APk1A`k2Apk3Uk4Uk5Ak6Ak7Uk8Uk9Ak:Ak;Al+fgl,S"l- m"gm#)nidm&m-.m4.m7_mRhmShmUhmXmYmZ `mc E mdV(7rcumeHmgZXmj`idmmpmptmqOxmrf8muh.hhhgfghS'nhn Emo o"hoh o3 oho(iho`oZZ(p0|ip1S'p7S'osqp9U5p;S"p<*p*p*p*p*p q iiiii qjqS'qqiXrqOjrrirsD wqrvTjHcpurwP OjExsjsEsjsj(lensS'HsjPspYjj..j.j.?@tktktkt &t3@@t ^jHt!.t".t#t$D t%it&  t'>l0 t(.8>cput*@>sspt+lHS'k.`t6>lt73t8jt:j(t;.Ht<>lPt=Xt>\kteltf`sdatgmth0"timClPxtDmtE>ltFmtH tIp5(tJ3HtKp5PtL.ptM.xtN.tO.tP.tQ.tR.tS.tTtU.tVp5tWV tY d t\. t]. t^j t_lp>lm.jluvn v9/ v9/v"Bnv#2v$v%v'fnv(v)v+nv,v-v!n v&n v*Bn v.fn vnmopsvnn nnv2#ov4.v6`v7` )`h@Lo   )`hHuo   hpohqLohrhso ohohnh.ho&hh.@hpoo@hphuoh.h.h. h (h,hp07rcuh8hpHpnhphidhpp6.hphp p(w>qwS"wKwwu x qxUx& x)-ildtx*q8x..@x9p5Hx:Zhx;rpx= dxxC#|xD~ qy ryZy.alty.y.y. y.(y\0y8y@yHyPyXy`yhypyxyy y!qr xF>q\ s^ Z``XSs(lruYr d eius j . k.(Rs sh VSss. (usz.pp{s|.}.~S' st.4tt Zztz$refzԒ8zVHzuhz`lz.popsz wxzZz\4t@(QtussstI u `  dD &uval.% u8MZuN ZP`5Jwu_lruK3u5WuX ZY&u8@GvI.ZuU VV . wu([ d0\ d4^.8F@F%vu=j8(mvn.o.q dr ds dt dv` F@lv%v=z80}w~.. Z Z Z  Z(8 Dw..F@|gwvw=<Dw.v.v@.Dw%.w< x ޓ 3 5   V Z ;(`0`4?X8|A@ʦP p  Zx#/$ % '4.w5xctx6x x=x>h@L(XyY-i(\pyb.h.t?w }$8y..Fypy=5yww zHrbB.x z{b{{c {h {j{k/{qR {s({tk0{u8{w@{{H{~P{ŸX{ٸ`{h{p{)xz{xyN{Ucid @@ i{ dD {. _@@|.N{@h@.P.X.`.h.ppgd  x) d5 d?|E.L`S dZS"]S'_a3p-ir..... .(.0.85@3D.H.P'.X3.`.h,brk.p!.x..%.0.@r.h3pxx&.. d dpS'i..S' i{{..3p.  d  .6.% `p{/ͷ{7(pmd{9  0pud{; !8ҷ@{EH{FPpte{L Xptl{P3`{T h4`      @ JJJJJ*|6*|9*|<*|GS'$. 8zz.z5z5z.z. z.(z0 E},ځ}- 3}/ )}0Z0~3-~4~6~7~8 xa~9  ~b~ ~" ~$3@@~-lru~/-~0S' b^2nr^3ns^4HBʂ.ق6. valU ق)`     ^ * @ {Zj8OZ iKP Z(Z0 sKt du4o# ~&BX.KV (set08 @HdP~K @dnrcuk`} &ŅHh lpx}h47dirŅ`&~BXU4%H9bbgLLMq.  a aal 7rcuamanEao av-ax#ay auF (xa.(arat.-aaaO Ԇ] aȇ aZ a ͇Z݇. a .Y .YȇaKa݇keya.Ya@al aIaBa a A a A(aوa.a.aaa  (a aF8 aaa 5 a8a 8 Bԉ Ep.0S'8@uid LPS'X d`$_"h` ` E`gid` L6.@`8 `nrcu`Qԉ?@@KgAKhS"cpuKi`Kj`Kk` Kl` Km` Kn` Ko` Kp`Kr`KsKtKu`K{  K|&D(K} 0K~&D8&KP@@BEFQ0D@a.JJq.?8cڋc c! c".c#Uc#U c$.(c$.0c'c(Uc)Uc07c1 c2 c3 cCRcDcLzcMcNzR8cQcR dcSRcTVڋɌ.Vٌ. ٌ E.  ,0o4& ` 7rss ,084@ dX fn 2arg Z. b   AfSD fT fU$@fWe fXIfY8fIqfJ^iocfK_".D f\`0'e^e Ze e/e9e. e`(e`,eE0e`4e8eԒHe("Xe0"Xe("Xe0"XeCXe3`ede8bhe3peVx,deve(e0e d4eM8eW@ep5H,ide he.peaxe3eDeie dekee XEe!ge"e#p5e&0e(34e)8e*jHe-u,fqe2e3e5p5e6p5e7p5e= e>30e@4,tdeD81eF@eK4PePp5heReSeUf8eVf8eWf8e[p5e] e h val r val  <ĒϒϒԒin.vl8_g`S'agbg c  d 7rcue reffϒ0 v . %q) Ǔ     . ޓ0  4Ǔ 45`67H//.9 4 >CR0pqxr s t Zu v#$d(ݔ  L    L  Px` iݔ  AA(A8 xH}Г(4)*+ ,0-p5@. 3`/ dd00@h1p2 x3.4  Wval 4 @)`6   BE(uidF L(gidG L H WDJcHd      ( 0 A8 A@H.. `(`, 0 8Z@ .!ٝ[$.@89˘:˘;˘<˘=ߘ >ߘ(?ߘ0@83˘0@ߘxИ0@XDEߘFęG ԙHߘIߘ Jߘ(K˘0N 8O @Q$HSPxę0@ԙxə;ٙ;W$;xYZ[U\U]U^U _U(`U0aK8cK@dHeLfUPgUXhU`iKhjp8```` ```ino  ( 0ޛ`ޛ. m``` ````X9˘RR˘ u(08@ԝHRPm90@AR0@`>p0@pW0@)z0@ϝ0@ϝ[8 4 ` -i 40 DH,ops!T ;D.dT.ٝd.5w}ž ֞83ž4S56E4֞ZǞM۞:Xq   O(0 8 @ ͡H ݡP IXl`h p x֢ ,005 SxSgw?q V0] VSv8DExF VraGI .J` K`$L(M.0Jx V`J(iS"x V``SZT VS͡S)ݡSҡM(+I,-./  l VSSNSqSS֢ VS¢x ۢx,M5[g`F=5! &;5_  ` GE`& ! '@Z[H\k]^`ů b(d 0e$8fG@hjHj$PkXm`ohppr -xsZusvy{ܱ}'@L ĥ Υ إ  (gx =3pidVBuid LL $ ʦ .`` `` 5 p5 UF )/=*+c2,g-%PZ'0  2Qo.    в ( 0 8˘@&H:P&X:`]h{p x       490()O*O+, get- set0(C  © ̩ѩ?)* + ,8b-^.y /.(0 d09 ]4: V8< d@=3D> ZH? ZP@XAp5`BC3E dFp5HIK Z&Q  * 4TN.T^.$%kpOU`ȫ ^pos % `xիx4xORMR`W eeee 9xE¬x¬Ǭ x`.Ѭx ;x5x9!Xx:vx]x {.ƭx....bc_x`Эx_`>x>(iCH  pxRx uxx`xx`` *R`f8H;f8`/Off8;fMm;pG;ůf8m;f8iʯ f8;f8$;f8Gm;f8O)jm;f8iLm;f8i]om;f8;f8`ݰmf8ݰİ mA A`e-f8P;PUUU 2s;_;f8x`ixm;xiGܱmf8ñmf8Gmf8" @f8, omt h .~~;Eo4`   ;0@в;;0ղ; 0@&0@:0@+Sf8SX ?{0@bf80@0@O;x0@h**/  9>f8fOZH("{.@@.AOBC3D EQ(sdFO0Gh83I`3J`3K`3L`3M`{{=`biou8 # d& ;4]8 Z@gHPUXq` {hpr  dt xPU)`zE     zNٶzT zZze ޶ t..mzzMz%zM)\6.zw z))ٶ8({0ͷvma{1 {2 ){3 .{4.{5. |5{>{? d{@   ./  R ...4k`W..p. Ÿ .ZOٸ ʸ _޸_ .$) . p.Burev. pOO d dOO7rbBns\0`8< i>o@idU` Zhp7rcux ops`!j Oh[ "$ % ߼ & (( 02 89@: H= 0P@IXA g`[ e (dir. z T kknOx Zp5 p5@`h x    @  A %{zzkzZZZ߼ZƼZzE0z¬Iz 5gzN)`  0'(l) * +, - 2(EZ\   E\'J'O' i'ml 'n 'o&X'0'1"'2 '3 Z'4 '5 ('7 0'9 8'; @'= H'?3Pll i>3>"%ia3H3f>E Vx3x3x33x3 'c' ' 83>h3>O` 3{ X0tLu avfw!kx*y z (La3Vcp'.u\bgP }~# >buf3  #.3.?TDl.yD~Oy'{@pHOPeXbus`h Zp Zxp5t2Y ,msi(8@UHUPX `hx (2 ],idA3 !!k# $<%F'#K)J+ `, a- b. c/ d9 e< f.ZZ Bh Dh Em F G Hځ IZ !`"` r AK : @N& O. P Q  * 2 . AN.gkg2    wk O~($E~$FOmod$G[$ops$H!Z$I -$J$K $L(arg$M Z(str$N(arr$OU$V$W`$X $\Pmax$^`$_`num$`ops$a!Z$bZP%0({&){QB. . `  T.7`-L.{mod/[$@03Hmp1QP2VX L856"7 9 ; <!(= 10VO [$O![$1[$&4`>`   <8EmodF[$2G_<PpqZrZst`Hmtnw` ) )` .3<)Q].& g qadlmd OO."g Z )Z (ZZH 3 (iZ (40 (MN P`R` T`(E..... 0z7rcu12h3z6. HIJK LM.N E:; <bv  !v"v#v $v(%v0&v8'v@(vH)vP*vX+v`,vh-vp.vx/v0v1v2v3v4v5vvg{4U   4`l    HxOy 3z`|`}p5~0T@ O'8/  / !/ "/ #/ $/ %/ &/ '/ (/ )A3 V @ @ A B C D E2CPUi4 d d`                `UUUU  (,qos0+,Oid-./3 0(1D02.X3 `4 h5 p6 x7 8.9.:.;.<.dev=3> 3?  2 Lopsv \v  u\Lu`aMNOOOP!kQ!kR!k T(U0Vv8W @X HY P[vX\v`^h_vpavxcvd pmfhz`aObusbd[$eOg hj$j(k0mv8n @ovHp PqXrv`s!kht!kppmvxw pyb`23O5!k6!k89 ; (< 0>v8@(@AHC PpmEXi\bg0X`YOZ!k[\ ^ pm`(`)`-     bg ``.4`J   4`t   8  0!" 4`1,      4`BP  4`Ot  cd&e2,f4Pg lidh   U ^cma  # - 7 At it8 t eCeD WeI geN{eS{~eeAeBNeC% `#U  `] / `] b l vr[dnPdo$dp`du#idw dx `dz d{ d~`8d3<d]@diPdTjpdxrd6. d@jklenlwpmnopqrs t ( ..)emF   eteuevewexeyez e} `ee eee .eQ eQ(ej0e .8e@eHe .Pe Xe`e hepe[$xe)e B  (  He7e{e @e`De& H%e  `%e] `ehei<ejIek.el.en`eo`ep` eq`$er`(es`,et`0eu`4ev`8ew`<ex`@ey`Dez`He{`Le|`Pe}`Te~`Xe`\e``e`de`he`le`pe`te`xe`|e`e`e`eeee`e`e`e`eF%e`ZnPe e{e @e H6.  %* 4 > H R \ f p z  eeCeC4`e   i8R`8b .8b#Q`.3`j8b`V o.8b`Z8b8b#" $B8b.WGg\{lR nid 9 -  & U ' U ) A)`  Z VxZ8   858 >.5 0 Z?nid.``` (2k8H|&  L  L  /6. / 9 C^netM W a  f8ops # ` E  VVAVAVA@VVVA<%.VIVIVI@Vb%@VvN. S'.f8f8;OZmf8;O\*f*/O"O"c p zend zH R"Z;f8`R@f8;f8S;0@S;PUUR4 (f8SRmA A`RDGr;0@OSZf8.adir2;TFf8T`oerrbnidXc`T;AKp "BUq(d#"(G",-V;] LBYV": 3B>Wx  BW BLeC4LHG<"LMUV edTbUadm@rf~g!Tv!Qs!RQWc"rV eL9.!Uv!Ts !QX!RT9!TsXXg@adir;T7@anidJTcbbufodebqnHGA TBWu BAz AU $0;<HTL`lKxyfpI UG9K?!U!Tv!Q!R9X!U9q!UXg+YZ"Y8#dirZ;"Z)"Z4:bsz\`]]^`^`_Zout$:midb :bufc:ded$ijkl`mHCqZ$y`y`$hyH+-"-C".#""/`"022 3`3`:de4$:mid< = ?`@H:retI$?`?`$h?+#qn=#qd!":i`pM"#dir";""f8""`C#"CC"$"\C"$"Wd"ZC"Wd$h"$c"Z $"C"""$"$"Y`r<;Y[;icpu[5`Y8gicpu8r86+%`#cpu@`M#cpu<`"N`+r #ptrrD\+A!#ptrA<\+4!#ptr4=\+'#Z""'0+K#nr.";K:MBs#vBIs"BSb+#nr."?K+#nr4"VK+#nr4"VK+"2#key"J7""Z(2Y ^s_ts_T^ i_T ^+ \$:c ^ M M#val M5$ OC O$ OA$ OM##ptr*8 A V@ D VH G*P H*X KJ`' NJ T+W W+W Z+W ^X k 1 m$X pA  qA( t*8 u*@"fs x.XH {8XP ~BXX LX` [h  0\p  oEx  oE  oE H *   \ A :\  K \ ED QI  V   V  b2  '    !"1 $"1' . <a' FP@@v G*? o !3key "3 ? A* B C G = >Vo   =kH  F  ƭ "խ   ( D#0 8 @ !H !H !H H !H !H !H !H @     >P h ] F F Ů    \ 4"kp   \( \, 0  8 @ A B \D  H PImem @ F *  \    t    ( V0 \8 V@ \H \L  P \X ` \h p x \ \ I# ! \ 0 \ \ # V \ !# "\ % & 9\ :: ? A D  F ` P D  Q\( TN#0eM f* g huv3w3keyxM UV `jkeyknkeyo;L<=? \ @ \$A \(B \+BC$D$E$ E$(#sE$,#dplE$-#pE'$/F$0#avlF$4#lF$5#dF$6#gF%$7F+$8 * * * * * Wpte "@ zpmd "c%%%4!%/D' pgd'(!'"Dp pudp!p"! @HPI*(r/r0 `4*8 @@1sp*es ds"$&*(*0*18*X*`cr2*h*p*xI1*\B** 0Cfpu i0@\(  & @@(x@}@Wz8 (v v (,Kw0)#w8XUwh%Nxp*xu VSx& ^Xxu,   P $$p $val ` ,  P ,p      *  `  !     NN ?@ # !&% + -/ \3&           *&*  ; &  0 c' dF eո g i  l ܷ( &! ! \"V'  ("'"'val" B"!B ""B"#V"$' B"*' "+&' ",#*(#'## '$*($!c$ 3("'f("(")3''".V "1("2("3"4 "5*"6* (("( "%V' "//( "7f(8")"*fn" *)(%)%)()%W)%Vend%V&;)#cs&=V#sl&?V#wfe&AV&E%*#ss&GV#sti&IV&KV#nmi&MV&PV &SV0&VV8#lm&XV9&]V:&dV<&R*$cs&$$csx&V &W)&*$ss&$$ssx&V &)&g+r15&m*r14&n*r13&o*r12&p*bp&q* bx&r*(r11&u*0r10&v*8r9&w*@r8&x*Hax&y*Pcx&z*Xdx&{*`si&|*hdi&}*p&*xip&*%*&*sp&*R*' +' ' +*p(5,cwd(Bswd(Btwd(Bfip(B fcs(Bfoo(Bfos(B(5,(BlBE,*(*i,rip(+Vrdp(,V(.,fip(/Bfcs(0Bfoo(1Bfos(2B (),E,i,0(@, (A, (B,B,* >($-cwd(%$swd(&$twd('$fop(($,(5B(6B(9- (<-(>,P,B-*B-*?(Q|.cwd(RBswd(SBtwd(TBfip(UB fcs(VBfoo(WBfos(XB(Z5,([ l(\ m(] n(^ orm(_ p(` q(a|.x(bB+ .*@(:.(; V(< V(= .V.* @@(O/)(P,(Q.(R/@ &/3*m@(^z/(_+9(`,(a-9(b.@(cz/ /]* @@(f00(h\(k\(nV(qVxfd(tV(w\(z\(\(\)(&/@@(i0( V(\(\ nfpu@(0(\(*(0(0(00 (000)(/@@/)  1) V)VP1*L*1*:1:1*?1 D1*>1*?**@**ABcpu*CB+81+91+<1+=11,<1 ,=\ ,> `,:(2,;11src,A$ dst,A $-282V-N2 -!!-b282 -N2. 2.! ."n2////!/%/'/,//b2/3/5/9/</A/D/H/L/Q/U/Y 0 !3(030\0 V030  033 4 4\V30#740$b20% 0' 412"k42#42&42'42' 4k443 43 ` 4)44*&4+ A>(? B? ? ?@:B@*@:B@:BB@ ZB@ :B@B@?B@:B AB-A BA A BAZB\B B @B'ZC-B(BB)  B*nC(B+C0B, 8B- 9B. :B/ ;BiCiCBZC@@C/CC0hC1\C2  seqC3`5C4iCC5B C6r0C7 8sC(D0DD D*D @DDB ;D;DC0DEzDEE `ED zDF DFD*D* F8DGDG ` GDH+EH,H-xIHEIHEI\`I*hmaxI*p*XE* J oEsigJD JXE KR{ KSE{E KU KVEEQLE L  L V L EL' FL(L)L-IFL.L/L0 EL1L5zFL6L7L8 E L<FL=L>L?L@LALSFLT #LUVLVV LYGLZ #L[ L^KGL_*L` La LJG LL LQ LWF L\F LbG LEGLFVKGLgGLh_fdLiLmHLnVLoLp\ Q L%eH L*E L2 F$_rtL9IF LBzF LdG LjG LqG0M HM M M M H0M HeH MH HM HM!M" oE M%7IM'EM(*M.EM0 oE M3QIsaM4H N IN N *lenN *N (OIO P$IP% P'P( 0PDJPM#IPP(PW)8Q JQVQVQVQVQV Q#V(Q,V0R)JR*VR+BPR8JR9JR:\HR;\LJJ*8RD$K-RERF4RG\0 S>KSKSZSpSSSendSKPK3*T KvalT T KT KvalT  T K SL U V V V WXY^[Y_DY` `YaYb YcYe74 Yh28YkH@YnXYq`YsdYt2hYwpYx\tYzۆx,Y\,Y\Y\YY-YBY itYY^YJYhY `YUY:ttyYYY 5YVY VYVYVYVYVYKY*Y*Y*Y'*Y* Y*(Y"*0Y,*8Y*@Y*HY"*PY,*XY*`Y*hYJpYYYY)Y \Y3YYYYY4Ytf0QXJ Y0\Yb2YDY74Y [ 5\ ?\Zt\ZʮZʮI\@[\[[ [ V [ ([*[,[-[0y\ \X\c}]\d&\e `\g \k b2\m~\n(\o0\q g8] ]H ] ] ]]]]]] ] ]* ] ^ ^*+^*$K 0^ :^ET^* T^ ^^J0[`[[[[Ф [,[.[~0[@[(H[P[VX[`[[*[4[ \:bdi[ [ ([Ůh[p[([ `:ev[2[\[\[\[#[\[b2[7[[[ g[g:cdi[A[:bb[K[![V[  [((h^h^ya^zil^|\^}m(Dm^l(^C0^*X^#m``@_4a_5a_6 V_7*_8*_90} _;\(_=\,_>=0_?X8 a a a a aa`b`V`V`` Jb`!`" `$\H`'b`(Fkey`)`*b`+V `,V(`-V0`. b8ext`/b@ab `3 `8ctp`9c`: V`;B`<BJb $3 adaBa la\a  aVaVinoa)V deva* `(a+ `,uida, K0gida- K4a. 8a/4A@a04APa14A`a24Apa3Va4Va5Ba6Ba7Va8Va9Ba:Ba;Bb+db,@j ij ij ij -jb2@@j gHj!*j"*j#j$Cj% grj& j'i0j(*8:cpuj*@:sspj+iH&i*`j6ij7b2j8hj:h(j;*Hj<iPj=Xj>\ijeijf\sdajgkjh!ji#kiJxjDkjEijFkjH jI4(jJb2HjK4PjL*pjM*xjN*jO*jP*jQ*jR*jS*jTjU*jV4jWUjY `j\*j]*j^Ugj_ipik*1hiklWk l. l.l"kl#3l$ l% l'kl( l) l+kl, l- l!k l&Wk l*k l.k l%l5kopsl/lk %l*ll2ill4*l6\l7\ \^@l   \^Hl   ^pl^ql^r^sl l^m^4l^*s^Dm-^^*?^Xmltm@^m^l^*^*^* ^ (^,^m04rcu^8^ nHXmk^ n^id^mn3*^6n^;n 6n(mnme@K(XdvYtf(\vb*h*t6w }$2v**@vv9/#wttu KwCrbB*Gv PwqbIxqc qh qjqkqq qs(qt0qu8qw/@q{Hq~PqWXqk`qhqpqx ZwIxvdvxVcid v@@ x `D x* Y^w@@|(x@Af@*P*X*`*h*ppgd  x) `5 `?|E*L\S `Z@@CghChb20[@4"td[D8'[F@[K74P[P4h[R[S[U7[V7[W7[[4[] ̈  val  ӌval  <i#n*v8_`&abc d 4rcue reff0ߌ# v * %     . 0  4 4F5\6F7oVV*` [ ejy0pqur s t Vu v$$(  K  &  K  ӌP\ l  4A4A(4A8 uHЇ([)*+ ,0-4@. b2`/ `d0s?h1p2 x3*4  ~val [ g\6   BE$uidF K$gidG K H ~DJH      ( 0 (A8 (A@HU* \(\, 0 8V@ U!D#U@8ْ9:;<= >(?0@$8 Zs?ޒs? XDғEFG HI J(K0N 8O2@QKHS$P )s?ד:-:-~K:7xY?Z[V\V]V^V _V(`V0aL8cL@dHeLfVPgVXhV`iLhjp8ڕ\\\\ \\\ino  ( 0\?* \\\ \\\\X=`yy (0ݗ8@HyP `s?ABys?\es?~s?Pݗs?ės?ڕْO8 [ \ tf [0 kH"ops!{ :k*{**/w} 834z563Vt>a  D v(0 8 ۛ@ H P pX`h Ŝp x* :S W W\ CzuztfTWTzƚ8DDEuFTraGII *J\ K\$L(M*0quT\qofzIuT\\zV{ T ۛzƛz%zt"(+p, -./ o  Tzz2uzŜzߜzߜߜʜTzu%  :u/St?>/c\@9/͝!͝ ݝ%ݝ:ҝ/!5^&  \ ! + @Z[ڨ\]^9`W b(d0e8f٩@hHjPk$XmQ`othppr xsuv-yP{n}ҫ 5    ˟ ՟(Pu 2pidU\Auid KK $  *\\ \\ / ؠ4 V@ )9*+1,P-ߟ!PV 0x  )xK* M ݝ ݝ b{ ( ݝ0 8@H̬PX̬`h p x&&&& N v    ғ= " ,@1 ; EJ T ^c>)* + ,`-. /*(0 `09 `4:T8< `@=b2D> VH? VP@*XA4`BCŮE `F4HWIK V-Qor   ƤP*P*$!**FV\/Z pos ! \uguƥuFt\ ["[[[ ˥;u*'HTuTY @|u\*cu:uǦu"u̦u&u&+  *Xu****5a5^u\bu5^\ЧuЧofէڧ uu Nuu\&{uu\S\ \7ڨ:7\F7:ߨ:09: W7>:7l\7:7:7٩:7F:7lީ$:7l`Q:7:7\)o7o&VAB\2cy7:VV Ī:-:7u\l P:ul20n7U70s7 ҫ7 mt Af *:׫.\>   :Ms?>b:R{:Wg:s?s?̬s?7 Ѭ s?&7Ns?+vs?FS:{s?e  ˭Э7FVڭ! *@@AFBCŮD} E(sdF0Ge8,I\,J\,K\,L\,M\  ϮSbioʮ \ `- 48 V@HhPVX` hpr  `t x\pE6     pNkpT {pZpe 6{ p#}5}r**_pp߰pp߰/)3*p p/)k2(q0_vmaq1q2 %q3 *q4*q5* /q>q? Wq@ z****Ʊ#}5}\#}5}***/ W*V4Fk\ ^p ^*# * *?Brev* ' ` `F4rbBnsX0\8< l>@idV` Vh4p4rcux' (ops! h !":$ S% q & (( 02 89@: H= ¶P@۶XA ` (  /$dir   /knu V4 4@`h x    @  A %Nx  9! :V&VS?VqVXVv H¶ T۶ Ƕ \!  0'}() ~* +, - (2( !=VX =X ܷ F l m n o&X 0 1 2  3 V 4  5 M( 7 z0 9 M8 ; z@ = H ?ŹP  lиŮиlŮڸŮи=TMuŮ%zuŮRuŮŹuŮ     6 ʹŮи6ŮиF`} b2  eX;0t޺u vw!x* y4 z N( ޺Ů'}X4%N9J }~:bufŻ *Ż*?Pֻ]* $=` ֻ F8) 8VVSB [ o 9 j@p.HFPXbusR`h Vp Vx4)38B "msi(Q8V@VHVPeX j`htx ~ `"idBb2 .!!# $%'#)+ `, a- b. c/ d9 e< f oN*vV NV  {B D E F> GM H IVv9  !\"\ 9 CHAoK : @NRN O* P  Q  * 3 . B*]]     ! -F(EFFmodGD#opsH!I .JK 3 .La$argM V$strN$arrOVW\X a \max^\_\num`opsa!bV #0( -) KB* F*{ \  {P*7` - . mod /D#@ 0ŮHmp 1P 2UX 8 5D 6 7 g 9  ;  <( = 0]]bD]bFlD#FD#D#.\ >   88 Emod FD#) G8P pt qV rV s t\Cmtn w    \   =_K*%t  bib & 5+?!P ZVn%V zVVH b2 ofV (740Nn MXN P\R\ T\(***** 04rcu12e3X3* HGIGJK LM*N} :g; <L  !"# $(%0&8'@(H)P*X+`,h-p.x/012345 sjj.Uy   .\lM    Hxy b2z\|\}4~0@  8g%  % !% "% #% $% %% &% '% (% )Bb2 U  @ @ A B C D E)BPV g74 ` `\                \VVVV  -("qos70+ ,Fid-./b2 0(1C02*X3 `4 h5 p6 x7 8*9*:*;*<*dev=j,> ,?  M-j3 2opss   jj\MNFOFP!Q!R! T(U/0V8W @X HY P[X\`^Hh_paxcd pmfMh j ` aFbusbRdD#eFg h$j(k0m8n @oHp PqHXr`s!ht!ppmvMxw py **V9Hjg4`23F5!6!8/9  ; 3(< 0>8@(@AGHC aPpmEMX W*l..#XG*8a*L0XYFZ![/\ B^ pm`M( f\-       zB*$\\*.\   .\   8 0F!~"K F.\1      .\B  .\O  c)d&Pe2f4g lidh )< = GLV [`G^cmao y     ʮ  [C%[D [I [N[S %e[AW[B[C7%/ ` V  \ \   OZnZoZZp\Zu#Zw Zx `Zz Z{ Z~\8Zb2<ZI\@Z gPZgpZx3* @j]klenlwpmn{o{p{q{r]s tm({m*{}*[m   [t[u[v}[w[x[y[z [} \[[ G[e[~[ [ [([0[ 8[@[H[ P[ X[C`[ \h[zp[D#x[[   # - < FH[[ [ @[\D[&lHP![  \![] \[h[i[j[k*[l*[n\[o\[p\ [q\$[r\([s\,[t\0[u\4[v\8[w\<[x\@[y\D[z\H[{\L[|\P[}\T[~\X[\\[\`[\d[\h[\l[\p[\t[\x[\|[\[\[\[[[[\[\[\[\[![..\VP[l[ [ @[ H3{3* {           [#[[.\[G   eʮ\L~`j`\*\`\ * C` \V \`Hz` !#a `% 7nid < 0{ { {\*j     & V ' V ) B\ͫ  Tu V2   2;v/Xv2 *;/  X>Unidj*\\\ ()7H|%%}U` ~8FG\s?FTVvTv @uT au- `f'u`ctx>*+aU WW+ ++$+0b;<H;I;U;a;maD+ +b;#;/;;5555555555L$U~T~XtU2T Q0V$+++++UT~cXT VA + LBUT}Q1LqUT R~XUT /WLUc-Y Bdir .:Bctx G*M VBde 2M \M /\Zend G11\1F1\G1V7d[ctx1*\F\[ino V\\dc:[fc;u"BpAKMT11Zret 0Z__p11G10606060606G06H06H06H06HG6HYA!BptrA M 2(* 3P$mm _*h _*p Fx         * W  W,  W,  W,  W-  W-  W-  W-  W-  W-  W-  W-  W-  W -  W -  W -  W - "W - * $$pid  ;  ; *   M M ( M0 M@ ,GP 1GX M "iG %Z* (Z* +  - L . L 3 L 4= 6= : ( =*0 >*8 A L@ D LH G*P H*X K;`* N; TH WH ZH ^I k R1 mI p2  q2( t*8 u*@$fs xIH {IP ~IX I` Mh  Mp  l6x  l6  l6 9 *   W  M  U= W B5 N:  L   L  j  4  BE  W3(  8  M@   H  NP  NX  N`  Oh  )Op  *x  .O  ;  W   L   L   L  5  =    8O  M   8   8  "BO  )O  M  O0  18  WX  O\  O`  1h  M  O          !W  "W  #  $*  & L  ' L  ( L * )  3O  C  D*  LO  N*  RO  S8(  T8,  Y*0  ] 8  ^ <  _ @  ` D * aH  d:X  gO  i:  lO  w  x  z*  }  ~O   L  L            * W O P HR R  W( W, dE0Ircu 0 5@  D H 4P ESx 5   "OS YS cS     L    >*    !"! $"!* . <mS* F)@@4*? )   M   m%val  ) M ,m   *      N N  4  V j@ V  "v<dH  F   " ַ  }( 0 {8 z@  H  H  H ۷H  H  H  H  H"@FM̾PhFF xH MW1$kpR W(W,H0 M8S@SASBWD WHPImem\@* WMmr| (0W8@WHWLPWX`Whp xWWWWW W!"W%& 9W:?MAMD F P QW(T0 -4 W*,fmtFFFWFF$e f* g huv)w)keyxm U#V j@keykn]keyoe6 7# 8@8FFFF-W-W-4Wkey9](&W=$   8UVMmodWXFY Z ([ ,\0FuvwxWyW$*WK* /?1Wset3get57 )"O" L r   b( b08!-@" FH# dP$ dX%}`&h'p(x)Ұ*+,@-E./ m0 1 ,2DZ3 5 9 ,; Y>Ұ?|@D O !)key")?} A* B C } ' = >O  ! % + -/ (  !  !*!*  ; !  A0c!dFexgxi yl y w(7!8!9!<!=!!<! =W > :)";!!srcA dstA ."9"___&W"  (""val 8!8 "8#L$" 8*# +&*# ,#W# *#  #!W#!W! )/#'#(G)`"".L 1#2#34 5*6* #($ %" /\# 7#8C$*fn W$#mR$R$$C$"$"Lend"L#;$'cs#=L'sl#?L'wfe#AL#ER%'ss#GL'sti#IL#KL'nmi#ML#PL #SL0#VL8'lm#XL9#]L:#dL<#%%cs#%csx#L #$#%%ss#%ssx#L #$#g&r15#m*r14#n*r13#o*r12#p*bp#q* bx#r*(r11#u*0r10#v*8r9#w*@r8#x*Hax#y*Pcx#z*Xdx#{*`si#|*hdi#}*p#*xip#*R%#*sp#*%$Bj'$C$D$E $E('s$E,'dpl$E-'p$E'/$F0'avl$F4'l$F5'd$F6'g$F%7$F+8 %* %* %* %* %*% 'pte%j' %"'% 'pmd%v' %"'&% (&%%'#&%/'B&' /(pgd&''#&'"(B&p U(pud&p'#&p"<(#&o(t(@'H('I*+b%c0' 4'*8(;)(<(=(? W (@ W$(A W((B W+"@@)Z*)b1sp)*es) ds)")$)&)*()*0)r18)*X)*`cr2)*h)*p)*x)1)*)W)8)*)*) *1Afpu) 0@d*"@@'*+i@' n@/(''*6'++g'_*' (g 'S(','%-P-8-*8-*?,Q.cwd,R8swd,S8twd,T8fip,U8 fcs,V8foo,W8fos,X8,Z},,[l,\m,]n,^orm,_p,`q,a.x,b8+.*@,:/,; L,< L,= /L"/*"@@,O_/.,P5-,Q.,R_/@n/2*f@,^/,_+7,`5-,a-7,b"/@,c//W*"@@,fx0,hW,kW,nL,qLxfd,tL,wW,zW,W,W.,n/@@,0, L,W,W gfpu@,%1,W,*,%1,%1,x0 ,x00.,/@@/- R1- L-LKb1*&r1*11*1 1.>1.?*.@*.A8cpu.C8/ 1/  0)520*+!0+4osq0-1 0/M,1_,1_,1_&W22     323 2 24 24M(5 35 5 M5M6736*67367336 W36 73636<3673 73/7 37 7 37W3&W8 3 @8'W4/8(38)  8*k4(8+408,88-98.:8/;3f4f43W4@@9/490Z91W92 G seq93<94f4953 96d097 8p4(:-5: :*: =5:8 85854-5;w5;; ;|5 w5< 5<5*5* <85=5=  =5>+6>,t>-tx?E6?E6?W`?*hmax?*p*U6* @ l6sig@5 @U6 ARV AS6x6 AU AV66QB6 B  B  B 6B'7B(B)B-F7B.B/B0 6B1B5w7B6B7B8 6 B<7B=B>B?B@BABS7BT BUBV BY8BZ B[ B^H8B_*B` Ba BJ8 BL BQ BW7 B\7 Bb8 BE8BFH8Bg8Bhm_fdBiBm9BnBoBpW Q B%b9 B*6 B27%_rtB9F7 BBw7 Bd8 Bj8 Bq80C 9C C C C 90C 9b9 C9 9C 9C!MC" l6 C%4:C'6C(*C.6C0 l6 C3N:saC49 D :D D *lenD *D S(E:E  F$:F%o(F'F( 0FD;FM#:FPS(FWS)8G ~;GLGLGLGLGL G#L(G,L0H);H*LH+3PH8;H9;H:WHH;WL~;;*8HD!</HEHF1HGW0 I><IKIZIpIIIendI<K<2*J!<J" W J&<JD<JD< JD<JE=JE< JE<JT 2=JY=JZ j J[=K U=valKk K >=K x=valK w K a= S= U L V L W40W [=    0 h^> i< j k=cpu lW mL nL  oL( > *    > *  86@@ ]?  L  L  L  8  8 *  *( *0 W8"@ A  L  L  L  L  L   L(  L0  L8  B@  LH  LP  BX  B`  Lh  Lp  Lx  L  L  L  L  L  L  L  L  L  L  L  L  L"@ WB >. 3 ! L( " L0 # L8 %M@ &P 'Q (R )S , LX - L` . Lh / Lp 0 Bx 1 L 3 L 6  7WB 9aB ;aB =*Aavg G>@A \B0 KB LM M* N* OW  P$ Q& SB(fB# ]BBSBBC6 `eD. a3 h L i L  j L( k L0 l L8 s B@ t LH uWP W W W W W W W W. 3X. 3rq D B eD B# ^rDwDDBXrqD D( W ( W ( W( WB E    h BERb DRs 8 _E _EBEN  lEqE {EDE*&!! E6F́oU @ D HW3P*` *h)Jp*x /jMU ESpidpL7,GL9 5L:WL; jL<~inoL=LL? L@z@LB4UH3rcuLC`LDpFAG* iGWKVAGMoHMp+!uidMq U=gidMr x= Ms U=Mt x=Mu U=Mv x=Mw U= Mx x=$My W(Mz'0M{'8M|'@M}'HM~'PMXMI`MIhMIpMIxM MQMmM9MV+/nGHSkeyNüIN5Nӊ+bNT semNU(N^PN X`N sVhuidN U=pgidN x=tNߊxN|N~N N*2NcH I I I I ICXO^MO_5O` OaOb OcMOe4U Oh8Ok9@OnzXOq`OsdOthOwpOxWtOz͐x-OW-OWOWOzOz/O3O itOҐ OP O; Oh O  O,G O8ttyO O O 2= OL O L OL OL OL OL O= O* O* O* O'* O*  O*( O"*0 O,*8 O*@ O*H O"*P O,*X O*` O*h O;p O O O O O W O% OS O O O_* O1 OU0ID OMOjO5O4UOz M M MPNPPM@QNQvQ vQ L Q (Q*QS,QS-QM0N NXRcORd+!Re Rg Rk jRmoRn|(Roz0RqX8N $O9 3O =O SOS^SFSRGO OO* O O O*O*!< O O6O* O PD0QHRQQQQ® Q,Q.Qo0Q@Q(HQwPQXQc` Q Q* Q1 Q W8bdiQ  Qx( Q xh QMp Q Q 8evQ QW QW QW Q QW Qj Q Q QM QX QX8cdiQ Q8bbQ Q QL Q  Q(( PhTyRTz_]T|WT}^+:^T](T40T*XT#^`MR@U4ESU5ESU6 U7*U8*U9&n U;W(U=W,U>0U?8R JS TS ^S hSV_V_V_V!_V%_V'_V,_V/_jV3_V5_V9_V<_VA_VD_VH_VL_VQ_VU_VY_}TW_ X !T(XTXWX XTX M XTTUUWTX#4UX$jX%M X' UY[UY 5YZ Z"[UZU Zj Z_UZUkUZWZ([0V[1+![7+!osq[91[;4[<M,[_,[_,[_,[_,[_\+sV\,4\-M ]] V] sV]m^V^^^^ W^!^" ^$WH^'W^(Fkey^)@^*W^+ ^,(^-0^. W8ext^/W@ VV ^3 ^8Wtp^9W^: ^;8^<8W !) _ XXXXX _KX_+!_M_WX`qX`rX`s4 wq`vXHcpu`wP XxaXaaXaY(lena+!HaYPapXY**Y*m'Y*C@bZbZbZb /bj@@b XHb!*b"*b#Sb$4 b%Xib&  b'zZ0 b(*88cpub*@8sspb+ZH+!Z*`b6zZb7jb8Yb:Y(b;*Hb<zZPb=Xb>\ZbeZbfWsdabg\bhbi\ZDxbD\bEzZbF\bH bI1(bJjHbK1PbL*pbM*xbN*bO*bP*bQ*bR*bS*bTSbU*bV1bWAG bY  b\* b]* b^KX b_ZpzZ\*'YZc_dM\ d. d.d"~\d#)d$d%d'\d(d)d+\d,d-d!\ d&M\ d*~\ d.\ d]+\opsd%]\ ] ]d2_]d4*d6Wd7W &WT@]   &WTH]   Tp]Tq]TrTs] ]T^T*]T*jT:^/TT*=TN^]k^@T^T]T*T*T* T S(T,T^03rcuT8T_HN^\T_TidT^_2*T,_T1_ ,_(ex_e4eBeMe* f `fLf& Af)Uldtf*`8f.*@f91Hf:hf;%apf= xfC|fD~ `g  agg*altg*g*g* g*(g0gm8gm@gmHgmPgmXgm`gmhgmpgmxgmg mg!m` a fFx_'\Za'^ '`W'Xa%lru'YM6a 'dM 'eM'ia 'j * 'k*('RaZa'hFa's* ('u)b'z*pp'{.b'|*'}*'~+! )b'Jb'*'nb'b' hbhPorefh8hAGHh5hhWlh*popsh 7xhhnb=('Q%caa3bJbE''Gc 'W ' B' `cval'*#'Gc9'Mc'N 'PW4'JcRlru'KMmc4'Wc'X 'Y`c9@'GAd'I*c'UF'V * c('[ 0'\ 4'^*8>@'F_dc7'jt(9('md'n*'o*'q 'r 's 't 'vW >@'ld_d7'zt(90'}Ie'~*'*' ' '  ' (9 '~e'*'*'M>@'|edIe7't(6'De+Ad+d@+~e#'*e6 f  j   F  ́(W0W4H8@P p  x# $ /% /'+ʪe'5gctx'6g g'=8g'>@U'@<('XUg'YU('\g'b*'h*'t6'w '}$9'g'*'*>'gg7'4'h'e'el 'r@idnL`n hnsp3rcunxp nqopsnrn!rn nqhnrnsn sn"tn$ 0tn% Nt n& ct(n( t0n2 8n9S@n: tHn= tPn@tXnA t`qr r nr%dirnp np nq r s nsknnqnfnsn n1 n1@n`nMhn xn  n  S@n  SAn %?issssssstss+ts+ttNts+t5tctsSttsht tstt tts*ttst&Wou  0o'duo(to) oo* nuo+uo,u o- )"(u<iuuuu su<upvp8p /pWp  pLpLinop)L devp* #(p+ #,uidp, U=0gidp- x=4p. 8p/V@p0VPp1V`p2Vpp3Lp4Lp58p68p7Lp8Lp98p:8p;8wF /m8w nw o&wX0w1v2 3 4y 5 Dy(7 qy09 Dy8; qy@= yH?yP8ww8wwww/ x xxx@q@xqAFqBMqC xqDtz qEz(sdqFq0qG@U8-qIW-qJW-qKW-qLW-qMWxvw/x xwxy xwxx|qa|{ |{| |F9|{*|9|W|{W|T{C|\| |r"|r#|r&|r'|r' |||s|sjs =s|Es|s }+|t3/}t48lent48t2J} } t6Lt1k}/}t8/J}ti} tjM tk}4Uptr} ts tt|EtutR~tTWtU=tV|tW~tXJ} tÝ0t[с8t_"`t`hhta*ptbx/td|p}tmtnz3d_utv}}}"x{́| /}~ U= x=W ""! h(F0 8*@OH #L P sVX sV` sVh8p8t8x8|j 8U**MMMM qt0A@AH P T X \P`h*EpM8PԧH P(X©`̩h p~*'@tttttt t(t !0t !8t 6@t THtPtXt`"@hM #*  {(!0!8 @"H*P*X*`~hUp &(#AK$Z_k| M  f  W (*!` 8sVsV!8"/ ®0 #14 Ү6W<1 BF@D"HFPPI+!XL`O /dRXhSzpZmxa pb pIrcucdXf1k0*nj@@oMHqjXrM`&Wt ~W~J}WFk}Ɔ~!~6~́&T~; uEuF~uGhuHuIYv܇mntv v ~S܇~~m w"lw#nidw&w-*w4*w7OwR<wSZwUZwXmwYwZ Wwc 5 wdAG(3rcuweHwgXwjM`idwmpwptwqFxwr~wu_*PPUl<+! ll Ml" ml$j@@l-lrul/dl0+! L2nrL3nsL42z*Ɖ2*x 'valxL x&Wy V   V zzz z,{_|Ɋ|Ί|* Ɋ N NNl 3rcuNmNn5No SNvDNxNy Nu] %xN*(NrNt*DNNNF Q Nߋ N N * N#I#(IߋNbNkeyNIN=Nƃ NMEN3N N sV N sV(NN*N*NNN  (N N]9 N2NMN 4 NON O Y-}} 5}6_}*0}+!8}@uid} U=P}+!X} `}$hM M 5MgidM x=/2*=MQ MrrcuMhC@@9gZ9h4cpu9iW9jW9kW 9lW9mW9nW9oW9pW9rW9s9t9uW9{  9|f4(9} 09~f48/9i@@[<_Jp4@z*4:*?8OO O! mO"*O#LO#L O$*(O$*0O'O(LO)LO0PO1 AO2 AO3 AOCkODOLOMONk8OQ͐OR OSkOTAG*,G*  5*   ~E~04U/ ` ב3rss E0*84U@ X fn )"arg v* #b   8RS] RTM RU[=RW~ RXERY8RIqRJwiocRKO;+] R\W0"QwQ QQ QQ* QW(QW,Q50QW4Qo8QHQ XQXQ XQXQ!XQj`QdQHRhQ xpQ4x$devQ(Qk0Q 4Q+8Q5@Q1H$idQ hQ*pQ?xQ xQ4QXQ QIQMQ 5Q!EQ"MQ#1Q&0Q(j4Q)M8Q*KXHQ-S$fqQ2]Q3MQ51Q61Q71Q=M Q>j0Q@4$tdQDg8*QF@QK4UPQP1hQRqQSMQU~QV~QW~Q[1Q] S~  valk  Ŗvalw  <ݖin*v8_`+!abc Sd S3rcue reff0і v * %&     . 0 A 4 485W687aHH*R M W\k0pԘqfr s t u v$}(  U=    x=  ŖPW /Ԙ  VV(V8 fHЊ(M)*M+M ,M0-1@. j`/ d0hh1ٚp2 x3*4  pval M Y&W6   BEٚ%uidF U=%gidG x= H pDJ|H}      ( 0 sV8 sV@HGM* W(W, 0 8@ G!G@8˜9:;<= >(?0@8LhМhٚXDĝEFݝG HI J(K0N 8O$@Q=HSPݝhɝ́́p =́)xY1Z[L\L]L^L _L(`L0aB8cB@dHeLfLPgLXhL`iBhjp8̟WWWW WWWino  ( 0W1* WWW WWWWX/Rkk (0ϡ8@HkPRh4khWWhphٚBϡhh̟ԡ˜O8 M W U M0 ]H$ops!m ́]*}m*}*4w}ۢ 83ۢ4l56Tfm0Sq  6 h(0 8 ͥ@ H P bX`h p ֦x ,E Io(IN 5lfleXFIvSFl8D6EfFFraGI *JW KW$LS(M*0cfFWcUl;fFWWlmFͥlSlҥlf(+b,-S.S/  Fll3glSlѦlѦѦSFlۦ  f ,f!Ef104t^W>z74! ϧ" ϧ́ħ4O  W  "@Z[\۲]^`5 b](d{0e8f@hڳHjPkXm/`oRhppr xsʴuv y.{L}o'     ǩ(Bf pid,GY2uid U=U= $  *WW WW 4 ʪ1 L> ) 7*+!,B-ѩz#P"0j  .jJ{*+ ϧ ϧ @Y m( ϧ0 }8@HPX`Ͷhp }x , Tm   }ĝ/  2#- 7< F PUC)* + ,HR-w.W /*(0 09 #4:F8< @=jD> H? P@XA1`BC xE F1HIK /Qd   KҮ*K*$#SFLW!L pos # WrfYf+twfF+t֯f֯Wۯ QQvQSQ i-f Fft2mdfW*K}f*íffҰffװf *@f****nTmOf+tWJf+tOWrfU± mf̱sf,ffWYffW1rrWw ^r֯W~́~WFֲ~ֲ́ב́"́S5~]́~/S:{~́~b́~́~Fڳ́~/́~/#߳/́~́~WM~M4zz8WuW~́LLŴ ́ϴ ́~fW/.́f/"L~3o~"Q~ t~ ߵmt U *́ߵ0W   ́+h@́0ÝIEḿ^}hrhhö~öȶ hZ*Ҷs~,h ThF1hh́YmhUr  ~ַ{F *s  xSbio5  / 4;8 @EHPLXO` Yhpr  t ^x.3&WhEd     hNhT hZhedo(n+nb**¹Yhh hh \$2*h7 h\$9(i0vmai1*i2 i3 *i4*i5* <4i>i? 'i@ 'º*ۺ**Ǻ*****n++nWnI+n**0*]*N**bF**OOл**o(**ջ "Ǿx@pHFPDXbus`h p x1R.8 $msi(8@LHLPX `Mhx  #$id8jM !!z# f$%$'#))(+ S`, Sa- Sb. Sc/ Sd9 Se< Sfܾ*ܾ1  B D E F̿ Gۿ Hp I1ǿ o(!W"W ǿ ѿֿA6K : @ܾNF O* P Q  * ) . 8S{SR    { 'F'(EFFmodGopsH!jI $JK ,'L%argM %strN %arrOeVWWX \`max^W_Wnum`opsa!jb`?0(/)J3* * W Z* (K*7`-\.xmod/@0 xHmp1aP2iGX \856v7 9 ;  <1(= A0fFF 1"A60W>p   68EmodF.Go6PpqrsStWAmtnwp 9 9W >C3,`Jm*  w WZW  -B  H~ j U~ (4U0 MN PWRW TW(%***** 0Z3rcu12@U3Zi2* HIJK LM*N n %:; <BV  f!V"V#V $V(%V0&V8'V@(VH)VP*VX+V`,Vh-Vp.Vx/V0V1V2V3V4V5VVGf[0Ut   0Wl    Hx.y jzW|W}1~M03@ ."8r( S ( S!( S"( S#( S$( S%( S&( S'( S(( S)8j MAG @ S@ SA SB SC SD SE.3PLX4U  W S S S S S S S  S  S  S  S WkkLLLL  ($qos0+,Fid-.M/j 0(1402*X3 `4 h5 p6 x7 8*9*:*;*<*dev=-> S-? Sr ) +opsV ;V f fT;S+TW@MjNFOFP!zQ!zR!z T(U0VV8W f@X fHY fP[VX\V`^h_VpaVxcVd fpmfhSY`aFbusbdeFgS hI$jv(k0mV8n f@oVHp fPqXrV`s!zht!zppmvxw fpyoW|ǾBj`2~3F5!z6!z89 ; (< f0>V8@( {@AHC PpmEX/~E{J{0X?YFZ!z[\ ^ f pm`(?&W-l   lq { uE{J{WW*0W(   0WR   8MMM 0!o" 0W1      0WB.  0WOR  cd&e2 f4.gS lidhS i  L Xcma     R_ GR R QCQD 5QI EQNYQSY\eQAQBҮQC% `L  W; W; @ J TOPn.Po[PpWPu#GPw Px `Pz P{ P~W8Pj<PM@PXPPXpPxcB2* B@jklenlwpmnvovpvqvrs t(v*v*&Qm$   QtQuQvQwQxQyQz Q} WQQ QQQ Q/ Q/(QH0Q 8Qk@QHQ PQ XQ`Q hQpQxQQ      HQQxQ S@QWDQ&H#Q  W#Q] WQhQiQj'Qk*Ql*QnWQoWQpW QqW$QrW(QsW,QtW0QuW4QvW8QwW<QxW@QyWDQzWHQ{WLQ|WPQ}WTQ~WXQW\QW`QWdQWhQWlQWpQWtQWxQW|QWQWQWQQQQWQWQWQWQ$#QWLPQQxQ @Q H2*     & 0 : D N X b lQQ!Q!0WQ   G֯WHR HR/W*WHHRW4aaf MSp*HRWHRHR+  HR 5S%E:YJi֯^ v <vW*     & L8],^L_́bQcMrefd 5(e0TW6O  <>@WBWCW HFG YpHUJW@KSDOQS(V=refW 5XMYBZ = Gh~i"~jnDmoptnOqMr1 uo@wWPxT{́Xlz4}`fh́pxLL8888"W88LL.. 8 8  x AGP Bp ,x Q  VTW   TW  7v< = xs*@c G! z*G J K L M N O P Q R S x* U b! b y z z 2z z x ?qe x?\E FKV ?v iG?f iGZFU: FW:*5F**Z*QQ*: qFF:F?qtz?qn x:q`! xz xFU:qtz:qT xFUw!] AU [U xGGsb1h1sbiQ wUv Uvy\Gsb.h1sbiQ1err@ !z%;UsT Q  UsT Q0R Xv Us;U|{ nH. x1sbiQKVL[UU#@]XH1 xHIxGbufFGlen1sbiQ|aX1ptr]}t*@1ret~HKYL@ !!!@? !P!Z!f;T0Q@@? K!P!Z!f;T0Q@@? !P!Z!f;T0Q@ qUQ T0Q qUQ VT  q+UQ 5IU~T s]nHn0 xHoxGbufo#1sbiqQ1asX1ptrt]KLqKLs@tT!!! zUQT  UQT ;UQT ^d]Msbid:QVe Ve\  1ret   uU T  U  U T Q0R  U ;U T?MxT7iGW  ^ sMs5FVEWMresZwF/x/x6 /U /fUF_FkFFFFintk,F* FWs8wWu8Ws16Wu164Ws32CWu32Ws64Wu64yk. F/1k2kHIX]^_`_FF$&<k Rb #F%&*/4=BhCnR} \ f f k k f zc \    _3 /[[ k3k[`}sx} Z /$G/WC/    ; L]VH U U   "' J  ( #0 8 @ t!H t!H t!H OH t!H t!H t!H t!H+@t PhUU kC,kp k(k,0 8@ABkD !HGPkmem&@/ k7<FP +(p0k8p@kHkLUPkXZ`kh_p  xkk#ikxkk#p k!#"k%&'9k:?AD QF zP Qk(T#0e f/g h u vCwC keyx  U V zt j$ keyk nA keyo ; <*=*)? k )@ k$)A k()B k+@ x _ /+-@ 6kk p ?( k,!k0( 4)+8*kH+/P,X5 `6 d8 h: l; p< t=kxNse?]^@,rt@_kdlA]`BX`Fb-IJ/KkObXb]b-`"\@dhkkk l/m nb ob(p'0q pXs`ubx dyxbhzp{c/    xb [*Q(-P,mmhpcx    /k k, k, k, k- k- k- k- k- k- k- k- k- k - k - k - k -"k -/-,pid  / (0@dPdX "=%(+ p- f. f3 f4Z6F[: z(=/0>/8A f@D fHG/PH/XKY`-N/ZTeWeZe^@k "6mfpP qQ(t/8u/@,fsxfH{fP~%fXf`Jjh jp ZTx ZT ZTX/ k[j O9k"SX f  f W7 ! b ( 8 j@  pH jP YkX ck` kh kp /x k YY k  f  f  f S fD  >m   R  R "Hm )m    m0  C8  kX m\ m` Ch  m      !k "k # $/ & f ' f ( f -)3 3m C# D/ Lm N/ Rm SR( TR, Y/0 ] 8 ^ < _ @ ` D -a3H d$YX gm iX lm w x z/ } ~m  f f  #   z z/kooArr k(k,b0krcu30?@ DHRP>sx? p "Hs Us_sp  f >-3 !"+$"+-.3<is-F@@  /? BUC4D4)E4 )E4(AsE4,AdplE4-ApE'4/)F40AavlF44AlF45AdF46AgF%47)F+48/////  pteU"  pmda"%%%?%//' pgd'y?'"/p @pudpm?p"'?Z_@ H I/8;0 z4 /8+@@!!6sp!/es! ds!"!$!&!/(!/0!68!/X!/`cr2!/h!/p!/x!6!/!k!R!/!/! 5Nfpu! 5@k (" " ' +@@ G8@ $@[O f 8     ( , Z0 38 X dh %]p /x   p b ; m g @0# ##0# #4#4# Bval# zk  #  #, 0$!$$! '! /$B!$ z $ c!'!$ $B!l%l%  &!& &! '"'!''' ''k'/,(w"fmt(U(U(U(k(U(U$)6")7 )8$ 8)#)U)U)U)U1)k1)k1)4k key)9w"(2k)=?# 8)U#)V mod)W#)XU)Y# )Z ()[ ,)\#0UU )u#)v#)w#)xk)yk"?#/ _$ / */U$*1k set*3 get*5*7 7,$^8&# . Q t  p( p08!@" H# *P$ *X%C`&\h'up(\x)*+,- ./ 30 [1 :23 5 s9 ; >?@Z$ +!&+% ++ +-+/ , &,!C key,"C,?&,A/,B ',C' - '- ' mod-#-'&& ,=5',>p&2k3'      /' /" ;'yk/v(     {(+@A@0+0@0$!0&50: W750</50=/50>/50@60A,960B,9 60Eϙ860G z60H/60KC60M60N60Oޕ60Q60T60Uޕ60V,960W70X70^/70d/70e/ 7-0i @@70t @70yk`70{/h70}kp70kt70/x70E70/=0ƒ=0"x>-0 @?0$ߙ?0?0A0YA 01cY+1dU1e`1g~1i 1l g(+&2 &2 &3&3&3 48+49+ 4<+4=++5<+5=k5> z 5:7,5;++ src5A4 dst5A 4<,G,p2k6j,(6,6, val6 R6!R 6"R6#f6$, R6*,6+&-6,#>- 7-77 , 8>-8t8 C-6'z-6(6)G,,6.f 61-62-6364 65/66/ -(6-6%j,6/C-67z- 86*.6/ fn6 >.-9.9.-*. 9k.9f end9f :;.Acs:=fAsl:?fAwfe:Af :E9/Ass:GfAsti:If):KfAnmi:Mf):Pf ):Sf0):Vf8Alm:Xf9):]f:):df<:f/Bcs:4Bcsx:f:k.:/Bss:4Bssx:f:. :g0 r15:m/ r14:n/ r13:o/ r12:p/ bp:q/ bx:r/( r11:u/0 r10:v/8 r9:w/@ r8:x/H ax:y/P cx:z/X dx:{/` si:|/h di:}/p:/x ip:/9/:/ sp:/f/ ; 0; ; 0/ p<I1 cwd<R swd<R twd<R fip<R fcs<R foo<R fos<R<I1<Rl RY1 /0<*}1 rip<+f rdp<,f0<.1 fip1z1 R2 / R2 /? 6> >! >" >#B6 f6 / _6m/ 6 / 66 /6 6 ?> 7??/?@/?AR cpu?CR&@AC7A! AW7-7AC7B z7Bc!B"c7&C&C&C&C!&C%&C'&C,&C/W7&C3&C5&C9&C<&CA&CD&CH&CL&CQ&CU&CYD !8 (D8DkD pD8D D8888kp8 D#,9D$W7D%D' 9E O9 valEE 89E r9 valE E [9ChFJ:FKFL@FMFN FOFP O9FQ r9 nsFRRFS/FV F^F_@F`/>Fe@@FgyHsetFiN=hFjW<Fl XFmFn+z@Fq`ZH~9 /: /I@ :::p:z;u; 8Iu;IUIpII zI;I; Ip(Ip0: Is;It zIu,9:; I;(IIW<XIW<8<I=I: II=( setIw=0I=8I=@IHI<P;0I<I:II IISI<\<nrcuI3ykI< J=JkJ#v<II=(IN=I=hI =pI>x=hIw=I=:dirI|=N=`I=(I;IX|=;=w==w==I===W<==O9r9=>W<:= K />K z (L0~>L1;L7; osqL9>L;!L<=L=L=L=L=L M>M>M/ > N?N zN>O O G?O ?OPPPl?:rcuPm3Pn?Po 0Pv?Px4Py #Pu??BxP/ (Pr@Pt/?P$@P)@PU @@_?{ PT@PpP Y@.@ pi@ /Pu@z@@@AA@@|keyPÇAP?PG?8APB semP/>(PBPP pXA`P ?h uidP O9p gidP r9tPS?xP|P~P P/UBBPB@T@ PAPi@ keyP@P$@SPAP[PP BP ?P ?0(PUBP/P/P$@P)@P + (PpBP? B> PBPP >' PBP.@pB B BAQ B valQfQB  %C #  /  1CECECB R"eCR#C R&CR'CR' CeCC S)CS*;S+! osqS-> S/=Tɪ=Tʪ=T˪ U!DU" kU&C UD?DUDDUD$D UEfDUEDUEKDUT DUYfDUZ W7U[rD0VDVW7V SVD[VDVD8D03E4R len4R25ED6f 1VEE85Ei}Ejk}E,9rEsteC[u3RFTkUfDVeCWFX5E YI0[I8_"J``XNha/pbpx(dD[Emn:d_uvEEE+x{I| z}~ O9 r9k oo! XN(c0 p8/@]H nL P ?X ?` ?hRpRtRxR|W7E 3R/>//44 c0@H zP zT zX z\z`h-cp8zH P(X`h ppF I /'@JNNNNN O( O0 O8 +O@ IOHOPOX P`IJ+@XN n/  (!&0!+80@"?H/P/X/`Fh/>p zp&#$JC    e ok (-F` pR??!R"y/ ~0 Z14 6k<C BU@D"JHFxPI;XL`O fdRyhSpZ xabkrcuc3dyfCk0-nW7@@oHqW7Xr`JXN2kNNFkNNNNF5ENNNkUNVENNNNOFNOF O+OFIO+IOF+0O WEOWFFWGXNWHWIOOONOO XO mntX OX FOOOOOOF PFbNO YaPYkYkYUYUYU ZPZfZf(ZP:ctZPZ&P aP2k[P \Q\  Q Q ] *Q] (^ _Q^ ^ ^ _Q(_ _  _ Q_2k` Q@`'7R(`(_Q`)  `*KR(`+R0`,8`-9`.:`/;QFRFRQ7R@@a/Ra0a1ka2  seqa3?Da4FRa5Q a60a7 8PR (b Sb b/b SbR SSR S cWScc zc\S WSd xSdxS /S /d8aS e+Se,e- xfSfSfk`f/h maxf/p /T / gCTg fg fg h ZT sighxShCTiRiS~TfTiUViVTT{jTj j pj Tj'Tj(j)j-4Uj.j/j0 Tj1j5eUj6j7j8 T j<Uj=j>j?j@jAjSUjT $jUpjVp jYVjZ $j[ j^6Vj_/j` ja jJ|VjLjQ jWUj\UjbV jEVjFp6VjgVjh _fdjijmVjnpjojpk { j%PWj*Tj2TB_rtj94UjBeUjd|VjjVjqV00k Wk k k k V 0k WPWkW Fu XFv nsFw  uidFx O9Fy zFz F{W k 6Xk!k" ZT k%xXk'rTk(/k.Tk0 ZT k3X sak46X l Xl +l / lenl /l  (mXm  n$$Yn%Zn'n( 0nDYYnM#XnP(nW) 8o Yofofofofof o#f(o,f0 p)Yp*fp+Q Pp8Zp9Zp:kHp;kL Y/Z /8pDeZ(pE3pFCpGk0 q>ZqKqZqpqqq endqZ _Z4/S[U fV fW!6k[F[0h[iDj k[cpulkmfnf of( [/   )\/ RO@@\ f f f R R/ /(/0k8+@]^ f f f f f  f( f0 f8 \@ fH fP \X \` fh fp fx  f  f  f  f f f f f f f f f f+@_[ ! f(" f0# f8%@&P'Q(R)S, fX- f`. fh/ fp0 \x1 f3 f6 7_9_;_=/NavgG)\@]^ _0K2`LM/N/Ok P$Q&S2`(_?]D`I`X`X`]`O`aah fi f j f(k f0l f8s \@t fHukPkkkkkkkkQXQrqa7`aX`?^aaaX`orqa5b!k !k !k!k/xbbpb5bpsRbbbl bb b ab /'' bOcI{/> ?@ zD zHP/` /h)Xp/x fW7/> pc|pidpr7dr9 ?r:kr; W7r<F inor=fr? r@@rB,9H:rcurC3`rDpc d /soesp; uidsq O9 gidsr r9 ss O9st r9su O9sv r9sw O9 sx r9$sy k(szB0s{B8s|B@s}BHs~BPsXs@`s@hs@ps@xs pss s Xs8jde f  f f  f Ht ft! ?t"t#t$t% t&(t'0t(8t)@*fCXu^Jju_?u` zuaub ucue,9 uh8ukX@unXuq`usduthuwpuxktuzx1uk1ukukuu(uQu  itu uuYuhu zuduGttyu0u:u Dufu fufufufufuZu/u/u/u'/u/ u/(u"/0u,/8u/@u/Hu"/Pu,/Xu/`u/huYYpu u?uàuQu ku[uuuuuCu/>0fJ ujuW7u?u,9u Oj j jvjvvj@wYkw^@w ^@w f w (w*w,w-w0j ^k Xxckxd;xe zxg xk W7xm{xn(xo0xqy8hk kWCPy>myy ?py>mxyyy y y yy:yyy"y(y.y/y0y9 y:(y;>m0y>8-yA3@k Cm zmzUz-z9Mm m m / m m m /m /eZ m m Sm /C@{o:css{X id{ q{E@c"@{{{W7 {y({/H{P{EX{{{${${$H{:"{?"{?"{/{ {o({o0{8{(T"H{P{x`{Y"{  x{3{7i"m0{o{&{o{ z8! oJ0wArwwww~ w,w.w{0w@w(<HwPwpXw`ww/wCw kGbdiwe w_(whwpw<w zGevw<wkwkwkw#wkwW7w<w4wwywyGcdiw<wGbbw<w|!wfw h; w(<(ph|yr|zs~||k|}8O|~(|R0|/X|#`Fr @}4>s}5>s}6 p}7/}8/}9k };k(}=k,}>W0}?s8r Csl~>Ms Zs ds6s spp  s!G" Q)$k H'ct(U key)$ *ct+p ,p(-p0. ht8 ext/mt@'ss3 8t tp9t: p;R<Rs8C #vR zk  ff ino)f dev* n(+ n, uid, O90 gid- r94. 8/?@0?P1?`2?p3f4f5R6R7f8f9R:R;R +Kv,!-JtvtvGmapxS ;v /?v:rcu3v vv4/Kv "w#? nid&-/4/7oRwS xU xXYZ kc ? d<(:rcue3HgpXj` idmpptqUxrFux/xxxwvw; 1xYx YxYx#^x1xYx ~x ? "~xxW7x xxkpp xxyyy :y;x Xq{yrysR wqvyH cpuwP {y8zy{y:rcu|3 wqy0[ xz[z:( len;H+zPp y+z / ;z /C@{{{ (W7@@ yH!/"/#$R%yq&3 '{0(/8Gcpu*@Gssp+{H ;%{ / `6{7W78:::(;/H<{P=X>\%{ e{fk sdag(}h|!i-}{JxD}E{F}H IC(JW7HKCPL/pM/xN/O/P/Q/R/S/TU/VCW<Y z\/]/^:y_{p {(} /;z{&a}33"}#C$%'}()+},-!~&a}*}.} /~?} ops9~} /~4~ 2s~4/6k7k 2k|@~2k|H~ |p~|q~|r|s~ ~0|(|>~|/|O(|3|/S|b_(@||~|/|/|/ | (|,|0:rcu|38|Hb~ || id| &4/ |A|F A (!\  &f& )/> ldt*+8./@9CH:ph;:p= zxC4|D*~ & 5p/ alt/// /(s08@HPX`hpx !05F0 \o ^ p `k XBlru YK d e iĂ j / k/0( Ro hc s/ 0( u> z/ pp {C |/ }/ ~; >0 _ /0    p   ref&8<HYhkl/p ops \xpAS( Q;ĂH_[ 3 ] k z/  vval /? ]> M N p Pk' JDŽplru K' W X p Yv>@ GW I/ Uc V / DŽ( [ z0 \ z4 ^/8K@ Fv5 j_>( m n/ o/ q z r z s z t z vk K@ lv5 z_>0 }a ~/ /  p  p  p   p(>  / / K@ |a5 _O Dކ8W8@8? /ކO   W7 K  νc p I(k0k4e8O@P p  px#/$ f% f'48 5!ctx 6& ! =V >cx @Z( Xs Y/>( \Ȉ b/ h/ tE w  }$>  / /K Ȉ5 3' 3  ކP ZNrb  /V _bXc h jkq7 s(tP0un8w@{H~PX`hpxiX+s  fcid   `@@   z/   / o@@ Ҏ8@ x@ /P /X /` /h /ppgd  Gx ) z 5 z ?Ҏ E/ Lk S z Z! ]; _ aW7 p/> r  / / / /  /  /( /0 /8 D@ W7D /H /P '/X 3/` /h,brk /p !/x / / %/ 0/ ׎ @  ? /h W7p x     & / /   z  z & ; y  / / ; l / /3 K /  ~9   /34/ +^ - / W7?  kZup/7(pmd9 Q0pud; f 8@EZHFZPpteL LXptlP7`T Mh6k e @@@@@@=6=9=<=G ; h0uؐ0vؐ0w/`  /^@0ő0/0E0:0ő800080x0/0/0(,gen0),seg0*01x0  / / /  / / / / / / // / / / ;K / / /H0seq0/0000( # / /ƒ / /0E0seq0/0/00000^ 0e0f0hW7P0n/X0o/`0q;h0sEp0u/0x0{K0v(0E  / / / " /0&iseq0(/0*m0,i 0. W7 x / /  /+@0:0 W7000 0000000: J / @000 0  / / /10Ε00Ε ޕ //6k0+@07y0;:0</ 0>/(0?/00Jy80M`0Ov(h0P!p0Q$x0V0W0X0c/0;0/0/0/0/0U0/0 D0-0 @00x0/0W7-0 @0/0/0E0/0/0k0k00 0 -0 @00`  /J / ; / ;Ø /000^ 00 Ø / 0Y0 W700/(00/0/0 /0 /0 / d@ / ϙ / ,9ߙ / ; //  8g/66// /(0 g]q,- W7/ ?0p{ 034d678  xa9{ < " $W7@@-d lru/0; < r2 nrr3 nsr4P  / i4/2k ֛ ֛  +@@yyXy/yyyyyyyyy,knyly$y$@yxy4Xy4Zy4\y4^y$`yyyy: yyy$y -y @@y@yHypyZy"y#Cy&,9y)y,psiy,,bpfy/( y2y5#Hsy9= & ?K/0;8@ uid O9P;X z`$!h s[s ?s gids [ r9j4/Sssnrcus3&C@@agah! cpuaikajkakk )alk)amk)ank)aok)apkarkasatauka{  a|FR(a} 0a~FR8(a@@]dPR@ / xXà /? 8u,u u! u"/u#fu#f u$/(u$/0 u'Tu(fu)f u0u1 u2 u3  uCuDT uL̡uMuN̡ 8uQuR zuSuT<ѡ , / d+ / + 5 SO /C)Q/067 (IJQ R(U0V8^@fHk~P(lpn8q(oxq|rsu(vxyz{   (08@HPX`h pqx      O V {0,9(3 ` :rss {0`8,9@ zX  5 fn 7, arg p E / Z b5E RxSxTxUۛSxWxX[xY38xI qxJ iocxKkr8 x\k0+ww pw?w?w?w/ wk(wk,w?0wk4w{8w&Hwt!Xw|!Xwt!Xw|!Xw @XwW7`wdwArhwpw=x,devw(w[0w z4w@8w@@wCH,idw hw/pw'@xwwRwyw zw1@ww xSw!w"w#Cw&0w(W74w)8w*:yHw-;@,fqw2E@w3w5Cw6Cw7Cw= w>W70w@4,tdwDO@8-wF3@wK,9PwPChwRY@wSwUFwVFwWFw[Cw]   ۪ valĪ val<!!& iNn/v8_`;ab)c )d :rcue3 reff!0 N ٫ v /%ī6kT! ۛ7 / / n!2 z. 0 4z 4Ҭ5k6Ҭ7 /  0pnqr s t pu v4$( O9 ۪ r9 P+k zn  ??(?8 H0Х()*+ ,0-C@. W7`/ zd0XNh1sp2 x3/4 val 2k69BEsBuidF O9BgidG r9H DEJ H 9 9 9 9 9  9( 90 ?8 ?@ H/ k(k, 90 98p@ !#@8e9~:~;~<~= >(?0@8~XNj+XNsXD^EFwG HI J(K~0N 8O@QײHSP+wXNc+|I9I ײIòxY˳Z[f\f]f^f _f(`f0a\8c\@dHeLffPgfXhf`i\hjp8fkkkk kkkino   3( 30k ˳ /  kkk kkkkXɵ~~ ((K0i8K@HP XNOεXNk#XN# FXNsFܲ-iXNFPXNfne^8  k /> 0 H,ops!  I /  /  /'w<}u 83u4z568<pzʸa  D v(0 8 ۻ@ H P pX`h żp x* :SZJ+a-/6 7 9L 1; k 1< k!1= k"1> k#1? k$1@ k%1A k&1I k'Pn(S0V8W /8X@Gwb[H\IP_X`\a`b hc pd xϸzzfcczƺ8DDEFcraG/:I /Jk Kk$L(M/0qckqxzIckkzp{'c'ۻzƻz?z" (+p,-./   czzuzżz߼z߼߼ʼcz% ':/S?ʸ'rkK53'ν!ν ޽8&޽Iӽ'"m' + k "o?k( 3!VI,+@Z[,\O]m^` b(d0e8f+@hNHjPkvXm`ohppr xs>uWvy{} $gtCi bdijel/m/op(q8rHs W7Xu z\v`x/y/z/{/|/ /(/08h%l W7px:y:y8&HXc    (f z7piddPuid O9O9 $  /kk kk ' C fK )/5*3++,f-٫?Pp+0  d /X! ޽ ޽  ( ޽0 8~@ HP X`Ah_p xxxxx     !^ɵ 5: 0()U*U+, I get-I set0I(D   C)* '+ ',Ar-. //(0 z09 n4:c8< z@=W7D> pH? pP@cXAC`BCE zFCHIK p(QC`e idf( /0/8cx@kDkHkLkP;X/`:wbh`{pC/>,9Gdev26(R0FX! j t _ / _ /$?Ufk pos ? k.Q+z;3tUz;Vk ww^@ww QByV *k/CV/\IHu9az /////ss3mz;k[z;mk8~~x ` x>s buf>+> > > >  > (> 0>C8 op>HX>`>Mh>ppkxkk kF,IFkUJFIJ1mIToIrF+IFzFIFIF+IFU NIFz0vIFznSIFIFk{FORktF+4I4ff9 WICIFkz\IzoFFoF $F Smt x /bbI)S6kIXNIIIXN XNlXN7F7< #_XN+FxFdXN+}XNUI+XNx  "FJUp, t!_ / @@AUBCD En( sdFl0Gcx81Ik1Jk1Kk1Lk1Mk__!|bioY E z( 48 p@HPfX ` hpr  zt x2kE NT ZeZ^p //02 2 C.A4/\C.>(0vma1V2 ?3 /4/5/ a'>? @ VV/V7V///^Ppk<^np//U/VsV/pUVVmmV/#ZV/idrI{kk / rev/  ll z zlU:rb nss0k8< z>@ idf` php:rcu3x  ops}! lhx "$ % & (( 402 89@: 4H= MP@fXA `x  BdirIq   knl pC C@`h +x    @  A %]ppz;ppz;p4+VM9fVRk2k 0'() v* +0,: - 7,(]p s&&+ ]s5 1g1U1 z1m1n)1o&3X10$11?12 13 p14 15 (17 019 81; @1= -H1?PP.=$8z[[?Bz~8e8[]c.+8+-8 P8V211 1 U[+[U ` W7_ X 0tiu ~vw!x*y z ( i~sY+s==J }0~0@GbufP +@ / +P /? _am/ aU MFN)O)P offQ immR2kqz6kj      !"6kH      !6k%      !"#$%&'()*+,-./0123456789: />P       "6 , 0 4 8 < @ H LK55`  Nkey8 P8  $ ( 0'  `F      ( , "60 @  D  H LP X \` h lp tx # ' `*+, - 4 '89 : '@A B > 72< = > ? D PPGH I J K OPQ R $S (T ,X0Y8Z @cpu[ D\ H'`_a b c d e > _g h Pkl m n'rs t 'z { | P@qv w x y (0 8P  `(KNbtf      $P0pid fd   Nbuf     ('  '  `G /` P  cnt /  /pf    'B  /a P0cnt  $pid ('  / K0 _G5`ptcxB5aP@  8' '  /H   /a /z /  /    /!" # _5__F5]2_5o5 5_5K5 Haz$X  jt jf k0(()d / p p BoDoEtFGHIp  Z!k"k y 0AK :@N-O/PQ * C. R U /zrz9 ~rU (*E*FU mod*G# ops*H!a*I >*J*K # +*LBarg*M pBstr*NBarr*O\ *V*Wk*X+ *\W max*^k*_k num*` ops*a!a*bpWU$  /  k  A _ /7 `-&._ mod/#@0H mp1+P2=X & 856?7 9 ; <(= 0+0U#U# #6k>:O8EfmodF#GOPpqprpstkNmtnw:  k++  M#df7 /=& A Krt{~t nd }s"f12 3  )H~?v~@4!~A4!~B4!~C4!~D4!~E4!~F4!~G4!~H4!~I4!~J4!~K4!~L4!~M4!~N4!~O4~Pj~QHlen~RR ~SRtag~T9~U"&9 ~V(~W #0aux~Y)8~Z09@8H ~ cnt~R~R~~ ~~~.1v=f (?///// 0u:rcu132cx3u 4/ HIJK LM/N$ ?+_@p HUP6 Xbus ` h pp pxCC )    ,msi ( 8 @fHfP X `h x     n,idRW7  !!# V$ %'#) + `, a- b. c/ d9 e< f :;<2F  V!F"F#F $F(%F0&F8'F@(FH)FP*FX+F`,Fh-Fp.Fx/F0F1F2F3F4F5FF7VK6U6klHxy W7zk|k}C~0$@ +8d!  ! !! "! #! $! %! &! '! (! )RW7 < y@ @ A B C D EQPfy,9 z zk                k[[ffff  (,qos0 +y,U id-./W7 0(1R02/X3 `4 h5 p6 x7 8/9/:/;/</ dev=1> 1? d ~C opsF -F V VF-Fk2 M\NUOUP!Q!R! T (U 0VF8W V@X VHY VP[FX\F`^ h_FpaFxcFd V pmf hKuu|  `| aU busb d#eUg h; $jh (kw 0mF8n V@oFHp VPq XrF`s!ht!p pmv xw V py za     2\ `2p 3U5!6!8 9  ; (< V0>F8@(@A HC P pmE X +   zu   p  s     ==  0X1 YUZ![ \ ^ V pm` ( 1 2k-^  ^ c  m r  | z+   ==  kk/6k 6kC 8   0 !l"   6k1 6kB 6kOC c d& e2 f4 g lidh       f    ocma         C &=/ H /6   F ops # k ?    onet 0nsR  X >m( FUFRFRFR0@FyFyFR<  /0FFF @FU @F  /  ; /= k  /@J79@0A`DGJ&My  /%O~Nrcu~3~9  /%  /%@TV:seqX D@[^RaVdf8(if@@ Rf / R| / /JʢʣʤʧCʪ!0ʭ68ʮfpʯfxʲ:yʵʶʹGavgʺxʽ ʾR(ʿ,9P zh zlCpRf6ff| R / f / / /$ / / 8yX knyly/yRyy ssyy&y y0y@ idyPykTyfXy z`yyh(yyyyyy yy y y  y (y 0y8y@yHy Py Xy Q`y+hy @py xy y y yyyidyyUyUyy yy$y$ykX  / (yD4yETyHfyJf yayf ygym(yuPy{xyy yyyyy $ /  / +@yAyByEkyH yKNrcuyL3 yS@@yVyY zy\ky_6yb26 4 4/yl yr26ys/@yy Hy|kPykTssyXy`y pyxy y)yByy y y y`y~y 4y Myt!f$$\B$.`$fG~$\e +>m@>m0C@ @;( @@/@;H;P/X;`;h/p/x/(" @$ min%/ low&/'/ max(/)@E x //// W7 (C8yX 0K k(" D, 0,%.K0k(1!,2k,l ? cnt@ zA}ES ynrcu3MN 'PkRk Tk    wC^wD BwI -BwNABwSAB^ ewAwBwC%h` fk k   y^vnvoۛvpkvu# vw vx `vz v{ v~k8vW7<vj@vyPvypvx y4/J< nr i < zL /2k!i si x W7R8/`/h/pp?p  pp H  W7 xp   (,90    {C  id{D ref{E ? {N {Oo{Q zC@{W~!{Yo{\'!{]!{^!({l @@{pE@q{q @{r!{s! H ~! !v /! / / ({!{f{ at{f{lS{"{nrcu{3@{5"[{E@[{E@ 5" ;O" / O" !i" / x"x"4/ ~C""f"fffff~D"""p"" ~ #map~ '~ 9~ 9~F7,%#k9#s9#F ~I#~JH~K"~L#~MR>#JX~Q%~S%~T'~U '~V '~W' ~X '(~Y (0~Z.(8~\Q(@~^.(H~at(P~d.(X~h (`~i (h~j (p~k (x~l (~m (~n (~q )~w $)~xB)~yV)~z p)~|)~.~ 0.~ T.~r.~.~.~ .~~.~ /~&"/~ @/ ~ Y/(~/0~ /8~/@~H~"/P#%%%O~'ops~1~'~p~ z~ R~ R ~ R$~f(~R0id~R4~8~@~RD~RH~RLbtf~0P~oX~"6`~Cp~ ~ 8=1~# ~/a1~0~1~2~3~4 ~51%''%%'''''''''pp'p ('p')(')(%(Q('ppf3(t(')(%V(('ppfy(('p(('pf(p('pR(p )'($)'p)=)'=)))RV)pG)p)'p[))))))')obtf)u))'))+x~.~ ~R~R ~R~R~R~Rid~R ~R$~R(~R,~R0~R4~R8~R<~0@~ 7H~pP~CX~O.x~7~j~H~~~~~~~~~~~~~~f~C~7~ 2~)~U~7~p~"7~7~7~R-~ 3,ops~ 7p~ 7x~C~7~O.~~f~R~~7~"6~"~p~o8~t8,btf~0~y8~~8~&8 ~. x(~/R0~0R4~5R8,mod~6#@~7RH~8 !Pc{7X)0.') .O.'RO.O.5.r.) RY..)f,w..'V.V.'...pR. . /.pR.//pHs/@/'ff'/Y/))E/w/w///|/ / ^//'}"pf/f/)/#2k~<0 @@@@@@@~7, ~0 btf~0~#~<0~R) ~0 btf~0~R~R ~ ~0~H0~0 0~.1~R~R~/0 0=14/K ~a1~ y}rcu!3/~)1~*)~+W7~,j ~-~.%\ 16k~2     @@ @ @ @~2~222O.)(%22O.2H~l3~O.~1~q3~ p~ ~ 0~ 1~ p8~R@ l3~53~6~7~8~93~:3 3 / +X~D4~/end~/~ D4~-~ ~ P _U4m/K ~y4}rcu3~y+~4~p~~3~&h~px~pcU4/0~5~v3~ p ~(~5~~5~C~ ?8~R<key~f@~4H~O.x~5~5~5 5 5 / 5 /y4~@6~4~!~!~/~g6map~'key~R'~6~@68~7~p~p~paux~pg6 ~0~1~42~R4~K7~R~1btf~0~R7~{7btf~0~#K ~97~:y}rcu;3K75 7O.6 7 72'P7 '7 /X~o8~y~  ~ (~f0~f8~f@~fH~pP725]>~]8~]8~]8 X84/^>~^8~^8~^8 84/'~\988 !9 / !9 +9'~Z9~Z9~f j9j9 /o9 ~ 9~O.59 t994/6k~ 9/~ 9~ ~ K/~ :~ 9pid~ RD*: f @j:k lenl wpmnopqr:s t:( : / : /2wm ; wth;wuwv:wwwxwywzw} kw<w @w@w@w @wA wA(w0A0w @8wSA@wlAHw @Pw AXwA`w AhwApw#xwAw Bt;< < <  < <Hw<w_w @wkDw&?H<?w  k?w] kwhi?wi=wj=wk/wl/wnkwokwpk wqk$wrk(wsk,wtk0wuk4wvk8wwk<wxk@wykDwzkHw{kLw|kPw}kTw~kXwk\wk`wkdwkhwklwkpwktwkxwk|wkwkwkwwwwkwkwkwkw ;?wv?{???kp4:Pw?w_w '@w 'H ??4/ ? ?? ? @ @ @ "@ ,@ 6@ @@ J@ T@w@w @w @6kw@@k@@Arh;@@Ar@Ah;k/@k0AArkAIAIANA 5AlAXAA/qAAAr'ki?pA+AAr AAAro!@A AABAr%AB B-B"BAB2BQBFB B J  B B B / JB4/ B   > Z !C  Zk*PC& f' f) R 8]C^D_IbDc refd ?(e+0tC <D>@kBkCk HFYDG H/>Jk@KD ODQ4S4 (VD refW ?XYDZ+ D DD hEi"EjBJm5G optnCqrC u{@wkPx4T{IX lz4}YD`hIp5Gx%:ffRRRR":Gk4RRfPCPCf33RR _<PDpCxD++DD2k\G GcZp> G  >G\C' HG\C> RHE/G' tH hCG HCI nidPC/kkk RH(FH(I O9 r9 VI I (IeI4/ZH#ZI#IF}IIFIUpIIFIUsIZ#Z#Z# %JJZ/+%J h J sb XN buf \G pos\C(p0+8@DH L5EPF`~I ~J ~ J+  K /K*J$K e$oQK sfpvKXNvK{K\G\CWUg;Kg=KkD> kD>+kD?\Cvret@7D=!pb <[wit<1XLsbXNB#k#k#!kXZ3sbi[R3pf #:Gm  nn"nila< lIOuUqi_uIOuji_uIlum i|uIOswSj[sfsMst tt GMqjU}T~ LjU}Q1 LjU}Q1EL 4MjU} MjU~T  MkU~T Q<Ew;4MU}VB9Uk*idx;k%F$,k " k /k9gUk%gD9@k%@G%AFU$\C*l.$4Ivsbi&[R7D)p9Gl*sbi[RUkel\eMelBU %pl. ;. G?U(pl\nD.N.Z?D U|.pm.|D.|P?7DkU%kOm.<.7Uz0|m.zC?.zX/U Im. :N &m\bit &.. &B#9 m% !#*bit +% 9klo\p$x\q?x.RDDWnensnnnnn"n"n"n"7"nnoo"o72o"Ao"Po"_o"7"#p.#:.$.%.&.'.(%oUoUoUpUpU^p%pU"4pU"CpU"RpU"7U"lpWzpWpWpWpW7pW"pW"pW"pW"7W"q\p9ZDvret2q@qNq\qjq7zq"q"q"q"7""r*pAZ%T$$jret 8rj__p+$$7$CrRNrRYrRdrRorR7|rR"rR"rR"rR"7R"93!r%3< GV r*nr *% Fr;9"s*nr/%;"s@9 DOs*nr D3% DOrV ss*nr *% Fr9 s*nr /% ?"s9 s*nr 4% V"s$ 9 s*nr 4% V"s9 +t*nr % 8r7jc V UOt*nr U% U8rV Hst*nr H% H1rV 4t*nr 4% 4/r9֦t*nr֦/%֦@"sjp֨ns$֩/jval֪/V^u*v^Ou%^YVP,u*vPJu%PTVBOu*vBIu%BS9A!lu*ptrA28*bH++P,_X5 `6 d8 h: l; p< t=bx\se?O@3rt@QgdlAQBQF(T8IXBJ+KbO2TX7T]7T8`"N@dhbkb l+m nGT oLT(p&0q vXs`ubx dyShzp{VT+    S M#B(8XBP3mmhpJUx    +b b, b, b, b- b- b- b- b- b- b- b- b- b - b - b - b -"b -+ )3pid  +_ __(0@UPUX "V%(+ v- ]. ]3 ]45L6L: (=+0>+8A ]@D ]HG+PH+XKJ`8NAKTWWWZW^nXk [1mxXpA qB(t+8u+@3fsxXH{XP~XXX`=\h \p Ex E E I+ ba\ LbDI ]  ] 2 t! S B( _8 \@  vH \P L]X V]` ]h ]p +x ] kJ b  ]  ]  ] D 5  ]   I  I "] )2^    <^0   58  bX A^\ V^`  5h  `^      !b "b # $+ & ] ' ] ( ] 8)9 3j^ C# D+ Lo^ N+ R^ SI( TI, Y+0 ] 8 ^ < _ @ ` D 8a9H d6JX g^ iJ l^ w x z+ } ~^  ] ]  #  +b^^`oa b(b,T0grcu90%E@ D_HADPax%E v "b  bbv  ] >89 !"1$"18.9<b8F@@t+? !:key":?A+BC t=>v!!!&U0H / Q  ! "0 S  ( {#0 8 @ I!H I!H I!H XH I!H I!H I!H I!H.@MS ٿPhQQ U Zb 53kp_ b(b,U0 Z8@ABbD dH!Pgmemi@+ bz %(v0b8v@bHbLPbX`bhp xbb#bbb#v b!#"b%&9b:?AD +F P Qb(T#0e{f+ghuv:w:keyx{ UV Mjkeyknkeyo;z<!=!&? b &@ b$&A b(&B b+B2C+D+&E+ &E+(4sE+,4dplE+-4pE'+/&F+04avlF+44lF+54dF+64gF%+7&F++8 + + + + + pte2 "n pmd> "%%%b/%/]' pgd'V/'"]p pudpJ/p"/7A7 @HI+9brr0 4+8A.@@k1sp+es ds"$&+(+0{18+X+`cr2+h+p+x1+bI++ 31\fpu 0@b(  &.@@9>y@n}@0J; 97w Uw (,w0<zw8Xwh%xp+xGv vx&`^xLv+d + ++ 5val %@ %d   , +   +! %  8!   !qq  t!  Y! !!!t!!!! !!b!+,"L"fmt"Q"Q"Q"b"Q"Q$|#6m"#7#8 8#"#Q#Q#Q#Q=#b=#b=#4bkey#9L"(0b#=#   8#U{##Vmod#W{##XQ#Y# #Z (#[ ,#\"0/Q#u##v##w##xb#ybm"#+V#+ $/($$1bset$3get$5$7 y2#r &{# ۥ  !  ˜( ˜0}8!@" H# צP$ צX%`& h'"p( x)E*c+,-./ 0 1 2:3 ]5 |9 ; ֨>E?@-$ %!R&%% %+ %-%/ 0b3&           +&+  ;& & 0'cK''dQ'ef'g'i 'l m(&!( !( 0b)'  ()')'val) I)!I )"I)#])$' I)* ()+&4(),#a(*4(**  (+a(+zc+ :9()'()())j'').] )1()2()3)4 )5+)6+ (() ))%')/f()7(8)M))+fn) a)(\)\) )M)^-+^-+.).]end.]/;)4cs/=]4sl/?]4wfe/A]/Et*4ss/G]4sti/I]&/K]4nmi/M]&/P] &/S]0&/V]84lm/X]9&/]]:&/d]</*5cs/+5csx/]/)/*5ss/+5ssx/]/)/g+r15/m+r14/n+r13/o+r12/p+bp/q+ bx/r+(r11/u+0r10/v+8r9/w+@r8/x+Hax/y+Pcx/z+Xdx/{+`si/|+hdi/}+p/+xip/+t*/+sp/+*0 +0 0 +*p1,cwd1Iswd1Itwd1Ifip1I fcs1Ifoo1Ifos1I1,1IlI,++1*,rip1+]rdp1,]+1.,fip1/Ifcs10Ifoo11Ifos12I 1) -%,%,01@,-1A,-1B,-I<-+ _1$-cwd1%+swd1&+twd1'+fop1(+,15I16I19- 1<- 1>,-s -I-+I-+?1Q.cwd1RIswd1SItwd1TIfip1UI fcs1VIfoo1WIfos1XI1Z,1[l1\m1]n1^orm1_p1`q1a.x1bI+.+@1:/1; ]1< ]1= /])/+.@@1Of/<1P<-1Q.1Rf/@u/B+@1^/#1_,K1`<-#1a-K1b)/@#1c//}+.@@1f01hb1kb1n]1q]xfd1t]1wb1zb1b1b<1u/@@101 ]1b1b fpu@1.11b1+1.11.110 100<1/@@/2 [12 ]2]Vk1+z{1+11+1 13>13?+3@+3AIcpu3CI4814924<24=215<>25=b5> 5:y25;12src5A+ dst5A +~22v626Y!622 627 278! 7"2!8!8!8!8!!8%!8'!8,!8/2!83!85!89!8<!8A!8D!8H!8L!8Q!8U!8Y 9 !3(9,49b9 v9,49  984=4[4[4bv39#49$29% 9' `4!:;"4;#4;&4;'4;' 444<  5<  =)K5=*&=+t!osq=-4 =/:>ɰ:>ʰ:>˰?!5?" b ?&o5?D5?D5 ?D5?E5?E5 ?E5?T 6?Y5?Z 2 ?[5+@86@2@ V@R6`@%6 @g6986+A36A4IlenA4IA26%g6A6]A166A86Ai6AjAk64Ar#7AsAt4`Au9 AR7ATbAU5AV4AW8AX6 AY*;0A[/;8A_";`A`?hAa+pAbvx>AdR66AmAnCd_uAv6#7#7.x{*;| }~ L )Lb ! ?(JU0 v8+@H tL P {AX {A` {AhIpItIxI|2 9If++ ++ ݝ0@H P T X \s`h8[Tp8s=H P(!X+`5h vp8?;+' @A;A?A?A@AG@A[@ Ao@(A @0A @8A @@A @HA?APA]AXAvA`?;;.@? t+  (!i0!n8s@"H+P+X+`8hfp v&#$ãȣ4   Gv  b `(8` vI{A{A!I"&/ +0 14 ;6b< 5 BQ@D";HF9fPI&XL`O dRghSpZU}xaobogrcuc9dygf 5k08n2@@oHq2Xr`<0bA? ?8b?@@@76@B@@bQB@6$@[@@L@o@8`@@8t@@8*;@%@8%@ BE@BF8BG?BHBIAA A@AC:AmntC AC 8A@XAXA:ADA8vA8?bA DD AD {AD0bEA     FAF B AG #BG(H XBH H H IBI+IBIBXBI BI BIBIBIB JB>J XBJ !J CJB0bK 6C  @K'C>K(BK) ! K*C(K+U?U@UAUSIGUT #UUvUVv UYmGUZ #U[ U^GU_+U` Ua UJGULUQ UWGU\IGUbmG UEHUFvGUg%HUh_fdUiUmVHUnvUoUpb t U%HU*:FU2^F5_rtU9FUBFUdGUjHUq%H+0V HV V V V VH0V  IH VH IV HIV!V" E V%IV'EV(+V.EV0 E V3IsaV4HI W IW %W +lenW +W (XJX Y$6JY%7Y'Y( 0YDkJYM#IYP(YW)8Z JZ]Z]Z]Z]Z] Z#](Z,]0[)J[*][+BP[81K[91K[:bH[;bLJAK+ 8[DwK>[E9[F 5[Gb0 \>K\K\Z\p\\\end\KVKB+] Lval] ] K] )Lval]  ] LSnLU ]V ]Wt!?b[L    0hMi5jknLcpulbm]n] o]( VM+M+ IJ@@N ] ] ] I I+ +(+0b8.@O ] ] ] ] ]  ]( ]0 ]8 S@ ]H ]P SX S` ]h ]p ]x  ]  ]  ]  ] ] ] ] ] ] ] ] ] ].@QVM< XB! ](" ]0# ]8%@&P'Q(R)S, ]X- ]`. ]h/ ]p0 Sx1 ]3 ]6 7Q9Q;Q=+\avgGM@O  Q0KQLM+N+Ob P$Q&SQ(Q/]QQQQQJ`S<aXBh ]i ] j ](k ]0l ]8s S@t ]HubPbbbbbbbb<6CX<6Crq;SQSQ/^#S(S_7SQ~rq7SS6b 6b 6b6b]SSubSusITTSq T#T -T@SGT+&& QTJJU*;1f E@ D HBP+` +h)p+x 2f v[Tvpidp^7U^9 %E^:b^; 2^<8ino^=]^?J ^@@^B4HCrcu^C9`^DZpOUU+ _V_b_dU `ozW`p&uid`q Lgid`r )L `s L`t )L`u L`v )L`w L `x )L$`y b(`z0`{8`|@`}H`~P`X`nX``nXh`nXp`nXx` v``U}`I`9 VzWvkeyanXa%Ea;9ʂa semaf(aƃPa vX`a {Ahuida Lpgida )LtaGxa|a~a a+Xa˃W sX }X X X X_Xb^=\b_%Eb` babb bcbe4 bh_8bk I@bnXbq`bsdbt_hbwpbxbtbz6x=bb=bbbbbb>b6Cb !itb; b bJ bKh b  bU bLttyb` bj b 6 b] b ] b] b] b] b] b5L b+ b+ b+ b'+ b+  b+( b"+0 b,+8 b+@ b+H b"+P b,+X b+` b+h bkJp b bo b b b b b b b b b b 5 bf0Xa b\b2b%Eb4b B\ \ \c\c%c%\@dL]dd d ] d (d*d,d-d0\ Q]Xec]ed&ee eg ek 2em1en(eo0eqyg8[] ] I ] ] f2^fkfSf_] 7^Q^+ Q^ [^ e^+^+wK ^ ^YE^+ ^ ^a0d`dddd+ d,d.d10d@d(HdPdvXdr` d d+ d 5 d bLbdid  dh( d h dp d d Levd db db db d# db d2 d dx d dyg dgLcdid dLbbd dQ! d] d  d($(^ hgyoagzlg|bg}7n9mgOm(gAD0g+Xg#]0h?y8ta a b b b28bimbivivii bi!!i" +&i$bHi'ci(Qkeyi)i*ci+v i,v(i-v0i. c8exti/#c@8bmb i3 i8uctpi9uci: vi;Ii<Ib +: jdjIj jbj  j]j]inoj)] devj* t(j+ t,uidj, L0gidj- )L4j. 8j/A@j0APj1A`j2Apj3]j4]j5Ij6Ij7]j8]j9Ij:Ij;Ik+ek,t!k- l"Uel#Enidl&l-+l4+l7^ lR%flSCflUCflXlYlZ blc %E ldU(Crcule9HlgvXlj`idlmplptlqQxlr8luHf+9f9f>fUee%f&mhfm %En n"hfnfn2nlfnfxfnbnvv(o0go1&o7&osqo94o;t!o<:o:o:o:o:o p dgigtgtgyg pgp&ppXgXqqgqrygqsAD wqqvgHcpuqwP gaxrZhrarZhrjh(lenr&HrzhPrpgjh++zh+h+_@seiseiseis >s2@@s gHs!+s"+s#s$AD s%ygs&9  s'i0 s(+8Lcpus*@Lssps+%jH&ui+`s6is72s8jhs:jh(s;+Hs<iPs=Xs>\uise%jsfbsdasgxkshQ!si}kiaxsDhksEisFhksH sI 5(sJ2HsK 5PsL+psM+xsN+sO+sP+sQ+sR+sS+sTsU+sV 5sWU sY  s\+ s]+ s^g s_%jpixk+h*j!tuku.u.u"ku#:u$u%u'lu(u)u+*lu,u-u!Xlu&ku*ku.l ulkopsul*l llu2lu4+u6bu7b 0bg@l   0bgHm   gpJmgqlgrgsOm Jm+gxmglg+gm>g9g+Vgm%Tmxm @g7ngmg+g+g+ g (g,g7n0Crcug98ghnHmXlghngidgAnwnB+gngn n(vnvt!vSvv w wow]w& w)fldtw*|o8w.+@w9 5Hw:vhw;ppw= xwC+|wD!~ wox pxvx+altx+x+x+ x+(xy0x8x@xHxPxXx`xhxpxxxx x!op wFn+\p^ v`bXp5lruY%pdeiqj +k++(REqphJUps+ +(uqz+pp{q|+}+~& q+q++q]r vy]ry~refyV8yUHybhybly+popsy dxyvyIqV(Qr%q%Eq%q%q`9rb ] rval+/rMMrN vPbDJsulruK%rDWMf@K(XvYf(\wb+h+tAw }$M7w++WUw%wK9Dzw#8u#+u w\rbXB+v wbxc h jkq? s(tX0uv8w@{H~PXƲ`߲hpxwxsvvx]cid @@  y ] >y+ ^@@}9x@f@+P+X+`+h+ppgd  x) 5 ?}E+LbS Zt!]&_a2pfr+++++ +(+0+85@2D+H+P'+X3+`+h3brk+p!+x++%+0+!}1}@F}p+h2pP}x_U}Gv&_}++  wn&ygi}++&  yx+1}+3nA}+ A} K}c Z} d}+}}B+/ b7}p/~7~(pmd9 &0pud; ; 8@E7HF7PpteL !XptlPJ3`T *h?b~      @ bbbbb:z6:z9:z<:zG8yy+y2y2y+y+ y+(y0 U'{,j{- 2{/ E{0v10|3|4|6|7|8 xa|91  || |" |$2 @@|-lru|/|0& ^2Enr^3ns^4EAZ+iB+} val}] }i0b~     :L)L16+ 1 a  a alCrcuam9an%Eao +avax+ay )auŁ%5xa+(ar at+aaaQ   St aGava L!v\+ ahmnXnXGaʂa\keyanXaVaa`aXBa a {Aa {A+(aXa+a+aaa % (asaŁ% M aaa  D a#a!%s  S %En+0&8@uid LP&X `$!h`` %E`gid` )LB+V``rcu`9ЃS_@@LgÅLht!cpuLibLjbLkb &Llb&Lmb&Lnb&Lob&LpbLrbLsLtLubL{ ! L|C(L} !0L~C8>L҅@@ĄU!ȅhC@+I+?8b\b b! b"+b#]b#] b$+(b$+0b'b(]b)]b0b1 b2 b3 bCԆbDbLbM_bNԆ8bQ6bR bSԆbTU\K+U[+ [ e1E+  _ 04>9 ` @Crss 084@ X gfn y2arg vw+ bg w  IeSƈeTeUVeWeX`eY9 8eI'qeJioceK]9ƈ e\b0.dd vd dd&d+ db(db,d%E0db4d18dVHdI!XdQ!XdI!XdQ!Xd0Xd2`ddd`hd pdCx3devd(dx0d 4d:8dD@d 5H3idd hd+pdNxd dADdygd dXdd Dd!Td"d# 5d&0d(24d)8d*gHd-b3fqd2ld3d5 5d6 5d7 5d= d>20d@43tddDv88dF9@dK4PdP 5hdRdSdU8dV8dW8d[ 5d] '  val  .val  <FQQVi~n+v 8_`&ab&c &d Crcue9 reffQ0:~ v + %0 I     . `0  4I 45b67ʎ+  ŎԎ0p=qGvr s mt vu v+$(_ L  )L .Pb =_  AA(A8 GvHЏ()*+ ,0- 5@. 2`/ d0?h1Bp2 x3+4c  ِval 0b6   BEB5uidF L5gidG )LH ِDcJH       ( 0 {A8 {A@Hi+ b(b, 0 8v@ ![{#i@849M:M;M<M=a >a(?a0@8M?9aRz?zBfXD-EaFFG VHaIa Ja(KM0N o8O@QHSPF?2VKjj*;[*;ِt*;jxYZ[]\]]]^] _](`]0aS8cS@dHeLf]Pg]Xh]`iShjp85bbbb bbbino  9( 90`b`p+ bbb bbbbXMԗԗM (088@VHԗP?XAԗ?b?pٗ?B8?zQ?Q5=4r8  b f 0 ƘH3ops!֘ *;Ƙ+֘+[+Dw #}D# X83D4՚563 XvImώ]ښ  ћ(0 8 6@ OH _P ˜X`h p ?xX r7 ՚Gv՚uJUߚ JU՚!8DEGvFJUraGI +Jb Kb$L(M+0̛GvJUb̛f՚GvJUbb՚v֛-JU-6՚!O՚E;_՚Txώx}(+˜,-./  % dJU՚՚М՚ ՚:՚::%XJU՚DvvGv{ -]GvώxDݝ#i#bW#K9D(#!(# 8 &8*;-D|#^## %# b | .@Z[5\X]v^` bک(d0e8f4@hWHjPkXm`oϪhppr xsGu`vy{ɫ}-p    & 0(Gv 2pidUAuid LL $  +bb bb D 3# 5# ]W )sK*9#+1#,#-:/Pv.0ӡ  <ӡh+2d 8 8 ֬ ( 80 8M@H'PX'`Jhhp x  ѭ   d- x}    l_)* -+ -,`-.f /+(0 09 t4:JU8< @=2D> vH? vP@XA 5`BC E F 5HIK v>Q ͣ   !V;+VK+$/X]Q]b Kpos / bۥGv¥Gv%!GvQ?ώ?bD d}ddd x&Gv\Gv צGvb+Gv+ܦ *;Gv"Gv}EGv'cGvJGv h+Gv++++)b^GvbGv^b+Gv+f05  ]Gv?rrGvw bGvGvb֨GvGvbb ۨ?b85*;8bQS8*;S@:v*;]*;{8%ک*;88*;8ߩ*;84*;8QW*;89*;8t\*;8*;8bʪ8ʪXAIbcԪ8%=*;=]]B `*;L*;8Gvbe*;Gvɫ88Ϋ 8  -8  \mt f +kk*;2\?b   *;?*;֬*;¬*;۬??u'?@8@E ,h?%Or8m?%ѭ?Q*;֭?>f  &+8SQv5I!h+@@AQBC D Et(sdFr0GMf8=Ib=Jb=Kb=Lb=Mbhh*vbiob%  > (4J8 v@THP]X^` hhpr  t mx=B0byE     yNưyT ְyZye ְ7˰}}}۰ ]r++y+y:yy:~)IB+ydy~)%ưM(0vma1+2 E3 +4+5+ iD>#? #@ ++++ ?++++!}}X}bD}}v}++]++{++vQƲ+߲+`^˲`^++#7++idrQ1bb +Brev+ r r  rQCrbXBnsy0b8< >@id]` vhŵpCrcu9x ops! rh~ "˶$ %  & (( :02 89@: :H= SP@lXA `~  5dirQw knrGvr v 5  5@`h %x    @  A %xʵ˶rvvrжvrvrv:%\S?l+Xq0b  0'() ,* +6,@ - y2(Uvy,,1 Uy;'m'Q' 'm'n/'o&9X'0*'1E'2 '3 v'4 '5 ޹('7 0'9 ޹8'; @'= 3H'?VP4C*>a aEH >k >aUJU޹Gv 4% Gv >%3Gv >VGv >+8'' ' Ǻ[ a%Ǻ aQ` 2h X̺0tou vw!x*yŻ z ߻(o yK'yŻ߻ʻa }6~6F LbufV  %F+%V+?Vg}+μgQɼɼӼ  .Կh@pHQPRXbus`h vp vx 5a<F 3msi(8@]H]PX `hx   t3idI2 !!# s$)%3'#8)7+ `, a- b. c/ d9 e< f +v>v BDEFGHjIv> 7!b"b  +A CK :%@%NSO+PQ  * : . Iff_     4Q4($E$FQmod$G{#ops$H!w$I 5$J $K 9 %4$L5arg$M v5str$N5arr$Or$V$Wb$X% $\mmax$^b$_bnum$`ops$a!w$bvm($ 0(>)hXB+ + b  V+7`-i.hmod/{#@0 Hmp1nP2VX i856E7 9 ; * <>(= N0%sQ*{#Q>{#/N{#C?b>}   J8EmodF{#<G|JPpqvrvstb\mtnw} F Fb%% KPD9hz+&  (c%j4c  ! vEv vvH 2 fv (40  MN -PbRb Tb(2+++++ 0gCrcu192Mf3gvB+ HIJK LM+Nn} 2:; <Oc  s!c"c#c $c(%c0&c8'c@(cH)cP*cX+c`,ch-cp.cx/c0c1c2c3c4c5ccTsh?U   ?bl    Hx<y 2zb|b} 5~0A@ <.86  6 !6 "6 #6 $6 %6 &6 '6 (6 )I2 U @ @ A B C D E<6CP]yg4  b                bxx]]]]  (3qos0+,Qid-./2 0(1AD02+X3 !`4 !h5 !p6 !x7 !8+9+:+;+<+dev==> =?  : 9opsc Ic s sbI9bbNMxNQOQP!Q!R! T(U0Vc8W s@X sHY sP[cX\c`^h_cpacxccd spmfhg`aQbusbd{#eQg hW$j(k0mc8n s@ocHp sPqXrc`s!ht!ppmvxw spy}ԿOx`23Q5!6!89 ; (< s0>c8@(@AHC PpmEX%y0XMYQZ![\ ^ s pm`(M0b-z   z  % bb+?b7   ?ba   8  0!"" ?b1      ?bB=  ?bOa  cd&e2f4=g lidh v  ] ~cma    $ .a! Va% a dCdD DdI TdNhdShkedAdB;dCd% `]  bJ bJ O Y crcn=cocpbcu#Vcw cx `cz c{ c~b8c2<c\@cygPcgpcxrQB+ Q@jklenlwpmnopqrs t(+ +0dm3   dtdudv dwdxdydz d} bdd dd d d> d>(dW0d 8dz@dHd Pd Xd`d hdpd{#xdd /    Hd$dhd @dbDd&H/d  b/d] bdhdi)dj6dk+dl+dnbdobdpb dqb$drb(dsb,dtb0dub4dvb8dwb<dxb@dybDdzbHd{bLd|bPd}bTd~bXdb\db`dbddbhdbldbpdbtdbxdb|dbdbdbddddbdbdbdbd3/dbv[Pddhd -@d -HB+   ! + 5 ? I S ] g q {dd0d0?bd   V%?b ``>b+ bW`bCppu \+`-bv%``D!  /`D4TIhYx?m|IK 8M 878 D9 D: D; < > 8? PA PB D C D$D D(E D,Fg0Gg@H DPu1N }TO 8VP 8XQZR[S D\T P`UhVi+  Kb*G    45 86 87+ & ] ' ] ) I8 ] ^ _*; b cref d %E( e%0 <W > @b Bb Cb H F G  Hf Jb@ KD O Q+ S+( Vref W %E X Y Z%    hD i"D ja muopt n q r 5  u1@ wbP x+T {*;Xlz4 }` Gvh *;p ux  ] ] I I I I  "z b +   I I ]   ] . . I I  h UP p x  % %W  JU Gv 7 vb a   0 sb ?in }out }bb algb$()%*gfpE,(! +% ?v}^L*^M*GG^O+;HQrqR!SbSb noTniT VbWbWb kinYD!(Y D!0Zv8[@@rq!bb bGP+L$@ i zziyX v?zi z?X bX vbi vX$9Q%X@dQ%jh hv}bYh yb Y->vvX 7}EWUY;Y=&j:j<Y%]JQY c?Qvy8j9'5(i)Zsb,?ZdsbJ(sbibufb(algb(ret O(dec&G vE E F ,rUvT|QRUvTQ~,U~,JUvT Qs;U~E5! F1   ( 4F@LX;U1,U|Tv,hU|,JT GIv kv<ZdstvIfZsrcwfkw%}(rqy!(sbz?(pgo{}{7(j|bH Hcb+lHHH IIHJH<'c      GE P; LE   ;U~Q0E~I  1jp v F1> @; L1?7 @; LQQG1 @; L1 @; L1 Y  ;U~Q0E~  ,JT ;JT X;Zrq;Ck<}>i@i(bsBi(curCb(niCb(noC b(piC$b(poC(bC,b(cntC2b(kinDD!OGK bK blK OOOOOOHOOOO%O'OcO      GUO[ +[ bl[ OOe be +le OgggggHg ggg-g'gcg      ;Qp1_  @; L1qk }   FR1 @; L[Rc      Q^E" iS.1M & @; LEqR }SS 1 @; L[wRc      ;Q Q^"P .T ZrqBk}ctx$b(dstv(ret251;)  L1 3  *F6AMYeq}d  @; L[RNS. dd w       # F/ : F R \ g s  [  [ E  [ 8     w #R P      ;Q}Qp P P; LQ dS  F'(,lCUT}Q GdQ Gd w.N $ 1 >;U~}"T0N YS,|UsTv",9T~,JT Q}Xv,T~,U|;U|, vSS FR'(,lfU}TsQ Gd1  @; L,{ U,U~TG- $ctxJ$dstD!2rq!!b2outD! D!2srcD!2ret bbe'< rq9xIQxbfQ@   F;cUvT0Q Q -|v{ $ctx|L"} v$out}v"}+"~ "~2rq!bb2ib2in}2srcv2tmpv e e e'b bbp 'R '''eA ctxALxB}mrqD!E~FD~fHbfJvmiKbmjKbmtopKbOfO<fP7Nm]  y P-  d;d SLN?V  P [P  !@. ? JFRVNmS  P  N;` LN~u  ;U~Q1G7+- e$sb8?$dsb""-v"72sbi2lz4e +G ](i(err   n 7) :}Tgfp JEn v5) 4}) Hb 'yp  v- S$sbi - q$sbi oj)07)=)QTlen yto%^'>'''o:Tto:/7):@7<%yvto<%B'CA"/y-v"27oG"TdstG67TsrcGH7A 3;" 337nvZ)EZn=~)=Zo)27)F+zvTp;~TcB)L!0'A*Q*a*q*'*z#)#:)$)%)&)')(UU UU(Uz=U*MU*]U*mU*'U*WWWWW'W*W*W*W*'W*z):))Zix'****'*- A!$ptr AU.    T M C(6@CP2mmhp2Vx    .e e, e, e, e- e- e- e- e- e- e- e- e- e - e - e - e -"e -.)2pid  . (0@VPVX "W%(+ j- Z. Z3 Z4M6M: t(=.0>.8A Z@D ZHG.PH.XKK`6N)LTgXWgXZgX^VYk 1m`YpB qB(t.8u.@2fsxjYH{tYP~~YXY`%]h l]p Fx F FJ. eUv] LeEJ Z  Z 23 h" T C( 8 ]@  jH ]P 4^X >^` ^h ^p .x ^ SK e  Z  Z  Z E 6  ^   F  F "^ )_    $_0  58  eX )_\ >_` 5h  H_      !e "e # $. & Z ' Z ( Z 6)- 3R_ C$ D. LW_ N. Rg_ SF( TF, Y.0 ] 8 ^ < _ @ ` D 6a-H dKX gq_ iJ l{_ w x z. } ~_  Z Z  $ t t.e__aWb e(e,T0brcu-0 F@ DH)EPbx F j "b bbj  Z >6- !"`2$"`26.-<c6Fr@@@.pad!.?@&@ :!7key"7?hA.BCmodq$h=>j:!!Sj,!T$H # T    " ;  ( q$0 ̢8 @ ="H ="H ="H @H ="H ="H ="H ="H-@AKPhTTM Re52kpW e(e,M0 R8@ABeD \HPbmema@. erw (j0e8j@eHeLPeX`ehp xeev$eee$j e!$"e%&9e:?AD F tP Qe(T{$0eof.ghuv7w7keyxo UV tAjkeyknkeyo;n<=#? e #@ e$#A e(#B e+B&C(D(#E( #E((3sE(,3dplE(-3pE'(/#F(03avlF(43lF(53dF(63gF%(7#F+(8 . . . . . ypte& "b pmd2 "%%%V,%/S' pgd'J,'"Sp pudp>,p",+0 @ Hr I.7Jsss0 t4 .8-@@!!1sp!.es! ds!"!$!&!.(!.0!18!.X!.`cr2!.h!.p!.x!2!.!e!F!.!.! 1\fpu! 81@e(" " H'-@@  7&z@ V~@y$ J /!7x   =x  ( , x08 bx8 X xh %yp .x /w  j y i' H_ y 4w&#X!##&#|!#(#(#!.val# t4!X!#!|! #,!&$!$$!!.$ "$ t!$ ,"!$! $ "k%k% &h"&! &M" '"'h"''' ''e'.,(@#fmt(T(T(T(e(T(T$)6c#)7)8 8)#)T)T)T)T=)e=)e=)4ekey)9@#(/e)=$   8)Uq$)Vmod)Wq$)XT)Yv$ )Z ()[ ,)\#0#T)u$)v$)w$)xe)yec#$.Y$. */%*1eset*3get*5*7 2$l'q$ æ   ( 0e8!~@" H# P$ X%ا`&h' p(x)-*K+s,-.s/ Ȩ0 1 }2"3 E5 d9 ; >-?@#% +!H'+% ++ +-+/ .X'. " ;X' , 0-c'-dT-eN-gl-i -l U(u'UeUt!/ !/ /e0$(  (0|(0|(val0 F0!F 0"F0#Z0$|( F0*(0+&(0,#(1(11 (2(2bd2 7(0'4)0(0)((0.Z 01)02)0304 05.06. )(0)0%$(0/(074)80)0.fn0 ))))))3%*3Zend3Z4;[*3cs4=Z3sl4?Z3wfe4AZ4E*3ss4GZ3sti4IZ#4KZ3nmi4MZ#4PZ #4SZ0#4VZ83lm4XZ9#4]Z:#4dZ<4 +.cs4(.csx4Z4%*4M+.ss4(.ssx4Z4[*4gS,r154m.r144n.r134o.r124p.bp4q. bx4r.(r114u.0r104v.8r94w.@r84x.Hax4y.Pcx4z.Xdx4{.`si4|.hdi4}.p4.xip4.*4.sp4. +5 {,5 5 {,M+p6-cwd6Fswd6Ftwd6Ffip6F fcs6Ffoo6Ffos6F6-6FlF-.&6*7-rip6+Zrdp6,Z&6.u-fip6/Ffcs60Ffoo61Ffos62F 6)--7-06@-6A-6B-F-. V6$M.cwd6%(swd6&(twd6'(fop6((u-65F66F69M. 6<]. 6>-m-F]..Fm..?6QJ/cwd6RFswd6SFtwd6TFfip6UF fcs6VFfoo6WFfos6XF6Z-6[l6\m6]n6^orm6_p6`q6aJ/x6bFS,_/.@6:/6; Z6< Z6= /Z/.-@@6O/86P-6Q_/6R/@/E.@6^I06_,K6`-6am.K6b/@6cI0Z0u.-@@6f06he6ke6nZ6qZxfd6tZ6we6ze6e6e86/@@6816 Z6e6e fpu@616e6.616160 60086Z0@@Z07 17 Z7ZY1.n1. 2 2.2 28>`28?.8@.8AFcpu8CF98{29929<29=2{2:<2:=e:> t::2:;{22src:A( dst:A (23j;3;M";233 ;3< U3<," <">3!=!=!=!=!!=%!='!=,!=/23!=3!=5!=9!=<!=A!=D!=H!=L!=Q!=U!=Y > !i4(>4>e> j>4>  >4444eji4>#5>$23>% >' 4 H5 $  .  T5h5h55!?@"5@#5@&5@'5@' 555A 5A t B)$6B*i'B+h"osqB-5 B/0Cɩ0Cʩ0C˩D!c6D" e D&H6DD6DDc6 DDo6DE6DEc6 DE6DT 6DY6DZ 23 D[6&E7E23E WE+7]E6 E@777&F3d7F4FlenF4FF27@7F6ZF17d7F87Fi7FjFk75Fr7FsFt5]Fu- FR8FTeFU6FV5FW8FX7 FY<0F[<8F_"<`F`@hFa.pFbjx>Fd+77FmFnFd_uFv777-x{<| y}~ L Me ss! @(2V0 j8.@H mL P cBX cB` cBhFpFtFxF|23 -Fg..(( Ş0@H tP tT tX t\m`h6CUp8m%H P( X`h jp88<"<.' @F<F@F@FAF/AFCA FWA(F gA0F gA8F |A@F AHF'BPFEBXF^B`"<<-@@ m.  ̢(!Q0!V8[@"jH.P.X.`8hgp tj&y#$z5   /w  e H(6r` jFcBcB!F"/ 0 t14 #6e<5 BT@D"<HF!gPIi'XL`O dRhhSpZ=~xaWbWbrcuc-dahf5k06n23@@oHq23Xr`<@/eF@ @8e@@@A87@*A@eT*A7 ACA@4AWA8HAgA8\A|A8<lAA8A GEAGF8GG@GHGI׍AAAAAH"BmntH AH 8AA@B@B"B,B8^B8@JB II BI cBI/eJB     KBK B BL  CL(M @CM M M NuCN.NuCNuC@CN CN uCNCNzCNuC OC>O @CO O DOC/eP D  @P'D>P(CP)  P*D(P+$E0P,8P-9P.:P/;DDDDD @@Q/$EQ0Q1eQ2  seqQ36Q4DQ5C Q60Q7 8D(RkER R.R {ERF vEvE)EkESESS tSE ET ETE.E. T8EU FU t UEV+AFV,V-xWFWFWe`W.hmaxW.p.F. X FsigXE XF YR| YSFF YU$ YVFFnZGZ Z j Z FZ'FGZ(Z)Z-GZ.Z/Z0 GZ1Z5GZ6Z7Z8 G Z<HZ=Z>Z?Z@ZAZS1HZT $ZUjZVj ZYUHZZ $Z[ Z^HZ_.Z` Za ZJHZLZQ ZWHZ\1HZbUH ZEHZFjHZg IZh_fdZiZm>IZnjZoZpe n Z%IZ*"GZ2FG._rtZ9GZBGZdHZjHZq I&0[ I[ [ [ [ >I0[ II [I I[ 0J[![" F [%rJ['F[(.[.F[0 F [3Jsa[40J \ J\ \ .len\ .\ (]J] ^$K^%+^'^( 0^DSK^M#J^P(^W)8_ K_Z_Z_Z_Z_Z _#Z(_,Z0`)K`*Z`+CP`8L`9L`:eH`;eLK)L. 8`D_L>`E-`F5`Ge0 a>LaKaZapaaaendaLYLE.b Lvalb b Lb Mvalb  b LSVMU ZV ZWh"?e[M    0hMic6jkVMcpulemZnZ oZ( >N.iN. FJ@@N Z Z Z F F. .(.0e8-@P Z Z Z Z Z  Z( Z0 Z8 P@ ZH ZP PX P` Zh Zp Zx  Z  Z  Z  Z Z Z Z Z Z Z Z Z Z-@Q>N8 @C! Z(" Z0# Z8%@&P'Q(R)S, ZX- Z`. Zh/ Zp0 Px1 Z3 Z6 7Q9Q;Q=.\avgGiN@P Q0KpRLM.N.Oe P$Q&SpR(Q,]RRRRRJ`S8a@Ch Zi Z j Z(k Z0l Z8s P@t ZHuePeeeeeeee8DX8Drq#TuRSR,^ TTTRvrqTsT4e 4e 4e4eSTTobsTosFTTTk U U U(T/U.d'X' 9UJ2V<g 9@ tD tHCP.` .h)p.x 23g jCUppidpc7Vc9 Fc:ec; 23c<8inoc=Zc?2 c@@cB5HFrcucC-`cDBp7VV. dWdedeV eobXepi'uideq Lgider M es Let Meu Lev Mew L ex M$ey e(ezh0e{h8e|h@e}hHe~hPeXeVY`eVYheVYpeVYxe jee=~eJe7WbXpkeyfVYf Ff#7f semfg(fPf jXӃ`f cBhuidf Lpgidf Mtf/xf|f~f f.@flX [Y eY oY yY YVXg^%]g_ Fg` tgagb gcge5 gh8gkJ@gnXgq`gsdgthgwpgxetgzx=ge=gegegg>gDg itg# g gK g3h g t gV gLttygH gR g 6 gZ g Z gZ gZ gZ gZ gM g. g. g. g'. g.  g.( g".0 g,.8 g.@ g.H g".P g,.X g.` g.h gSKp g gW gۆ gl g e gv g g g g g5 gg0Y^ gl]g23g Fg5gˆ *] q] {]h]h h ]@i4^ii i Z i (i*i,i-i0] 9^Xjc^jdi'je tjg jk 23jmjn͍(jo0jqah8C^ ^I ^ ^ k_kck;kG^ _9_. 9_ C_ M_.g_._L l_ v_AF_. _ _^0iaiiii i,i.i0i@i(HiȍPijXi` i i. i5 i eLbdii  iP( ih ip i i tLevi ie ie ie i$ ie i23 i i` i iah ihLcdii iLbbi iE" iZ i  i(L(_ hlyWblzml|el}o7nl7n(l)E0l.Xl#$o`a@m4bm5bm6 jm7.m8.m9r~ m;e(m=e,m>Q0m?m8\b b b b c5 cnUcnjnjnn cn!n" #n$eHn'dn(Tkeyn)n*dn+j n,j(n-j0n. d8extn/ d@ cUc n3 n8]dtpn9]dn: jn;Fn<Fc 27 oeoFo yoeo  oZoZinoo)Z devo* m(o+ m,uido, L0gido- M4o. 8o/oB@o0oBPo1oB`o2oBpo3Zo4Zo5Fo6Fo7Zo8Zo9Fo:Fo;Fp+ep,h"p- q"=fq#9nidq&q-.q4.q7_ qR gqS+gqU+gqXqYqZ eqc F qdV(Frcuqe-HqgjXqj`idqmpqptqqTxqr8qu0g.!g!g&g=fe gi'rPgr Fws s"Pgsgs23sTgsg`gsesjj(t0ht1i't7i'osqt95t;h"t<0t0t0t0t0t u LhQh\h\hah uhui'uu@hXvqhvrahvs)E wqvvhHcpuvwP hUxwBiwUwBiwRi(lenwi'HwbiPwphRi..bi.ri.V@xMjxMjxMjx >x23@@x hHx!.x".x#x$)E x%ahx&-  x'j0 x(.8Lcpux*@Lsspx+ kHi']j.`x6jx723x8Rix:Ri(x;.Hx<jPx=Xx>\]jxe kxfesdaxg`lxhE"xielj^xxDPlxEjxFPlxH xI5(xJ23HxK5PxL.pxM.xxN.xO.xP.xQ.xR.xS.xTxU.xV5xWV xY t x\. x]. x^h x_ kpj`l.rik!yzlzO/zO/z"lz#7z$z%z'lz(z)z+mz,z-z!@mz&lz*lz.l zgmwlopszqmm gmlmz2mz4.z6ez7e /el@m   /elHm   lp2nlqmlrls7n 2n&l`nlvml.ln>l-l.Wln8~VH~Jh~el~.pops~ Lx~j~1rW( Qssq-rrr] - s e tS  sval ., s@ Ms N j Pe9 Jsolru Ks9 W$t X j Ys@@ Gt I.s U2V V . s( [ t0 \ t4 ^.8X@ Ft$tK j0@( mu n. o. q t r t s t t t ve X@ l8utK z0@0 }u ~. .  j  j  j   j(@ u . . X@ |u8uuK 0J Dv7t7u@7u, .vJ /w H 23 E  2V j <(e0e4gX8A@P p  jx#[$ % '`7%v 5Qwctx 6Vw Qw =w >5g @L( Xw Yg( \w b. h. tD w  }$@ x . .X =xwK -9 bx  v v  x\rb @C .w xbyc ײh ײjkq' sұ(t@0u^8wr@{ұH~ұPX`dzhpxxy[ww y Zcid   @@ y  tS &z  . _@@ ~7y@ g@ .P .X .` .h .ppgd   x ) t 5 t ?~ E. Le S t Zh" ]i' _ a23 pg r  . . . .  .  .( .0 .8 c6@ 23D .H .P '.X 3.` .h2brk .p !.x . . %. 0.  ~ ~@ .~ xq .h 23p 8~x  =~ /w &G~ . .   t  t _o i' ah Q~ . . i' yy.~.3o)~. )~ 3~nd B~ L~.e~E.,  e+|~p/7(pmd9  0pud; /!8@E+HF+PpteL  XptlP3`T h?e l      @ _____06090<0G8~~.~5~5~.~. ~.(~0 T,R- 23/ 90j034678 xa9  ڀ " $23 @@-lru/0i' ڀc2-nrc3nsc4-BB.QE. hvalZ Q/e    ց 0LM.  f f  flpFrcufm-fn Ffo &fvfx(fy fup.xf.(frft.fffT ;n f/fjf 4 jD. fPUsVYsxVY/ffDkeyfVYfWfӃf]f@Cff cBf cB&(f@f.f.fff  (f[f@ fff 9 ff [  }; Fo.0i'8@uid LPi'X t`$t"hepe Fegide pME.Weercue-;V@@QgQhh"cpuQieQjeQke #Qle#Qme#Qne#Qoe#QpeQreQsQtQueQ{  Q|D(Q} 0Q~D8>Q@@TcD@ˆ.rJۆ.?8gDg g! g".g#Zg#Z g$.(g$.0g'lg(Zg)Zg0g1 g2 g3 gCgDlgLgMgN8gQgR tgSgTVD3.VC. C MFg. g q 0و5>- ` (Frss 0{85@ tX Ofn 2arg j_. tbO _  FjSjTjUWjWωjX]jY- 8jIqjJȍiocjK^7 j\e0-iȍi ji5iDiNi. ie(ie,i F0ie4i8i>Hi="XiE"Xi="XiE"XiXXi23`idiahipikx2devi(i0i t4ib8il@i5H2idi hi.pivxii)Eiahi tiii Ei!|i"i#5i&0i(234i)8i*hHi-2fqi2i3i55i65i75i= i>230i@42tdiD86iF-@iK5PiP5hiRiSiU8iV8iW8i[5i] ω ҍ val ܍ val  <.99>ifn.v֎ 8_ю`i'aюbю#c #d Frcue- reff90"f v . %ێ/ 1     . H0  41 45e67.  0p%q/wr s Ut ju v($Ι(G L i M Pe y%G  oBoB(oB8 /wHЕ()*+ ,0-5@. 23`/ td0@h1*p2 x3.4K  val /e6   BE*.uidF L.gidG MH DKJ͑HΒ      ( 0 cB8 cB@HQ. e(e, 0 8j@ !Cq$Q@895:5;5<5=I >I(?I0@g85@!I:b@b*NXDEIF.G >HIII JI(K50N W8Ou@QHSgPl.@>3RR<Cp<p\<RzxYZ[Z\Z]Z^Z _Z(`Z0aP8cP@dHeLfZPgZXhZ`iPhjp8eeee eeeino  -( -0HeHX. חeee eeeeX55 ߘ(0 8@>HPח@@B@eژ@ژX@* @b9@9%l8  e g 0 H2ops! <.Β.CΙ.9w}, @83,456]4@j1UE›ۛ  (0 8 @ 7H GP X֝`h p 'x@m }Z+ /wuۛ2VǛ2V 8DE/wF2VraGI .Je Ke$L(M.0/w2Veg/w2Veej!2V! 79#G<``e(+,-./  L֝2Vt۝""" @2V,^^/whc !E}/wr`9ŞleXK-9! ' <9dq_i  e d n-@Z[\@]^^|` bª(d0e8f@h?HjPkgXm`ohppr xs/uHvpy{}ԬXx     (/w U3pidVBuid LL $  .ee ee 9 5 ZX )[K*-+{2,-",Pj-0  8cو̢.&L    ҭ( 0 85@HPX`2hPp xiiii  Ү   ѢL `e ot~   TV)* !+ !,a-ȍ. /.(0 t09 m4:2V8< t@=23D> jH? jP@XA5`BCE tF5H IK j>Q    Y#.Y3.$,@EmmTZer 3pos , eæ/w/wȦ /wT''e, ieiii ~/wmjU/w /we.ا/w ħ</wݧ /we-/wK/w2i/win P./w....xcȨq_/we/wq_eͨ/wg E/w'ZZ/w_ J/w/wei/w/weששeܩ éש'e8<8eT;8<;("^׍<Es|<c8ª׍<8y8<8Ǫ<8׍<8T?׍<8y!g׍<8ymD׍<8<8el׍8i߫׍@B߫Fesd8%<%ZZ* H<4p<8/weyM׍</wyus׍8Ԭ׍8s׍8 ٬8 Dmt g .SS<D?e   <@<<ҭ<í@׭@]@(8(- P@7iZ8U@n@Tͮͮ<@&g׮  8;̢Tj="P.@@ATBCD E\(sdFZ0G5g8=Ie=Je=Ke=Le=MePPpbioJ  8 t> P4r8 j@|HPZX` hpr  tt xej/e~Ey     ~N~T ~Zұ~ey+e~ұw~ñEs..ױw~&~"~~")1E.~L~)@(0vma1 2 93 .4.5. Q9>̲? y@ ײ ̲ .ܲ ' ... e~@w~e,e~^w~..E.r c .jwT dz H_H_ .$̳+ .idr9ee {.zCrev. {Z Z t tZTFrb@Cnsm0e8< y>z@idZ` jhpFrcu-x opsk!u Zhf "$ ̷% & (( "02 89@: "H= ;P@TXA r`f p .dir9_ vknZ/wZ j5 5@`h x    @  A %yvZjj̷ZjZjѷZj"U;'T @rY/e  0'(w) * +,( - 2(Tjm Tm#-U-T- y-mw-n-o&!X-0-1--2 -3 j-4 -5 ƺ(-7 0-9 ƺ8-; @-= H-?>Pww+&yII-0yl&S&qIT2Vƺ/w/w&˺/w&>/w&  -n- - CIsIT` 23P ޽X0tWu lvqw!vx*y z Ǽ(Wlan{'mǼ^ }~. Lbuf>  ..>.?YOu.ٽOTϽϽ̼Խ -P@pHTPzXbus`h jp jx58n 2msi(8 @ZHZPX `h)x 3=G m2idF23 !!v# $Q%['#`)_+ `, a- b. c/ d9 e< f.j&j B}D}EFGHRIj& +!e"e  &A+K : @N;O.PQ  * 7 . Fc.kkG      ,T,(*E*FTmod*Gq$ops*H!o*I 2*J *K 1,*L.arg*M j.str*N.arr*Oj*V *We*X  *\emax*^e*_enum*`ops*a!o*bje% 0(>)c@C. . e  Y.7`-a.Pmod/q$@0Hmp1fP2WX a856-7 9 ; " <6(= F0k T"q$T6q$'Fq$;?e>u   J8EmodFq$8GtJPpqjrjste\mtnwu > >e CHA1cr.' | d kd TT."  j!9j -=jjH 23 gj (50! = M N !PeRe Te(Z..... 0Frcu1-25g3 E. HIJK LM.NV~ Z:; <w  !"# $(%0&8'@(H)P*X+`,h-p.x/012345&|?U   ?el    Hxdy 23ze|e}5~0i@ d-84  4 !4 "4 #4 $4 %4 &4 '4 (4 )F23 V @ @ A B C D E8DPZah5 t te                eZZZZ  (2qos0+,Tid-./23 0(1)E02.X3 `4 h5 p6 x7 8.9.:.;.<.dev==> =?  7 aops& q  qaevMNTOTP!vQ!vR!v T(U0V8W @X HY P[X\`^h_paxcd pmfh`aTbusbdq$eTg h$j(k0m8n @oHp PqXr`s!vht!vppmvxw pyϽw`23T5!v6!v89 ; (< 0>8@(@AHC PpmEX ym0XuYTZ!v[\ ^ pm`(u/e-     5ee.?e_   ?e   8 50! " ?e1A      ?eBe  ?eO  cd&e2Af4eg lidh   Z vcma$ . 8 B L V! ~  iCiD liI |iNiSeiA iB#iC% `8Z  er Der w  lhnehohpehu#~hw hx `hz h{ h~e8h23<h]@hahPhhphxyE. y@jklenlwpmnopqrs t"(".2./im[   itiuiv2iwixiyiz i} eii ii3i Cif if(i0i C8i@iHi CPi Xi`i hi/piq$xi>i W  =  HiLiPi @ieDi&!H,i  e,i] eihiiQij^ik.il.ineioeipe iqe$ire(ise,ite0iue4ive8iwe<ixe@iyeDizeHi{eLi|ePi}eTi~eXie\ie`iediehieliepietiexie|ieieieiiiieieieiei[,iejPi!iPi !@i !H0E. 0 :? I S ] g q {    iiXiX?ei   ~ 'e3aCa8fe.Heaek .a!eja/a8" 49WahCl\|q'PbBcZd eZf(g(h i(j j0k j8l @mZH| 9 WG|eа<pos lenZP e (xj9<eR<RB>\<e<eteb     @  Lqe*k    @hi 1k 19eg =kdn 1syqe    ? = ?1O. 1 1 & Z ' Z ) F8] ^_<bcrefd F(e0<T>@eBeCe HFG HgJe@KDOQ(S((VrefW FXYZ   hAi"Aj^mroptnqr5 u@wePx(T{<Xlz4}`/wh<prxZZFFFF"we(FFZZO/O/ F F  P VP p  x   T/e͙  2V/w+j@   @)9F@ S.)9  FVCnid.eee (88HHLbufMO O(PZ0PZ8R@SYBTeDqea   0f0/U U cU U c8  <map lcn . ( $(0C(. d ,j<ex==yY$ Ed1 h5d $eH5x=y@Tj=@|d !j<ee)A5<ACA A!eAA(Dret`mapC~%)U~T~Q1%U~ftA+<gmapKA DviDerr'B!jG9   h[aY 1j v)YZH  M] 01=M: 1*  1*  1+:7C7:$H 8:M CZ01=ZINrZ;TvQsR}*  MC:G    haY 1j v)YZH  M] 01=M: 1*  1*  1+:7C ::H :M CZ!Q(Z4*9rE;TvQsR}X|*  MC:%Uv;IUvTsQ}e/HDA/2<+vi1Dsb2@Derr3N3 Dpos4`buf5~Dh6Diii'B1!jzo`mapyC~%I4UsT~Q4%MU~;U|T ;`mapC~%IUsT|Q4;U|G8d  a  aD$ U `Q+A   HfYH+  < G*m H ~ C :;U}T>R QE]  *  *D$ U `GH .);QJ Q]g nQT ` k*   G  Q(q  *    * X  ;BU}T>%U~T|R1%U~%U|T %U|T %6U|T feA0<gmapA(DviNN`m7DerrNeNeN%eN.DofsDendi*'B!jG, 1I >)Vbn{YY%IYU~T~%U~T Q~;U~T Q~G   )Yh,-:%InU~TQ0;U~T R;U~T Q{$ G%  ) %IU~TQ1;T R%IU~T|%Q0%IU~T|%Q0%<T R|%,TU|%sT %T fO 'RmK'B<+vi+mapBe+lcnZBZ+err"Bj7O7 Rm7I'[8e+sb:@+vi;+map<!B=l+lcn>.+err?outw{z"B;!jO IRm@'[e+sb@+viBl{0',B!j"+lcn.+erregmH'glcneA zN jG    ) !-Y9P .);P{ Pc  t ~  )U #Hw h?8 @LrXP     )*F CP     ):*F CP k     ):*F Cdy 1u111 ):aW    ):*F CHx  Pn     )*F C;QR1TU' 8 B)NZeq|PW .);H# ;QvR1$ cmF'lcn. <(viee%ee(posout'T!j"(__xe$d dmd?'eeposff(vihilje(lojejej!ej-ej3ek(inl8"l (im'?h!j"~ e~ e"s~ $M M3eNeOeinO!8"iO)(loQe(d1QeR$Ce'C7einD 8"posDeD%8"(vFl(loGl$ mC'lcn. <(vi(pos(di! e"!jO<  <map  eret ' '  " m'h " d j'P d"s "|j " '   " " <  <map  e' ' " m'} " d j'e d"s "|j " '   " " $Fp2m'  x =O$X[$4<+sbi&X"B)jF${sbiXOe[<<}&Rbit&.[&B$$!$bit+9eO[Rcpu[5eO8KRcpu8[86$%eicpu@e<cpu8%*bH%++P%,.X%5 `%6 d%8 h%: l%; p%< t%=bxqse%?r]@Hrt%@^}dl%Aq_%Bl_%FaP%IO%J+%Kb%Oa%Xa%]aP%`"[@%d%hb%kb %l+%m %n b %ob(%p10%q X%s`%ub%x d%yah%zp%{b%+%%% %% %% % %a%%% %Z%%SO(P%OPHmm%'h%'p% cx% % % % %+%b&% b,&% b,&% b,&% b-&% b-&% b-&% b-&% b-&% b-&% b-&% b-&% b-&% b -&% b -&% b -&% b -&%"b -%+%4Hpid% % %+%.% .%%%.(%0%@%cP%cX% %"c%%$%($%+ %- l%. l%3 l%4Y%6\Z%: (%=+0%>+8%A l@%D lH%G+P%H+X%KX`P%NX%TCe%WCe%ZCe%^3f%k <=%m=f%pO %q8O(%t+8%u+@Hfs%xGfH%{QfP%~[fX%f`%jh% jp% (Sx% (S% (S%V%+% %b%%j% Y%b%Q%bW% l % l % ? %Q, %a %O( %.8 %j@ % H % kP %kX %k` %lh %lp %+x %#l %)X %b % l % l % l %/R %PB % %tm % % S % S %"~m %)m %  % m0 % |A8 % bX %m\ %m` %|Ah % %m % % % %  %!b %"b %# %$+ %& l %' l %( l P%)e %3m %C. %D+ %Lm %N+ %R n %SS( %TS, %Y+0 %] 8 %^ < %_ @ %` D P%aeH %dWX %gn %iW %ln %w %x %z+ %} %~"n % l% l% % %.%%% % %+%b%7n%An%p%p %b(%b,%a0}rcu%e0%VR@% D%.H%rQP%qx%VR% % "q% q%q%% % l&% &%&%>P%e% %!";>%$";>P%.e%<qP%Fl"@@r6@4N;Qpad4!N^+? @4r/34&^@ 5 5!D key5"D65?5A+5B 5C 6 6  mod6Z.6 5=65>/=*=*n*k*I*R=*o"H" " Q" " o" "~"  " H(" Z.0" k8" @" $,H" $,H" $,H" H" $,H" $,H" $,H" $,HK@7777}7;P7h7Z7Q7Q7n77 7b7|AHkp7 7b(7b,707 87@7A7B7bD7 H7P}mem7@7C7+7 b7777q77 7;(707b87@7bH7bL7 P7bX7`7bh7p7 x7b7b7_.77b7]7b7b7.77 b7!.7"b7%7&79b7:g7?7A7D 7F 7P q 7Qb(7Td.068e8f+8g8h 8u8vD8wD key8x 8UE8V /"8jb3key8k$"8n3key8o$ 9;9<&9=&B9? b B9@ b$B9A b(B9B b+ :B:C0:D0B:E0 B:E0(Ls:E0,Ldpl:E0-Lp:E'0/B:F00Lavl:F04Ll:F05Ld:F06Lg:F%07B:F+08 :wList:x0B:y0B:z0Ldpl:{0 Lp:|0 :E:0:0::0:S:S :E :~::+V;+;+;+;+;+;+:;  pte;;":;  pmd;;""<%.<%%I<%/n<' T3pgd<'I<'";n#>=3sp>+3es> 3ds>">$>&>+(>+0>=8>+X>+`3cr2>+h>+p>+x>=>+&>b>S>+>+> =qfpu> <@W"!#b#!###!###!$$$EQ$!7$#b'$!V$V$V$V$V$b<$ lo$b`$!$bbbt$ l$b$$ $bbb$ l$$!$.$ (=q=%=z ={ =| =~ =  dX=i'= = = ("= '= ' = ((= !(0= 8= ("@="H= ("P= (X= 5(`= O(h= d(p= d(x= d(= d(= ("= ("= ("= ("= ~(= (= )= )= = = = = )= = = = = *= = (= .*0=! 8= H*P!y'y''' (? '? 1~'''i'!''''!'''K@@(RJ@z@'!!(+ ( 5('&(!J('J(T:(!d('+T(!y(y(i(!((( ((+y((j)RC' ./a (,0S8Xh%p+xS 1mX(!)(+y()!)))!**zz*!.*J(T*!H*b.3*C@q*@@C@*@0@06@*Qval@ ;M*;q* @*/*@,*CA*AA* ++6A$+A ;* A E+/ +A*A$+ (=+= += = += = !++S*+!+++d=, cpu=V irq=$ammu==%=Q+p\='+CC  DQ,D*D6, E,EQ,EEE EEbE+",F)-3fmtFQFQFQFbFQFQ$G6K-G7EG8b48G-GQGQGQGQ]Gb]Gb]G4b keyG9)-(EbG=- 8GUZ.GV modGWZ.GXQGY_. GZ (G[ ,G\-0Q Gu.Gv.Gw.GxbGybK--+V.+ H//H1b setH3 getH5+H7 >.~"0"Z."<" b" " " R(" R0"8"!@"" cH"# P"$ X"%`"&h"'p"(x")"* "+5",]"-b".5"/ "0 "1 "2"3 "5 "9 "; $">"?G"@e / I!11I% I+ I-I/ Eb31     +1+? ;~'1 vbK2      0Lc2LdQLeLgLi Ll /(2\)b\)s~'\)t~'=M =M EbN=3:(N3N3 valN SN!S N"SN#lN$3 S6N*3N+&3N,#4 O3O O 3 P4PsP D3:N'M4N(N)3/3N.l: N14N24N3N4 N5+N6+ Q$4 fdQ%Q&Q'46(N4N%=3N/4N7M4 8N,5N+ fnN @5/4 ;5;54,5\R+\R+ S5Sl endSl T;5LcsT=lLslT?lLwfeTAl TES6LssTGlLstiTIlBTKlLnmiTMlBTPl BTSl0BTVl8LlmTXl9BT]l:BTdl<6T6QcsT0QcsxTlT56T6QssT0QssxTlT5 Tg7 r15Tm+ r14Tn+ r13To+ r12Tp+ bpTq+ bxTr+( r11Tu+0 r10Tv+8 r9Tw+@ r8Tx+H axTy+P cxTz+X dxT{+` siT|+h diT}+pT+x ipT+/S6T+ spT+/6 U 7U U 76 pVc8 cwdVS swdVS twdVS fipVS fcsVS fooVS fosVSVc8VSlSs8+CV*8 ripV+l rdpV,lCV.8 fipV/S fcsV0S fooV1S fosV2S 6V)8;s8;860V@ 9VA 9VB 9S9+ eV$9 cwdV%0 swdV&0 twdV'0 fopV(0/8V5SV6SV99 V<9V> 98S9+S9+? VQ: cwdVRS swdVSS twdVTS fipVUS fcsVVS fooVWS fosVXSVZc8V[lV\mV]nV^o rmV_pV`qVa:xVbS7:+"@V::V; lV< lV= :l ;+K@@VOF;SVP9VQ:VRF;@U;^+@V^;>V_7kV`9>Va9kVb ;@>Vc;;+K@@Vfa<VhbVkbVnlVql3xfdVtl&Vwb&Vzb&Vb&VbSVU;@@"V<V lVbVb fpu@V=VbV+V=V=Va< Va<0SV;@@; W <=W lWlVL=+V\=+? X=X 7X! jX" UX#\=l=+V=+=+==+== Y>;>Y?+Y@+YAS cpuYCS Z8V>Z9q> Z<q>Z=q>V>6[<>[=b[>  [:>[;V>/v> src[A0 dst[A 0>!>6\>\6, \ ?/>\>:] 0?]E+]"?=Q,===!=%='=,=/ ?=3=5=9=<=A=D=H=L=Q=U=Y^ !\@ (^@^b^ ^@^ ^@@ @@b\@ ^#@^$ ?^%^' @= _"/A_#WA _&WA_'WA_' \A/AWA ` |A`  a)Aa*1a+Q, osqa-aA a/Nb|ANbNb c!Bc" bc&A cD)BcDBcDB cEPBcEBcE5B:cT BcYPBcZ ?c[\BCB ? lBw;B4BRBBCd3Cd4S lend4S6d2#C;Bd6l d1DC/Cd8#C6dikCdjdkkC@drCds#dt/Awdue4dRyDdTbdUPBdV/AdW~DdX#C dYG0d[G8d_"H`d`PLhda+pdbxDddB/ICdm#dnTd_udvpCCCKx"{G"| "}"~ Y" Y"b """! "PL(" c0" 8"+@/?H" L" P" NX" N`" Nh"Sp"St"Sx"S|" ?"""" T"S"w"+"+"#""""0"0""" d0"@"H" P" T" X" \`"hP"bp"8ĻH" P"(X"`"h" pDDGG+'4@dHdLdLdLdLdL dL(d M0d M8d M@d =MHdMPdMXdN`GHK@"PL"" ""+"  "k("!0"!8"@"" H"+P"+X"+`"~Dh"wp"" ""&"#1";"$J"O""A" " " S" " "#"b "(P"`" "S"N"N"!S"""/ "0 "1"4 "6b"<|A "BQ@"D"HH"FvP"I1X"L`"O d"RPyh"Sp"Zax"a"b}rcu"ce"d,x"f|A"k0P"n ?@@"oH"q ?X"r`HEbdsL L~DbsL LLLyD#CL LLbQLDCL LLL L~DL! M~DL!M~DGM ;=M~D;$M eEMeF~DeGPLeHeI MMMBMM fM mntf Mf ~DMM MMMM ~DN~DULMg g :Ng Ng4 hNhbhbhQhQhQ iNilil4(iNTcti:Ni&N NEbjO k.Ok 3O.O l SOl (m Om m m4nOn+nOnOO n On O nPnOnO4 o.PDo Oo < o IPoOEbp gP4@p'PDp(Pp) < p*P(p+mQ0p,8p-9p.:p/; IPPPgPP4@@q/mQq0ڞq1bq2  seqq3)Bq4Pq5.P q60q7 <8P (rQr #r+r QrS !QQrQQ sQss sRQ:t RtR+/R+t8R uVRu u;R v+Rv,v- xwRwRwb`w+h maxw+p+R+ xSx lx lx:y (S sigyRySzRzSLS4SzUzViSQS{S{ { { nS:{'S{({):{-T{.#{/{0 S{1:{54T{6{7{8 S: {<T{={>{?{@{A:{ST{T .{U{V: {YT{Z .{[ :{^U{_+{` {a 6{JKU{L{Q {WT{\T{bT: {EhU{F/U:{gU{h _fd{i:{mU{n{o{pb  {% V{*S{2SQ_rt{9T{B4T{dKU{jhU{qUC0| ^V| | | | U 0| rV/ V|^V }uV}v# ns}wa uid}x Y}y }z }{~V | W|!|" (S |%HW|'@S|(+|.]S|0 (S |3bW sa|4W ~ W~ ;~ + len~ +~  (W ~' $W%'( 0D)XM#WP(W) 8 Xlllll #l(,l0 )X*l+.P P8X9X:bH;bLXX+48D5YDEeF|AGb04 >YKZp endYVY^+: Y val Y: Y val  Y"%S,Z%U l%V l%WQ,Jb%[\Z"0%hZ%iB%j%k,Z3cpu%lb%ml%nl %ol(" %[%+%%%"%?[%+% Sj@@%[% l% l% l% S% S%+ %+(%+0%b8K@%r]% l% l% l% l% l % l(% l0% l8% b@% lH% lP% bX% b`% lh% lp% lx%  l%  l%  l%  l% l% l% l% l% l% l% l% l% lK@%^%[S% O%! l(%" l0%# l8%%@%&P%'Q%(R%)S%, lX%- l`%. lh%/ lp%0 bx%1 l%3 l%6 %7^%9^%;^%=+qavg%G?[@r]^"0%KF_%L%M+%N+%Ob %P$%Q&%SF_(^I%]X_]_ l_l_q_j%``S%aO%h l%i l %j l(%k l0%l l8%s b@%t lH%ubP&%b&%b&%b&%b&%b&%b&%b&%bS%gPXS%gP3rq%`%K_%`%l_I%^`` .`l_rq`"%JaU%b U%b U%bU%bn%a%%%%%ab%Jas%S"%a%aa%aaa` b+11bj" c"G""w" `@" D" H"OP"+`" +h"):p"+x" " ?""w" bpidp7c9 VR:b; ?<~D ino=l?̓ @@B@HTrcuCe`Dܓpc#c+ &c&b&uc4o>ep1 uidq Y gidr Y s Yt Yu Yv Yw Y x Y$y b(z0{8|@}H~PX3f`3fh3fp3fx ѝaV֝Rc>ekey3fVRRR՜ semw(ߜP X/` Nh uid Yp gid Yt^x|~ +/q/He8fBfLfVf H f! VR"#$%Ǔ &('0(8)@`feX^j_VR` ab ce@ h.8kV@nXq`sdt.hwpxbtzMx]b]bbDgP < itRПXbh cattyw Bl lllllY+++'++ +("+0,+8+@+H"+P,+X+`+h)Xp  b'|Aw0fd j ?VR@ jjj"! k!s!sj"@k  l  (*,-0kk Xcld1e g k ?mn(o0q,x8klrVePtm VRptmx   ԑ"#(./09 :(;tm0>8PAe@(lym" mmmm+mmm+ n+5YnnR2n+2n0?8pqqqq2 q q  -r!" B$b H'r(Q key)b*r+ ,(-0. r8 ext/r@qq34 8r tp9r: ;S<S-rPDeh}J\r{ e"|fb sdagu}h-,iz}{dxDe}E{Fe}H I|A(J ?HK|APL+pM+xN+O+P+Q+R+S+TU+V|AWcY \+]+^ y_"|p{u}+z'|=6}:::"}#D$%:'~():+(~,-6!V~&}*}.~ }~/} ops~/(~}~~ 2~4+6b7b Eb@~EbH pJq~rsOJCx~+De+l;Tx4@8+++  (,80Trcue8iHV~ i idBx^+  (߀Q,b : xl& )w ldt*}8.+@9|AH:h;p= xC0|D&~x + alt+++ +(08@HPX`hpx !F߀C\^ `b6XQlruY;de6ij +k+C(RF/h c/s+ C(uz+ pp{|+}+~1 C+CՃ^  ^* refk8cHhbl+p ops x/Ճl(Q;;F;;we6b n DŽ3val+I`MN Pb_JlruK;Ԅ_W>>X >YDŽ`@GI+/U cV + /([ 0\ 4^+8r@FDž;>kj`(m4n+o+q r s t vb r@lR;Džkz`0}~++     (` ++r@| ;R;kjD-RR4@R I+2j" N" "  ?" x " " c"  "G("b0"b4"Ce8"M@/P" p"  x"#"$ "% "'RDD"5u3ctx6zu"=>v@Y"(XLjYw"(\b+h+tAw }$`C++ra;ke_>?>2 qrbO+"bc @h @jYkmq s:(t0u8w@{:H~:PX`0hNpgxLj"l3cid @@  n J+ 7n@@(R@Mw@+P+X+`+h+p3pgd  J(x) 5 ?(E+LbS ZQ,]1_a ?pwr+++++ +(+0+8B@ ?D+H+P'+X3+`+hHbrk+p!+x++%+0+-=@R+h ?p\x.aS&k++  x1,xu++1 +=+3M+MWsfp+^+I b"p/+/ 7+(3pmd9 (03pud; )8/@EHFP3pteL y(X3ptlP?`T hJb @pppppEb ]              \ bN6N9N<NG+ Jb1*+ 8+22++ +(0o$b"$,$- ?$/ `$0 03?4678  xa9 t " $ ?4@@- lru/?01 t 2Ǔ nr3 ns4ǓOܓ+^+:  vallEb 22 q K@@SK+Hkn@x0X0Z0\0^$`ԑ $ P@@@HpY"#|A&@),xHpsi,Hbpf/n 25#q9qN@  22 8Q ߗ (07 sߗt u@4 DO4XRߘc2 U( set08@HPCߘ2 l;rcuevb4UDZޙh px4hŃʙTdirZ4`DOX ʙ ޙUϙ!YY 2 HM+H$04lTrcumenVRo CvĚx0y U6uݚ;Qx+ (r%t+/Ě/4Q %%j ` e9u+ 3f3f*` u key3f/lwO6& N NC(q++/4 ; 6(ݚ;&`   _ М>9;Мڜ l VR+018#@ uid YP1X `$],h  VR gid Y^+lѝrcuele@@qgڞqhQ, cpuqibqjbqkb BqlbBqmbBqnbBqobBqpbqrbqsqtqubq{ < q|P(q} <0q~P8Dq@@۝o<ߞP@+HW +? 8s ! "+#l#l $+($+0 '(l)l 0П1 2 3  CD LM.N 8QMR STcsb+cr+r|bR+e)/067 DIJQ R(U0V8^@fHkPDlpn7qDoxq|rsuDvxyz{   (08@HPX`h px       £.40@De 4` UTrss £V$08@@ X  | fn > arg +: b| S6SۤTU7lWX#wYe48I< qJ iocKl/Rۤ \b0K + b(b,VR0b48kH$,X-,X$,X-,XX ?`dphnpxHdevg(80 48@|AHHid h+pxnrQ,x  R!"#|A&0( ?4)8* yH-Hfq235|A6|A7|A= > ?0@4HtdD8PFe@K@PP|AhRSU~DV~DW~D[|A] <: val : C val,<[!ffk in+v48_`1abBc Bd Trcuee refff0OEb      : v + %"  b !b 'b =b  A M >Jb TYI lf7v+ 7++ x nvE ϫ:. 0 4ϫ 4'5b6'7P77+A<FKZ"0"pì"qS"r "s "t "u "v0$/m(6"" Y" 6"" Y" C P""b" /ì/ " "N"N("N8" SH"е(<)#*+ ,0-|A@. ?`/ d0PLh1ɮp2 x3+4: _ val <HEb6B6EɮQuidF YQgidG YH _ D/Jk Hm      ( 0 N8 N@ H7+ b(b, 0 8@" 7!Z.7"@89԰:԰;԰<԰= >(?0@8< ԰PL ٰ PLɮ"XDEFͱG ݱHI J(K԰0N 8O@Q-HSP ͱPL!ݱұ G G_ -G"xY!Z[l\l]l^l _l(`l0ab8cb@dHeLflPglXhl`ibhjp"8bbbb bbb3ino  T( T0"b!+" vbbb bbbb"XB԰[[԰ ~(08@ݵH[Pv BPLM$ [PLbG yPLy` PLɮ2 PL صPLصĵ~8 = b w =0 MHHops!] GM+m]+m+_"w>"}˶>" ߶"83˶4\56P@ ߶ж!U"" "C"a"z" " & "X("0" 8" @" ֹH" P" RX"u`"h" p" ƺx"ߺ" " "5 99>% \S\ H z c9f  c\!"8D&ESF c3raGI +Jb Kb$L(M+0 SS cbS{w\+ S cbb\] H cH!\ ֹ\`¹!\۹ U (+R,-./ /l/  u c\\W \z \!\ ߺ c\˺ SH!S 5U! _"d>"i>"br">"k"e_">"!>" 0!G_">"n>">" ;>" b K@"Z"["\"]"^"` "b(("dF0"e_8"f@"hH"j_P"kX"m`"oh"pJp"r hx"s"u"v"y"{"}:"b"{""("2"S" 0?3pid"c"N3uid" Y"Y "$" "" +"b"b "b"b" _ ">"|A>" lr ")k"*e>"+V>>",2>"-I"PK0"Z"" " S"Zk+"""" " " "$ "8(" 0" H8"԰@"aH"uP"aX"u`"h"p" Hx""""" " "8" Q" Q" Hp"',6@Ee)* H+ H,p-.& /+(0 09 4: c8< @= ?D> H? P@wXA|A`BCnE F|AHIK DQlTV+V+$I"   Qlb""<" 3pos" I" b bSI S;g SQ Ub"   S  r6S6; %c&@' r" Sb+h S( GS S S S +S+0 +]S++++:q nSbg Snb S{w S!S! xX bufX;X X X X  X (X 0X|A8 opXGXX`XLhXp SSb $SSb ==bB) e=bL ~DG~Dbj Q~DGU G G ~D; (G~D F~DG~D- _G~DK G~DQd G~D G~D G~DG~Db ~D EMESb5>? >@ !@(5 Y(+E m(^ (+++r b ++ +( (+ Q( 0(m mN(+.5 g(+Sidrbb +O rev+  4  QTrbO ns0b8< >/@ idl` hpTrcuex  ops! "h "$ 7% U & j(( 02 89@: H= P@XA ` 6 Qdir  knS |A |A@`h ;x  &  @&  A % !  7# U<!jZ ;o r6 ( Eb 0'b() * l+, - >(og qo LLQL 6LmLnLo&"XL0~L1L2 L3 L4 L5 2(L7 _0L9 28L; _@L= HL?P~ n n no c 2Sn; _Sn;7 Snd Sn("LL L  n; nQ `b ? KX 0tu vw!x*y z 3(g!n2 bi  !3d }~abuf ;+;+?V+  #F  Q <<8(AxbblK6g@3pyHQPX3bus`bh p x|AS~ Hmsif(8@lHlPX `hx g HidS ? y!!# 3$%'#)&+ `&, a&- b&. c&/ d&9 e&< flK+ sK  x6BDEF;GJHIs 6 !b"b 6@ECAl/K 6:@K;O6NO+PQ * D. S+" * Q (HE HFQ modHGZ. opsHH!HI :HJ HK/0  +;6HL^QargHM QstrHNQarrHO HVHWbHX;^ H\ maxH^bH_b numH`V$ opsHa!Hb/40( D) O+  C+ x b $ xV+7 `7-7. mod7/Z.@70nH mp71P72cX 875A7677 d79 7; 7<(7= 0 ZZ_;A Z_Qi!Z.Q Z.!Z.Jb7>j87E3mod7FZ.S7GjP7pq7q7r7s7tbqmtn7w" 77 7b7;7;N<+0qr"|r# ]QQ+b(l,I b2 `! H: ? {w: ?(@04MN HPbRb TbV+/ (+++++ 40'Trcu1e2v3'6^+ HIJK LM+Nz  :;<"#  3!#"### $#(%#0&#8'#@(#H)#P*#X+#`,#h-#p.#x/#0#1#2#3#4#5# #g!3g(JUhJbl"Hxy ?zb|b}|A~0Ɂ@K8ɗ?ɘUə  Uɚ !Uɛ "Uɜ #Uɝ $Uɞ %Uɟ &Uɠ 'Uɡ (Uɢ )ɣSɤ ? ɦɧc ɨT@&ɩ @&ɪ A&ɫ B&ɬ C&ɭ D&ɮ ESɳgPPɴlɵ,xɶ@ɷ^ɸ ɹ &ɺb&ɻ &ɼ &ɽ &ɾ &ɿ & &  &  &  &  &  bh88llllc  x(Hqos0 +T,Q id-./ ? 0^(1rQ02+X3 <`4 <h5 <p6 <x7 <8+9+:+;+<+ dev=g]> ]? ?Y!xgDh}"3ops# # 3 3!!g !gb M7NQOQP!Q!R! T\(Uz0V#8W 3@X 3HY 3P[#X\#`^h_#pa#xc#d 3 pmfh& PgPW `WaQ busbdZ.eQg h$jD(kS0m#8n 3@o#Hp 3PqXr#`s!ht!p pmvxw 3 py]U< uu<6a g7 `2K3Q5!6!8z9 i ; ~(< 30>#8@(@AHC P pmEX ;dudP!yyKn u!u 0X YQZ![z\ ^ 3 pm`( Eb-::?INXU ;udo"bb+JbJb"8f 0"!"Jb1JbBJbO"ctd&e2f4g 3lidh t6lcma=!!s!" CrD I NS+r eABCN%|` lb6  b #~!n!o7!pb!u#!w D!x D`!z D!{ D!~b8! ?<!j@!,xP!Pyp!#x2^+by     JbE     "#$Jbg{     "0!!\! ! !\!  3_i!(x!q2 @jk lenl wpmnopqrs t(++Em t)uvwxyz} b"@ n  (0 8@-H P BXj` hpZ.x 5@JTcm"H @bD&HwI  bI] b"h*ijk+l+nbobpb qb$rb(sb,tb0ub4vb8wb<xb@ybDzbH{bL|bP}bT~bXb\b`bdbhblbpbtbxb|bbbbbbbI7< UUb"P H@ HHZ^+ "JJbn sbs p)!p )b+ bpb   -!B+2 jpHb*G ;pdo p+J p!! !I9K NM N 7~8 Z9 Z: Z; < > N? fA fB Z C Z$D Z(E Z,F|0G|@H ZP u1N TO NVP NXQZR[S Z\T f`UhV~i+   Yb*& l' l) S 8]b^_Gbc refd VR(e;0vb6 <>@bBbCb HF G lHwJb@KD O2Q0S0 (Vt refW VRXYyZ; t~2 hi"jdm optnqr|A u@wbPx0T{GX lz4} `ShGpx]llSSSS"b0SSll::SS cPypbx;;vbEb- o cS`   `_;>` # +/_ E > ;o;e  nid+bbbV$ /# (SDH"HLV 3bufM-O O(Pl0Pl8R@SVBTbD"8g hbij]kSll n(ob0xv. x1 0   sb PL in  out bb algb$()%* gfp`, (    ;   PL 9      / /  \O+# tL Q !\ \ a  (ф хц@ ч щ 8{ |b}Q,~р.(с\ 0 4@Tb TseqX B@[b ^Sar dl8Di @@br +S +S ++dҢңҤҧ|AҪ!0ҭ=8ҮlpүlxҲ yҵҶҹaavgҺ*xҽ. ҾrQ(ҿ@P h l|ApSl=ll  S+l*+++@++LQ!fSkC6@d79@0A`DGJkM,x+%+%+% 8K kn+rQ4 ssk 0@ idPbTlX `,xhDUy"      ( 08@H P X `h 2p $x $ $ &&&3idQQ lbK+ "(D'ERHlJl "affgm(uP{x" ++ K@ABEbH KqrcuLe SSq@@VY \b_=bL='^+"،lrL=s+@y H|bPbT3ssX`px 4 7 U jRp  $, l b4  Rl9 pbW u !!  ! .tm !2.tm"G+=N   ~D ops # b VRnet"03nsQaV tm( }U}S}S}SC@}y}y}S< +C}}} 6@};U; @}/+ 1+NE-9f      !"#$%&'()*+,-./0123456789:;<=>?@AUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~NfN/\(S\(S-r\(t\(t-r  endb !!!&^+ ("N""N^+l(GI&rcuLe4x.K/|AD0B 3(609b8<b<?b@BDEFR^HPpSqVrYs\x(hyicj,xka  Hc sbdPLe f ulK eiom@m Ay @ 7b  +%   t t  nrb curbb,!Py b/&   bc ? bd Jb "!G3map 3 Php3pcl!x bb. ~@mD"nD"HsboPLHpclp!suw x0yb8yb<T"+" |"}~b\" ' V(S"\V `#"V 5# #? J *#Py'xVE# \ M&v W#c?!f s#`'EFF#\?# c\+`ME ##Q#u$,? $$`YF!j ,$sF 6 ?$?!e$sbb? s|$|$V ? s$|$M$.M$.F!y$sF$sF$s?%PL|$M&g #%cV) 9%9%B?\d% c+v`F_%?%\?%`?% c+v`? &7`Mb &A?$4=&+`Vb S&AMbY o&AQ#sIV' &9%sH?&&PL-Mb &A%W%UM;&s:MI]'Qy?4'&8Q'M=h's4UsT~1(4U|(74U,fb f;9Xb,SXb@\2dGfe% ~8errf 4s h68%91e5 6) (S  #@ WC5 H<^(S6p)]   ): !  , ?   P  [ h  y  * 1c5*h< (SB7* _*l1x yWt7 u W7 ("Q0&(S4A*1R*S;9Y8U~T0Q1K}8U~TvQ0;98U~T0Q08U~>8U~T01(8U}(9UD(-9T Qs,c.>Gf.K>Grac/X/'21G8map2'8cur38end3238err4Z=2P +2Q\U/; #    ! , ?  P [   $  Y<< C T*`N  `Sh eG X1b*c&)UsS m=<P= >%T<%Q6  T= K=U}TsQ~\(Us8>O >1 (('>UvT}Q2'>UvQ2d%UT f A@GfA>Xbio!A@~8sbiQ@b~8err?0=[@?UsT|Q~R T $0.z?U|Ts%@Uz3@UTs,yQ@+Q@c _GfF>Gfgq&_X X8sbPL8mc c2_8q"_222b8biosb+2zZZbV 8pcl!8cur8end28ib2ZBB2 gaB%pB p +p 8p#*Ep*RpBp\C p+p8p Ep Rp(_p(np(}p CE/ mE@# LX)c t9wD )    #@ <  2E! , ?  P [  $  1 (+  !  , )?  P  [ ) $   FTFq/Yq,q7qDqPq# \q iq vq q q q q@q@q@qlG GZ GhUsH,Us/ I@# L(X)c t9H )    #@ <  I! , ?  P [  $  1 ((qSK a }DJ,#o~K Z J *  Z     :       1 * #Us eL   !!  , ?  P  [  $  M # +   !  , )?  P  [ ) $  G N Ub>_^N Lm z q q o|ca qc  !p  { I V  a  eP PP  C  T*`N  `Sh eG X1b*c&)Us Q Q  C T*`N  `Sh eG X1b*c&)UsZ# RhU},cR,LRU}U}/0 "T@# L(X)c t9,S )    #@ <  S! , ?  P [  $  1 (G88VUb>_ULmzq q o|caqc  !p { I V a :WW C  T*`N  `Sh eG X1b*c,&)V&7Xdq  'X,U}z(X,),\(\(XUs%YU~#hT~Q1#U}T}R~dY( Y%2?LW#T Q0R $ZUvT$ZU?$EZUT~Q|R}$^ZU,$$ZU,$$ZUe$Up  \p pp# p@pIQr[ VA`#U~ T Q +R)D+p^ppp# p@pIQ\VA`#U~T Q R]DWp] p p#UHT~Q -R 9pL^ pkI{+AIN(Z(h^ ^$_Uv$,_UqG_T~$__Uv,,$,$,y_+__+cqpGbioq's8qs"_8errt8fiu{g=Lb2x\z9a     ! , ?  P [   $  |oabc   p { I  V a 7bU~\(U~wg# !8c&A2 3!c!pd!f!pg!p np%i }p%k%lp=(_ q$sb=JPL$fgq>*_$fg>5-q@"_tO pC qCIN5 q2-$f*>$pcl!$nrb$mc c-gfp`-zbv c\-bstt!t1% cnxGioH_X8sbiV@ZUs2+ lr++ r++#s1****( 51B C(PZu2 Zs2 gs% #2  Z>t$,+AN(Z(hst,&t,o&t #U @Qs*#Tsu|  4 $.18 9v|  4 $.18 9 ')x{ 1 { w1****( 51B C(P { y(xy# yuyXzxUsTX(xUX,$UsE#xUU#,cdyXG\ y5y y yuyXWzty*zzyUsTX(yUX,$Us,5 z>'x-bgq"_f ݚGioKݚXbe$!w28errZz2 gz%  Ϛ#   ' 4 A L W d q ~ S#  ) 4A? @ M Z g*t<} < | "U) 6B(N9W} 9}   }& 89|  Ɲ ӝ e~)& 89B*   , 9WF4*G  ',(A  (/P@# L(X)c t9Z )    #@ <  ! , ?  P [  $  1 (o'kTw)Uw9*k {&2   ͜ ڜǂ9uwN [gs) 5 A M  P^ s p%UsT1+   C  T*`N  `Sh eG X1b*c&)Us&EUw(,,$o'rUsTw0Us,$U~&Uw(Uw, $beK$err-sbiV@-pcl!b%/ -i-j      ˛ q # q# %> %K%u! $beF -pcl!b-i-err 5 $beH-pcl!3 -i5 $beJ$errb-p-n-bvi-endb-curb-dst -src    b b bb-lenb  b b  %%T"cGbeMX22bZ2 q2 + A   {*T Q +Yfr) { (# 4"U}TQ~(h h6Y K$sbiY>Q@Zbf GfC>X\Gra$2G8map!'28bsi8endb2(b8cur3b8pgs8b228errZ: Z  b% +  *7D# Qu^ k x>"A/*0 <#3)& 89I' N [ h u W*# 'Qv(9{  (     ' UT|Q11("U1(U+ K]+c+~g+ M +  8 ! , )?  P [ ) $  : s  #*  A <-~) 5 A M  P^ s p%U~T1   C  T*`N  `Sh eG X1b*c&)U~4k %UsTQ07VD-dq+< ,U~9@  ^ "c0/ @# L(X)c t9 )    #@ <  ^! , ?  P [  $  1 (> Lm z qq o |( _  &U~T~R0D(U~T Q~i iUs'T|&U}a+#u,9#*F S# )& 8 # ( 5 W! , ?  P [  $  # ( 5 W! , ?  P [   $  9^ ck#l{T0Qv~ +## + #! , )?  P [ ) $  'yUUs'U~T~Q0'Uo'UT~, $sb6PLH\$curb$end#b$pos4G-buf--cntb-src+ b % cqGfeF>8pcl!Z&k##%Uv U|TvQ0&Uv5 $sbi8Q@$pcl!&+SkGsbi9Q@X+8pcl!2bb+ZhUvk0}#  w (Uvo(Us"UT,UsUs      Z  hUs(UT y,UvZhUv ,Uv(4UvT~Q R8(]UvT~Q R8, $sbiAQ@$pcl!!w $sbiwCQ@$pclx!!cq>Xq3Z!2s+?sM# Z gArAs t(TUH# $fe#G>-map%'-sb&PL'-pcl(!-ret) IpIII I I II[ %d!?]v $feJ>-map'-sbPL-sbiQ@-pcl!-pre!!-errtb$, f [Gpcl;!ZhUv3     $,Uvm,Uvv&Uv $feD> +-pcl!-rethGsb2PL2Gpa~Q)yUv9)UsT15 :\fj  "Xj7\GgfpjD`8pcll!2m8endn8retol!n$ q+  !! , )?  P [ ) $  Zu hU~ ,U~/y@# L{c t9 )    #@ <  h! , ?  P [  $  1 ((X6{, 9  !! , ?   P [   $  GU>  !K V $ *1 <   C T*`N  `Sh eG X1b*c&)U|fP GsbiPFQ@GpclQ&!2SbT\8iUS/[ @# L(X)c t9 )    #@ <  L! , ?  P [  $  1 (o]  Z  *  Z     :       1 * `  c ,#*9   !!  , ?   P  [   $  G U>  !K  V $ *1  < +   C T*`N  `Sh eG X1b*c&)UX,\(5 $feD>-mc c-pcl!b-gfp`-ib##%& $feL>b\H 'h)T0'! 41>!,),3,!++  fy SEGcpuy+b2{ g=g% %%Z}hU #,U ,))Usff Gcpuf*b2h 8oldh" Z 2r %rg%r%rj # % Ez 5*UsT0Q Rs,"*Z n hU sl,PU U )UvL N -cpuOb Q qQY %Y %Y%Y@ 3$cpu@<B c1Q?23 8cpu4bg29g%9 %9%9F 6# W c o ,*,))5 $pcl-9Q-:)-;)b .CC=D.>>< V8errtzzzzs *  1#sA${G*sY f#u*U~QR@<${v  r  # <<  N [  h *U~T ,'~E +)  ,*  9  ~Q + )  ,*aQ~s~ +  _*T F V  W c o *Qs $W  % E 5*UsT}Q Rs,"*1 ((0 5& GTan)UT Q}R X Y},|4+U TB,!+,',+,3,55L:$gfpJ`7\$as7K c8+.'sb>PL.'sbi?Q@!ssZ!s:!t$opf!t%!t0`5!/$fi!/6$bio!/Fs!5!5%!5{5!$fi!7$bio!Gs$i! !-!*!*%!*.!-O'bio!>s0!0!.!y'bio!,s'bit!>b b$rac F+$racA$racA$rac>\&G\\SI\5{o{-\XX0\.\/55@ c6+`$x> cG8\5]p]7\]D5b$mb? cbH`R`R= c5#r#r5\#s #s5##2\#@#Q$len#-to# ;#  ###### #####%#5##4# b#b# b#b# -i# b q# #%#7/.4\B.27 5\73&33FEF aka5k-C\C6\+6!\7k5*\5",\5>*5Z,\@\K+44\~~2ebe X.$$ .$$*.$$/.$'v$2+>=kq^q;Fe~e>F K K9k 6 6Ak5  ?\  4F ' 7&Tz'x&T7c&W$, %./'l/<BlMy{ + { +{ +{ +{ +5:5?gZg5?5]v]3?D(J?DC?M'J?V%J?MJ?.C+&+^ + + + + + +% )[~$cpu)[5b)%b)Jy')8$cpu)8)86y'.)%b'cpu)@b7)'cpu),b$src,1q,Cb#k#:$%&'( C%U R%U a%U p%U %U  %UO %UO %UO %UO%UO %W %W %W %W %W -%WO =%WO M%WO ]%WO%WO< : % % % % % %O  %O  %O . %O%O+#v +3+C+ + # + 3+ C+  .+3! +3<.O! 'ptrOD.A! 'ptrA<.4!( 'ptr4=.'#F '0.8+ 82q8F+9+[val<+7' '2Q'<'b'G._&+ 'w_A+.7 'nr7/7K 7. 9 'nr + ;9 <7'c 'nr','H 7 'nr*F 7^ 'v^O ^Y7P 'vPJ PT7B 'vBI BS.+&+! 'w+=[res-+.&+? B+.h 'nr+?9 . 'nr4V9 0. 'nr4V9 . 'nr!= .$ 'nr8 [c 7HI 'nrHH1 74n 'nr44/ . 'nr+@9 [pq0+[val+. " 'key "J  "Z ($ *k!-_t*k-_T*!k5*A$_T*!.\_[c^ 7M'valM50O 0O0OS0O j j8 jV7  /7 ) 77 Y 2 Kh 7 'new / F7 'new 1  h . j jF[ret l0 o0 p. AA'new A@ B C[ret E7 #s #5 hh %h &7'ptr< H78+7'n*7 'ptr> J .,1'p,; ,Kb.(Y'p(: (Jb|'4 4>|,U/"j @ L(Xc tW     @ <  T! , ?  P [  $  1*(|  d,OUT# Uv w (U~o(Uv"UvTs)7 B  .y< Gp  ::LU~ ,U~(UT#HT |yday yuyXWz*zz#UsTX(;UX,$SUs,|R K0]c~g M    8 ! , ?   P [  $  Kh]+c+~g+ M +  8 ! , )?  P [ ) $     #*z,)UsT0Q7+y2+L+X7Q7] u7 7 7 7 int ] ,7 *7Hs8iHu8|Hs16Hu16!Hs320Hu32Hs64Hu64z]3 u 7 +  1] 2] H I X ] ^ _ `Q77 <]  ? 6      #r7 % & *+ 4 = B h0 n? } I  S  S  ]  ]  S I 2I qI ZqQ +44 D D49QyQ+W0&0   S+ I  !( r*,-@ ~2]] I F( ],!]0( 4)38*]H++P,X5 `6 d8 h: l; p< t=]x]se?CQ@0rt@RjdlABSB=SFU8ICJ+K]OUXU]U8`"O@dh]k] l+m nU oU(p '0q IXs`ubx dy]Uhzp{U+    ]U NC(8CP0mmhpVx    +] ], ], ], ]- ]- ]- ]- ]- ]- ]- ]- ]- ] - ] - ] - ] -"] -+*0pid Z Z+ (0@mWPrWX "W%n(n+ I- S. S3 S4M6-N: I(=+0>+8A S@D SHG+PH+XKL`8NLTYWYZY^Yk :2mZprC qC(t+8u+@0fsxZH{ZP~%ZX/Z`]h ^p QGx QG QGJ+ ]4^ M]'F3K S  S 3 " U 8  !"2$"28. <c8F%@@@q-pad!+?@&@ !0 key"0?GA+BLCQ G=w>I~~~VH  L  s "   L( $$0 68 @ !H !H !H H !H !H !H !H,@w8PhTLLr ]50kp ](],0 8r@rArB]D HPjmem@=+ ]k (I0]8I@]H]LP]X `]hp Ex]])$]']]z$I ]!z$"]%&Q9]:1?AD F IP ; Q](T.$0W W! S"e"f+"gE"hO"uE"v0"w0 key"x J"Uu"V I"jkey"kT"nkey"oT#;#<#=$#? ] $#@ ]$$#A ]($#B ]+$B$C!$D!$$E! $$E!(1s$E!,1dpl$E!-1p$E'!/$$F!01avl$F!41l$F!51d$F!61g$F%!7$$F+!8 %+ %+ %+ %+ %+%  pte% %"% = pmd% %"&&%f&%%.&%/I^&' pgd&'.&'"s^&p pud&p.&p".&@'H'I+9st0' I4'+8_&,@@(i(J2sp(+es( ds("($(&(+((+0(Z28(+X(+`cr2(+h(+p(+x(y2(+(](?(+(+( 2]fpu( 1@]() ) &x,@@'9z@'@=I' 9x'' fx 'r(','?K@i$ 2!&2% 2+ 2-2/ + '+ ) ;x '  q'z]4'     05c*(5dL5e5gּ5i 5l ('W ]W sx6 ~6 ~/]7((7(7( val7 ?7!? 7"?7#S7$( ?7*)7+&+)7,#X)8+)88 )9X)9 e9 00)7')7(f7)a((7.S 71)72)7374 75+76+ )(7*7%(7/])77)87D*7+ fn7 X*)S*S**D*:*:S end:S;;*1cs;=S1sl;?S1wfe;AS;ES+1ss;GS1sti;IS$;KS1nmi;MS$;PS $;SS0$;VS81lm;XS9$;]S:$;dS<;+-cs;!-csx;S;*;+-ss;!-ssx;S;*;g, r15;m+ r14;n+ r13;o+ r12;p+ bp;q+ bx;r+( r11;u+0 r10;v+8 r9;w+@ r8;x+H ax;y+P cx;z+X dx;{+` si;|+h di;}+p;+x ip;+S+;+ sp;++< ,< < ,+p=c- cwd=? swd=? twd=? fip=? fcs=? foo=? fos=?=c-=?l?s-+&=*- rip=+S rdp=,S&=.- fip=/? fcs=0? foo=1? fos=2? =)-s--0=@ .=A .=B .?.+ `=$. cwd=%! swd=&! twd='! fop=(!-=5?=6?=9. =<. => .t-?.+?.+?=Q/ cwd=R? swd=S? twd=T? fip=U? fcs=V? foo=W? fos=X?=Zc-=[l=\m=]n=^o rm=_p=`q=a/x=b?,/+@=:/=; S=< S== /S0+,@@=OE0;=P.=Q/=RE0@T0E+@=^0=_,J=`.=a.J=b0@=c00{+,@@=f_1=h]=k]=nS=qSxfd=tS=w]=z]=]=];=T0@@=1= S=]=] fpu@= 2=]=+= 2= 2=_1 =_10;=0@@0> :2> S>SQJ2+Z2+j2j2+o2 t2?>2??+?@+?A? cpu?C?@82@92@<2@=22A<3A=]A> IA:X3A;22 srcAA! dstAA !]3h3IB~3B"B3h3 B~3C 3C! C"3~"~~!~%~'~,~/~33~5~9~<~A~D~H~L~Q~U~Y~ D !4(D5D]D ID5D  D5!5?5?5]I4D#l5D$3D% D' D5E~F"5F#5F&5F'5F' 555G 5G I H)/6H*'H+" osqH-5 H/2I~52I~2I~J!v6J" ] J&[6JD6JDv6 JD6JE6JEv6 JE6JT 6JY6JZ 3 J[6&K$7K3K XK>7aK7KS79$7&L3w7L4? lenL4?L27S7L6SL17w7L8l7Li7LjLk7l5Lr8LsLt5aLu LR8LT]LU6LV5LW8LX7 LY<0L[<8L_"<`L`@hLa+pLbIx=Ld>77LmLn@d_uLv788,x{<| N}~ M M] ݡݡ!U @(V0 I8+@ H BL P gBX gB` gBh?p?t?x?|3f ?\h++_!! /0q@qH IP IT IX I\tU`ih8Up8tH P(sX}`h Ip8+<+'@L<L@L@L AL3ALGA L[A(L kA0L kA8L A@L AHL+BPLIBXLbB`+<<,@@ B+  6(!0!8Ŧ@"ԦH+P+X+`8h\hp II&#$5  Z w d n] (8ܤ` I?gBgB!?"x/ }0 14 6]<5 BL@D"<HFgPI'XL`O dRihSpZ~xaabajrcuc d if5k08n3@@oHq3Xr`</]L@@8]@AAA87@.AA]L.A7AGAA8A[A8LAkA8`AA8<pAA8A MEAMF8MG@MHMIAAAAAN&B mntN AN 8AADBDBr&B0B8bB8@NB OO BO gBO PBP]P]PLPLPLQCQSQS(Q9C@ctQBQ&9C B/]RmC SCS C CT CT(U CU U UVDV+VDVDCV b?b@bAbSHbT $bUIbVI bYHbZ $b[ b^-Ib_+b` ba bJsIbLbQ bWHb\HbbH bEIbFI-IbgIbh _fdbibmIbnIbobp] u b%GJb*Gb2G-_rtb9+HbB\HbdsIbjIbqI&0c Jc c c c I0c JGJ cJ Jc Jc!c" QG c%Kc'iGc(+c.Gc0 QG c33K sac4J d uKd d + lend +d r(eKe xf$Kf%f'f( 0fDKfM#uKfPr(fWr)8g cLgSgSgSgSgS g#S(g,S0h)Lh*Sh+DPh8Lh9Lh:]Hh;]LcLL+8hDM=hE hF5hG]0 i>oMiKiZipiii endioMQ~ME+j M valj j ~Mj M valj  j MSMU SV SW"3][-N0hNiv6jkMcpul]mSnS oS( N+O+ ?I@@O S S S ? ?+ +(+0]8,@CQ S S S S S  S( S0 S8 I@ SH SP IX I` Sh Sp Sx  S  S  S  S S S S S S S S S S,@RN; C! S(" S0# S8%@&P'Q(R)S, SX- S`. Sh/ Sp0 Ix1 S3 S6 7R9R;R=+]avgGO@CQ R0KSLM+N+O] P$Q&SS(R.])S.Sr=S=SBSI`T;aCh Si S j S(k S0l S8s I@t SHu]P]]]]]]]];DX;DrqTST=S.^TTT=S|rqTU4] 4] 4]4]^]UUvbUvs?UUUr UU UTU+' ' UIV<#\h @ ID IHh o I omW oKttyoS o] o 6 oS o S oS oS oS oS oM o+ o+ o+ o'+ o+  o+( o"+0 o,+8 o+@ o+H o"+P o,+X o+` o+h oKp o ob o ow o ] o or o o o o5 o\h04Zb o^o3oFol5oֈ ] ^ "^pW^pwpw,^@q^qq q S q (q*qr,qr-q0\^ ^Xrc`_rd're Irg rk 3rm#rn؏(ro0rq i8^ e_J t_ ~_ s_sss_ __+ _ _ _+`+M ` `F7`+ 7` A`b0qbqqqq} q,q.q#0qZ@q(HqӏPqIXq` q q+ q5 q ]Kbdiqd  q( qrh qp q! q IKevq+ q] q] q] qz$ q] q3 q0 qʤ q q i qiKcdiq: qKbbqD q! qS q  q((K`htybtzWnt|]t}o93otn(tE0t+Xt#o`b@u4cu5cu6 Iu7+u8+u9# u;](u=],u>&0u?L8c c c c c2cvcvIvIvv 2dv!v" $v$]Hv'dv(L keyv)v*dv+I v,I(v-I0v. d8 extv/d@Vcc v3 v8e tpv9ev: Iv;?v<?2d 90 wmfw?w Nw]w  wSwS inow)S devw* B(w+ B, uidw, M0 gidw- M4w. 8w/sB@w0sBPw1sB`w2sBpw3Sw4Sw5?w6?w7Sw8Sw9?w:?w;?x+fx,"x- y"fy# nidy&y-+y4+y7<`yRgySgyUgyXyYyZ ]yc F ydW(@rcuye HygIXyj` idympyptyqLxyr8yug+gggffg'zgz F}{ {"g{)h{3{g{Whh{]{II(|0h|1'|7' osq|95|;"|<2|~2|~2|~2|~2|~ } hhii i }Bi}'}}hX~qi~r i~sE wq~viH cpu~wP i4xi4ii( len'HjPpii++j+j+`@jjj =3@@ iH!+"+#r$E % i&   'rk0 (+8Kcpu*@Kssp+kH' k+`6rk738i:i(;+H<rkP=X>\ kekf] sdag mh!imwkbxDlErkFlH I5(J3HK5PL+pM+xN+O+P+Q+R+S+TrU+V5WW Y I \+ ]+ ^Bi _kprk m+jk~Em//"vm#0$%'m()+m,-!m&Em*vm.m n#m opsnm nn2Wn4+6]7] /]t@n/]tHntpntqntrtsn n&t ot"nt+t3o=t t+XtHon o@totnt+t+t+ t r(t,to0@rcut 8toHHomtot idto pE+t&pt+p &p(rp"Ig  qS& q)\h ldt*q8.+@95H:Ih;rp= IxC!|D~  q rI+ alt+++ +(L08@HPX`hpx !qr Frp&'\Tr'^ I'`]'Xr-lru'Y0r'd'e'ir'j +'k+&('RrTr'hVr's+ &('u#s'z+ pp'{(s'|+'}+'~' #s&'Ds'+&'hs's' Is refI8WHh]l+p ops xIhsX('Qtrr-sDsa' 'At']' I^' Ztval'+.'AtL'Mt'N I'P]F'Jtvlru'KgtF'Wt'X I'YZtL@'G;u'I+t'UV'V + t('[ I0'\ I4'^+8Y@'FYutJ'jL('mu'n+'o+'q I'r I's I't I'v] Y@'luYuJ'zL0'}Cv'~+'+' I' I' I ' I(L 'xv'+'+'Y@'|vuCvJ'I'Dv9;u9u@9xvv.'+vI w  3   zV I <(]0]4Y8A@`P p  Ix#Ť$ % 'ʤ9v'5xctx'6x x'=7x'>g'@oM('XTx'Y\h('\x'b+'h+'t<'w '}$L'x'+'+Y'xxJ' F'y'v'v '+mWN+ N XFr+ r |0l5=  ` 3@rss i08l5@ IX Z fn X3 arg I|j+  bZ j  ?rSrTrUXrWڋrXarY 8rI qrJӏ iocrK`_9 r\]0,qӏq Iqyqqq+ q](q],qF0q]4q#8qIHq!Xq!Xq!Xq!XqXq3`qdqbhqrpqx0devqd(q0q I4q8q@q5H0idq hq+pqxqrqEq iq Iqqq }Fq!q"q#5q&0q(34q)8q*BiHq-0fqq2q3q55q65q75q= q>30q@40tdqD88qF @qKl5PqP5hqRqSqU8qV8qW8q[5q] rڋ ݏ val  ! val  <9DDIiqn+v8_ܐ`'aܐbܐ$c r$d r@rcue  reffD0-q v + %3]TCY++ _nC/ . 0 q 4 45]67+  &0pqwr s t Iu v!$8( M Ӓ M !PL] N  sBsB(sB8 wHQЛ()*+ ,0-5@. 3`/ Id0@h1p2 x3+4  + val  /]6Z BE-uidF M-gidG MH +DfJ7H8 Z Z Z Z Z  Z( Z0 gB8 gB@H+ ](], Z0 Z8I@ !$$@89:;<= >(?0@і8@L̖@̖XDEFG HI J(K0N 8Oߗ@QHSіP֖L@L<Zڗ<ڗ+Ɨ<xYZ[S\S]S^S _S(`S0aI8cI@dHeLfSPgSXhS`iIhjp8]]]] ]]]ino  ( 0]™+ A]]] ]]]]X && I(l08l@H&PA @DB&@]D@D™+g@gN@̖gq@s8  ] \h 0 H0ops!( <+8(+8+Fw]} 834'564]I!,E ^ #(U0 n8 @ H P X@`Th rp xנ Ĝ 'w'vEV1r^V'Jnns8DEwFVraG@I +J] K]$Lr(M+0cwV]Wh'UwV]]'I(nVZ'sr''ʟ!ʟϟ(+,-r.r/ i @V''~"T'Err'Y'rwV'ȠȠwҠ͠ wܠ!ʟF/d]YUJ Fz!z &<FΡ`ӡ  ] Ρ ء,@ZP[\]Ȭ^` b,(dJ0ec8f@hHjcPkѭXm`o!hpNpr lxsuvڮy{}>f¯P Z d n x (w 3pidmW>Cuid MM $ ` +]] ]] F 5 SY )ŤJ* +2,-.PI,0%  ;%k6+   ( <( 0 L8@eHyPeXy`hp LxӰӰӰӰ  #< U U L; ʦϦ ٦ަ    `)Z* + ,b-ӏ. /+(0 I09 B4:V8< I@=3D> IH? IP@#XA5`BCrE IF5HPIK I=Qi _ i sQ+Q+$.rררLS]ܨ pos . ]-wPw2swLU!] qϩqqrq xwרԩ*w )w]+Bw.[<wGtwϤ`wywӪwӪت +w++++c2`w]Zw`]7}w}Wh _wīīwɫ ww]ӫ(ww]AA]F -iA]P8<8]nL8<3Ȭ<ݡ<rͬ8,<8Nr J8<81c<8O<8Lh<8Nѭ<8NB<8<8]֭8ӒIDBI?]e&l8S<SS q<ڮ<8w]N<wN߮ݡ8>8ݡ \8\a C8\k mt )h +<3]<@<(<<<-L@Ae@ǯQy@j8 ~@nӰī8@ذ#@L77<L(U@gAiin Z x}86LI!+@@mALBCrD` Eƾ( sdFķ0Gg8<I]<J]<K]<L]<M]|wbioִwZ |fU I=  48 I@HaPSX` hpr  It x/]ENT (Z<e_(<(-_s++A}&d]*E+]*hL( 0 vma 1 2  3 + 4+ 5+ F >6 ?  @ =A6Z+Fn_+++s(]ȵ(+++ܵ͵+IL 1__O+z$6h+Tidr#]] +!D rev+  ķķ I IķL@rbC nsL0]8< N>@ idS` Ihp@rcu x   opsո!߸ ķhи "$ 6% T & i(( 02 89r@: H= P@XA ܺ` и ڸ -dirɷ  knķwī I5 5@`h x    r@  rA %?zīI I6ī"ITīI;iīIYn*ܺú/]0'`() * j+, - X3(VIeL~~ oVL55L5 N5m5n5o&X50|5152 53 I54 55 0(57 ]059 085; ]@5= H5?P|NrNּrrۼVV0wr]wr5wrbwr5ؽ5 5 rݽrL`` 3 HX0tu ־v۾w!x*y z 1(e־r˾ؽ*(`mL1b }~ Kbuf  ++?Q{+ CL 996%>_ _ i,3d@p'HLPXbusJ`h Ip Ix5;,1; 0msi(J8O@SHSP^X c`hmx w B0id?3 &!!# $%'#)+ r`, ra- rb. rc/ rd9 re< rfiH+pIHI uBDEF8GGH\IIp3 !]"] 3 =B&AiK :@HLNO+PQ  * 0 . ?ss    s  L(1E1FL mod1G$$ ops1H!1I +1J1K 1LK-arg1M I-str1Nx-arr1O1Vs1W]1XKs 1\ max1^]1_] num1`i ops1a!1bI}$_1&$0(=)kC+ =+r ] n rQ+7`-. mod/$$@0rH mp1P2WX 85;67 ^9 ; <(= 0TTY;TYLc$$L$$$$3]>I8EmodF$$;GIPpkqIrIsrt]]mtnw  ]s :k+&k  dkd  ,"6" QIeI qIIH 3 WhI (l50Ee MON P]R] T](+++++ 0@rcu1 2g3OE+ H>I>JK LM+N :^; <C  !"# $(%0&8'@(H)P*X+`,h-p.x/012345jdd3U3]lEHxy 3z]|]}5~0@ ,8^4 r 4 r!4 r"4 r#4 r$4 r%4 r&4 r'4 r(4 r)?3 W @ r@ rA rB rC rD rE;DPS il5  I I] r r r r r r r  r  r  r  r ]SSSS  %(0qos/0+,L id-./3 0 (1E02+X3 `4 h5 p6 x7 8+9+:+;+<+ dev=d<> r<? r E%d0 *opsj   drd]MNLOLP!Q!R! T (U'0V8W @X HY P[X\`^@h_paxcd pmfEhrd`aL busbJd$$eLgr h$j(k0m8n @oHp Pq@Xr`s!ht!p pmvExw py ""93@d^,`23L5!6!8'9  ; +(< 0>8@(@A?HC YP pmEEXO"N&&L?"0Y"D0XYLZ!['\ ;^ pm`E(^/]-   ;"y]]+3]3]8 y0?!"D ?3]13]B3]Oc"d&Ie2f4gr lidhr "4 6 @ES TY@|cmah r |   ~ w  qCqD qI qNqSeqAPqBqC%( `|S  ] ]   spnpopp]pu#pw px `pz p{ p~]8p3<p,^@p iPpippxE+ @jVk lenl wpmn|o|p|q|rVs tf(|f+|v+/qmqtquqvvqwqxqyqz q} ]qq @q^qwq q q(q0q 8q@qHq Pq Xq<`q Uhqspq$$xqq   & 5 ?Hqqq r@q]Dq&eHI.q  ].q] ]qhqiqjqk+ql+qn]qo]qp] qq]$qr](qs],qt]0qu]4qv]8qw]<qx]@qy]Dqz]Hq{]Lq|]Pq}]Tq~]Xq]\q]`q]dq]hq]lq]pq]tq]xq]|q]q]q]qqqq]q]q]q]q.q '']IPqeqq @q H,tE+ t ~          qqq3]q@^w]Ewbcb|Z]+]b]Z ZrZ+<b]IUbAsb!Z x}bҠZrZZ | oM]*@ & S8]^_<bc refd F(e0L<>@]B]C] HF1G mH\hJ]@KrDOYQ!S!(V refW FXYZ  Yhi"jbm optnqr5 u#@w]Px!T{<X lz4}1`wh<p xZSS????"]!??S@@S// ? ?   WP p x   _'  f 3 ptr I # ]:{ $:0{ :] :)] :] X+: l X#+l# : l l#  :3 : :] :g MygMIY <6L!Z.2]x E'Z ra'xs y]Mu LxLOuI#]+fO+#FMI <6~~Z2I8Z8IYZ?IuO ]c]O5#rO`#rMI <6Z++OI <6My&gOygC]L9qd+9[9gesc#gAsbiApAnr+%]+m@  INp }U \U ) bU \U ! bU Npd }U N@# Z MN6 GN _>(kUs) )  P*27  )+  + 7+   (UsT~Q PCBUvBU~T}Uv+:gUscgT) *Ru c)n& * fesb4@Asbi+p } }U Gh tC GN _>(kUs) )  PGU bU BUvBUsT dfResb2@Asbig:! Us T Q +p  }U +5  ).  + 7+   (UvT Q|PCCU b U f[(#>%GS  ` >Qm N  w >( C   n)(/C   >o,+ <  )1 B M)$  R<(=PIN    n ( S   >o,\v  v *   *  s EUsT1S{   \   *    *    Q, )  *h * RQ2Us+p- }5+Um b5)U b5p|[.#egfp>[Hr%m m% |% UsT0G9  J C1C BC! S +p> }5CU b55CfA|AiAj ga%{GS F ` >Qm N   >( PC   n)(/C   >o,+   )1 B M)$  R<(=PIN    n G( S   >o,\v   *   *  s EUsT1*{   \  / *    *    Q, )  *h * RQ2Us5y5ddpAN[A(]:C 5 %D#%E{AptrFI%FI%GAiG AjGoutog1%R|%RIC\ R  m  x  >( S   U@T m%Z|%Z++: Z)H  RY QZ U Q0RsX0Yv+pdB }U~GUj} bU~BU BU BUvTsQ45ByUvBaT0B2UvU f70eptr7I%9{+T ;Re (f GU=  b5d p$IXT [$%]%'{+T *Re (f +p+ }Us+U.9  bUs55 !] 6D! 6D! Lp{  Ai}]%}]m % ]% ]h gi 2|%IUsT Q g %|%IT8Q C} S*  ; H5u- FS B&E U0T 5i { " *q 'i  " ,'' r " @'" K6q r'  " 4'' ~ " ~2!9 6Tret!AW A5W '(I UnD"N"Zq '|.I "|D"|P6q]'%] "<"r6'z0: "zC"zX+ ! Wv 6D Y 6D Y L'r "= v'qr "q;W 'ed "e>W ! &+  HW D +6h ! +W U SW <D r6D +6h ip"5.4i]"]3.4'D(3"DC.4M'3M3' %]" Js'r  Uvr ' (''dr,Uvd,I!M#vMU!#n#v#+ ' IUv %}'rUv#,'Uv!M! I#v A!Ar#vA@,6TcC r!*#v=M' ]VUsrc 1c" C]!3!rt3J !,r#p,;,K]!(r#p(:(J]\  m  x  (  S   UUTT q* **F*R* K* WaW( { * * * * rint W ,* **;s8{;u8;s16;u16 2;s32 A;u32;s64;u64y * *  1W 2W H Iy X ] ^y _ `K** $ & ( <W  P S    # * % & 4 = B hA l  nP } Z d d W W d k  T  Z w            K$* L L \$\LQsht"W."Wf0. in.   out 3   (u*WA#-@  2WW a F( W,!W0( 4)B38*WH+*P, X5 `6 d8 h: l; p< t=WxIse?cQ@&rt@RQdlAbSB]SFU+IDJ*KWOUXU]U+`"O@dhWkW l*m nU oU(p'0q aXs`ubx dy}Uhzp{V*    }U NC(+DP&mmhpVx    *W W, W, W, W- W- W- W- W- W- W- W- W- W - W - W - W -"W -*&*&pid w w*    (0@WPWX "W%(+ a- d. d3 d4M6MN: k(=*0>*8A d@D dHG*PH*XKL`+NLT-YW-YZ-Y^Zk _2m&ZpC qC(t*8u*@&fsx0ZH{:ZP~DZXNZ`]h 2^p qGx qG qGJ* WL<^ MWGFSK d  d 3 1" U \D(  8 F^@  aH v^P ^X _` _h _p *x _ L W  d  d  d F 6  _   P  P "_ )_    _0  68  WX _\ `` 6h  `      !W "W # $* & d ' d ( d +)$ 3` C$ D* L` N* R-` SP( TP, Y*0 ] 8 ^ < _ @ ` D +a$H dKX g7` iK lA` w x z* } ~F`  d d  $ k k*W[`e`bc W(W,U0Qrcu$0F@ D HEPcxF a "c cca  d >+$ !"2$"2+.$<c+F;@@P!*? I!A key"A?w A* B| C w!=>aIBvH  F  * "9 \  ( 8$0 8 @ "H "H "H aH "H "H "H "H#@)PhFF)+ 0W6&kp5 W(W,+0 08@ABWD :HPQmem?@* WPU_i (a0W8a@WHWLnPWXs`Whxp hxWW=$WWW$a W!$"W%&9W:?AD F kP QW(TB$0Ce3 f* gh hruhvAwA keyx3 mUV kjkeykwnkeyow;2<(=(? W @ W$A W(B W+BC2D2E2 E2('sE2,'dplE2-'pE'2/F20'avlF24'lF25'dF26'gF%27F+28 * * * * * = pte "& ` pmd "I%%%$%/lJ' pgd'$'"Jp pudp$p"$@H6I*, t6t0 k4*8 #@@o2sp*es ds"$&*(*028*X*`cr2*h*p*x2*WP** 72Ifpu 1@W(  ' #@@,z@@=`< ,x y (,My00%y8XWyh%Pzp*xw aUz0'`Zzw !! E!22e!(val k !!y!E! ,e! !!!*!  k! !!y! !U U !1"!y! !" """1"""" ""W"*,# #fmt#F#F#F#W#F#F$b$6*# $7 $88$#$F$F$F$F1$W1$W1$4W key$9 #("W$=#8$U8$$V mod$W8$$XF$Y=$ $Z ($[ ,$\#0F$u$$v$$w$$xW$yW*##*K$* %/$%1W set%3i get%5%7 }3 $V&8$   *  Ԟ( Ԟ08!@" ¨H# P$ X%`&h'+p(x)N*l+,-./ 0 1 2C3 f5 9 ; ߪ>N?@  $ &!'&% &+ &-&/ *'*  ; ' ' aW)'     0*c9(*dF*e9*gW*i u*lz @( 'CWCs+ + "W,((,(,( val, P,!P ,"P,#d,$( P,*) ,+&:) ,,#g)-:)-- ).g).(e. A?),'),(,)p((,.d ,1),2),3,4 ,5*,6* )(,&* ,%( ,/l) ,7)8,S*,* fn, g*)b*b*&*S*C/*C/*0*0d end0d1;*'cs1=d'sl1?d'wfe1Ad1Ez+'ss1Gd'sti1Id1Kd'nmi1Md1Pd 1Sd01Vd8'lm1Xd91]d:1dd<1+(cs12(csx1d 1*1+(ss12(ssx1d 1*1g, r151m* r141n* r131o* r121p* bp1q* bx1r*( r111u*0 r101v*8 r91w*@ r81x*H ax1y*P cx1z*X dx1{*` si1|*h di1}*p1*x ip1*z+1* sp1*+2 -2 2 -+p3- cwd3P swd3P twd3P fip3P fcs3P foo3P fos3P3-3PlP-* 3*- rip3+d rdp3,d 3.- fip3/P fcs30P foo31P fos32P 3).--03@2. 3A2. 3B2.PB.* K3$. cwd3%2 swd3&2 twd3'2 fop3(2-35P36P39. 3<.3>2.W.P.*P.*?3Q/ cwd3RP swd3SP twd3TP fip3UP fcs3VP foo3WP fos3XP3Z-3[l3\m3]n3^o rm3_p3`q3a/x3bP,/*@3:03; d3< d3= 0d/0*#@@3Ol003PB.3Q/3Rl0@{06*w@3^03_-=3`B.3a.=3b/0@3c00c*#@@3f13hW3kW3nd3qdxfd3td3wW3zW3W3W03{0@@313 d3W3W xfpu@3223W3*32232231 310030@@04 _24 d4dKo2*22*22*2 25>25?*5@*5AP cpu5CP6836936<36=337<B3 7=W 7> k7:}37;3 3 src7A2 dst7A 233a83 8"833 839 39! 9"31"!%',/3359<ADHLQUY : !4(:55:W: a:55:  :A5F5d5d5Wa4:#5:$3:% :' i5;<"5<#5<&5<'5<' 555= 6= k >)T6>*0'>+1" osq>-5 >/-?ɛ6-?ʛ-?˛@!6@" W @&}6@D6@D6 @D6@E6@E6 @E6@T 7@Y6@Z 3 @[6 AF7A3A DA`7LA"7Au7,F7 B37B4P lenB4PB27u7 B6dB177B8K 7Bi7 Bj Bk75yBr08 Bs Bt5LBu$BR9BTWBU6BV5BW 9BX7 BY6<0B[;<8B_"=`B`@hBa*pBbax2Bd`77BmBn3d_uBv8 0808#x{6<| k}~ M MW ! @(V0 a8*@H _L P BX B` BhPpPtPxP|3 $P{h**22 z0@H kP kT kX k\W ` h+ Vp8WFH P(*X4`>h ap9K<*'@B=BABAB+ABSABgA B{A(B A0B A8B A@B AHBKBPBiBXBB` K<=#@@ _*  (!r0!w8|@"H*P*X*` 9h{hp ka&#$̥ѥ5   w  %W i(+` aPBB!P"// 40 614 D6W<6 BF@D"=HFgPI0'XL`O BdRihSpZ~xabQrcuc$d'if6k0+n3@@oHq3Xr` ="WB@A 9W@!A!A&A97 ANA!AWFNA70AgA!AXA{A 9lAA 9AA 96<AA 9A CEBCF 9CG@CHCIBBBABDFB mntD BD  9 BBdBdBFBPB 9B 9@nB EE BE BE F CFWFWFFFFFFG2CGdGd(GYC3ctGBG&YC  C"WHC ICI C CJ CJ(K DK K KLX?X@XAXSHXT $XUaXVa XYIXZ $X[ X^MIX_*X` Xa XJI XL XQ XWH X\H XbI XEIXFaMIXgIXh _fdXiXmJXnaXoXpW X X%gJ X*G X2 H(_rtX9KH XB|H XdI XjI XqI 0Y JY Y Y Y J0Y JgJ YJ JY JY!Y" qG Y%9KY'GY(*Y.GY0 qG Y3SK saY4J Z KZ Z * lenZ *Z ([K[ \$K\%\'\( 0\DL\M#K\P(\W)8] L]d]d]d]d]d ]#d(],d0^)L^*d^+DP^8L^9L^:WH^;WLLL*8^D&M2^E$^F6^GW0 _>M_K_Z_p___ end_MKM6*` M val` ` M` M val`  ` MSNU dV dW1".W[MN0hNi6jkNcpulWmdnd od( O*0O* P<@@O d d d P P* *(*0W8#@cQ d d d d d  d( d0 d8 Z@ dH dP ZX Z` dh dp dx  d  d  d  d d d d d d d d d d#@RO0 D! d(" d0# d8%@&P'Q(R)S, dX- d`. dh/ dp0 Zx1 d3 d6 7R9R;R=*IavgG0O@cQ R0K7SLM*N*OW P$Q&S7S(R$]ISNS]S]SbS<`T0aDh di d j d(k d0l d8s Z@t dHuWPWWWWWWWW0DX0DrqTttye ee 7ede dededededeMe*e*e*e'*e* e*(e"*0e,*8e*@e*He"*Pe,*Xe*`e*heLpeeee.e We8eeeee6e{h0SZM e2^e3eFe5e ] 7^ A^fv^f.f.K^@g^g[g [g d g (g*g,g-g0{^ ^Xhc_hd0'he khg hk 3hmۀhn(ho0hq'i8 _ _J _ _ i_i4ii(_ __* _  ` `*-`*&M 2` <`GV`* V` ``M0gbgggg4 g,g.gۀ0g@g(HgPgaXgH`gg*g6g W>bdig gq(g)hgpgg k>evggWgWgWg$gWg3gggg'igi>cdigg>bbgg"gdg e g((j`hjycjzpnj|Wj}o,Kojn(jE0j*Xj#o`b@k4ck5ck6 ak7*k8*k94 k;W(k=W,k>H0k?c8"c c c c c1cldlalall Qdl!l" l$WHl'dl(F keyl)l*dl+a l,a(l-a0l. d8 extl/d@cd l3 l8#e tpl9#el: al;Pl<PQd .A mfmPm kmWm  mdmd inom)d devm* _(m+ _, uidm, M0 gidm- M4m. 8m/B@m0BPm1B`m2Bpm3dm4dm5Pm6Pm7dm8dm9Pm:Pm;Pn+fn,1"n- o"go#0 nido&o-*o4*o7[`oRgoSgoUgoXoYoZ Woc F odW(3rcuoe$HogaXoj` idompoptoqFxor 9oug*ggggfg0'php Feq q"hqHh q3 qhqvh&hqWqaa(r0hr10'r70' osqr95r;1"r<-r-r-r-r-r s ii"i"i'i s\is0'ssiXtqitr'itsE wqtviH cputwP iLxujuLujuj( lenu0'Hu(jPupij**(j*8j*K@vkvkvkv 2v3@@v iHv!*v"*v#v$Ev%'i|v&$ v'k0v(*8>cpuv*@>sspv+kH0'"k*`v6kv73v8jv:j(v;*Hv<kPv=Xv>\"kvekvfW sdavg%mvh"vi*mkMxvDmvEkvFmvH vI6(vJ3HvK6PvL*pvM*xvN*vO*vP*vQ*vR*vS*vTvU*vV6vWWvY kv\*v]*v^\iv_kpk%m*8jkwx^m x/ x/x"mx#Ax$x%x'mx(x)x+mx,x-x!n x&^m x*m x.m x,ng@M(XfxY{h(\xb*h*t6w }$?x**Eyx=$7%yvv MyIrbD*Ix RybKzc h jk%qH s(ta0u8w@{H~PXϴ`hpx \yKzxfxzdcid @@ z kJ z* [`@@~,z@Hh@*P*X*`*h*ppgd  x) k5 k?~E*LWS kZ1"]0'_a3p{hr***** *(*0*86@3D*H*P'*X3*`*h&brk*p!*x**%*0*~~@~;r*h3p~x ~w& ** k k"p0''i**0' z_z*~*3Gp~* ~ ~4e  *'6*$ W>p/ó7(pmd9 0pud; 8ȳ@EHFPpteL XptlPS4`T h.W. @NNNNN-}6-}9-}<-}G8|ǀ|*|1|1|*|* |*(|0 ǀBр~,~- 3~/ 0~0aۀ03g4ā678  xa9ۀ   " $3@@-ā lru/g00' a2 nra3 nsa4C*Ɂ6* * vald "W Y Y  -MMۂ* ۂ d ddl23rcudm$dnFdo  dvVdx2dy duo2(xd*(drdt*VddƃdF X d da d ˃a* d5Z5:Zdtd keydZdDdƕ dLdDd d B d B (dd*d*ddƃd  (d do? dDdd 7 dad˃ a k? FGp*00'8@ uid MP0'X k`$="hc2c Fc gidc 2MA6*Dcd crcuc$zK@@OgmOh1" cpuOiWOjWOkW OlWOmWOnWOoWOpWOrWOsOtOuWO{  O|kE(O} 0O~kE82O|@@nB rRuE@*9K*?8ee e! e"*e#de#d e$*(e$*0e'.e(de)de0ce1 e2 e3 eC~eD.eLeM eN~8eQeR keS~eTW*W*  F)* ) 3X 052$ ` 3rss X0=85@ kX  fn }3 arg a!* 6 b !  PhSp hT hU^DhW hXLhY$8hIъ qhJ iochK_N,p h\W0#gg agggg* gW(gW,gF0gW4gۀ8gHg"Xg"Xg"Xg"XgXg3`gdgbhg)pgx&devgξ(gN0g k4g8g@g6H&idg hg*pg$xg)gEg'ig kg.gg Fg!*g"g#6g&0g(34g)8g*\iHg-8&fqg2Bg3g56g66g76g= g>30g@4&tdgDL8+gF$@gK5PgP6hgRVgSgU 9gV 9gW 9g[6g] ъ  val  ؎ val  <i(n*v8_`0'abc d 3rcue$ reff0( v * %.WT^** fn" R. i0  4R 45W67Ӑ*Đ ɐΐݐ0pFqwr s vt au v2$(h  M    M  ؎PW kFh  BB(B8 wHБ()*+ ,0-6@. 3`/ kd0@h1Kp2 x3*4l  val ˒"W6 BEK(uidF M(gidG M H DlJH       ( 0 B8 B@Hr* W(W, 0 8a@ !d8$r@8=9V:V;V<V=j >j(?j0@8 V@Bj[@KoXD6EjFOG _HjIj Jj(KV0N x8O@QHSP O@;_Tss6<d6<}6<sxYZ[d\d]d^d _d(`d0aZ8cZ@dHeLfdPgdXhd`iZhjp8>WWWW WWWino  $( $0iWiy* WWW WWWWXęVݙݙV (#0A8#@_HݙP ę@dBݙ@Wə@y@KA@(Z@Z>F=V8  W {h 0 ϚH&ops!ߚ 6<Ϛ*ߚ*d*7w}M a83M4ޜ564aaRvؐfŜ  ڝ( 0 %8 ?@ XH hP ԞX` h )p Hxa  { ޜwޜvʜVVޜ%%*8DEwFVraGI *JW KW$L(M*0՝wVW՝vhޜ wVWWޜaߝ%V?ޜ*Xޜ0Dhޜ]ؐ(+Ԟ,-./  mVޜޜ6ٞ ޜ)ޜCޜCC.aVޜMw fwؐ7^WE =$71!1 A&A6<677`  W  #@Z[>\a]^` b(d0e8f=@h`HjPkXm`oجhppr #xsPuivy{ҭ}6y    % / 9(w 3pidW^Cuid MM $  *WW WW 7 <6 dE )|=*$+3,-C$Pa#0ܣ  0ܣR*m A A Ʈ߮ ( A0 8V@H0PX0`Shqp x  گ    m6     ¥ǥuK)* + ,b-.< /*(0 k09 _4:V8< k@=3D> aH? aP@XA6`BC)E kF6HIK a2QӾ֥   *KD*KT*$$afFdW Tpos $ Ww˧w*wF HؐHWM gg[gg N/wGw wW*Ǩw6<w+wNw0lwSw q*w****c7`wWƩw7`W4w4vh9> fwH{{w kwwWߪwwWW  HW 9>6< 9W%F\ 96<\C6<f6< 96< 9k 96< 96< 9=6< 9F`6< 9kB6< 9k_e6< 96< 9WӬ 9ӬdBPW9eݬ# 9 F6<FddK (i6<U6< 9wWkn6<wkҭ 9 9׭ 9 6 9" emt Hh *tt6<;e.W6<@Ʈ6<߮6<ˮ6<@@~0@!I 9IN 5q@X{ 9v@گ@F6<߯ @g  %  /4 9\Fa>"q*@@$AFBC)D EG( sdFE0Gg81IW1JW1KW1LW1MW qq3Zbiok.  k2w 4 8 a@*HPdX4` >hpr  kt Cx"W|E|Nϲ|T ߲|Z|e ߲Բ'9t**e| |C||C*R6*|m |*ϲ?(0óvma12 03 *4*5* r7>? =@ `*%H****'a9WM'9**f**aFϴ`Դ`*$*  f*ADk rev* fEE k kEF3rbD nsc0W8< k>e@ idd` ahp3rcu$x  opsV!` EhQu "$ % ո & (( 02 89@: H= &P@?XA ]` Q [ (dir$ p J a knEw{ a6 6@`h x    @  A %Pzppapz{aa{aո{a{aڸ pG&p?p+]pD"W0'(b) ր* + , - }3( Bac Bc*@*F* k*mb *n *o& X*0*1*2 *3 a*4 *5 (*7 ޻0*9 8*; ޻@*= H*?)P bb k4)4kW)>u)\4BVw)޻w)w))w) *Y* w*  .w)4^)4F|` 3q ɾX0tBu Wv\w!ax*y z ( BW)LYf9(zz$kcM } ~ >buf) *)*?K:c*oľ :t F  oӾ#qξ@pHFP(Xbus`xh ap ax670 &msi~(8@dHdPX `hx } _&idP3 !!a# I$% '#) + `, a- b. c/ d9 e< f Ӿ*a a  B^ D^ Ec F G H Ia !W"W h  A K : @N O* P Q  * A . PiQi(    i]Qu Fd(%Ed%FF mod%G8$ ops%H!@%I <%J%K n%L(arg%M a(str%N(arr%O;%V%WW%X  %\6 max%^W%_W num%` ops%a!@%ba 6$f%&$0(n2)nRD* * W  K*7`-?.q mod/8$@0)H mp1DP2WX ?8567 9 ; <(= $0IF8$F8$$8$.W>S<8EmodF8$0GR<PpqarastWImtnwS  W !&KcRP*& Z ddkd } " a0a aaHa 3 vhaa f(50 MN PWRW TW(***** 0=3rcu1$2g3=L6* HIJK LM*N :; <%9  I!9"9#9 $9(%90&98'9@(9H)9P*9X+9`,9h-9p.9x/9091929394959 9ξ*Iξ>.U.WlHxy 3zW|W}6~0@ #8V)  ) !) ") #) $) %) &) ') () )P3 W k@ @ A B C D E0DPd'i5u k kW                WNNddddz  (&qos0+k,F id-./3 0u(1E02*X3 `4 h5 p6 x7 8*9*:*;*<* dev=ξ1> 1? V pξA ops9 9 I I8ξ8ξW$MNNFOFP!aQ!aR!a Ts(U0V98W I@X IHY IP[9X\9`^h_9pa9xc9d I pmfh =gξgn`naF busbd8$eFg h-$jZ(ki0m98n I@o9Hp IPqXr9`s!aht!ap pmvxw I pys lSxξ%N`2b3F5!a6!a89 ; (< I0>98@(z@AHC P pmEX {{kgbc0X#YFZ!a[\ ^ I pm`( #"W-P PU _d nl{WW*.W .W78~ 0!̀" .W1.WB.WO7cd&e2f4g lidh L  d dcma     7 ,7. 7 gCgD gI *gN>gS> AegAgBDgC% `d  W W % / 9hVfnfo^fpWfu#,fw kfx k`fz kf{ kf~W8f3<fK^@f'iPfipfxHh'6* '@jk lenl wpmnopqrs t(**"gm gtegugvgwgxgygz g} Wg|g ggg g g(g-0g 8gP@giHg Pg ~Xg`g hgpg8$xgg  q|    Hggqg @gWDg&H$g  W$g] Wghfgigj gk*gl*gnWgoWgpW gqW$grW(gsW,gtW0guW4gvW8gwW<gxW@gyWDgzWHg{WLg|WPg}WTg~WXgW\gW`gWdgWhgWlgWpgWtgWxgW|gWgWgWggggWgWgWgWg $gsxWa1Pggqg @g H6*        ) 3 = G Qggg.Wg,.HWbebeW*W-bWFFK 2iU~*nbWfab{b" b *>/NHCbIt K # M #78 /9 /: /; < > #? ;A ;B / C /$D /(E /,F0G@H /P u1N STO #VP #XQZR[S /\T ;`UhVi*W*;1< /= #>1A*0  sb @ in 4 out 4WW algW$()%* gfp0,(8`~  [@[at=yy4AeCL*8HQ6 rqR!ySWSW noT niT VWWWWW kinY"(Y "0Za8[@Mkku06 p4 3 4 W 4W 4*W 4k 4i5 R* 4 gd RF* 6gF # F uiO? `6O? `6ES:Wai5O@FFB uS^HHvhvh4PouP:d5>F:d5P: d5S`yFWhF2a 0F8a,^0F?aH0SWccWPvcPIu[ W\rqCy]4Gsb@4~buf~!k!GerrTH!W!*i99898wT44~!Hhj8495U TsQ2%UsT0oU Ts8!W!*i989869@ ^ : U :l5: KU @U : U @U %2Uv5M%WT|%#U~TQ|R}%U T3Q1R0%U~T 5[H \sbH9@\dsbI[]I)a]I34K 6 !L!MWGiMW!Nk!NkGerrOTmH!kk89rHTr4r4!rHjr89r5U T|Q2%U|T0oU T|: qIU :lr{5: nU ^wU : TU @U %U 5v%rU1T~% U T3Q0R0%+U %JU %oT Q~%T %T QR5[0UGi2WH!9k8e!9U!9ak9!!l/ @MZ[k  E| T Q @?U @BU 5Zk 6_1l?_P_^5H2C !k8+Gn%k5vcUv: 'U @"hU ^U m/c`am2Aa/E6A %a// ;/ G0A|.ak/|D/|P0nWA%W/</nhAz0/zC0/zX*o/5S4o]/]3S4O'3O 3A%W?/JAWlsrc1c/CWG`_&*pw_A*`+&*pw+=res-*)p) **F*R) K) W 4t c) t 6*q` T8 U8 V W Y= Z  [(msg ]B0 ^d8 `@ b iH c P d XocK P d P iGrint i e gu ) t ) ) i W ,) *)7s87u87s167u16 17s32 @7u327s647u64aW)  i ) * i 1W 2W H I X ] ^ _i `i)) $ & ( <W  O e     # ) % & 4 = B h@ nO } Y  c  c  W  W  c li U Y x    K%*MM ]%]MRgst*W@{!-@ <2WW G( W,!W0( i4)r38*WH+*P,<X5 i`6 id8 ih: il; ip< it=WxGse?Q@$rt@ROdlASBSFV*I7DJ*KWOVXV]V*`"O@dhWkW l*m in%V o*V(pO'0q Xs`ubx idyUhzp{4V* i i i iU iND(*7DP$mmhp(Wx i i i i*W W, W, W, W- W- W- W- W- W- W- W- W- W - W - W - W -"W -*V*$pid  *< <<(0@WPWX "W%(+ - c. c3 c4N6}N: l(=*0>*8A c@D cHG*PH*XKL`*N MT]YW]YZ]Y^LZk 2mVZpC qC(t*8u*@$fsx`ZH{jZP~tZX~Z`^h b^p Gx G GJ* WMl^ MWwFK c  c 3 a" U D( <8 v^@  H ^P *_X 4_` _h _p *x _ JL W  c  c  c F 7  i _   O  O "_ )`    `0  B68  WX `\ 4`` B6h  >`        i !W "W # i $* & c ' c ( c *)% 3H` C$ D* LM` N* R]` SO( TO, Y*0 ] i8 ^ i< _ i@ ` iD *a%H dLX gg` iK lq` w i x i z* } i ~v`  c c i i$ l l*W``bMc W(W,U0Orcu%0G@ iD<H FPcxG  "c cc  c >*% i!"3$"3*.%<c*Fk@@Q*? y!@key"@? A* B C Q=>yAi uH   F i Y "h   2( h$0 8 @ 6"H 6"H 6"H H 6"H 6"H 6"H 6"H!@)XP hFFXZ _WB6$kpd W(W,Z0 _8@ABWD iHPOmemn@* W B(0W8@WHWLPWX`Whp xWWm$WWW$ W!$"W%i&9W:?AD F lP QW(Tr$0B ec f* g huv@w@keyxc UV l5jkeyknkeyo;b<'='? W @ W$A W(B W+BC1D1E1 E1(%sE1,%dplE1-%pE'1/F10%avlF14%lF15%dF16%gF%17F+18 * * * * * mpte "V pmd& "y%%%J"%/H' pgd'>"'"Hp pudp2"p""$@HfI*+=tft0 l4*8 $!@@2sp*es ds"$&*(*028*X*`cr2*h*p*x2*WO** g2Gfpu 1@Wi(  ?' !@@ +{@G@m 8(!+y 0y (i,}y00Uy8Xyh%zp*x"x z`'>`z'xQ!u!11!&val l-!Q!!u! ,! !  !!* "  l! %"! ! "T!T! "a""! "F" #"#a"#i#i#i #i#W#*,$9#fmt$F$F$F$W$F$F$b%6Z# %7 %88%#%F%F%F%F1%W1%W1%4Wkey%99#('W%=#   8%Uh$%Vmod%Wh$%XF%Ym$ %Z p(%[ p,%\#0 F%u$%v$%w$%xW%yWZ##*K$* &/%&1Wset&3get&5&7 3 $U&h$  6 Y  ( 08!Ψ@" H# P$ X%(`&Ah'Zp(Ax)}*+é,-.é/ 0 @1 ͟2r3 5 9 ; >}?1@O % '!?''% i'+ i'-'/ *O'*  ; O' ( aW*(                    0+ci(+dF+eh+g+i +l o( (BWBs, , 'W-(  (-)-)val- O-!O -"O-#c-$) O-*B) -+&j) -,#).j).. B)/)/Xe/ @o)-')-(-)( )-.c -1*-2#*-3i-4i -5*-6* *(-V* -%( -/) -7)8-*-*fn- *(***V**B0*B0*1*1cend1c2;+%cs2=c%sl2?c%wfe2Ac2E+%ss2Gc%sti2Ic2Kc%nmi2Mc2Pc 2Sc02Vc8%lm2Xc92]c:2dc<2+&cs21&csx2c 2*2,&ss21&ssx2c 2+2g -r152m*r142n*r132o*r122p*bp2q* bx2r*(r112u*0r102v*8r92w*@r82x*Hax2y*Pcx2z*Xdx2{*`si2|*hdi2}*p2*xip2*+2*sp2*+3 2-3 3 2-,p4-cwd4Oswd4Otwd4Ofip4O fcs4Ofoo4Ofos4O4-4OlO-*4*-rip4+crdp4,c4.,.fip4/Ofcs40Ofoo41Ofos42O 4)@.--04@b. 4Ab. 4Bb.Or.* I4$/cwd4%1swd4&1twd4'1fop4(1,.45O46O49/ 4</4>b.V@.O/*O$/*?4Q0cwd4ROswd4SOtwd4TOfip4UO fcs4VOfoo4WOfos4XO4Z-4[l4\m4]n4^orm4_p4`q4a0x4bO -0*@4:O04; c4< c4= O0c_0*!@@4O004Pr.4Q04R0@04*v@4^04_7-94`r.4a$/94b_0@4c01c*!@@4f14hW4kW4nc4qcxfd4tc4wW4zW4W4W040@@414 c4W4W wfpu@4b24W4*4b24b241 410041@@15 25 c5cK2*b2*22*2 26>36?*6@*6AOcpu6CO780379K37<K37=K3038<r3 8=W 8> l8:38;03P3src8A1 dst8A 13393 9F"933 93: 4:%" :"3a"!%',/3359<ADHLQUY ; !#5(;e5;W; ;e5;  ;q5v5i55Wi#5;#5;$3;% ;' 5<="5=#6=&6='6=' "656> B6> l ?)6?*`'?+a"osq?-'6 ?/,@ɭB6,@ʭ,@˭A!6A" W A&6AD6AD6 AD6AE7AE6 AE6AT F7AY7AZ 3 A["7Bv7B3B iCB7JBR7B7+v7C37C4OlenC4OC277 C6cC187C8{ 7Ci,8 Cj Ck,85xCr`8 Cs Ct5JCu%CR89CTWCU7CV5CW=9CX7 CYf<0C[k<8C_"7=`C`AhCa*pCbx2Cd7 8CmCn3d_uCv18 `8`8!x{f<| }}~ M NW àà!; A((W0 8*@H qL P BX B` BhOpOtOxO|3L %Oh**Ei11 y0@H lP lT lX l\V;`Oh*9Vp8VuH P(YXc`mh pB9t{<*'@C2=C8AC8AC[ACACA CA(C A0C A8C A@C AHC{BPCBXCB` {<2=!@A qt*  (!0!8@"H*P*X*`=9hhpi l&ɥ#$5  @ "x J TW (*£` OBB!O"^/ c0 e14 s6W<B6 BF@D"7=HFhPI`'XLi`O qdRihSpZ.xaHbHOrcuc%dWifB6ki0*n3@@oHq3Xr`<='WC$A i8A=9W$AiQAQAVA897=Ai~AQAWF~A8`AiAQAAiA=9AA=9AA=9f<ABA=9BiA DE5BDF=9DGADHiDIȎDBDBIBANBEvBmntE DBE =9 NB5BiBBvBB=9B=9AB FF BF BF G:CGWGWGFGFGFHbCHcHc(HC3ctHBH&C :C'WIC     JCJ C CK DK(L 7DL iL LMlDM*MlDMlD7DM DM lDMDMqDMlD ND2N 7DN N DND'WO E @O'E2O(DO)  O*E(O+F0O,8O-9O.:O/;DEEEE@@P/FP0P1WP2  seqP36P4EP5D P60P7 8E(QbFQ Q*Q rFQO mFmF FbFRFRiR lRF FS FSF*F* S8FTGT l TFU+8GU,U-xVzGVzGVW`V*hmaxV*p*G* W GsigWF WG XR XSGG XU  XVGGWY H Y i Y  Y GY'=HY(Y)Y-{HY.Y/iY0 HY1iY5HY6Y7Y8 H Y<HY=Y>Y?iY@YAYS(IYT $YUYV YYLIYZ $Y[ Y^}IY_*Y` Ya  YJI YLi YQ  YWH Y\(I YbLI YEIYF}IYgJYh_fdYiiYm5JYnYoiYpW W Y%J Y*H Y2=H&_rtY9{H YBH YdI YjI YqJ0Z JZ iZ iZ iZ 5J0Z JJ ZJ JZ 'KZ!Z" G Z%iKZ'GZ(*Z.GZ0 G Z3KsaZ4'K [ K[ B[ *len[ *[ (\K\ ]$L]%]']( 0]DJL]M#K]P(]W)8^ L^c^c^c^c^c ^#c(^,c0_)L_*c_+DP_8M_9M_:WH_;WLL M*8_DVM2_E%_FB6_GW0 `>M`K`Z`p```end`MKM4*a Mvala a Ma Nvala  a MSMNU cV cWa"-W[}N    0hNi6jkMNcpulWmcnc oc( 5O*`O* O8@@O c c c O O* *(*0W8!@Q c c c c c  c( c0 c8 Y@ cH cP YX Y` ch cp cx  c  c  c  c c c c c c c c c c!@R5O0 7D! c(" c0# c8%@&tP'tQ(tR)tS, cX- c`. ch/ cp0 Yx1 c3 c6 i7R9R;R=*GavgG`O@Q R0KgSLM*N*OW P$Q&SgS(R"]yS~SSSS8`T0a7Dh ci c j c(k c0l c8s Y@t cHuWPWWWWWWWW0EX0ErqUlSTS"^UU<USdrqUjU(W (W (W(WHUzUXbjUXsOUUUT UV  VU%V*['O' /V8(Wf< h 1@ lD lHDP*` *h)p*x q3h 9VYpidpb7Wb9 Gb:Wb; 3b<=9inob=cb?# b@@bB5H3rcubC%`bD3p-WW* cWcWcfWdoXYdp`'uiddq Mgiddr N ds Mdt Ndu Mdv Ndw M dx N$dy W(dzY0d{Y8d|Y@d}YHd~YPdtXdLZ`dLZhdLZpdLZxd dd.dJd+p WXYYkeyeLZeGe+e semeh(ePe XĄ`e Bhuide Mpgide Nte xe|e~e e*1sebY QZ [Z eZ oZ yZIXf^^f_Gf` lfaifbi fcfe5 fh<8fkJ@fnXfqi`fsidft<hfwipfxWtfzx1fW1fWfWff2fEf itfffLf$hf lfWfi:ttyf9fCf F7fcf cfcfcfcfcfNf*f*f*f'*f* f*(f"*0f,*8f*@f*Hf"*Pf,*Xf*`f*hfJLpffHḟf]f WfgfffffB6fh0ZK fb^f3fGf5f  ^ g^ q^g^g]g]{^@h*_hh h c h (h*h,h-h0^ /_Xic_id`'ie lig ik 3im in(io0iqWi89_ _J _ _ j`jcjKjW_ `/`* /` 9` C`*]`*VM b` l`8G`* ` `K0hbhihihihc h,h.h 0h@@h(HhPhXhw`hih*hB6h W:bdihJ h(hXhhphh l:evhhWhWhWh$hWh3hhhhWihi:cdihhi:bbhh>"hch h()(`hkyMckznk|Wk}p+{ok,o(k F0k*Xk#p`b@l4cl5cl6 l7*l8*l9c l;W(l=W,l>I0l?b8Rc c c c c1idimKdmmmim dm!m" m$WHm'dm(Fkeym)m*dm+ m,(m-0m. d8extm/e@dKd m3p m8Setpm9Sem: m;Om<Od /@ nfnOn }nWn  ncncinon)c devn* q(n+ q,uidn, M0gidn- N4n. 8n/B@n0BPn1B`n2Bpn3cn4cn5On6On7cn8cn9On:On;Oo+fo,a"o- p"3gp#1nidp&ip-*p4*p7`pRhpS!hpU!hpXpYipZ Wpc G pdW(3rcupe%HpgXpj`idpmipppitpqFxpr=9pu&h*hhh3gfh`'qFhq Ger r"Fhrxh r3 rJhrhVhrWr(s0hs1`'s7`'osqs9'6s;a"s<,s,s,s,s,s t BiGiRiRiWi tit`'tt6iXuqiurWius F wquviHcpuuwiP iMxv8jvMv8jvHj(lenv`'HvXjPvpiHj**Xj*hj*I@wBkwBkwBkwi 2w3@@w iHw!*w"*w#w$ Fw%Wi{w&% w'k0w(*8:cpuw*i@:sspw+lH`'Rk*`w6kw73w8Hjw:Hj(w;*Hw<kPw=iXw>i\RkwelwfWsdawgUmwh>"wiZmkKxwDEmwEkwFEmwHi wIB6(wJ3HwKB6PwL*pwM*xwN*wO*wP*wQ*wR*wS*wTwU*wVB6wWWwY lw\*w]*w^iw_lpkUm*hjlxym y0 y0y"my#@y$y%y'my(y)y+ny,y-y!5n y&m y*m y.m y\nlmopsyfnn \nany2ny4*y6Wy7W 'Wk@n   'WkHn   kp'okqnkriks,o 'okUokknk*|k{o2k%k*Cko1o}Uo@kpknk*k*k* k (ki,kp03rcuk%8kCpHo5nkCpkidkpRp4*kmpkrp mp(zpza"zYzzv { Rq{c{& {)hldt{*Wq8{.*@{9B6H{:h{;frp{= lx{C1|{D'~ Rq| ar||*alt|*|*|* |*(|b0|8|@|H|P|X|`|h|p|x|| |! \qar {Fp\r^ `WXr&lruYwr d eir j * k*(R srh(Wrs* (ujsz*pp{os|*}*~`' jss*s8t }8t}ref}/8}WH}h}Wl}*pops} x}}isC(Qftr stssJ%t W  lH tval*"t;MtN PW5JtXlruKt5WuX Yt;@GuI*tU(WV * t([ l0\ l4^*8D@Fuu9j$;(m vn*o*q lr ls lt lvW D@l+vu9z$;0}v~**    (; v**D@|v+vv9$8Dw+u+ v@+v"* w8 "x  3 =  `(W f<(W0W4]Y8NB@FP p  x#$ q% q'+kw5Dxctx6Ix Dx=yx>+h@M(XxYh(\xb*h*t6wi }i$;y**D0yx9%5Uyww~ }yGrb7D*yx yb{zc 'h 'j@kTqw s"(t0u8w´@{"H~"PX`h5pNx y{zNxxzccidii @@ z lH {* `@@~+z@xh@*P*X*`*h*ppgd  x) l5 l?~E*LWS lZa"]`'_ia3phri***** *(*0*86@3D*H*P'*X3*`*h$brk*p!*x**%*0*~ @kr*h3p)x<."x&8**i l lRp`'WiB**`' zz* *3wp*  $de 3 =*V4*" Wmp/7(pmd9  0pud; (!8@EHFPpteL  XptlP4`T h-W]      @ LLLLL,~6,~9,~<,~G8}}*}1}1}*}* }*(}0 A,C- 3/ 10 03467i8 xa9  ˁ " $3@@-lru/0`' ˁb2nrb3insb4C3*B4* Yvalc B'W    ǂi ii,MN *  e eela3rcuem%enGeo evex1ey eua&xe*(eret*eeeF ,W e e e % 5* eAFidLZdiLZ ee5keyeLZeCeĄ eJe7De e B e B(e1e*e*eee B (eL e; esee 5 eeL  n, Gwp*0`'8@uid MP`'X l`$m"hdad Gdigidd aNp4*Cd dircud%,I@@PgPha"cpuPiWPjWPkW PlWPmWPnWPoWPpWPrWPsPtPuWP{  P|E(P} 0P~E82P@@A PE@*iK̇*?8f5f if! f"*f#cf#c f$*(f$*0f']f(cf)cf0f1 f2 f3 fCfD]fLՈfM<fNՈ8fQfR lfSfTWڈ5$*W4* 4 >GX* X b<0ʉii52% ` 3rss 0l85@ lX @fn 3arg P* eb@ P  OiS iT iUCiW iXJiY%8iIqiJiociK_}+ i\W0!hh hh!h+h* hW(hW,hG0hW4h 8h/Hh6"Xh>"Xh6"Xh>"Xh5Xh3`hidhbhhXphHx$devh(h}0h l4h?8hI@hB6H$idh ihh*phSxhXh FhWih lh]hh Fh!Yh"h#B6h&i0h(34h)8h*iHh-g$fqh2qh3h5B6h6B6h7B6h= h>30h@i4$tdhD{8*hF%@hK5PhPB6hhRhShU=9hV=9hW=9h[B6h]  Î val ͎ val  <**/iWn*vǏ8_``'abc d 3rcue% reff*0W v * %̏-WT)    ?** fn)'t     . 0  4 4ِ5W6ِ7*  0puq"xr s t ui v1$(  M    N  P2W }u  BB(B8 "xH7В()*+ ,0-B6@. 3`/ ld0Ah1zp2 x3*4  val 'W6@   BEz&uidF M&gidG N H DLJH @ @ @ @ @  @( @0 B8 B@Hi* W(W, @0 @8@ i!h$@8l9:;<= >(?0@8 iAiqi2iAzXDeEF~G HI J(K0N 8OŖ@QޖHSP 2~Aij2f<@if<iޖf<ʖxYҗZi[c\c]c^c _c(`c0aY8cY@diHeiLfcPgcXhc`iYhjip8mWWWW WWWino  %( %0Wҗ* 'iWWW WWWWXЙ   /(R0p8R@H P 'iAiiBՙi AWi*Ai*iMAzM4ipAMWiAmulU8  W h 0 H$ops! f<***5wC}| 83|4 5i65Cќ+ D ם  (;0 T8 n@ H P X&`:h Xp wx ͟ i ֜i "x vi+(WD(W 0TTY8DםE"xF(WraGI *JW KW$L(M*0Ii"x(WWh ܝi;"x(WWW T(W@n Y 1s (+,-./  i&(W  ei: +X ?r rr]i(W |i"x ͟"xŸiҟќ5^WD;9%5`!` p&pf<e5g` B W  !@Z6[m\]^̫` b(d00eI8fl@hHjIPkXm`ohp4pr Rxsuvy{}$Le Ƞ6 @ J T ^ h("x 4pidWCuid MM i$ F *WW WW 5 kB6 cD )9*%+03,-r"P!0  i i0 Pʉ* p p  "( p0 28@KH_PKX_`hp 2x  " ; ; 2 !eЙ  ӥĥ Υ إݥ  I)@* + ,b-.k /*(0 l09 q4:(W8< l@=3D> H? P@XAB6`BiCXE lFB6HIiK 2Q E O YKs*K*$"FicW§ pos " W"xi6"xBӂY"xFӂ;iwwW| hhhh }^iΨ"xY"x Ө"xW*i("x iAf<"x-iZ"xFi}"xi_ii"xii"xi *"x****ȩdg`"xӂW@"xӂg`Wic"xichhm E"xiw"x "x"xW"x"xWi''W, iO'wW6=9mf<=9WTF=9f<riȎf<ià̫f<ii=9BiѫiȎf<=9}i0=9f<=9iIf<=95ilȎf<=9FNiȎf<=9}qiȎf<=9}qiȎf<=9f<=9WiȎ=9i/ȎB/OWie R=9B9iuf<uccz Wif<iif<=9"xW}iȎf<"x}ŭàȎ=9ii$Ȏ=9àiiBȎ=9BG )ie=9BQ mt xh *f<j-WѮ   f<AѮf<iif<i"f<2A'iKA7i_APix=9x} diABi=9AiB AiFf<2;Ah'iOOT @ ^c=9iFm6"*@@SAFBCXD Ev(sdFt0G+h81IW1JW1KW1LW1MW bYbio֚]@ L l2 -4O8 @YHPcXc` mhpr  lt rxBG'W}Eɲ     }N}T }Z"}eE ɲV"hiE8t**i'e}}r}J}r*4*} }*N;(0vma1 2 13 *4*5* 5>? m@ ' i@ *,iT Eiw ***YVhW|Vh***´ i *iiǴF i >`>`5 *$N *: *qDrev* tt l ltF3rb7Dnsb0W8< }>@idc` hǷp3rcu%x ops! th "͸$ %  & (( <02 89@: <H= UP@nXA `   ·&dirS  y ·knt"x B6 B6@i`h Bx    @  A %zi̷i͸ӂҸӂ <BYUAin Zis'W  0'() * +8,B - 3( Ab..3 Ab=+o+F+ }+m +n1 +o&;X+0,+1G+2 +3 +4 +5 (+7 0+9 8+; @+= 5H+?XP 6E, @}cXciGJ}X@imX@icA(W"xX6B "xX@B5"xX@iiX"xX@ :++ + ɼ ]XcBɼXcF` 3 Xμ0tqu vw!x*yǽ z ( qX{i(Sbǽ؂݂̽K }8~8Hi:bufXi BH*BX*?Kic*о ii F˾ ˾iվ !@pHFPWXbus`h p xB6f0K $msi(8@cHcPX `hx $i q$idO3 !!# x$.%8'#=)<+ `, a- b. c/ d9 e< f t*  6  B D E F G HC I 6 !W"W  A;K : @NK O* P Q  * @ . OjjW     tt i,F,(&E&FFmod&Gh$ops&H!o&I ;&J&K 1iB,&L&arg&M &str&N&arr&Oj&V &WW&XB   &\emax&^W&_Wnum&`ops&a!o&b e%f&&%0(2)P7D* *i  W   K *7`-n.mod/h$@0XHmp1sP2WX n856G7 9 ; / <C(= S0Bx F/h$FiCh$4Sh$H-W>   88EmodFh$0G8PpqrstWGmtnw K KWBB PUJ1P*&  ele  " 1  H 3ii h (50 MN PWRW TW(7***** 0l3rcu1%2+h3l{4* HIJiKi LiM*NG 7:;i <Th  x!h"h#h $h(%h0&h8'h@(hH)hP*hX+h`,hh-hp.hx/h0h1h2h3h4h5h ihYxm-iU   -Wl    HxAy 3zW|W}B6~0F@ A!8(  ( !( "( #( $( %( &( '( (( )O3 W @ @ A B C D E0EPcWi5 l lW                W}}iicccc  ($qos0+,Fid-i./3 0(1 F02*X3 `4 h5 p6 x7 8*9*:*;*<*dev=1> 1?  @ >opsh Nh x xgN>igWSM}NFOFP!Q!R! T(U0Vh8W x@X xHY xP[hX\h`^h_hpahxchd xpmfh li`aFbusbdh$eFg h\$j(k0mh8n x@ohHp xPqXrh`s!ht!ppmvxw xpy iiT}`23F5!6!89 ; (< x0>h8@(@AHC PpmEX B}b؂݂0XRYFZ![\ ^ x pm`( R'W-     B؂݂WW*-W<   -Wf   8 0!" -W1      -WBB  -WOf  cd&e2f4Bg lidh {  c dcma    ) 3f [f] f hChD IhI YhNmhSm pehAhBshCA% `c  WO ! WO T ^ hUgnBgogpWgu#[gw gx `gz g{ g~W8g3<g{^@gWiPgipgxwV4* V@jklenlwpmnopqrs t(**'thm8   hthuthvhwthxthythzt h} Whh hhh hC hC(h\0h 8h@hHh Ph Xh`h hh phh$xhh 4     Hh)hh @hWDh&H"h  W"h] Whhhi.hj;hk*hl*hnWhoWhpW hqW$hrW(hsW,htW0huW4hvW8hwW<hxW@hyWDhzWHh{WLh|WPh}WTh~WXhW\hW`hWdhWhhWlhWphWthWxhW|hWhWhWhhhhWhWhWhWh8"hiW`Phhh @h H 4*   & 0 : D N X b l v hh5h5-Wh   [i]wWib biC@W*%W\bWHiu@uz ai@@*ibWBbi b1" i4b I@9Y@Nim@^}wrbI K 5 M 578 A9 A: A; < > 5? MA MB A C A$D A(E A,F@0G@@H APu1N TO 5VP 5XQZR[S A\T M`UhVi*W*'    DREFRb*0  sb Ain cout cWW algW$()%*gfp1,(Y B i|A|i^icbBM*YHQWrqR!SWSW noTiniT iVWWWWW kinY1"(Y 1"0Z8[@Khz0hW6 3 6 W 6 -W 6 65 R* 6 g RF* 6gF # h=21=81=?1E@ 6Ml* ; iE@ 6EiM;iJJWi5=  ifEAF= W iiM^ihhc= M iiZ;J5>=;$J5iZ; <5iM`i\FWMWwdWZbEl b[d i6:\rqdF]ecQsbgA6h~.o.piQerrp iR|RS.uW.u*i>uj>w?>?wR6#5~.Sz?F>< U TvQ2#$UvT0 U TvS.W.*i>j>?,>N,s v<H YF3 > eU F<FL }BW wU N3> eU FL W wU N3> eU #<)Us#GUvT #dUvT3#U~T~QvR|#OUv#OUv#%U T3Q1R0#fU~T #O,Uv<"[4 iC.\sb4<A\dsb5|]5)]53iQdfl7.68 B6 69 R^SW.H?^.J 3.J ^lJ }}k   > T Q h? .N3.N<<FL TW wU N3WB> eU  wUs#vU #U #fUvT #U <#fT  fUvT QR'bC[,i1^0_k__<\ .?&9Qn"< wUvFL W wU N3> eU ^3 > eU ,l/b`Hl2@g/Egf@ %/ ;/ G1@|./|D/|P1mW@%W/</mh@z03/zC1/zX*nL/54n]e/]34E'w#4E#4@%W/J@Wsrc1d/CWG`_&*ow_A*`+&*"ow+=res-*-5 @/}6/P/\@U@a y@ @ @ @ int a ,@ *@Ss8mSu8Ss16Su16*Ss329Su32Ss64Su64ja: ~ !@ !/ ! !1a !2a !H !I !X !] !^ !_ !`U@@ "<a # H #? # # #  ##{@ #% #& #*/ #4 #= #B #h9 #nH #} R # \ # \ # a # a # \# W# #@# z#R #c ### ## ###U/"#8#8# HH8=U}U=/W9-0   \/ M  *( {*6-@  O3 a a  M  xG( a, !a0 ( 4 )38 *aH +/P ,X 5 ` 6 d 8 h : l ; p < t =axcse ?R@:rt @jSkdl AT BT F|VA ID J/ Ka OV XV ]VA `"aP@ d ha ka  l/ m  nV  oV( p'0 q MX s` ub x d y"Vh zp {V /             "V     bO  vD(A DP:mm h p Wx         / a  a,  a,  a,  a-  a-  a-  a-  a-  a-  a-  a-  a-  a -  a -  a -  a - "a - / *:pid  c  c /     ( 0 @ 2XP 7XX  "oX % ( + M - \ . \ 3 \ 4N 6N : W( =/0 >/8 A \@ D \H G/P H/X KOM`A NM TY WY ZY ^Z k 3 mZ p6D  q[D( t/8 u/@:fs xZH {ZP ~ZX Z` ^h  ^p  Hx  H  H sK /   a 8 ^  YN a F K  \   \  c4  b"  HV  E(  8  ^@   MH  _P  _X  _`  %`h  /`p  /x  4`  L  a   \   \   \  QG  7    >`     H   H  "H`  )`    `0  68  aX  `\  ``  6h    `          !a  "a  #  $/  & \  ' \  ( \ A )  3`  C$  D/  L`  N/  R`  SH(  TH,  Y/0  ] 8  ^ <  _ @  ` D A aH  dLX  g`  iTL  l`  w  x  z/  }  ~`   \  \     $    W  W / a a  a Nc c  a( a, jV0krcu 0 xG@  D H FP Kdx xG  M "Ud _d id M    \    >A    !"3 $"3A . <sdA Fl@@@#u7pad!/? @~&@~)@ $ /$!9 key$"9$?] $A/ $B $C %% mod%k$%] $=$>M/'']M2'^H& & P& & T& "c&  & -(& k$0& 8& @& 7"H& 7"H& 7"H& H& 7"H& 7"H& 7"H& 7"H6@'6'a'''P')h''P'P'S'c' h'a'6:kp'm 'a('a,'c0' h8'{@'{A'{B'aD' rH' Pkmem'w@''/' a'''' '' ' ('M0'a8'M@'aH'aL'P'aX'`'ah'p' x'a'a'p$''a''a'a'$'M' a'!$'"a'%'&'9a':'?'A'D 'F W'P 'Qa('Tu$0(ed (f/ (g (h (u(v9(w9 key(xd  (U(V W6(jkey(k(nkey(o );c)< )= ,)? a ,)@ a$,)A a(,)B a+ *B*C**D*,*E* ,*E*(;s*E*,;dpl*E*-;p*E'*/,*F*0;avl*F*4;l*F*5;d*F*6;g*F%*7,*F+*8 +/ +/ +/ +/ +/+ n pte+ +"W+  pmd+' +"z,%,%%K2,%/],' pgd,'?2,'"],p pud,p32,p"2, %"@-Hg-I/Btt0- W4-/8%6@@..3sp./es. ds.".$.&./(./0.+38./X./`cr2./h./p./x.J3./.a.H././. 2cfpu. i2@a (/ / '6@@- B{@-@n T-)!By-- y -{(-,-y0C-y8-X-zh-%{p-/x-x- M-{-'-`- {-x-0R!00-0v!0*0*0!7val0 W#.!#R! 0!v! 0,!-1!11!!/1" 1 W#! 1 &"!1! 1"s2s2  3b"3! 3G" 4"4b"444 44a4/,5:#fmt5P5P5P5a5P5P$66]# 67 68"86#6P6P6P6PE6aE6aE64a key69:#(.a6=$ 86Uk$6V mod6Wk$6XP6Yp$ 6Z (6[ ,6\#0P 6u$6v$6w$6xa6ya]#$/U$/ 7/%71a set73 get7577 )4$t&&&k$&& & 1& T & (& 0&8&!ɪ@&" H&# P&$ X&%#`&&<h&'Up&(<x&)x&*&+&,&-&.&/ &0 ;&1 ȡ&2m&3 &5 &9 ܬ&; &>x&?,&@J% 8!B'8% 8+ 8-8/ .a3'     /'/ / ;' 9 zja;(      0 '> .a?=)(?)?) val? H?!H ?"H?#\?$) H?*) ?+&) ?,#* @)@@ ) A*AeA 9)?'M*?(o?)))?.\ ?1*?2*?3?4 ?5/?6/ *(?* ?%=) ?/* ?7M* 8?*?/ fn? +* + +**OB/OB/ CV+C\ endC\ D;+;csD=\;slD?\;wfeDA\ DE$,;ssDG\;stiDI\,DK\;nmiDM\,DP\ ,DS\0,DV\8;lmDX\9,D]\:,Dd\<DQ,7csD*7csxD\ DV+D~,7ssD*7ssxD\ D+ Dg- r15Dm/ r14Dn/ r13Do/ r12Dp/ bpDq/ bxDr/( r11Du/0 r10Dv/8 r9Dw/@ r8Dx/H axDy/P cxDz/X dxD{/` siD|/h diD}/pD/x ipD/$,D/ spD/Q, E -E E -~, pF4. cwdFH swdFH twdFH fipFH fcsFH fooFH fosFHF4.FHlHD./-F*h. ripF+\ rdpF,\-F.. fipF/H fcsF0H fooF1H fosF2H F).#D.#h.0F@. FA. FB.H./ YF$~/ cwdF%* swdF&* twdF'* fopF(*.F5HF6HF9~/ F</F>.u.H//H//? FQ{0 cwdFRH swdFSH twdFTH fipFUH fcsFVH fooFWH fosFXHFZ4.F[lF\mF]nF^o rmF_pF`qFa{0xFbH-0/@F:0F; \F< \F= 0\0/6@@FO1CFP.FQ0FR1@%1L/@F^z1$F_-UF`.$Fa/UFb0@$Fcz11/6@@Ff02FhaFkaFn\Fq\xfdFt\FwaFzaFaFaCF%1@@Fi2F \FaFa fpu@F2FaF/F2F2F02 F020CF1@@1 G  3G \G\U3/c+3/;3;3/@3 E3 H>3H?/H@/HAH cpuHCH I83I93 I<3I=33J<3 J=a J> W J:)4J;33 srcJA* dstJA *.494MKO4 KG" Kc494 KO4L 4L&" L"o4'M'M'M'M!'M%'M''M,'M/c4'M3'M5'M9'M<'MA'MD'MH'ML'MQ'MU'MY N !5 (N5NaN MN5N  N55 6 6aM5 N#86N$c4N% N' 6'O P"l6P#6 P&6P'6P' 6l66 Q 6Q W R)6R*'R+b" osqR-6 R/8Sɇ8Sʇ8Sˇ T!:7T" a T&7 TDa7TD:7 TDF7 TE7TE:7 TEm7TT 7TY7TZ c4 T[7-U7Uc4U _U8dU#7"U8B7-V3;8V4H lenV4HV2V8#8 V6\ V1w8;8V8pV8Vi8 Vj Vk886Vr8 Vs Vtl6dVu"VR9VTaVU7VVl6VW9VXV8 VY<0V[<8V_"=`V`vAhVa/pVbMxFVd8|8VmVnJd_uVv8886x&{<&| W&}&~ YN& |N&a &&&!6 &vA(&W0& M8&/@H& KL& P& +CX& +C`& +Ch&Hp&Ht&Hx&H|&c4&&&G& &H&"i&/&/&&&@&&*&*&&& 0&z@&zH& WP& WT& WX& W\u6`&JhA&Vp&8upH& P&(TX&^`&hh& Mp9</'"@V=VAVAVAVAV B VB(V /B0V /B8V DB@V bBHVBPV CXV&C`<=6@&vA&& K&&/&  &(&!0&!8&@&"H&/P&/X&/`&9h&"ip&& W&M&&ħ&#ݧ&&$&&&Q6& & ;& x& E& O&&a &(A&`& M&H&+C&+C&!H&"Y&/ ^&0 &1&4 n&6a&<6 &BP@&D"=H&FhP&I'X&L`&O d&RIjh&Sp&Zx&a܂&b܂krcu&c&di&f6&k0A&nc4@@&oH&qc4X&r`=.aVAA9aAAAA9V8AAAaPAw8A BAAB9B/B9$BDB9<4B bB9 IB WEBWF9WGvAWHWIBBBgBB XB mntX BX 9BBCC{BB9&C9{AC Y Y _CY +CY" ZCZaZaZPZPZP [C[\[\"([CJct[_C[&C C.a\1D ]QD] VD QD ^ vD^ (_ D_ _ _"`D`/`D`DD ` E` D `(E`D`D" aQEFa Da  a lEaE.ab E"@b'FFb((Eb)  b*F(b+F0b,8b-9b.:b/;lEFFEF"@@c/Fc00c1ac2 o seqc3a7c4Fc5QE c6:0c7 8F (dFd d/d FdH FFFF e Gee We%G  Gf AGfAG/QG/ f8*G gxGg W g]G h+Gh,h- xiGiGia`i/h maxi/p/G/ j H sigjAG jG kR~ kS9H!H kU kVVH>HvlH l  l M l [Hl'Hl(l)l-Hl.l/l0 Hl1l5 Il6l7l8 H l<kIl=l>l?l@lAlSIlT $lUMlVM lYIlZ $l[ l^Il_/l` la lJ7J lL lQ lWkI l\I lbI lETJlFMIlgxJlh _fdlilmJlnMlolpa v l% K l*H l2H7_rtl9H lB I ld7J ljTJ lqxJ-0m IKm m m m J 0m ]K K mIK iK m Km!m" H m%Km'-Hm(/m.JHm0 H m3K sam4K n 9Ln  n / lenn /n { (oTLo  p$Lp% p'p( 0pDLpM#9LpP{(pW{) 8q 'Mq\q\q\q\q\ q#\(q,\0 r)OMr*\r+QE Pr8Mr9Mr:aHr;aL'MM/"8rDMFrErF6rGa0" s>3NsKsZspsss ends3NUBNL/t YN valt t BNt |N valt  t eN SN U \ V \ Wb"<a [N0 hbO i:7 j kNcpu la m\ n\  o\( O /    O /  HT@@ aP  \  \  \  H  H /  /( /0 a86@ R  \  \  \  \  \   \(  \0  \8  R@  \H  \P  RX  R`  \h  \p  \x  \  \  \  \  \  \  \  \  \  \  \  \  \6@ [S OC D ! \( " \0 # \8 %@ &P 'Q (R )S , \X - \` . \h / \p 0 Rx 1 \ 3 \ 6  7[S 9eS ;eS =/cavg GO@R `S0 KS L M/ N/ Oa  P$ Q& SS(jS2 ]SS{TTTT `iUC aD h \ i \  j \( k \0 l \8 s R@ t \H uaP a a a a a a a aC EXC Erq U S iU T2 ^vU{UUTrqU U= a = a = a= a] "V     HVwb Uws H eV eVHVs  rVwV VUV/'' VT&W&<&&"i& @& WD& WH&EP&/`& /h&)p&/x& &c4&&"i& MVxpidpu72Xu9 xGu:au; c4u<9 inou=\u? u@@uB86HJrcuuC`uDǃpWGX/ voXvav2gGX"woYwp' uidwq YN gidwr |N ws YNwt |Nwu YNwv |Nww YN wx |N$wy a(wz0w{8w|@w}Hw~PwXwZ`wZhwZpwZxw Mw'wwnKw,BtXYxkeyxZxxGxB7x) semx"i(x3Px MXX`x +Ch uidx YNp gidx |Ntxxx|x~x x/ņx8Y Z Z Z Z ZYXy^^y_xGy` Wyayb ycye86 yh8yksK@ynXyq`ysdythywpyxatyzxEyaEyayayyFyEy  ityy&yOMyhy Wy2XyVttyy͊y׊y 7y\y \y\y\y\y\yNy/y/y/y'/y/ y/(y"/0y,/8y/@y/Hy"/Py,/Xy/`y/hyLpyy܊y`yy ayy{yyyy6y"i0Zl y^yc4yxGy86yP ^ ^ ^_XX^@z_zz z \ z (z*z{,z{-z0!_ _ X{c%`{d'{e W{g {k c4{m{nR({o0{qi8_ *`]K 9` C` |`|y|Q|]M` ``/ ` ` `/`/M ` `G`/ ` al0zNczzzz^ z,z.z0z;@z(#HzMPzMXz`zz/z6z aVbdizE z(zShzpz-z WVevz7zazazaz$zazc4z<zzzizIjVcdizFzVbbzPz?"z\z  z((a"h}yc}zo}|a}}pBo}o(}F0}/X}#p`Sc @~4Kd~5Kd~6 M~7/~8/~9 ~;a(~=a,~>40~?P8c Pd Zd dd nd6d dMM  d! " ,$a H'me(P key)*me+M ,M(-M0. re8 ext/we@dd 3" 8e tp9e: M;H<Hd A9 2gH Wa  \\ ino)\ dev* K(+ K, uid, YN0 gid- |N4. 8/7C@07CP17C`27Cp3\4\5H6H7\8\9H:H;H +Zg,b"- "g# nid&-/4/7a"RyhShUhXYZ ac xG dGX(JrcueHgMXj` idmpptqPxr9uh/hhhgZgyh' h xG "hh c4 h ihaMM (0qi1'7' osq96;b"<88888 iiiii j'i XqDjrisF wqvIjH cpuwP Dj8 xj8jj( len'HjPpNjj//j/j/Y@kkk Fc4@@ SjH!/"/#{$F%i& '3l0(/8Vcpu*@Vssp+zlH'k/ `63l7c48j:j(;/H<3lP=X>\k ezlfa sdagmh?"im8llxDmE3lFmH I6(Jc4HK6PL/pM/xN/O/P/Q/R/S/T{U/V6WGXY W\/]/^j_zlp3lm/jl'n 0 0"7n#9$%'[n()+n,-!n &n *7n .[n nm opsnn nn 2o4/6a7a .a}@Ao.a}Hjo }po}qAo}r}so o-}o}n}/}oF}}/_} p#oo"@}p}jo}/}/}/ } {(},}p0Jrcu}8}pH pn }p} id}ppL/ }p}p p (3qb"Rk  q\& z)"i ldt*q8./@96H:Mh;rp= WxC*|D ~ q rM/ alt/// /(P08@HPX`hpx !qr F3q--\s-^ M-`a-XHs7lru-Y#r -d -e-ijs -j / -k/-(-Rss-hWHs-s/ -(-us-z/ pp-{s-|/-}/-~' s--t-/--)t-t- M t! ref)8GXHhal/p ops xM})t_(-Qt#js#s#s#td--u -a - W]- uval-/2-uK-MOu-N M-PaG-Jluwlru-K#(uG-Wu$-X M$-YuK@-Gu-I/Ou-UW-V / lu(-[ W0-\ W4-^/8`@-Fv#uU-j%K(-mv-n/-o/-q W-r W-s W-t W-va `@-lv#vU-z%K0-}w-~/-/- M- M- M - M(K -9w-/-/-`@-|\w#v#wU-%T-DwBuBv@B9w\w2-/wT& x& & c4& ( & [&W& M &<(&a0&a4&Y8&B@AP& p&  Mx&#&$ &% &'Bfw-5xctx-6x x-=x->h-@3N(-Xy-Y"i(-\jy-b/-h/-t@-w -}$K-y-/-/`-y#jyU-G-y$-w$-w -ycrb-D-/x zbzc #h #j<kPqs s(t0u8w@{H~PX`h1pJx zzxy-H{-\cid-- @@- c{- W] -{--/- a@@-vBH{@-h@-/P-/X-/`-/h-/ppgd-  x-) W-5 W-?v-E/-La-S W-Zb"-]'-_-ac4-p"i-r--/-/-/-/-z-/ -/(-/0-/8-:7@-c4D-/H-/P-'/X-3/`-/h:brk-/p-!/x-/-/-%/-0/-{-@--r-/h-c4p-x---x-&-/-/-- W- W-p-'-i--/-/-'- c{{//3p/  e  /L/2- a p/y7y(pmd9  0pud; )!8@E HF PpteL  XptlP4`T h<a-ހ @eeeee.a]              O86898<8G 8/66// /({0 ^{,ׂ- c4/ 0M 03*4678 { xa9 _ " $c4"@@- lru/*0' _ u2 nru3 nsu41Dǃ/փL/ val\ փ.a   [ 8YN|N /  x x"xlJrcuxmxnxGxo {-xvxx*xy xu2#7xx/ (xrzxt/xxxP zzv x xM x MɅ/ xՅڅZZ x7xɅ keyxZx_xX xdxDxz x +C x +C-(xņx/x/xxx  (x x2#zK xxx vG x$$x# $ .  xGp/0'8@ uid YNP'X W`$n"h ww xGw gidw |NL/_w' wrcuw=Y@@cg0chb" cpuciacjacka ,cla,cma,cna,coa,cpacracsctcuac{  c|F(c} 0c~F8Fc?@@1^5mF@P/K`/? 8yɉy y! y"/y#\y#\ y$/(y$/0 y'y(\y)\ y0&y1 zy2 zy3 z yCAyD yLiyMyNiA 8yQyR WySAyTGXnɉ/2XȊ/ Ȋ ҊG/   "0^86F "` Jrss 0886@ WX  ԋ fn )4 arg M/ bԋ   H{S3 {T {U!_{WT {Xd{Y"8{I q{JM ioc{K%`B3 {\a06zMz Mzzzz/ za(za,zxG0za4z8z)Hz7"Xz?"Xz7"Xz?"XzXzc4`zdzNchzSpzx:devz(z0z W4z8z@z6H:idz hz/pzxzSzFziz Wzzz AGz!z"z#6z&0z(c44z)8z*jHz-:fqz2z3z56z66z76z= z>c40z@4:tdzD8AzF@zK86PzP6hzRzSzU9zV9zW9z[6z] {Tja ja S  ސ val ǐ  val  <$$) iQn/v"8_`'ab,c {,d {Jrcue reff$0 Q ۑ v / %Ƒ<aT#!9// n#. |. 0 z 4| 4Ԓ5a6Ԓ7/  0&pp&qx&r &s &t M&u &v*$(& & YN & ސ& & |N &  P&-&a& Wp & &7C&7C(&7C8& xH2Ф()*+ ,0-6@. c4`/ Wd0vAh1up2 x3/4  val .a6; BEu7uidF YN7gidG |N H DGJ H ; ; ; ; ;  ;( ;0 +C8 +C@ H/ a(a, ;0 ;8M@ !k$@8g9:;<= >(?0@8vAl-vAuXD`EFyG HI J(K0N 8O@Q٘HSP-yvAe-~<;< ٘<ŘxY͙Z[\\\]\^\ _\(`\0aR8cR@dHeLf\Pg\Xh\`iRhjp8haaaa aaaino  ( 0a͙/ "aaa aaaaX˛ *(M0k8M@HP"vACЛvAa%vA% HvAuHޘ/kvAHRvAhpgt8  a "i 0 H:ops! </ //G&w>$&}w$& 8 3w 4 5 65>M|&̞&& &&& ?& ҟ &(&60& O8& i@& H& P& X&!`&5h& Sp& rx&&& ȡ&  ўx\w&W{?W+OOT8 Dҟ Ex FWra G I / Ja  Ka$ L{( M/0DxWaiן6xWaaM OW;iT{n (+,-{.{/ # !W5&{S:mmm{XWwx ȡx̞͡G&$&h$&a`&6$&U&G&[$&![$& k&k<`G&$&`$&$& $& a  6@&Z1&[h&\&]&^ǭ&` &b (&d+0&eD8&fg@&hH&jDP&kX&m߮`&oh&p/p&r Mx&sz&u&v&yޯ&{&}&G&`&â1 ; E O Y c(&ޤ&x& 4pid&2X&Duid& YN&YN &$ &A& /&a&a &a&a& G &f$&6$& \` &)U&*$&+3$&,ޤ$&-ۑm2&PM60&&& & C&m^/&&۰& k& k& & &(& k0& -8&@&FH&ZP&FX&Z`&}h&p& -x&&&&& ܱ& && 6& 6& -`˛  Χɧ ӧا  Y);* + ,Nc-M. //(0 W09 K4:W8< W@=c4D> MH? MP@XA6`BCSE WF6H#IK MFQ @ J TUn/U~/$2&{P\a&& ~pos& 2& ax1x gTxPg6rraw zzz{z Yɪx3x Ϊ xa/#x <<x(UxAxxZx}x /x////ë}d`xga;xg`a^x^ich @xrx ܬxxa xxa""a' J"ra19h<9aOP9<m<ǭ<{9 ̭ <9W{+9<9D<90g<9PI<9Wl<9WK߮<9<9a9*C*HaeM9 4p<p\\u R<<9xaWޯ<xW99=9=B $`9=L& mt& h& /<e<a&̰<۰vA̰< <<-vA"FvA2ZvAKs9sx _vA 9ܱvA vAP<- 6vAh"JJO ; Y^9PMh7"/ @@NAPBCSD Er( sdFp0Gh8EIaEJaEKaELaEMa]xbio֕X; OG( WF g48 M@H4P\X` hpr  Wt x|.aEĴ NT Ze@Ĵ  @t//"-nEn.+}L/ .+#JK(0vma1 2 3 /4/5/ G>$? n$@ # < /(P As ///Uax///  /MöP  ``1 /$ J /6 /D rev/  p"p W WpPJrbD nsP0a8< W>@ id\` MhùpJrcux  ops! ph| "ɺ$ % & (( 802 89{@: 8H= QP@jXA `|  7dirO  u   knpx M6 6@`h x    {@  {A %{ȹɺMMgκMMgM8 3Q=j Vo.a 0' () * +4,> - )4(^MP**/ ^P9 <k<P< WT8'Emod'Fk$C'GTP'p 'qM'rM's{'tacmtn'w 'T' T'a' ' " Y^CG&m/'  |ezle  PP/"ޤ #M7M CSMM H c4 iM (8607 S"M!N PaRa Ta (p///// "0Jrcu12h3!L/ HIJK LM/N p :0; <  !"# $(%0&8'@(H)P*X+`,h-p.x/012345<<U<alHxzy c4za|a}6~0@ z680= { = {!= {"= {#= {$= {%= {&= {'= {(= {)Hc4 GX @ {@ {A {B {C {D {ECEP\i86 W Wa { { { { { { {  {  {  {  { a\\\\  (:qos0 +,P id-./c4 0(1F02/X3 `4 h5 p6 x7 8/9/:/;/</ dev=E> {E? { 9 wops<   {wa MNPOPP!Q!R! T(U0V8W @X HY P[X\`^h_paxcd pmfh{ `aP busbdk$ePg{ h$j(k0m8n @oHp PqXr`s!ht!p pmvxw py0 `23P5!6!89 ; (< 0>8@(@AHC +P pmEX! WP+lq 0XYPZ![\ ^ pm`(0.a-     lqKaa/<au<a8 K0!" <a1W<aB{<aOcd&e2Wf4{g{ lidh{   \ &+cma: E O Y c m' X  zCzD zI zNzS ezA#zBnzC% ` O\  a [ a   tn|o!pau#w x `z { ~a8c4<^@iPIjpxL/a     <aEg     "#$0    _i(  @jbk lenl wpmnopqrbs tr(r//.zm ztzuzvzwzxzyzz z} azz Lzjzz z z(z0z 8z@z Hz Pz XzH`z ahzpzk$xzz  ( 2S A KHzzz {@zaDz&qHU2z  a2z] azhzizjzk/zl/znazoazpa zqa$zra(zsa,zta0zua4zva8zwa<zxa@zyaDzzaHz{aLz|aPz}aTz~aXza\za`zadzahzalzapzatzaxza|zazazazzzzazazazaz2z33aMPzqzz @z H8L/            z(zz<azLjXraQNcoNc;a/aNca;  ;{ ;/HNcaM% aNcMNc2"(f Nc;{;;r & \ ' \ ) H 8]u^_<bc refd xG(e 0 (V refW xGXYZ   z.a 4Wx MK [  KG#[$K i/G  $  #4#Y nid/aaa (C9HHLbufMO O(P\0P\8R@SUBTaD8ghui;jkxl\ n(oa0u.̞8f8/OSOSdOtOtdY bio ] ,/ ` map devH rq`' ySM{MPcMׂ/8f=z<f P/{f6/zzyfPP{XMPvAMPMvAP<M2yt\M</a{fuvAPMXf{XaMPM XMP& xM *a/9P2MOP8Mp!P?MMX;O{nqgrac>Oa<nio,~Derr%4M3 h /  / Q5(+ t)++4o+Z\30(tkB(*P(] b()o(*s*: *)*+*  *)+++ &+)1+H=+N7H 3+tH ,,*c,o,N{,|,Z"Z.3R?>2T|X1++,t8,*E,NV,HW,/  4 I! !4%!I{# #9& K&Y&M k&s*8 **(*  *+(J+ $[+f+W# #b##*# $*c$ t$H$+(  (*(h (*) )N)H)>U}0p7UvT}W 0\cT W-ph1xhEnio,~Derr/=Qd(+S)++4o+Z30(SB(*P(] b()o(*s*: *)*+*  *)+++ &+)1+H=+N<H3+SAH ,,*c,o,N{,|,Z "!-Z9>RJ>xT~Q1++,S8,*E,NV,HW,0pUUsW W-U[gioU9[hUKaW<DmapXDcurYaDendYaDlenY1aaY6aDposZ DofsZ!p[nbv\~Derr]|j aj |nbufl~Dsrcm M3)q*/! u- 8 D P (] >i t   /"w"""/}''''4'Q'x'[''*( ((#(>U|TQ1>FU|TQ3*r :,*0XU~R10UT0Q~R1X0U~>U~/s!W!/3!Z,E!S!  e!/ #Y#*$c($*9&gK&*Y& M k&*s* 8 **+* *++J+$[+f+/9*aK*X*e*33!i FE!*S!  e!3~ D  Z   +$B$$$$*$  $$N$$b$  %%>OT Q >U~# T0Q~R X0/!~x!!!!u! "!!!4H"#"I#  #6$H$4U$s*W**(* *+(J+$[+f+Iy" "(" "b#  #*6$H$U$*s*W**+* *++J+ $[+f+IN#`#4m#s*#**(* *+(J+$[+f+[."3"b))U<)I)V)>-T0Qs 0UW 0T~0U}0fT}Q~R0U~T~05UT~0MUW-,OgbioO*XaQ M UU J X\~ hJ:(~ L  4 Q P   ($B$$$$$  $$[$$ b$  0 %%>OT Q >U|T0QsR X0&@ ` @LXrqB`B BMC{- grq-<`p/Dret0/[%5 , S (i% S z%4%%3% F %+Z' l'/% F S %+& +  &,&+% F %%&0 UT0Qs0 T|Q0  U|W-{h4gret?Drq`Dfig| aM/   >U|Tv3,#>uU|/2$`?KX4cI[3[I&&&4&R'('#'Q/'4'(+)++4o+3s***+* *++J+$[+f+NA'B'RN'Qp6q~I #* #$c($9&gK&Y& M k&s* 8 **(* *+(J+$[+f+R.#+@#{#E#9& K&Y&M k&s* 8 **(*  *+(J+$[+f+/$@QIHb #53#*$c($*9&gK&*Y& M k&*s* 8 **+* *++J+$[+f+R I.#6u@#{#E#9& K&Y&M k&s* 8 **(*  *+(J+$[+f+28?KX4cI][3D[I&&&4&R'('#'Q/'&4'(+)++4o+3s***+* *++J+$[+f+NA'B'RN'QpMq~I #*7)#$c)($9&g)K&Y& M )k&s* 8 *)*(* *)+(J+$[+)f+R.#+)@#{#E)#9& )K&Y&M )k&s* 8 *)*(*  *)+(J+$[+)f+3y&%9&&*s* **+* *++J+$[+f+NU|0fU|U>Tv?tt<t/ta rawt{%t{%ttP%dttretM%JtreqtptM t{%t{t{t{tt?SS rawS{%S{%SSP%oSSreSM%USreqSpSM S{%S{S{S{SS\1bio.X\/-1fi/6-1bio/FX555595g\1fi7-1bioGX1i 55*5*9*& bio>X&{ bio,X bit>a?!  bio,X>a?;]  bv;3;E len<a<"a?,  bv,2,C  len-a-"a! a 1rac FO! / 1rac AO! ! GO5 ! 3! IO5 ! S! .! s! / ! P<! P7\r!r5s s\`"4  aa aa5 Mri a%A"5%T"59?y"/P&M"2 ?3"33 &"!P. iF!M#E#g!a)#a5)#w!CN#C6!/{#6 5!!#7)#\#,!/#4 !#4!~$~2 !ea6$e<)#!Sac$S8 5U&$6 Xret! %M$ ; G!|.M$|D|P5a!%a.%<{9!z0[%zCzX/ Q& 9% p 99Xioc ;%` <& '% '9& % 8& n& n/ n> o & *{9& tsk *= ,!K{Y&K9)#!6{y&6A)#!{&<)#rret{!0xd&0C)#1n1 a53#&&/'H#/q&+#Z'S#%A'{/q! ?x'1p ?7x'&{'P*6{Xsz55?(&:/?0( ptr;P nN/{![{P(1cpu[5a!8{}(1cpu886&%a( cpu@a?( cpup > xmm HmWmm/y m!/"m%&9m:a?AD F yP k Qm(T 0= !!= 99"< Gval y+ + P  ,< =   !  ! /"    y+\     P   }!}!  " "P " #x # ### ##m#/,$ fmt$W$W$W$m$W$W$"%e %f/%g> %hH %u> %vH%wH key%x C %Un %V y %j key%kM %n key%oM &6 &7n &8 #8&G &W&W&W&W1&m1&m1&4m key&9 (-m&=p  8&U &V mod&W &XW&Y &Z (&[ ,&\G 0W &u%&v%&w*&xm&ym p /maI/ '/'1m set'3i get'5'7 ,Ion O u   L( L08!0@" SH# qP$ qX%`&h'p(x)*+%,M-R.%/ z0 1 23 5 9 ; >?7@U ( (!H key("H"(?(A/(B(C )) mod) )s (=)(>y*  +!w+% ++ +-+/ ,, y,w"-- --). . ."-ml&\6/&@6#/|///|/|G / / | ///| 0;$0</0=/30? m 30@ m$30A m(30B m+#@1= x1=aN/6-@2  #272m2m2 y 2(2 m,2!m02( 42),82*mH2+/P2, #X25 `26 d28 h2: l2; p2< t2=mx^se2?\^@7rt2@_|dl2A\`2BW`2Fb<2IG2J/2Km2Ob2Xb2]b<2`"\@2d2hm2km 2l/2m 2nb 2ob(2pz(02q yX2s`2ub2x d2yxbh2zp2{c2/2!2!2 22 22 2 2xb222 2[22'Q(<2GP7mm2&h2&p2cx2 2 2 2 2/2m2 m,2 m,2 m,2 m-2 m-2 m-2 m-2 m-2 m-2 m-2 m-2 m-2 m -2 m -2 m -2 m -2"m -2/2.7pid2 2 2/2 #2  #222 #(202@2dP2dX2 2"u=2%n&2(n&2+ y2- k2. k23 k24Z26E[2: y(2=/02>/82A k@2D kH2G/P2H/X2KY`<2N.Z2Tf2Wf2Zf2^@2k 62m f2pP 2q Q(2t/82u/@7fs2xfH2{fP2~(fX2f`2Mjh2 jp2 WTx2 WT2 WT2 X2/2 2m2_2j2 92m2S2X2 k 2 k 2 2  2b 2( 2 #8 2j@ 2 yH 2jP 2\kX 2fk` 2kh 2kp 2/x 2k 2XY 2m 2 k 2 k 2 k 2S 2hD 2 2Am 2 2 W 2 W 2"Km 2)m 2  2 m0 2 C8 2 mX 2m\ 2m` 2Ch 2 2m 2 2! 2 2  2!m 2"m 2# 2$/ 2& k 2' k 2( k <2)7 23m 2C/ 2D/ 2Lm 2N/ 2Rm 2SW( 2TW, 2Y/0 2] 8 2^ < 2_ @ 2` D <2a7H 2d#YX 2gm 2iX 2lm 2w 2x 2z/ 2} 2~m 2 k2 k2 2 2/222 y2 y2/2m2o2p2Er2r 2m(2m,2b0|rcu2702@2 D2 #H2RP2Bsx22 y2 "Ls2 Ys2cs2y2 2 k2 22><272 2!"c,2$"c,<2.72<ms<2F)%@@N! #/? 3B#3C93D933E9 33E9(Ns3E9,Ndpl3E9-Np3E'9/33F90Navl3F94Nl3F95Nd3F96Ng3F%9733F+984/4/4/4/4/)4 +$ pte4#4"$)4 N$ pmd4#4"7$5%w$5%%$H5%/Z$>5' $pgd5'#H5'"$>5p $pud5p#H5p"$H5$$#@6H$%6I/AA06 y46/8$6@@7n&7n7sp7/es7 ds7"7$7&7/(7/07~787/X7/`cr27/h7/p7/x777/7m7W7/7/7 6^fpu7 D6@~& #s& (8 &8 j(&6@@6&A@60@$+$N$&_6'A6&6 w$ 6(6,6f06?86X6ph6%ip6/x6 6 y6n6)6m6s6$!-m3j(     /z(/8 ;&z(m:5)     :)6@A@;+;Ś@;$֚!;&5;: 5;</5;=/5;>/5;@6;A96;B9 6;E86;G y6;H/6;KC6;M #6;N6;O6;Q6;T6;U6;V96;W #7;X7;^/7;d/7;e/ 7<;i$@@7;t7@7;ym`7;{/h7;}mp7;mt7;/x7;\7;/=;ݓ=;9x><;$@?;$?;?;A;pA 0.>.> ?8~,?9, ?<,?=,~,"@<,@=m@> y @:,@;~,, src@A9 dst@A 9- -y-mA.-)(A-A- valA WA!W A"WA#kA$- W"A*-A+&-A,#. B-BB - C.CtC H-)A'>.A(A) --A.k) A1.A2.A3A4 A5/A6/ ."(A.A%.-A/.A7>. 8A.A/ fnA /. .... D//Dk endDk E;e/NcsE=kNslE?kNwfeEAk EE/NssEGkNstiEIk3EKkNnmiEMk3EPk 3ESk03EVk8NlmEXk93E]k:3Edk<"E*0GcsE9GcsxEkE//"EW0GssE9GssxEkEe/ Eg]1 r15Em/ r14En/ r13Eo/ r12Ep/ bpEq/ bxEr/( r11Eu/0 r10Ev/8 r9Ew/@ r8Ex/H axEy/P cxEz/X dxE{/` siE|/h diE}/pE/x ipE//E/ spE/*0 F 1F F 1W0 pG 2 cwdGW swdGW twdGW fipGW fcsGW fooGW fosGWG 2GWlW2/=G*A2 ripG+k rdpG,k=G.2 fipG/W fcsG0W fooG1W fosG2W "G)2+2+A2"0G@2GA2GB2W2/ JG$W3 cwdG%9 swdG&9 twdG'9 fopG(92G5WG6WG9W3 G<g3G>2~2Wg3/Ww3/? GQT4 cwdGRW swdGSW twdGTW fipGUW fcsGVW fooGWW fosGXWGZ 2G[!lG\!mG]!nG^!o rmG_!pG`!qGaT4xGbW]1!i4/@G:4G; kG< kG= 4k4/6@@GO4GP2GQi4GR4@!4D/@G^T5G_1BG`2Gaw3BGb4@GcT5!e5/6@@Gf 6GhmGkmGnkGqkxfdGtkGwmGzmGmGmG4@@GD6G kGmGm fpu@G6GmG/G6G6G 6 G 60Ge5@@e5 H 6H kHka6/a7/? IH7I I! I" I#7k]7/an7/ #~7/77/7 7 J>7J?/J@/JAW cpuJCW. .K.K.K.K!.K%.K'.K,.K/.K3.K5.K9.K<.KA.KD.KH.KL.KQ.KU.KYL ! 9 (LO9LmL yLO9L L[9`9 ~9~9my 9 L#9L$L%L' 9)M 9 valMM 9)M 9 valM M 9JhNJ);NKNL@NMNNNONP 9NQ 9 nsNR5NS/NV N^N_@N`>Ne@@Ng yHsetNi=hNj<NlXNmNn/z@Nq`/>;/O@ J; m;m;y);;; 8O;OWOyOO tO<O< Oy(Oy0r; Os<Ot yOu9>;;# OM<4OGO<#XO<A=Ou=Om; O=( setO=0O>8O>@OHO3=PM<=O=Om;OO OO`O3=+<urcuO7mOM= Pu=PmP'vM=#Oʽ=4O=OF>hO j>pO>xz=#hO=O2>EdirO==#`O>4OM<OX=$< 2>=#> =F>=7>`><`>e>99K> ><m;o> Q >Q y (R0>R1)R7) osqR9>R; R<FRFRFRFRFR S[?S`?S/ [?T T ?T e?TUU#Ul?ErcuUm7UnUo =Uv @Ux9Uy '"Uu$@+?GxU/ (Url@Ut/ @Uv@U{@UW l@l@? U@UyU @@y@/U@@ @@AA@@keyUAUU?ABU C semU>(UCPU yX X/FYCFYFY Z!DZ" mZ&C ZDADZDDZD&D ZEhDZEDZEMD)ZT DZYhDZZ Z[tD=[D[[ `[Dl[+D#[DAD=\3E\4W len\4W"\27E+D\6k \1XEE\87E"\iE\j\kE9\rE\s\t_Cl\u7#\RF\Tm\UhD\V_C\WF\X7E \YI0\[I8\_"J`\`ZNh\a/p\byx4\dD]E\m\nEd_u\vEEE6x{I| t}~ 9 9m   ! ZN(c0 y8/@9H \L P e?X e?` e?hWpWtWxW|! 2W>//f99 v^0@H yP yT yX y\~`ph<cp8~H P(zX`h ypFI/'#@\J\N\N\N\N\N \O(\ O0\ O8\ (O@\ FOH\OP\OX\ P`IJ6@ZN \/  ?(!0!8@"H/P/X/`Fh>p yy&#$#DC  c    m h(<` yWe?e?!W"/ 0 11!4 6m<C BW@D"JHFxPI)XL`O =dRyhSpZxab|rcuc7d yfCk0<n@@oHqXr`J-m\|N NFm|N NNNF7EN NNmWNXEN NNN OFNOFO(OFIO 1FOF1-O ]EO]FF]GZN]H]I OOOKOO ^O mnt^ O^ FOO OOOO F PF_NO# _^P_m_m_W_W_W `P`k`k#(`PEct`P`&P ^P-maP bQb Q Q c 'Qc (d \Qd d d# eQ4e Ge  e Qe-mf Q#@f'4R4f(\Qf)  f*HR(f+R0f,!8f-!9f.!:f/!; QCRCRQ4R#@@g/Rg0ig1mg2  seqg3ADg4CRg5Q g6s0g7 8MR (h Sh h/h ShW SSR S iTSii yiYS TS)j uSjuS/S/j8^S k+Sk,k- xlSlSlm`l/h maxl/p/ T/ m@Tm km km)n WT signuSn@ToRoS{TcToUoVTTpTp p yp T)p'Tp(p))p-2Up.p/p0 Tp1)p5cUp6p7p8 T) p<Up=p>p?p@ pA )pSUpT 9pUypVy) pYVpZ 9p[ )p^4Vp_/p` pa "pJzVpLpQ pWUp\UpbV) pEVpFy4V)pgVph _fdpi)pmVpnypoppm  p%OWp*Tp2TG_rtp92UpBcUpdzVpjVpqV=0q Wq q q q V 0q WOWqW NuXNv nsNw uidNx 9Ny yNz N{W q 5Xq!q" WT q%wXq'oTq(/q.Tq0 WT q3X saq45X r Xr 1r / lenr /r  (sXs & t$#Yt%$t't( 0tDXYtM#XtP(tW) 8u Yukukukukuk u#k(u,k0 v)Yv*kv+Q Pv8Zv9Zv:mHv;mLY.Z/#8vDdZ4vE7vFCvGm0# w>ZwKwZwpwww endwZaZD/2S[2U k2V k2W ?m2[E[02h[2iD2j2k[cpu2lm2mk2nk 2ok( 2[2/2222(\2/2 W_@@2\2 k2 k2 k2 W2 W2/ 2/(2/02m86@2\^2 k2 k2 k2 k2 k 2 k(2 k02 k82 a@2 kH2 kP2 aX2 a`2 kh2 kp2 kx2  k2  k2  k2  k2 k2 k2 k2 k2 k2 k2 k2 k2 k6@2_2[2 G2! k(2" k02# k82%@2&P2'Q2(R2)S2, kX2- k`2. kh2/ kp20 ax21 k23 k26 27_29_2;_2=/^avg2G(\@\^ _02K1`2L2M/2N/2Om 2P$2Q&2S1`(_H2]C`H` W`W`\`_2`a2aG2h k2i k 2j k(2k k02l k82s a@2t kH2umP2m2m2m2m2m2m2m2m2QX2Qrq2a26`2a2W`H2^aa #aW`rqa25b,2m ,2m ,2m,2m>2xb2!2!2!2!2bb25bs2W2b2bb}2 bb bab/(z( b_cI> >@ yD yHP/` /h)4p/x => ycpidpx7dx9 x:mx; x<F inox=kx?i x@@xB9HErcuxC7`xDypcd/#yoeyp) uidyq 9 gidyr 9 ys 9yt 9yu 9yv 9yw 9 yx 9$yy m(yz8C0y{8C8y|8C@y}8CHy~8CPyXy@`y@hy@py@xy yy`yyXyeA@de f f f #f Hz fz! z"z#z$z%d z&(z'0z(8z)@-fJX{^Mj{_{` y{a{b {c{e9 {h #8{k X@{nX{q`{sd{t #h{wp{xmt{zܤx1{m1{m{m{{4{Q{  it{{_{Y{h{ y{d{Utty{{{ D{k{ k{k{k{k{k{Z{/{/{/{'/{/ {/({"/0{,/8{/@{/H{"/P{,/X{/`{/h{XYp{{{{({ m{2{{{{&{C{>0fY {j{{{9{ Rj j j|j| | j@}\k}S} S} k } (}*},}-}0j ak X~ck~d)~e y~g ~k ~m~n(~o0~q y8kk kWJPAm pAmxg   Q"(./09g :g(;Am0>8<A7@k Fm m4(Pm m!m/ m m m/m/dZ m mSm/J@oEcss= id$Ђ*@v`&@  y(/HP*X   H&&&/ p(p08(&HP#`& 7x?7&m#0po yA@& oY0}Er}}}} },}.}0}c@}(PH}P}yX}"`}}/}C} mUbdi} }(}h}p}P} yUev}"P}m}m}m}/}m}}'P}}} y}yUcdi}1P}Ubb};P} }k} N }(P(p#hyrzy~|m}AU(R0/X#`Jr @4Bs5Bs6 y7/8/9w ;m(=m,>V0?t8r Gs}>Qs ^s hs6 s syy  s!" 3$m H'gt(W key) *gt+y ,y(-y0. lt8 ext/qt@ss3# 8t tp9t: y;W<WsCH 'vW tm  kk ino)k dev* \(+ \, uid, 90 gid- 94. 8/q?@0q?P1q?`2q?p3k4k5W6W7k8k9W:W;W +Ov, -YxvxvUmapuS)v/?#vErcu7vvvD/Ov "!w#> nid&-/4/7o#RwSxUxXYZ mc  dM=(Ercue7HgyXj` idmpptqWxrFux /xx x!wvw) 5x]x ]x]x#bx5x]x x  "x"xx xxmyy xxyy y >y)x Xqyr ysR wqvyH cpuwP y#8zy{ yErcu|7 wqy0_ xz_z.;( len)H/zP!py/z/?z/J@{{{ 4@@ yH!/"/#$R% y&7 '{0(/8Ucpu*@Ussp+{H)*{/ `6{78.;:.;(;/H<{P=X>\*{ e{fm sdag-}h i2}{YxD}E{F}H IC(JHKCPL/pM/xN/O/P/Q/R/S/TU/VCWM=Y y\/]/^>y_{p{-}/?z{."g}Y4Y4)"}#H$!%!)'}(!)!)+},!-!"!~&g}*}.} 5~E} ops?~} 5~:~ 2y~4/6m7m -m@~-mH~ pq~rs =.D~/U47/`h+ p.#@~///  (,0Ercu78Hh~  id,D/ GL G ( a ) ,k& )> ldt*18./@9CH:yh;@p= yxC9|D/~ , ;y/ alt/// /(t08@HPX`hpx !6;F=6\u6^ y6`m"6XGlru6Y+Q6d6e"6iʂ6j /6k/=(6Ru6hc6s/ =(6uD6z/ pp6{I6|/6}/6~) D=6e6/=666 y  ref8M=HGhml/p ops Jxy/`(6QA+ʂ++N+el67"6c6m6 y>6 |val6/H6cS6M6N y6Pm26J΄lru6K+26W6X y6Y|S@6G^6I/6Uc6V / ΄(6[ y06\ y46^/8V@6F}+B6j$S(6m6n/6o/6q y6r y6s y6t y6vm V@6l +}B6z$S06}h6~/6/6 y6 y6 y 6 y(S 66/6/6V@6|+ +hB6$_6DA^A@AH6/_  h  J  c y I(m0m4f8O@gP p  yx#$ =% ='A65-ctx662 -6=b6>gx6@Z(6X6Y>(6\Ԉ6b/6h/6tG6w 6}$S66/6/V6+ԈB6726?66a 6f^rb6G6/b kbdc h jkq% s(t>0u\8wp@{H~PX`hpxud766kcid66 q@@6 ˊ6 y> 666/6 o@@6ގA@6x@6/P6/X6/`6/h6/ppgd6  &x6) y65 y6?ގ6E/6Lm6S y6Z 6])6_6a6p>6r66/6/6/6/66/ 6/(6/06/86D@6D6/H6/P6'/X63/`6/h7brk6/p6!/x6/6/6%/60/66@66E6/h6p6x6 #66 6&!6/6/66 y6 y6,6)6 y6+6/6/6)6 ˊx//3Q/   9  &/?D/6+j6-6/ H6 m$p/ 7 (pmd9 &0pud; '8@E$HF$PpteL &XptlPb8`T $h?m6q @KKKKK-m]x              F6F9F<FG Ǒ) h;u;v;w/`/o@;ܒ;/;G;.;;ܒ8;;;8;*x;F;F;(7gen;!)7seg;!*;5x0///////*///F///)b///H;seq;/;;;;Ǔ(/Ǔ//ݓ//;\;seq;/;/; ;);;;o ;e;f;hP;n/X;o/`;q)h;sGp;u/;x;{b;5);\)///9/;&seq;(/;*m;, ;. x///6@;Q; ;;; ;;;!;!;!;;Q a/ @;;; ;/ //1;;;//?m;+6@;7;;.;;</ ;>/(;?/0;J8;M`;O5)h;P!p;Q$x;V;W;X;c/;);/;/;/;/;W;/; D;<;$@;;x;/;<;$@;/;/;G;/;/;m;m;; ; <;$@;;ʙ`/aǑ/ )ʙ/ )ڙ/;;;+o ;';'ڙ7/ ;p; ;;/(;Ś;/;/; /; /; / w+@֚/ /9/) //  8~/66// /(0 ~n ,˛ -  / > 0yV  B 72   /2//6@       AЛ œ(~(22yҜ/?H /ߜ8 Dxa E F/ G H I J K L  MҜ( Nם0 03ם49678  xa9   " $#@@-9 lru/ܝ0)  x2d nrx3 nsx4dPy/>D/-m    6@@g=/7knZ  @x9X9Z9\9^$`Q gg$ <$@@g@HpZ"#C&9) y7psi,7bpf/  25#Ls9F  Q/0)8@ uid 9P)X y`$ h y1y y gidy 19@D/`y`yurcuy7yJ@@ggigh cpugimgjmgkm 3glm3gmm3gnm3gom3gpmgrmgsgtgumg{  g|CR(g} 0g~CR84gx@@jnnwMR@/wX/? 8{{ {! {"/{#k{#k {$/({$/0 {'*{(k{)k {0_{1 {2 {3  {Cz{D* {L{M #{Nz 8{Qܤ{R y{Sz{TM=/d/   S%/J)(/067 4IJQ R(U0V8^@fHkP4lpnq4oxq|rsu4vxyz{   (08@HPX`h px      % - R ##0947 #` Erss R40789@ yX   fn , arg y/) 1 b  W"~Sk~T~U`~W~Xl~Y7#8~Iͩ q~J ioc~KkIAk ~\m06}} y}pS}S}S}/ }m(}m,}0}m4}8}H} X} X} X} X}SX}`}d}Erh}p}Px7dev}(};0} y4}S8}S@}CH7id} h}/p}Sx}}R} y} y}S}} uS}!!}"}#C}&0}(4})8}*>yH}-S7fq}2S}3}5C}6C}7C}= }>0}@47td}DS8<}F7@}K9P}PCh}RS}S}UF}VF}WF}[C}] ͩ ) val) խ val< i%n/v#8_`)ab3c 3d Ercue7 reff0%) v /%?mT// n- Q). h0 4Q 45m67ү/ï  ȯͯܯ0pEq r s ut yu v9$("g 9 " 9 խ Pm tEg  q?q?(q?8  HЩ()*+ ,0-C@. `/ yd0ZNh1Jp2 x3/4k) val ʱ-m6B"EJGuidF 9GgidG 9H DkJ H       ( 0 e?8 e?@ Hq/ m(m, 0 8y@ !c q@8<9U:U;U<U=i >i(?i0@8 UZNA iZ ZNJnXD5EiFNG ^HiIi Ji(KU0N w8O@QHSP NZN:^S rrIc I| IrxYZ[k\k]k^k _k(`k0aa8ca@dHeLfkPgkXhk`iahjp8=mmmm mmmino  2( 20hmhx/ mmm mmmmXøUܸܸU ("0@8"@^HܸP øZNO ܸZNmȸ ZNx ZNJ @ZN' YZNY=E<o8  m > 0 ιH7ops!޹ Iι/޹/c/2w}L `8 3L 4Q 5 69 `yQuׯe8Vo   M(0 8 @ ˾H ۾P LXo`h p xٿ /z $Y+8-/6 7 9# 1; m 1< m!1= m"1> m#1? m$1@ m%1A m&1I m'P#(S0VN#8W /8X@Uwb[fH\IP_X`\a`b hc pd x Q Q= oc[ cQt8 D E  Fcra G7A I / Jm  Km$ L( M/0 H cmHxQ  cmmQyR &c&Q ˾Q>۾Qо ׯ (+G,!-./   ocQQQ Qt QQ ٿcQſ   &޿  /ׯ2^tmVB72! nI2m 1 m  6@Z[s\]^` b(d60eO8fr@hHjOPkXm`o hp:pr Xxsuvy{}*RkJif bdijl/m/op(q8rHs Xu y\v`x/y/z/{/|/ /(/08h l px>y>y8HXvy  k u  (  piddPuid 99 $ g /mm mm 2 C kV )B*7+~,,-HPy60.  .w?/    (( 0 88U@QHePQXe`hp 8x  ( A A 8D5     tJ)c* &+ &,Er-.  //(0 y09 \4:c8< y@=D> yH? yP@H!XAC`BCE yFCHu!IK y4Q(J` idk4G /0/8gx@mDmHmLmP)X/`Ewbh`pC>9Udev6(R0FXh  a/a/$H Wkm$O pos H m u \  1;z  W; ׯm }}S}} U 0  DI IN 5 q m/X  &v I           /M ////*ws zm ;mW  ;mm  x       xI bufI1I I I I  I (I 0IC8 opI+XI`I0hIyp   m   m --m2  U-m< FsIFmZ WFIx I I F1 IFt 6FIF OIF; rIFWT IFtw IFt\ IFIFm F 5O5Wmt XF1? {I{kk ] I IF mt I t F *F  HFHM / kFHW mt x / Ip?m IZNI I (I8ZN- QZN= eZNV ~F~ j ZNn&1  F ZN1 ZNW ##I AZN x- UUZ Z ops[&@\C]?(^ y0_ y8`F@aHbPcfX logd?`eWpf yxg yhmimjm1k{>1l>1m 1n 1o 1p F  F?Wy / @@AWBCD E\( sdFZ0Ggx81Im1Jm1Km1Lm1Mm   W W y   hD/bioG c !z! y4  !4!8 y@!H!PkX!` !hpr  yt !x""-mEv NT Zev$ j| //=  //D/"J/+S(0vma1&2 >3 /4/5/ O2>? +$@ N$& &/ & %&/// j>|m* j\|//C /p&a &/yu W& &m m&// $&/idr7mm y/~ rev/ y Z#Z y yZWErbG nst0m8< t>z@ idk` yhpErcu7x  opsk!u Zhf "$ % & (( "02 89@: "H= ;P@TXA r`f p" Gdir7_  v knZ   yC C@`h 1x    @  A %i v  y y ; y y; y "1 D;I' T&@ rY-m 0'(w) * +,( - ,(ny t nt# <U<W< t"Pww+& tII-0 tl&S &qInc  1  &1  & > && <n< < C I1s IW `  X 0tWu lvqw!vx*y z (Wlan{,  t`>e>Y }~.Ubuf> 1./1>/?aO/ O  W  M4N3O3P offQ immR-mqh?mX      !"?m6      !?m%      !"#$%&'()*+,-./0123456789:/SP       6 , 0 4 8 < @ H LVBBq   ^keyA a8  $ ( 02  q4      ( , 60 @  D  H LP X \` h lp tx # ' q*y+, - 4 289 : 2@A B S 7 y< = > ? D aPGH I J K OPQ R $S (T ,X0Y8Z @cpu[ D\ H2`Ma b c d e S _zg h akl m n2rs t 2z{ | a@qv w x y (0 8a  q(9^btf      $a0pid fd   ^buf     (2  2   q5 >N a  cnt >  > pf    20  >O  a0cnt  $pid (2  > V0 p 5BNtcx0BOa@  A2 2  >7   >P >i >  >    >!" # +pB pp4+B] +MBozBBpB9B 7Pi$G  jt jf k#0(4)wG/ y y "B^D^EcFGHIy  $!m"m h =A K ":@+"NO/P!Q * H. WQ( i]Qu Wd ('Ed'FW mod'G  ops'H!@'I C'J'K!  1n"'LGarg'M yGstr'NGarr'O; 'V'Wm'X1 '\6 max'^m'_m num'`4 ops'a!@'by6  m/  m n& a/7 `-. mod/ @0H mp1 P2u=X  85k6-7 9 ; <(= 0 1k W W   ?m>_8EEmodF G_Ppqyrystm^mtnw  m11 RwE/5  *vt{t MC \Rfx E"12 3  )pH?U@9,A9,B9,C9,D9,E9,F9,G9,H9,I9,J9,K9,L9,M9,N9,O9PXQ6lenRW SWtagTg=U"|= Vn&(Wr'0auxY.8Z=@R=H  cntWW 5UFf (///// #0UErcu172gx3UdD/ HIJK LM/N0 6@p}HWPXbus `fh yp yxC#  7msij(8@kHkPX `hx k \7idW ~!!v# 6$%'#)+ `, a- b. c/ d9 e< f :;<&  6!&"&#& $&(%&0&&8'&@(&H)&P*&X+&`,&h-&p.&x/&0&1&2&3&4&5& &6+?Ul?mlHxy zm|m}C~0@ 68D ,  , !, ", #, $, %, &, ', (, )W M= Y @ @ A B C D EQPk y9c  y ym                ml;;kkkkh   } (7qos 0 +Y ,W id-./ 0c (1R02/X3 `4 h5 p6 x7 8/9/:/;/</ dev=1> 1? D  ^ } Hm    ops& & 6 6&    & m  M< NWOWP!vQ!vR!v Ta (U 0V&8W 6@X 6HY 6P[&X\&`^ h_&pa&xc&d 6 pmf h+  U U \  `\ aW busb d eWg h$jH(kW0m&8n 6@o&Hp 6Pq Xr&`s!vht!vp pmv xw 6 pyaZ A  z z f   <  `2P3W5!v6!v8 9 n ; (< 60>&8@(@AHC P pmE X  1iz itU~~Ps tz z `>e> 0XYWZ!v[ \ ^ 6 pm` (-m-> >C MR \Z  1z i`>e>smm/?m?m#8j 0!" ?m1?mB?mO#cxd&e2f4g lidh x d  k cma     #.F/+/H7  w F ops # m  w|   net 0ns5X Am( N9NWNWNW=@N]N]NW<m/=NNN"@N+9+m @N/ )/Fm/@Y7|9|@0A`DGJM y/%_^rcu7=/%!/%#@T;EseqX D@[^Wa;dk84iK@@WK/Wa//Ỵ̢̧̤C̪!0̭M78̮kp̯kx̲>y̵̶̹Uavg̺x̽ # ̾R(̿9P yh ylCpWkM7kkaW/k/// // 8= knZ/R#g ss 0@ idPmTkX y` yh4y w     ( 08@H P X `h %p ~&x ~& ~& idWW   m=/ (DE THkJk afgm(uP{xgg  // 6@AB~EmH K^rcuL7 S@@VgY y\m_]7b6gD/lr6s/@y H|mPmTssX`px '   Ec " ;  k   a'  E k, c aJ wh |      #Am% #AmJ@ %)4$@@/@)H)P/X)`)h/p/x/4"$@$ min%/ low&/'/ max(/)%* x ////  (C8 yX 0Q m(" D, 0, .Q0m(1 ,-m,Q  ?y  cnt@ yAE`  yurcu7#M N &PmRm Tm     }CC!}D U}I U}NU}SU C! e}Au!}B}C#%M!`! !km"! !m  ! ! !ho|n"|o|pm|u#$|w $|x $`|z $|{ $|~m8|<|j@| yP|yp|x"h"D/?mEN#     "#$Y# nr i #Q#/-m!# ## x%$ R8/`/h/p1$ yE$>yQ$a$yy H$  xy$ $(90%$E$a$ $ C% idD refE  NF%OoQ yJ@W%Yo\'%]%^%4l$@@p\@q$@r%s!%H % %v/%// (@&k atkQ ``&urcu7@&l*@l*@ &)&/ &%&/&&D/F%C&& k'kkkkkD'' ('y('-' f'map +  > G>F,w' m't'4 I'J+K'Lf'MW'YXQ*S8*T,U ,V &,WD, X &,(Y ],0Z,8\,@^,Ha,Pd,Xh ],`i ,hj -pk -xl -m -n >-q \-w v-x-y-z -|-n2 2 2222 3MB3 \3&u3 3  3(30 484@n&H"4P' 3*3*$*_+ops6+y h W W  W$k(W0idW48@WDWHWLbtf4PpX6`Cp  A5# /501234 5 6=* ++3*=*+,+ ,&,+, D,+yy+, y],+yI, {,+{,3*b, ,+yyk, ,+ {,3*, ,+yyk, -+y,  -+yk- y>-+yW%- y\-+ C-v-+ya- -+-{- W-y--+y - -----+-btf-- .+..6xn2 WW WWWWidW W$W(W,W0W4W8W<4@ ;HyPCX2x;X6kC< .7-W <y"<<"<W< /87ops '<p ,<xC1<2`kW6<6&y<<7btf4<<&< . x(/W00W45W87mod6 @7WH8 Pv;X.2+.s22+W222 2-W2 2-k-2 2+&2 D3+ I3 8383yW=3 3\383yWG3 p3p3yLsa3 3+kkz3 3--3 33333 3 3 4+&yk3 k4-4'-m4 @KK@KKK, 4 btf4 4W- $5 btf4WW " F544 05WW4$5F55D/V 5  yrcu!7>)6*-+,X -.*a 6?m6     KK K K K776 72{,3*7.72#7H7267 y  0 1 y8W@ 7586!7!8!98:8!/8/ 6X8/end/ 8<  Pa8/V 8rcu7 y6?9y/8hyxyv8>0t97 y (:":C 8W<keyk@?9H2x':7:G: :7:/G:/8:9,,>:map+keyW2::8Y;yyyauxy: 0!192W4;W6btf4WY;;btf4 V 9;: yrcu;7;t9 ;2: < <7+;+F</X< y  (k0k8k@kHyPF<37L:]S] =]<] =G=D/^S^C=^=^C=R=D/2\g=+<+=!w=/ w= =2==k==/=  =2===D/?m >> G> g 9> n> =pid W96-m>-m&>-m3?"BH?C 1D yEH?F  (?? key@W3A>@?H I L?MW logN@ P@ !!!  @? 0s{@t @ dupu@v@w@x y(@{@@U@ @UU@ @U@M?@ @Uy@1@/ 7A ops!& "J /-)}A4AAAy%B& TJ' TJ(mJ) OJ* ?F - OJ(.J0/ ?F80 J@1JH3 OJP6 JX7 `: OJh; ?Fp< ?Fx= J> OJAB fC refgh yi yjm kmlmMn y o_C(p8qHr yXs xt/u/CL!!! WkMMB QD refRS DDDCD hՃEՅ/FՆ ՇmՈmՉmՊmՋ ?F Ռ ?F(Վ0Տ/F@ՐHՑ PՒLHF3GJpIAJI c(ׯ0DF8X`p4JDPIXI`h y y!mmmm ym y7len  I !!  ( 0 8  /@  H7refP/X"B` OJh=G-J  ` 4J yurcu7DDJ/OJIDJ$ mJI YJ J/FrJ JIJ J mHxJJIJJIJDJ?mDK K KDFK RK KJ}Ay*K zK K}AyWKK KKKK L K;);L-7L HaM refIJ yK yLm Mm keyN 'O P_C0Q y@RfM`S yhTpU/x[!\4 aM"MGkey yY4"MGaux yg=LM @jMNk lenl wpmnopqrMNs t]N(]N/mN/-}mN }tN}u}vmN}w}x}y}z}} m} P} 7T}UT}nT} ~T}T }T(}T0} ~T8}T@}TH} ~TP} UX}3U`} LUh}jUp} x}yU} UN P P Pa$ ,P 6PH}P}} @}mD}&\SH@PH}  mH}] m}hR}iP}jP}k/}l/}nm}om}pm }qm$}rm(}sm,}tm0}um4}vm8}wm<}xm@}ymD}zmH}{mL}|mP}}mT}~mX}m\}m`}md}mh}ml}mp}mt}mx}m|}m}m}m}}}}m}m}m}m}NH}SS SSmyMP}\S}} &@} &H#SkSD/ kS uSzS S S S S S S S S S S}T}S}S?m}7T  UT m@mBmCm HF4WG H>Jm@KD O\WQ9S9 (VW refW XYMZ1 \W hWi"Wj!UYmY optnVqrC u@wmPx9T{IX lz4}4W` h؀Ip؁Yx؂M؃k؄k؅W؇W؉W؊W؋!،"Z؍m؏9ؑؒؔWؕWؖkؙ7Vؚ7V؜k؞Y4؟Y4ؠWءW ؤإM=PبMpةVxتWث1ج1VW-m#Z eZc $yHLZbufM#ZOCV OCV(Pk0Pk8R@SaBTmD8gU[hVicjMk lk nCV(om0w.m C m C m  m  mO m   `0\DF }AH yP ref!X ($\%c&  len' ( ) ref*$J\ io[Ebio `\h\/x. U[|' bM"]WWtb1?]>Wb Z]Z]U/@e, r]ZNb]qO]?Z ]MtZ]r ]Ob`#]Z ]CbC^M!tt7^W8T^*W Ik^ZNb5#^Z ^CZ ^Ct^e ^IW,1^W>ZY _Cbڠ _WWZY 1_C I He JV_QW yr_r_/Z _t/Z_/b_tWؐ_ZN_ZW`e؊,`,`#Ze&X`mW؎y~`,`ZNCVZWؓ`I`eZe`QW cy`/b ` KCZaZNWe )am/OW2yNa>W8yoa>W?ya>ZtaaeatW}}z!ae|a c!!lbisb6ZNIsbib*b+7C] T0 Q0CjC|Wvnjisbv3ZNIretxIsbiybLzVL{m%y~ Tjz&z!z.zr;z c@zrNzcOz%e $51>RH&^Pٻ  ge$h  z'  ǼѼTۼ ܼae Us T1a Us T2%^zipz&|zzzzszgzzC bUbp  c*  f˲Na T Q(%ոh5 /{g&k^ U~ T  Qj,%khx5} 5D )rz Viz* :ir] U ^oi T zi U|Caai U}a U}_i U _i T}^j U ^7j U ^ U * jjj U|Czbj(ctxbRH&^Pٻ  n$h  z'  ǼѼTۼ ܼa n U~ T1a U~ T2%ո;To$. P{=ok^ Uv T  Q|j,szo Uv T| Q}1!^o U| T Cr%Kcq $51>RH&^Pٻ  /q$h  z'  ǼѼTۼ ܼaLq Us( T1a T2_q U ^q U _q T|` Uv T  Q|xs ?Ver(sb?OZN@ 1@ m[ctxBV9CW8Ur9Gy:9Gy )Vr(sb)KZN* 1* m[ctx,V9-W Dsictx CV*Y"Qsgt^ T0 Q0*0 #s>K^ T0C^Caya UUVyisbOZNt 1t mLMIctxVLCIisbZNLIIreterrku.yLyCbUbp   cf* u˲Na T Q8%-vʹjֹj%. vA&LY U|*k}wx$} $ D'  )*$ )xɮծ] U} T4 Q| X0 Y0* x] U} T0*x%0y>K^ U} T0*Y ygt^ U} T0 Q0CT^`y UU T  Q|Ca` UU T  Q|P  ^z(sb>ZN[err9W[sbib8Nz9y:9y  z(sb:ZN[err9W[sbibout8z9 y9 y:[mntO |isb>ZNIsbibL1LML1Iret*P {amy\ Us T0 Q0 R0%|*+T|<"]z| U T a| Us`| U| T  Qs` U| T  QsX };Wdiracd?Ireqf*h|}%4kEQ]&isu~fv5CV!bUbp  cf*  ~˲Na T Q($k]x$} $D' )%kį%үk%q ,&% 1&>%}  M ȴ48 EP5  5[ $lwC`' *˱'ٱ ' *6$  '!h 3'  TC`tqz0=K Uvx0\S tS2 tSFQIreqUIretV%XX#jc g M ȴ4 8 EP5 5[$lw%LXq^l  ~%4XEQz]&isufv5CV!bUbp  cf*  ˲Na T Q($k]x$} $D' )_z0&=K Uv  UvC_ Us G K(reqG=[retI {ireqCLcLIIsbZNIio{mapeZ~Z~Ipos L  Iret kbuf#Z}~L Isrc y* %$ 5AM/y&s}cǵȵ' !w_ U~ T} Q1_ U~ T} Q~*+ @<X`f U} T} R11` U~ T0 Qv Rs X ` U}_Ӌ U } T~` U}`Z(~1`? U} T0 Qv Rs X~_ U~ T}kL0 L0 %;}& r!$Cv bUb'p  T*  ˲Na T Q`/| $51>RH&^Pٻ  $h  z'  ǼѼTۼ ܼa T1a T25k}x5} 5D )%A&'/eג/g/~yE  3 ºغͺ&*  g»ͻ'?  Q\'  ǼѼTۼ ܼa T3$- { U~a U~ Us~` T~_& U} T}1`U U~ T0 Qv Rs X}m Q~C[\7 \KQ]ctxV]ret]req]io{out/Xjc 'g' M ȴ'4 8 EP$ $[$lw/Lו^l  ~/4EQz]&isu fv5CV!bUbp  cf*  ˲Na T Q($k]x$} $D' )/& s\!5C v bUbp   c* =˲Na T Q`/| $51>RH&^Pٻ  $h  z'  ǼѼTۼ ܼa T1a T2$k }x$ } $ D' )PXj'c ' g' M ȴ'48 EP$ $[$lw/Lӝ^l  ~/L ^l  ~/&'q U| U}1` U| T0 Q|Ԟ UsC_ UTsӟbio+ ]ioӟ]ret8T@!yax Us@ T0 Qs Q| U|a Uv UU\ lߡ\;_]ioӟkFygy5pcf *  ʠ˲Na T Q /kx5} 5D )a U| T0 Qs R  X0;\+y\ \&]ioӟfM{{ Us UUCa\?C\ io+{gRH&^Pٻ  $h  z'  ǼѼTۼ ܼa T1a T2/p í&Э% & Us Tv Q R2 Ys/̰{P Us Tv Q~ R} X Y0`t U0 T ` U0 T  QPޭ,*4EP$ $[$lw` Us TU/ ިC0t!{/!reqtUQiov{:@v y@v yit\i,y\j \j&]iol{]reqm5q&'/e/g/yE 3 ºغͺ&*  »ͻ'?  Q\'  ǼѼTۼ ܼya T3$ - { Usa Usx;a 4!ioa?{Qreqc0S!SOcT!lenTQreqV:@V!y@V!y;K !reqK<;7 !req7A@9Q@:@; /@< /Qxas>0- !io-;{)pfc:U?] UU T ޭ0 K J}A y[ops 8G  @ KC 8G+[+FX4Y47C4DX@C t!^X>C0CFM!tt;P7Mt0M;WWt m(rac F ү(rac A (rac > Q G9 Q QL I9 Q l .Q  /$X b(m b?c bH>XLڰ(iL7LAX<(i<7<>k 1(i1<G0X!t.!iF axa5x 7xX,Q ٱ4Q ~~2$ eme |.y|D|P>:9m %m<:O z0zC>zX/ yX(xas 5r_(max H/9 9 y (xas /r_ @tX (xas /r_  1  ,t y4(xa 34 9 .m:9  y:O  ˛0 \ +t0 z /t0 y!v 2/ KK9x 6ִ6AxX?Q :/*:1Q(n:Am9<$ 0rsb0Cx(n1 m93b$%lM0صt*6Qsz:9:9;&:/;.!ptr;t!nN/(p9\9[ret8uO8O8O8O8O:8¶Od8ҶOd8Od8Od:Od"!pA\T@@Qret 8Q__p1@@:@8M8M8M8M8ʷM:8ڷMd8Md8Md8Md:Md s?s6?:Ou  jqj8?jV?;/;7;ո2K:M;!new/F;7!new1:M0j{jFQretl:@o@p0A!newA@BCQretE;##58M%:M&0O! !ptrODt0A!+!ptrA0]!nr/;]A;!nr*F;;^!v^O^Y{;Pٽ!vPJPT;B!vBIBS0&!nr/?]0[!nr4V]@0!nr4V];4!nr44/0ܦ!nrܦ/ܦ@]Qpܨrs@ܩ/Qvalܪ/;&!ptr<H0,N!p,;,Km0(v!p(:(Jm/gMyE 3 ºغͺ&% »ͻ?  Q\  ǼѼcۼܼya UU#$ T3/ K /O&ìϬ۬Pp@C:_/XBCjw' PִEA* 'boz$/Ao#z0&=J% *  < T j''\ mPgHC1_V_ U| TsCC_ya UUCY/g/yE 3 ºغͺ&% v»ͻ?  Q\  ǼѼcۼܼa Us T3$ - { Usa Us|3|%gyE 3 ºغͺ&*  »ͻ'?  Q\'  ǼѼTۼ ܼa Us T3%|  |%q~5/7H&T] Us$jʸ*&j3*+7C] T0 Q0^ U Caa UUC]_ U ^ U y^ U jjfj%jbj&j%gl=yE 3 ºغͺ&*  &»ͻ'?  Q\'  ǼѼTۼ ܼa T3%qn=~$P7HT] Us$jʸ_\ U ^| U r Us^ U x|xrH  5A : F ^  q q     Iint F ,  * +s8R+u8e+s16}+u16 +s32+u32+s64+u64P \    1F 2F Hc IP X ] ^P _ `:   <F  '   o   #SB  %{ & 4 = B h n' } 1  ;  ;  F  F   $1  XXX0xx : JKL Wx K  s \x1MH  5  G "V y  ( ;$0 t8 ]@ "H "H "H ~H "H "H "H "H$@    0  RP h  5 5 F @  E F 1/kp J  F( F, @0  E8 B@ BA BB FD  OH sP8mem T@ t   F 0 e j  t ~  ( 0 F8 @ FH FL P FX ` Fh p  x F F @$  F  F F $  F !$ "F % &r' 9F : ?0 A0 D } F  P  QF( TE$0N  ; cs =;sl ?;wfe A; Ex ss G;sti I; K;nmi M; P;  S;0 V;8lm X;9 ];: d;<  cs  csx ;    ss  ssx ;   g r15 mr14 nr13 or12 pbp q bx r(r11 u0r10 v8r9 w@r8 xHax yPcx zXdx {`si |hdi }p xip x  sp   B  C  D  E   E (s E ,dpl E -p E' / F 0avl F 4l F 5d F 6g F% 7 F+ 8  % %% )%/ 9' pgd' )'"  @H? I!_0_0 48em f g h u vwkeyx\m  U V ? j keyk n keyo ;l<=? F @ F$A F(B F+$-@ (y0FF  4( F,!F0( 4)Y.8*FH+P,(X5 `6 d8 h: l; p< t=Fx5se?@@/rt@A8dlABBBFD%I2JKFODXD]D%`"w>@d]hFkF lm nD oD(p'0q Xs`ubx dy/Dhz0p{D 0 0  /D00 x=01(%2P/mmhpEx    F F, F, F, F- F- F- F- F- F- F- F- F- F - F - F - F -"F -30/pid * *( (00((000@>FPCFX 0"{F%v(v+ - ;. ;3 ;4<6=: (=0>8A ;@D ;HGPHXK:`%N;TGWGZG^Hk -mHp0 q1(t8u@/fsxHH{HP~HXI`Lh Lp 5x 5 58 ~FL o<F\4h9 ;  ; u1 2" TD p2( (8 L@  H MP  MX M` Mh Mp x M /: F  ;  ;  ; 4 <  M 0  '  ' "M )M  0  M0  18  FX N\ N` 1h 0  N      !F "F # $ & ; ' ; ( ; %) 3*N C$ D L/N N R?N S'( T', Y0 ] 8 ^ < _ @ ` D %aH d9X gIN i9 lSN w x z } ~XN  ; ;  $  FmNwNNN F(F,vD08rcu04@ D(H4POx4  " O OO  ; >% !"-$"-%.<(O%F-@@l$@@q-spes ds"$&(0-8X`cr2hpx-F' i-5fpu ,@F(  '$@@!d@&i@ , !c c B(,Gd0&d80XQdh%`dpxb ed' Njdb !  >!val   R!! ,>!!! !!  ^! !!R! ! " \ " ?? 2"R! " "2" F, #fmt555F55$O6,# 7 8 8#5555'F'F'4Fkey9 #("F=#   8U;$V0modW;$X5Y@$ Z ([ ,\#05u$v$w$xFyF,## :$ /$1Fset3Cget5\7 .$D&;$ 5 X {  -( -08!@" ߙH# P$ X%`&/h'Hp(/x)k*+,ٚ-ޚ./ 0 .1 2`3 5 9 ϛ; >k?@=$ !'% + -/  :' !key " ?h' A Bm' Cr' h'' =' >:' '  ;{' ! $0"c("d5"e."gL"i j"lo 5('# N# Np$(cwd$'swd$'twd$'fip$' fcs$'foo$'fos$'$($'l '($*(rip$+;rdp$,;$..)fip$/'fcs$0'foo$1'fos$2' $)B)((0$@d) $Ad) $Bd) 't) :$$*cwd$% swd$& twd$' fop$( .)$5'$6'$9* $<*$>d)@B) '* '&*?$Q+cwd$R'swd$S'twd$T'fip$U' fcs$V'foo$W'fos$X'$Z($[l$\m$]n$^orm$_p$`q$a+x$b'! +@$:Q+$; ;$< ;$= Q+ ;a+$@@$O+&$Pt)$Q+$R+@ +2P@$^,$_9(-$`t)$a&*-$ba+@$c, ,E$@@$f,$hF$kF$n;$q;xfd$t;$wF$zF$F$F&$+@@$,$ ;$F$F Qfpu@$d-$F$$d-$d-$, $,0&$,@@,% -% ;%; :- - --- -&N&N&N'8.'92.'<2.'=2..(<Y. (=F (> (:.(;.7.src(A  dst(A .."F).  () /) /val) ')!' )"')#;)$ / ')*G/ )+&G/ ),#t/#*t/*uQ* L/)'/)(6)).%/).; )1/)20)3)4 )5)6 /()30 )%. )/y/ )7/8)`0)fn) t00\o0o030`0+>0+?+@+A'cpu+C'"F,0     - 1- 1  1. 01.0/ K1/ 0a1 0"0u1K1 0a11 11! 1"1 2)12*'2+2"osq2-01 2/0(3 23 3 0304P244P24P224 p24 P2424U24P2 52(5 25 5 25p2"F6 2 @6'q3(6(26)  6*3(6+406,86-96.:6/;2332q3@@7/470~71F72 6 seq73;743752 76077 83(8G48 x88 W48' R4R44G49499 94 4: 4:4 4 :84;4;  ;4<+5<,c<-cx=_5=_5=F`=hmax=p o5 > 5sig>4 >o5 ?RE ?S55 ?U ?V55A@5 @  @  @ 5@'"6@(o@){@-`6@.@/@0 5@1@56@6o@7{@8 5 @<6@=o@>{@?@@@A@S 7@T $@U@V @Y17@Z $@[ @^b7@_@` @a @J7 @L @Q @W6 @\ 7 @b17 @E7@Fb7@g7@h\_fd@i@m8@n@o@pF A @%|8 @*5 @2"6_rt@9`6 @B6 @d7 @j7 @q70A 8A A A A 80A 8|8 A8 8A  9A!0A" 5 A%N9A'5A(A.5A0 5 A3h9saA4 9 B 9B B lenB B B(C9C {D$9D% D'D( 0DD/:DM#9DPB(DWB)8E :E;E;E;E;E; E#;(E,;0F):F*;F+2PF8:F9:F:FHF;FL :;8FD;;(FEFF1FGF0 G>;GKGZGpGGGendG; :;2H!;H" F H&;HD;HD; HD;HE<HE; HE<HT L<HY<HZ u1 H[(<I o<valIZ I X<I <valI f I {<S<U ;V ;W2"6F[=    0hx=i;jk<cpulFm;n; o;( == ',@@w> ; ; ; ' ' (0F8$@@ ; ; ; ; ;  ;( ;0 ;8 1@ ;H ;P 1X 1` ;h ;p ;x  ;  ;  ;  ; ; ; ; ; ; ; ; ; ;$@qA=& 2! ;(" ;0# ;8%0@&qP'qQ(qR)qS, ;X- ;`. ;h/ ;p0 1x1 ;3 ;6 7qA9{A;{A=5avgG=@@ vA0KAL0MNOF P$Q&SA(A)]BBBBBB,`C&a2h ;i ; j ;(k ;0l ;8s 1@t ;HuFPFFFFFFFF&2X&2rqCACB)^CC(CBRrqCC;F ;F ;F;F9/DSTDBbCBs'qDqDTD? ~DD D CD'' D,EqRjS @ D Hp2P` h)px u10S DFpidpJ7>FJ9 4J:FJ; u1J<minoJ=;J?y J@]@JBSH.rcuJC`JDypE xSF K{FKFKZTSFLoGLp'uidLq o<gidLr < Ls o<Lt <Lu o<Lv <Lw o< Lx <$Ly F(Lzy0L{y8L|y@L}yHL~yPLqXLH`LHhLHpLHxL L}L iL8L}!}FGFkeyMHM4Moz!{M| semMS(M|PM X|`M huidM o<pgidM <tM{zxM|M~M M||M|G H H H H H:XN^LN_4N` NaNb Nc0NeS Nh(8Nk8@Nn]XNq`NsdNt(hNwpNxFtNzx'NF'NFNFN]N](N2N itNN4N:NƀhN N>FN\V_eNW_fFsda_gX_h"_iX WCx_DX_EW_FX_H _I1(_Ju1H_K1P_Lp_Mx_N_O_P_Q_R_S_TB_U_V1_WSF_Y _\_]_^T__NWp WXUSW`NaX a+ a+a" Ya#a$a%a'/Ya(a)a+SYa,a-a!Y a&X a* Y a./Y aYXopsaYSY YYa2Ya4a6Fa7F "FQ@Z   "FQH@Z   QpuZQqZQrQszZ uZQZQYQVQZ(QQ3QZZWZ@Q`[Q@ZQQQ Q B(Q,Q`[0.rcuQ8Q[HZYQ[QidQ j[[2Q[Q[ [(b\b2"b1b0b  c \c;c& $c)Sldtc*\8c.@c91Hc:hc;]pc= xcC |cD~ \d ]ddaltddd d(d0d\8d\@d\Hd\Pd\Xd\`d\hd\pd\xd\d \d!\\] cF\\]^ `FX^lruY0] d0 e0i>^ j  k(Rn^]hE^s (u^zpp{^|}~' ^^^_  ^3(Q0_>^n^^^7R_ F  9 k_val)R_0M_N PF*J_BlruK0x_*W_X Yk_0@GL`I_UEV  _([ 0\ 4^84@Fj`_-j 0(m`noq r s t vF 4@l`j`-z 00}Ta~     (0 a04@|a`Ta- ,Da!L`!`@!a)a, b  u1   E  q(F0F4G8w@pP rp  x#Օ$ % 'ڕ!a5cctx6c c=Cc>AS@;(X`cYS(\cbht%w }$0c4cc-*daaX Gd5rb2Cc Ld Vd[dc`cd;cid Y@@ d 9 d0 mNZ@@h!d@S@PX`hppgd  x) 5 ?hELFS Z2"]'_au1pSr0$ (08;@u1DHP'X3`h/brkp!x%0hh@h]hu1pix( ib&i  ['T!i' dod h3 [h h iQ i i 5i2#e6N#e9N#ej gGMj gHj gIii 4j9j CjHjh,jh- u1h/ h0RjgAjigK ~g:j g@~ijgNj gO gP gQ r(g+Dkg,g-Bg.Bg/ ~jj 0pkqbr rs t u v $H(Dkji"ki#ki&ki'ki' kkkj(lju1j 3jBl7jljWl!(lk3{lk4'lenk4'k2lWl k6;k1l{lk8lkil kj0 kklS[krm ksx ktk7kukRmkTFkU<kVkkWmkXl kYq0k[q8k_"q`k`uhkapkbx(kdBllkmxkn].d_ukvlmm$x{q| }~ o< <F !e u(E0 8@H L rP X ` h'p't'x'|u1^ 'Sx0o  000 \?0$@$H P T X \@e`yh%Dp08@H P(X`h pm q-q'@kqkukukvk6vkJv k^v(k nv0k nv8k v@k vHk.wPkLwXkew`-qq$@u0 q r t(!0!8@"HPX`mhSp &!#:D$SXk 0 b b l vxF (%` '!'"/ 0 14 6F<1 B5@D"qHFxPI'XL`O dRUhS]pZ ixaxbx8rcucdTf1k0%nu1@@o0Hqu1Xr0`q"Fku umFuvv vmlu1vvF51vlvJvv;v^vmOvnvmcvvmqsvvmv lEvlFmlGulHlIvvvvwm)wmntm vm mwvGwGwB)w3wmewmuQw n"wn#nidn&n-n4n7mNnRxnSxnUxnX\nYnZ Fnc 4 ndSF(.rcuneHngXnj0`idnmpnptnq5xnrmnuxxxxwjwx'0o3xo4\yo60o7o8 Bxao9Rj  o4yo 0o" \o$u1@@o-\ylruo/xo0' 4yJ2ynrJ3nsJ4y0 ]y ayy2p yvalp; py"Fq y   y r1zrr r#sNteztjzt ez M MMlz.rcuMmMn4Mo BMvzMx My MuzzxM(MrA{MtzMK{MP{M5 A{A{zA M{{ M M {U{ { M{{{H{{HF{{{M{M{keyMHMK{3M| M07M2MA| M  M (M|MMMK{MP{M  (M| MzA|0 M|M0M =z* M|MU{| | |{u}u 4u[u0u'8ux@uidu o<Pu'Xu `u$>"hL}L 4LgidL } <}23L} L]rcuL}}:@@7g~7h2"cpu7iF7jF7kF 7lF7mF7nF7oF7pF7rF7s7t7uF7{  7|3(7} 07~38(7M@@}1~"F7:M        =3@^ N9n?8NN N! \N"N#;N#; N$(N$0N'N(;N);N04N1 $N2 $N3 $NCONDNLwNM(NNwO8NQNR NSONTSF| ƀ >Fր ր  4  v)v(0wlwwwS(w `x .rssx )xq0x8xS@x Xy fny .argy  ez bz z { 'OSA OT0 OUy3OWb OXx7OY8OIqOJiocOKM!A O\F0 b | ҂val|Z || val|f |ނ} v}  }%6F}T^    "q~      . 0 $ 4"F.ۃ   45F679 * % /4`  o<  ҂  <  PF >`  rKK(K8 bHЁ()x*0+0 ,00-1@. u1`/ d0uh1bp2 rx34 { څval ÅGF  "F6(   BEbuidF o<gidG < H څD4JH ( ( ( ( (  (( (0 8 @HЇ0 F(F, (0 (8@ Ї!;$ЇGF        @89:;<=È >È(?È0@8uÈ܈u܈bȈXDEÈFG HÈIÈ JÈ(K0N щ8O@QHSPủ̉q(qڅ։q̉xYZ[;\;];^; _;(`;0a18c1@dHeLf;Pg;Xh;`i1hjp8FFFF FFFino  ( 0‹F‹ ҋ QFFF FFFFX66 Y(|08|@H6PQuGw6uF"TuTҋ;wubw ^u܈wuD8  F S 0 (H/ops!8  q( 8 H*wm}r mwk\Ǐ! : T (0 ѐ8 @ H P -XP`dh p x   ̏ba!E B:E&JJO ?bErFSYbErFFѐE~~֐B -kkPEy2dUB~~iBEؑؑbݑ bkkǏ*?MF4e]-*! &q*ޒIN  F ޒ $@Z`[[\~]^`؜ b(d0e78fZ@h}Hj7PkXmҝ`ohp"pr @xsmuvyў{}:S` j t ~  ( b 1pid>F0uid o<o< $ p FF FF r* 1 ;4 )Օ-*+., -])P^F    $0c  &c=ltΟ    ( 0 8@9HMP9XM`php x Ϡ  ) ) y  +& 05 ? INۃ ] g q { : :$)Bߘߘ5r;F pos r) Fr5brXb~oi:{b5~oi]kF bߘՙbՙڙ \bFb/qbHbߕ4kbrrMbpb ٚb$PINboi~F.boiIN~F QbQSV[ 3\brreb ϛbrbr~FrbrbrrFԛF =F$m[qmFB5ymqy`qqB؜mqmBݜmqm7qm#Zqm5<}qm_qmҝqmqmFmםGw'FQ@m~'cqc;;h EqrqmbFўqbm֞m0m05 Sm0? mt S qX6F   qΟuqӟqq u9u%Mu>fmfk RuvumϠu~ru5~rԠ q\)ux==B . LQmyt5[ "@@AA5B0CFD֪ E<(sdF90GAS8'IF'JF'KF'LF'MF *  . 'PPW     qq  ZU2_rev Z99  95.rb2ns0F8< >Y@id;` hp.rcux opsJ!T r9hEi y"$ % ɦ & ަ(( 02 ~89B@: H= P@3XA Q`E O dir d > Ukn9b 1 1@`0h x  ~  B@  BA %`dddUydn~oiɦoiަΦd~rdՙ3drQdr8"Fz  0'֧(V) ji* +, - .(z1ۧ 1"5"5" "mW "n "o&X"0"1 "2 ~"3 "4y "5 ("7 ө0"9 8"; ө@"= H"?PWW )F) LF3~jFQ)1EtbFr~~өbFr~rbFrةbF"N" l" #lF)SF)5~q`֪0 u1 X0t7u LvQw!Vx*yy z (۪7LFAN[(oot֧A`t~ttiyiC }~(E>F5modG;$opsH!I JKa ܬì\׬HLargM strNarrOVWFX \max^F_Fnum`qopsa!b$0(;();=2L t F v   :7` -  .mod /;$@ 0FHmp 1P 2{FX  8 5r 6  7  9  ; ͯ  <( = 0r5~ͯ;$5;$ү;$6F >   ,8 ELmod F;$& G6 J       _,P p q r sB tF5mtn w  1  1 F   6;"ܬy=e& o y#QNW/Q  "L Aϱ >ϱ `   A >  A3#>3  A\"L>\ a M b L % Kint 1u8? #W   1 <!%',/359<ADHLQUYɲʲ˲  6 9 < GK 1 :@ 1T| 1.111-  g l - - - `J 9   % V9  `/V ,4p ,   : ;9 I8  : ; 9 I8 I !I : ;9 I8( I~1B 4: ; 9 I 'I : ; 9 I8  : ; 9  : ; 9 I8I!I/  <: ; 9 I41B&I 1H} : ; 9 I : ;9  : ;9 I : ;9 I k.?: ;9 '< : ; 9 I : ;9 I8 : ; 9 IB I8 ! "4: ; 9 I #'$ U% : ;9 I 8 &H}'4: ; 9 IB(4: ; 9 I)H}*41+ : ;9 I k ,: ; 9 I-41 . I/1RBUX Y W 0 : ; 9 1  : ; 9!2 : ; 9 3 : ;9 4: ;9 I5 : ;9 6.: ; 9 'I 71RBX Y W 8.?: ;9 'I<9: ; 9 IB:>! I: ; 9!;4: ;9 I<4: ; 9 IB= : ; 9 >1RBX YW ?4: ;9 I @ UA : ;9 I8B : ; 9 I k C : ;9 I D : ; 9 I 8 E.?: ; 9 'I<F : ; 9 I kG41H  : ;9 I1RBX Y W J : ;9 I 8K.?: ; 9 '<L!IM I 8 N> !I: ;9!O : ;9 P: ;9 IQ(R: ;9 IBS4:! ;9 IBT.: ; 9 ' U : ; 9 IV : ; 9 I8W.?: ;9 '<X.: ; 9 '@zY4: ; 9 I?<Z  : ;9![ : ; 9 I 8 \ !: ;9 ].: ;9 'I ^: ;9 I_.?: ; 9 '<`H}a1RBUX! YW b 1Uc : ; 9 I k d  : ; 9!e : ; 9 I f  : ;9 g4Gh$ > i : ; 9!j1RBUX Y W k 1Ul4: ;9 Im : ;9 I 8 n4: ;9 Io.:! ;9 'I@zp4: ; 9 Iq !: ; 9!r:! ;9 IBs t : ;9 Iu !: ; 9 v.: ;9 ' w:!; 9!Ix:!; 9!Iy!I/z  : ; 9 {1RBUX YW |1RBX YW }.: ; 9 'I@z~'I I!>! !I: ;9!4:!; 9!I!4:! ;9 IB 1.?:!; 9!'I@z H} : ;9!  : ;9 1.?:! ;9 'I !1>! !I: ; 9  : ;9 I 8 I 8I ( .: ;9 '@z :!";!I8  !: ;9!4: ;9 I?<< : ; 9 I 8 : ; 9!I! :!;9!I!4:! ;9!I!.?: ; 9!'< :! ;9!.?: ; 9 '@z:!; 9!I.1@z I8 : ; 9  : ;9! !: ; 9! !: ; 9 .?:!;9!'< 1.?:!;9! 'I<5I : ; 9! !: ; 9! : ; 9! !:!;9!.?:! ;9 n'I<41 H}.:! ;9! 'IU@zH}1UX! Y!W!.:!; 9!'.?:!; 9!'.?:!; 9!' !.?<n:!";!% U$ >  &I : ; 4: ; 9 I?'!I7   : ;9   : ;9  : ; 9 I 8  : ;9   : ;9   : ; 9 (! : ;9 4G: ;9 .?: ; 9 n'I<.?: ; 9 '<1  14: ;9 I : ;9 .: ; 9 'IU@z.?: ; 9 'IU@z4: ; 9 I4I4.: ;9 'I .?: ; 9 'I .?<n : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 ( 'I : ; 9 I8 < : ; 9 I : ; 9 I8 : ; 9 I&I1BI!I/  : ;9  : ;9 I kI~4: ; 9 I I8 41B' : ; 9    : ; 9!  : ; 9 : ;9 I : ;9 I8 I!.?: ;9 '<" : ;9 I#4: ;9!I $ 1%.: ;9 'I &H}' : ; 9 ( : ; 9 I k ).: ; 9 'I *: ; 9 I+>! I: ; 9!, : ; 9 I-: ;9 I. : ; 9 I 8 /: ; 9 I0  : ;9!14: ; 9!I 24: ;9 I31RBUX!Y W 4 : ;9 I85 : ; 9 I k 6 I 8 7 : ;9 I k 8H}94: ; 9 I:$ > ; : ;9 I 8< : ;9 I 8 => !I: ;9!>1RBX Y W ?: ;9 I@ : ; 9 I kA : ; 9 I!8 B : ;9 C4: ;9 I?<D!IE : ;9 F.?: ;9 'I<G41H I 1UJ:!; 9!IK  : ;9!L : ;9 I M : ; 9 I8N.?: ;9 '<O1RBX YW P1RBX YW Q  : ; 9!R !: ; 9!S1RBUX YW T UU1V 1W : ;9 X'IY  : ;9!ZH}[4: ;9 I\ : ;9 I 8 ] : ; 9 I!^ : ; 9!_(`.?: ; 9 'I<a:!;9 IBb.: ; 9 ' !c.: ;9 ' !d>! !I: ; 9 e : ;9 I 8f4: ; 9 I?<g : ; 9 hI i.?: ; 9 '<j4:!;9 IBk1RBUX Y W l1RBX Y W m 1n:!;9 Io !: ;9!p : ;9!q I8r<s : ;9 It !: ; 9!u4G:!;9!v5Iw!I/x !: ; 9 y : ; 9!I!z.?:!; 9!'<{|:!;!9 IB}4:!;9 IB~.:!;9! 'I@z4: ; 9 I : ; 9!% U$ >  &4: ; 9 I?4: ; 9 I? <' : ; 9   : ;9   : ;9   : ; 9  I 8 : ;9  : ; 9 I 8 : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9  : ; 9 (  : ; 9 .?: ; 9 '<.?: ;9 'I@z.?: ;9 'IU@z U 141 1 1U.?: ; 9 '<.?: ;9 'I .?<n: ; .?<n : ; 9 I8  : ;9 I8  !II : ;9 I8'I : ; 9 1B ( : ; 9 I8 < : ; 9 I &I : ; 9 I8 : ; 9 I : ;9 I~I : ;9 I k!I/ 4: ; 9 I I8 : ; 9 I' : ; 9 41B : ; 9 1 : ;9 I8  .: ;9 'I  I! : ;9 I".: ; 9 'I #  : ; 9!$4: ;9!I %: ; 9 I&1RBX YW ':!;9 IB(: ;9 I): ;9 I* : ; 9 I k +1RBX Y W ,1RBX Y W - : ; 9 .1RBUX Y W / 0 : ; 9 I1: ;9 I2.?: ;9 'I<31RBUX Y W 4>! I: ; 9!5  : ;9!64: ; 9!I 7 : ;9 I88 : ; 9 I k 9 : ;9 I k : U;$ > < : ;9 I 8= I 8 > : ;9 I 8 ?.: ; 9 ' @ : ; 9 I kA : ; 9 I 8 B> !I: ;9!C : ;9 DH}E1RBUX YW F : ;9 GH}H41I4: ; 9 I?<J!IK : ; 9 I!8 L1RBX YW M 1N4: ; 9 IO4:!; 9 IBPH}Q 1R:!; 9!IS  : ;9!T : ;9 I U : ; 9 I8V.:!;9 'I@zW4:!;9 IBX:!;9 IBYH}Z5I[ : ;9 \'I]  : ; 9!^ !: ; 9!_  : ;9!`.?: ; 9 'I<a1RBUX YW b4:!; 9 IBc 1d.: ;9 ' !e : ;9 I 8 f : ; 9 I!g : ; 9!h(i.?: ; 9 '<j4: ;9 IkH}l:!; 9 IBm.?: ; 9 '<n : ;9 I 8oI p.?: ;9!'<q4:!;9 IBr 1Us 1Ut 1u.1@zv !: ;9!w : ;9!x I8y : ; 9 z : ;9 I{ !: ; 9!|4:!;9 I?<}H}~ U.?:!; 9 'I@z:!; 9 IB4: ;9 I1>! !I: ; 9! : ; 9!!I/< !: ; 9 4:!;9 I4G:!;9 4:!;9 I.?:!;9!'@z.?:!; 9!'@z4:!; 9 I.?:!; 9!' !4:!; 9!I% $ >  &4: ; 9 I?4: ; 9 I? <'  : ;9   : ;9   : ; 9  I 8 : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9  : ; 9 I  : ; 9 (  : ; 9 1 .: ;9 '@z.?: ;9 'I@z: ;9 I: ; 9 I : ; 9  : ; 9  .?: ; 9 'I .?: ;9 '< : ; 9 .?<n : ; 9 I8  : ;9 I8  !II : ;9 I8'I : ; 9  : ; 9 I8 < : ; 9 I ( : ; 9 I8 : ; 9 I&II : ;9 !I/  : ;9 I k I8 '4: ; 9 I : ; 9 41B : ; 9   : ; 9! : ;9 I8 1B I : ;9 I4: ;9!I  : ; 9  : ; 9 I k !I~": ; 9 I#: ; 9 I$ %: ;9 I& : ; 9 I 8 '  : ;9!( : ; 9 I)>! I: ; 9!*4: ; 9!I +.: ; 9 'I , : ;9 I8- : ; 9 I k . I 8 / : ;9 I k 0$ > 1 : ;9 I 82 : ;9 I 8 3 : ; 9 I k4> !I: ;9!5 : ;9 6!I7 : ; 9 I!8 8 : ;9 9H}:4: ; 9 I;:! ; 9!I<  : ;9!= : ;9 I > : ; 9 I8?  : ; 9!@ !: ; 9!A1RB UX!Y W B1C D : ;9 E'IF  : ;9!G1RB X Y W H : ;9 I 8 I : ; 9 I!J(K 1UL41M.: ; 9 ' !N : ;9 I 8O4: ; 9 I?<P : ; 9!QI R.?: ; 9 'I<S.?:!;9 'I<T:!; 9 IBU UV1RB X YW W1RB X Y W XH}Y.: ;9 'I !Z !: ;9![ : ;9!\ I8] : ; 9 ^<_ : ;9 I` !: ; 9!a:!; 9 IBb4:!; 9 Ic4: ; 9 Id 1e 1f 1gH}h.?: ; 9 '<i: ;9 Ij5Ik>! !I: ; 9 l!I/m !: ; 9 n : ; 9!I!o4:!; 9 IBp1RB UX Y W q 1r: ;9 Is4:! ;!9!It% u$ > v w&x4: ; 9 I?y4: ; 9 I? <z'{ : ; 9 |  : ;9 }  : ;9 ~  : ; 9  I 8 : ;9  : ; 9 I 8 : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 (  : ; 9 4: ;9 I?<4G: ; 9 .?: ; 9 '<.?: ;9 '<.: ; 9 'I@z4: ; 9 IB.?: ; 9 'I@z 1U : ; 9  : ; 9 .: ;9 ' .1@z41.?<n : ; 9 I8  : ;9 I8  !II : ;9 I8'I : ; 9  : ; 9 I8 < ( : ; 9 I : ; 9 I &I : ; 9 I8I : ;9  : ;9 I k!I/  I8 ' : ; 9  : ; 9  : ;9 I8  : ;9 I  : ; 9!4: ;9!I  I : ; 9 I k  : ; 9 I~>! I: ; 9!   : ;9!!: ;9 I" : ;9 I8# : ; 9 I k $ : ; 9 I% : ;9 I k &$ > ' : ;9 I 8( I 8 ) : ;9 I 8 *4: ; 9!I +1B, : ; 9 I k- : ; 9 I 8 .> !I: ;9!/ : ;9 0 14: ; 9 I2 : ;9 3!I4 : ; 9 I!8 5 16.?:!;!9!'<7:!; 9!I8  : ;9!9 : ;9 I : : ; 9 I8;41B<4:!; 9 IB='I>  : ; 9!? !: ; 9!@  : ;9!A4:!; 9 IBB: ; 9 IC : ;9 I 8 D : ;9 E : ; 9 I!F(G H I : ;9 I 8J : ; 9!KI LH}M: ; 9 IN !: ;9!O : ;9!P I8Q : ; 9 R : ;9 IS !: ; 9!T.?: ;9 'I<U UV1RB X!Y W W1XH}Y.: ; 9 'I Z4: ; 9 I[:!;9 I\:!;9 I]!I/^<_ !: ; 9 `:!;!-9 IBa1RB UX!Y W b UcH}d.:!;9 'I !e% Uf$ > g> I: ; 9 h i&j4: ; 9 I?k'l : ; 9 m  : ;9 n  : ;9 o  : ; 9 p I 8q : ;9 r : ; 9 I 8s  : ; 9 t I u  : ;9 v  : ;9 w  : ;9 x : ; 9 I y( z : ; 9 {> I: ;9 |4: ;9 I?<}4G: ; 9 ~.?: ; 9 '<.?: ; 9 n'I<.?: ; 9 'I<.?: ;9 '<.?: ; 9 '<.: ; 9 'IU@z4: ; 9 I 1U 1H}1X Y W .?: ; 9 'I .?<n : ; 9 I8  : ;9 I8  !II : ;9 I8'I : ; 9  : ; 9 I8 < ( : ; 9 I : ; 9 I8 : ; 9 I&II : ;9  : ;9 I k!I/  I8 I~' : ; 9  : ; 9  : ;9 I8   : ; 9!4: ;9!I  : ;9 I4: ; 9 I I : ; 9 I k  : ; 9  H}!1B"  : ;9!#: ;9 I$ : ;9 I8% : ; 9 I&>! I: ; 9!' : ; 9 I k ( : ;9 I k )$ > * : ;9 I 8+ I 8 ,4: ; 9!I - : ; 9 I k. : ;9 I 8 / : ; 9 I 8 0> !I: ;9!14:!; 9 IB2!I3 : ; 9 I!8 4 : ;9 5:!; 9!I6  : ;9!7 : ;9 I 8 : ; 9 I89 : ;9 :.?: ; 9 'I<;H}<'I= !: ; 9!>  : ;9!?.?: ; 9 '<@1RB UX!Y W A : ;9 I 8 B : ;9 C  : ; 9!D : ; 9!E : ; 9 I!F(G:!; 9 IBH:!; 9 IBI : ;9 I 8JI K L4:!; 9 IM: ; 9 IN !: ;9!O : ;9!P I8Q : ; 9 R : ;9 IS !: ; 9!T>! !I: ; 9!UV: ; 9 IW!I/X<Y !: ; 9 Z.?: ;9 'I<[H}\.?:!; 9 'I@z].:!; 9!'I@z^.: ; 9 'I _% U`$ > a b&c4: ; 9 I?d'e : ; 9 f  : ;9 g  : ;9 h : ;9 i : ; 9 I 8j  : ; 9 k I l  : ;9 m  : ;9 n  : ;9 o : ; 9 p  : ; 9 q I 8r : ; 9 I s4: ;9 I?<t( u : ; 9 v> I: ;9 w.?: ;9 '@zx.?: ; 9 '@zyH}z 1U{.: ; 9 '@z|4: ; 9 I}4: ; 9 I~ U4: ; 9 IBH} : ;9  : ;9 .: ; 9 '  .?<n : ; 9 I8  : ;9 I8  !II : ;9 I8( 'I : ; 9 I8  : ; 9  : ; 9 I8 < I !I/ : ; 9 I&I1B : ; 9 I : ;9 I~ : ;9 I I8   : ;9 I k : ;9 I8 .?: ;9!'<' : ;9 I 8   : ; 9! : ; 9  I : ; 9  H}! : ;9 I k " #4:!; 9 IB$4: ; 9 I%: ; 9 I&4: ;9!I ' : ;9 ( : ; 9 I 8 ) : ; 9 I k *: ; 9 I+  : ;9 , : ;9 I8- : ;9 I 8.: ;9 I/ : ;9 0 : ; 9 1 : ; 9 I k2>! I: ; 9!34:!;9 IB4!I5 : ;9 I 6> !I: ;9!7 8 I 8 9.: ; 9 'I !: : ; 9 I 8 ;H}<41B=4: ; 9!I > : ;9 ?: ;9 I@(A : ; 9 I k B : ; 9 IC  : ; 9!D4: ;9 IEH}F$ > G : ; 9 I8H:!;9 IBI1RB X Y W J : ; 9!K  : ;9 L4:!; 9 IBM1RB X Y W N : ;9 I 8 O  : ;9!P !: ;9 Q4:!;9 IBR.?:!;!9!'<S !: ; 9!T1RB X YW U.: ;9 'I V.: ; 9 ' !W:!; 9!IX UY:!; 9 IBZ4: ; 9 I?<[ : ; 9 I \: ;9 I]'I^ : ;9!_ I!`  : ;9 a Ub.:!; 9 'I@zc I 8dI e.?: ; 9 'I<f.?: ;9!'I<g.?: ; 9 '<h i4:!;9 Ij4: ; 9 Ik : ;9 I 8l !: ;9!m!I/n : ; 9!I!o<p : ;9 Iq : ; 9 I 8r.?:!;9 'I@zs:!;9 IBt1RB UX!YW u41v4: ;9 Iw:!; 9 IBx5Iy>! !I: ; 9 z I8{ : ; 9 | !: ; 9!} :!;9!I!~4G:!; 9 .?:!; 9!'<.?: ;9!'<1RB UX YW 4: ; 9 I1RB UX!Y W .?:!;9 'I !.?<n:!;! !: ; 9  !: ; 9! !:!;9!1RB X!YW 1RB UX Y W % $ >  &4: ; 9 I?'!I7  : ; 9   : ;9   : ;9  : ; 9 I 8  : ; 9  : ;9   : ; 9   : ;9 4: ;9 I?< : ; 9   : ;9 (   : ; 9 (> I: ;9 !4G: ; 9 I.?: ; 9 n'I<.?: ; 9 '<.?: ; 9 'I<.?: ;9 '@z.: ;9 'I@zH}.: ; 9 'I@|  1H}H}: ; 9 I4: ; 9 I : ; 9  1.: ;9 ' .?: ; 9 'I .: ; 9 ' .1@z.?<n : ; 9 I8  : ;9 I8  !II : ;9 I8'I : ; 9  : ; 9 I8 < ( 1B : ; 9 I : ; 9 I8 : ; 9 I&II : ;9 !I/  : ;9 I k .?: ;9 '<I~41B I8 ' : ; 9  : ; 9  : ;9 I8 4:!;9 IB4: ;9 I4: ; 9 I   : ; 9!!4: ;9!I ": ; 9 I# : ;9 I$: ; 9 I% I& : ; 9 I k ' (4:!;9 IB): ;9 I* + : ; 9 ,H}-.: ; 9 'I .  : ;9!/: ;9 I0>! I: ; 9!11RBUX YW 24: ; 9 I3 : ;9 I84 : ; 9 I k 5 : ; 9 I6 : ;9 I k 7$ > 8 : ;9 I 89 I 8 :4: ; 9!I ;H}< : ;9 I 8 = : ; 9 I k> : ; 9 I 8 ?> !I: ;9!@1RBUX Y W A.: ; 9 ' !B!IC : ; 9 I!8 D : ;9 E1RBX!YW F UGH}H I:! ; 9!IJ  : ;9!K : ;9 I L : ; 9 I8M : ;9 N1RBX!Y W O UP1RBX Y W Q 1R41S1T: ;9 IU'IV !: ; 9!W  : ;9!X.?: ;9 'I<Y.?: ; 9 '<Z:!;9 IB[ 1U\ : ;9 I 8 ] : ;9 ^4: ; 9 I?<_  : ; 9!` : ; 9 I!a : ; 9!b(c1RBX YW d1RBUX!Y W e.?:!; 9 '<f4:!; 9 IBg : ;9 I 8hI i.?: ;9!'<j.?: ; 9 '<k:!;9 IBl m4:!; 9 IBn.: ;9 'I !o.: ;9!' !p5Iq !: ;9!r : ;9!s I8t : ; 9 u : ;9 Iv !: ; 9!w 1x:!; 9 IBy4: ;9 Iz.?:!;9 'I !{.?<n:!;!| : ; 9!}!I/~< !: ; 9 >! !I: ;9!.?:!;9!'I@z4:!;9 I4:!;9 I.:!;9! 'I@z 1U:!; 9 IB4:!; 9 I% U$ > > I: ; 9  &4: ; 9 I?'  : ;9   : ;9   : ; 9  I 8 : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9  : ; 9 I  : ; 9 (  : ; 9 !4G: ;9 I.?: ; 9 'I<.?: ;9 '<.?: ;9 n'I<.?: ; 9 '<.?: ;9 '@|H} 11RBUX YW  : ;9  11UX YW .?: ; 9 'I@z : ; 9 .: ; 9 'I@z.?: ;9 'I@|.?: ;9 'I<.1@zH}.?<n : ; 9 I8  : ;9 I8  !II : ;9 I8'I : ; 9  : ; 9 I8 < ( : ; 9 I 1B : ; 9 I8&I : ; 9 II~41BI : ;9  : ;9 I k!I/ 4: ; 9 I I8 ': ; 9 I : ; 9 : ; 9 I : ; 9  : ;9 I8  : ;9 I I   : ; 9!!4: ;9!I " # : ; 9 I k $.: ; 9 'I %H}& : ; 9 ' (4: ; 9 I) U*1RBX Y W +4: ;9 I,: ;9 I-  : ;9!. : ; 9 I/>! I: ; 9!04: ; 9!I 112 : ;9 I83 : ; 9 I k 4 : ;9 I k 5$ > 6 : ;9 I 87 I 8 8 : ;9 I 8 9 : ;9 :41;H}<.: ; 9 ' != : ; 9 I k> : ; 9 I 8 ?> !I: ;9!@ : ;9 A:!;9 IBB4: ;9 IC 1D4:!;9 IBE!IF : ; 9 I!8 G1RBUX!YW H1RBX Y W I:!; 9!IJ  : ;9!K : ;9 I L : ; 9 I8M1RBX YW N4:!;9 IBO.: ;9 'I P1RBUX!Y W Q1RBX YW R: ;9 IS : ;9 T'IU4: ; 9 I?<V  : ; 9!W !: ; 9!X  : ;9!Y 1Z 1[: ;9 I\ : ;9 I 8 ] : ; 9 I!^ : ; 9!_(`4:!;9 Ia1RBUX Y W b : ;9 I 8cI d.?: ; 9 'I<e.:!;9! 'I@zfH}g:!;9 IBh 1Ui :!;9!j5Ik !: ;9!l : ;9!m I8n : ; 9 o : ;9 Ip !: ; 9!q>! !I: ;9!r 1s.?: ; 9 '<t>! !I: ; 9!u!I/v<w !: ; 9 x.?:!;9!'<y.?: ; 9 '<z U{ :!;9!|4:! ; 9!I}.: ;9 ' !~% $ >  &4: ; 9 I?4: ; 9 I? <' : ; 9   : ;9   : ;9   : ; 9  I 8 : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9  : ; 9 I  : ; 9 (  : ; 9  : ;9 4: ;9 I?<4G: ;9 .?: ; 9 'I<.?: ;9 'I<.?: ;9 'I@z  : ;9 411UX Y W  1U1RBUX YW  : ; 9  : ; 9 .: ; 9 '  : ; 9 .?<n : ; 9 I8  : ;9 I8 I1B !I(  : ;9 I8I~ 41B  : ; 9  'I : ; 9 I8 1 : ; 9 I8<4: ;9 I: ;9 I: ; 9 I1RBX YW 1RBX YW 1RBUX YW 1RBX Y W I&IH} !I/  : ; 9 IH}.: ;9 'I : ; 9 I !'" : ;9 # U$: ;9 I%.?: ;9 '<& : ;9 I k': ; 9 I( 1)1RBUX Y W *41+1RBUX YW ,H}-4: ;9 I..: ; 9 'I / I8 04: ; 9 I1 124:!;9 IB3 : ;9 I8 4  : ; 9!5.: ;9 ' 6 : ; 9 7.: ; 9 ' 84:!;9 IB9 1U: : ; 9 ; I<1RBX Y W =4: ;9 I > : ;9 I?.?: ;9 'I<@ 1A 1UB : ; 9 I k C : ; 9 D : ; 9 I 8 E> I: ; 9!F.?: ;9 '<G:!;9 IBH : ;9 I8I: ;9 IJ> !I: ;9!K  : ;9!L : ; 9 I k M.?: ; 9 '<N4: ; 9!I O P : ;9 I 8Q : ; 9 IR I 8 S : ;9 I 8 T : ; 9 I 8 U : ;9 I k V.?: ; 9 'I<W 1X:!;9 IBY$ > Z U[4: ; 9 I\4: ; 9 I?<] : ; 9 I k^!I_ : ;9 ` : ;9 a : ; 9 I8b4:!;9 Ic.:!;9! '@zd : ; 9!e  : ; 9!f.:!;9 'I@zg h.?: ; 9 '<i:!/; 9!Ij  : ;9!k : ;9 I l !: ; 9!m5In : ;9 o'Ip(q : ;9 I 8 r  : ;9!s.?: ; 9!'<t :!;9!u41v>! !I: ; 9 w : ; 9 I!x4: ;9 I?<yz :!;9!{1RBUX Y W |.1@z} : ;9 I 8~ : ;9!I 4: ; 9 I4:!;9 IH} !: ;9! : ; 9! I8!I/ : ; 9 < : ;9 I !: ; 9!( : ; 9!I!>! !I: ;9!.?:!;9 'I@z.: ;9 '  !: ; 9  : ; 9 I!8(! !: ; 9!.?: ; 9 'I< 1U1RBX YW H}1X!YW  H}.?:!;9!'I !.?<n:!;!% U$ >  &4: ; 9 I?!I7 4: ; 9 I? <'  : ;9   : ;9   : ; 9  I 8 : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9  : ; 9 !4G: ;9 .?: ; 9 '<.?: ;9 'I<1UX YW H}1 41 .?: ;9 '@z.: ;9 'I .: ; 9 '  : ; 9 .: ; 9 'I 11X YW .?<n : ; 9 I8  : ;9 I8  !II : ;9 I8( 'I : ; 9  : ; 9 I8 < : ; 9 I 1B : ; 9 I8 : ; 9 I&III~ : ;9 !I/  : ;9 I k I8 ' : ; 9  : ; 9  : ;9 I8 : ; 9 I  : ; 9!4: ;9!I H} : ;9 I I 1!.: ; 9 'I ": ;9 I#: ; 9 I$ : ; 9 I k %4:!; 9 IB& : ; 9 '.: ;9 'I !(41B)1RB X Y W *1RB X YW +1RB X Y W ,  : ;9!- : ; 9 I.: ;9 I/>! I: ; 9!0 : ;9 I81 : ; 9 I k 24: ; 9 I 3> !I: ;9!4 : ;9 I k 5H}6 7$ > 8 : ;9 I 89 I 8 :4:!; 9 I; : ;9 I 8 < : ; 9 I k= : ; 9 I 8 > U?.: ; 9 ' !@ : ; 9 I!8 A4:!; 9 IBBH}C1RB UX Y W D4: ; 9 IE!IF : ;9 G1RB UX Y W H:!; 9!II  : ;9!J : ;9 I K : ; 9 I8L : ;9 M.?: ; 9 '<N1RB UX YW O.?: ; 9 'I<P 1Q41R 1S1RB UX YW T4: ; 9 IU: ;9 IV'IW4: ; 9 I?<X !: ; 9!Y  : ;9!Z.?: ;9 'I<[:!; 9 IB\1RB X YW ] : ;9 I 8 ^ : ;9 _4: ;9 I?<`  : ; 9!a : ; 9 I!b : ; 9!c(dH}e:!; 9 IBf.?:!; 9!'@zg Uh.?: ; 9 '<i.: ;9 ' !j : ;9 I 8kI l4:!; 9!I m n 1Uo 1p.?:!; 9 'I@zq4: ;9 Ir !: ;9!s : ;9!t I8u : ; 9 v : ;9 Iw !: ; 9!x.?: ;9 '<y5Iz>! !I: ; 9!{!I/|<} !: ; 9 ~.?:!;9! '<.?:!;!9!'<.:!; 9!'I@z4:!;9 IBH}1!% U$ >  &4: ; 9 I?4: ; 9 I? <' : ; 9   : ;9   : ;9   : ; 9  I 8 : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9  : ; 9 I  : ; 9 (  : ; 9 > I: ;9 4G: ; 9 .?: ;9 '@z: ; 9 I: ; 9 I1 1U : ; 9  .?: ;9 'I@z.: ; 9 'I   : ; 9 .1@z : ; 9 I8  : ;9 I8  !II : ;9 I8'I : ; 9 ( : ; 9 I8 < : ; 9 I : ; 9 I &I : ; 9 I8I : ;9 !I/  : ;9 I kI~ I8 ' : ; 9  : ; 9  : ;9 I8   : ; 9!4: ;9!I  : ;9 I1B I : ; 9 I k H}  : ; 9 !4:!; 9 IB">! I: ; 9!#  : ;9!$: ;9 I%H}& : ;9 I8' : ; 9 I k ( : ; 9 I) : ;9 I k *$ > + : ;9 I 8, I 8 -4: ; 9!I .> !I: ;9!/: ;9 I0 : ;9 I 8 1 : ; 9 I k2 : ; 9 I 8 3 : ; 9 I!8 44:!; 9 I5H}6!I7 : ;9 8 9.?:!; 9 '<:1RB X!Y W ;:! ; 9!I<  : ;9!= : ;9 I > : ; 9 I8? : ;9 @1RB UX!Y W A.: ;9 'I !B'IC4: ; 9 I?<D !: ; 9!E  : ;9!F.?: ;9 'I<G4:!; 9 IBH UI : ;9 I 8 J : ;9 K  : ; 9!L : ; 9 I!M : ; 9!N(O.?: ; 9 '<P.?: ;9 '<Q : ;9 I 8RI S.?: ; 9 'I<T :!; 9 U !: ;9!V : ;9!W I8X : ; 9 Y : ;9 IZ !: ; 9![.:!; 9 'I@z\:!; 9 IB]:!; 9 IB^1RB UX Y W _1`.: ; 9 'I !a>! !I: ; 9!b : ; 9!c!I/d<e !: ; 9 f4: ;9 I?<g4:!;!9!I h.?:!;!9!'<i j4:!; 9 Ik1RB X!Y W l1RB X YW! m:!; 9 In o.:!;9!' !p: ; 9 Iq% Ur$ > s t&u4: ; 9 I?v'w  : ;9 x  : ;9 y  : ; 9 z I 8{ : ;9 | : ; 9 I 8}  : ; 9 ~ I   : ;9   : ;9   : ;9  : ; 9 I (  : ; 9 > I: ;9 4G: ; 9 .?: ; 9 'I<.?: ;9 '<4: ; 9 I  141B1RB X YW .: ; 9 '@z UH}.: ; 9 ' 4: ;9 I: ;9 I.: ; 9 ' 4: ; 9 I.?<n : ; 9 I8  : ;9 I8  !II : ;9 I8'I : ; 9  : ; 9 I8 ( < : ; 9 I : ; 9 I &I : ; 9 I8I : ;9 !I/  : ;9 I kI~ I8 ' : ; 9  : ; 9  : ;9 I8   : ; 9!4: ;9!I  : ;9 I I : ; 9 I k 1B : ; 9  H}!  : ;9!": ;9 I#H}$ : ;9 I8% : ; 9 I k & : ; 9 I'>! I: ; 9!( : ;9 I k )$ > * : ;9 I 8+ I 8 ,4: ; 9!I -> !I: ;9!.4:!; 9 IB/: ;9 I0 : ;9 I 8 1 : ; 9 I k2 : ; 9 I 8 3 : ; 9 I!8 4!I5 : ;9 64:!; 9 I7:! ; 9!I8  : ;9!9 : ;9 I : : ; 9 I8; : ;9 .?:!; 9 '<? @.: ;9 'I !A'IB4: ; 9 I?<C !: ; 9!D  : ;9!E.?: ; 9 '<F1RB X!Y W G : ;9 I 8 H : ;9 I  : ; 9!J : ; 9 I!K : ; 9!L(M.?: ; 9 'I<N1RB UX!Y W O : ;9 I 8PI Q4:!; 9 IBR :!; 9 S UT !: ;9!U : ;9!V I8W : ; 9 X : ;9 IY !: ; 9!Z.?: ;9 '<[.:!; 9 'I@z\:!; 9 IB]:!; 9 IB^1RB X!Y W _1`.: ; 9 'I !a>! !I: ; 9!b : ; 9!c!I/d<e !: ; 9 f4: ;9 I?<g4:!;!9!I h.?:!;!9!'<i j k1RB X YW! l:!; 9 Im n.:!;9!' !o: ; 9 Ip% Uq r$ > s&t4: ; 9 I?u'v  : ;9 w  : ;9 x  : ; 9 y I 8z : ;9 { : ; 9 I 8|  : ; 9 } I ~  : ;9   : ;9   : ;9  : ; 9 I (  : ; 9 > I: ;9 4G: ; 9 .?: ;9 'I<.?: ; 9 'I<.?: ;9 '<4: ; 9 I1RB UX Y W  141B1RB X YW .: ; 9 '@z U.: ; 9 ' 4: ;9 I: ;9 I.: ; 9 ' 4: ; 9 I.?<n : ; 9 I8  : ;9 I8  !II : ;9 I8( 1B'I  : ; 9  : ; 9 I8 < : ; 9 I : ; 9 I&I : ; 9 I8I : ;9 I~!I/  : ;9 I k41B4: ; 9 I I8 : ; 9 I: ;9 I'  : ; 9  : ; 9  : ;9 I8 1RBUX YW : ; 9 I!.: ;9 'I "  : ; 9!# I$ : ;9 I% &.: ; 9 'I '4: ;9!I (1RBUX Y W )1*1RBX YW +1RBX Y W , : ; 9 I k - : ; 9 .>! I: ; 9!/1RBUX Y W 0H}1: ;9 I2: ;9 I31RBX Y W 4 U54: ;9 I6  : ;9!7 : ; 9 I84: ; 9!I 9.?: ;9 '<: : ;9 I8; : ; 9 I k <> !I: ;9!= : ;9 I k >H}?.: ; 9 ' !@$ > A : ;9 I 8B I 8 C : ;9 I 8 D4:!; 9 IBE : ; 9 I kF : ; 9 I 8 G : ;9 H41I1RBUX YW J : ; 9 I!8 K : ;9 L!IM.?: ;9 '<N 1O4: ; 9 I?<P.?: ;9 'I<Q 1UR 1S:! ; 9!IT  : ;9!U : ;9 I V : ; 9 I8WH}X4: ; 9 IY  : ; 9!Z 1[ 1U\.: ;9 ' !] : ;9 ^'I_ !: ; 9!`  : ;9!a4:!; 9 IBb1RBX YW c : ;9 I 8 d : ; 9 I!e(f.?: ; 9 '<g:!; 9 IBh:!; 9 IBi j>! !I: ; 9!k : ;9 I 8l : ; 9!mI n4:!; 9 Io 1p4: ; 9 Iq.?: ; 9 '<r4: ;9 Is !: ;9!t : ;9!u I8v : ; 9 w : ;9 Ix !: ; 9!y.?: ; 9 'I<z.?: ; 9 '<{.:!; 9! '@z| U}5I~4:!; 9!I? <!I/< !: ; 9 4: ;9 I?<.:!; 9! 'I@z41 % $ >  &4: ; 9 I?' : ; 9   : ;9   : ;9   : ; 9  I 8 : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9  : ; 9 I (  : ; 9 > I: ;9  : ; 9 I 84G: ; 9 .?: ; 9 '< : ; 9 .?: ; 9 '@z H}.?: ; 9 'I@z1RBUX Y W H}H}.: ; 9 'I .?: ;9 'I  : ; 9 .?<n.?<n: ;  : ; 9 I8  : ;9 I8 I !I : ;9 I81B(  : ; 9 I8 'I  : ; 9  I~ : ; 9 I8 <!I/ I: ; 9 I&I : ;9  : ; 9 I41B : ;9 I I8 ' : ;9 I8  : ;9 I k: ;9 I: ; 9 IH}H} : ;9 I 8 1RBUX YW .: ;9 'I !: ; 9 I" : ; 9 #  : ; 9!$1RBX Y W %1RBUX YW & U'1RBX YW (: ;9 I) : ; 9 *1RBX YW + I, : ;9 I k ->! I: ; 9!.4: ;9 I /1RBUX Y W 0.: ; 9 'I 1 : ; 9 I k2 : ;9 3 : ; 9 I k 4 : ; 9 I 8 51RBUX Y W 6  : ;9 7 : ;9 I88 94: ;9 I: ;.: ; 9 ' < : ;9 I 8= : ; 9 > : ;9 ?> !I: ;9!@4: ; 9 IA I 8 B : ;9 I CH}D!IE : ; 9 I 8 F4: ; 9 I G : ; 9 IH: ;9 II4:!;9 IBJ  : ; 9!K(L4:!;9 IBM.?: ; 9 '<N : ; 9 I k O.?: ;9 '<P1RBX Y W Q4: ; 9 IR$ > S : ;9 T 1U : ; 9 I8V  : ;9 W.?: ;9 'I<X.: ;9 ' Y : ; 9!Z.?: ; 9 '<[4: ;9 I\:!; 9 IB]4:!; 9 IB^ : ;9 I 8 _  : ;9!` !: ; 9!a !: ;9 b.?: ; 9 'I<c 1Ud e.?: ;9 '<f41 g4:!; 9 IBh:!; 9!Ii:!;9 IBj 1k Ul : ; 9 I m4:!; 9 In'Io : ;9!p I!q  : ;9 r 1s 1Ut:!;9 IBu : ; 9!I!v I 8wI xH}yH}z1{H}| : ;9 I 8} !: ;9!~ I8!I/< : ;9 I : ; 9 I 84:!;9 I.?: ; 9 '<.:!;9 'I@zH}.1@z5I>! !I: ; 9  : ; 9  !: ; 9! :!;9!I!41.:!; 9! 'I@z:!; 9 IB !: ; 9 4: ;9 I?< !: ; 9! !:!;9!1!.?:!;9 'I@z.:!;9! '@z4:!;9 I .:!; 9! '@z.:! ;9 ' !%  $ > &4: ; 9 I?'4: ; 9 I?< : ; 9 !I7   : ;9   : ;9  : ; 9 I 8  : ; 9  : ;9   : ; 9   : ;9  : ; 9   : ;9 (   : ; 9 (> I: ;9 4G: ;9 .?: ; 9 n'I<.?: ; 9 '<.?: ;9 '@z 1.?: ;9 '  : ;9  : ;9  : ;9 1X YW 1UX YW  : ; 9 .?: ; 9 '@zH}.?: ; 9 'I@z4: ; 9 IH}.?: ;9 'I .?: ; 9 'I 41.?<n: ; .?<n : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 'I : ; 9 I8 < ( : ; 9 I : ; 9 I I&I!I/  : ; 9 I8 : ;9  I8  : ;9 I k : ; 9  : ; 9 4: ;9!I '  : ; 9! : ;9 I I : ;9 I8  : ; 9 I k  : ; 9  : ; 9 I k  : ; 9 I $ > ! I 8 ">! I: ; 9 #4: ; 9!I $  : ;9!% : ;9 I 8& : ;9 I 8 ' : ; 9 I k( : ; 9 I 8 ): ;9 I* : ;9 +:!; 9!I,  : ;9!- : ;9 I . : ; 9 I!8 / : ;9 I80 : ;9 1'I2!I3 !: ; 9!4  : ;9!5 : ;9 I 8 6> !I: ;9!7 : ; 9 I!8 : ;9 I 89 : ;9 :  : ; 9!; :!;9!I k < : ; 9 I8=I >4:!; 9!I!? !: ;9!@ I8A : ; 9 B : ;9 IC : ; 9!D : ;9!E!I/F !: ; 9!G>! !I: ; 9!H% I$ > J K&L4: ; 9 I?M'N4: ; 9 I?<O : ; 9 P  : ;9 Q  : ;9 R<S : ;9 T : ; 9 U : ; 9 I 8V  : ; 9 W I X  : ;9 Y  : ;9 Z  : ;9 [  : ; 9 \ I 8] : ; 9 I ^> I: ;9 _( `4G: ; 9 a.?: ; 9 '<b.?: ; 9 'I<( 4: ;9!I $ > 4: ; 9!I &II!I/ 4:!; 9!I  : ; 9 I :!; 9!I!8 >! !I: ; 9  :!;9!I8 > !I: ;9!>! !I: ; 9! !!:!; 9! :!; 9!I8!% $ > : ; 9 I4: ; 9 I?> I: ;9  : ;9 ( JI                   !ft<JJf Ȑf.t<JJf<fJt<JJf %!ft <JJf #fft<JJf Ȑt<JJf $'f.t<JJf<~!<:<'fJ A.xX fXf *  |xJDX w  w<Y JtfX X= !G 7tY PXmf [  KZYYY   { ]  XvXJ| { ]7  O AX x[uMX/MX/M/KZZZ!   ` x. ZVY; Z  =/x,+"<K< J  zK YYt1<{X/X |X  J .!wXY}.pX!-XY}XL7 }X"~y:(zt } ~X   <O          >KK.<<~XJJ~ ~JJu"~ ~J<W &Y .~Z" J<%[J%/J -[1t~L  JXuK  Ju<=  &jSJu  &eJu  Ju   Xs< ! <J?  .%~y XXy X yj<*| {) ) < >!jl XgWKJ* {<X8(#-(/#; >/; Y- ='. XJvXXK ~  z X s.6-$Ju' wXX8q/ J,Y  #~~ LJ:KXJAJy:(z J.X![4U<.Y ~XJ  X;YvX Xr <C!yZ\UY(;J@( = J:JtrtXXZ rX X!\"ZX}Xt      #               z z =tX,t jx  aJz tzti3f%J  wt .zX  .<1"r!I==%} t Z Y <;ztfJ XdY/ < W  JYxJLJa<KJKJ<u;<KY `XXf.N<2K J  JYxJLJKJKJ<*WyXXf (UH=X<g 9 X/-J$J.VXY@NX/Kf/M q/WKR JWYIYgl/sYV}Xt:~ J}o~Y YJ  Xu:sX XG  f\7O 7+X= W_#i K<l t <Y ! ? Ob)bW).)  K ..! qX.N~. us . ~Xy t{|q~.  |  t |tXJX  | t .t}JZ ,[  ;N W Zd        - J wKEKTJ=""2"==!  u-X   8K  !  JL <uJ  <>ut   K!~=fPtu<;+J&w!t#G?!<[t<,YJ,f(<+I\ JJX|M'  m" Ut0X[  I=.f -yX g-K \#XyJ /WK@><;Iu+&w!t#G?!< =K :K~  < J'XJ$Xi;J" X-G hHZK]<* }<* }gMMJJfK o.= r. Zy<3;$t3~J< X XY!=y<Mu [*uXJu WZI ;/L VL XK!} ;[ Y%N.tJ....oXX M[! x>:vb#t /Ztv ""_JJ0!_<0!t_<0!< <L . [[  kJK K!} tN -/ L ;[ Y%Pf.t q X J..XJ ft bX}X0V!<= ]J~Of .N J  X   ?  70 ~ ]J~ <  YzX5  { :pX | X| ! ;!Y ~J<v  ~J Xt3s!~<J <[  XY!l- .yX=J=(<.J % [JXyL Z ,L :Zn .= wX  J*wY HY!W'Y!G7K]f  Xl#tVYvXU mXdX=WY[UM=Y~ ~ <Y~ XL W!:Y !Y? YKYZfYuJt.%gXt~   ~<< Z< X.d  uXn }f< =;=YJ/sj YZV J<=/ -Z ;JJ.qXL !:K !Y HY Yu~  9/ZYJY/i/u tY ; KJ- vrLY.s jo9I9Y Y < b%.~ | JJ| J l) t;K,sJ J,sJtY0!|!|t<= YL:vvX=eYl. E$  ls 0d <<YK .<  < }Zw-Z  ;Ne ! ;=Ya. Xt         X0V!!;ZV/=JsZ =TM/f Xtot t ot(e*<Jr.Ku15q t.k~/"X<<J%f+Y t_*WX<) uJ.(b+f="f <XoX ZY |XXXZ+.YguY\ >JK XXXYfI<M  rXXX -L. x qf.t<Y ==w4z< u X    f<.vI-=I=~ q .q  .Y:~q* ~A Jt"q ."q <qt"A<?< C/wX}  M<<+ </ <tF@Jf<X* ~ }/ kX<=j(A.1X t( f I/.7XftUJ IKQx%D<</  >tX tsX Jpt.r( ft.( <A,H JL d~J qt <q;\~q* ~ <q<X:x* }JX } }<. -X~tJ { ..{  < Qy.YvY~t.<X] Z   .  ~'!lX<j J} f  XhXz .}X Xf Z ;  gX  ~ }  pJpt p ~X XXh !~ X0J Ig  .X3[< v< < XsX!> v<7>:.N:bKYX>w KfYM<<  ZV;uJ>#;XFX:.XfYppX&f <<;K!~X(f<P XU ~X&fL ? ?U Y X  XXX},XWKX)< HuK<JLg%JJLK JK  >(f>D+v.~t= X fX~X ~Y14kJJ\N~X  X.*X<X*~X..K~YoXXZ XX~X 0J KtZE;XcX~X~ 4~f ;XX~X ~<~h ^~)6X~t J`<~J.EX?XXX~Xr*"X!}J|]Of .)< J| X ? 70 |]J/}J=e}Jv }J }Xf=t;}<tWf8XG3X=} 6Jv S@ Xeu Z :0YfXK1Kf zX g. {:pXX4tV/20 t S@ XK Z V0 XY";^7c0XVZX !! {   z<.  JJ K sKz< { ~. J.. zX  t{|q .|  t }tXJX| t. |  t{|q G.|  t }tXJ| tfX } lX K:fvKsKU ?O 2 $0VT<fX/MKWuIK JKZrKJW<gf J..pX/sK g$Jvg/'l               ` e.tX  t wttt     XYY<"Y$K .tt     YS<~  ~f g ~t<5XY<ZY-pJ Y!I =<X K X vX}z<Of/gf} y.} Yp @<J. u<;- X  .}%~ t  }t X xJ t  <<  JY xXi  <  wJ=M K Y Yt tJ'!J= ZZ &yJL+U ~y   ]< 1QLy\ $ Y.J!}"o u    m / a    t kt <    Xmt {~ '<Y-J{J_ &wJ+U ~X  jJ <K[u xx yJt <  j XK;xt <  1vYxXZ tZu  w~ '<-J0zJ0^z$~ v   ]< 1J&X  J><<Z#tO w!v 0ut ~  Xg } M MX |X X=J:=zJQ=yJR=x* .XX.=tX J=X XX oXJv gK &uJ+U ~X ~ u. }xx n J ~X wJXJX1X NJXJX< v ~Yr(t< ~ u   ]< 1J&XX <, vJX wh 9<YJfuf 9<YJfXjFc u| t   .1t &y f  u {Y    <{Xtafu| t   ./<bJJ b Xw}  & f   }~  HcYX   ytI tJ  X {JJ  y XXf"IKK!uVo) WXJ)k &J<J+U ~ X x<<!;>Jux }i z]<ZX<!q<!tC vi z][8 J!q  !ux }i z]<XZX<!q!<C vi z][8! q?<  y {]< </ s tJ u yyX v!udVoJ1'L1HtLO &J<JIh+U ~  X<!;>Jux }i z]<ZX<!q<!tC vi z][8 J!q  u YuI=.JI sX   x<D ]< 1J& J ~   xD ]< 1J&J HJ 8tHJ 8 =Ftt 9 =Ft 9J DJJY (#{}#r:*#   v#{.  <vJ$.  <$o#<X  J X=!xY!x f.5 s0J0;NXY)r# Xg< rX   xD ]< 1J&JY8y J Y)%,}  v,  .vXv )%,} , .X (.J  %X. [JX{v} f }. }f<./i>!}        .. J- &Mg-) XpXZutX .(         gk t(.J % [JXXz .tKX j pK  iK= t JmXK  t=X ~<<P Yg K<~[t !=M u u K<w lJ~MYu t   .tfJ=}_ K yX}Z d t  }.tfJJϻ* U,.Xg* X*X X=[~K K }<KKX}Y&dJtt=(X y=X&g,IhqJ\WȻ *+Xvh*f(0tv XYY X  M"U<utY   &uJ+U~.  ~u.  }xx n J  /t  ~Yr(t <Z Xtf  ]< 1QJ&.KY;q(;.J(%fuJ- XJX+>Y JC[| <qX A  OQ X[| <XvXt&X<KX~LX~+!J <X~&  /   &uJL+U~X  ~u.  }xx n J  f u L rLXX~X~   &uJKJ.~  ~Yr(t <Z J u~t  ]< 1J&X  u2JgKX~ 1/vJGXGit !=M Y rK ~ ~t .X~/vtZvp JYg K<"~tKX~= X  u W[%u$Y /~ % }}    }fK XiZX Uv[fK,=%WJ=WuXY/;uxKJ< 0/<B          1}u]}tX} <> JYY y sXJ of} }t X~#0VK;/yXIYCy< K;(tu  owJ <v< J<Xo H*I=tZ< ~X~u]<~tuX~ I ;ft YH-Y= Xu w9Y nV! !cu YVu ;u  t~t s=X~u#JK.< t X   <   X"&J XdX~$ J =-ttZdf <6x<}U)X~u^}tX}<;=&;Z,o<f=,nf<6X, t X   <   X >,o<f=,n f:Cb JYYKOo X~~tuX~LsuYR$ u;Y h.1.]Z utZ z.Y . 0p2/%}  |a5%.~%~ yYY v'}t.X}t}ts=X}'uf  ./.          1}u\}tX} <> z tXJ qf} yff0VK;/XY t<?o=;(fu { J<X oYJ*I=ttZ< }F8X~u]J~tFuX~ KJ<K=!JYKm MK u1<J<tXK KK Jv. Kh~ t~t sKX~u"<H.< t X   <   X!MXdZ ~K %% <tY& %.~%~  yXK]}t}ts=X}&g&e. v 3.nXY `tJ<ux}iz]ZJ<q<tCviz][8 tJq}X  xDt]<1_J&tJ.uX  x<D]<1J& JtJXtJ1O<~tX,. o.Ju ,Y  u KgX  q< <. f #<<u'vqrsZ!v..  mX$X <JJx= <|X|x}iz]<XoX8 o<K uxK!Y 6y j< .<rVt~<<~< ux < g eY t J   tXY  W  @ T N FN  %.~%~ Xy2 Iu2#Ju 'fJ.dXK =K Y% K  U U q !P.FnY KJY( Xo X'Z,X F.,`X'J}p~x]ZX<w~x]Jy[J&<J.p] W[Jq ~X<X  p.. p<X.~3W <F ux8'!Y y <!B=X<.~ YX.X#!Wt/=O.//YX* t{|q~.|  t|tX J| t.}$0VI/<;==   <utt   v   <=viz]X[J {>Y}xx n X .u <<  f< v  R<J/I=LKu&u< t pR.. tJ t{|q.|  t}tX | tf Xvf .y uJ%.~%~ ty  yX <<yJ . t X+         Y =}<Y~<Yt=X{ 0YYuu XX>[~ <!}X}<u f. qtt5;Y!} .,eY )tY XX| tX|Y tt|u%.~%~ X||J ~<JJ}D  |t~ j t< ~BJ</ YIK ~Jt!sg= KX.Bhv.rY =;Ytk~tY~~. |$X  .oX!!lS  y X  ]~J ~ h#KLY# ;M G/YL HL" Yy<  tg|}JS  Y~#fX<\Z2|< s th= K.sX  Xs XyI=.I  Xit  ~X Xt~.~X.JX~]JY!!lS  y Q  / QX  /<X  ] ~J3 X ~<YZ XJ ~ ?=Ut.>L p H!J!lS  y   ]~J f ~<YfY2 < t X~ X~ X~sJJY =tY!!lS  y   ]Ju~X ~p }JYMg K<"m t~JY@XuwX}%X}]t  <<< X<}  J~J  Xu Q <-9Y  Xg J~JmE  z XX    <Ja }JJ3X< Jf}~t ~  ~ H!!lS  y Xf  ]1Y dXVZJ,d:YYXa ~<Y2!~ <_! XX.X XX xXf(   <v .{   Jv<  vJP  uvJ Jt J!t!%.~%~ !y= K KD  |t  RfJ/I=LO v   <=viz]X[< {>Y}xx   n J /X w RfJ.wJb KK%= e Xu&.w <..^$x}iz]~J<LJ< wu ~t  ~J{ J XJ!x!%.~%~ <!yZ= K KD  |tu. KKptX x ~#.%~z .z Jtz  zX t<z"u ~tKD  |J .! +3).A>:0YN .Vu;=K -XtaqvYtJJJ Utj<fh<v!| K}mE  z     <|tK|Ji !=M Y rK  J hJ/}JmE  z   L  <K. nX rZ|XXVX =sY -f3zf tY!}J!lS  y   ]Jw}X IK|p YMg K<"|<KZY= Xv   u }X. Xu ~tYtJ%JJKuJu~mE  z     <   ZY!{u /f.~ H | %.~%~  |K }t ~t }JK}D  |}i =M K rK  Yf.~!| YJf..|}XX, !vtZ tY\ S|tY        x <NKBA A(s CBB,<JAkA4EKAA nCBD[KBB A(A0|(C BBB<NKBA A(s CBBDZKBB A(A0{(C BBB,<JAkA4^EC DH, BBA E <NEC DEH BBBA E DEC BEEF BBBBA E <EC FED BBBBA E D?EC BEGD BBBBA E 4EC E BBA E <FFD GX  AABE DFGD D(F` (A ABBE TFEB E(I0D8Gps 8A0A(B BBBE LFEJ D(A0Gh} 0A(A BBBE TFEB J(D0D8Gp 8A0A(B BBBE <FIA GXi  AABE <aEDU AE R dAA<\EDU AE Y XAADbEDU AE Z O(M AAA4SEDU AE iAdFEB A(A0U (A BBBE m8L@GHV0A(A BBBDEDx C(X AA AE A AE FEB B(A0A8GHU 8A0A(B BBBE PPEXI`GhHpBxP8A0A(B BBBEH   , JA AE $OJ@,DJEa AE BTKAA ` ABE [ ABE M ABE ,JK(O AE ,~AJ i E 04KAD  ABE $JS8CDEC DGH3 BBBBA E   <KDA K@  AABE ,JP AE 4jJAR AE AA4KAA wABT!FEB J(A0D8Dx 8A0A(B BBBE $JF  4JC EtBBA $ LGEB D(D0 (A BBBE $0\ KGB B(A0A8G 8A0A(B BBBE $TIKHB B(A0D8GP 8D0A(B BBBE $ Px <JQ MN BBBBA E $ x gMUDJHC AI A AE D AE <JAe AE A AE $oJt E ,JD8} AE dKEE H(D0 (A BBBE  (A BBBE hpL KBB A(A0GX 0C(A BBBE TXKBB B(A0D8DH 8A0A(B BBBE \KKB B(D0H8Gb 8C0A(B BBBE P,x \GBB B(A0A8D 8D0A(B BBBE \@KBB B(A0A8D 8A0A(B BBBE 4JDD0L AAE x \KBB B(A0A8D 8C0A(B BBBE $x LKIE A(A0G@ 0A(A BBBE $JpLKOD D(Z  AABE \ AAB4GJAQ AE _A!x #tGBB B(A0A8D@ 8A0A(B BBBE D8C0A(B BBBtGBB B(A0A8D` 8A0A(B BBBE  8D0A(B BBBE \GBB B(A0A8DP\ 8A0A(B BBBE tGBB B(A0A8DH 8A0A(B BBBE M 8A0D(B BBBE GBE E(A0A8 0A(B BBBE A 0F(B BBBE D 0A(D BEBE LxGGB A(A0G~ 0C(A BBBE \KJB B(A0A8G  8A0A(B BBBE @\.KJE B(A0A8GJ 8A0A(B BBBE ,fJAUATKBB B(A0A8Dxz 8D0A(B BBBE <KBA A(  ABBE x \GJB B(A0A8GY 8A0A(B BBBE dYEB B(A0D8DP\ 8C0A(B BBBE  ,]JALA,<JH] AE \TKBB B(A0A8D 8A0A(B BBBE \ KEE E(D0A8DH` 8A0A(B BBBE \KBB B(A0D8Dx\ 8D0A(B BBBE $5Jfx tGDB B(A0C8GHu 8A0A(B BBBE  8A0A(B BBBE \GBB B(A0D8GQ 8A0A(B BBBE \HGBB B(A0A8D] 8C0A(B BBBE <tKEA D(v  DBBE \KJE J(A0A8G 8C0A(B BBBE x $SJD$QFF$4Fi,[FEU AE <FC FF BBBBA E ,,JJX AE >LGAA D(  CABE x FABtGBB A(A0J (E BBBE r (A BBBE u (A BBBE 4qGAA v ABE < FK FPp BBBBA E 4dJAD(I AAE 4dJAD(I AAE DnFAD( AAE c EAE tKBB B(A0D8D@ 8D0A(B BBBE k 8A0A(B BBBE \GEB B(G0A8JW 8A0A(B BBBE lGBB E(A0A8D 0A(B BBBE 0A(K BFB\ KBB A(A0T (C BBBE k (A BBBE $RR] E T\ GBE B(A0A8Q 8A0A(B BBBE <GHA J  CABE \#KGE E(A0A8Gx 8A0A(B BBBE LfKGB A(D0G 0C(A BBBE LKBB A(A0DX0C(A BBB$\P~ E ,hJDM AE \SKBB B(A0E8DP! 8D0A(B BBBE x T9KIB B(A0A8D@r 8A0A(B BBBE F$J,XJCt AE 0TKBB B(A0A8M@ 8A0A(B BBBE DAdEA A(  ABBE I,aFY AE ,JA AE 4KOA VHB,JApAx 4TAd AE AH\WKGB E(A0D8Gq 8D0A(B BBBE LKBB A(A0D` 0D(A BBBE ,QAAx 4TA_ AE X1\6KGB B(D0A8JJ 8D0A(B BBBE ,CJD AE x \KIB E(H0D8DHj`cHc 8A0A(B BBBE <GAA DPH  AABE \GBB E(A0A8GF 8A0A(B BBBE ,JLQ CE DnKGA A(J (A ABBE 4\KKK sABx $DFy)LGBB D(A0] (D BBBE dGJB I(D0O8Z0u (A BBBE u (A BBBE tGGA A(Dh{ (A ABBE F (D ABBE y (J ABBE ,YFY E ^ E $;J` E DtJAh AE _ AE A FE 4Fi E l E U E \GBB B(A0A8DX@ 8D0A(B BBBE TKBH B(A0D8 0C(B BBBE \GGB B(D0A8G  8D0A(B BBBE \WLB D(E0 (D BBBE J(A BBBLKBH A(A0G8z 0A(A BBBE 4lKKK CABDsKNA w ABE RABdKBE D(D0 (A BBBE @ (A BBBE LSAr HE S AE A AE MAnKBB B(D0A8D@ 8A0A(B BBBE  8A0A(B BBBE I 8A0A(B BBBE $lJF E inode_isizecall_get_stackstartparentlookupkernel_siginfowritten_stamp_sigpoll__compiletime_assert_109initializedbpf_prog_typekill_sb__bi_remainingnum_bugsnr_requestscftypesock_fprog_kernusercntirq_delay_totalTRACE_EVENT_FL_FPROBE_BITstate_entry_ptrstatsit_func_ptractive_basesswap_slot_free_notifytemp_sizestart_databoolcompact_order_failedbv_lenerofs_default_options___GFP_RECLAIMABLE_BITmodsctimedestroy_inodetype_lenfs_param_is_enumcma_pagesfutex_pi_state__compiletime_assert_124i_mutex_dir_keyrescue_workdevice_physical_location_vertical_positionget_aclset_aclac_exe_dev_erofs_printkmemory_tiers_voppercpukill_block_supererofs_xattr_prefixes_initprint_fmt_erofs_destroy_inodedescpoll_bioiterate_sharedmemswsym_vdso32_sigreturn_landing_padcma_areaheader_sizeESTACK_VCfeatures__compiletime_assert_132__compiletime_assert_133rcu_tasks_exit_cpuperf_fetch_caller_regsmigrate_from_cpubd_size_lockwriteerror_codebuddy_listldt_structPERF_SAMPLE_BRANCH_CALL_SHIFTperf_trace_run_bpf_submitup_readprog_attach_flagscred_guard_mutexbus_groupsd_timeEVENT_FILE_FL_ENABLED_BITUTASK_SSTEP_TRAPPEDget_nameVTIME_INACTIVEmg_src_cgrpclass_preempt_is_conditionallink_createtimeouturing_cmdshrinker_idnr_dirtiederofs_super_blockgetattrBPF_SK_SKB_STREAM_PARSERsetattrPTR_TO_TCP_SOCKfs_parsevmstats_percpuf_bsizefixupblockcode_page_sizedevsdevtlast_cpufor_backgroundnr_wakeups_localfill_link_infouidhash_nodemax_ratioworker_privatepoll_eventalloc_factorlinelinkbi_pooleffectivecompact_blockskip_flushmoderead_char__bpf_trace_erofs_readpagesPERF_COUNT_SW_CPU_MIGRATIONS___GFP_NOWARN_BITnode_idPTR_TO_STACKevent_class_erofs_read_foliotargetget_nextdqblkprocessedrcu_tasks_idxparent_ctx__ret_do_oncejournal_infobi_inline_vecstqhead__compiletime_assert_164last_used_at__compiletime_assert_169line_offhres_activeold_subtree_controlmod_namenotes_attrsdelay_workblock_device_operationsoffset_ctxbi_blkgirqwaitOpt_fsidFREEZE_HOLDER_KERNELarch_test_bittail_call_reachableESTACK_DFlast_switch_timecompact_init_free_pfnwakeup_countwait_indexlog_sizerunnable_weightmap_push_elemperf_refcountperf_eventsclass_releaseconstant_tablelast_sum_exec_runtimedd_key_truesa_handlerfree_countcg_listlocked_vmaddressstart_timezone_wplugs_hashkprobe_multicookielistmem_rsvddevt_slotofftrace_raw_output_erofs_read_foliofreezersig_okextablemax_entriesi_sizeentry_eipcgroup_atypesplice_pipexstate_headerrtpoll_timerdma_addrm_llen__SCT__tp_func_erofs_map_blocks_enterem_perf_domaind_flagsget_uuidz_algorithmtype___GFP_HIGHMEM_BIT__bpf_trace_tp_map_erofs_read_foliodying_tasks_large_mapcountnode_present_pagespid_namespacemanagedliveclock_was_set_seqspc_warnlimitseqcount_tmin_flt__tpstrtab_erofs_map_blocks_enterblock_devicethreadedMEMORY_DEVICE_GENERICpkruBPF_MAP_TYPE_PERF_EVENT_ARRAYprojid_tEVENT_FILE_FL_RECORDED_CMDmemcg_nodeBPF_CGROUP_UNIX_SENDMSGpwr_accsample_flagskey_payloadpinnednbp_th_start__empty_insnsiBPF_RB_NODE_dummy_bndexception_cbwakeup_eventsBPF_TRACE_UPROBE_MULTIper_cpu_pagesetsaved_stateparent_exec_idutil_sumdd_key_falsesigvalfsnotify_mark_connector__ubuf_iovecsize_is_constantcputime_atomicdeadlineperf_output_handlebio_integrity_payload__SCK__tp_func_erofs_read_foliowait_queue_upperclass_write_lock_irq_is_conditionalcgroup_fileswap_readahead_infovtimemap_flagss_rootstack_refcountgrpmaskTRACE_TYPE_NO_CONSUMEs_remove_countBPF_SK_LOOKUPlru_gen__tracepoint_erofs_destroy_inodewrite_newaddr_filters_syncerofs_fc_get_treeuser_namespacepending_disable_irqclass_rwsem_write_is_conditionalpids_active_resethlist_nodexattr_isizeblk_features_tsuper_operationsautosleep_enabledPG_foreignu64_to_fsidwrite_file_infoload_sumaddress_spacecpus_maskdl_yieldedremove_on_execdo_trace_event_raw_event_erofs_read_foliofile_dispread_newd_spc_softlimitsymbolskreferofs_shrinker_unregisterrseq_css_lock_keydqi_flagsjump_entrypi_top_taskhlist_nulls_nodepacct_structac_padpathnameuser_sizefree_auxFILTER_CPUMASKbd_statserofs_fc_freeshow_fdinfoFAULT_FLAG_MKWRITE__seq_puts__event_erofs_destroy_inodefadviseclass_read_lock_irq_is_conditionaliommu_cntrlinenodown_writeMODULE_STATE_LIVEtask_listPTR_TO_CTXFAULT_FLAG_RETRY_NOWAITinherit_statBPF_CGROUP_SOCK_OPStrace_event_type_funcs_erofs_map_blocks_exit_qprocread_foliohas_elevatordtordq_countnlinksignalnr_wakeups_passiveself_exec_idstate_syncedtrace_event_raw_erofs_map_blocks_enterrcu_batchesroot_nidf_epctl_tableavailable_compr_algs__this_modulercu_specialprog_fdbtf_trace_erofs_map_blocks_exitentryold_subtree_ss_maskbacksda_is_staticBPF_MAP_TYPE_LRU_HASHcgwb_domaincntssock___GFP_THISNODE_BITidr_rtdqio_semnr_linfoRPM_REQ_RESUMEmq_freeze_wqstart_prevent_timebdev_file_open_by_pathpgd_tsigset_twq_offevent_class_erofs_map_blocks_exitmap_btf_idbucket_idrstat_flush_nextiomap_folio_opsignoredget_fieldsremovableBLK_INTEGRITY_CSUM_CRC64prog_idbase_indexi_inoserver_has_tasks_killpgdatsrcmaptrace_event_filei_spc_warnlimitf_posBPF_MAP_TYPE_HASH_OF_MAPSperformancesoftac_pidowner_trapnoload_weightBPF_PROG_TYPE_SOCK_OPSfls_longsleepablesymlinkclass_rwsem_write_try_is_conditionalkmalloc_noprofbd_queuein_iowaitxa_init_flagspids_activeget_inode_aclbdi_writebackrb_leftmostdst_neededbug_addr_dispmigration_pendingd_real__NR_PAGEFLAGShrtimer_lockns_commonmap_ifindexs_max_linksctl_table_rootf_typeverified_insnsthread_headacquire_dquotclockid_tzone_capacityFORTIFY_FUNC_strlenpgdval_td_managedatalayoutmax_ctx_offsetis_late_suspendedback_pad__traceiter_erofs_read_folioMIGRATE_SYNCwcharseq_fileiommu_bankonline_cntBPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATEDrestoredomain_idline_infotrace_event_raw_erofs_readpagesHPROBE_LEASEDBPF_LSM_MACthaw_superalt_lenregs_intrseq_operationsPERF_SAMPLE_BRANCH_NO_TX_SHIFTfallocatelog_true_size__ret_call_addrwriteback_sync_modesi_mmap_rwsem__compiletime_assert_10undo_list__compiletime_assert_13__compiletime_assert_14__compiletime_assert_15__compiletime_assert_16__compiletime_assert_17__compiletime_assert_18__compiletime_assert_19attribute_groupPERF_SAMPLE_BRANCH_ANY_SHIFTdma_poolspersonalitykmem_argsprintk_index_sizeperf_trace_buf_alloceflags__compiletime_assert_20bp_len__compiletime_assert_22do_perf_trace_erofs_map_blocks_exit__compiletime_assert_24__compiletime_assert_25__compiletime_assert_26__compiletime_assert_27__compiletime_assert_28__compiletime_assert_29uprobe_task_statePG_vmemmap_self_hostedWB_REASON_BACKGROUNDstimestatic_priotmpfileattach_func_namedata_indqi_formatoverflow_arg_arearhash_headnvcswrcu_pending__compiletime_assert_30__compiletime_assert_31_nr_pages_mapped__compiletime_assert_33frequency__compiletime_assert_35__compiletime_assert_36__compiletime_assert_37__compiletime_assert_38__compiletime_assert_39e_tagrtpoll_totalfa_fddev_pm_ops__kmalloc_indexblk_mq_ctxno_updateiter_typePG_reclaimDEVICE_PANEL_BOTTOMnetns_inomap_get_next_keyBPF_SK_REUSEPORT_SELECT_OR_MIGRATEPERF_COUNT_SW_CONTEXT_SWITCHESnr_wakeupsqueryenabledki_filpmultiple_queueswork_func_tmemcg_vmstats_percpupp_magic__SCK__tp_func_erofs_fill_inodefpu_state_permdevres_headPERF_COUNT_SW_PAGE_FAULTS_MAJ_SLAB_RED_ZONEused_maps_mutexidr_get_nexterofs_register_sysfsRPM_REQ_IDLEfilenamebaseac_ppidd_prunePG_lrurestore_noirqextension_progkprobe_addrrlockBPF_PROG_TYPE_SCHED_CLSi_rt_spc_warnlimitqueue__compiletime_assert_80__compiletime_assert_81__compiletime_assert_82fs_param_is_stringBPF_PROG_TYPE_CGROUP_SOCK__compiletime_assert_85__compiletime_assert_86__compiletime_assert_87__compiletime_assert_88__compiletime_assert_89bytesexclude_kernelprint_fmt_erofs_map_blocks_exitnuma_migrate_retryf_ffreeMEMORY_DEVICE_COHERENTenclavefilterroot_blkgd_revalidateerofs_dev_context__compiletime_assert_90WB_REASON_PERIODIC__compiletime_assert_92exclusive__compiletime_assert_94__compiletime_assert_95__compiletime_assert_96__compiletime_assert_97__compiletime_assert_98__compiletime_assert_99cgrpwatermark_boosttracepoints_incoredqsi_opsubtree_controlquota_syncsrcu_have_cbsmemory_peaksasync_in_progresssignumdqi_dirty_listpi_locktrace_event_raw_event_erofs_fill_inodedirtied_stamptimespec64BPF_WORKQUEUEnr_forced_migrationsdst_mutexumount_beginbadblocksnr_descendantskernfs_nodecpumaskerofs_fc_fill_superptrace_messagelengthbio_alloc_cachei_wb_frn_avg_timecache_strategyBPF_LIST_HEAD_pincount__roundup_pow_of_tworeclaim_statecur_imagesourceruntime_errori_sb__poll_tbpf_jit_poke_descriptorsubvolon_dispatchdirty_inodesymtabTRACE_TYPE_PARTIAL_LINEd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structfs_parameter_specrcu_data0real_blocked__item_lengthruntime_suspendPERF_COUNT_SW_PAGE_FAULTS_MIN__s16BPF_CGROUP_UNIX_GETPEERNAMEbacktraces_umounton_listchild_total_time_enabledrefaultstrace_event_fields_erofs_fill_inodedata_vmneeds_force_resumebtf_recordrpm_statusuint_32deferred_split_queueunregister_filesystem__s32p_sizechildrenbpf_local_storage_mapcheck_eventsdqi_bgracei_wbf_inodeserialburstname_offpermissionsgraph_rootkernel_load_data_strcgroup_roothostmsi_device_datamaskget_tree_nodevkallsymsmap_alloc_checki_ino_timelimitFILTER_DYN_STRINGTRACE_EVENT_FL_FPROBEhuge_encode_devbi_issuebd_holder_opsBPF_KPTR_REFtrace_print_flags_seqlink_idspmu_enablecgwb_frnsrcu_idxa_countutil_est__s64binaryipc_ns__event_erofs_lookuphugetlb_usagebpf_cookiesect_attrssrcu_size_statewrite_inodei_rdevacct_rss_mem1___orig_eipsrcu_datadevice_physical_location__UNIQUE_ID_description766__keycgtimefs_context_operationsbypass_spec_v1pagefault_disabledfilter_hashindexs_time_maxfragucount_maxdelayed_worksysfs_errprog_flagsopen_partitionssa_maskkswapd_lockmmappedElf64_Wordold_dom_cgrpjited_imageref_ctr_offsetsatomic_flagscallernum_jump_entriesPIDTYPE_PGIDbtf_vmlinux_value_type_idmnt_namespaceelemwb_completionquotalenerofs_alloc_inodesrcu_data_have_cbsnivcswoffdevbi_sector_tidparent_inouapi_mutexregister_filesystemlinfo_idxmce_vaddrBPF_CGROUP_UNIX_GETSOCKNAMEerofs_inode_cachepdl_dev_stateshowrb_subtree_lasts_listBPF_MAP_TYPE_CGROUP_STORAGEhigh_worknr_segstailcall_targetof_match_table_entryBPF_PROG_TYPE_CGROUP_DEVICEino_timelimitoverflow_handleralternative_gpt_sectori_readcountblkcg_polsincrvar1_dwfields_arrayfreefreqrange_cyclicprog_cntlock_countthrotl_datalist_lru_onei_pagesmxcsrd_make_rootarchdataptrace_entryuid_mapguest_permPG_arch_1PG_arch_2wait_queue_headnum_srcu_structsprev_sum_exec_runtimei_flagsgendisku_flagspmu_disabletag_set_listcallchainlogical_block_sizesubtree_ss_maskinvalidate_lock_keyinfousersizetrace_event_get_offsets_erofs_map_blocks_enterl1d_flush_killctx_outPG_swapbackedtimestampsphys_addrrlimit_maxwrite_beginbpf_prog_offloadbtf_trace_erofs_lookupwrite_infohrtimer_restarts_encoding_flagssessionids_time_minerofs_release_device_infovdsoclass_raw_spinlock_irq_try_is_conditionallistxattrbpf_iter_aux_infos_stack_depthnode_offsetkprobe_override__vm_flagsqueue_depthbpf_tramp_imageaux_watermarkxattr_shared_countpm_messagememcg_lrufred_cschangedPG_mappedtodiskz_fragmentoffcur_ktimeinitfop_flags_tgroupsoffstty_structnotify_nextvirtual_dr6dma_opsmmap_basebd_devsyscall_workelowbpf_trampoline__bpf_trace_tp_map_erofs_destroy_inode__SCT__tp_func_erofs_destroy_inodelockdep_mapnum_trace_evals_addr_bndPG_isolatedcgroup_base_statksymbolzone_device_dataquota_readplenseq_printfhlistoffloadpinned_vmreventsfunc_cntwritepagesperf_addr_filter_rangenuma_faults_localityqrwlockPTR_TO_FLOW_KEYS__write_overflow_fieldreg_save_arearw_semaphoreattach_bpf_fdfirst_minori_blocksread_sizetask_fragWB_REASON_LAPTOP_TIMERsource_listsum_block_runtimeBPF_NETKIT_PRIMARYnuma_scan_period_max__compiletime_assert_653__compiletime_assert_654__compiletime_assert_655__compiletime_assert_656__compiletime_assert_657total_timepowerrequest_queuenum_ei_funcsi_generationflushBPF_PROG_TYPE_PERF_EVENTtask_fd_querymg_dst_cgrponline__compiletime_assert_660__compiletime_assert_661__compiletime_assert_662__compiletime_assert_663__compiletime_assert_664BPF_PROG_TYPE_RAW_TRACEPOINTformatcycleslast_switch_counttmp_seqlast_wakeeswapmemfd_noexec_scopeinosuint32_tssize_tvtime_statecancel_forkparent_could_setfcapper_cpu_nodestatcloseds_blocksizeprevent_sleep_timeclass_spinlock_irqsave_try_is_conditionals_readonly_remounti_io_listrefaultedperf_trace_erofs_map_blocks_enterchild_countBPF_MAP_TYPE_ARRAY_OF_MAPSrelease_agent_workVTIME_IDLEBPF_PROG_TYPE_STRUCT_OPSwb_domaincgroup_subsysnbp_th_nr_candconfigcompat_uptr_tcgwb_treeDEVICE_HORI_POS_LEFT_hugetlb_subpoolend_pfnuclamptgidlimits_lockerofs_read_metadatareleaseidr_initnr_wakeups_migrateserial_nrstack_vmi_fieldmaskupidinameprotection_supportkcompactd_highest_zoneidxfh_to_parentfreeze_mutextrace_evalsia_vfsuidbtf_mod_pairquota_format_opsi_data__tracepoint_erofs_read_foliorescue_listanamefsverity_infocore_threadclosidreserved2sched_avgcodeencode_fhBPF_LSM_CGROUPu64_stats_syncsyscorenr_reserved_highatomicsb_flags__i_nlinkpmd_tinumsrcu_barrier_cpu_cntbatchedreadaheadhrtimer_cpu_baseirq_domainwait_liststatic_call_trampac_etimefsverity_operationscoublockbug_tablemigrate_modeusing_gplonly_symbolsFS_CONTEXT_RECONFIGURINGwb_listremovedhandlertrace_event_get_offsets_erofs_read_folionr_writeback_throttledsym_vvar_pagemembarrier_stateBPF_PROG_TYPE_LWT_INnr_statdma_pad_maskBPF_KPTR_UNREFbin_sizeFORTIFY_FUNC_strlcatondisk_extradevsrcu_read_lock_nestingreg_typecb_accessrcu_tasks_nvcswfred_sss_sync_lock__signalfn_tdax_holder_operationsio_bitmapDEVICE_VERT_POS_CENTERsched_taskread_formatmanaged_pageslong unsigned intfs_context_phasemax_timeread_file_infotrace_event_get_offsets_erofs_readpagesexec_startia_sizeprefixRPM_RESUMINGunpinned_netfs_wbMODULE_STATE_COMINGsym___kernel_sigreturn__tracepoint_erofs_readpagesZONE_DEVICEfunc_info_cntuser_cpus_ptrtotal_time_enabledd_opstate_initializedinterruptsrelease_dquotplugsoftirq_activatedkey_sizeinv_weightsecuritykernel_symboldl_timerlockdep_map_pmodule_param_attrsdirty_ratelimit__UNIQUE_ID_rcu731__user_state_sizechainedVTIME_GUESTsysvsemstashedperf_sw_idsuser_xfeatures__kmalloc_cache_noprofevent_class_erofs_lookuptid_entryPERF_SAMPLE_BRANCH_MAX_SHIFTuse_memdelaynr_cached_objectshas_timeoutcgroup_namespacecommcallback_headexception_table_entryPERF_COUNT_SW_CPU_CLOCKin_hrtirqctl_table_set_overruncondconfcoredumpd_sbio_lock_cls_keybpf_link_opssample_freqksetsleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsPTR_ERRnodesysvshmuint_64data_outerofs_exit_sysfserofs_fscache_register_fsfirst_indexcommit_metadata__dstactive_countblobnr_active_requests_shared_tagserofs_init_devicenum_tracepointscopyueventsharedmemcg_completionsdisk_eventsget_tree_bdev_flagss_sysfs_namesigval_tconfig1config2config3PERF_SAMPLE_BRANCH_USER_SHIFTmap_pop_elembitsnr_siblingsbase_pfnclass_mutex_try_is_conditionalsem_undo_listcompat_rmtp_SLAB_CONSISTENCY_CHECKSclass_local_lock_is_conditionalstatic_key_true_stimeinsnsperf_event_ctxpprogscostxcomp_bvio_context__traceiter_erofs_readpagesPIDTYPE_PIDwakee_flipsvolumevlagufdserofs_shrinker_registersegment_boundary_maskattach_tracing_progioctlprev_cputimeis_active__UNIQUE_ID___addressable_init_module764btf_flagshorizontal_positionem_perf_tablebi_crypt_contextkfreeerofs_deviceslotprivatePERF_COUNT_SW_ALIGNMENT_FAULTSswp_entry_tcharmatchnr_failed_migrations_hotreg_offsetBPF_TRACE_KPROBE_MULTIpacked_nidFORTIFY_FUNC_UNKNOWNposix_acl_entrywrite_charfilter_typebin_attrscpu_itimerhlist_entrydevres_lockspecfiles_structtriggers__ret_onceblk_zoneerofs_fast_symlink_iopsEVENT_FILE_FL_TRIGGER_MODEicq_treePTR_TO_BTF_ID_OR_NULLvfsuid_tf_lockexec_vmkernel_paramfs_typebtf_fielddisabledvertical_positionbtf_dtor_kfunc_tshutdown_prerelease_folioftrace_managedbi_io_vec__UNIQUE_ID_author767BPF_LINK_TYPE_NETNSarraymtimearchrobust_listasync_probe_requestedthaw_earlyac_btimevectors_securitysplice_writeparam_lockreq_listnotify_failurei_opflagstot_write_bandwidthfreeptr_offsetdentry_operationss_blocksize_bitsbp_typeexp_hintclass_srcu_is_conditionalpurposeprealloc_mutexbpf_raw_event_mapstrnleniomap_valid_head_2aperf_cgroup_infosym___kernel_vsyscallopen_mutexTRACE_EVENT_FL_CAP_ANY_BITfortify_funcfdevcan_forklow_usageget_timeki_flagsFTRACE_OPS_CMD_ENABLE_SHARE_IPMODIFY_SELFs_inode_wblist_lockpermwriteback_inodesERR_PTRdestroy_workuprobes_statemm_counttrace_overrunargsargvuclamp_reqswap_info_structs_qcopwb_tcand_bytes__kernel_long_tsrcu_usagefaultableperf_event_mutex__read_overflowsync_modesystemmap_gen_lookupin_execve__builtin_strlenrlim_maxBPF_LINK_TYPE_UNSPECBPF_LINK_TYPE_NETFILTERtarget_listOpt_daxhrtimer_interval_msseq_bufbpf_kfunc_btf_tabrtpoll_next_updatecoherent_dma_maskgeneric_fh_to_parentBPF_CGROUP_INET4_POST_BINDdriver_flagsfile_ra_statek_sigaction_hugetlb_hwpoisoninsn_offshrinker_info__SCT__tp_func_erofs_readpagescompletionsreadahead_controlprocs_fileswait_queue_headmemory_type__probestub_erofs_fill_inodevm_userfaultfd_ctxTT_NONEmem_opPERF_SAMPLE_BRANCH_COUNTERS_SHIFTmap_pagesBPF_PROG_TYPE_TRACEPOINTmod_tree_nodelocal_watermarkprobe_offsets_bdev_filedev_pagemaperofs_fscachecheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fssoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLErb_nodereturn_consumersuper_set_sysfs_name_genericksymi_private_dataroot_csetused_btfsptracer_credsrcu_barrier_headleadercheckTT_COMPATcap_effectivenetfilterexit_statefaultPERF_COUNT_SW_EMULATION_FAULTS_SLAB_POISONprogs_hlistsb_extslotsnuma_pages_migratedidr_nextaddr_filters_genf_blocksfiltersnr_frozen_descendantsno_cgroup_migrationPG_private_2_SLAB_SKIP_KFENCEbpf_func_info_auxtrampoline__tpstrtab_erofs_map_blocks_exitprintk_index_startPG_writebackindex_keyevent_mapped__bi_nr_segmentsupdate_progforce_scanintervalavgs_lockbug_entryzswap_maxtimers_activenum_classesbpf_cgroup_storagevma_lockrtpoll_untilkswapd_waitdl_throttledbpf_progseccompDEVICE_VERT_POS_UPPERblk_holder_ops__reserved_2__reserved_3fprop_local_percpuuuid_nullstatic_key_modxattr_prefix_startfilter_countpsi_filesmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodeerofs_is_fileio_modeumode_terofs_sb_lz4_infoz_erofs_map_headerinitial_nsno_pmGRPQUOTA__srcia_vfsgidioctx_lockTRACE_REG_REGISTERtimer_slack_nss_bdixarrayjited_linfocan_wakeuptime_namespacepdeath_signalexpected_attach_typeFS_CONTEXT_FOR_RECONFIGUREdst_regnr_wakeups_idledqi_igraceqf_nextBPF_MAP_TYPE_LPM_TRIEPG_savepinnedmaple_treensproxyslave_dir__p_len__write_overflowperf_raw_frag_pkeykernfs_rootucountsget_next_ida_refcountDD_CLASS_TYPE_LEVEL_NUMEVENT_FILE_FL_FILTERED_BIThooknumwrite_syscallslistscore_relo_rec_sizerefcount_t__SCT__tp_func_erofs_read_folioDEVICE_PANEL_TOPmemtiermax_hw_discard_sectorsxa_initint32_txol_areasrcu_gp_mutexdebugfs_dirwakee_flip_decay_tsprio_listdo_perf_trace_erofs_map_blocks_enterPERF_SAMPLE_BRANCH_KERNEL_SHIFTlast_timerequestblk_unique_idwpcopy_delay_totaltotal_blocksparent_generationcontexterofs_mount_optsrwlock_tvm_fault_tEVENT_FILE_FL_ENABLEDuse_autosuspendclass_spinlock_irq_try_is_conditionalcfs_rqtree_reclaimedPG_owner_2virt_boundary_maskcgroupscore_occupationget_policycore_cookiepcrefz_idataoffrefcount_struct__kernel_ulong_tkf_opsfwnodeZONE_DMAarch_hw_breakpointBPF_CGROUP_GETSOCKOPTcgroup_storagestatic_call_keyerofs_xattr_long_prefixnamespaceparameterstrace_event_type_funcs_erofs_map_blocks_enterbtf_sizegroup_leaderrunnable_avgdirect_calllookaheadiowait_countshstkioac__kernel_clock_tcall___GFP_DMA32_BITgp_seqprintk_get_levelnew_encode_devuuidmaj_fltWB_REASON_FORKER_THREADcached_requested_keydqb_rsvspace__SCK__tp_func_erofs_map_blocks_exit___GFP_NOMEMALLOC_BIT_SLAB_OBJECT_POISON__reserved_1__s8inode_operations__kernel_size_tdma_configurefile_leasepage_counterarg_flagsclass_local_lock_nested_bh_is_conditionalgpl_symsallowed_attachsrecursion_detectedpercpu_rw_semaphorerctxarch_spinlock_tbpf_linkseqcount_raw_spinlock_tbpf_iter_init_seq_priv_tpmu_privatehighthread_pidmap_lookup_batchPG_large_rmappablertpoll_min_periodemindl_non_contendingcurr_ret_stackpgtable_t__u8q_usage_counterwakeirqi_atime_nsecclass_raw_spinlock_is_conditional_sigsysupdate_mapcore_forceidle_sumget_offset_ctxptscreleasedFILTER_RDYN_STRINGexport_operationsbitposqc_stateBLK_INTEGRITY_CSUM_IPmempool_smempool_timplicit_on_dfllengthpPERF_SAMPLE_BRANCH_IN_TX_SHIFTd_inodepmu_ctx_entrypageset_batchworkqueue_structBPF_MAP_TYPE_SOCKMAPi_lock_keyuevent_suppressgraveyard_linkbi_opffsidfs_superscall_get_func_ip__read_overflow2xattr_shared_xattrs__rcu_icq_cache___GFP_KSWAPD_RECLAIM_BITcompact_cached_free_pfncap_ambientqstrtaskss_d_opBPF_MAP_TYPE_TASK_STORAGEi_rcu__count__already_donenetnsio_optspanned_pagesTRACE_REG_PERF_ADDpcountbio_listwlockedrtpoll_trigger_lockdeviceevent_class_erofs_destroy_inodemodule_kobjectaux_pausedmap_releasePTR_TO_PACKET_META__compiletime_assert_723mg_tasks__compiletime_assert_726__compiletime_assert_727BPF_TRACE_ITER__compiletime_assert_729percpu_count_ptrnr_ia_rangesthawmap_update_batchlink_attach_flags__tracepoint_erofs_fill_inodetlbflush_unmap_batchremovebvec_iteroom_mm__compiletime_assert_730__compiletime_assert_732__compiletime_assert_733__compiletime_assert_735__compiletime_assert_736bpf_local_storage__compiletime_assert_739name_linkcompat_long_tcnivcswmap_freePERF_EVENT_STATE_INACTIVEPTR_TO_SOCKET_OR_NULLshort intkswapd_highest_zoneidxtrc_reader_specialgtime__compiletime_assert_741__compiletime_assert_742thread_group_cputimersizemigrate_to_ramUTASK_SSTEP_ACKTRACE_EVENT_FL_CAP_ANYloginuiddesc_structi_wb_lists_umount_keyquota_typenamecgrp_ancestor_storagesetleasedealloc_deferredmnt_rootname_lenBPF_MAP_TYPE_SK_STORAGEpsi_flagsfh_len__compiletime_assert_760sighandbtf_key_type_idavgs_workaddrerofs_init_managed_cache__rcu_headac_utime_SLAB_HWCACHE_ALIGNksm_zero_pagesBPF_MAP_TYPE_LRU_PERCPU_HASHqueuedataprivate_dataBPF_MAP_TYPE_CPUMAPgid_map__SCT__tp_func_erofs_map_blocks_exitpageset_high_minfs_structnuma_nodedev_archdatabr_stack_cntrnr_perf_statess_flagsrcu_nodeorig_pmdrb_rightclock_baseBPF_SK_REUSEPORT_SELECTclass_irq_is_conditionallaunder_foliois_funcperf_branch_sample_type_shifts_vfs_rename_mutexElf64_XwordTRACE_EVENT_FL_EPROBE_BITflockmigrate_entryiter_createva_list__SCK__tp_func_erofs_readpagesvalue_type_btf_obj_fd__paddingoffline_waitqnr_reclaim_startevent_unmappedio_lockdep_mapatomic_write_hw_boundarymap_nr_maxiowait_sumdescriptionfolio_batchbi_nextblk_status_tTRACE_EVENT_FL_CUSTOMUSRQUOTABPF_CGROUP_ITER_SELF_ONLYdriver_privateerofs_module_initcore_relospm_onlyd_rt_spc_warnsset_read_onlypgmapactive_refmap_owner_storage_ptrhctx_tablekernfs_open_filelowmem_reserves_iflagsprintednr_hw_queuesbuffercodetagallowed_mapsevent_class_erofs_readpagesctx_arg_infotask_epcBPF_PROG_TYPE_SK_LOOKUPcid_worki_versionpinned_activeswap_deactivatesr_lockattachclass_rwsem_read_is_conditionalqueue_limitsunitil_weightEVENT_FILE_FL_FREEDdma_parmsbdi_idKOBJ_NS_TYPES__UNIQUE_ID___addressable_cleanup_module765cmin_fltEVENT_FILE_FL_PID_FILTER_BITarch_uprobe_tasklicensewrite_protect_seqkobj_ns_type_operationsshutdownevent_countsched_statisticslru_lock__kernel_uid32_tnode_zonelistsallocchild_mutexTRACE_TYPE_HANDLEDb_attachedorig_pterq_timeoutkeystimestampinit_nameper_cpu_zonestaterofs_kill_sbfile_lockidr_for_eachstatfstrace_print_funcrw_semswappinesserofs_scan_deviceserofs_bufdevice_privatevm_policydl_deadlinetracepoint_extclass_mutex_is_conditionalis_signedfpregs_statememcg_datadqb_curinodesBPF_XDPfileattr_setac_tgetimercu_barrierbtf_log_sizeDEVICE_PANEL_UNKNOWNPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionfs_dax_get_by_bdevlast_tagmce_ripvDL_DEV_NO_DRIVERbpf_arenafree_after_mult_rcu_gpret_stack__tpstrtab_erofs_lookupnbp_rl_nr_candreal_timeri_privatealloc_tagextended_state_areanum_kprobe_blacklistaccessmap_seq_show_elemsubdirsh_advisedev_releasecgroup_freezer_statemlock_countBPF_PROG_TYPE_LWT_SEG6LOCALmempolicycacheline_padding_bandfd_arraypollfdblinding_requestedlaptop_mode_wb_timerdev_tplatform_dataf_refFS_CONTEXT_RECONF_PARAMSftrace_ops_cmdprev_posenv_endfileattrs_subtypeusage_countpr_opsOpt_user_xattrstate_in_sysfsring_buffer_iterdqb_ihardlimitunlocked_ioctluprobebd_mappingkmem_cachenuma_next_scansrcu_last_gp_endtnodeclass_local_lock_irq_is_conditionalconst_folio_flagsholders_dirMODULE_STATE_UNFORMEDst_valueEROFS_ZIP_CACHE_DISABLEDlist_headdo_trace_event_raw_event_erofs_readpagesptrace_bpss_user_ns__bpf_trace_tp_map_erofs_readpagescan_attacherofs_get_parentmap_lookup_elem_sys_onlymin_usagearch_tlbflush_unmap_batchquick_threadsdefer_syncfs_parameterstream_idBPF_LINK_TYPE_NETKITBPF_TASK_ITER_TIDmissed__bpf_trace_erofs_read_foliousernsBPF_PROG_TYPE_CGROUP_SKBsum_sleep_runtime__len__d_spc_timerd_ino_hardlimitchange_cookiebi_statuscss_allocdl_periods_dquotdo_perf_trace_erofs_fill_inodesaved_funcnew_sbifsnotify_sb_infomap_fd_get_ptrrecent_cida_opsftrace_opstp_namebpf_eventprocnamepad_untilmap_redirectperf_event_listinterval_expinsnBPF_CGROUP_UDP4_SENDMSGrstat_css_list___GFP_LAST_BITvm_node_stat_difffs_value_typereplace_bpf_fdki_completepgprotread_syscallsclocktimespec_typebd_deviceBPF_LINK_TYPE_TCXvmstatsdquot_operationsbio_vecPG_waitersposix_cputimers_workgsbase__lruvecBPF_CGROUP_INET_EGRESSstrlenTRACE_EVENT_FL_KPROBEcompact_delay_totalio_tlb_memseq_showminorcpuspmu_disable_count__bpf_trace_erofs_destroy_inodefilesinblockbd_claimingtails_magic__empty_rawmem_lockumount_mutexnuma_faultsFS_CONTEXT_FAILEDmem_dqblktarget_ifindexlocal_hashstatusBPF_PROG_TYPE_CGROUP_SOCKOPTWRITE_LIFE_NONEread_countBPF_CGROUP_INET6_CONNECTHRTIMER_NORESTARTlast_update_timesas_ss_spold_map_fdpanel___GFP_ZEROTAGS_BITwatermark_SLAB_CMPXCHG_DOUBLEnode_start_pfnmax_allowed_capacityopen_moderead_pos___GFP_ACCOUNT_BITclass_cpus_read_lock_is_conditionalmg_dst_preload_nodecpu_run_real_totalEVENT_FILE_FL_SOFT_MODE_BITD_REAL_METADATAgpl_crcstimes_prevclass_raw_spinlock_try_is_conditionalkiocbf_namelenEVENT_FILE_FL_FILTEREDvalidity_cookietstampaux_resume___GFP_MEMALLOC_BITexecute_only_pkeyreturn_instancesma_lockcss_offlineattach_btf_tracedockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsbacctwb_tcand_iddentrysequential_iowait_pidfds_writersgroup_stop_countavg_next_updateEVENT_FILE_FL_SOFT_DISABLEDvm_opswb_reasonftrace_hashrecoveredget_unmapped_areamkobjsym_VDSO32_NOTE_MASKfrozenactive_uprobeunregisteringget_parentmin_vruntimestoragesdebug_dirclass_disable_irq_is_conditionalsyscrsyscwsync_ionum_bpf_raw_eventski_pose_csetsavx512_timestampfh_typee_freezeBPF_GRAPH_ROOTfree_cached_objectstaints_Boolsget_keymax_tp_accessstart_txntrace_event_raw_erofs_destroy_inodexol_vaddrb_dirtylist_lru_nodeuclamp_ses_time_granprintk_skip_levelvm_statsuper_setup_bdiblk_integritykuid_tdev_pm_qosbd_holdersper_cpu_zonestatsdo_trace_event_raw_event_erofs_map_blocks_enter_sifieldstaskfs_value_is_undefinedBPF_CGROUP_INET6_BINDerofs_blk_tresetpath_sizesched_reset_on_forkcompound_headnr_retrieswake_irqbrancherofs_set_sysfs_namei_cdevfunc_infoi_fsnotify_marksin_thrashingdl_deferBPF_MODIFY_RETURNwaitersvm_startmprotectquota_ond_automountDEVICE_REMOVABLE_NOT_SUPPORTEDkprobe_funcctl_table_headeratimeget_ownershipf_task_workmax_sectorspending_work_waitmy_qinherit_threadtrace_event_raw_event_erofs_read_folioTRACE_EVENT_FL_NO_SET_FILTER_BITBPF_SK_SKB_STREAM_VERDICTeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalsectors_wb_err__q_sizeEVENT_FILE_FL_NO_SET_FILTER_BITBPF_LINK_TYPE_CGROUPfs_pinattach_prog_fdftrace_func_tcloseevent_erofs_fill_inodeiopl_warnelevator_queuefs_privateptraced__MAX_BPF_MAP_TYPEdonesym___kernel_rt_sigreturnsrcu_struct_ptrsbinfmt_miscfs_value_is_fileinodesattr_updatememcg_awarei_atime_seccancel_txnac_schedqsize_t__fpstatemap_poke_trackBPF_MAP_TYPE_SOCKHASHperf_event_pmu_contextqf_ownerid_header_sizesuspend_noirqd_inamebi_flagslinks_countprealloc_pterdevd_ino_countarg_locksysfs_registerederofs_is_fscache_modeclass_rcu_tasks_trace_is_conditionalDEVICE_REMOVABLE_UNKNOWNignore_childrenflexible_activeBPF_CGROUP_UDP6_RECVMSGdirty_exceededfreeze_fsin_eventfdresume_earlymax_dev_sectorsdup_xol_workalimitd_obtain_aliasitemsperf_raw_recordnuma_groupmem_snoopblk_independent_access_rangesdeferred_resumekmap_ctrlfscrypt_operationsrangesevents_lockfs_contextmnt_idBPF_CGROUP_INET6_POST_BINDfreq_count_stampdrop_inodeBPF_MAP_TYPE_REUSEPORT_SOCKARRAYorc_unwindprojid_mapmap_lookup_and_delete_batchkprojid_t__u16PTR_TO_XDP_SOCKpagesh_idata_sizesyscall_dispatchdl_densityon_rqlru_gen_mm_walkaltmapmin_perf_statercu_tasks_exit_list__real_strscpysp_regactive_oncpus_master_keysflagsEVENT_FILE_FL_TRIGGER_CONDbd_holder_locknr_threadsvm_mmtrace_buffer__u32fmt_sizequery_flags__MAX_BPF_LINK_TYPEmax_secure_erase_sectorsseq_nextenable_statss_quota_typesvm_lockswapin_count__compiletime_assert_652_ddebug__compiletime_assert_659FAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimit__compiletime_assert_724delayskcompactd_max_ordermnt_ns__data_loc_nametimerqueue_headBLK_INTEGRITY_CSUM_CRCOpt_errfieldkioctx_tableprioritytrace_event_fields_erofs_lookuperofs_put_superksm_rmap_itemsclass_read_lock_is_conditionalKMALLOC_RECLAIM__u64revoked_at_folio_nr_pageswritepageis_dirty_writebackpkey_allocation_mapdq_idZ_EROFS_COMPRESSION_ZSTDdisable_depthem_perf_statethread_shstkposix_timerswait_chldexitsas_ss_flagspresent_early_pagesinheritgpl_compatibleinsn_idxPTR_TO_MEMbi_itersrcu_cblist_invokingsample_regs_intriopollPG_swapcacheline_coliov_lenlatency_recordPG_anon_exclusivefs_value_is_filenamedirty_limit_tstamperofs_module_exit__BPF_REG_TYPE_LIMITd_releaseavg_totalpending_addrBPF_NETKIT_PEERzswap_writebackexpiresnuma_scan_seqmnt_sb__event_erofs_fill_inodeblkcg_csshashnodemask_tsize_poke_tabsignalfd_wqhhang_detecteddevice_drivergroup_generationlast_zone_capacityfsindexout_batchraw_spinlock_tinfixsnapshot_auxPG_lockeds_cops_activenum_argspidlist_mutexbpf_link_typetag_sizebtf_trace_erofs_destroy_inodeBPF_MAP_TYPE_PERCPU_HASHlast_old_flushbuffer_iters_uuidclear_child_tidruntime_statusdqb_btimedq_opBPF_MAP_TYPE_DEVMAPtrace_event_type_funcs_erofs_lookupshow_pathdl_serverVTIME_USERquota_disablesched_delayedsrcu_gp_seq_neededtask_ctx_datatask_structcurrent_may_mountkmalloc_cachespushpeaks_lockbpffs_fdpath_fdis_noirq_suspendedPTR_TO_TP_BUFFERcountersuspendnr_userdax_part_offoom_score_adj_min_pflagszone_wplugs_poolzone_typedomain_datacopy_file_rangesrcu_gp_startreport_zones_cbsched_cb_usagellenxa_flagsattach_btf_idlru_gen_foliobtf_idbpf_insntv_nsecmax_zone_append_sectorssas_ss_sizes_inode_list_lockBPF_MAP_TYPE_STACKUTASK_SSTEPraw_tracepointerofs_exit_shrinkerdq_sb__traceiter_erofs_lookups_mounts__event_erofs_readpagesBPF_LINK_TYPE_RAW_TRACEPOINTelem_flagsvm_stat_diff__probestub_erofs_lookupsym_pvclock_pageswapin_delay_totalfree_listPG_reservedpage_frag__probestub_erofs_map_blocks_exitinfo_lennamespaceserofs_free_dev_contextfsuidRPM_REQ_AUTOSUSPENDsrcversiontrace_event_callwakeup_sourceis_partially_uptodatedl_runtimemay_splitio_uring_cmdprogs_cntread_dqblkowner_entrye_uidrtpoll_nr_triggerssrcu_parenttrace_event_fields_erofs_read_folioinit_seq_privatebi_cookiesuppliersfile_operationsbpf_ctx_arg_aux__traceiter_erofs_destroy_inodepagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotpid_allocatedtrace_event_buffer_reserveis_preparedpgprotval_tinterrupts_seqmemorytrc_holdout_listsm_reffunc_hashasync_suspendq_nodezone_pgdatclass_mutex_intr_is_conditionalstrtabpage_freeperf_sample_dataftopdepends_ontp_name_lenHPROBE_CONSUMEDi_mmapnr_cgrpsdirty_paused_when___GFP_COMP_BITcss_resetprint_fmt_erofs_fill_inodecapacityversionperf_trace_erofs_map_blocks_exitlost_samplesFS_CONTEXT_CREATE_PARAMSllisthiwater_vmmax_perf_statebpf_prog_array_validbi_idxPERF_SAMPLE_BRANCH_NO_CYCLES_SHIFTcookiesfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntget_treerseqattach_typemagictarget_knlimit0limit1pi_blocked_onpid_tac_exe_inodevmemmap_shiftbpf_attach_typeusage__kernel_time64_tPERF_SAMPLE_BRANCH_ABORT_TX_SHIFTrq_qos_mutexkernel_read_file_strcapabilitiesi_securitydevice_physical_location_panellimitsq_lock_cls_keyenvpactive_memcgElf64_Halfallow_reiniterofs_fc_set_dax_modetimer_autosuspendslrugenratelimit_test_bitstat_threshold_softexpiresautosuspend_delayrotate_disableline_info_rec_size_zonerefsi_flctxlist_lockvm_fault__SCT__tp_func_erofs_fill_inodenr_cgroupsip_epilogueoptimistic_spin_queuetarget_obj_idpermissionbpf_prog_array_itemerofs_fc_parse_param__UNIQUE_ID_alias763flush_listpayloadDEVICE_FIXEDFILTER_COMMlast_statustrace_event_type_funcs_erofs_readpagesxfeaturestp_listslice_maxiputeval_valueIS_ERRmap_namebi_max_vecsthaw_noirqsched_debugfs_dirtrace_trigger_soft_disabledEVENT_FILE_FL_FREED_BITaccounting_timestampcan_matchtime_archmem_blkchunk_sectorshlist_bl_headtrace_ctxpageflagsqc_dqblkcalledpasid_activatedtrace_event_fieldsancestorsfa_next__fortify_panicbvec_integrity_poolBPF_XDP_DEVMAParch_datae_permwakeup_watermark_oldshrink_controlegidthreaded_csetsmax_rdonly_accessmap_direct_value_addr_SLAB_NO_USER_FLAGSnet_deviceenvp_idxcrypto_kobjectPERF_SAMPLE_BRANCH_ANY_RETURN_SHIFTperf_bufferirq_work___GFP_NO_OBJ_EXT_BITf_modeoffloadszone_idxfolioruntime_autopref_node_forklru_zone_sizeclassipc_namespaceBPF_SK_SKB_VERDICTarenaprev_scan_seqpinned_groups_perfpsi_group_cpufeature_incompat__bpf_trace_erofs_map_blocks_exitwait_queue_head_ttask_cputimeFAULT_FLAG_INSTRUCTIONdeferred_splituser_nsclass_raw_spinlock_irqsave_is_conditionalsb_set_blocksizesymsFILTER_STATIC_STRING_flagscgwb_release_mutextrace_arraysync__compiletime_assert_100__compiletime_assert_101__compiletime_assert_102__compiletime_assert_103__compiletime_assert_104__compiletime_assert_105__compiletime_assert_106__compiletime_assert_107__compiletime_assert_108mq_freeze_lockdata_page_sized_childrenucountmap_local_storage_unchargectl_table_sizebpf_map_opsPG_fscacheddebug_class_mapstruct_opsdfl_cftypesprealloc_bufaudit_contextfl_owner_tBPF_MAP_TYPE_DEVMAP_HASH__bpf_trace_erofs_map_blocks_enterpersistent_keyring_register__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123s_kobj_unregister__compiletime_assert_125__compiletime_assert_126i_pipe__compiletime_assert_128__compiletime_assert_129d_waitllist_headtask_itersnode_spanned_pagesavg_refaultedwait_page_queuebpf_line_infoBPF_SK_MSG_VERDICTtrace_raw_output_erofs_destroy_inodeFAULT_FLAG_REMOTEcontext_switch__compiletime_assert_130dl_bwtrace_event_data_offsets_erofs_map_blocks_exithierarchy_id__compiletime_assert_134__compiletime_assert_135__compiletime_assert_136unaccepted_pages__compiletime_assert_138__compiletime_assert_139i_dir_seqheaderwatchdog_stampstate_startlist_op_pendingi_rwsemsrcu_cb_mutexsysfs_lockBPF_CGROUP_UNIX_CONNECTallowed_progsno_callbackssaved_trap_nrclock_listbpf_func_infofolioq_slotkmemdup_nulMODULE_STATE_GOINGidr_destroyxattr_handlerf_frsizeac_utimescaledrqos_debugfs_diridr_baseunlock_native_capacityFILTER_OTHERclass_preempt_notrace_is_conditionaldqb_bhardlimitin_txfromnextentsevent__compiletime_assert_160__compiletime_assert_161__compiletime_assert_162__compiletime_assert_163keytype__compiletime_assert_165__compiletime_assert_166__compiletime_assert_167__compiletime_assert_168var3_w__kernel_gid32_tevicteddev_pm_domaintrace_reguaddr2f_securityvariable_test_bitdefparamdiscard_granularity_SLAB_ACCOUNTbtf_trace_erofs_fill_inodeclass_raw_spinlock_irq_is_conditionalq_size__bi_cntmanaged_cacheerofs_fs_typercuwaitattributes_maskdl_defer_runninggeneric_encode_ino32_fhlru_gen_mm_listevents_fileevent_erofs_read_foliotagged_writepagescompact_defer_shiftlocal64_tia_valid_SLAB_NO_OBJ_EXTlog_buf__compiletime_assert_192srcu_size_jiffiesclassesstatic_call_sitehlist_emptycputimeis_seenupdated_nextsrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliod_rt_spc_hardlimitmap_fdrcharbdevi_verity_info_addr_pkeyperf_trace_erofs_fill_inodepid_cacheprw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countBPF_PROG_TYPE_XDPbpf_ksymtcp_ptr__atomic_opentrace_print_flagserofs_fscache_unregister_fserofs_iloc__mptrsigactiontarget_namerlimops_funcbtf_token_fdmce_addrf_freeptrBPF_MAP_TYPE_CGROUP_ARRAY__sighandler_tclass_spinlock_try_is_conditional__taskzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMEShash_lenfs_flagsh_algorithmtypevm_filei_countuser_structmap_idaddress_space_operationscgroup_idtrace_event_data_offsets_erofs_lookupperf_event_stateFAULT_FLAG_USERkey_perm_tPERF_SAMPLE_BRANCH_COND_SHIFTused_btf_cntbtf_log_buftimer_listverifier_zextmemory_eventscgwb_listrun_delaynum_ftrace_callsitessrcu_cblistoffload_requestedblk_independent_access_rangetrampoline_sizeavg_write_bandwidthperf_probetlb_ubcpgtables_bytesi_lruGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacktrc_ipi_to_cpucss_onlinePTR_TO_FUNCmemory_events_localmin_slicePG_checkedsb_listfa_locksysfs_opscore_relo_cntatomic_write_hw_unit_maxcmaj_fltsaved_slotsbio_integrity_poolkparam_arrayPERF_SAMPLE_BRANCH_CALL_STACK_SHIFTFORTIFY_FUNC_strscpypercpu_refevict_inode__fs_parsedqb_itimertpoll_statestask_ctx_nrperf_sample_weightthread_keyringcgroup_nscpumask_tsnapshot__kernel_fsid_taddr_filters_validaterstat_css_noderb_leftgfp_maskinactive_timerlost_eventsseq_putsattributetrace_event_raw_erofs_map_blocks_exitperiod_timemm_lock_seqFORTIFY_FUNC_memchrkernfs_elem_symlinkBLK_UID_T10wb_lcand_id__kernel_dev_tfa_filePG_owner_priv_1prog_namepm_domainBPF_CGROUP_INET4_BINDmax_rdwr_accessmax_prop_frac__data_sizefsgid__compiletime_assert_11__compiletime_assert_12sector_t__traceiter_erofs_map_blocks_entercompact_cached_migrate_pfn_sys_privatesignal_structactive_mmkernfs_iattrsshow_devnameint_32e_gidpending_irqhrtimer_intervalEVENT_FILE_FL_RECORDED_TGID_BITthread_infoi_mmap_writabledata_size_outPG_has_hwpoisonedattach_btf_obj_fdread__compiletime_assert_21stack_user_size__compiletime_assert_23value_recreadposatomic_write_max_sectorsgroup_exit_codesb_flags_maskuuid_equalFS_CONTEXT_FOR_SUBMOUNTperf_branch_stacktrace_event_functionsFORTIFY_FUNC_memcmpopc1eventfs_inodevalue_btf_idexec_max__compiletime_assert_32__compiletime_assert_34sync_statedo_perf_trace_erofs_destroy_inodedev_groupstrace_raw_output_preputs_namespacePERF_SAMPLE_BRANCH_IND_CALL_SHIFTzone_start_pfnvalue_sizekernfs_elem_dirdo_trace_event_raw_event_erofs_map_blocks_exitpercpu_counterleftover_printkcgroup_subsys_statesequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startUTASK_RUNNINGopenseglenBPF_MAP_TYPE_QUEUEFORTIFY_FUNC_memcpyevent_base__kernel_ssize_tvdso_imagesi_signopending_tasknr_no_switch_fastunused_hctx_lockrseq_sigresultrefsfunc_namedelayed_callfh_to_dentrytime_slicefunc_info_rec_sizenr_rangemax_seqmmap_databtf_func_modelspc_timelimituid_gid_mapnr_freeh_reserved1resumeset_ownershipnr_freqbpf_iter_task_typeregsbi_write_hinterrorclass_rcu_is_conditionalattrOpt_domain_idd_aliasis_suspendedseq_priv_sizetrace_event_raw_erofs_fill_inodedax_deviceEROFS_SYNC_DECOMPRESS_FORCE_ONrestore_sigmaskactive_entryrequeue_locktm_refrotate_necessarykcsan_check_accessnr_deferredmem_cgroup_idsrcu_sspi_lockattach_stateuser_event_mmbtrace_seqbuild_timez_tailextent_headlcns_devsiblingia_rangedirfdmap_lookup_elemldt_usr_semsbdataposix_cputimersflexible_groupsRPM_INVALIDfreeze_kcountrequest_key_authblocksexpected_crcpercpu_ref_datad_spc_warnssrcu_supnbp_thresholdfreeptr_tns_typeRPM_REQ_NONEprog_btf_fdixolfasyncarg_startkprobes_text_sizekfunc_tabblk_crypto_profilefop_flagswork_lockPERF_SAMPLE_BRANCH_ANY_CALL_SHIFT_addr_lsb_addrpfn_mkwritentimeuaddrrtpoll_waitBPF_STRUCT_OPSKMALLOC_DMAfunc_proto_unreliabletrace_event_get_offsets_erofs_map_blocks_exit__compiletime_assert_83__compiletime_assert_84_uidmm_stateevent_filterneed_frees_fs_infomm_stats__rb_parent_colorWRITE_LIFE_EXTREMEicq_list__MAX_NR_ZONESmm_users_pp_mapping_padimagekey_serial_tfolioqfolios_slab_flag_bitsmem_lvl_numcputimernrpageswake_q_nodebasessample_max_stack__compiletime_assert_91blk_flags_tmap_fd_put_ptr__compiletime_assert_93s_maxbyteshd_geometryioctx_tabledma_io_tlb_memdo_perf_trace_erofs_readpagesKMALLOC_CGROUPlz4_max_distancefree_after_rcu_gpget_unique_idkasan_check_read__probestub_erofs_read_folioPG_workingsetNR_KMALLOC_TYPESexpire_countcompact_init_migrate_pfnfor_syncwake_cpujited_lenPTR_TO_SOCKETlinfobio_splitname_ptr____GFP_DMA_BITfreeze_supertick_dep_maskvmpressurelruvecmap_check_btfiter_infoqc_infoobjcg_listPERF_COUNT_SW_DUMMYfault_flagmodnameput_foliosaved_metricia_ctimehrtimer_activetrace_eval_mapparent_genorig_objcgasync_put_workresvnum_static_call_sitesZONE_MOVABLEvm_lock_seqFORTIFY_FUNC_strncatevent_erofs_readpageshw_idxkmem_cache_freeroot_listPG_hwpoisonBPF_TRACE_FENTRYget_folioElf64_Addrwait_queue_entry_tseqlock_tlatency_record_countmay_skip_resumeVTIME_SYSalloc_tag_countersbase0base1base2bio_setCONST_PTR_TO_DYNPTRBPF_MAP_TYPE_RINGBUFalignment_offsetTRACE_TYPE_UNHANDLEDlinkschild_total_time_runningfutex_staterseq_lenkobj_completionbdi_dev_namefs_param_typei_spc_timelimitf_opsync_decompressbindproc_ns_operationsold_prog_fdBPF_PROG_TYPE_SK_REUSEPORTEROFS_NO_KMAPaux_start_pausedmm_mtgid_trelease_workPERF_COUNT_SW_PAGE_FAULTSavg_nr_triggersOpt_dax_enumBPF_PROG_TYPE_LWT_OUTrcu_read_unlock_specialBPF_CGROUP_UNIX_RECVMSGtls_arraybp_listtask_io_accountingcss_rstat_flushf_raDEVICE_PANEL_FRONTmodule_memorynetkitsitesfs_value_is_flagcompat_robust_list_headcss_releasedthread_nodestatic_call_mods_shrink__compiletime_assert_127gp_countnr_sectorsperf_branch_entrybpf_raw_eventsiommutimer_expiresbpf_storagekset_uevent_opsf_ownerfull__state_permtrace_event_type_funcs_erofs_read_folio__probestub_erofs_destroy_inodeDEVICE_PANEL_BACK__SCK__tp_func_erofs_lookupoffsetswb_switch_rwsem_syscalldiskjit_requestedsrcu_lock_counttrc_blkd_cpugp_waittrace_subsystem_dir__compiletime_assert_131ESTACK_MCEiommu_mmfunc__compiletime_assert_137erofs_fh_to_parentio_uring_taskrepeatjit_keyrings_fsnotify_infofunctionlinkagetrace_raw_output_erofs_map_blocks_exitBPF_PROG_TYPE_CGROUP_SOCK_ADDRprojidmce_kill_mema_external_lockpid_linksconv_zones_bitmaps_dio_done_wqfor_kupdatestart_all_reasonhlist_head_pad3_ioc_nodethrottle_disktrace_entryarray_bufferbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACE__fortify_strlenfbufferrunningrw_hintblk_integrity_checksumdestroy_rworkdma_skip_syncpartition_meta_infotstamp_type_accessDEVICE_VERT_POS_LOWERsample_regs_userBPF_CGROUP_ITER_ANCESTORS_UPnr_dying_subsysclass_spinlock_irqsave_is_conditionalutf8datarebootperf_trace_erofs_readpageshlist_nulls_headrequeue_workof_node_reuseddyndbg_infoFORTIFY_FUNC_strncpymem_dtlbperf_overflow_handler_tElf64_Symtrace_event_raw_initreclaim_waitsaved_errd_rt_spc_softlimitpollfree_file_infoin_lru_faultsched_contributes_to_loadtlb_gentrace_raw_output_erofs_fill_inoderuntime_idlemap_countgp_offseti_rt_spc_timelimitPROBE_PREFER_ASYNCHRONOUSfs_parse_resultqc_type_states_dentry_lruac_comms_bdev__string_srccrcsrun_listuevent_opsbpf_func_statebpf_reg_typesched_classret_sizeutil_avganon_vma_pidsigcntseq_putcuse_freeptr_offsetDD_CLASS_TYPE_LEVEL_NAMEShas_callchain_buftailcall_target_stablebpf_cgrp_storagemodinfo_attrsst_spacepartrefclass_map_typekparam_stringd_real_typemaxrsscredBPF_MAP_TYPE_ARRAYkernfs_open_nodef_wb_errmm_cid_activetrace_event_classEVENT_FILE_FL_PID_FILTER__SCT__tp_func_erofs_lookupkzalloc_noprofkmem_cache_alloc_lru_noprofmodule_sect_attrsruntime_resumeac_stimescaledgroup_exec_taskrestrict_linkirq_countget_inode_usagekmalloc_typexarray_startbpf_ctxpm_domain_dataserver_pick_taskbw_dworkaux_sizeattach_btfmap_lookup_and_delete_elem__p_size_fieldload_avgi_private_lockget_dqblktail_callmq_listphysical_block_sizePG_unevictablepgoffnetdevdeallocBPF_LIST_NODEdefault_setmodelfreeze_latemf_statsglobalhrtimer_clock_baseZONE_NORMALcount_objectsvma_numab_statedma_map_opsdq_dirtylnodefd_typeatomic_write_boundary_sectorswpcopy_counterofs_param_cache_strategywrite_bytesoom_reaper_listnumab_statefutex_offsetbpf_fdsubsys_fmt_prefixdq_lockintegritybranch_sample_typepte_tnr_scanned__stateeval_stringtext_pokeBPF_MAP_TYPE_UNSPECPG_readaheadnew_typenr_iosslicecgroupdrv_groupswrite_backwardcustom_sliceper_cpu_pagesstart_idbdi_listmq_freeze_depthpadding1_SLAB_TRACEnestedatomic_write_segments_maxinsn_cnttrace_event_type_funcs_erofs_fill_inodemap_set_for_each_callback_argsnr_dirtied_pausequeue_kobjdst_progreal_addressbd_holder_dirac_tgidinvalidate_locknum_exentriescss_local_stat_showprint_line_tperf_permblk_mode_tpmdval_tBPF_GRAPH_NODEkvecfree_area__tpstrtab_erofs_destroy_inodeset_latency_tolerancedepthorig_typed_ino_timerprobenetlink_nsnr_argstokendev_uevent__p_sizedefine_fieldsdep_mappage_mkwritevfs_inodelast_busyvm_flags_tuptrnregnr_failed_migrations_affined_in_lookup_hashdom_csetptrace_dr7erofs_init_fs_context_SLAB_KMALLOCreschedule_countmax_hang_timeopt_failedcutimelockreftrace_handle_returnnew_map_fdmap_meta_equaltlb_flush_batcheddev_priv___GFP_HIGH_BITia_uidtrace_event_data_offsets_erofs_fill_inodeautogroupsequencebuild_time_nsecrcu_syncarg_endclass_spinlock_irq_is_conditionalTRACE_REG_PERF_CLOSEPERF_EVENT_STATE_OFF__SCK__tp_func_erofs_map_blocks_enter_dummy_pkeyvruntimeBPF_CGROUP_ITER_DESCENDANTS_POSTvar2_wscanned___GFP_HARDWALL_BITtrace_seqSCALAR_VALUEnr_extentspidlistsWB_REASON_VMSCANTRACE_EVENT_FL_CUSTOM_BITfeatures_locked__kernel_pid_tdev_stateerofs_sb_has_sb_chksumfile_flagss_fsnotify_maskcinblockdma_alignmentBPF_TCX_INGRESS__kernel_loff_tset_performance_stateserial_nodelru_gen_mm_statePERF_SAMPLE_BRANCH_IND_JUMP_SHIFTstate_remove_uevent_sentnotify_countsrc_regexclude_callchain_userupdated_childrenspin_lock_offBPF_CGROUP_SYSCTLhprobeBPF_LINK_TYPE_PERF_EVENTswap_activatedqb_isoftlimitsaved_auxvnoinstr_text_size__init_rwsemdl_overrundetachedloff_toom_flag_originfreepages_delay_totaldesc_lenoom_score_adjwb_waitqevent_initksm_merging_pages__bpf_trace_tp_map_erofs_map_blocks_entertest_runrmidm_pleniter_flagsa_entriesPG_reportedPG_xen_remappeddevice_removablefxsavedev_pagemap_opsbv_offsetBPF_MAP_TYPE_XSKMAPset_infoFAULT_FLAG_ALLOW_RETRY_workingsetWRITE_LIFE_NOT_SETd_lockrefPG_mlockedexclude_idlebtf_typeprecise_ipBPF_LINK_TYPE_TRACINGnr_populated_domain_childrenmflagssession_keyringOpt_cache_strategy__q_size_fieldbtf_log_true_sized_deleteuts_nsd_ino_softlimiterofs_inode_init_onced_weak_revalidateerofs_read_superblocki_devicesuptodatedqb_curspacehw_perf_event_extraparse_paramBPF_TRACE_KPROBE_SESSIONalloc_locktrace_event_raw_event_erofs_destroy_inodeearly_inittotal_numa_faultswritable_sizemax_segmentsobj_cgroupvsnprintfem_tableBPF_PROG_TYPE_TRACINGfs_value_is_stringmq_sysfs_init_done__tracepoint_erofs_lookupevent_base_rdpmccompact_consideredz_erofs_init_subsystem__lstatepercpu_drift_markxattr_filter_reservedFILTER_CPU__BPF_REG_TYPE_MAXEROFS_SYNC_DECOMPRESS_AUTOkmem_cache_argssample_periodinodesubtree_bstatmem_snoopxbd_fsfreeze_mutexTRACE_EVENT_FL_TRACEPOINThrtimeratomic_write_unit_maxmeta_blkaddrsample_id_allFAULT_FLAG_UNSHAREtrace_print_symbols_seq__compiletime_assert_658group_indextask_sizemust_resumeRPM_ACTIVEend_codePTR_TO_SOCK_COMMON_OR_NULLnr_free_highatomicpreempt_notifierstlb_flush_pendingmigration_flagsDEVICE_PANEL_RIGHTmap_poke_untrackcap_inheritabletrace_event_data_offsets_erofs_map_blocks_enterbpf_cgroup_iter_orderkobj_sigval__stack_chk_failwritecntBPF_KPTR_PERCPUsrcu_n_exp_nodelayin_batchseqcount_spinlock_textra1extra2write_s64s_rootserofs_check_ondisk_layout_definitionstree_scanned__int128 unsignedverifiedcpu_countcgroup_rstat_cpuwb_lcand_byteswait_sumuprobe_xol_opspage_ordermin_align_maskevent_entrynextevtBPF_CGROUP_INET_SOCK_CREATEbooleanrcu_segcblistread_s64reported_split_lockevent_class_erofs_map_blocks_enterreturn_instancewait_countconfirm_switchnr_wakeups_affine_attemptspud_ti_ino_warnlimitpreallocmax_open_zonesring_buffer_eventrmtpnext_offsetblindedacpi_device_idctx_idutaskctx_inis_bin_visiblecompat_ioctldo_perf_trace_erofs_read_folios_countnr_wakeups_affinefutexauprobeperiod_contribnr_hangsSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcss_setfwnode_handlegfp_tZ_EROFS_COMPRESSION_LZ4type__vpp_verifyqf_fmt_iddestroylink_updatepagefs_put_daxstartedpageset_high_maxatomic_write_unit_minsleep_startmap_mem_usageaudit_namesmemalloc_noiobegintypetabBPF_PROG_TYPE_RAW_TRACEPOINT_WRITABLEi_crypt_infoDEVICE_HORI_POS_CENTERold_hashTRACE_EVENT_FL_NO_SET_FILTERaudit_ttybatch_sizenr_zoneserofs_sb_has_fragmentsjobctlsi_errnonr_leaves_on_treeattr_groupsFTRACE_OPS_CMD_ENABLE_SHARE_IPMODIFY_PEERtrace_iteratorqueue_ctx_sigchld__le16HPROBE_STABLEquota_format_type__ret_condbio_crypt_ctxcheck_periodpercpu_ref_func_t_SLAB_TYPESAFE_BY_RCUpm_message_tsplit_queueac_memsaved_dst_prog_typepprevtimeoffsetino_warnlimitexception_boundarybpf_iter_seq_infoup_writezone_wplugs_lockmnt_flags__tpstrtab_erofs_readpagesexclude_callchain_kernelac_stimemem_cgroup_reclaim_iterrange_endlast_mergememcg_nr_pages_over_highsw_reservedbpf_token__le32__tpstrtab_erofs_fill_inodebpf_iter_fini_seq_priv_tcss_freecpu_delay_totalobjcgblock_startvm_area_structnum_gpl_symsBPF_CGROUP_INET6_GETPEERNAMEis_extendednr_charged_bytes__compiletime_assert_738long long unsigned intWRITE_LIFE_MEDIUM__builtin_memcpyBPF_MAP_TYPE_CGRP_STORAGEtask_ctx_cachenext_addrz_erofs_exit_subsystemhuge_faulti_fopautasklast_task_numa_placementtotal_time_running__le64fortify_memcpy_chkip_after_callrefcntfreeze_holderpsi_groupcdevperf_eventtreemount_optunregfuncoom_group_SLAB_STORE_USERTRACE_REG_PERF_REGISTERf_fsidseqcountBPF_XDP_CPUMAPclass_idbitsetlist_lruallowed_cmdsbtf_field_typecan_swapof_device_iddisk_statsactive_listclass_migrate_is_conditionalmin_ratioclass_write_lock_is_conditionals_xattrparent_blockb_dirty_time__event_erofs_read_folio__UNIQUE_ID_x_761il_prevPTR_TO_SOCK_COMMONd_initerofs_export_opsused_mapsspan_seqlockfileattr_get__kmalloc_noprofswap_task_ctxthreaded_csets_nodeclass_groups__ret_warn_on__call_single_nodeunicode_mappending_wakeupTRACE_EVENT_FL_TRACEPOINT_BITtrace_event_raw_event_erofs_readpagespathrwsemhigh_maxaux_outputpreempt_countrecent_used_cpuruntimeold_time32_t_SLAB_CACHE_DMA32socket_pressurespinlock_checkenforce_expected_attach_type__state_sizeBPF_CGROUP_INET6_GETSOCKNAMEunsigned interofs_map_blocksclass_irqsave_is_conditionalcore_kallsymssample_stack_userdax_devscan_objectsbi_privatewb_id__real_strnlenEVENT_FILE_FL_NO_SET_FILTEREROFS_ZIP_CACHE_READAROUNDDD_CLASS_TYPE_DISJOINT_BITSevent_liststartupkeyring_index_keyiov_iterd_rcustatic_key_false___GFP_DIRECT_RECLAIM_BITuintptr_twake_entryrcu_tasks_holdoutfreezefprop_globalassoc_array_ptrbatchcacheBPF_TRACE_RAW_TPlogfcold_timespec32rcu_blocked_nodefunc_idxsubsys_datast_namegroup_nodei_mtime_secbus_dma_regionEROFS_ZIP_CACHE_READAHEADmmap_countac_majfltmce_kflags___GFP_NORETRY_BITsyscall_user_dispatchFORTIFY_FUNC_memsetscheduledbus_dma_limitubufbtimeshrinker_run_noPERF_EVENT_STATE_EXITia_gidmigrate_foliohigh_minrq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrnext_posix_timer_idmq_ops_mapcounterofs_init_sysfsstarttimefile_costreschedule_jiffieshprobe_stateerofs_nameii_sb_listquota_offmap_poke_runmap_delete_batchshm_clisterofs_show_optionsmap_delete_elemcb_headpages_skippedzone_wplugs_hash_bitspi_offsetac_flagparse_monolithicpt_regsmmap_missexpires_nextblk_opf_treport_zoneskeyring_name_list___GFP_ZERO_BITnum_trace_bprintk_fmtiter_seq_infosubsys_maskcdrom_device_infolruvec_stats_percpuchunkformatbpf_prog_statsTRACE_REG_PERF_DELwork_structtruelast_queuedreverseri_timernr_populated_threaded_childrenpipe_bufsavg_last_updatebp_offsetkmalloc_cache_typeswap_events_filegeneric_fh_to_dentryprotectedbsyncsaved_scratch_registertracepoints_ptrstrace_raw_output_erofs_map_blocks_enterblock_maxstatic_keydev_boundFAULT_FLAG_VMA_LOCKtrace_event_printftotalreserve_pageskswapd_orderuse_clockid__tracepoint_erofs_map_blocks_exitdma_range_mapvaluesKOBJ_NS_TYPE_NONEctl_table_pollmin_slab_pages_dataEROFS_KMAPkstrdupFAULT_FLAG_WRITEshow_optionswait_queue_entryexpirep_lenBPF_LINK_TYPE_UPROBE_MULTIi_uidmap_fd_sys_lookup_elemexpiryTRACE_EVENT_FL_DYNAMICperiodbmapPG_dirtyrescue_workqueuehw_perf_eventmap_allocpoweroff_noirqfsaveBPF_TRACE_UPROBE_SESSIONi_write_hintsuspended_timeread_byteszone_wplugs_worksum_sched_runtimes_writers_keySYSCTL_TABLE_TYPE_DEFAULTbpf_callback_tEVENT_FILE_FL_RECORDED_CMD_BITstart_boottimenrpagetimer_offentriesi_modecap_permitted_flags_2aslab_flags_tFS_CONTEXT_AWAITING_MOUNTBLK_UID_NAAstart_coderet_flagsvm_flagssi_codeseqcount_spinlockperf_event_groupsTRACE_EVENT_FL_EPROBEBPF_PERF_EVENTheadHPROBE_GONElast_siginfosched_rt_entityfc_log__bpf_trace_tp_map_erofs_lookupFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorsdworkprint_fmtdevice_dma_parametersdir_contextsaved_dst_attach_type__builtin_va_listiopl_emulconsumersmap_blocksEVENT_FILE_FL_SOFT_MODEpoll_queue_procratelimit_statepower_statedq_flagsrstat_cpufieldsswap_plugcapture_controlPTR_TO_MAP_VALUE_OR_NULLPG_headoffline_nodePERF_SAMPLE_BRANCH_HV_SHIFTsized_strscpyclass_device_is_conditionalnon_rcuput_superbpf_exception_cbxdp_has_fragsdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_statctx_arg_info_size__kmalloc_large_noprofftrace_regsraw_blkaddrsubop_listfolio_opsjitedopen_flagslegacy_namemap_lookup_percpu_elemtrace_eventFAULT_FLAG_INTERRUPTIBLEmap_token_fds_inodes_wbsubsysfolio_queuedurationa_rcu__event_erofs_map_blocks_exitinit_fs_contextuprobe_taskESTACK_NMIf_mappingconstant_test_bitFILTER_TRACE_FNtailcall_bypassstart_stackBPF_MAP_TYPE_STRUCT_OPSf_bavailprog_array_member_cntDL_DEV_PROBINGi_linkEVENT_FILE_FL_SOFT_DISABLED_BITWB_REASON_MAXstack_vm_areacpu_filep_logevent_erofs_map_blocks_exitd_hashBPF_SPIN_LOCKdl_server_pick_ftty_old_pgrpst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquotaphaseorc_entry__MAX_BPF_ATTACH_TYPEblk_mq_opsunused_hctx_list__bpf_trace_tp_map_erofs_fill_inodeutimemmapshrinkeralloc_dquotOpt_devicebw_time_stamperofs_fscache_unregister_cookiemappingdl_defer_armederofs_statfsmap_pollrunnable_sumcpu_scaled_run_real_totalshort unsigned inteventsexclude_guestdevice_nodemm_walkrequeue_listp_size_fieldlong long intsym_vvar_startuuid_is_nullZ_EROFS_COMPRESSION_MAX_hugetlb_cgroup_rsvdsival_ptrpercpu_sizedata_srcBPF_TASK_ITER_ALLinvalidate_folios_kobj__bpf_trace_tp_map_erofs_map_blocks_exitis_vallocerofs_sopsdrop_nsNOT_INITparam__flagsgenerationno_pm_callbackscountd_parentsched_task_groupBPF_TIMERupdate_timememcg_idpidsdotdot_nameof_nodeTRACE_EVENT_FL_UPROBErun_nodedata_sourceBPF_UPTR___GFP_UNUSED_BITs_instancesvm_rcubd_start_sectctl_node__data_offsetspage_table_locksysv_semquota_infotrace_event_raw_event_erofs_map_blocks_enterbtf_trace_erofs_read_folioquota_enableprint_fmt_erofs_read_folio__kernel_timer_twork_listBPF_MAP_TYPE_PROG_ARRAYPTR_TO_PACKETdomain_tagmax_integrity_segmentscmaxrssit_real_incrkill_anon_supertrace_raw_output_erofs_readpagesprobestubextable_lenlast_arrival_watermarkswap_rwshrinker_errreservemap_extrasplit_queue_lockevents_local_filecpu_pmu_contextsrcu_gp_seq_needed_expPG_privateDEVICE_HORI_POS_RIGHTdirect_IOia_mtimenr_thpslegacy_cftypessysv_shmfopssuppress_bind_attrsinsnlen__page_1__page_2sample_typei_mutex_keykey_restrictionstatquota_writedomainget_linkxattr_prefixeserofs_put_metabufmax_depthctl_table_argpriv_stack_ptrPG_referenced___GFP_NOFAIL_BITblkcg_nodeforksa_flagscancelled_write_bytesnbp_rl_startpredictedtask_worksmm_cidatomic_write_hw_maxdfl_cgrp_ddebug_infoaddrsshrinker_info_unitstats_locknum_kpit_funcMEMORY_DEVICE_PRIVATE__bd_flagssuper_blockTRACE_EVENT_FL_UPROBE_BITbi_bvec_donemap_get_unmapped_areabus_typeerofs_inodeBPF_MAP_TYPE_PERCPU_CGROUP_STORAGE_DEPRECATEDassoc_arrayzoneactorBPF_CGROUP_ITER_DESCENDANTS_PREfls64bpf_offload_devkobj_ns_typemax_descendantssched_shared_tagslong int__UNIQUE_ID_rcu722__UNIQUE_ID_rcu725__UNIQUE_ID_rcu728parent_partrefcore_nodebdi_nodexattr_blkaddrtarget_btf_idmem_dqinfodevnodesaved_sigmaskperf_trace_erofs_destroy_inodeac_uidBLK_UID_EUI64__UNIQUE_ID_rcu734__UNIQUE_ID_rcu737MEMORY_DEVICE_PCI_P2PDMAac_nicedq_offpinsblkcg_mutexis_visiblecgrp_linksconf1disk_nameevent_class_erofs_fill_inodeuuid_t__kernel_clockid_twritabledqb_bsoftlimit__UNIQUE_ID_rcu740vfork_donetask_cputime_atomicki_waitqra_pagesh_fragmentoffgroupEVENT_FILE_FL_TRIGGER_MODE_BITmmap_compat_legacy_basesysfs_dir_lockcss_idrignored_posix_timerslockedsival_intia_filecancel_attachio_pages__bpf_trace_erofs_fill_inoderequest_pendingbpf_trace_run1bpf_trace_run2bpf_trace_run3bpf_trace_run4dl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsclass_read_lock_irqsave_is_conditionalbio_end_io_td_spc_hardlimitrecordcpu_id_startfscache_cookiePIDTYPE_SIDavg_triggersctl_dirrobust_list_headunsigned charwake_qrange_startrethooksgroup_capsnuma_scan_periodelem_countnegatedwakeup_pathresult_maskFORTIFY_FUNC_memscanei_funcs__func__BPF_NETFILTERtablespipe_inode_inforaw_spinlockmemcg_cgwb_frnblkio_delay_totalZ_EROFS_COMPRESSION_LZMAinstrument_atomic_readktypebpf_attrBPF_PROG_TYPE_CGROUP_SYSCTLsubmit_biomigration_disabled__traceiter_erofs_fill_inode__dataEVENT_FILE_FL_WAS_ENABLEDext_mutexmemcmpRPM_REQ_SUSPEND_SLAB_FLAGS_LAST_BITpgprot_ttracepoint_ptr_tfor_reclaimphysical_locationchildren_low_usagepacked_inodenum_vfPIDTYPE_MAXevent_erofs_lookupbi_sizemg_dst_csetthrashing_countwatchers__kmem_cache_createstopwait_maxmax_distance_pagesclass_write_lock_irqsave_is_conditionalioveca_flagsm_flagsiomapd_dnamenr_migrations_coldbtf_value_type_idmnt_idmap__probestub_erofs_map_blocks_enterPG_partially_mappederofs_iget___GFP_FS_BITseeksoverflow_handler_contextquotactl_opski_ioprioraw_initconfig_baseiomap_itersched_remote_wakeupmemcpysock_filterBPF_LIRC_MODE2tracing_graph_pauseread_itersuspend_latefront_padPG_uptodatepmu_ctx_listbi_integritycommit_txnm_deviceidexitio_uringchild_ns_typeorderslave_bdevsfile_namecommit_dqblkclass_local_lock_irqsave_is_conditionalmark_dirtykernfs_opsnr_dying_descendantsoom_reaper_timermispredmodulepending_disablebtf_trace_erofs_map_blocks_enterwb_bytesbd_securitynodeinfoPG_idlequeue_lockd_typef_pathstatic_call_siteself64_symPERF_SAMPLE_BRANCH_HW_INDEX_SHIFTunlinkcpumask_var_ttime64_tdrivers_diri_gidtype_idbr_stackFORTIFY_FUNC_strnlenrq_qostrace_event_raw_erofs_read_foliomark_deadicq_hintrmdirdq_dqbmemory_failureblkcg_gqbtf_field_kptrmax_hw_sectorsselectors_mtdmod_kallsymss_typefield_maskjits_use_priv_stackprog_bind_mapio_minfini_seq_privateremount_fsbd_holdernext_idtask_delay_infopi_sescopejit_dataperf_trace_erofs_read_folioexclude_hvrelative_fdperf_regsin_useforwardrq_countMIGRATE_SYNC_LIGHTerrseq_tkstatfslruvec_statsreclaimedmems_allowed_seqmax_user_discard_sectorsinsnsibug_listBPF_CGROUP_INET4_CONNECTmax_nr_cidsb_sizemod_arch_specifictracer__bpf_trace_erofs_lookupsplit_queue_lensharebpf_net_contextsched_cb_entryprobe_addrno_cgroup_ownerfolio_test_uptodateftrace_timestampbi_ioprioBPF_LINK_TYPE_SOCKMAPd_ino_warnsESTACK_VC2stack_depthkernfs_elem_attrBPF_PROG_TYPE_SK_SKBi_ctime_nsecrelative_idf_spareprint_fmt_erofs_lookupi_private_listbinfmtftrace_sleeptimedata_size_inBPF_CGROUP_ITER_ORDER_UNSPECi_statebv_pagepcpu_cidsched_migratedZONE_DMA32childcgroup_tasksetdup_xol_addrBPF_PROG_TYPE_SOCKET_FILTERrcu_node_entryBPF_MAP_TYPE_BLOOM_FILTERcgroup_bpffile_system_typeorig_ret_vaddrtrace_event_fields_erofs_readpagesbtf_log_levelfp_offsetmmu_notifier_subscriptionsswap_iocbBPF_RB_ROOTdefault_groups__sifieldsb_ionr_watchesfind_special_pageDL_DEV_DRIVER_BOUNDadj_offcurr_ret_depth__fillerFILTER_STACKTRACEdestroy_dquotsigtrap__task_fpstatefilldir_tget_reserved_spacefeature_compatioprioKMALLOC_NORMALunreliablecreateBPF_PROG_TYPE_SCHED_ACTbpf_raw_tp_linkdirtied_time_whenz_logical_clusterbitsstart_scan_seqperf_rdpmc_allowedmin_seqsym_vdso32_rt_sigreturn_landing_padspinlock_terofs_fc_reconfigurebd_openersdq_inuseerofs_xattr_prefixes_cleanupstr__erofs__trace_system_nameofflinedev_pm_infomremaptime_nsin_memstallva_formatmem_hopsperf_callchain_entrynode_size_lockcss_extra_stat_showkptrpoweroff_latei_nlinkwakeupcb_list___GFP_IO_BITcpu_iditer_info_lenpushable_taskstty_audit_buffilp_openmaxlensockmapkernel_cap_tbpf_funcpoke_tabmems_alloweds_inode_lrucached_rqse_cset_nodesb_rdonlykf_rootmmap_compat_baseretvalpreparenr_threaded_childrenclock_op_might_sleepf_sb_errneed_mbd_namecheck_flagsi_sequencebp_addrerofs_dax_param_enumsrt_priorityOpt_aclTRACE_EVENT_FL_IGNORE_ENABLE_BITkretprobe_instancescrypto_profiletoken_createiov_basecpus_ptraux_actionq_lockdep_mapb_more_ioload__kmem_cache_create_argsfuncscpu_bitmapf_bfreeatomic_write_lensaved_tfxa_headdetachprog_ifindexmm_listget_statetracepoint_funcd_seqnuma_scan_offsetcpus_allowed_lock_statusmapped_blkaddrlocklinux_binfmttp_eventblkg_listnum_symtabperf_event_attrexec_update_lockfscrypt_inode_infosplice_readent_size_SLAB_RECLAIM_ACCOUNTsleepable_refcnt__va_list_tagneed_qsbd_diskuid_gid_extentnumberszone_wplugs_wqWRITE_LIFE_SHORTsigpendingpi_entryinode_init_onceBPF_MAP_TYPE_ARENAs_inodesdirtied_whenmap_direct_value_metaMIGRATE_ASYNCBPF_MAP_TYPE_PERCPU_CGROUP_STORAGEnext_scanBPF_CGROUP_UDP6_SENDMSGgsindexwrite_bandwidthnr_task_datacompletewatch_listBPF_CGROUP_UDP4_RECVMSGd_sibf_filesmodule_attributeFS_CONTEXT_CREATINGtrace_raw_output_erofs_lookupnotrace_hashsuper_set_uuidPERF_EVENT_STATE_ERRORneed_tsin_dpm_listm_latrace_event_data_offsets_erofs_readpagesPERF_SAMPLE_BRANCH_PRIV_SAVE_SHIFTmmap2workdyn_sizemultiprocessquiesce_depthfbatchclass_task_lock_is_conditionalBPF_CGROUP_INET_INGRESStask_groupf_pos_lockperiod_timerBPF_FLOW_DISSECTORcommit_blocksexpected_revisionerofs_read_metabufbio_pooltimeout_workBPF_PROG_TYPE_LWT_XMITwrite_endsrcu_barrier_completionmmap_mutexBPF_MAP_TYPE_STACK_TRACEpacctZ_EROFS_COMPRESSION_DEFLATEblk_mq_tag_setcurr_targetBPF_PROG_TYPE_NETFILTERvm_page_protbalanced_dirty_ratelimitbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatPTR_TO_PACKET_ENDaux_pauseperf_event_contextatomic64_tnoinstr_text_startctx_size_outrhlist_headac_btime64HRTIMER_RESTARTuuid_to_fsids_fscacheac_gidtrace_event_raw_event_erofs_lookupnotify_timermem_lvlcorememBPF_MAP_TYPE_USER_RINGBUF__trace_trigger_soft_disabledstack_canarym_pauser_keyring_registermax_write_zeroes_sectors_utimeevent_idx__fortify_size_flags_1_flags_2taskstatsproactive_compact_triggeraux_sample_sizeposix_acl__le64_to_cpupi_dio_countftrace_ops_hasharch_rwlock_tdriversym_timens_pageprog_token_fdsysctlsoffsetrtpoll_taskN_EXCEPTION_STACKSpost_attachdev_iommuWB_REASON_SYNCnr_file_filtersmap_typeclass_rwsem_read_intr_is_conditionalcompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_userserofs_fh_to_dentryaddr_filtersbacking_dev_infoi_mappingTRACE_REG_PERF_UNREGISTERdiscard_alignmentshow_statsnr_populated_csets_ress_vfs_rename_keyetypei_bytes___GFP_WRITE_BITnormal_prioftrace_ops_func_tblkio_countBPF_MAP_TYPE_INODE_STORAGEsrcu_nodelast_mm_ciddelayedfs_value_is_bloberofs_context_opstrace_event_data_offsets_erofs_destroy_inodeper_cpu_nodestatsvaddris_softgrab_current_nsidr_allocclass_namesnr_taskslock_class_keyfile_inodeperf_copy_fpriv_stack_requestedsum_exec_runtimememory_failure_statslink_fdsetupexclusive_cntdev_pin_infodo_trace_event_raw_event_erofs_destroy_inodepoll_table_structmce_whole_pageia_modercu_tasks_holdout_listevent_callsched_rt_mutextrace_event_raw_erofs_lookups_pinsswap_peaksnon_seqbpf_prog_arrayattach_func_protopresent_pagesperf_trace_erofs_lookuprb_entryrenamecontiguousbpf_link_infothrashing_delay_totalmajorktime_ttrace_event_regidr_init_basePRJQUOTAlink_idzswap_lruvec_stateBPF_CGROUP_INET_SOCK_RELEASEm_algorithmformatkprobe_blacklistjump_entriesdio_offset_aligndma_masksa_restorerdatalentarget_name_lenmkdirnextrelax_counttrace_event_bufferrestore_earlyPIDTYPE_TGIDilencpu_run_virtual_totalBPF_LINK_TYPE_KPROBE_MULTITRACE_REG_UNREGISTERmax_active_zonesdevice_physical_location_horizontal_position_SLAB_CACHE_DMAattach_flagstrace_event_get_offsets_erofs_fill_inodekfunc_btf_tabmax_pclusterblkskmem_cache_destroyerofs_fscache_register_cookiekobj_uevent_env___GFP_MOVABLE_BITkprobes_text_starterofs_sb_infopid_typefown_structi_default_aclBPF_PROG_TYPE_LIRC_MODE2erofs_nfs_get_inodeflatdevfregs_stateBPF_PROG_TYPE_LSMzonerefFILTER_PTR_STRINGFORTIFY_FUNC_strcpypending__regsBPF_MAP_TYPE_PERCPU_ARRAYbd_nr_sectors__real_kmemdupnr_eventskmemcg_idkstatanon_vma_nameexclude_userdq_hashfa_rcu__ioverofs_kmap_typegp_stategrphierofs_breadntab__traceiter_erofs_map_blocks_exitiommu_mm_datamap_for_each_callbacknr_disk_swapinszone_wplugs_err_listma_flagsarch_uprobebio_issueDL_DEV_UNBINDINGKMALLOC_RANDOM_ENDtime_deltaTRACE_EVENT_FL_DYNAMIC_BITrefcountload_timemmap_lockuprobe_multitrace_event_data_offsets_erofs_read_foliozonelistsrcu_reader_flavorbtf_fdtimerqueue_nodereal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_allowedrt_mutex_waitermem_cgroup_per_nodekcompactd_pad_page_pooldq_dqb_lockctorf_flagsblk_qc_tinner_map_fdsuper_set_sysfs_name_idflush_requiredWB_REASON_FS_FREE_SPACE__event_erofs_map_blocks_entermemcg_vmstatskeyring_sembtf_trace_erofs_readpagesattributesblk_queue_statsgrplokgid_ttrace_event_buffer_commitkey_userdirblkbitsreadlinkoffline_disabledd_comparetime_ns_for_childreni_wb_frn_winnerqspinlockperiod_left__compiletime_assert_451sighand_structstart_brktrace_event_get_offsets_erofs_destroy_inode__str__map_mmapfs_errdio_completelocked_pendinglockdep_keyPERF_EVENT_STATE_DEADextentfile_offsets_idstate_maskcore_statealignsym_int80_landing_padngroupssp_offset__sigrestore_tRPM_SUSPENDEDvolnamemutexattrsBPF_TCX_EGRESSsrcu_n_lock_retriesfsbaseinactivesrcu_barrier_mutexdirty_limit_keyswregs_stateerofs_free_inode__kernel_timespecchildren_min_usagepglist_datad_lruwaitqmax_pkt_offsetd_fieldmaskcountersfaults_disabled_mappingEVENT_FILE_FL_WAS_ENABLED_BITBPF_LINK_TYPE_XDPnameidataarg_sizefailedblkszbitspoweroffblkaddrbpf_prog_opsaborterofs_unregister_sysfsbpf_verifier_envminorsnonresident_agedown_readaux_flagselemsizefputrlim_curFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagevent_erofs_map_blocks_enterdebugfs_entrywaitkmemdup_noprofperf_cgroupmax_sync_decompress_pagesst_shndxreservedi_wb_frn_historyprocess_keyringset_dqblkPERF_SAMPLE_BRANCH_TYPE_SAVE_SHIFTrestart_blocks_opbi_end_iokobjectposix_cputimer_basenr_memcgsleveluser_definedcow_page__warn_printknanosleepchunkbitsfalsetemppi_state_listvolume_nametv_secac_exitcodeBPF_KPTRsuid__UNIQUE_ID_license768prog_typeKMALLOC_RANDOM_STARTerofs_device_infokey_typedismissi_hashmm_cid_next_scanfreeze_noirqoublockia_atimetrace_event_fields_erofs_destroy_inode_timerfifochild_reapervm_private_dataperf_addr_filters_headextra_devicesrtpoll_scheduledWB_SYNC_NONEBPF_PROG_TYPE_KPROBEorig_progdq_freeroot__tracepoint_erofs_map_blocks_enterpolicycpu_basePG_activeBPF_PROG_TYPE_SYSCALLinline_datacap_bsetnr_to_writeprev_countnr_itemsanon_costseq_startbp_regbvec_poolkern_versionrb_root_cachedWB_REASON_FOREIGN_FLUSHi_blkbitswritervm_pgoffvirtmemdevice_id_mask_refcounttarget_fdcsum_typebin_attributemath_emu_infopushable_dl_taskswrite_u64testWB_SYNC_ALLmg_nodesched_infogroup_infotailsPERF_EVENT_STATE_ACTIVEifindexz_erofs_parse_cfgsdqi_fmt_idPTR_TO_ARENAmemcg_csssoftirq_next_timerrevisiontrace_event_raw_event_erofs_map_blocks_exitis_child_subreaperexit_codefile_lock_contexttracingnr_pageswriteback_indexread_u64TRACE_EVENT_FL_KPROBE_BITfiemap_extent_infofilemempool_free_tPTR_TO_TCP_SOCK_OR_NULLpmu_ctxfree_foliort_spc_warnlimitatomic_write_hw_unit_minpin_countcompact_countenable_on_execEVENT_FILE_FL_RECORDED_TGIDperf_mem_data_src__SCK__tp_func_erofs_destroy_inodeislotbitstimer__empty_rangessig_datadev_namebpf_mapi387erofs_nid_tBPF_PROG_TYPE_EXTBPF_PROG_TYPE_FLOW_DISSECTORnotified_atwb_errh_clusterbitskswapdwrite_dquotrefcount_offpercpu_pvec_drainedf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachestorebi_bdevPERF_COUNT_SW_CGROUP_SWITCHESerofs_superblock_csum_verifyst_infoTRACE_EVENT_FL_IGNORE_ENABLEdescsdqi_max_ino_limitllseeknet_nsRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleseq_writeevent_capsget_projidfunc_info_auxtracePERF_SAMPLE_BRANCH_NO_FLAGS_SHIFTpart0cnvcswcallskqidmem_cgroupPTR_TO_BUFprint_fmt_erofs_map_blocks_enterfree_inodetrace_event_fields_erofs_map_blocks_enternext_keysiglockwait_queue_func_tperf_recursionnr_wakeups_remoteaux_output_matchd_spacei_ctime_secdebugfs_idreal_func_cnttrace_event_type_funcs_erofs_destroy_inodenext_timer_typeBPF_TASK_ITER_TGIDTT_NATIVEused_map_cnt__empty_insnshlist_bl_nodeoldbitnum_descserofs_fs_parameters_head_1_head_2clockidkprobe__read_overflow2_fieldFREEZE_MAY_NESTsym_hvclock_pageremap_file_rangemmap_legacy_baseaddr_filter_rangespfmemalloc_wait_batch_countz_idata_sizeend_dataxa_lockfutex_exit_mutexPG_youngiommu_grouplast_periodmap_peek_elemFS_CONTEXT_AWAITING_RECONFoncpunr_isolate_pageblockmempool_alloc_talloc_inodePG_pinnedbtf_field_graph_rootdirty_folionode_zonesfscache_volumefscrypt_keyringexception_stack_orderingis_hardasync_sizetrap_nrlocal_tperf_cpu_pmu_contextfasync_structf_iocb_flagsctx_size_indataxattr_prefix_countkcompactd_waitregex_locktotal_vmmem_remote_entire_mapcountiteratorpool_dataqf_opsforce_atomic_pad1_real_credblkcnt_td_rt_spaceprog_idssetup_auxBPF_MAP_TYPE_HASHsigned charmap_local_storage_chargexattr_name_filterhas_child_subreapermountprimarydevice_blocks_pad2_event_limitreasonblk_flush_queuesched_entitydev_links_infos_uuid_lenpcpu___GFP_RETRY_MAYFAIL_BITdqi_privfmode_tsweventactivatefxregs_state_lowerpaddingDEVICE_REMOVABLEpid_ns_for_childrentimestimer_rand_stateEROFS_SYNC_DECOMPRESS_FORCE_OFFlru_gen_memcgFS_CONTEXT_FOR_MOUNTllist_nodebit_nrpending_killbpf_run_ctxregs_userbio_slabstate_add_uevent_sentenv_startmodule_notes_attrsio_cqlower_firstnr_addr_filtersrangebvecprog_arrayacct_vm_mem1on_cpumg_src_preload_nodestringnuma_preferred_niderofs_domainerofs_sb_has_device_tablefree_diskPTR_TO_MAP_KEYlast_bdp_sleepvmem_altmapPERF_COUNT_SW_TASK_CLOCKfreq_time_stamptrace_event_get_offsets_erofs_lookupwait_startextra_regembeddedelevatorspinlockmin_unmapped_pagessrcu_barrier_seqi_acl_nr_pagesnofaultbpf_map_typeoldapiia_rangesq_size_fielduseroffsetis_rel__ilog2_u32pteval_tlog_levelblk_mq_tagsDEVICE_PANEL_LEFTorc_unwind_ipchild_listrel_deadlinekobj_typePTR_TO_MAP_VALUEsb_writersdma_cleanupdriver_dataphys_addr_tdma_iommufs_context_purposeirq_saferescue_lockdefault_timer_slack_nsxregs_states_state_deferred_listcurr_nrset_child_tidiattracpi_match_tablenfdsrlimitBPF_TRACE_FEXITmap_update_elemlast_subtree_bstatnr_frozen_tasksexclude_hostitererofs_off_trelease_agent_pathidle_notificationmodule_statedo_trace_event_raw_event_erofs_fill_inodertpoll_triggersPTR_TO_BTF_IDwait_lockf_pipegetgeocset_linkswrite_iterD_REAL_DATAacct_timexpdclock_mutexBPF_LINK_TYPE_ITERnr_failed_migrations_runningfscacheuserfaultfd_ctxevent_flagsthread_structsibling_listbuf_lenmm_context_tbd_stamp__tpstrtab_erofs_read_foliotrace_event_fields_erofs_map_blocks_exitcpu_entrydio_mem_aligncstimeatomic_long_trpm_requestpositionio_comp_batchline_info_cntcftsf_credtrace_eventschecksumd_iputlast_bstatnew_prog_fdnr_wakeups_syncbranch_regstackmap_release_urefBPF_REFCOUNTblockedvm_numa_eventdst_trampolinefile_bdevbypass_addrmce_countweighttotal__entry_sizeblk_plugtrc_reader_nestingfpstatetag_setis_roxaux_eventmanaged_pslotsprevseqcount_raw_spinlockprint_fmt_erofs_readpagesnum_orcskswapd_failuresFORTIFY_FUNC_kmemdupbuflenbpf_kfunc_desc_taberofs_init_shrinkerzip_errdeadcomm_execBPF_CGROUP_DEVICEWRITE_LIFE_LONGESTACK_DBexpiry_activemtd_infois_confidentialactive_timei_dentryfixupsBPF_LINK_TYPE_STRUCT_OPSvm_endvm_structproc_handlermemcgFTRACE_OPS_CMD_DISABLE_SHARE_IPMODIFY_PEERfsyncsgidcompat_robust_listnuma_workprio_SLAB_NOLEAKTRACEprivvaluercu_workBPF_CGROUP_INET4_GETPEERNAMEcurrent_stack_pointerac_minfltbpf_prog_aux_hugetlb_cgroupPERF_COUNT_SW_BPF_OUTPUTset_policythreadftrace_callsitesinfix_lenmmlistBPF_CGROUP_SETSOCKOPT_SLAB_PANICforceidle_sumpending_workusedpage_typeclass_spinlock_is_conditionalusermynodeseq_stop__MAX_BPF_PROG_TYPEblk_traceactionPERF_COUNT_SW_MAXlink_detachpi_waitersdom_cgrpuprobe_pathrheadfile_name_offbstatfailcntatomic_tpcp_listerofs_xattr_prefix_itemqueue_flagsBPF_PROG_TYPE_UNSPECrb_rootfreepages_countutf8data_table__UNIQUE_ID_y_762BPF_PROG_TYPE_SK_MSGexe_file__probestub_erofs_readpagesuid_treconfigureelementsd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_dataEVENT_FILE_FL_TRIGGER_COND_BITdef_flagsprogerofs_xattr_handlersraw_locksrcu_structthis_cpu_offinner_map_metais_guestdo_perf_trace_erofs_lookupaux_configrtpoll_wakeupsplice_eofanon_vma_chaini_mtime_nsecseq_opsrseq_event_maskem_pdi_fsnotify_maskshared_pending__int128__mce_reservedwriteback_controlmax_write_lenmm_structevent_erofs_destroy_inode__restorefn_tcrc32ctrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEdo_trace_event_raw_event_erofs_lookupbuild_idz_advises_export_optrace_fileCONST_PTR_TO_MAPBPF_CGROUP_INET4_GETSOCKNAMETRACE_REG_PERF_OPEN_SLAB_NO_MERGElen_descseg_boundary_maskanon_namesched_dl_entitypp_ref_countactivest_other___GFP_THISNODE_BITlinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterszone_wplugs_lockAS_UNEVICTABLEd_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalbdev_dma_alignmentnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmounterofs_generic_iopsextable_basenoinstr_text_sizeattributescached_rqsset_child_tidblk_unique_id_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_statemin_nrxattr_prefixestick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugtotal_blocksdomain_idneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numbererofs_read_inoded_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockederr_outVTIME_GUESTregsslice_maxlast_switch_countz_idata_sizeqsize_ttime_ns_for_childrenfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolvfs_inodebd_mappingsym_vvar_pagemodule_sect_attrsreturn_instancearch_test_bitsoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intgendiskxattr_filter_reservedspc_timelimits_instancesdescseqcountoom_score_adjoldbitd_seqbi_crypt_contextia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sum__compiletime_assert_127freeze_ucountcpuhp_deads_remove_counterofs_is_fscache_modesyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tdevscputime_atomicrestoredelayed_callbi_iter__compiletime_assert_134max_nr_cid__compiletime_assert_137erofs_getattr_statusmark_deadd_sibdma_opsbin_attributemin_align_maskpercpu_countererofs_get_acldev_groupsnuma_pages_migratedlimits_lockdl_dev_statemapping_flagsgsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdax_devicercu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollxattr_name_filterresvnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAsyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_panelctl_tableuid_tflush_requiredino_tsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritevolume_nametypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionali_blocksizeFORTIFY_FUNC_strlcatmeta_blkaddrdma_poolsifmt_addr_lsbctl_table_polli_generation_sigpollmxcsrdevtd_rt_spc_hardlimitbuild_timebi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qoserofs_xattr_prefix_itembi_sectormap_typeclass_preempt_notrace_destructorf_oppids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationserofs_fiemapclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbarch_static_branchsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entry___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimeerofs_fast_symlink_iopsnestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanunregisteringf_raquota_writeAS_FOLIO_ORDER_MAXsrcu_barrier_cpu_cntiopl_warnrmdirsockbi_write_hinthash_lenget_policyHRTIMER_RESTART__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedquotdl_runtime__ret_do_oncenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdxattr_prefix_countfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueextra1ptrace_messageAS_STABLE_WRITESnum_trace_events_sys_privatealignment_offsetopen_mutexinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_nodeerofs_inode_versionrequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherskmalloc_cachescompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKclass_rcu_tasks_trace_is_conditionalactive_uprobebit_nrshow_optionsdiskbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodecurr_nrerofs_off_tsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printkAS_FOLIO_ORDER_MINvm_operations_structcnivcswbin_attrs_newerofs_bufbio_alloc_cachebi_bdev__builtin_memcpyiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrennregdirty_foliois_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infopermissionserror_remove_folioold_time32_tcore_kallsymsmemcpysrcu_parentdetachedclock_op_might_sleepenvp_idxcgroup_namespace_head_1_head_2bd_size_lockbackrequest_maskstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setrcuwaitbio_listwrite_dquotblkaddrclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsprimarydevice_blocksonlineruntime_resumedup_xol_workqueue___GFP_WRITE_BITMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdevice_id_maskdio_offset_aligndelay_workoublockrecent_cidbdev_get_queuekernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexhprobecrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expinterval_experofs_squash_inoaddress_space_operationsspinlock_t__task_fpstate__ret_oncewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeerofs_iget5_eqerofs_is_fileio_modeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalseremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagcoredump_datatasks_pidaddress_spacemm_context_t__q_sizeuid_gid_extent__call_single_nodestartupchunkbitsof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatorpanelclass_id__read_overflow2_fielderofs_kmap_typeinactive_timer_pkeyfilenames_export_opfront_pad__mptrstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errshm_clistis_child_subreapercall_depthunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidrseq_sigdev_pm_domainlimit0limit1nr_zonesmigrate_modebio_poolpoweroff_lateftrace_callsitesd_hashis_confidentialerofs_inode_i_udl_bwkobjfsyncmtd_infoi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeinode_nohighmemblk_queue_statspushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapalloc_dquotpm_messagemay_split__q_size_fieldmem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrstack_vmusage_count_folio_nr_pagesioctlshowunsigned charumount_beginvdso_test_bitmmap_legacy_basepipe_inode_infosecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opspoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITs_vfs_rename_mutexsuspend_latewakeupcg_listsrcu_barrier_completiondriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaitersAS_EXITINGsessionidbi_flags_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1dax_devllistdebugfs_entryinode_set_ctimeelemnr_retriesflatdevsigval_talimitundo_listKMALLOC_RANDOM_STARTmissedreport_zonesparent_could_setfcapquota_readst_shndxerofs_read_metabuffrees_fscachei_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typegeneric_ro_fopsmtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tpathAS_NO_WRITEBACK_TAGSst_sizermtpwait_sumnum_tracepointsupidi_uid_writeexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkiget5_lockedclock_was_set_seqerofs_igetDD_CLASS_TYPE_LEVEL_NUMcid_workkeyring_semsrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entryfeature_compatstart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollpagesizedisk_names_blocksizevm_pgoffauprobepto_val__numa_workupdate_timeptrace_dr7_call_addrrescue_lockmax_segmentsloginuidcheckexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkg__lstatearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvinosmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_namemm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalp_size_fieldrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flagsa_rcu_pincounttreerq_timeouterofs_symlink_iopsDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_head__UNIQUE_ID_y_561tgidmax_pclusterblkswrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockbd_holderend_codeqspinlock__kmalloc_large_noproflru_geninsnfilldir_t__must_check_overflowdl_non_contending__tracepoint_erofs_fill_inodeerofs_inode_chunk_infodir_contexterofs_dev_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqkmemdup_nulset_nlinklong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsgroupseq_showctl_nodeswait_queue_headcow_pageinode_set_atime_to_tsinumsectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinki_private_listhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgnoderesetvm_lockno_cgroup_migrationbuild_time_nsecnextevts_writers_key__countxcomp_bvcma_areastatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatipc_namespaceexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentfirst_minorcgroup_nsia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symbolsubsys_databi_statustv_secma_lockpid_ttask_listftrace_sleeptimebdev_logical_block_sizerun_nodeblock_device_operationsma_rooturing_cmdnr_failed_migrations_affineIS_ERRuser_cpus_ptrpi_top_taskactoruprobenotifier_subscriptionss_readonly_remounthlist_bl_nodest_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthinode_get_ctimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsEROFS_INODE_CHUNK_BASED___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offxattr_prefix_startdq_inusecachedqi_flagskeyring_name_listkfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlencodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listsched_rt_mutexlocked_pendingpao_tmp__nr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listbi_blkgnr_hw_queuesktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidtablesbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmfortify_memcpy_chkdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTART__cpu_online_maskbd_disksp_offseterofs_fileio_aopssrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_fileipc_nserofs_mount_optspcp_listpid_linkss_sysfs_nameq_size_fieldrefcountvaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbd_holder_dirkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersproc_ns_operationsi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditional__ret_condshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infouser_keyring_registermempolicypm_message_te_permioveci_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentpayloadtrace_erofs_fill_inodeac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxatomic_openbio_end_io_tstart_prevent_timei_mtimecondreadahead_controlblk_trace__kernel_gid32_tit_func_ptrkernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_devz_erofs_aopsread_newsignalfd_wqhmmappto_tmp__modnameasync_put_workmknodfsnotify_sb_info__sigrestore_tbi_idx__kernel_loff_tdetachget_unmapped_areadev_pagemaproot_nidwritepagessched_statisticsheadsync_decompressminorsi_user_ns__state_permuprobe_taskwriteback_controluclampsuper_operationsbi_cookiesplice_eofutil_avg___GFP_DMA_BITtaskrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriocap_inheritablegp_waitlookupcostdev_pm_infopacked_nidblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsFORTIFY_FUNC_memscannsecerofs_fill_symlinkmake_kuidvm_private_dataerofs_iget5_setio_bitmap__bi_remaininguprobe_task_statetimerkobj_typediskseqi_pagesatomic_write_hw_boundaryz_advisehlist_bl_headino_warnlimitarch_uprobe_taskfasynci_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecfdevsysctlsmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nrdatalayoutbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_free_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetis_suspendede_taguts_namespacetimeout_workburstinode_get_ctime_nsecetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatecap_bsetopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultmax_sync_decompress_pagescounterskasan_check_readname_linkblk_mq_tagscmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_typepao_ID__policysharedxattr_shared_xattrswait_queue_entrydismissd_real_typelookahead_bandseq_startrq_qos_mutexraw_blkaddrzone_wplugs_wqraw_lockd_dnameget_dqblkerofs_put_metabufmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamelogical_block_sizeAS_RELEASE_ALWAYSrun_delaytailsblk_flags_tlinenoz_algorithmtypebi_io_vecbase_pfnstatget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimez_fragmentoffstart_codeis_hardfsbaseblk_status_tclock_listattrscpumask_tgid_mapswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldis_seenpi_offsetdiscard_granularityfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_tnuma_faults_localityhas_child_subreaperi_acl___GFP_ZERO_BITwrite_newlist_lockpm_domaininode_set_ctime_to_tscpu_bitmapcopieducount_maxstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statesoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagsswp_entry_tqueue_dma_alignmentbi_inline_vecs_mapcountdomain_taghang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyevent__SCK__tp_func_erofs_fill_inodeset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacAS_INACCESSIBLEnr_to_scanDEVICE_PANEL_UNKNOWNfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtpi_bytesdma_cleanupmaple_treeKMALLOC_DMAdentrylast_mergecpu_itimerfscache_cookiepercpuget_unique_idrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupqueue_logical_block_sizenr_threads__i_nlinkerofs_fscache_access_aopspushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesrangeerofs_nid_tfutex_exit_mutexpm_onlykernfs_iattrstrc_blkd_noded_spacegraveyard_linkblkszbitsxol_vaddrsplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagserofs_inode_compactnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevblk_integrity_checksumself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsreq_listxa_flagsfreezebin_sizeclosegrphi___GFP_RETRY_MAYFAIL_BITerofs_domaini_formatnr_sectorsd_spc_timerjump_entriesctl_dirasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqbuidhash_nodesaved_tfi_reserved2Elf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkdefault_setpercpu_refns_commonhorizontal_positionmanaged_cacherlimit_maxpref_node_forkwait_queue__int128dqi_privchunkformatrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxresult_maskerofs_inode_datalayoutstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_file___GFP_COMP_BITidr_basei_blockss_state__compiletime_assert_550user_sizedev_pm_opscdrom_device_infoscheduledfsidFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkkmalloc_typeqstrma_flagsnr_ia_rangesmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptscache_strategy__le16alt_lencinblockextableexit__compiletime_assert_562kernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_count__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headpart0f_wb_errm_pofsinit_special_inodercharfutex_pi_statekstat__kernel_uid32_t__le32q_lock_cls_keyDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockepoll_watchesprealloc_ptedqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidposix_acl_entrya_refcountst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned int__le64i_mutex_dir_keyq_nodespc_warnlimitctl_table_sizeextents_encodinggpl_crcsorc_entrykeysorig_ptedqb_curinodesload__s8__UNIQUE_ID_guard636invalidate_lock_keydma_maskprealloc_mutexnanosleep__already_donecompressedsrcu_gp_seq_neededpscr_ret__dq_dqb_lock__kernel_ulong_tvolnameio_minerofs_inodedl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignpage_get_linkbtimeprefixextra2__u8is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onedevice_physical_location_horizontal_positionseq_stopkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidctl_table_args_blocksize_bitsnuma_scan_periodutil_summigration_disablediter_typeclass_device_is_conditionalshrinker_idbio_setrootprojid_mapoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedEROFS_KMAPdiscard_alignmentraw_spinlock_tkey_taggetgeofs_flagsworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstksrcu_ssppage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONExattr_shared_countactive_timei_sequencepool_datadisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeerofs_file_fopsBLK_INTEGRITY_CSUM_CRC64f_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumerofs_aopsf_path__u64journal_infoFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startunused_hctx_lists_flagsfaultmigration_pendingalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkintegritydq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusep_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releaseerofs_dir_fopsalloc_locks_dquotmax_hw_sectorsfolioqprev_posseqcount_spinlockexpire_countuid_maps_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_idrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_padmapping_set_large_foliostailia_atimeinfixtlb_ubcbi_issuequota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometrysuppress_bind_attrsRPM_RESUMINGd_weak_revalidategsbases_quota_types__preempt_count_addf_llistmq_freeze_locki_xattr_icountdax_part_off__UNIQUE_ID_x_545__UNIQUE_ID_x_548i_nlinkbranchwrite_begingroupsEROFS_INODE_COMPRESSED_FULLpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_mask__UNIQUE_ID_x_551__UNIQUE_ID_x_554BLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_terofs_xattr_ibody_sizeshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevwlockedfreeze_superPTR_ERRs_inode_list_lock__UNIQUE_ID_x_560elevator_queueruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirminornextentsreal_blockedarg_locknum_exentriespid_ns_for_childrenlower_firstrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalerofs_ilocbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosfsavekeyring_index_keyxattr_blkaddrqrwlockoverflowfile_ra_stateuser_structerofs_xattr_long_prefixon_rq__p_size_fieldfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDerofs_blk_tprojiddrop_inodenum_trace_evalsnum_vfinode_get_ctime_secllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameinode_set_mtime_to_tsgottenunfreeze_fsintervalclasslast_mm_cidmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagsSYSCTL_TABLE_TYPE_DEFAULTkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structcred_guard_mutexmajorsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cachei_gid_writeanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offsetkaddri_opflagsrobust_listsym___kernel_rt_sigreturninfix_lensym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stack__compiletime_assert_451dockforwarddev_links_infoloff_tthread_pidfscache_volumesrcu_gp_seqextra_devicesia_ranges_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typePROBE_PREFER_ASYNCHRONOUSicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1matchmemory_typerb_rootnr_wakeups_localnr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpaddingopaque__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secevent_flagssched_delayedbd_statsbi_sizeAS_ENOSPCmodule_state__write_overflow_fieldmq_kobjlast_used_athardirq_stack_ptrvm_endlast_queuednuma_migrate_retryuser_ns__statefirstiommu_groupdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keyerofs_dir_iopsvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeproc_handlerFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexcpumask_checki_private_dataElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupxol_arearlockpcpu_hotfl_owner_t_resia_rangeeuidwaitEROFS_INODE_DATALAYOUT_MAXbug_tabledirtied_time_whencpu_onlinesequential_io_avgnr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVEnblks__state_sizecallerthread_structcached_requested_keyenvp_indexbvec_iterctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datacpu_max_bits_warnmm_usersbd_holder_locks_ids_dentry_lrubp_offsetnet_nsblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkoom_flag_origine_uidcounterorc_unwindavailable_compr_algsWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonecpumask_test_cpufscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSratelimitfree_foliodebugfs_dirqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsblkcg_gqia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatei_linknew_decode_devlistxattr_lowertrap_nrbinfmt_miscasync_probe_requestedcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_terofs_sb_infomnt_namespacequery_flagss_opsysv_shminstrument_atomic_readdq_countunlock_new_inodeutf8data_tableset_latency_tolerancez_idataofffoliowake_entryxa_headsuidi_readcountblk_integritylocked_vmrb_leftEROFS_INODE_FLAT_INLINEseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_t__UNIQUE_ID___addressable___SCK__tp_func_erofs_fill_inode639class_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryblkg_listrecent_used_cpunum_jump_entriesmount_opts_qcopatomic_tbv_pagealloc_tag_counters_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitshort intmynodepart_tbl__compiletime_assert_638zone_wplugs_hashblk_mq_opsclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datanr_extentsnr_scannedpoll_table_structdirect_IOwait_queue_entry_televatorcurrent_may_mountseqlock_tbd_queuenuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmask__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTArwsemi_ctime_nsecia_validSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYvertical_positionFORTIFY_FUNC_strncati_rcumax_distance_pagesi_atime_seccompressed_blocksqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listerofs_inode_extendedxarray_start__flagsAS_EIOfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidumount_mutexattribute_groupcontextposix_timers__UNIQUE_ID_y_546__UNIQUE_ID_y_549selectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nskcsan_check_accesssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_tctl_table_root___GFP_NOFAIL_BIT__UNIQUE_ID_y_552__UNIQUE_ID_y_555group_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizemce_kill_mephysical_block_sizeuuid_t__SCT__tp_func_erofs_fill_inode___GFP_UNUSED_BITatomic_write_hw_unit_minclass_preempt_notrace_constructorcount_objectsctl_table_seterrorq_size_stimezone_device_datanr_active_requests_shared_tagsi_flctxbase_indexdefparama_countfred_csq_lockdep_mapfault_flagkprojid_tptracer_credtlb_genstoreio_lock_cls_keypage_mkwritekobjectaudit_ttyvariable_test_bitmce_ripvstatfsctl_table_headertag_setnumab_stateremovablefeatureson_listkgid_ton_cpumanaged_pslotsFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedsysfs_registeredEROFS_INODE_COMPRESSED_COMPACTdebugfs_mutexwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opssequential_iotime_namespace_large_mapcountsda_is_staticformatftopenclavebi_privatesp_regcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_listget_reserved_space__compiletime_assert_119non_seqstack_refcountinvalidate_lockbmapERR_PTRkey_payloadtimer_rand_stated_real__dataexpiry_active__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126dqi_max_spc_limit__compiletime_assert_128__compiletime_assert_129eval_stringexception_table_entry_erofs_printkvirt_boundary_maskevent_countpreempt_counts_kobjfallocatei_spc_warnlimitbuddy_listi_ino_timelimit__compiletime_assert_130__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135__compiletime_assert_136mems_allowed__compiletime_assert_138__preempt_count_dec_and_testtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadergeneric_fillattrtimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcat__bi_cnttimer_listEROFS_NO_KMAPd_ino_warnsAS_FOLIO_ORDER_BITShiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitbd_nr_sectorsconstant_test_bitqf_nextrangesiommu_mmblk_features_tcutimeem_tableerofs_fill_inodepersonalityget_stateAS_MM_ALL_LOCKStask_sizes_inodes_addrbinfmtirq_domainsigned charpersistent_keyring_registerprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signopacked_inodeenabledfixupsfile_operationserofs_inode_is_data_compressedKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasepinspacct_structmust_resumelong intfile_lock_contextusagel_yessiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimesync_iofred_ssi_reserved__kmalloc_indexinode_locvolume__write_overflownr_iosprintk_index_sizesymtabfree_diskrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegiddatamodedq_hashput_superiget_failedpushable_dl_tasksf_flagscodetagprocnamemq_sysfs_init_donez_logical_clusterbitsmark_dirtyEROFS_INODE_FLAT_PLAINnum_srcu_structsbdi_writeback__UNIQUE_ID_rcu637kobj_completion__kernel_clockid_tseccompxattr_isizeiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespecinode_isizecancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvale_gidbvecnameidatalatency_recordmod_kallsymsmnt_idislotbitsdepthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldz_tailextent_headlcnerofs_fscachecheck_eventsssize_tiopl_emulmax_write_zeroes_sectorswork_structdesc_lensb_sizeflocktask_io_accountingmremaps_writers__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structreversepr_opspi_lockfeature_incompat___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEsrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyqueue_deptha_entriesgfp_maskpi_state_listrcu_segcblistsubvolusedfree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infosrcu_structrlim_curnofaultmm_countdrv_groupsstackshrinker_run_nomnt_nsidmapfunctionki_flagsbvec_poolbd_start_sect___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashmax_sectorssgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqdma_pad_maskki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYmapping_set_folio_order_rangerlimread_foliosimple_get_linknr_events__vpp_verifyiommubi_opfprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipeblk_mq_tag_setblk_independent_access_rangess_lock_keysrcu_gp_startopentime_nsit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodstqheadmake_kgids_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_task__compiletime_assert_547task_worksmemory_failurerb_root_cacheds_copset_ownershipdd_key_truehres_activebpf_raw_eventsclass_preempt_notrace_tdq_dirtydl_defer__compiletime_assert_553__compiletime_assert_556bug_listdirect_completeidr_rtxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateuts_nsis_late_suspendedsysvsemucountignore_children_pflagsrestore_earlyclock_mutexfs_supersuid_gid_mapdqb_bsoftlimitpendingmax_dev_sectorsf_task_work___GFP_NORETRY_BITiowait_countset_read_onlythrotl_datas_kobj_unregisterdma_io_tlb_memstringread_countfutex_offsetlong long intbdevatomic_flagssysvshmerofs_listxattrtimer_expirestrace_evalsactive_basesearly_initmprotectsecurityxmm_spaceactivatenr_cpu_idsf_pos_lockerofs_sb_lz4_infoi_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITdomain_dataidr_nextrelax_countlinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sepkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterszone_wplugs_lockd_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizeattributeserofs_unmap_metabufcached_rqsset_child_tidblk_unique_id_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_statemin_nrxattr_prefixestick_dep_maskatomic_readlistthrottle_disksi_errnopageflagss_inode_lrusrcu_size_stateblk_plugtotal_blocksdomain_idneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startchunknrdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countz_idata_sizeqsize_tfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixoliocbvfs_inodebd_mappingsym_vvar_pagemodule_sect_attrsreturn_instancearch_test_bitsoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intgendiskxattr_filter_reservedspc_timelimits_instancesdescseqcountoom_score_adjoldbitd_seqbi_crypt_contextia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_list__kunmap_localpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucountcpuhp_deads_remove_counterofs_is_fscache_modesyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwrite__tracepoint_erofs_map_blocks_entercallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tdevscputime_atomicrestoredelayed_callbi_itermax_nr_cid_statusmark_deadd_sibdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedlimits_lockdl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdax_devicercu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDerofs_device_infoblk_independent_access_rangefind_special_pagebacktraceiomap_iter_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollxattr_name_filterresvnr_wakeups_idleiomap_folio_opsio_cqelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listlastblkPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAsyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requirederofs_file_llseek__SCK__tp_func_erofs_map_blocks_exitsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritevolume_nametypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionali_blocksizemeta_blkaddrdma_poolsfieinfo_addr_lsbfeature_incompati_generation_sigpollmxcsrdevtd_rt_spc_hardlimitbuild_timebi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_headsubmit_ioend_iodev_pm_qoserofs_xattr_prefix_itembi_sectormap_typeread_cache_folioclass_preempt_notrace_destructorf_oppids_active_resetrandomconfirm_switcherofs_onlinefolio_endseqcount_tnuma_scan_seqinode_operationserofs_fiemapclass_raw_spinlock_irq_is_conditionalpercpu_size__phys_addr_nodebugdq_sbarch_static_branchsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entryPG_owner_priv_1cmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootPG_arch_2next_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warn__UNIQUE_ID_y_680rmdirsockbi_write_hinthash_lenget_policyHRTIMER_RESTART__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedquotdl_runtimevma_start_write__ret_do_oncenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdxattr_prefix_countfaultableio_comp_batchiov_iter_countshutdowndq_locki_cdevldt_structenv_endobj_cgroupPG_checkedrescue_workqueueptrace_messagenum_trace_events_sys_privatealignment_offsetopen_mutexinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authfolio_test_largevirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatchersdown_writecompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolPG_hwpoisonUTASK_SSTEP_ACKclass_rcu_tasks_trace_is_conditionalactive_uprobebit_nrshow_optionsdiskbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodecurr_nrerofs_off_tsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structcnivcswbin_attrs_newerofs_bufbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGPG_vmemmap_self_hostednrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2bd_size_lockbackvmemmap_basestate_add_uevent_senti_hashhlist_nodevalidity_cookieio_uringcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setPG_pinnedbio_listwrite_dquotblkaddrclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointersect_attrslaunder_folioprimarydevice_blocksonlinem_fscacheruntime_resumedup_xol_workqueueidr_findMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdevice_id_maskdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimei_mmapPG_owner_2phys_addrd_lrusignal_structperf_event_mutexhprobecrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__task_fpstatemask__ret_oncewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeerofs_is_fileio_modeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrPG_xen_remappedpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjPG_uptodatesrcu_cb_mutexstatic_call_siteput_page_testzeroMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalseremovedshow_pathPIDTYPE_TGIDerofs_dax_vm_opscurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagcoredump_datatasks_pidaddress_spacemm_context_t__oldiomap_end__call_single_nodestartupchunkbitsof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatorpanelclass_iderofs_kmap_typeinactive_timer_pkeyfilenames_export_opfront_pad__mptrstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqerofs_breadpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errshm_clistis_child_subreapercall_depthunicode_mapnum_descsPG_workingsetexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfofolio_file_pagealloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidrseq_sigdev_pm_domainlimit0limit1nr_zonesmigrate_modebio_poolerofs_iomap_beginpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_info__folio_swap_cache_indexi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscountfolio_nr_pagesGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrmmap_assert_write_lockedstack_vmusage_count_folio_nr_pagesioctlshowunsigned charumount_beginvdso_test_bitmmap_legacy_basepipe_inode_infoPG_reportedsecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_ops__compiletime_assert_660poll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklists_vfs_rename_mutexsuspend_latewakeupcg_listsrcu_barrier_completion__compiletime_assert_678driver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapraw_atomic_long_readfiemap__UNIQUE_ID___addressable___SCK__tp_func_erofs_map_blocks_enter661waiterssessionidarch_atomic_readbi_flags_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1dax_devllistdebugfs_entryelem_compound_headnr_retriesflatdevsigval_talimitundo_listdirty_foliomissedreport_zonesbi_idxquota_readPG_private_2st_shndxerofs_read_metabuffrees_fscachei_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typeatomic_dec_and_testmtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tpathst_sizermtpwait_sumnum_tracepointsvm_flags_setupidexit_codemempool_texec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkPG_fscacheperiod_contribrcu_node_entryfeature_compatstart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncgeneric_file_llseekvm_opsraw_atomic_dec_and_testiopollpagesizedisk_names_blocksizevm_pgoffauprobepto_val____retnuma_workupdate_timeptrace_dr7_call_addrrescue_lockmax_segmentsloginuidcheckexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkg__lstatearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvinosmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flagsm_llen_pincountget_foliotreerq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidmax_pclusterblkswrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockbd_holderend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexterofs_dev_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqlong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsseq_showswait_queue_headPG_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagssrcmapclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinki_private_listiomap_seek_datahrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgnoderesetvm_lockno_cgroup_migrationbuild_time_nsecnextevts_writers_key__countxcomp_bvcma_areakmap_local_pagestatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionkmap_to_pageDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentPG_activefirst_minoria_sizein_hrtirqs_master_keysconst_test_bitwchar_addr_bndkernel_symbolsubsys_databi_statustv_secrwsem_assert_held_write_nolockdepma_lockpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsma_rooturing_cmdnr_failed_migrations_affineIS_ERRuser_cpus_ptrpi_top_taskm_dax_part_offactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writehlist_bl_nodest_otheriomap_readaheadPG_anon_exclusivei_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsEROFS_INODE_CHUNK_BASEDmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offxattr_prefix_startdq_inusecachedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_mask__folio_putrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimesigactionfolio_opsdev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listPG_swapcachesched_rt_mutexlocked_pendingpao_tmp__nr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listbi_blkgnr_hw_queuesiomap_release_folioktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidtablesbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTART__cpu_online_maskbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannederofs_mount_optspcp_listpid_linkss_sysfs_namerefcount__SCT__tp_func_erofs_map_blocks_entervaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbd_holder_dirdown_readkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveerofs_read_folioprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headerofs_bmapwait_startatomic_long_readiomap_read_foliof_freeptrclass_raw_spinlock_irqsave_try_is_conditional__ret_condshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_enddevice_ids_fsnotify_infomempolicypm_message_tioveci_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentPG_unevictablepayloadac_minflti_sbd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflinePG_reclaimatomic_write_segments_maxatomic_openbio_end_io_tstart_prevent_timecondreadahead_controlblk_trace__kernel_gid32_tit_func_ptrkernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_devpage_ref_dec_and_testread_newsignalfd_wqhmmappto_tmp__modnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemaproot_nidwritepagessched_statisticsheadsync_decompressminors__state_permuprobe_taskwriteback_controluclampsuper_operationsbi_cookiesplice_eofutil_avgrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriocap_inheritablegp_waitlookupcostdev_pm_infopacked_nidblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsdax_iomap_rwvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typediskseqi_pagesatomic_write_hw_boundaryz_advisehlist_bl_headino_warnlimitfasynci_rt_spc_warnlimit__compiletime_assert_368__compiletime_assert_369page_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecfdevmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nrdatalayoutbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handlepage_fixed_fake_headElf64_Symd_automountqueue_limitsPG_writeback_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typePG_idlecurr_targetis_suspendedtimeout_workburstetypeei_funcsmodule_kobjectorderactive_memcgdef_flagsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatecap_bsetopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areafolio_test_swapbackedsaved_statekernfs_elem_attrbasess_bdev_filefolio_end_readnuma_faultslinux_binfmtpage_table_lock_sigfaultmax_sync_decompress_pagescounterskasan_check_readname_linkblk_mq_tagscmaxrsstimer_slack_nsbus_typepao_ID__policysharedxattr_shared_xattrswait_queue_entrydismissd_real_typelookahead_bandseq_startrq_qos_mutexraw_blkaddrzone_wplugs_wqraw_lockd_dnameget_dqblkerofs_put_metabufmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamelogical_block_sizewrittenrun_delaytailsblk_flags_tlinenoz_algorithmtypebi_io_vecbase_pfnget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimez_fragmentoffstart_codelowmem_page_addressis_hardfsbaseblk_status_tclock_listattrsarch_atomic64_readcpumask_tswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpuerofs_map_blocksshrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldpi_offsetdiscard_granularityfopsreservedPG_privatelatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_terofs_map_blocks_flatmodenuma_faults_localityhas_child_subreaperi_aclm_deviceidwrite_newlist_lockpm_domaininstrument_atomic_read_writecpu_bitmapstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statePG_dirtysoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagsswp_entry_tbi_inline_vecs_mapcountdomain_taghang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventup_writeset_performance_statefile_inodephys_addr_tclass_preempt_is_conditionalconsumers_cntm_bdevmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtpi_bytesdma_cleanupmaple_treedentryiomap_opslast_mergecpu_itimerfscache_cookiepercpuget_unique_idrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listnoop_direct_IOhiwater_rsskretprobe_instancesrangeerofs_nid_t__ptrfutex_exit_mutexpm_onlytrc_blkd_noded_spacegraveyard_linkblkszbitsxol_vaddrsplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsnvcswwatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERorigshared_pendingi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevblk_integrity_checksumiomap_dio_rwself_exec_idkernfs_opsfile_lockPG_swapbackedMODULE_STATE_LIVEnr_migrationsa_opsreq_listxa_flagsraw_atomic64_readfreezebin_sizeclosegrphierofs_domainnr_sectorsd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arrayrwsem_assert_held_writemnt_idmapdq_dqbuidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXPG_lockederofs_file_mmapnlinkinline_datapercpu_refhorizontal_positionmanaged_cachewhencePG_mappedtodiskpref_node_forkwait_queue__int128dqi_privchunkformatrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxresult_maskfolio_test_swapcachestate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_fileidr_basei_blockss_stateuser_sizedev_pm_opscdrom_device_infoscheduledfsidFAULT_FLAG_TRIEDraw_atomic_readclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeqstrma_flagsnr_ia_rangesmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptscache_strategy__le16alt_leniomap_seek_holecinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmdatomic_cmpxchgdirtied_whenmapped_blkaddr_batch_count__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headpart0f_wb_errrcharfutex_pi_statekstat__kernel_uid32_t__le32q_lock_cls_keyDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned intuniti_mutex_dir_keyq_nodespc_warnlimitm_fps_encoding__UNIQUE_ID___addressable___SCK__tp_func_erofs_map_blocks_exit669gpl_crcsorc_entrykeysorig_ptedqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutex__already_done__NR_PAGEFLAGSsrcu_gp_seq_neededpscr_ret__dq_dqb_lock__kernel_ulong_tvolnameio_minerofs_inodedl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlock__UNIQUE_ID_guard658rlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onedevice_physical_location_horizontal_position__UNIQUE_ID_guard666seq_stopkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodutil_summigration_disablediter_typeclass_device_is_conditionalshrinker_idbio_setrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKm_labpf_storageno_callbacks__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadmutexpgd_tnr_cpus_allowedEROFS_KMAPdiscard_alignmentraw_spinlock_tkey_taggetgeofs_flagsworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstksrcu_sspiomap_bmappage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdevraw_atomic_cmpxchg__u32ptracedtrc_reader_specialHPROBE_GONExattr_shared_countactive_timei_sequencepool_dataerofs_dax_huge_faultdisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesm_pauclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeerofs_file_fopsBLK_INTEGRITY_CSUM_CRC64f_iocb_flagsPG_isolatedpoweroffcmaj_fltvtimemath_emu_infoiowait_sumerofs_aopsf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssPG_lruflushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_sfiller_tpinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startunused_hctx_lists_flagsfaulterofs_map_devmigration_pendingalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkintegritydq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendingpage_offset_baseRPM_REQ_SUSPENDs_listPG_youngFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotmax_hw_sectorsfolioqfolio_putprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_idrequeue_lockvfork_donenanosleepBLK_UID_T10pud_tfolio_test_headrt_spc_timelimitsym_int80_landing_padtailia_atimeinfixtlb_ubcbi_issuequota_format_typedax_iomap_faultseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometryset_dqblksuppress_bind_attrsRPM_RESUMINGd_weak_revalidategsbases_quota_types__preempt_count_addf_llistmq_freeze_lockdax_part_offi_nlinkwrite_begingroupsEROFS_INODE_COMPRESSED_FULLpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_tadvisesharepagefault_disabledsyscwil_prevwlockedfreeze_superPTR_ERRs_inode_list_lockelevator_queuehugetlb_optimize_vmemmap_keytrace_erofs_map_blocks_enterruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgPG_large_rmappablentabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirfolio_indexPG_referencednextentsreal_blockedarg_locknum_exentriesrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalerofs_ilocbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosfsavekeyring_index_keyxattr_blkaddrqrwlockfile_ra_stateuser_structerofs_xattr_long_prefixon_rqfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDerofs_blk_tprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitput_folioatomic_write_boundary_sectorswritable_sizefilemap_splice_readrcu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpupage_freeilenmnt_flagsvm_structcred_guard_mutexmajorsigcnthrtimer_cpu_basecb_headcheck_quota_fileattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheanon_vma_chainnum_gpl_symsthp_get_unmapped_arealist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offsetkaddri_opflagsrobust_listsym___kernel_rt_sigreturninfix_lensym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockdev_links_infoloff_tthread_pidfilemap_readfscache_volumesrcu_gp_seqextra_devicesia_ranges_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeerofs_iomap_opsof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1matchmemory_typerb_rootnr_wakeups_localnr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secevent_flagssched_delayedbd_statsbi_sizemodule_statemq_kobjlast_used_athardirq_stack_ptrvm_endlast_queuednuma_migrate_retryuser_ns__stateconst_folio_flagsfirstiommu_groupdma_alignmentmigrate_to_ramPG_reservedwait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexcpumask_checki_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeup__compiletime_assert_486xol_arearlockpcpu_hotfl_owner_tia_rangeeuidwaitEROFS_INODE_DATALAYOUT_MAXbug_tabledirtied_time_whencpu_onlinem_plensequential_io_avgnr_pagesnum_trace_bprintk_fmtvm_policyraw_atomic_inciomap_dio_opsperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpidr_get_nextout_unlock_indexbvec_iterPG_savepinnedctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datacpu_max_bits_warnmm_usersbd_holder_locks_ids_dentry_lrubp_offsetblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimefolio_put_testzerosymlinkoom_flag_originfscachecounterorc_unwindavailable_compr_algs__is_vma_write_lockedWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonecpumask_test_cpufscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSratelimitfree_foliodebugfs_dirqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsblkcg_gqia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_tactive_countphys_bases_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_terofs_sb_infos_opsysv_shminstrument_atomic_readiomap_validdq_countutf8data_tableset_latency_toleranceprocessedPG_waitersz_idataofffoliowake_entryxa_headsuidi_readcountblk_integritylocked_vmrb_leftEROFS_INODE_FLAT_INLINEseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryblkg_listrecent_used_cpunum_jump_entriesmount_opts_qcopatomic_tbv_page_flagsrqos_debugfs_dirnotify_nextmax_perf_statePG_mlockedbus_dma_limitshort intmynodepart_tblzone_wplugs_hashblk_mq_opsclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablearch_atomic_incf_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRCDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalem_pdtrace_event_callsyncis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOwait_queue_entry_televatorcurrent_may_mountseqlock_tbd_queuenuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmask__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTArwsemi_ctime_nsecia_validvertical_positioni_rcumax_distance_pagesi_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listread_mapping_folioiomap_beginz_erofs_iomap_report_opsxarray_start__flagsfadvisem_algorithmformatvmem_altmaparg_endsyscall_dispatchthaw_super__compiletime_assert_668revoked_atlast_sum_exec_runtimeiov_iteria_gidumount_mutexattribute_groupcontextposix_timersiomap_fiemapselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nskcsan_check_accesssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_tgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizeerofs_readaheadmce_kill_mephysical_block_sizeuuid_tatomic_write_hw_unit_minclass_preempt_notrace_constructorcount_objects_stimezone_device_datanr_active_requests_shared_tagsi_flctxbase_indexdefparamfred_csq_lockdep_mapfault_flagkprojid_tptracer_credtlb_genstoreio_lock_cls_keypage_mkwritekobjectaudit_ttyvariable_test_bitmce_ripvstatfstag_setnumab_stateremovablefeatureson_listkgid_ton_cpumanaged_pslotsFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexitgeneric_file_readonly_mmaperrseq_tioctx_tableVTIME_SYSchangedsysfs_registeredEROFS_INODE_COMPRESSED_COMPACTdebugfs_mutexwatch_listaudit_contextpp_ref_count__tracepoint_erofs_map_blocks_exitup_readsysfs_opssequential_io_large_mapcountsda_is_staticformaterofs_onlinefolio_initftopenclaveerofs_inode_chunk_indexbi_privatesp_regcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_listget_reserved_spacenon_seqstack_refcountinvalidate_lockbmapkey_payloadtimer_rand_stated_real__dataexpiry_activedqi_max_spc_limiteval_stringexception_table_entry_erofs_printkvirt_boundary_maskevent_counterofs_file_read_iterpreempt_counts_kobjarch_atomic_dec_and_testfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowed__preempt_count_dec_and_testtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_syncerofs_fill_from_devinfokallsymsprevdma_parmsfs_structclockiduint32_targ_startatomic_incblocksset_infofileattr_getvector__bi_cnttimer_listEROFS_NO_KMAPerofs_init_metabufarch_atomic_cmpxchgd_ino_warnshiwater_vmfolio_containstracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitconstant_test_bitqf_nextPG_arch_1rangesiommu_mmblk_features_tcutimeem_tablepersonalityget_statetask_sizes_inodes_addrerofs_onlinefolio_splitbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmask__SCK__tp_func_erofs_map_blocks_enteruprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signopacked_inodeenabledfixupsfile_operationserofs_inode_is_data_compressedno_pmbi_max_vecsgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writersPG_foreignsetleasepinspacct_structmust_resumelong intfile_lock_contextusagel_yessiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimesync_iofred_ssvolumenr_iosprintk_index_sizesymtabfree_diskrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegidiomapdatamodedq_hashput_superpushable_dl_tasksf_flags__newf_inodePROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donez_logical_clusterbitsmark_dirtyEROFS_INODE_FLAT_PLAINnum_srcu_structsbdi_writebackvfs_setposkobj_completion__kernel_clockid_tseccompxattr_isizeiteratorqc_infodev_nameTT_NONEVTIME_INACTIVE__kernel_timespecinode_isizecancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvaltrace_erofs_map_blocks_exitbvecnameidatalatency_recordfile_bdevmod_kallsymsmnt_idislotbitsdepth__UNIQUE_ID_rcu659wait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldz_tailextent_headlcnerofs_fscachePG_readaheadcheck_eventsssize_tiopl_emul__SCT__tp_func_erofs_map_blocks_exitmax_write_zeroes_sectorswork_structdesc_len__UNIQUE_ID_rcu667sb_sizeflocktask_io_accountingmremaps_writerstracepoint_funcargventryfree_cached_objectsworkqueue_structPG_has_hwpoisonedpr_opspi_locktailendpacking___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEsrcu_reader_flavorirq_safetv_nseci_lruqueue_depthstartoffgfp_maskpi_state_listrcu_segcblistsubvolm_daxdevfree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infosrcu_structrlim_curnofaultmm_countdrv_groupsstackshrinker_run_nofunctionki_flagsbvec_poolbd_start_sectsrcu_have_cbsd_in_lookup_hashmax_sectorssgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDerofs_dax_faultbpf_net_contextopc1__int128 unsignedpcountrestore_noirqdma_pad_maskki_filpcap_ambientdma_configurePG_partially_mappedruntime_errormdevatomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_events__vpp_verifyiommubi_opf__UNIQUE_ID_x_679privatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipeblk_mq_tag_setblk_independent_access_rangess_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmodstqheads_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cachediomap_invalidate_folios_copdd_key_truehres_activebpf_raw_eventsclass_preempt_notrace_terofs_iomap_enddq_dirtydl_deferbug_listdirect_completeidr_rtxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsembd_nr_sectorsignore_children_pflagsrestore_earlyclock_mutexfs_supersdqb_bsoftlimitpendingmax_dev_sectorsf_task_workiowait_countset_read_onlythrotl_datas_kobj_unregisterdma_io_tlb_memstringread_countfutex_offsetlong long intbdevatomic_flagssysvshmtimer_expirestrace_evalsactive_basesearly_initmprotectsecurityxmm_spacem_flagsactivatenr_cpu_idsf_pos_lockerofs_sb_lz4_infopfn_ti_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structdomain_dataidr_nextrelax_countlinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sepkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterszone_wplugs_lockd_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizeattributescached_rqsset_child_tidblk_unique_id_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_statemin_nrtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionalneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countz_idata_sizeqsize_ttime_ns_for_childrenfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolvfs_inodebd_mappingsym_vvar_pagemodule_sect_attrsreturn_instancearch_test_bitsoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjoldbitd_seqbi_crypt_contextia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesendprfxrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucountcpuhp_deads_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicrestoredelayed_callbi_itermax_nr_ciderofs_getattr_statusmark_deadd_sibdma_opsbin_attributemin_align_maskpercpu_countererofs_get_acldev_groupsnuma_pages_migratedlimits_lockdl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDerofs_find_target_blockblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollxattr_name_filterresvnr_wakeups_idleio_cqelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAdiffsyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_panelctl_tableuid_tflush_requiredsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionali_blocksizedma_pools_addr_lsbctl_table_polli_generation_sigpollmxcsrdevtd_rt_spc_hardlimitbi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qosbi_sectormap_typeclass_preempt_notrace_destructorf_oppids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationserofs_fiemapclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbarch_static_branchsighand_structflags__UNIQUE_ID___addressable___SCK__tp_func_erofs_lookup631i_lock_keykmem_cacheinodedrivers_dirback_padbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanunregisteringf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdir__UNIQUE_ID_y_684sockbi_write_hinthash_lenget_policyHRTIMER_RESTART__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedquotdl_runtime__ret_do_oncenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueextra1ptrace_messagenum_trace_events_sys_privatealignment_offsetopen_mutexd_typeinit_fs_contexts_subtypeheaderfuncperf_event_contexterofs_nameitlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherscompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsdiskbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodecurr_nrerofs_off_tsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structcnivcswbin_attrs_newerofs_bufbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrennregis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_statednamerethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infopermissionserror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idxcgroup_namespacendirents_head_1_head_2bd_size_lockbackstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setmatchedbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointersect_attrsonlineruntime_resumedup_xol_workqueueMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexhprobecrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__task_fpstate__ret_oncewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalseremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencefile_typert_spc_warnlimitac_flagcoredump_datatasks_pidaddress_spacemm_context_tuid_gid_extent__call_single_nodestartupchunkbitsof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatorpanelclass_iderofs_kmap_typeinactive_timer_pkeyfilenames_export_opfront_pad__mptrstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqerofs_breadpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errshm_clistis_child_subreapercall_depthunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidrseq_sigdev_pm_domainlimit0limit1nr_zonesmigrate_modebio_poolfind_target_direntpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasks__compiletime_assert_630platform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrstack_vmusage_count_folio_nr_pagesioctlshowunsigned charumount_beginvdso_test_bitmmap_legacy_basepipe_inode_infosecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opspoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklists_vfs_rename_mutexsuspend_latewakeupcg_listsrcu_barrier_completiondriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiters__compiletime_assert_682sessionid__compiletime_assert_685bi_flags_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listdirty_foliomissedreport_zonesparent_could_setfcapquota_readst_shndxfreei_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tpathst_sizermtpwait_sumnum_tracepointsupidexit_codemempool_texec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqerofs_igetDD_CLASS_TYPE_LEVEL_NUMcid_workkeyring_semsrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollpagesizedisk_names_blocksizevm_pgoffauprobepto_val__numa_workupdate_timeptrace_dr7_call_addrrescue_lockmax_segmentsloginuidcheckexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkg__lstatearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flagsa_rcu_pincountrq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockbd_holderend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqlong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsgroupseq_showctl_nodeswait_queue_headcow_pageinumsectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinki_private_listhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgnoderesetvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areastatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatipc_namespaceexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentfirst_minorcgroup_nsia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symbolsubsys_databi_statustv_secma_lockpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsma_rooturing_cmdnr_failed_migrations_affineIS_ERRuser_cpus_ptrpi_top_taskactoruprobenotifier_subscriptionss_readonly_remounthlist_bl_nodest_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flagskeyring_name_liststatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listsched_rt_mutexlocked_pendingpao_tmp__nr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listbi_blkgnr_hw_queuesktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidtablesbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTART__cpu_online_maskbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_fileipc_nspcp_listpid_linkss_sysfs_namerefcountvaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbd_holder_dirkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersproc_ns_operationsi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditional__ret_condshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infouser_keyring_registermempolicypm_message_te_permioveci_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentpayloadac_minflti_sbd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxatomic_openbio_end_io_tstart_prevent_timecondreadahead_controlblk_trace__kernel_gid32_tit_func_ptrkernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_devread_newsignalfd_wqhmmappto_tmp__modnameasync_put_workmknodfsnotify_sb_info__sigrestore_tbi_idx__kernel_loff_tdetachget_unmapped_areadev_pagemapwritepagessched_statisticsheadminors__state_permuprobe_taskwriteback_controluclampsuper_operationsbi_cookiesplice_eofutil_avgtaskrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriocap_inheritablegp_waitlookupcostdev_pm_infoblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typediskseqi_pagesatomic_write_hw_boundaryz_advisehlist_bl_headino_warnlimitarch_uprobe_taskfasynci_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecsysctlsmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nrdatalayoutbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_free_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetis_suspendede_taguts_namespacetimeout_workburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatecap_bsetopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcounterskasan_check_readname_linkcmaxrsstimer_slack_nsbus_typepao_ID__policysharedxattr_shared_xattrswait_queue_entrydismissd_real_typelookahead_bandseq_startrq_qos_mutexraw_blkaddrzone_wplugs_wqraw_lockd_dnameget_dqblkstartprfxerofs_put_metabufmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamelogical_block_sizerun_delaytailsblk_flags_tlinenoz_algorithmtypebi_io_vecbase_pfnERR_PTRget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimez_fragmentoffstart_codeis_hardfsbaseblk_status_tclock_listattrscpumask_tgid_mapswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldis_seenpi_offsetdiscard_granularityfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_tnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockpm_domaincpu_bitmapucount_maxstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statesoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagsswp_entry_tbi_inline_vecs_mapcountdomain_taghang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanDEVICE_PANEL_UNKNOWNfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtpi_bytesdma_cleanupmaple_treedentrylast_mergecpu_itimerpercpuget_unique_idrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesrangeerofs_nid_tfutex_exit_mutexpm_onlytrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsnvcswwatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidneeds_force_resumeerofs_lookupmin_vruntimefaults_disabled_mappingquota_typei_rdevblk_integrity_checksumself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsreq_listxa_flagsfreezebin_sizeclosegrphinr_sectorsd_spc_timerjump_entriesctl_dirasync_suspendmsi_device_dataalignsuper_blockset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqbuidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXerofs_direntnlinkdefault_setpercpu_refns_commonhorizontal_positionrlimit_maxpref_node_forkwait_queue__int128dqi_privchunkformatrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_filei_blockss_stateuser_sizedev_pm_opscdrom_device_infoscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeqstrma_flagsnr_ia_ranges__SCK__tp_func_erofs_lookupmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attempts__le16alt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_count__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headpart0f_wb_errrcharfutex_pi_statekstat__kernel_uid32_tq_lock_cls_keyDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidposix_acl_entrya_refcountst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned int__le64i_mutex_dir_keyq_nodespc_warnlimit__UNIQUE_ID_guard628ctl_table_sizeextents_encodinggpl_crcsorc_entrykeysorig_ptedqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutex__already_donesrcu_gp_seq_neededpscr_ret__dq_dqb_lock__kernel_ulong_tvolnameio_minerofs_inodedl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefixextra2__u8is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onedevice_physical_location_horizontal_positionseq_stopkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidctl_table_args_blocksize_bitsnuma_scan_periodutil_summigration_disablediter_typeclass_device_is_conditionalshrinker_idbio_setrootprojid_mapoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadmutexpgd_tnr_cpus_allowedEROFS_KMAPdiscard_alignmentraw_spinlock_tkey_taggetgeofs_flagsworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstksrcu_ssppage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONExattr_shared_countactive_timei_sequencepool_datadisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeBLK_INTEGRITY_CSUM_CRC64f_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startunused_hctx_lists_flagsfaultmigration_pendingalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkintegritydq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotmax_hw_sectorsfolioqprev_posseqcount_spinlockexpire_countuid_maps_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_idrequeue_lockvfork_donenanosleepBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcbi_issuequota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalencandidatef_pipei_wb_frn_historylast_wakeenextio_tlb_memsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometryset_dqblksuppress_bind_attrsRPM_RESUMINGd_weak_revalidategsbases_quota_types__preempt_count_addf_llistmq_freeze_locki_nlinkwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedfreeze_superPTR_ERRs_inode_list_lockelevator_queueruntime_idle__SCT__tp_func_erofs_lookupsweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentriespid_ns_for_childrenlower_firstrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDerofs_blk_tprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagsSYSCTL_TABLE_TYPE_DEFAULTkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structcred_guard_mutexmajorsigcnthrtimer_cpu_basecb_headcheck_quota_fileattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offseti_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockforwarddev_links_infoloff_tthread_pidsrcu_gp_seqia_ranges_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typePROBE_PREFER_ASYNCHRONOUSicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1matchmemory_typerb_rootnr_wakeups_localnr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillerd_splice_aliassaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secevent_flagssched_delayedbd_statsbi_sizemodule_statemq_kobjlast_used_athardirq_stack_ptrvm_endlast_queuednuma_migrate_retryuser_ns__statefirstiommu_groupdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keyerofs_dir_iopsvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeproc_handlerFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresserofs_qstrsrcu_barrier_mutexcpumask_checki_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_arearlockpcpu_hotfl_owner_tia_rangeeuidwaitbug_tabledirtied_time_whencpu_onlinesequential_io_avgnr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvp_indexbvec_iterctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datacpu_max_bits_warnmm_usersbd_holder_locks_ids_dentry_lrubp_offsetnet_nsblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkoom_flag_origine_uidcounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonecpumask_test_cpufscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSratelimitfree_foliodebugfs_dirqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsblkcg_gqia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatei_linklistxattr_lowertrap_nrbinfmt_miscasync_probe_requestedcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_tmnt_namespaces_opsysv_shminstrument_atomic_readdq_countutf8data_tableset_latency_tolerancez_idataofffoliowake_entryxa_headsuidi_readcountblk_integritylocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryblkg_listrecent_used_cpunum_jump_entriess_qcopatomic_tbv_page_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitshort intmynodepart_tblzone_wplugs_hashblk_mq_opsclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRCDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datanr_extentsnr_scannedpoll_table_structdirect_IOwait_queue_entry_televatorcurrent_may_mountseqlock_tbd_queuenuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmask__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTAi_ctime_nsecia_validSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYvertical_positioni_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_start__flagsfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nskcsan_check_accesssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_tctl_table_rootgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizemce_kill_mephysical_block_sizeuuid_tatomic_write_hw_unit_minclass_preempt_notrace_constructorcount_objectsctl_table_seterror_stimezone_device_datanr_active_requests_shared_tagsi_flctxdefparama_countfred_csq_lockdep_mapfault_flagkprojid_tptracer_credtlb_genstoreio_lock_cls_keyPTR_ERR_OR_ZEROpage_mkwritekobjectaudit_ttyvariable_test_bitmce_ripvstatfsctl_table_headertag_setnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedsysfs_registereddebugfs_mutexwatch_listaudit_contextpp_ref_countsysfs_opssequential_iotime_namespace_large_mapcountsda_is_staticformatftopenclave_ndirentsbi_privatesp_regcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_listget_reserved_spacenon_seqstack_refcountinvalidate_lockbmapkey_payloadtimer_rand_stated_real__dataexpiry_activedqi_max_spc_limiteval_stringexception_table_entry_erofs_printkvirt_boundary_maskevent_countpreempt_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowed__preempt_count_dec_and_testtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleader__UNIQUE_ID_y_681timewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvector__bi_cnttimer_listEROFS_NO_KMAPd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitbd_nr_sectorstrace_erofs_lookupconstant_test_bitqf_nextrangesiommu_mmblk_features_tcutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charpersistent_keyring_registerprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsno_pmbi_max_vecsgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasepinspacct_structmust_resumelong intfile_lock_contextusagel_yessiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimesync_iofred_ssnameoffnr_iosprintk_index_sizesymtabfree_diskrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegiddq_hashput_super__UNIQUE_ID_rcu629pushable_dl_tasksf_flagsf_inodeprocnamemq_sysfs_init_donez_logical_clusterbitsmark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompxattr_isizeiteratorqc_infodev_nameTT_NONEVTIME_INACTIVE__kernel_timespecinode_isizecancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvale_gidbvecnameidatalatency_recordmod_kallsymsmnt_iddepthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldz_tailextent_headlcncheck_eventsssize_tiopl_emulmax_write_zeroes_sectorswork_structdesc_lenflocktask_io_accountingmremaps_writerstracepoint_funcargventryfree_cached_objectsworkqueue_structreversepr_opspi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEsrcu_reader_flavorirq_safetv_nseci_lruqueue_deptha_entriesgfp_maskpi_state_listrcu_segcblistsubvolusedfree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infosrcu_structrlim_curnofaultmm_countdrv_groupsstackmnt_nsfunctionki_flagsbvec_poolbd_start_sectsrcu_have_cbsd_in_lookup_hashmax_sectorssgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqdma_pad_maskki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_events__vpp_verifyiommubi_opfprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipeblk_mq_tag_set__UNIQUE_ID_x_680__UNIQUE_ID_x_683blk_independent_access_rangess_lock_keyerofs_dirnamecmpsrcu_gp_startopentime_nsit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmods__tracepoint_erofs_lookuptqheads_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copset_ownershipdd_key_truehres_activebpf_raw_eventsclass_preempt_notrace_tdq_dirtydl_deferbug_listdirect_completeblk_mq_tagsxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateuts_nsis_late_suspendedsysvsemucountignore_children_pflagsrestore_earlyclock_mutexfs_supersuid_gid_mapdqb_bsoftlimitpendingmax_dev_sectorsf_task_workiowait_countdirblksizeset_read_onlythrotl_datadma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmerofs_listxattrtimer_expirestrace_evalsactive_basesearly_initmprotectsecurityxmm_spaceactivatenr_cpu_idsf_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structdomain_datarelax_countlinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterszone_wplugs_lockd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizeattributescached_rqsset_child_tidblk_unique_id_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_statemin_nrtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countz_idata_sizeqsize_tfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolvfs_inodebd_mappingsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqbi_crypt_contextia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucountcpuhp_deads_remove_countsyscall_workmaxsizedevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicrestoredelayed_callbi_itermax_nr_cid_statusmark_deadd_sibdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedlimits_lockdl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollxattr_name_filterresvnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAsyscore__s64dqi_bgrace__UNIQUE_ID_y_617__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredsum_block_runtimepgmapmin_perf_statestrnlendq_oprcu_tasks_nvcswwritetypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatde_namelendma_pools_addr_lsbi_generation_sigpollmxcsrdevtd_rt_spc_hardlimitbi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qosbi_sectormap_typef_oppids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockbi_write_hinthash_lenget_policyHRTIMER_RESTART__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedquotdl_runtimenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueptrace_messagenum_trace_events_sys_privatealignment_offsetopen_mutexd_typeinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherscompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsdiskbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodecurr_nrerofs_off_tsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structbin_attrs_newerofs_bufbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2bd_size_lockbackstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointersect_attrsonlineruntime_resumedup_xol_workqueueMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexhprobecrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalseremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencefile_typert_spc_warnlimitac_flagcoredump_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupchunkbitsof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatorpanelclass_iderofs_kmap_typeinactive_timer_pkeyfilenames_export_opfront_pad__mptrstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqerofs_breadpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidrseq_sigdev_pm_domainlimit0limit1nr_zonesmigrate_modebio_poolpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bw__real_strnlenkobjfsyncmtd_infoi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrstack_vmusage_count_folio_nr_pagesioctlshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opspoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklists_vfs_rename_mutexsuspend_latewakeupcg_listsrcu_barrier_completiondriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidbi_flags_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listdirty_foliogeneric_read_dirmissedreport_zonesbi_idxquota_readst_shndxfreei_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wqerofs_fill_dentries_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tpathst_sizermtpwait_sumnum_tracepointsupidexit_codemempool_texec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncgeneric_file_llseekvm_opsiopollpagesizedisk_names_blocksizevm_pgoffauprobe__retnuma_workupdate_timeptrace_dr7_call_addrrescue_lockmax_segmentsloginuidcheckexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkg__lstateueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincountrq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockbd_holderend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqlong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsseq_showswait_queue_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinki_private_listhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgnoderesetvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areastatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentfirst_minoria_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symbolsubsys_databi_statustv_secma_lockpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsma_rooturing_cmdnr_failed_migrations_affineIS_ERRuser_cpus_ptrpi_top_taskactoruprobenotifier_subscriptionss_readonly_remounthlist_bl_nodest_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskdir_emituser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlennamelencodegtimesigaction__UNIQUE_ID_x_616dev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listsched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listbi_blkgnr_hw_queuesktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidtablesbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbd_holder_dirkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicypm_message_tioveci_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentpayloadac_minflti_sbd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxatomic_openbio_end_io_tstart_prevent_timecondreadahead_controlblk_trace__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_devread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapwritepagessched_statisticsheadminors__state_permuprobe_taskwriteback_controluclampsuper_operationsbi_cookiesplice_eofutil_avgrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriocap_inheritablegp_waitlookupcostdev_pm_infoblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsFORTIFY_FUNC_memscanvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typediskseqi_pagesZ_EROFS_COMPRESSION_DEFLATEatomic_write_hw_boundaryz_advisehlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nrdatalayoutbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_free_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetis_suspendedtimeout_workburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatecap_bsetopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkcmaxrsstimer_slack_nsbus_typepolicysharedxattr_shared_xattrswait_queue_entrydismissd_real_typelookahead_bandseq_startrq_qos_mutexraw_blkaddrzone_wplugs_wqraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamelogical_block_sizerun_delaytailsblk_flags_tlinenoz_algorithmtypebi_io_vecbase_pfnget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimez_fragmentoffstart_codeis_hardfsbaseblk_status_tclock_listattrscpumask_tswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldpi_offsetdiscard_granularityfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettime64_tnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statesoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagsswp_entry_tbi_inline_vecs_mapcountdomain_taghang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventset_performance_statefile_inodephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtpi_bytesdma_cleanupmaple_treedentrylast_mergecpu_itimerpercpuget_unique_idrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesrangeerofs_nid_tfutex_exit_mutexpm_onlytrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsinitialnvcswwatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevblk_integrity_checksumself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsreq_listxa_flagsfreezebin_sizeclosegrphinr_sectorsd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqbuidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXerofs_direntnlinkpercpu_refhorizontal_positionpref_node_forkwait_queue__int128dqi_privchunkformatrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_filei_blockss_stateuser_sizedev_pm_opscdrom_device_infoscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeqstrma_flagsnr_ia_rangesmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attempts__le16alt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_count__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headf_wb_errrcharfutex_pi_statekstat__kernel_uid32_tq_lock_cls_keyDEVICE_FIXEDZ_EROFS_COMPRESSION_LZMApte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned int__le64i_mutex_dir_keyq_nodedentry_blkspc_warnlimits_encodinggpl_crcsorc_entrykeysorig_ptedqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tvolnameio_minerofs_inodedl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtime__u8is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onedevice_physical_location_horizontal_positionseq_stopkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodutil_summigration_disablediter_typeclass_device_is_conditionalshrinker_idbio_setrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadmutexpgd_tnr_cpus_allowedEROFS_KMAPdiscard_alignmentraw_spinlock_tkey_taggetgeofs_flagsworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstksrcu_ssppage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONExattr_shared_countactive_timei_sequenceZ_EROFS_COMPRESSION_LZ4pool_datadisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeBLK_INTEGRITY_CSUM_CRC64f_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startunused_hctx_lists_flagsfaultalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkintegritydq_flagsDD_CLASS_TYPE_DISJOINT_NAMESp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releaseerofs_dir_fopsalloc_locks_dquotmax_hw_sectorsfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_id__p_lenrequeue_lockvfork_donenanosleepBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcbi_issuequota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memarch_spinlock_tsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometryset_dqblksuppress_bind_attrsRPM_RESUMINGd_weak_revalidategsbases_quota_typesf_llistmq_freeze_locki_nlinkwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskerofs_readdirBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevwlockedfreeze_superPTR_ERRs_inode_list_lockelevator_queueruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentriesrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDerofs_blk_tprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structcred_guard_mutexmajorsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offseti_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockdev_links_infoloff_tthread_pidsrcu_gp_seqia_ranges_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1matchmemory_typerb_rootnr_wakeups_localnr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secevent_flagssched_delayedbd_statsbi_sizemodule_statemq_kobjlast_used_aterofs_put_metabufZ_EROFS_COMPRESSION_ZSTDvm_endlast_queuednuma_migrate_retryuser_ns__statefirstiommu_groupdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupxol_arearlockfl_owner_tia_rangeeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvp_indexbvec_iterctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSratelimitfree_foliodebugfs_dirqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsblkcg_gqia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opsysv_shmdq_countutf8data_tableset_latency_tolerancez_idataofffoliowake_entryxa_headsuidi_readcountblk_integritylocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryblkg_listrecent_used_cpunum_jump_entriess_qcopatomic_tbv_page_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitshort intmynodepart_tblzone_wplugs_hashZ_EROFS_COMPRESSION_MAXblk_mq_opsclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRCFORTIFY_FUNC_memchr_invDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOwait_queue_entry_televatorcurrent_may_mountseqlock_tbd_queuenuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keymemalloc_noioGRPQUOTAi_ctime_nsecia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atde_namelast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_tgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizedbstartmce_kill_mephysical_block_sizeuuid_tatomic_write_hw_unit_mincount_objects_stimezone_device_datanr_active_requests_shared_tagsi_flctxdefparamfred_csq_lockdep_mapfault_flagkprojid_tptracer_credtlb_genstoreio_lock_cls_keypage_mkwritekobjectaudit_ttymce_ripvstatfstag_setnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedsysfs_registereddebugfs_mutexwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavebi_privatesp_regcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_list__compiletime_assert_39get_reserved_spacenon_seqstack_refcountinvalidate_lockbmapkey_payloadtimer_rand_stated_realexpiry_active__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_44__compiletime_assert_45__compiletime_assert_46__compiletime_assert_47__compiletime_assert_48dqi_max_spc_limitexception_table_entry_erofs_printkvirt_boundary_maskevent_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcat__bi_cnttimer_listEROFS_NO_KMAPd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextrangesiommu_mmblk_features_tcutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsno_pmbi_max_vecsgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasepinspacct_structmust_resumenameoff0long intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ssnameoffnr_iosprintk_index_sizesymtabfree_diskrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegiddq_hashput_superpushable_dl_tasksf_flagsf_inodePROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donez_logical_clusterbitsmark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompxattr_isizeiteratorqc_infodev_nameTT_NONEVTIME_INACTIVE__kernel_timespecinode_isizecancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldz_tailextent_headlcncheck_eventsssize_tiopl_emulmax_write_zeroes_sectorswork_structdesc_lenflocktask_io_accountingmremaps_writers__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structpr_opspi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmfs_ftype_to_dtypeFAULT_FLAG_INTERRUPTIBLEsrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyqueue_depthgfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infosrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flagsbvec_poolbd_start_sectsrcu_have_cbsd_in_lookup_hashmax_sectorssgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infop_lensuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqdma_pad_maskki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_eventsiommubi_opfprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipeblk_mq_tag_setblk_independent_access_rangess_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmodstqheads_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listdirect_completeblk_mq_tagsxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsembd_nr_sectorsignore_children_pflagsrestore_earlyclock_mutexfs_supersdqb_bsoftlimitpendingmax_dev_sectorsf_task_workiowait_countset_read_onlythrotl_datadma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesearly_initmprotectsecurityxmm_spaceactivatef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structdomain_datarelax_countlinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameters__struct_ptrzone_wplugs_lockd_releasestates_d_operofs_attr_zero_paddingmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batchmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizeattributesfs_kobjcached_rqsset_child_tidblk_unique_id_overruntmpfileerofs_attrrcu_read_lock_nestingem_perf_statemin_nrxattr_prefixestick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugtotal_blocksdomain_idneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolerofs_feat_attrsbd_mappingsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intgendiskxattr_filter_reservedspc_timelimits_instancesdescseqcountoom_score_adjd_seqbi_crypt_contextia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nseccpuhp_deads_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tprealloc__init_swait_queue_headpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tdevscputime_atomicrestoredelayed_callbi_itermax_nr_cid_statusmark_deadd_sibdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedlimits_lockdl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdax_devicercu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrFAULT_FLAG_WRITEvm_fault_ttty_structUTASK_SSTEP_TRAPPEDblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollresvnr_wakeups_idleio_cqelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAsyscore__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tEROFS_SYNC_DECOMPRESS_FORCE_ONflush_requiredsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritevolume_namekobject_deltypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionalmeta_blkaddrdma_poolserofs_attr_compr_head2_addr_lsbfeature_incompati_generation_sigpollmxcsrdevtd_rt_spc_hardlimitbuild_timebi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qoserofs_xattr_prefix_itembi_sectormap_typef_oppids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimeattr_pointer_boolnestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockbi_write_hinthash_lenget_policyHRTIMER_RESTART__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedquotdl_runtimenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdxattr_prefix_countfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueptrace_messagenum_trace_events_sys_privatealignment_offsetopen_mutexinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksstart_stackerofs_groupwatcherserofs_init_sysfscompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsdiskbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodecurr_nrsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onskip_spacesvm_operations_structbin_attrs_newbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2bd_size_lockbackstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointersect_attrsprimarydevice_blocksonlineruntime_resumedup_xol_workqueueMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdevice_id_maskdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connectorerofs_attr_sync_decompress_sigsysqueue_kobjsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagcoredump_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatorpanelclass_idinactive_timer_pkeyfilenames_export_opfront_pad__mptri_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoalloc_inodeuser_event_mmerofs_rootd_inamedevres_headi_mappinginblockrmidi_rt_spc_timelimitrseq_sigdev_pm_domainlimit0limit1nr_zonesmigrate_modebio_poolpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotpm_messagemay_spliterofs_attr_storemem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrstack_vmusage_count_folio_nr_pagesioctlshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opspoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklistclass_local_lock_is_conditionalsuspend_latewakeupcg_listsrcu_barrier_completiondriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1dax_devllistdebugfs_entryelemnr_retriesstruct_erofs_mount_optsflatdevsigval_talimitundo_listdirty_foliomissedreport_zonesbi_idxquota_readst_shndxfrees_fscachei_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tpathst_sizermtpwait_sumnum_tracepointsupidexit_codemempool_texec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entryfeature_compatstart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollpagesizedisk_names_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrrescue_lockmax_segmentsloginuidcheckexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkg__lstateueventlock_countrefcount_tplugchild_countsaved_auxvinosmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttreerq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidmax_pclusterblkswrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockbd_holderend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexterofs_dev_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqlong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsseq_showswait_queue_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgnoderesetvm_lockno_cgroup_migrationbuild_time_nsecnextevts_writers_key__countxcomp_bvcma_areastatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentfirst_minoria_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symbolsubsys_databi_statustv_secblk_integrity_checksumpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsma_rooturing_cmdnr_failed_migrations_affineEROFS_SYNC_DECOMPRESS_FORCE_OFFstrcmpuser_cpus_ptrpi_top_taskactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offxattr_prefix_startdq_inusecachedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageattr_idcodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listsched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listbi_blkgnr_hw_queuesktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidtableskset_registerbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTpart0bd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannederofs_mount_optspcp_listpid_linkss_sysfs_namerefcountvaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbd_holder_dirkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headinvalidate_mapping_pageswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalerofs_sb_releasethaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicypm_message_tioveci_private_locksegment_boundary_maskstruct_typeVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentpayloadac_minflti_sbd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxatomic_openbio_end_io_tstart_prevent_timecondreadahead_controlblk_trace__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_devread_newsignalfd_wqhmmapfeat_errmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemaproot_nidwritepagessched_statisticsheadsync_decompressminors__state_permuprobe_taskwriteback_controluclampsuper_operationsbi_cookiesplice_eofutil_avgrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriocap_inheritablegp_waitlookupcostdev_pm_infopacked_nidblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typediskseqi_pagesZ_EROFS_COMPRESSION_DEFLATEatomic_write_hw_boundaryhlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecfdevmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_aliaserofs_attr_drop_caches__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthmax_hw_discard_sectorsbuflensaved_trap_nrbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_freekobject_put_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetis_suspended__keytimeout_workburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultmax_sync_decompress_pagescountersname_linkblk_mq_tagscmaxrsstimer_slack_nsbus_typepolicysharedwait_queue_entrydismissd_real_typelookahead_bandseq_startrq_qos_mutexzone_wplugs_wqraw_lockd_dnameget_dqblksysfs_emitmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamelogical_block_sizerun_delaytailsblk_flags_tlinenobi_io_vecbase_pfnget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimewait_for_completionstart_codeis_hardfsbaseblk_status_tclock_listattrscpumask_tswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldpi_offsetdiscard_granularityfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statesoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagsswp_entry_terofs_attr_chunked_filebi_inline_vecs_mapcountdomain_taghang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treedentrylast_mergecpu_itimerfscache_cookiepercpuget_unique_idrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesrangeerofs_nid_tfutex_exit_mutexpm_onlytrc_blkd_noded_spacegraveyard_linkblkszbitsxol_vaddrsplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsnvcswwatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEkset_unregisternr_migrationsa_opsreq_listxa_flagsfreezebin_sizeclosegrphierofs_domainnr_sectorsd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqbuidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkpercpu_refhorizontal_positionmanaged_cachepref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_fileidr_bases_stateuser_sizedev_pm_opscdrom_device_infoscheduledfsidFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeqstrma_flagsnr_ia_rangesmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fraginit_completionsrcu_gp_mutexdatalennr_wakeups_affine_attemptscache_strategyalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_count__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tq_lock_cls_keyDEVICE_FIXEDZ_EROFS_COMPRESSION_LZMApte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysorig_ptedqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutexerofs_attr_fragmentssrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tvolnameio_mindl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefixerofs_attr_ops__u8is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onedevice_physical_location_horizontal_positionpercpu_ref_func_tseq_stopkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalshrinker_idbio_setrootoom_reaper_listerofs_feat_groupsshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadmutexpgd_tnr_cpus_alloweddiscard_alignmentraw_spinlock_tkey_taggetgeofs_flagsworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstksrcu_ssppage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequenceZ_EROFS_COMPRESSION_LZ4pool_datadisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeBLK_INTEGRITY_CSUM_CRC64f_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64erofs_featjournal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startunused_hctx_lists_flagsfaultalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkintegritydq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasestruct_erofs_sb_infoalloc_locks_dquotmax_hw_sectorsfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_idrequeue_lockvfork_donenanosleepBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_padtailia_atimeinfixtlb_ubcbi_issuequota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memarch_spinlock_tsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometryset_dqblksuppress_bind_attrsRPM_RESUMINGreg_offsetgsbases_quota_typesf_llistmq_freeze_lockdax_part_offi_nlinkwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevattr_pointer_uiwlockedfreeze_supererofs_attr_dedupes_inode_list_lockelevator_queueruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosfsavekeyring_index_keyxattr_blkaddrqrwlockfile_ra_stateuser_structerofs_xattr_long_prefixon_rqfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structcred_guard_mutexmajorsigcnterofs_attr_big_pclusterhrtimer_cpu_basecb_headcheck_quota_fileattributerestrict_linkdev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheanon_vma_chainnum_gpl_symserofs_unregister_sysfslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturninfix_lensym_pvclock_pageerofs_attr_ztailpackingserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockdev_links_infoloff_tthread_pidfscache_volumesrcu_gp_seqextra_devicesia_ranges_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_masknr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_lockevent_flagssched_delayedbd_statsbi_sizemodule_statemq_kobjlast_used_atZ_EROFS_COMPRESSION_ZSTDvm_endlast_queuednuma_migrate_retryuser_ns__statefirstiommu_groupdma_alignmentmigrate_to_ramattr_drop_cacheswait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuerofs_register_sysfsasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_arearlockfl_owner_tia_rangeeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmterofs_attr_device_tablevm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvp_indexbvec_iterctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkoom_flag_origincounterorc_unwindavailable_compr_algsWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliodebugfs_dirqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsblkcg_gqia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_terofs_sb_infos_opsysv_shmdq_counterofs_groupsutf8data_tableset_latency_tolerancefoliowake_entryxa_headsuidi_readcountblk_integritylocked_vmrb_leftseq_nexterofs_attr_compr_cfgssym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesEROFS_SYNC_DECOMPRESS_AUTOautosleep_enabledptrace_entryblkg_listrecent_used_cpunum_jump_entriesmount_opts_qcopatomic_tbv_page_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitshort intmynodepart_tblzone_wplugs_hashZ_EROFS_COMPRESSION_MAXblk_mq_opsclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRCDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalerofs_feat_ktypeem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOwait_queue_entry_televatorcurrent_may_mountseqlock_tbd_queuenuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keymemalloc_noioGRPQUOTArwsemi_private_listia_validvertical_positioni_rcumax_distance_pagesi_atime_secqc_type_statekobject_init_and_addkey_serial_tdev_ueventsetupf_lockactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadviseerofs_exit_sysfsvmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidumount_mutexattribute_groupcontextposix_timersselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_tgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizemce_kill_mephysical_block_sizeuuid_tatomic_write_hw_unit_mincount_objects_stimezone_device_datanr_active_requests_shared_tagskobject_set_namef_wb_errbase_indexdefparamfred_csq_lockdep_mapfault_flagkprojid_tptracer_credtlb_genstoreio_lock_cls_keypage_mkwritekobjectaudit_ttymce_ripvstatfstag_setnumab_stateremovablefeatureson_listkgid_ton_cpumanaged_pslotsFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedsysfs_registereddebugfs_mutexerofs_ktypewatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclaveerofs_sb_ktypebi_privatekstrtoulsp_regcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_listget_reserved_spacenon_seqstack_refcountinvalidate_lockbmapkey_payloadtimer_rand_stated_realexpiry_activedqi_max_spc_limitexception_table_entryvirt_boundary_maskevent_counts_kobjerofs_attr_sb_chksumfallocatei_spc_warnlimitbuddy_listi_ino_timelimiterofs_feat_groupi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvector__bi_cnttimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writestate_in_sysfsqf_nextrangesiommu_mmblk_features_tcutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signopacked_inodeenabledfixupsfile_operationsno_pmbi_max_vecsgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasepinspacct_structmust_resumelong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ssvolumenr_iosprintk_index_sizesymtabfree_diskrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegiddq_hashput_superpushable_dl_tasksf_flagsf_inodePROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVE__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idislotbitsdepthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_colderofs_fscachecheck_eventsssize_tiopl_emulmax_write_zeroes_sectorswork_structdesc_lensb_sizeflocktask_io_accountingmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpr_opspi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEsrcu_reader_flavorirq_safetv_nseci_lruqueue_depthgfp_maskpi_state_listrcu_segcblistsubvolattr_featurefree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infoerofs_attr_showsrcu_structrlim_curnofaultmm_countdrv_groupsstackshrinker_run_nofunctionkstrtoullki_flagsbvec_poolbd_start_sectsrcu_have_cbsd_in_lookup_hashmax_sectorssgidz_erofs_shrink_scaninitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqdma_pad_maskki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_eventsiommubi_opfprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipeblk_mq_tag_setblk_independent_access_rangess_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmodstqheads_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truehres_activeerofs_attrsbpf_raw_eventsdq_dirtydl_deferbug_listdirect_completeidr_rtxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsembd_nr_sectorsignore_childrenroot_err_pflagsrestore_earlyclock_mutexfs_supersdqb_bsoftlimitpendingmax_dev_sectorsf_task_workiowait_countset_read_onlythrotl_datas_kobj_unregisterdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesearly_initmprotectsecurityxmm_spaceactivatef_pos_lockerofs_sb_lz4_infoi_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesdomain_dataidr_nextrelax_count___GFP_THISNODE_BITbtf_fdlinelinkstart_timekernfs_nodercu_workRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEfront_padmap_local_storage_chargedup_xol_addrtstamp_type_accesscapture_controlBPF_PROG_TYPE_CGROUP_SKBnr_wakeupsBPF_PROG_TYPE_LIRC_MODE2startBPF_MAP_TYPE_SOCKHASHstart_brkstatic_key_modd_ino_softlimitxregs_state__BPF_REG_TYPE_LIMITWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocbtf_log_bufparameterszone_wplugs_lockcss_resetBPF_CGROUP_ITER_ANCESTORS_UPd_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalerofs_xattr_trusted_listnetlink_nsneed_qsarg_flagscompact_defer_shiftswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITrstat_flush_nextmap_pagesreschedule_countvfsmountcss_onlineextable_basenoinstr_text_sizeattributescached_rqsBPF_CGROUP_INET6_BINDset_child_tidblk_unique_id_overrunrestrict_linktmpfiledata_inrcu_read_lock_nestingem_perf_statemin_nrxattr_prefixestick_dep_masklistthrottle_disksi_errnoBPF_MAP_TYPE_HASH_OF_MAPSbsynce_freezememcg_lrunetkitbuffer_sizes_inode_lrumemcg_nodesrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionaluid_gid_mapPTR_TO_TP_BUFFERunpinned_netfs_wbdomain_idneed_tsof_noderefsmmap_compat_baseline_colWB_SYNC_NONEtrace_eventsenv_startcgrp_ancestor_storagedma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_statebpf_iter_init_seq_priv_tUTASK_SSTEPreal_parentlockedcgroup_tasksetVTIME_GUESTbpf_tramp_imagertpoll_next_updateregsslice_maxlast_switch_countz_idata_sizeqsize_tblkio_delay_totaltime_ns_for_childrenfilesdqb_bhardlimitgraph_rootlivevm_faultatomic_write_unit_maxpcrefs_staterun_listixolvfs_inodebd_mappingsym_vvar_pagemodule_sect_attrsmg_src_preload_nodereturn_instancearch_test_bitdst_mutexsoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayprefix_lenBPF_CGROUP_INET_EGRESSunsigned intwq_offrtpoll_taskgendiskxattr_filter_reservedfd_arrayspc_timelimits_instancesBPF_TASK_ITER_TIDBPF_SK_REUSEPORT_SELECTdescseqcountlicensetokenoom_score_adjoldbitd_seqbi_crypt_contextia_vfsgidBPF_CGROUP_INET6_CONNECTzone_typesize_tacpi_device_idmap_seq_show_elemcap_permittederofs_xattr_iterTT_NATIVEzone_pgdatclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesu64_stats_syncinfo_lenxattr_header_szrcu_tasks_idxsync_modercu_tasks_holdouttarget_listavg_write_bandwidthb_attachedpasid_activatedpi_sezonerefget_offset_ctxcore_forceidle_sum__compiletime_assert_127__compiletime_assert_129freeze_ucountBPF_MAP_TYPE_ARRAY_OF_MAPScpuhp_deads_remove_countused_map_cntjited_lensyscall_workcompletionsdevice_physical_location_vertical_positionnext_posatomic_long_tpreallocpfn_mkwriteBPF_CGROUP_INET6_POST_BINDcallback_headmemory_failure_statss_vopperf_eventf_securityi_sb_listbtf_log_sizevm_rcupgtables_bytesget_linkfmode_tdevscputime_atomicfree_after_mult_rcu_gpbpf_token__compiletime_assert_130restoredelayed_callbi_iter__compiletime_assert_134BPF_PROG_TYPE_LWT_OUTmax_nr_cid__compiletime_assert_137_statusmark_deadd_sibdma_opsbin_attributemin_align_maskpercpu_countererofs_get_aclcapabledev_groupsnuma_pages_migratedlimits_lockdl_dev_stategsindexexpires_nexti_io_listPTR_TO_SOCK_COMMON_OR_NULLf_epsrcu_barrier_seq__compiletime_assert_54__compiletime_assert_55BPF_KPTR_REF__compiletime_assert_57links_countreturn_consumerrelease_dqblkin_thrashinguaddr2css_extra_stat_show__kernel_timer_tclass_srcu_is_conditionalcss_releasedsleepableDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasemodelscan_objectspid_typewb_errcputimerbtf_sizetrace_recursionbv_lenstart_dataposix_cputimerskref__compiletime_assert_64jit_keyringsrcu_unlock_count__compiletime_assert_66file_dispblkcg_nodedax_devicercu_specialclear_child_tidf_refBPF_TCX_EGRESSextable_lenper_cpu_zonestatbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depth__compiletime_assert_159data_vm__s32entry_eiptaskstatshugetlb_usageBPF_LSM_CGROUPratelimit_states_pinsattrFAULT_FLAG_WRITEBPF_MAP_TYPE_ARENAstate_in_sysfswrite_syscallsvm_fault_tthreaded_csets_nodetty_structUTASK_SSTEP_TRAPPEDdebug_dirblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollbtf_recordac_padmemcg_idxattr_name_filterresvnr_wakeups_idleFORTIFY_FUNC_memset__compiletime_assert_164rtpoll_waitio_cqprobeelf64_symshutdown_preSCALAR_VALUElink_attach_flagslatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listctx_size_inmap_token_fdPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAbpf_iter_seq_infoextension_progmap_direct_value_addrsyscorewb_reason__s64dqi_bgraceBPF_XDP__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_panelpoweroff_latectl_tableuid_tnetdevflush_required__compiletime_assert_176procs_filesum_block_runtimepgmapmin_perf_statestrnlendq_oprcu_tasks_nvcswmap_freewritevolume_nametypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionalcan_forkFORTIFY_FUNC_strlcatfor_backgroundtail_call_reachablemeta_blkaddrdma_pools_addr_lsbctl_table_pollsaved_dst_attach_typei_generation_sigpollmxcsrdevtrange_cyclicd_rt_spc_hardlimiteminbuild_timebi_end_ioerofs_xattr_iter_inlineblk_holder_opsfreepages_delay_totaloffloadsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startBPF_MAP_TYPE_ARRAYnr_wakeups_affinewait_page_queuepteval_ti_inocgwb_listdyndbg_infocompact_cached_free_pfnindexdev_links_inforecursion_detecteddriver_datathread_headac_exe_devdev_pm_qoserofs_xattr_prefix_itembi_sectormap_typeperiod_timef_oppids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionale_name_lenpercpu_sizeerofs_listxattr_foreachdq_sbcgroup_storageposix_acl_from_xattr__UNIQUE_ID_y_665__UNIQUE_ID_y_667cgroupsighand_structflagsi_lock_keykmem_cacheinodedrivers_direrofs_read_metadatapathnameback_padbug_entryBPF_SK_MSG_VERDICT___GFP_NOWARN_BITcancel_attachwaiterscmin_fltrw_semdqio_semprev_sum_exec_runtimemap_allocnestedvalue_szrtpoll_nr_triggersnr_forced_migrationsseq_operationsnum_argsri_timerstack_canaryBPF_PROG_TYPE_SK_SKBinactiveblksizesiblingmnt_rootnext_scanunregisteringf_ravalue_recquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockbi_write_hinthash_lenget_policyshrinker_info_unitBPF_TRACE_RAW_TPnr_reclaim_startprog_btf_fd__bi_nr_segmentstask_iterssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecss_freecpu_basedquotdl_runtimechildren_min_usage__ret_do_oncenumbersswapin_delay_totalbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdxattr_prefix_countfaultableio_comp_batchshutdowndq_lockzswap_maxi_cdevldt_structenv_endobj_cgrouprescue_workqueueprogsextra1ptrace_messagenum_trace_events_sys_privatealignment_offsetopen_mutexBPF_SK_SKB_STREAM_PARSERmin_usageinit_fs_contexts_subtypeheaderfuncperf_event_contextspin_lock_offno_cgroup_ownernbp_th_nr_candcputimetlbflush_unmap_batchsoftfreepages_countcrypto_kobject__sifieldsstrlenrcu_read_unlock_specialread_byteskprobe_overridefsverity_operationswake_q_nodereplace_bpf_fdrequest_key_authvirtual_dr6attachPTR_TO_TCP_SOCKkprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksinsn_offstart_stackwatcherskmalloc_cachesrange_endcompletionreasonsw_reserved__builtin_memcmpdevice_removablebd_meta_infobio_integrity_poolbuf_lenUTASK_SSTEP_ACKactive_uprobebit_nrBPF_KPTRshow_optionsdiskbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodebpf_cgrp_storageexception_boundarycurr_nrcorememerofs_off_tsector_ttrc_blkd_cpuin_memstallpermission_utimekprobe_multimap_meta_equalget_dquotsnextentsnum_orcscma_pagesclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timermemcmps_uuiddestroy_dquots_kobjd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printkbpf_callback_tvm_operations_structbpf_trampolinebin_attrs_newerofs_bufbio_alloc_cachebi_bdev__builtin_memcpyiov_basesrcu_size_jiffiesac_pidi_statesched_classBPF_LIST_NODEfield_maskmultiprocesspi_waitersbpf_reg_typeexp_hintd_childrennregdirty_foliois_softbindcntsRPM_SUSPENDEDreclaim_stateevictedvma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGcacheline_paddingnrpages_refcounti_crypt_infoprog_flagspermissionsnr_frozen_descendantsbdi_nodeerror_remove_folioold_time32_tcore_kallsymsmemcpysrcu_parentdetachedclock_op_might_sleepenvp_idxquerycgroup_namespaceZONE_DEVICEattach_btf_obj_fd_head_1_head_2subsysload_timebd_size_lockbackBPF_RB_NODEstate_add_uevent_senti_hashhlist_nodetarget_fdio_uringtask_fd_querycore_occupationcall_get_stackftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setline_infokzalloc_noprofBPF_CGROUP_UNIX_GETSOCKNAMErcuwaiterofs_xattr_security_handlerbio_listwrite_dquotclass_read_lock_irq_is_conditionalmap_lookup_batchioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsBPF_PROG_TYPE_CGROUP_SOCK_ADDRmg_dst_cgrpprimarydevice_blocksonlineruntime_resumedup_xol_workqueuewrite_charlocal_watermark___GFP_WRITE_BITMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdevice_id_maskdio_offset_aligndelay_workoublockrecent_cidkf_opskernel_paramprog_token_fddeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexhprobecrcsBPF_TCX_INGRESSpgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrsprotectedsas_ss_flagsf_modeki_completevtime_statewakee_flipsmap_btf_idset_aclfile_name_offpids_activedriverZONE_NORMALi_opldt_usr_semHRTIMER_RESTARTwpcopy_countkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entryswap_iocbproactive_compact_triggersrcu_gp_seq_needed_expinterval_expbpf_exception_cbpath_fdaddress_space_operationsspinlock_t__task_fpstatemask__ret_oncewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startbtf_log_true_sizehuge_faultkstatfssites__lruvecDEVICE_VERT_POS_UPPERret_flagsmem_cgroup_reclaim_iterevents_lockptracequota_disablekprobe_blacklistwork_lockcpus_ptrnotified_atpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsyskswapd_lockqueue_kobjdirty_limit_tstampsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tflatdevmax_integrity_segmentspgprotbstatfalseremovedshow_pathPIDTYPE_TGIDreal_func_cntcurr_ret_depthac_utimeverified_dummy_pkeyiommu_mm_datamce_countswap_info_structsequenceBPF_MAP_TYPE_SOCKMAPrt_spc_warnlimitac_flagexpected_attach_typecoredump_datavm_stattasksmem_cgroup_per_node_pidaddress_spacemm_context_t__q_sizeuid_gid_extent__call_single_nodestartupsrc_regchunkbitsof_device_idseqcount_spinlock_tbio_issuei_wbcss_local_stat_showhas_elevatorpanelclass_id__read_overflow2_fielderofs_kmap_typeinactive_timer_pkeyfilenames_export_opwrite_u64__mptrstashedvm_page_protrelax_counttimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockBPF_CGROUP_INET6_GETPEERNAMElowmem_reserveerofs_breadpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsext_mutexdestroy_inodegetxattrrelease_foliolast_busyi_pipebaseforce_scanhostuaddris_funcfailedcgrps_wb_errold_subtree_ss_maskshm_clistis_child_subreaperunicode_mapnum_descscontiguousrecoveredexec_vmrw_copyfscrypt_inode_infost_name__SCT__might_reschedmmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfounusedalloc_inodeBPF_STRUCT_OPSmap_mmapuser_event_mmKMALLOC_RECLAIMd_inameraw_tracepointdevres_headi_mappinginblockrmidkfunc_tabrseq_sigBPF_PROG_TYPE_RAW_TRACEPOINT_WRITABLEdev_pm_domainattach_btf_idlimit0limit1nr_zonespages_skippedmigrate_modeBPF_PROG_TYPE_LWT_XMITbio_poolfree_areakswapd_failureszswap_lruvec_stateftrace_callsitesd_hashis_confidentialdl_bw__real_strnlenkobjfsyncmtd_infoerofs_getxattr_foreachlru_gen_mm_listi_flagsprobe_offsetbpf_kfunc_btf_tablimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodemap_poke_runblk_queue_statspushable_tasksBPF_CGROUP_UNIX_RECVMSGplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapmap_alloc_checkalloc_dquotpm_messagemay_splitlinfo__q_size_fieldmem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackstat_thresholdlevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventhlist_heads_encoding_flagsrunnable_weightincrallowed_attachsbpf_fdstack_vmusage_count_folio_nr_pagesinsnsshowunsigned charzone_start_pfnvdso_test_bitmemtiermmap_legacy_basepipe_inode_infononresident_ageBPF_MAP_TYPE_INODE_STORAGEpriv_stack_requestedsecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollmap_extrabi_poolcompat_uptr_tuevent_opsWB_REASON_FORKER_THREADpoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BITblinding_requested___GFP_DIRECT_RECLAIM_BITsubtree_ss_masks_vfs_rename_mutexsuspend_latewakeupcg_listpi_offsetcgwb_release_mutexsrcu_barrier_completionip_epilogue__compiletime_assert_56wb_completionshrink_control__compiletime_assert_58written_stamp__compiletime_assert_59driver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapspan_seqlocksessioniddtorbi_flagslast_bdp_sleep_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1dax_devBPF_REFCOUNTllistnop_posix_acl_accessZONE_DMAdebugfs_entrybpf_attach_typeelemnr_retriescgwb_frnavg_refaultedsigval_talimitundo_listKMALLOC_RANDOM_STARTlinkagercharZONE_MOVABLEnr_populated_domain_childrenmissedkswapd_highest_zoneidxreport_zonesparent_could_setfcapquota_readst_shndx__compiletime_assert_63free__compiletime_assert_65pageset_high_maxs_fscachei_wb_frn_avg_timexdp_has_fragsbd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolfunc_infoprog_idsinitfiles_structwrite_iterPTR_TO_MEMfunc_proto_unreliables_securitys_dio_done_wq_dummy_bndmin_unmapped_pagessas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typewb_tcand_idmtimeserver_has_tasksswap_events_filezone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_thigh_worknode_zonelistspathst_sizenr_frozen_taskserofs_xattr_prefixes_initlru_gen_foliormtpbpf_cookiewait_sumnum_tracepointsupidexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalline_offconsumersrtpoll_min_periodkernfs_elem_symlinkfini_seq_private__compiletime_assert_160clock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workkeyring_semsrcu_n_lock_retriesi_fopsa_handlernew_map_fd__compiletime_assert_167unlinkperiod_contribforceidle_sumrcu_node_entryfeature_compatstart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opstailcall_bypassiopollpagesizedisk_names_blocksizevm_pgofftimesauprobecan_swaperofs_xattr_ibody_header__retrelease_agent_worknuma_workerofs_getxattrenforce_expected_attach_typeupdate_timeptrace_dr7priorityduration_call_addrexpiremax_segmentsloginuidcheckrtpoll_untilexpiryBPF_TRACE_FEXIToptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkgnbp_rl_nr_candtailcall_target__lstate__compiletime_assert_173BPF_MAP_TYPE_CGROUP_STORAGEupdated_nextueventlock_countrefcount_tcset_linksplugchild_countsaved_auxvinosmce_addrlast_bstatnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsinner_map_fdmod_namemm_cidFORTIFY_FUNC_strnlenmemory_tierunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalorig_objcgrseq_csnum_ftrace_callsitesPTR_TO_XDP_SOCKsoftirq_expires_nextioctlPTR_TO_BTF_ID_OR_NULLreadlinkmigration_flagsbtf_key_type_idBPF_CGROUP_UDP6_RECVMSGa_rcunode_zonesnbp_th_startelow_pincountBPF_LIST_HEADtreerq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmapunreliablemin_seqlist_headlru_lockbtf_flagsWB_REASON_FOREIGN_FLUSHtgidbatchedBPF_LIRC_MODE2for_reclaimmax_pclusterblkswrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holderbpf_prog_opsend_codeblkio_countqspinlockBPF_TRACE_UPROBE_MULTI__kmalloc_large_noproflru_geninsnfilldir_tfolio_batchlow_usage__must_check_overflowdl_non_contendingdir_contexterofs_dev_contexttracepoint_ptr_tutaskfailcntrelative_fdsched_entityd_spc_hardlimitmq_freeze_wqlockdep_keyPTR_TO_TCP_SOCK_OR_NULLlong unsigned intsleep_maxmmap_baserescue_workio_contextrevisionquiesce_depthhctx_tablegpl_symsgroupseq_showctl_nodeswait_queue_headBPF_CGROUP_SOCK_OPScow_pageinumac_btimeblocki_spc_timelimitlog_bufreturn_instanceszone_wplugs_hash_bitsbpf_map_typesched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinki_private_listhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgarch_clear_bitnoderesetfor_kupdatevm_lockwb_tcand_bytesno_cgroup_migrationbuild_time_nsecnextevts_writers_key__countxcomp_bvcma_areastatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatipc_namespaceexec_update_lockBPF_MAP_TYPE_PERCPU_HASHarch_set_bitatomic_write_hw_maxl1d_flush_killfunc_idxi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimeaddrsstate_remove_uevent_sentread_charnop_posix_acl_defaultfirst_minorcgroup_nsia_sizein_hrtirqs_master_keysconst_test_bitac_stimescaledwchar_addr_bndkernel_symbolsubsys_databi_statusnr_cgrpstv_secma_lockmap_poke_trackpid_ttask_listftrace_sleeptimeprog_ifindexrun_nodeblock_device_operationsma_rooturing_cmdpsi_filesnr_failed_migrations_affineIS_ERRuser_cpus_ptrirq_delay_totalpi_top_taskbtf_fieldBPF_CGROUP_INET4_GETSOCKNAMEBPF_PROG_TYPE_CGROUP_SOCKbtf_vmlinux_value_type_idactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writehlist_bl_nodest_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthBPF_CGROUP_INET_SOCK_CREATEmax_seqi_sizedl_deadline_hugetlb_hwpoisonpsi_group_cpuubufksm_rmap_itemstest_run___GFP_HIGHMEM_BITnr_populated_csetsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tmap_nameautaskBPF_GRAPH_NODEsleepable_refcntuser_namespacevfsuid_traw_spinlockkswapd_waittimer_autosuspendspudval_t__rcu_headBPF_MAP_TYPE_TASK_STORAGEmce_vaddrquota_offxattr_prefix_startdq_inusecachedqi_flagskeyring_name_listfile_costBPF_PROG_TYPE_PERF_EVENTkfreeBPF_PROG_TYPE_SCHED_ACTread_posstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuealloc_factordqi_dirty_listpinswait_on_bit_lockmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenerofs_sb_has_xattr_filterh_reserved2codegtimenr_populated_threaded_childrensigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listsched_rt_mutexlocked_pendinghlist_nulls_nodenr_deferredfown_structfeatures_lockedlruvec_statstracing_graph_pauseavg_triggerspermcompat_robust_listbi_blkgnr_hw_queuesktypelockrefin_dpm_listsrcu_struct_ptrsBPF_PROG_TYPE_SOCKET_FILTERmm_structrtpoll_wakeupvlagi_uidbpf_prog_auxref_ctr_offsetstablesbi_iocost_costspinlocknr_dying_subsystimestampspid_namespace_syscallmod_arch_specificmax_write_lennum_static_call_sitesend_pfnvm_mmvalue_type_btf_obj_fdfortify_memcpy_chkdebugfs_idwb_lcand_bytesguest_permtype_idmem_dqinfotrueBPF_CGROUP_UNIX_CONNECTi_countHRTIMER_NORESTARTpart0WB_SYNC_ALLbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipcgwb_treeBPF_MAP_TYPE_CGRP_STORAGEufdsexe_fileipc_nserofs_mount_optspcp_listpid_linksfree_countBPF_CGROUP_GETSOCKOPTs_sysfs_nameBPF_SK_REUSEPORT_SELECT_OR_MIGRATEq_size_fieldrefcountvaddrrequestpglist_datarw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ippage_counterlog_sizeoffload_requestedqc_dqblkbpffs_fdfprop_local_percpuavg_next_updatemmappedseqcount_raw_spinlockbd_holder_dirdst_neededname_totalcpu_run_virtual_totalelem_countvalueskill_sbbtf_func_modeld_opMIGRATE_ASYNCdevice_dma_parametersproc_ns_operationsi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failthrashing_countllist_headbyteswait_startf_freeptrnr_freeclass_raw_spinlock_irqsave_try_is_conditionalcore_relo_rec_sizemap_nr_maxget_dqblk__ret_condshow_fdinfofixuprefcount_offBPF_PROG_TYPE_SYSCALLset_ownershipposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqerofs_xattr_prefixpreempt_notifierskernel_read_file_strsrcu_last_gp_endenable_statsbdi_ids_fsnotify_infoinit_user_nscpu_delay_totaluser_keyring_registermempolicyadj_offpm_message_te_permioveci_private_locksegment_boundary_maskVTIME_IDLEjited_linfostatic_keyremovehooknums_magicdl_overrunallocd_parentonline_cntpayloadac_minflti_sbmin_ratiokmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxfunc_info_cntatomic_open_zonerefsbio_end_io_tbtf_log_levelstart_prevent_timeBPF_FLOW_DISSECTORlru_zone_sizecondreadahead_controlblk_tracertpoll_timerdirty_limit__kernel_gid32_tcompact_init_free_pfnkernfs_open_filestate_maskf_credbpf_line_infoMODULE_STATE_COMINGnotify_countmg_dst_csetoffline_disabled__empty_rangesbd_devread_newsignalfd_wqhmmapmodnameused_maps_mutexasync_put_workmknodfsnotify_sb_info__sigrestore_tbi_idx__kernel_loff_tdetachget_unmapped_areadev_pagemaproot_nidwritepagessched_statisticsheadBPF_PROG_TYPE_LWT_SEG6LOCALsync_decompressminors__empty_insns__state_permuprobe_taskselfwriteback_controlattach_typeuclampsuper_operationsbi_cookiesplice_eofnr_threaded_childrenutil_avg___GFP_DMA_BITtaskrlimiterofs_xattr_trusted_handlersched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAnetfilterbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETcapabilitiesctx_iddirty_ratelimitd_rt_spc_warnsctx_inh_name_filterq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsBPF_PROG_TYPE_TRACEPOINTWB_REASON_MAXiopriocap_inheritablegp_waitlookupcostdev_pm_infoexpected_revisionpacked_nidbtf_dtor_kfunc_tblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsevents_fileFORTIFY_FUNC_memscanrelative_idntimekfunc_btf_tab__builtin_strlenvm_private_dataio_bitmapksymBPF_TRACE_KPROBE_SESSION__bi_remainingsubtree_bstatuprobe_task_statetimerkobj_typeb_dirty_timediskseqi_pagesBPF_MAP_TYPE_STACKZ_EROFS_COMPRESSION_DEFLATEatomic_write_hw_boundaryz_advisehlist_bl_headino_warnlimitpfmemalloc_waitarch_uprobe_taskfasyncpidlistsi_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecfdevsysctlsprotection_supportfd_typemax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkvm_node_stat_diffbio_slabd_alias__iovcpumaskdumpernode_size_lockwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimes_rootsBPF_MAP_TYPE_PERCPU_CGROUP_STORAGEwrite_bandwidthd_rt_spc_timermap_redirectevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsBPF_PROG_TYPE_SOCK_OPSbuflensaved_trap_nrdatalayoutbio_crypt_ctxfreeze_fsuserfaultfd_ctxBPF_MAP_TYPE_CGROUP_ARRAYsigset_tcapacityftrace_opsrq_countrunningrseq_event_masks_rootra_pageslegacy_cftypesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitsBPF_CGROUP_ITER_SELF_ONLYpage_freeread_syscallshlist_nulls_head_nr_pagesparentnode_offsetatimecopy_file_rangebpf_prog_statstask_cputime_atomicbtf_token_fduser_definedBPF_MAP_TYPE_DEVMAPkey_typecgrp_linkslaunder_foliocurr_targetstack_depthis_suspendedarch_test_and_set_bite_taguts_namespacefor_synctimeout_workburstetypeei_funcsmodule_kobjectmemoryorderactive_memcgbpf_local_storage_mapdef_flagsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0rtpoll_totalno_updatecap_bsettagged_writepagesopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areaBPF_MAP_TYPE_LPM_TRIEsaved_statekernfs_elem_attrBPF_CGROUP_INET_INGRESSbasess_bdev_filenuma_faultsperiodcgroup_subsysprog_nameattach_func_namefile_offsetlinux_binfmtpage_table_lock_sigfaultmax_sync_decompress_pagescounterskasan_check_readname_linknr_charged_byteswait_bit_keycmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_typerstat_css_list__compiletime_assert_62policysharedmap_get_next_keynet_devicexattr_shared_xattrswait_queue_entrydismissd_real_typelookahead_bandseq_starttask_cputimerq_qos_mutexraw_blkaddrzone_wplugs_wqclear_bit_unlockraw_lockd_dnameac_schedmax_hang_timecpus_mask_pad_b_dirtysubdirscgroup_bpftask_groupinitializedstarttimemmap_missswap_peaksquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamelogical_block_sizerun_delaytailsvmstatsblk_flags_tlinenoz_algorithmtypebi_io_vecbpf_progbase_pfnstatBPF_NETFILTERget_inode_acl_addr_pkeymigrate_foliocustom_slicespanned_pagesthread_keyringeffectiveexception_cbkparam_arrayutimez_fragmentoffstart_codemap_for_each_callbackset_bitis_hardfsbaseprog_bind_mapblk_status_tac_uidinsn_idxBPF_CGROUP_INET_SOCK_RELEASEBPF_MAP_TYPE_PROG_ARRAYattrspercpu_drift_markallowed_cmdscpumask_tgid_mapswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axtarget_btf_idbd_claimingcompletesched_rt_entitymight_reschedtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__empty_insnsinr_cached_objectsia_mtimetrc_ipi_to_cpudirty_exceedednodeinfomxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldis_seentest_and_set_bitBPF_MAP_TYPE_XSKMAPdiscard_granularityBPF_TASK_ITER_TGIDfopstotalreservedmap_fddev_boundlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetrstat_cpudst_progtime64_tBPF_CGROUP_DEVICEnuma_faults_localityhas_child_subreapersock_fprog_kerni_aclmap_release_uref___GFP_ZERO_BITwrite_newwb_listcgroup_freezer_statelist_lockpm_domaininstrument_atomic_read_writecpu_bitmapucount_maxstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statepageset_high_minsoftirq_next_timermap_update_elemctx_outpresent_early_pagesmax_active_zoneszone_wplugs_poolBPF_PROG_TYPE_SK_MSGcheck_flagshandlerswp_entry_tbi_inline_vecsmemcg_css_mapcountmap_iddomain_taghang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keybpf_prog_offloadset_performance_statephys_addr_terofs_xattr_iter_sharedclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryimplicit_on_dflk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacac_exe_inodenr_to_scanthreaded_csetsDEVICE_PANEL_UNKNOWNfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtpi_bytesdma_cleanupwake_up_bitmaple_treeKMALLOC_DMAdentrylast_mergecpu_itimerfscache_cookiepercpuget_unique_idprogs_hlistrel_deadlinezone_capacityclass_spinlock_try_is_conditionalper_cpu_zonestatsDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkattach_btfpushmm_walkdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesBPF_SPIN_LOCKstart_all_reasonBPF_PROG_TYPE_RAW_TRACEPOINTrangepageset_batchcgroup_base_statfutex_exit_mutexmap_lookup_elempm_onlykernfs_iattrsbpf_func_statecompact_blockskip_flushtrc_blkd_nodewriteback_inodesd_spaceWB_REASON_PERIODICgraveyard_linkwritecntblkszbitsxol_vaddrsplice_readElf64_Addrd_rt_spacenameBPF_MAP_TYPE_PERF_EVENT_ARRAYread_s64blk_mq_ctxbi_iopriou_flagsnvcswac_tgetimeKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERout_batchshared_pendingi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typehighi_rdevblk_integrity_checksumlist_lru_nodeself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEstopnr_migrationsa_opsreq_listxa_flagsfreezebin_sizeclosegrphi___GFP_RETRY_MAYFAIL_BITerofs_domainerofs_xattr_generic_getnr_sectorscftyped_spc_timerjump_entrieslink_idsctl_dirasync_suspendmsi_device_dataassoc_array_ptrsuper_blockFORTIFY_FUNC_UNKNOWNset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqbmm_stateuidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keymemory_events_localBPF_TRACE_UPROBE_SESSIONnum_symsmodule_notes_attrsvm_lock_seqpdeath_signalgenerationPIDTYPE_MAXroot_listBPF_CGROUP_UNIX_GETPEERNAMEnlinkcpu_countdefault_setavg_totalpercpu_refns_commonhorizontal_positionmanaged_cacherlimit_maxpref_node_forkwait_queue__int128reclaimeddqi_privchunkformatrss_statmap_local_storage_unchargemems_allowed_seqrefcntthawD_REAL_METADATANOT_INITget_nextdqblks_fs_infocrypto_profilefutexwait_maxac_niceresult_maskBPF_MAP_TYPE_DEVMAP_HASHstate_syncedpp_magice_namedquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightip_after_callvm_file___GFP_COMP_BITidr_basei_blockskswapd_orderuser_sizedev_pm_opscdrom_device_infoscheduledfsidFAULT_FLAG_TRIEDused_mapsclass_raw_spinlock_nested_is_conditionalworker_privateis_reltag_sizeset_dqblkkmalloc_typeqstrma_flagsnr_ia_rangestarget_ifindexBPF_WORKQUEUEmax_user_discard_sectorsfreeze_mutexfutex_statenr_linfoBPF_CGROUP_UDP4_SENDMSGorig_pmdqueue_lockacct_timexpds_op__rcu_icq_cachemax_tp_accessBPF_PROG_TYPE_KPROBEsizefree_after_rcu_gpZONE_DMA32lnodeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_twb_switch_rwsemtask_fragsrcu_gp_mutexdatalenCONST_PTR_TO_MAPPTR_TO_FUNCnr_wakeups_affine_attemptscache_strategy__le16alt_lencinblockextablePTR_TO_FLOW_KEYSexitcompact_considereditemskernel_param_opsbus_dma_regionio_uring_cmddirtied_whenused_btf_cnt_batch_countac_utimescaled__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexbpf_prog_arraycore_statehas_callchain_buftimerqueue_headBPF_TRACE_FENTRYf_wb_errserial_nrout_of_line_wait_on_bit_lockdeferred_split_queuefutex_pi_statekstat__kernel_uid32_t__le32q_lock_cls_keysubsys_maskDEVICE_FIXEDZ_EROFS_COMPRESSION_LZMApte_tdevice_driverdying_tasksdl_server_has_tasks_frunnable_sumDEVICE_PANEL_TOPreal_credsysfs_dir_lockbpf_ctx_arg_auxcancel_forkepoll_watcheslink_createprealloc_ptekcompactd_waitdqb_curspacegp_statebitsetload_avgaccesscstimeBPF_MAP_TYPE_USER_RINGBUFcfs_rq_uidposix_acl_entrya_refcountbpf_kfunc_desc_tabst_spacemm_cid_next_scanns_typekptrmap_check_btfdfl_cgrpac_majfltposix_cputimers_workproc_handlerbpf_iter_aux_infomodule_param_attrsshort unsigned intwatermark_boostunitelem_flagscpu_scaled_run_real_totali_mutex_dir_keyq_nodespc_warnlimitctl_table_sizeextents_encodingiter_infogpl_crcsorc_entryBPF_CGROUP_INET4_GETPEERNAMEkeysBPF_XDP_DEVMAPerofs_xattr_copy_to_bufferperiod_timerorig_ptedqb_curinodesnbp_thresholdload__s8hashbitPTR_TO_CTXcss_allocinvalidate_lock_keydma_maskprealloc_mutexnanosleep__already_doneobjcg_listsock_filtereventdq_dqb_lock__kernel_ulong_tvolnamelruvec_stats_percpuio_minerofs_inodeerofs_nid_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefixextra2map_peek_elem__u8is_roxlockcompact_cached_migrate_pfnrlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onezswap_writebacknr_argsdevice_physical_location_horizontal_positionBPF_MAP_TYPE_PERCPU_ARRAYseeksseq_stopkf_rootPTR_TO_MAP_KEYkiocbbv_offsetclass_rwsem_read_intr_is_conditionalcompact_order_failedjit_requestedfsuidctl_table_argbtf_typecompact_init_migrate_pfns_blocksize_bitsnuma_scan_periodmanaged_pagesutil_summigration_disablediter_typepositionclass_device_is_conditionalattach_func_protomax_entriesshrinker_idbio_setrootprojid_mapoom_reaper_listnr_reserved_highatomicdev_stateattach_bpf_fdsym_VDSO32_NOTE_MASKrtpoll_scheduledbpf_storagebpf_map_opsmap_delete_elemno_callbacks__u16timers_activewait_countmap_get_unmapped_areasig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedseq_opsEROFS_KMAPwork_listdiscard_alignmentraw_spinlock_tkey_tagopen_flagsfs_flagswordworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstkkernel_load_data_strsrcu_ssppage_orderwake_irqcan_attach__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialverified_insnsHPROBE_GONExattr_shared_countvalue_sizeactive_timethrashing_delay_totali_sequenceZ_EROFS_COMPRESSION_LZ4pool_datapgdatbtf_field_typetailcall_target_stabledisk_statsinit_seq_privatedqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_privateuprobe_multi_perfi_dir_seqbpf_attrkqiddefer_syncKOBJ_NS_TYPE_NONE_watermarkBPF_MAP_TYPE_HASHswap_activatemkobjcore_cookiesrcu_supd_deleteb_more_ioPRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqfile_flagschange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeBPF_PROG_TYPE_NETFILTERmf_statsBLK_INTEGRITY_CSUM_CRC64f_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumBPF_MAP_TYPE_PERCPU_CGROUP_STORAGE_DEPRECATEDPTR_TO_PACKET_ENDblindedPTR_TO_SOCK_COMMONf_pathpidlist_mutex__u64journal_infoarenaFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_trueb_ioweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsBPF_TIMERbpf_arenaBPF_MAP_TYPE_STRUCT_OPSclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_snext_keypinned_vmnode_start_pfn_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startsrcu_gp_seq_neededBPF_SK_SKB_STREAM_VERDICTret_sizeunused_hctx_lists_flagsfaultcur_imageerofs_xattr_handlersalternative_gpt_sectorshow_statsdl_densityfreeptr_tallowed_progsread_dqblkac_gidintegritydq_flagserofs_xattr_entry_sizeDD_CLASS_TYPE_DISJOINT_NAMESp_sizedata_size_inmemcg_datatracepoint_extline_info_rec_sizekprobes_text_startrunnable_avgs_time_granrepeatBPF_PROG_TYPE_STRUCT_OPSkernel_cap_tnon_rcuwait_listrequest_pendingdworkhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_countBPF_CGROUP_INET4_BINDs_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITavgs_worknum_kpin_execvetlb_flush_pendingtail_callRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceBPF_MAP_TYPE_QUEUEversionmax_descendantswb_lcand_idserialclass_releasealloc_lockname_offs_dquotmax_hw_sectorsfolioqfoliosthreadedupdated_childrenprev_posdelayedseqcount_spinlockexpire_countftrace_manageduid_maps_umountis_bin_visiblepgoffsyscall_user_dispatchumount_beginnr_disk_swapinsrcu_tasks_exit_listbpf_jit_poke_descriptorarchdataia_uidBPF_MAP_TYPE_REUSEPORT_SOCKARRAYarg_sizechildrenrb_subtree_lastno_pm_callbacksbuild_id__p_lenrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_padmap_fd_put_ptrBPF_CGROUP_SYSCTLtailia_atimeinfixtlb_ubcWB_REASON_LAPTOP_TIMERprog_typebi_issuequota_format_typedev_privignoredvmstats_percpuiter_createtask_structanon_costrelease_dquotsrcu_n_exp_nodelaysuspend_timerprog_cntquotalenPTR_TO_SOCKETtotalreserve_pagesf_pipei_wb_frn_historylast_wakeenextjits_use_priv_stackmin_slab_pagesio_tlb_memarch_spinlock_tsubmit_bioblk_flush_queuenr_tasksi_mtime_nsecperformancemmlisthd_geometrysuppress_bind_attrsRPM_RESUMINGd_weak_revalidategsbases_quota_typeswrite_s64f_llistmq_freeze_lockhigh_maxdax_part_offin_batchread_u64i_nlinkbranchwrite_begingroupsBPF_PROG_TYPE_CGROUP_SOCKOPTpi_blocked_onbypass_addrs_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalBPF_CGROUP_INET4_CONNECTbtf_value_type_idsyscrpkey_allocation_mapki_ioprioattributes_maskarch_clear_bit_unlockBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_treclaim_waitfbatchnr_writeback_throttledlink_idshareFORTIFY_FUNC_strscpypagefault_disabledstate_startsyscwnr_memcgsopt_failedil_prevwlockedfreeze_superPTR_ERRs_inode_list_lockalignelevator_queueruntime_idlebpf_cgroup_storagesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICoffline_nodequota_enablesched_avgntabzonedevice_typemaj_flth_shared_xattrsarch_rwlock_ttree_scannedclock_basecdevmy_qgroup_leadermkdirzoneliste_csetsreal_blockedarg_locknum_exentriespid_ns_for_childrenlaptop_mode_wb_timerlower_firstrequeue_workbio_splitint32_tio_pagesoffset_ctxcur_ktimemap_lookup_percpu_elemnr_failed_migrations_runningcompact_delay_totalclassesnext_timerclass_write_lock_is_conditionalerofs_ilocbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosmap_lookup_and_delete_batchfsavekeyring_index_keyxattr_blkaddrqrwlocksplit_queueoverflow__p_sizefile_ra_statemax_depthuser_structerofs_xattr_user_handlerbtf_mod_pairBPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATEDerofs_xattr_long_prefixon_rqPTR_TO_STACK__p_size_fieldfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDerofs_blk_tprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGerofs_xattr_user_listlast_old_flushnext_offsetcommit_dqblknamespacei_ino_warnlimitdirtied_stampatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclassjited_imagecgroup_atypelast_mm_cidmax_open_zonescookiebd_stamptargethigh_minmap_pop_elema_flagstrace_overrunwriteback_sync_modessession_keyringcpusfop_flagsSYSCTL_TABLE_TYPE_DEFAULTkey_restrict_link_func_twb_bytess_maxbytesreal_timerd_ino_countlast_cpumap_push_elemilenmnt_flagsvm_structmemory_peakscred_guard_mutexmajorsigcntfiltershrtimer_cpu_basepriv_stack_ptrcb_headcheck_quota_fileFORTIFY_FUNC_memchr_upperattributeclass_raw_spinlock_is_conditionalgpl_compatibledev_archdatai_deviceskey_perm_tcss_rstat_flushbio_integrity_payloadrescue_listswappinesspi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsxattr_prefixrescue_locklist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offsetkaddri_opflagslink_fdlast_subtree_bstatrobust_listmap_lookup_and_delete_elemsym___kernel_rt_sigreturninfix_lenBPF_XDP_CPUMAPsplit_queue_locksym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctlctx_arg_infolockdep_mapfiltercurr_ret_stack__compiletime_assert_451dockcgroup_fileforwardstart_idloff_tthread_pidfscache_volumesrcu_gp_seqcore_relo_cntextra_devicesia_rangescgroup_rstat_cpu_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevmap_delete_batchmap_poke_untrackcallsi_default_acls_uuid_lenioc_nodemm_statsof_node_reusedinsnlenclass_map_typePROBE_PREFER_ASYNCHRONOUSicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1iter_info_lenmatchmemory_typerb_rootnr_wakeups_localwait_bit_action_fnr_requestsHPROBE_STABLEresume_noirqrq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpaddingmax_prop_frac__fillersaved_sigmaskd_timePTR_TO_PACKET_METAentriescpu_idfop_flags_t__MAX_NR_ZONESFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secmax_pkt_offsetevent_flagssched_delayedbd_statsbi_sizemodule_state__write_overflow_fieldmq_kobjlast_used_atmemcg_vmstatserofs_put_metabufZ_EROFS_COMPRESSION_ZSTDvm_endlast_queuednuma_migrate_retryuser_ns__statefirstiommu_groupdma_alignmentmigrate_to_ramwb_domainwait_pidfdptrace_bpss_umount_keymax_ratiovm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctime__fortify_strlenBPF_MAP_TYPE_SK_STORAGEFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progressattach_btf_traceavgs_locksrcu_barrier_mutexBPF_SK_LOOKUPi_private_dataElf64_Halfbw_dworkBPF_CGROUP_ITER_DESCENDANTS_POSTcompact_countFORTIFY_FUNC_memcpynsproxycan_wakeupbtf_idBPF_UPTRxol_areaBPF_MAP_TYPE_CPUMAPBPF_PROG_TYPE_SK_REUSEPORTrlockfl_owner_tPTR_TO_ARENAkey_size_reslink_detachia_rangeeuidwaitbug_tabledirtied_time_whensequential_io_avgoom_grouptimer_offnum_trace_bprintk_fmtmap_set_for_each_callback_argscpu_run_real_totalvm_policyperf_rdpmc_allowedrdevprivate_dataretvalsignumfscrypt_keyrings_mountsuse_memdelaycalledRPM_ACTIVEcookies__state_sizecallerthread_structcached_requested_keyenvpout_unlock_indexbvec_iterper_cpu_pagesctimereleasemax_segment_sizenr_pagessched_dl_entityBPF_PROG_TYPE_CGROUP_DEVICE__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_idmap_owner_storage_ptrs_dentry_lrubp_offsetnet_nsblk_crypto_profileattach_tracing_progfolio_queuelast_task_numa_placementnr_descendantspgtable_tblock_startmap_direct_value_metacgtimeWB_REASON_VMSCANsymlinkoom_flag_origine_uidcounterorc_unwindavailable_compr_algsWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcusocket_pressureki_waitqnotify_timerverifier_zexttrace_eval_mapCONST_PTR_TO_DYNPTRdonesuspendxattr_handler_can_listfscrypt_operationsrelease_workWB_REASON_FS_FREE_SPACEksm_zero_pagesmap_lookup_elem_sys_onlymountDD_CLASS_TYPE_DISJOINT_BITSac_btime64__BPF_REG_TYPE_MAXmg_dst_preload_noderatelimitfree_foliodebugfs_dirBPF_KPTR_UNREFBPF_PROG_TYPE_UNSPECqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaswapin_countdl_timeri_dataDL_DEV_NO_DRIVERrstat_css_nodeFAULT_FLAG_ORIG_PTE_VALIDinner_map_metasysv_semanon_vma_namefileattrwatermarkavg_nr_triggersfprop_globallong long unsigned inttoken_createanon_nameopen_partitionsblkcg_gqhashia_filesival_intnuma_preferred_nidinstrument_atomic_write_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uproberecord_Boolsleep_starttnodemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatemm_listcss_idri_linklistxattr_lowertrap_nrbinfmt_miscasync_probe_requestedcompat_long_tac_etimeactive_counts_iflagsprevent_sleep_timemce_kflagslog_true_sizenext_idtotal_numa_faultss_countdev_msi_infod_revalidatectx_size_outbus_groupsentry_szpmd_terofs_sb_infomnt_namespacequery_flagsnode_spanned_pagessysv_shminstrument_atomic_readdq_countutf8data_tableset_latency_toleranceprocessedjit_dataz_idataofffoliowake_entryBPF_CGROUP_SETSOCKOPTxa_headsuidi_readcountBPF_LSM_MACblk_integritylocked_vmrb_leftmg_src_cgrpseq_nextBPF_CGROUP_ITER_ORDER_UNSPECsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditional__MAX_BPF_MAP_TYPEbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countmemcg_completionsbpf_cgroup_iter_orderksm_merging_pagesfree_listautosleep_enabledptrace_entryblkg_listuse_autosuspendrecent_used_cpunum_jump_entriesxattr_handler_mapmount_opts_qcopatomic_tbv_pagealloc_tag_counters_flagsrqos_debugfs_dirnotify_nexte_cset_nodebus_dma_limitbuffershort intmynodepart_tblzone_wplugs_hashZ_EROFS_COMPRESSION_MAXblk_mq_opsPTR_TO_MAP_VALUE_OR_NULLwb_waitqPTR_TO_BUFclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invcss_offlinepad_untilDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2kern_versiondestroy_rworklast_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datanr_extentsnr_scannedpoll_table_structprogs_cntfifodirect_IOwait_queue_entry_televatorpcpucurrent_may_mountseqlock_tbd_queuenuma_scan_offsetcgroup_subsys_stateold_map_fdnr_free_highatomicmax_rdwr_access___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskfreezer__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTArwsemi_ctime_nsecia_validSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYvertical_positionvirtmemFORTIFY_FUNC_strncati_rcuBPF_MAP_TYPE_LRU_PERCPU_HASHe_name_indexmax_distance_pagesi_atime_secBPF_CGROUP_INET4_POST_BINDmap_gen_lookupqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BIT__read_overflowBPF_PROG_TYPE_FLOW_DISSECTORactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxnew_prog_fdpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listcall_get_func_ipxarray_start__flagsp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidumount_mutexBPF_KPTR_PERCPUtree_reclaimedattribute_groupcontextposix_timersper_cpu_nodestatselectorblkcg_polsMEMORY_DEVICE_PRIVATEmap_flagsdev_releasebi_nextdefault_timer_slack_nskcsan_check_accessbpf_iter_fini_seq_priv_tsource_listbpf_iter_task_typeRPM_REQ_NONEswap_readahead_info__fpstateactive_reftracingpmdval_tctl_table_root___GFP_NOFAIL_BITgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizebit_waitdfl_cftypesctx_arg_info_sizedeferred_splitjitedmce_kill_mephysical_block_sizeuuid_t___GFP_UNUSED_BITatomic_write_hw_unit_minBPF_TRACE_ITERcount_objectsctl_table_setcore_relosq_size_stimezone_device_datakcompactd_max_ordernr_active_requests_shared_tagsdst_regpeaks_locki_flctxbase_indexBPF_GRAPH_ROOTdefparama_countsaved_errfred_csq_lockdep_mapmap_releasefault_flagprobe_addrkprojid_tptracer_credtlb_gencgwb_domainio_lock_cls_keypage_mkwriteBPF_CGROUP_INET6_GETSOCKNAMEkobjectaudit_ttyvariable_test_bitrtpoll_triggersmce_ripvstatfsctl_table_headertag_setnumab_stateattach_prog_fdremovablePTR_TO_BTF_IDfeatureson_listPTR_TO_SOCKET_OR_NULLkgid_ton_cpumanaged_pslotsFAULT_FLAG_VMA_LOCKBPF_TASK_ITER_ALLfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistmap_update_batchstoragesremainingclass_groupsallowed_mapsBPF_MAP_TYPE_BLOOM_FILTERpsi_groupnuma_nodeoffsetsi_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedbdi_listPTR_TO_MAP_VALUEdata_size_outdebugfs_mutexwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opssequential_iocb_accesstime_namespacebypass_spec_v1_large_mapcountsda_is_staticformatftopenclavebi_privatecreateiattrrseqprog_fdnfdssigvalvma_lockmax_discard_segmentsperf_event_listgetgeoget_reserved_spacenon_seqstack_refcountinvalidate_lockbmapERR_PTRerrorkey_payloadtimer_rand_stated_realancestorstot_write_bandwidthxxh32expiry_activeBPF_CGROUP_UNIX_SENDMSG__compiletime_assert_47__compiletime_assert_48__compiletime_assert_49dqi_max_spc_limit__compiletime_assert_128vm_numa_eventexception_table_entry_erofs_printkvirt_boundary_masknr_isolate_pageblockBPF_PROG_TYPE_LWT_INevent_countnr_to_writeis_extendedfallocatei_spc_warnlimitbuddy_listi_ino_timelimit__compiletime_assert_50__compiletime_assert_51__compiletime_assert_52__compiletime_assert_53node_present_pages__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135__compiletime_assert_136mems_allowed__compiletime_assert_138__compiletime_assert_139tlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderprog_idold_subtree_controltimewakee_flip_decay_tsmemcg_vmstats_percpu__compiletime_assert_60__compiletime_assert_61s_max_linksnr_wakeups_sync__compiletime_assert_140__compiletime_assert_141__compiletime_assert_142__compiletime_assert_143__compiletime_assert_144__compiletime_assert_145__compiletime_assert_146kallsymskcompactdprevdma_parmsfs_structclockiduint32_targ_startbpf_insnblocksfunc_info_rec_sizeset_infofileattr_getvectorerofs_xattr_prefixes_cleanupFORTIFY_FUNC_strncpyBPF_MAP_TYPE_STACK_TRACEFORTIFY_FUNC_strcat__bi_cnttimer_listrefaulted_oldEROFS_NO_KMAPerofs_init_metabufe_value_size__compiletime_assert_157__compiletime_assert_158prog_array_member_cntd_ino_warnssize_poke_tabhiwater_vmbtf_field_graph_roottracepointcompound_headia_vfsuidunaccepted_pagesinsn_cntlink_updateBPF_MAP_TYPE_LRU_HASHlrugen__kernel_ssize_tfunc_info_auxorig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimit__compiletime_assert_161__compiletime_assert_162__compiletime_assert_163splice_write__compiletime_assert_165__compiletime_assert_166BPF_NETKIT_PRIMARY__compiletime_assert_168__compiletime_assert_169i_rt_spc_timelimitbd_nr_sectorsmax_ctx_offsetseq_priv_sizebpf_mapconstant_test_bitqf_nextWB_REASON_BACKGROUNDbpf_offload_devrangesmemory_events__compiletime_assert_170__compiletime_assert_171__compiletime_assert_172iommu_mm__compiletime_assert_174__compiletime_assert_175BPF_PROG_TYPE_LSMblk_features_tused_btfscutimeem_tablepersonalityget_stateline_info_cnttask_sizes_inodes_addrbinfmtirq_domainsigned charpersistent_keyring_registerprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signousercntpacked_inodeenabledBPF_PROG_TYPE_SK_LOOKUPfixupsfile_operationsbpf_prog_typeKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tagavg_last_updateBPF_MAP_TYPE_UNSPEC_killktime_tchildren_low_usagesymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387iterd_ino_timeravx512_timestampfuncsend_datapercpu_pvec_drainedsubtree_controlsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncrange_startper_cpu_nodestatssetleaseBPF_MODIFY_RETURNpacct_structmust_resumescannedlong intBPF_TRACE_KPROBE_MULTIpresent_pagesfile_lock_contextusageerofs_xattr_entrysiglockmap_pollper_cpu_pagesetstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ssattach_flagsh_shared_count__kmalloc_indexvolume__write_overflowpoke_tabnr_iosprintk_index_sizesymtabtimes_prevfree_diskbpf_verifier_envrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegiddq_hashput_supernext_addrpushable_dl_tasksf_flagscodetagprocnamemq_sysfs_init_doneprogz_logical_clusterbitsmap_fd_sys_lookup_elemmark_dirtylinfo_idxnr_dying_descendantsnum_srcu_structsbdi_writeback_pad1_kobj_completionclear_and_wake_up_bit__kernel_clockid_tseccompxattr_isizeiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEbalanced_dirty_ratelimitbatch_sizef_inode__kernel_timespecinode_isizemap_fd_get_ptr_pad2_cancelled_write_bytesac_tgidsrcu_usagebitmapacpi_match_tablememcgbw_time_stamptotal_blocks_sigvalBPF_PROG_TYPE_XDPmax_perf_stateBPF_PROG_TYPE_CGROUP_SYSCTLe_gidbvecnameidatalatency_recordmod_kallsymsmnt_idrefaultsislotbitsdepth_pad3_wait_queue_func_tcnvcswnuma_next_scanimageMIGRATE_SYNC_LIGHTnr_migrations_coldz_tailextent_headlcnerofs_fscachelistscheck_eventsbuffer_ofsssize_tsr_lockiopl_emulmax_write_zeroes_sectorswork_structdesc_lensb_sizeflocktask_io_accountingmremaps_writers__fortify_panictracepoint_funcargventryfree_cached_objectsBPF_CGROUP_UDP6_SENDMSGworkqueue_structblk_mq_tagsbtf_field_kptrreversepr_opspi_lockBPF_RB_ROOTreg_typelru_gen_mm_statefeature_incompat___orig_eipprobestubsectorget_timedata_outmm_cid_activeBPF_CGROUP_ITER_DESCENDANTS_PREelemsizedirty_paused_whenBPF_PERF_EVENTblkcg_cssmaxlensuspend_noirqrelease_agent_pathclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEBPF_CGROUP_UDP4_RECVMSGsrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyqueue_deptha_entrieszone_idxdom_cgrpwpcopy_delay_totalgfp_maskpi_state_listrcu_segcblistsubvolusedBPF_PROG_TYPE_SCHED_CLSfree_inodeprojid_tmg_tasksuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infortpoll_trigger_locksrcu_structrlim_curnofaultmm_countdrv_groupsstackshrinker_run_nooffline_waitqmap_ifindexmnt_nsac_ppidfunctionwb_idki_flagsbvec_poolbd_start_sect___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashmax_sectorssgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infop_lensuspended_timecgroup_rootdatastrtabtty_old_pgrpold_dom_cgrpdl_throttledi_rwsemrtpoll_states__MAX_BPF_PROG_TYPEget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1BPF_MAP_TYPE_RINGBUF__int128 unsignedpcountdst_trampolinerestore_noirqdma_pad_maskki_filpcap_ambient__UNIQUE_ID_x_664dma_configure__UNIQUE_ID_x_666runtime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_foliobpf_func_info_auxsplit_queue_lennr_events__MAX_BPF_ATTACH_TYPEWB_REASON_SYNCiommubi_opfold_prog_fdprivatehlistcftsst_infoclock_listmap_countsp_regexit_signalsa_restorerbpf_run_ctxswap_plugsplice_pipemap_mem_usageblk_mq_tag_setmax_rdonly_accessblk_independent_access_rangess_lock_keyBPF_SK_SKB_VERDICTmg_nodekswapdsrcu_gp_startopentime_nsit_real_incrwaitqmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmem_cgroup_idKMALLOC_RANDOM_ENDmodstqheads_activesym_vvar_startMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalorig_progdeadremap_file_rangeac_commnr_hangskcompactd_highest_zoneidxgid_twake_cpuchainedio_uring_taskinsnsitask_worksmemory_failurerb_root_cacheds_copdd_key_truekmalloc_array_noprofhres_activebpf_func_infobpf_raw_eventsdq_dirtydl_deferbug_listdirect_completenbp_rl_startidr_rtlegacy_namexa_lockfxregs_statememcg_cgwb_frnlog_levelload_weightoffdevkuid_tarch_datafpstateshrinker_infoblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateuts_nsbpf_prog_array_itemis_late_suspendedsysvsemucountvm_stat_diffkmemcg_idignore_childrenlru_gen_mm_walk_pflagsrestore_earlyclock_mutexfs_supersvalue_btf_idPTR_TO_PACKETdom_csetevents_local_fileroot_csetdqb_bsoftlimitpendingmax_dev_sectorsf_task_worklru_gen_memcgusernspm_subsys_data___GFP_NORETRY_BITiowait_countsysfs_registeredset_read_onlymemswthrotl_datas_kobj_unregisterBPF_PROG_TYPE_EXTdma_io_tlb_memBPF_NETKIT_PEERstringread_countpost_attachstoreforklruvecoffloadfutex_offsetvmpressureprog_attach_flagslong long intbpf_ksymatomic_flagssysvshmerofs_listxattrtimer_expirestrace_evalsactive_baseshierarchy_idearly_initmprotectac_exitcodesecuritysaved_dst_prog_typexmm_spaceactivatefunc_cntf_pos_lockerofs_sb_lz4_infoi_fieldmasktls_arrayownerfieldsacct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITiter_seq_infodepends_ondomain_dataidr_nextBPF_PROG_TYPE_TRACINGerofs_init_inode_xattrslinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterszone_wplugs_lockd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizeattributescached_rqsset_child_tidblk_unique_id_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_statemin_nrxattr_prefixestick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugtotal_blocksdomain_idneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolbd_mappingsym_vvar_pagemodule_sect_attrspartial_decodingreturn_instancearch_test_bitsoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intz_erofs_lz4_decompress_ctxgendiskxattr_filter_reserved__compiletime_assert_116spc_timelimits_instancesdescseqcountoom_score_adjoldbitd_seqbi_crypt_contextia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listoutpagesheadpage__kunmap_localpasid_activatedpi_seget_offset_ctxcore_forceidle_sum__compiletime_assert_127freeze_ucountnrpages_incpuhp_deadz_erofs_init_decompressors_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkvm_unmap_ramfmode_tdevscputime_atomicrestoredelayed_callbi_iter__compiletime_assert_134max_nr_cid__compiletime_assert_137_statuserofs_allocpagemark_deadd_sibdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedlimits_lockdl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdax_devicercu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrFAULT_FLAG_WRITEstate_in_sysfsz_erofs_stream_switch_bufsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollresvnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listmemchr_invPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAsyscore__s64dqi_bgrace__kernel_pid_tstatic_call_modmay_inplace_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tdst_maptypeflush_required__compiletime_assert_179sum_block_runtimepgmapmin_perf_state__UNIQUE_ID_y_620__UNIQUE_ID_y_623__UNIQUE_ID_y_628dq_opLZ4_decompress_safe_partialrcu_tasks_nvcswwritevolume_nametypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatmeta_blkaddrdma_pools__UNIQUE_ID_y_632_addr_lsb__UNIQUE_ID_y_635feature_incompati_generation_sigpollmxcsrdevtd_rt_spc_hardlimitmagicbuild_timebi_end_ioblk_holder_ops__compiletime_assert_184numa_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_start__UNIQUE_ID_y_640nr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_headlowmem_page_addressdev_pm_qoserofs_xattr_prefix_itembi_sectormap_typef_oppids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestedz_erofs_decompressornr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockbi_write_hinthash_lenget_policyHRTIMER_RESTART__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedquotdl_runtime__ret_do_oncenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdxattr_prefix_countfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueptrace_messagenum_trace_events_sys_privatealignment_offsetopen_mutexinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksoutputsizestart_stackwatcherscompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrset_page_privateshow_optionsdiskbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodecurr_nrerofs_off_tsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printkvm_operations_structbin_attrs_newerofs_bufbio_alloc_cachebi_bdev__builtin_memcpyiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymsmemcpysrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2bd_size_lockbackvmemmap_basestate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointersect_attrsprimarydevice_blocksonlineruntime_resumedup_xol_workqueueMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdevice_id_maskdio_offset_aligndelay_workvm_map_ramoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexhprobecrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__task_fpstatemask__ret_oncepadbufsizewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_start___set_bithuge_faultkstatfssitesarch___clear_bitDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalseremovedsb_extslotsshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitinpagesac_flagcoredump_datatasks_pidaddress_spacemm_context_t__q_size__call_single_nodestartupof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatorpanelclass_id__read_overflow2_fieldinactive_timer_pkeyfilenames_export_opfront_padstashedvm_page_prottimespec64PIDTYPE_SIDinputsizebpf_ctxd_pruneprintedunused_hctx_lockresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffsdecompresslast_siginfoalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmid__compiletime_assert_616__compiletime_assert_617__compiletime_assert_618rseq_siginbuf_szdev_pm_domainlimit0limit1nr_zonesmigrate_modebio_pool__compiletime_assert_621__compiletime_assert_624__compiletime_assert_625poweroff_lateftrace_callsites__compiletime_assert_629d_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasks__compiletime_assert_630platform_datad_compare__compiletime_assert_633sighanditerate_shared__compiletime_assert_636is_visiblesignalreleaseddep_mapalloc_dquotpm_messagemay_split__q_size_fieldmem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscount__compiletime_assert_641__compiletime_assert_642__compiletime_assert_643GNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrstack_vmusage_count_folio_nr_pagesioctlshowunsigned charumount_beginvdso_test_bitmmap_legacy_basepipe_inode_infosecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opspoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklists_vfs_rename_mutexsuspend_latewakeupcg_listpageofs_insrcu_barrier_completiondriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidbi_flags_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1dax_devllistlz4_max_distancedebugfs_entryPageHighMemelemnr_retriesflatdevsigval_talimitundo_listdirty_foliomissedreport_zonesbi_idxquota_readst_shndxfrees_fscachei_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tpathinpagest_sizermtpwait_sumnum_tracepointsupidexit_codemempool_texec_startclass_read_lock_is_conditionalZ_EROFS_COMPRESSION_RUNTIME_MAXconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entryfeature_compatstart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollbouncedpagesizedisk_names_blocksizevm_pgoffz_erofs_decompress_reqauprobenuma_workupdate_timeptrace_dr7_call_addrrescue_lockmax_segmentsloginuidcheckexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkgcopy_highpage__lstateueventlock_countrefcount_tplugchild_countsaved_auxvinosmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttreerq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidmax_pclusterblkswrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holderend_codeqspinlocklru_geninsnfilldir_tinszdl_non_contendingdir_contexterofs_dev_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqkoutlong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsz_erofs_parse_cfgsseq_showpadendswait_queue_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinki_private_listhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgnoderesetvm_lockno_cgroup_migrationbuild_time_nsecnextevts_writers_key__countxcomp_bvcma_areakmap_local_pagestatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentfirst_minoria_sizein_hrtirqs_master_keysconst_test_bitwchar_addr_bndkernel_symbolsubsys_databi_statustv_secma_lockpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsma_rooturing_cmdnr_failed_migrations_affineIS_ERRsupport_0paddinguser_cpus_ptrpi_top_task__compiletime_assert_626actoruprobenotifier_subscriptionss_readonly_remountkasan_check_writehlist_bl_nodest_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizeerofs_vm_map_ramdl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskerofs_sb_has_compr_cfgsuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headz_erofs_gbuf_growsizemce_vaddrquota_offxattr_prefix_startdq_inusecachedqi_flagskfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlencodegtimesigactiondev_iommuclass_rwsem_read_is_conditional__UNIQUE_ID_x_619sum_sched_runtimetag_set_listsched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listbi_blkgnr_hw_queuesktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidtablesbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmfortify_memcpy_chkdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannederofs_mount_optspcp_listpid_linkss_sysfs_nameq_size_fieldrefcountvaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbd_holder_dirkill_sbkmsan_copy_page_metad_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headreserved2wait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditional__ret_condshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispmaptypedqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicypm_message_tioveci_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentpayloadac_minflti_sbd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxatomic_openbio_end_io_tstart_prevent_timecondreadahead_controlblk_trace__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_devread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemaproot_nidwritepagessched_statisticsheadsync_decompressminors__state_permuprobe_taskwriteback_controluclampsuper_operationsbi_cookiesplice_eofutil_avgrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETchecksumctx_idd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriocap_inheritablegp_waitlookupcostdev_pm_infopacked_nidblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsFORTIFY_FUNC_memscanvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typediskseqi_pagesZ_EROFS_COMPRESSION_DEFLATEatomic_write_hw_boundaryhlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecfdevmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_alias__iovcpumaskdumperwakeirqmemmoveclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nrz_erofs_gbuf_initbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_free_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetis_suspendedcopy_pagetimeout_workburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatecap_bsetopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasesvictims_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultmax_sync_decompress_pagescountersz_erofs_lz4_prepare_dstpageskasan_check_readname_linkblk_mq_tagscmaxrsstimer_slack_nsbus_typepolicysharedwait_queue_entrydismissd_real_typelookahead_bandseq_startrq_qos_mutexzone_wplugs_wqraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tbounceshow_devnamelogical_block_size__real_memchr_invrun_delaytailsblk_flags_tlinenobi_io_vecbase_pfnERR_PTRget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseblk_status_tavail_outclock_listattrscpumask_tswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldpi_offsetdiscard_granularityfopstotalreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetz_erofs_stream_dctxtime64_terofs_sb_has_zero_paddingnuma_faults_localityhas_child_subreaperi_aclmemsetwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statesoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagsz_erofs_exit_decompressorswp_entry_tavailablesz_erofs_lz4_cfgsbi_inline_vecs_mapcountdomain_taghang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtpi_bytesdma_cleanupmaple_treedentrylast_mergecpu_itimerfscache_cookiepercpuget_unique_idz_erofs_lzma_decomprel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesrangeerofs_nid_tfutex_exit_mutexpm_onlytrc_blkd_noded_spacegraveyard_linkblkszbitsxol_vaddrinplace_iosplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsnvcswwatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevblk_integrity_checksumself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEomarginnr_migrationsa_opsreq_listxa_flagsfreezebin_sizeclosegrphierofs_domainnr_sectorsd_spc_timerjump_entriesdistanceasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqbuidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlink__erofs_allocpagepercpu_refhorizontal_positionmanaged_cachepref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAz_erofs_deflate_decompget_nextdqblks_fs_infocrypto_profilefutexwait_maxresult_masknrpages_outstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_fileidr_basei_blockss_stateuser_sizedev_pm_opscdrom_device_infoscheduledfsidFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeqstrma_flagsnr_ia_rangesmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptscache_strategy__le16alt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_count__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headgeneric___clear_bitf_wb_errrcharfutex_pi_statekstat__kernel_uid32_t__le32q_lock_cls_keyDEVICE_FIXEDZ_EROFS_COMPRESSION_LZMApte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidinbuf_posst_spacemm_cid_next_scanns_typeac_majfltflush_dcache_pageposix_cputimers_work_uppermodule_param_attrsshort unsigned int__le64i_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysorig_ptedqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutex__already_donesrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tvolnameio_mindl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onedevice_physical_location_horizontal_positionseq_stoppadbufkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodutil_summigration_disablediter_typeclass_device_is_conditionalshrinker_idbio_setrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadmutexpgd_tnr_cpus_alloweddiscard_alignmentraw_spinlock_tkey_taggetgeofs_flagsworkpgprotval_tkeytypefortify_memset_chksigpendingmq_freeze_depthfsindexshstksrcu_ssppage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialmax_distanceHPROBE_GONEactive_timei_sequenceZ_EROFS_COMPRESSION_LZ4pool_datadisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeBLK_INTEGRITY_CSUM_CRC64f_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalz_erofs_load_lz4_configreschedule_jiffiesalgssum_sleep_runtimedeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startunused_hctx_lists_flagsfaultalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkintegritydq_flagsDD_CLASS_TYPE_DISJOINT_NAMESp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grantmppagekernel_cap_twait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendingpage_offset_baseRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotmax_hw_sectorsfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_idrequeue_lockvfork_donenanosleepBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_padtailia_atimeinfixtlb_ubcbi_issuequota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memarch_spinlock_tsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometryset_dqblksuppress_bind_attrsRPM_RESUMINGd_weak_revalidategsbases_quota_typesf_llistmq_freeze_lockdax_part_offi_nlinkwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevwlockedfreeze_superPTR_ERRs_inode_list_lockelevator_queueruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentriesrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockdocopyrq_qosfsavekeyring_index_keyxattr_blkaddrqrwlockfile_ra_stateuser_structdevt_slotofferofs_xattr_long_prefixon_rq__p_size_fieldfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDerofs_blk_tprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structcred_guard_mutexmajorsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offsetkaddri_opflagsrobust_listsym___kernel_rt_sigreturninfix_lensym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockLZ4_decompress_safeZ_EROFS_COMPRESSION_INTERLACEDdev_links_infoz_erofs_lz4_decompress_memloff_tthread_pidfscache_volumesrcu_gp_seqextra_devicesia_ranges_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodegeneric___set_bitof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1matchmemory_typerb_rootnr_wakeups_localnr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillerlz4_max_distance_pagessaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secevent_flagssched_delayedbd_statsbi_sizemodule_state__write_overflow_fieldmq_kobjlast_used_aterofs_put_metabufZ_EROFS_COMPRESSION_ZSTDvm_endlast_queuednuma_migrate_retryuser_ns__statefirstiommu_groupdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexz_erofs_gbuf_exiti_private_dataElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupxol_arearlockfl_owner_tia_rangeeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvp_indexbvec_iterctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetz_erofs_decompblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtime__builtin_memmovesymlinkoom_flag_origincounterorc_unwindavailable_compr_algsWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSratelimitfree_foliodebugfs_dirqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsblkcg_gqpageofs_outia_filesival_intnuma_preferred_nid_hugetlb_cgroupz_erofs_fixup_insizedentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolfillgapssleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagsz_erofs_put_gbuftotal_numa_faultss_countdev_msi_infod_revalidatebus_groupsz_erofs_transform_plainpmd_terofs_sb_infos_opsysv_shminstrument_atomic_readdq_countutf8data_tableset_latency_tolerance___clear_bitfoliowake_entryxa_headsuidi_readcountblk_integritylocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tretriedquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesz_erofs_get_gbufautosleep_enabledptrace_entryblkg_listrecent_used_cpunum_jump_entriesmount_opts_qcopatomic_tbv_page_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitshort intmynodepart_tbl__compiletime_assert_637__compiletime_assert_638zone_wplugs_hashZ_EROFS_COMPRESSION_MAXblk_mq_ops__UNIQUE_ID_x_622class_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRCFORTIFY_FUNC_memchr_invDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalpagepoolem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOwait_queue_entry_televatorcurrent_may_mountseqlock_tbd_queuenuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmask__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTArwsemi_ctime_nsecia_validvertical_positionFORTIFY_FUNC_strncati_rcumax_distance_pagesi_atime_secqc_type_statekey_serial_tinstrument_writedev_ueventsetupf_lock__read_overflowactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listpgplxarray_start__flagsp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidumount_mutexattribute_groupcontextz_erofs_lz4_decompressposix_timersselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nskcsan_check_accesssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_tgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizemce_kill_mephysical_block_sizeuuid_tdirblkbitsatomic_write_hw_unit_mincount_objectserrorq_size_stimezone_device_datanr_active_requests_shared_tagsi_flctxbase_indexdefparamfred_csq_lockdep_map__UNIQUE_ID_y_645fault_flagkprojid_tptracer_credtlb_genstoreio_lock_cls_keypage_mkwritekobjectaudit_ttyvariable_test_bitmce_ripvstatfstag_setnumab_stateremovablefeatureson_listkgid_ton_cpumanaged_pslotsFAULT_FLAG_VMA_LOCKfregs_statedrop_nsvfromnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedsysfs_registereddebugfs_mutexwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_static__compiletime_assert_109formatftopenclavebi_privatesp_regcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_list__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115get_reserved_space__compiletime_assert_117__compiletime_assert_118__compiletime_assert_119non_seqstack_refcountinvalidate_lockbmapkey_payloadtimer_rand_stated_realexpiry_active__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126dqi_max_spc_limit__compiletime_assert_128__compiletime_assert_129exception_table_entry_erofs_printkvirt_boundary_maskevent_counts_kobjfallocatei_spc_warnlimitbuddy_listi_ino_timelimit__compiletime_assert_130__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135__compiletime_assert_136mems_allowed__compiletime_assert_138tlb_flush_batchedz_erofs_lz4_handle_overlap_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcat__bi_cnttimer_listerofs_init_metabufd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitconstant_test_bitqf_nextrangesiommu_mmblk_features_tcutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned char__compiletime_assert_180__compiletime_assert_181__compiletime_assert_182__compiletime_assert_183prio__compiletime_assert_185__compiletime_assert_186__compiletime_assert_187__compiletime_assert_188privgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signopacked_inodeenabledfixupsdstmap_outfile_operationsno_pmbi_max_vecsgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasepinspacct_structmust_resumelong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ssvolume__write_overflownr_iosprintk_index_sizesymtabfree_diskrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegiddq_hashput_superpushable_dl_tasksf_flagsf_inodePROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVE__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idislotbitsdepthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_colderofs_fscacheinputmargincheck_eventsssize_tiopl_emulmax_write_zeroes_sectorswork_structdesc_lensb_sizeflocktask_io_accountingmremaps_writers__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structpr_opspi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEsrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyqueue_depth__UNIQUE_ID_x_627gfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infosrcu_struct__UNIQUE_ID_x_631rlim_cur__UNIQUE_ID_x_634nofault__UNIQUE_ID_x_639mm_countdrv_groupsstackshrinker_run_nofunctionki_flagsbvec_poolbd_start_sectsrcu_have_cbsd_in_lookup_hash__UNIQUE_ID_x_644max_sectorssgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqdma_pad_maskki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGY__compiletime_assert_516__compiletime_assert_517rlimread_folionr_eventsiommubi_opfprivatest_infoerofs_read_metadatamap_countpdeath_signalexit_signalsa_restorerbpf_run_ctx__compiletime_assert_526page_copycntsplice_pipevm_unmap_aliasesblk_mq_tag_seterofs_super_blockblk_independent_access_rangess_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrarch___set_bitmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmodstqheads_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_taskmemcpy_to_pageZ_EROFS_COMPRESSION_SHIFTEDtask_worksmemory_failurerb_root_cacheds_copdd_key_truehres_activeconfigbpf_raw_eventsdq_dirtydl_deferbug_listdirect_completeidr_rtxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsembd_nr_sectorsignore_children_pflagsrestore_earlyclock_mutexfs_supersoenddctxdqb_bsoftlimitpendingmax_dev_sectorsf_task_workiowait_countset_read_onlythrotl_datas_kobj_unregisterdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesearly_initmprotectsecurityxmm_spaceactivatef_pos_lockerofs_sb_lz4_infoi_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structdomain_dataidr_nextrelax_countlinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sepkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterszone_wplugs_lockd_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizeattributeserofs_unmap_metabufcached_rqsset_child_tidblk_unique_id_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_statemin_nrxattr_prefixestick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugtotal_blocksdomain_idneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countz_idata_sizeqsize_tfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolvfs_inodebd_mappingsym_vvar_pagemodule_sect_attrslookback_distancereturn_instancearch_test_bitsoftirq_activatedzone_wplugs_workendoffclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intgendiskxattr_filter_reservedspc_timelimits_instancesdescseqcountoom_score_adjoldbitd_seqbi_crypt_contextia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucountcpuhp_deads_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwrite__tracepoint_erofs_map_blocks_entercallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tdevscputime_atomicrestoredelayed_callbi_itermax_nr_ciddi_u_statusmark_deadd_sibdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedlimits_lockdl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdax_devicercu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDblk_independent_access_rangefind_special_pagebacktraceiomap_iter_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollxattr_name_filterresvnr_wakeups_idleiomap_folio_opsio_cqelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAz_erofs_get_extent_compressedlensyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritevolume_nametypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionali_blocksizemeta_blkaddrdma_pools_addr_lsbfeature_incompati_generation_sigpollmxcsrdevtd_rt_spc_hardlimitbuild_timebi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qoserofs_xattr_prefix_itembi_sectormap_typeclass_preempt_notrace_destructorf_opheadtypepids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbarch_static_branchsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtime__UNIQUE_ID_y_679nestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockbi_write_hinthash_lenget_policyHRTIMER_RESTARTbig_pcluster__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedquotdl_runtime__ret_do_oncenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdxattr_prefix_countfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueptrace_messageztailpackingnum_trace_events_sys_privatealignment_offsetopen_mutexinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherscompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKclass_rcu_tasks_trace_is_conditionalactive_uprobebit_nrshow_optionsdiskbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodecurr_nrerofs_off_tsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionallclusterbitsFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structcnivcswbin_attrs_newerofs_bufbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabencodebitswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infoh_idata_sizeerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2bd_size_lockbackstate_add_uevent_senti_hashhlist_nodevalidity_cookiez_erofs_get_extent_decompressedlenio_uringcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setbio_listwrite_dquotblkaddrclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerclusterofssect_attrsprimarydevice_blocksonlineruntime_resumedup_xol_workout_put_metabufz_erofs_iomap_begin_reportqueueMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdevice_id_maskdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexhprobecrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completeunpack_compacted_indexvtime_statewakee_flipsset_aclcompacted_2bpids_activedriveri_oplobitsldt_usr_semkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entryunmap_outlist_lru_nodesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__task_fpstatemask__ret_oncefragmentwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentsz_erofs_maprecorderpgprotfalseremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequenceafmtrt_spc_warnlimitac_flagcoredump_datatasks_pidaddress_spacemm_context_tiomap_end__call_single_nodestartupchunkbitsof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatorpanelclass_iderofs_kmap_typeinactive_timer_pkeyfilenames_export_opfront_pad__mptrstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errshm_clistis_child_subreapercall_depthunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_name__SCT__might_reschedmmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidrseq_sigdev_pm_domainlimit0limit1nr_zonesmigrate_modebio_poolpoweroff_latez_erofs_map_headerftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrstack_vmusage_count_folio_nr_pagesioctlshowunsigned charumount_beginvdso_test_bitmmap_legacy_basepipe_inode_infosecurebitsh_clusterbitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_ops__compiletime_assert_660poll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklists_vfs_rename_mutexsuspend_latewakeupcg_listsrcu_barrier_completiondriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemap__UNIQUE_ID___addressable___SCK__tp_func_erofs_map_blocks_enter661waiters__compiletime_assert_680sessionidbi_flags_sifields_hugetlb_subpoold_manageicq_hintheadlcnfiemap_extent_infopadding1dax_devllistdebugfs_entryelemnr_retriesflatdevsigval_talimitundo_listdirty_foliomissedreport_zonesbi_idxquota_readst_shndxerofs_read_metabuffrees_fscachei_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tZ_EROFS_LCLUSTER_TYPE_MAXpathst_sizermtpwait_sumnum_tracepointsupidexit_codemempool_texec_startclass_read_lock_is_conditionalZ_EROFS_COMPRESSION_RUNTIME_MAXconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerz_erofs_load_compact_lclusterunlinkz_erofs_load_lcluster_from_diskperiod_contribrcu_node_entryfeature_compatstart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollpagesizedisk_names_blocksizevm_pgoffauprobepto_val__numa_workupdate_timeptrace_dr7_call_addrrescue_lockmax_segmentsloginuidcheckexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkg__lstatearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvinosmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flagsm_llen_pincountget_foliotreerq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidmax_pclusterblkswrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockbd_holderend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexterofs_dev_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqlong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsseq_showswait_queue_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagssrcmapclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinki_private_listhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgarch_clear_bitnoderesetvm_lockno_cgroup_migrationbuild_time_nsecnextevts_writers_key__countxcomp_bvcma_areastatic_prioget_compacted_la_distanceflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatexec_update_lockarch_set_bitatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentfirst_minoria_sizein_hrtirqs_master_keysconst_test_bitwchar_addr_bndkernel_symbolsubsys_databi_statustv_secma_lockpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsma_rooturing_cmdnr_failed_migrations_affineIS_ERRuser_cpus_ptrpi_top_taskactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writehlist_bl_nodest_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsEROFS_INODE_CHUNK_BASEDmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offxattr_prefix_startdq_inusecachedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listwait_on_bit_lockmax_timemod_tree_nodef_sb_errwritepagecodegtimesigactionfolio_opsdev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listsched_rt_mutexlocked_pendingpao_tmp__nr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listbi_blkgnr_hw_queuesktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidtablesbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTART__cpu_online_maskbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannederofs_mount_optspcp_listpid_linkss_sysfs_namerefcount__SCT__tp_func_erofs_map_blocks_entervaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbd_holder_dirkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditional__ret_condshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicypm_message_tioveci_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentpayloadac_minflti_sbd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxatomic_openbio_end_io_tebasestart_prevent_timecondreadahead_controlblk_trace__kernel_gid32_tit_func_ptrkernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_devread_newsignalfd_wqhmmappto_tmp__modnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemaproot_nidwritepagessched_statisticsheadsync_decompressminors__state_permuprobe_taskwriteback_controluclampget_unaligned_le32super_operationsbi_cookiesplice_eofutil_avgrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriocap_inheritablegp_waitlookupcostdev_pm_infopacked_nidblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typediskseqi_pagesZ_EROFS_COMPRESSION_DEFLATEatomic_write_hw_boundaryz_advisehlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecfdevmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nrdatalayoutbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_free_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetis_suspendedtimeout_workburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatecap_bsetopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultmax_sync_decompress_pagescounterskasan_check_readname_linkblk_mq_tagswait_bit_keycmaxrsstimer_slack_nsbus_typepao_ID__policysharedxattr_shared_xattrswait_queue_entrydismissd_real_typelookahead_bandseq_startrq_qos_mutexraw_blkaddrzone_wplugs_wqraw_lockd_dnameget_dqblkerofs_put_metabufmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamelogical_block_sizerun_delaytailsblk_flags_tlinenoz_algorithmtypebi_io_vecbase_pfnget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringh_algorithmtypekparam_arrayutimez_fragmentoffstart_codeset_bitis_hardfsbaseblk_status_tclock_listattrscpumask_tswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitymight_reschedtimerqueue_nodeZ_EROFS_LCLUSTER_TYPE_PLAINil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpuerofs_map_blocksshrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldtest_and_set_bitpi_offsetdiscard_granularityfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_tnuma_faults_localityhas_child_subreaperi_aclm_deviceidwrite_newlist_lockpm_domaininstrument_atomic_read_writecpu_bitmapstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statesoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagsswp_entry_tbi_inline_vecs_mapcountdomain_taghang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtpi_bytesdma_cleanupwake_up_bitmaple_treedentryiomap_opslast_mergecpu_itimerfscache_cookiepercpuget_unique_idrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpblkpushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesrangeerofs_nid_tfutex_exit_mutexpm_onlytrc_blkd_nodez_erofs_lcluster_indexd_spacegraveyard_linkblkszbitsxol_vaddrsplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsnvcswwatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevblk_integrity_checksumself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsreq_listxa_flagsfreezebin_sizeclosegrphierofs_domainnr_sectorsd_spc_timerjump_entriesasync_suspendmsi_device_dataZ_EROFS_LCLUSTER_TYPE_NONHEADalignsuper_blockset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqbarch_test_and_set_bituidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkinline_datapercpu_refhorizontal_positionmanaged_cachepref_node_forkwait_queue__int128dqi_privchunkformatrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_fileidr_basei_blockss_stateuser_sizedev_pm_opscdrom_device_infoscheduledfsidFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeqstrma_flagsnr_ia_rangesmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptscache_strategy__le16alt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_count__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headpart0f_wb_errout_of_line_wait_on_bit_lockrcharfutex_pi_statekstat__kernel_uid32_t__le32q_lock_cls_keyDEVICE_FIXEDZ_EROFS_COMPRESSION_LZMApte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_upperclear_bit_unlockmodule_param_attrsshort unsigned int__le64i_mutex_dir_keyq_nodespc_warnlimits_encoding__UNIQUE_ID___addressable___SCK__tp_func_erofs_map_blocks_exit669gpl_crcsorc_entrykeysorig_ptedqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutex__already_donesrcu_gp_seq_neededpscr_ret__dq_dqb_lock__kernel_ulong_tvolnameio_minerofs_inodedl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlock__UNIQUE_ID_guard658rlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onedevice_physical_location_horizontal_position__UNIQUE_ID_guard666seq_stopkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodutil_summigration_disablediter_typez_erofs_map_blocks_iterclass_device_is_conditionalshrinker_idbio_setrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKm_labpf_storageno_callbacks__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadmutexpgd_tnr_cpus_allowedEROFS_KMAPdiscard_alignmentraw_spinlock_tkey_taggetgeofs_flagswordworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstksrcu_ssppage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONExattr_shared_countactive_timei_sequenceZ_EROFS_COMPRESSION_LZ4pool_datadisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesm_pauclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeBLK_INTEGRITY_CSUM_CRC64f_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_s__SCK__tp_func_erofs_map_blocks_exitpinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startunused_hctx_lists_flagsfaultmigration_pendingalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkintegritydq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotmax_hw_sectorsfolioqnextpackoffprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_idrequeue_lockvfork_donenanosleepBLK_UID_T10partialrefpud_trt_spc_timelimitsym_int80_landing_padh_reserved1tailia_atimeinfixtlb_ubcbi_issuequota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometryset_dqblksuppress_bind_attrsRPM_RESUMINGd_weak_revalidategsbases_quota_types__preempt_count_addf_llistmq_freeze_lockdax_part_offi_nlinkwrite_begingroupsEROFS_INODE_COMPRESSED_FULLpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskarch_clear_bit_unlockBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_tadvisesharepagefault_disabledsyscwil_prevwlockedfreeze_superPTR_ERRs_inode_list_lockelevator_queuetrace_erofs_map_blocks_enterruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentriesinitial_lcnrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalerofs_ilocbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosfsavekeyring_index_keyxattr_blkaddrqrwlockfile_ra_stateuser_structerofs_xattr_long_prefixon_rqfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDerofs_blk_tprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitput_folioatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structcred_guard_mutexmajorsigcnthrtimer_cpu_basecb_headcheck_quota_fileattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offseti_opflagsrobust_listsym___kernel_rt_sigreturninfix_lensym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockZ_EROFS_COMPRESSION_INTERLACEDdev_links_infoloff_tthread_pidfscache_volumesrcu_gp_seqextra_devicesia_ranges_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeerr_bogusacct_vm_mem1Z_EROFS_LCLUSTER_TYPE_HEAD1Z_EROFS_LCLUSTER_TYPE_HEAD2matchmemory_typerb_rootnr_wakeups_localwait_bit_action_fnr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namesdeltas_mtdkparam_stringpoweri_mtime_secevent_flagssched_delayedbd_statsbi_sizemodule_statemq_kobjlast_used_athardirq_stack_ptrZ_EROFS_COMPRESSION_ZSTDvm_endlast_queuednuma_migrate_retryuser_ns__statefirstiommu_groupdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexcpumask_checki_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_arearlockpcpu_hotfl_owner_tia_rangeeuidwaitEROFS_INODE_DATALAYOUT_MAXbug_tabledirtied_time_whencpu_onlinem_plensequential_io_avgnr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpout_unlock_indexbvec_iterctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datacpu_max_bits_warnmm_usersbd_holder_locks_ids_dentry_lrubp_offsetblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkoom_flag_origincounterorc_unwindamortizedshiftavailable_compr_algsWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonecpumask_test_cpufscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSz_erofs_do_map_blocksratelimitfree_foliodebugfs_dirqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsblkcg_gqia_filesival_intnuma_preferred_nidinstrument_atomic_write_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_terofs_sb_infodi_advises_opsysv_shminstrument_atomic_readiomap_validdq_countutf8data_tableset_latency_toleranceprocessedz_idataofffoliowake_entryz_erofs_extent_lookbackxa_headsuidi_readcountblk_integritylocked_vmrb_leftEROFS_INODE_FLAT_INLINEseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryblkg_listrecent_used_cpunum_jump_entriesmount_opts_qcopatomic_tbv_page_flagsrqos_debugfs_dirnblknotify_nextmax_perf_statebus_dma_limitshort intmynodepart_tblzone_wplugs_hashZ_EROFS_COMPRESSION_MAXblk_mq_opsclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRCcompacted_4b_initialDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOwait_queue_entry_televatorcurrent_may_mountseqlock_tbd_queuenuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faulth_advisegrpmask__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTArwsemi_ctime_nsecia_validvertical_positioni_rcumax_distance_pagesi_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listdecode_compactedbitsiomap_beginz_erofs_iomap_report_opsxarray_start__flagsfadvisem_algorithmformatvmem_altmaparg_endsyscall_dispatchthaw_super__compiletime_assert_668revoked_atlast_sum_exec_runtimeiov_iteria_giderofs_sb_has_big_pclusterumount_mutexattribute_groupcontextposix_timersselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nskcsan_check_accesssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_tgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizebit_waitmce_kill_mephysical_block_sizeuuid_tatomic_write_hw_unit_minclass_preempt_notrace_constructorcount_objects_stimezone_device_datanr_active_requests_shared_tagsi_flctxbase_indexdefparamtotalidxfred_csq_lockdep_mapfault_flagkprojid_tptracer_credtlb_genstoreio_lock_cls_keypage_mkwritekobjectaudit_ttyvariable_test_bitmce_ripvstatfstag_setnumab_stateremovablefeatureson_listkgid_ton_cpumanaged_pslotsFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistdi_clusterofsclass_groupsnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedsysfs_registeredEROFS_INODE_COMPRESSED_COMPACTdebugfs_mutexwatch_listaudit_contextpp_ref_count__tracepoint_erofs_map_blocks_exitsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavebi_privatesp_regcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_listget_reserved_spacenon_seqstack_refcountinvalidate_lockbmapkey_payloadtimer_rand_stated_real__dataexpiry_activedqi_max_spc_limiteval_stringexception_table_entry_erofs_printkvirt_boundary_maskevent_countpreempt_counts_kobjfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowed__preempt_count_dec_and_testtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startblockscompressedblksset_infofileattr_getvector__bi_cnttimer_listEROFS_NO_KMAPd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitconstant_test_bitqf_nextrangesiommu_mmblk_features_tcutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmask__SCK__tp_func_erofs_map_blocks_enteruprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signopacked_inodeenabledfixupsfile_operationsno_pmbi_max_vecsgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasepinspacct_structmust_resumelong intfile_lock_contextusagel_yessiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimesync_iofred_ss__pptrvolumenr_iosprintk_index_sizesymtabfree_diskrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegidiomapdq_hashput_superpushable_dl_tasksf_flagsf_inodePROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donez_logical_clusterbitsmark_dirtyEROFS_INODE_FLAT_PLAINnum_srcu_structsbdi_writebackkobj_completionclear_and_wake_up_bit__kernel_clockid_tseccompxattr_isizeiteratorqc_infodev_nameTT_NONEVTIME_INACTIVE__kernel_timespecinode_isizecancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvaltrace_erofs_map_blocks_exitbvecnameidatalatency_recordmod_kallsymsmnt_idislotbitsdepth__UNIQUE_ID_rcu659wait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldz_tailextent_headlcnerofs_fscachecheck_eventsssize_tiopl_emulz_erofs_load_full_lcluster__SCT__tp_func_erofs_map_blocks_exitmax_write_zeroes_sectorswork_structdesc_len__UNIQUE_ID_rcu667sb_sizeflocktask_io_accountingmremaps_writerstracepoint_funcargventryfree_cached_objectsworkqueue_structpr_opspi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEsrcu_reader_flavorirq_safetv_nseci_lruqueue_depthgfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infosrcu_structrlim_curnofaultmm_countdrv_groupsstackshrinker_run_nofunctionki_flagsbvec_poolbd_start_sectsrcu_have_cbsz_erofs_fill_inode_lazyd_in_lookup_hashmax_sectorssgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountvcntrestore_noirqdma_pad_maskki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYheadnrrlimread_folionr_events__vpp_verifyiommubi_opf__UNIQUE_ID_x_678privatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipeblk_mq_tag_setblk_independent_access_rangess_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmodstqheads_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_taskh_fragmentoffZ_EROFS_COMPRESSION_SHIFTEDtask_worksmemory_failurerb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsclass_preempt_notrace_tdq_dirtydl_deferbug_listdirect_completeerr_bonus_cblkcntidr_rtxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsembd_nr_sectorsignore_children_pflagsrestore_earlyclock_mutexfs_supersdqb_bsoftlimitpendingmax_dev_sectorsf_task_workiowait_countset_read_onlythrotl_datas_kobj_unregisterdma_io_tlb_memstringread_countfutex_offsetlong long intbdevatomic_flagssysvshmtimer_expirestrace_evalsactive_basesearly_initmprotectsecurityxmm_spacem_flagsactivatenr_cpu_idsf_pos_lockerofs_sb_lz4_infoi_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structdomain_dataidr_nextrelax_count___GFP_THISNODE_BITlinelinkstart_timekernfs_nodercu_workRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEz_erofs_init_subsystemdup_xol_addrBIO_CLONEDgate_structcapture_controlnr_wakeupspost_attachstartstart_brkstatic_key_modd_ino_softlimitCPUHP_POWERPC_PMAC_PREPARExregs_stateWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemduppkruElf64_Wordz_erofs_is_sync_decompressgp_seqkset_uevent_opsiov_offsetfpregs_statebd_device__compiletime_assert_690CPUHP_PRINTK_DEADsubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterszone_wplugs_lockEROFS_ZIP_CACHE_DISABLEDCPUHP_FS_BUFF_DEADd_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treework_bitssi_codethread_nodemake_pgdnr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITrstat_flush_nextmap_pagesreschedule_countvfsmountcss_onlineextable_basenoinstr_text_sizeattributesWQ_HIGHPRI__list_del_entrycached_rqsCPUHP_HRTIMERS_PREPAREset_child_tidblk_unique_id_overrunwrite_u64restrict_linktmpfilercu_read_lock_nestingem_perf_statemin_nrxattr_prefixestick_dep_masklistthrottle_disksi_errnobsynce_freezeREQ_OP_WRITE_ZEROESpageflagss_inode_lruatomic_setsrcu_size_stateblk_plugout_allocfoliototal_blocksuid_gid_mapREQ_OP_LASTdomain_idneed_tsof_noderefsmmap_compat_basewrite_idt_entrytrace_eventsenv_startcgrp_ancestor_storagedma_addrcpu_numberd_flagskthread_workxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockederr_outcgroup_tasksetVTIME_GUESTrtpoll_next_updateregsslice_maxlast_switch_countz_idata_sizeqsize_tWORK_OFFQ_DISABLE_SHIFTblkio_delay_totaltime_ns_for_childrenfilesdqb_bhardlimitliveatomic_write_unit_maxCPUHP_AP_CPU_PM_STARTINGrun_listixolz_erofs_decompress_queuevfs_inodebd_mappingsym_vvar_pagemodule_sect_attrslist_lockpartial_decodingmg_src_preload_nodereturn_instancearch_test_bitsoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stackfree_disknode_id_workingsetCPUHP_AP_PERF_ARM_HW_BREAKPOINT_STARTINGautosuspend_delayflush_tlb_one_userunsigned intrtpoll_taskgendiskxattr_filter_reserved__compiletime_assert_116spc_timelimits_instancesmake_pmddescseqcountoom_score_adjoldbitd_seqbi_crypt_contextia_vfsgidcgroup_bpfzone_typewq_flagssize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesu64_stats_syncrcu_tasks_idxz_erofs_register_pclusterrcu_tasks_holdouttarget_list__kunmap_localpasid_activatedpi_sez_erofs_free_pclusterCPUHP_AP_PERF_ARM_MARVELL_CN10K_DDR_ONLINEget_offset_ctxflush_tlb_info__compiletime_assert_127freeze_ucountalloc_workqueuecpuhp_deadz_erofs_init_decompressors_remove_countCPUHP_AP_PERF_ARM_HISI_L3_ONLINEerofs_is_fscache_modesyscall_work__UNIQUE_ID_x_584device_physical_location_vertical_positionz_erofs_alloc_pclusteratomic_long_tprealloc__init_swait_queue_headpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tdevscputime_atomic_SLAB_KMALLOCrestoredelayed_callbi_iter__compiletime_assert_134max_nr_cid__compiletime_assert_137_statuserofs_allocpagemark_dead__kcsan_check_accessd_sibdma_opsbin_attributemin_align_maskpercpu_counter_SLAB_NO_USER_FLAGSdev_groupsnuma_pages_migratedlimits_lockdl_dev_stategsindexexpires_nexti_io_listf_epCPUHP_AP_IRQ_RISCV_SBI_IPI_STARTINGsrcu_barrier_seqjobqueue_initlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2css_extra_stat_show__kernel_timer_tpv_lazy_opsclass_srcu_is_conditionalcss_releasedDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimerreadahead_indextrace_recursionbv_lenmake_ptestart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdax_devicercu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vmmake_pud__s32entry_eiptaskstatshugetlb_usage__dummyratelimit_states_pinsattrCPUHP_AP_X86_HPET_ONLINEFAULT_FLAG_WRITEstate_in_sysfsfilemap_add_foliowrite_syscallsvm_fault_tthreaded_csets_nodetty_structUTASK_SSTEP_TRAPPEDwrite_ldt_entryp4d_valblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollac_pad__SCT__tp_func_erofs_read_folioxattr_name_filterresvnr_wakeups_idleFORTIFY_FUNC_memsetrtpoll_waitio_cqelf64_symfolio_zero_segmentread_msr_safelatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSCPUHP_X86_HPET_DEADBLK_UID_NAAWORK_OFFQ_FLAG_SHIFTarch_test_and_set_bit_lockdesc_ptrCPUHP_AP_ARM_GLOBAL_TIMER_STARTINGsyscorepao_tmp____s64dqi_bgrace_SLAB_FLAGS_LAST_BIT__kernel_pid_tsystemstatic_call_mod_SLAB_NO_MERGE_timerdma_map_opsma_external_lockdevice_physical_location_panelctl_tableuid_tEROFS_SYNC_DECOMPRESS_FORCE_ONflush_requiredCPUHP_AP_PERF_ARM_QCOM_L2_ONLINEZ_EROFS_PCLUSTER_FOLLOWED_NOINPLACEprocs_filesum_block_runtimepgmapmin_perf_stateCPUHP_PERF_POWERdq_opCPUHP_AP_ONLINE_DYN_ENDrcu_tasks_nvcswCPUHP_AP_SCHED_STARTINGwritevolume_nametest_and_set_bit_lockCPUHP_SOFTIRQ_DEADtypetabmax_user_sectorsdrain_ioclass_read_lock_irqsave_is_conditionali_blocksizecan_forkFORTIFY_FUNC_strlcatlockref_put_or_lockmeta_blkaddrdma_poolsJQ_SUBMIT_addr_lsbctl_table_polli_generation_sigpollmxcsrdevtd_rt_spc_hardlimitmagicbuild_timebi_end_ioerofs_folio_is_managedblk_holder_opsfreepages_delay_totalREQ_OP_FLUSHnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinewait_page_queuepteval_ti_inotry_freedyndbg_infoindexset_p4ddriver_datathread_headac_exe_devlowmem_page_addressdev_pm_qoserofs_xattr_prefix_itembi_sectormap_typeclass_preempt_notrace_destructorf_oppids_active_resetrandomconfirm_switcherofs_onlinefolio_endseqcount_tkmem_cache_alloc_noprofnuma_scan_seqinode_operationsatomic_add_returnclass_raw_spinlock_irq_is_conditional__maskpercpu_sizearch_irqs_disabled_flagsdq_sberofs_release_pagesarch_static_branchcgroupsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entry___GFP_NOWARN_BITcancel_attachcmin_fltrw_semdqio_semprev_sum_exec_runtimexa_is_internalkmap_local_folionestedrtpoll_nr_triggersz_erofs_decompressornr_forced_migrationsseq_operationsnum_argsCPUHP_AP_PERF_ARM_HISI_PCIE_PMU_ONLINEri_timerstack_canaryinactiveblksizesiblingmnt_rootPG_arch_2next_scanunregisteringf_raarch_atomic64_addquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockbi_write_hinthash_lenget_policy__list_add_valid__UNIQUE_ID___addressable___SCK__tp_func_erofs_read_folio656HRTIMER_RESTARTfolio_attach_privateCPUHP_NET_DEV_DEAD__bi_nr_segmentstask_iterssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecss_freecpu_basedquotdl_runtime__ret_do_oncenumbersswapin_delay_totalbi_vcnt_softexpiresidt_bitscore_forceidle_sumkey_user_hugetlb_cgroup_rsvdxattr_prefix_countfaultableio_comp_batchfileattr_getshutdowndq_locki_cdevldt_structfolio_getenv_endobj_cgroupPG_checkedrescue_workqueueprogsextra1ptrace_messageztailpackingnum_trace_events_sys_privatealignment_offsetCPUHP_BP_PREPARE_DYNopen_mutexinit_fs_contexts_subtypeheaderfuncperf_event_contextcputimetlbflush_unmap_batchsoftfreepages_countcrypto_kobject__sifieldsCPUHP_AP_SCHED_WAIT_EMPTYrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_autherofs_fileio_submit_biofolio_test_largevirtual_dr6attachkprobes_text_sizestatic_call_sitespsi_memstall_leavethread_group_cputimernuma_scan_period_maxbadblocksoutputsizestart_stackwatcherskmalloc_cacheskthread_workeroffset_lowxa_is_errcompletionsw_reserveddevice_removablebd_meta_infoz_erofs_cache_release_foliobio_integrity_poolerr_pcluster_poolPG_hwpoisonUTASK_SSTEP_ACKclass_rcu_tasks_trace_is_conditionalactive_uprobebit_nr__REQ_POLLEDshow_optionsdiskbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodebpf_cgrp_storagecurr_nrcorememerofs_off_tsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_datapud_valatomic_long_addget_dquotsnextentsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquots_kobjd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onmultibases__warn_printksafe_haltvm_operations_structcnivcsw__compiletime_assert_241bin_attrs_newerofs_bufCPUHP_RADIX_DEADbio_alloc_cachebi_bdev_seg_count__builtin_memcpyiov_basesrcu_size_jiffiesac_pidi_statesched_classmultiprocesspi_waitersexp_hintd_childrennregpgd_freefolio_test_privateold_bvpagedirty_foliois_softbindcntsRPM_SUSPENDEDreclaim_stateload_gdtvma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGcacheline_paddingpgd_allocPG_vmemmap_self_hostedwbinvdnrpages_refcounti_crypt_infopermissionsnr_frozen_descendantserror_remove_folioold_time32_tcore_kallsyms__REQ_NR_BITSmemcpysrcu_parentdetachedclock_op_might_sleeponstack_pagesenvp_idxcgroup_namespaceCPUHP_AP_DUMMY_TIMER_STARTINGZONE_DEVICEWORK_STRUCT_INACTIVE_BIT_head_1_head_2subsysbd_size_lockbackvmemmap_basestate_add_uevent_senti_hashhlist_nodesprintfio_uring__xa_eraseget_debugregWQ_MEM_RECLAIMcore_occupationalgorithmformatftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumeirq_disablewake_qfileattr_set__compiletime_assert_725xa_errrcuwaitPG_pinnedbio_listwrite_dquotclass_read_lock_irq_is_conditionalreadahead_posioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsbios_slab_flag_bitsmg_dst_cgrpqueue_work_onlaunder_folioprimarydevice_blocksonlinem_fscacheruntime_resumedup_xol_work__cpuhp_remove_statequeuewrite_char___GFP_WRITE_BITMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdevice_id_maskdio_offset_aligndelay_workoublockrecent_cidkf_opsCPUHP_AP_X86_INTEL_EPB_ONLINEkernel_paramdeferred_resumed_spc_softlimitreported_split_lockkthread_queue_workgfp_tswap_slot_free_notifyseccomp_filterstimei_mmapPG_owner_2phys_addrd_lrusignal_structWORK_STRUCT_COLOR_BITSperf_event_mutex__folio_lockhprobecrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modereadahead_folioki_completevtime_statewakee_flipsset_aclz_erofs_page_is_invalidatedset_fixmappids_activedriverZONE_NORMALi_opldt_usr_semwpcopy_countkobj_ns_type_operationsbd_security__REQ_BACKGROUNDseqcount_raw_spinlock_tpercpu_rw_semaphoretocachefolio_unlockcredjump_entryfolio_sizelist_lru_nodesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__kmem_cache_create__task_fpstatez_erofs_attach_pagemask__ret_oncewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeerofs_is_fileio_modeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssiteskickDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrnotified_atPG_xen_remappedpaccti_dentrydisk_eventsCPUHP_AP_PERF_POWERPC_HV_GPCI_ONLINEgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsys__REQ_DRVmemcpy_to_folioqueue_kobjPG_uptodateuse_freeptr_offsetsrcu_cb_mutexstatic_call_sitefortify_funcput_page_testzeroMODULE_STATE_UNFORMEDkmem_argsexpires___GFP_HARDWALL_BITset_ldtnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotbstatfalseremovedsb_extslotsshow_pathPIDTYPE_TGID__UNIQUE_ID_x_710curr_ret_depth__UNIQUE_ID_x_712ac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitREQ_OP_READac_flagEROFS_ZIP_CACHE_READAROUND__ret_warn_oncoredump_data__tracepoint_erofs_readpagestasks_pidaddress_spacemm_context_t__oldfolio_lock__q_sizeuid_gid_extent__call_single_nodestartupnr_folioschunkbitsof_device_idseqcount_spinlock_tbio_issueCPUHP_ONLINEi_wbcss_local_stat_showCPUHP_AP_PERF_X86_STARTINGCPUHP_BRINGUP_CPUhas_elevatorcompound_orderpanelclass_idz_erofs_pclusterpages__read_overflow2_fielderofs_kmap_typeinactive_timer_pkeyfilenames_export_opfront_pad__mptrbio_first_bvec_allstashedvm_page_prottimespec64PIDTYPE_SIDinputsizebpf_ctxd_pruneprintedunused_hctx_lockresume_noirqxenderofs_breadpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsCPUHP_AP_PERF_X86_AMD_UNCORE_ONLINEdestroy_inoderelease_foliopacked_nidlast_busyi_pipebasehostuaddrcgrps_wb_errold_subtree_ss_maskptep_modify_prot_commitWORK_STRUCT_PWQ_SHIFTis_child_subreapercall_depthunicode_mapz_erofs_put_shortlivedpagenum_descsis_zone_device_pagePG_workingsetexec_vmrw_copyfscrypt_inode_infost_name__SCT__might_reschedmmu_notifier_subscriptionswait_lockbd_openersoffsdecompresslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_iname_compound_headCPUHP_S390_PFAULT_DEADdevres_headi_mappingCPUHP_AP_PERF_POWERPC_THREAD_IMC_ONLINEinblockrmidrseq_sigp4d_tCPUHP_AP_PERF_ARM_CCI_ONLINEdev_pm_domainerofs_init_managed_cachelimit0limit1z_erofs_submit_queuenr_zonesractlmigrate_modebio_poolfolio_test_highmem__UNIQUE_ID_rcu720poweroff_lateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoCPUHP_AP_PERF_XTENSA_STARTINGi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_stats__rcu_read_unlockCPUHP_AP_IRQ_APPLE_AIC_STARTINGpushable_tasksstart1platform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapalloc_dquotCPUHP_ARM_OMAP_WAKE_DEADrcu_read_lockpm_messagez_erofs_pcpu_workersmay_spliterofs_cpuhp_state__q_size_fieldmem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscount_r_a_p__vfolio_nr_pagesGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventbackmostset_infohlist_heads_encoding_flagsrunnable_weightincrbvpagestack_vmusage_count_folio_nr_pagesioctlshowcompound_nrCPUHP_AP_BLK_MQ_ONLINEunsigned charumount_beginvdso_test_bitmmap_legacy_basepipe_inode_infoPG_reportedsecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opstightpoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITsubtree_ss_masks_vfs_rename_mutexsuspend_latewakeupcg_listpageofs_inZ_EROFS_PCLUSTER_INFLIGHTfind_get_page__xa_cmpxchgsrcu_barrier_completionCPUHP_AP_PERF_ARM_APM_XGENE_ONLINEdriver_flagserofs_destroy_percpu_workersPG_owner_priv_1elementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaitersput_pagesessionid__compiletime_assert_689kthread_create_worker_on_cpubi_flags_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1dax_devllistlz4_max_distanceZONE_DMAdebugfs_entryelem__compiletime_assert_691nr_retries__compiletime_assert_693__compiletime_assert_694__compiletime_assert_695__compiletime_assert_696__compiletime_assert_697__compiletime_assert_698__compiletime_assert_699flatdevsigval_talimitundo_listKMALLOC_RANDOM_STARTZONE_MOVABLEBIO_QOS_THROTTLEDnr_populated_domain_childrenmissedreport_zonesparent_could_setfcapquota_readPG_private_2st_shndxerofs_read_metabuffrees_fscachei_wb_frn_avg_timedelayed_work_listbd_fsfreeze_countfile_ref_ttypeblknrmembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typeatomic_dec_and_testmtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minCPUHP_AP_CACHECTRL_STARTINGCPUHP_AP_PERF_RISCV_STARTINGkobj_uevent_envCPUHP_AP_ONLINE_DYNfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tget_page__ai_ptrpathst_sizenr_frozen_tasksREQ_OP_ZONE_RESET_ALLz_erofs_pclustermodermtp_SLAB_HWCACHE_ALIGNwait_sumnum_tracepointslast_paupidexit_codemempool_tbitmap_weightexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalCPUHP_AP_ARM_CACHE_B15_RAC_DEADconsumersrtpoll_min_periodkernfs_elem_symlinkclock_was_set_seqwrite_msrDD_CLASS_TYPE_LEVEL_NUMcid_workkeyring_semsrcu_n_lock_retriesi_fopsa_handlerunlinkPG_fscacheperiod_contribforceidle_sumrcu_node_entryfeature_compatstart_scan_seqfsgidswap_rwCPUHP_PADATA_DEADneed_parent_lockrcu_syncerr_cpuhp_initslabvm_opsraw_atomic_dec_and_testiopollpagesizedisk_names_blocksizevm_pgoffz_erofs_decompress_reqtimesauprobepto_val____retrelease_agent_worknuma_workupdate_timeptrace_dr7_call_addrrescue_lockmax_segmentsWORK_BUSY_RUNNINGloginuidcheckrtpoll_untilexpiryoptimistic_spin_queuespin_unlockdl_defer_runningbi_bvec_doneroot_blkgz_erofs_bvec_iter_end__lstateCPUHP_AP_ONLINE_IDLEbio_alloc_biosetarch_spinlock_tupdated_nextueventlock_countrefcount_tcset_linksplugchild_countsaved_auxvinosmce_addrBIO_REFFEDnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_namemm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfdCPUHP_AP_RANDOM_ONLINEnr_wakeups_remotejtopllist_nodez_erofs_is_inline_pclusterswappagesclass_spinlock_irq_is_conditionalmemcg_awareparavirt_patch_templateclass_spinlock_irqsave_is_conditionalz_erofs_pcluster_beginrseq_csnum_ftrace_callsitessoftirq_expires_nexterofs_fileio_bio_allocreadlinkmigration_flagsfolio_putm_llenicur_pincountmptr__rcu_read_locktreerq_timeoutDEVICE_PANEL_BOTTOMlocked_pendingconv_zones_bitmapfolio_clear_privatelist_headqueued_spin_lock_slowpathtgidmax_pclusterblkswrite_protect_seqxa_mk_internalset_pgd_tidlast_statuss_inode_wblist_lockfrombd_holderend_codeblkio_countqspinlock__kmalloc_large_noproflru_geninsnfilldir_tz_erofs_do_decompressed_bvec__must_check_overflowdl_non_contendingdir_contexterofs_dev_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqCPUHP_BLK_MQ_DEADlockdep_keyset_nlinklong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsgroupseq_showctl_nodetlb_remove_tableswait_queue_headPG_headstart_context_switchcow_pageinumraw_atomic64_decfolio_get_privateac_btimeblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsCPUHP_AP_RISCV_TIMER_STARTINGclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integrityCPUHP_AP_IRQ_ARMADA_XP_STARTINGs_shrinkCPUHP_AP_TI_GP_TIMER_STARTINGi_private_listhrtimer_restarts_fsnotify_maskexit_mmapsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgcall_rcuarch_clear_bitnoderesetvm_lockteardownno_cgroup_migrationbuild_time_nsecnextevts_writers_key__countxcomp_bvcma_areakmap_local_pagestatic_prio__compiletime_assert_714flush_listmay_skip_resume__compiletime_assert_716__compiletime_assert_717shrinkerdl_yieldeddqi_formatipc_namespaceexec_update_lockCPUHP_AP_SMPBOOT_THREADSarch_set_bitatomic_write_hw_maxl1d_flush_killi_versionCPUHP_X2APIC_PREPAREDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentread_charPG_activesched_set_fifo_lowfirst_minorcgroup_nsia_sizein_hrtirqs_master_keysconst_test_bitset_pmdac_stimescaledqtailCPUHP_AP_ARM_XEN_RUNSTATE_STARTINGwchar_addr_bndkernel_symbolsubsys_dataz_erofs_decompressqueue_kthread_workbi_statusnr_cgrpstv_secma_lock__compiletime_assert_721__compiletime_assert_724pid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsma_rooturing_cmdpsi_filesnr_failed_migrations_affineIS_ERRnr_biosEROFS_SYNC_DECOMPRESS_FORCE_OFFuser_cpus_ptrirq_delay_totalpi_top_taskz_erofs_decompressqueue_workWORK_NR_COLORSJQ_BYPASSm_dax_part_offactoruprobenotifier_subscriptionss_readonly_remountCPUHP_AP_TMIGR_ONLINEkasan_check_writehlist_bl_nodest_otherPG_anon_exclusivekthread_destroy_workeri_mutex_keyflush_dcache_folioksethrtimer_clock_basevruntimedisable_depthCPUHP_AP_IDLE_DEADi_sizedl_deadline_hugetlb_hwpoisonpsi_group_cpuCPUHP_SMPCFD_PREPARECPUHP_AP_IRQ_BCM2836_STARTINGflush_tlb_kernelubufksm_rmap_items___GFP_HIGHMEM_BITstart2nr_populated_csetsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacemaxpagesvfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offxattr_prefix_startdq_inusecachedqi_flagswait_for_completion_iokeyring_name_listfolio_trylockkfreeread_posstatic_call_trampbtrace_seq_pp_mapping_padsa_mask__folio_putaddend1addend2__UNIQUE_ID_y_705request_queue__UNIQUE_ID_y_708__REQ_NOMERGEdqi_dirty_listmax_timefreedmod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlen__REQ_METAhaltcodegtime__UNIQUE_ID_y_711__UNIQUE_ID_y_713nr_populated_threaded_childrensigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listPG_swapcachesched_rt_mutexset_pte_SLAB_RED_ZONEnr_deferredfown_structfeatures_lockedCPUHP_AP_PERF_ARM_MRVL_PEM_ONLINECPUHP_XEN_PREPAREtracing_graph_pauseavg_triggerspermcompat_robust_listparavirt_callee_savebi_blkgnr_hw_queuesktypeCPUHP_MIPS_SOC_PREPARElockrefin_dpm_listsrcu_struct_ptrsmm_structset_pudrtpoll_wakeupvlagi_uidz_erofs_runqueueCPUHP_NET_IUCV_PREPAREtablesbi_iocost_costspinlocknr_dying_subsyspid_namespacesave_fl_syscallmod_arch_specificmax_write_lennum_static_call_sitesend_pfnvm_mm__kmem_cache_create_argsfortify_memcpy_chkdebugfs_iderofs_init_percpu_workerguest_permidle_notificationmem_dqinfotruei_countHRTIMER_NORESTART__cpu_online_maskbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_fileCPUHP_AP_IRQ_RISCV_IMSIC_STARTINGipc_nserofs_mount_optspcp_listpid_linkss_sysfs_nameq_size_fieldrefcountvaddrrequestrw_hintCPUHP_AP_IRQ_AVECINTC_STARTINGtimeoutreport_zones_cblast_switch_time__REQ_SWAPnum_classes__arch_hweight64orc_unwind_ip__compiletime_assert_655qc_dqblkavg_next_updatemmappedseqcount_raw_spinlockbd_holder_dircpu_run_virtual_totalkill_sbz_erofs_pcluster_readmored_opMIGRATE_ASYNCdevice_dma_parametersproc_ns_operationsWORK_OFFQ_FLAG_BITSi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failthrashing_countllist_headreserved2bytesCPUHP_CREATE_THREADSwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalget_dqblk__ret_condshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infobio_putcpu_delay_totaluser_keyring_registermempolicypm_message_tioveci_private_lockWQ_BHsegment_boundary_maskVTIME_IDLEfactor2static_keyremovesegments_magicdl_overrunallocd_parentz_erofs_read_fragment__WQ_DRAININGonline_cntPG_unevictablepayloadac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDCPUHP_AP_WORKQUEUE_ONLINEeventsofflinePG_reclaimpartialatomic_write_segments_maxatomic_opencss_resetbio_end_io_tpv_irq_opsstart_prevent_timeCPUHP_AP_RCUTREE_DYINGcondreadahead_controlblk_tracertpoll_timerz_erofs_bvset__kernel_gid32_tit_func_ptrkernfs_open_filestate_maskf_credMODULE_STATE_COMINGnotify_countmg_dst_csetoffline_disabled__empty_rangesbd_devz_erofs_aopspage_ref_dec_and_testread_newsignalfd_wqhmmapPageUptodatepto_tmp__modnameasync_put_workCPUHP_AP_PERF_ARM_HISI_HHA_ONLINEmknodpagecache_get_pagefsnotify_sb_info__sigrestore_tbi_idx__kernel_loff_tdetachget_unmapped_areadev_pagemapCPUHP_AP_PERF_X86_AMD_UNCORE_STARTINGroot_nidwritepagessched_statisticsheadsync_decompressminors__state_permuprobe_taskselfwriteback_controluclampsuper_operationslast_bstatbi_cookiesplice_eofnr_threaded_childrenutil_avg___GFP_DMA_BITtaskrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAz_erofs_pcluster_endbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETchecksumctx_idd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockfg_outraw_atomic_long_decbitsiopriocap_inheritablegp_waitlookupcostdev_pm_inforeq_opREQ_OP_ZONE_RESETblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_ops__REQ_NOUNMAPevents_fileFORTIFY_FUNC_memscanntimeerofs_global_shrink_cnt_cond_reschedvm_private_dataio_bitmap__bi_remainingsubtree_bstatuprobe_task_statetimerkobj_typeCPUHP_OFFLINEdiskseqCPUHP_ARM64_FPSIMD_DEADi_pagesZ_EROFS_COMPRESSION_DEFLATEatomic_write_hw_boundaryz_advisehlist_bl_headoldpageino_warnlimitCPUHP_AP_PERF_ARM_L2X0_ONLINEarch_uprobe_taskfasyncpidlists__eaxi_rt_spc_warnlimit__compiletime_assert_368__compiletime_assert_369page_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecfdevsysctls__WQ_LEGACYmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkCPUHP_IOMMU_IOVA_DEADbio_slabd_alias__iovcpumaskdumperwakeirq__ecxclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsz_erofs_pcpu_worker_lockclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflen__edisaved_trap_nrdatalayout__edxbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityerofs_try_to_free_all_cached_foliosrq_countrunningrseq_event_masks_rootra_pageslegacy_cftypesTT_COMPATCPUHP_AP_PERF_X86_AMD_IBS_STARTINGfwnode_handlepage_fixed_fake_headElf64_Symd_automountqueue_limitsPG_writebackread_syscallsreadahead_count_nr_pagesparentCPUHP_TOPOLOGY_PREPARE__dummy2atimecopy_file_rangetask_cputime_atomicuser_definedkey_typeWORK_STRUCT_LINKED_BITz_erofs_bvec_iter_begincgrp_linksPG_idlecurr_targetis_suspendedz_erofs_scan_foliopsi_memstall_enteruts_namespace__keytimeout_workvariable__ffsburstraw_atomic_setetypeei_funcsmodule_kobjectactive_memcgFORTIFY_FUNC_strcatreadahead_expandreadahead_gfp_maskdef_flagsCPUHP_AP_PERF_ARM_HISI_PA_ONLINEbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0rtpoll_totalno_updatecap_bsetmutex_lockopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areaCPUHP_AP_WATCHDOG_ONLINEsaved_statekernfs_elem_attrbasess_bdev_filenuma_faults__put_devmap_managed_folio_refsCPUHP_AP_ACTIVEcgroup_subsysfile_offsetlinux_binfmtpage_table_lock_sigfaultmax_sync_decompress_pagescountersfree_ldtkasan_check_readname_linkblk_mq_tagsmove_to_bypass_jobqueuecmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_typerstat_css_listpao_ID__policysharedxattr_shared_xattrswait_queue_entryCPUHP_XEN_EVTCHN_PREPAREdismissfind_next_bitlist_deld_real_typelookahead_bandseq_starttask_cputimepage_ref_incrq_qos_mutexraw_blkaddrzone_wplugs_wqraw_lockd_dnameac_schedWQ_CPU_INTENSIVEerofs_put_metabufmax_hang_timecpus_maskz_erofs_rcu_callback_pad_subdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamelogical_block_sizerun_delaytails__SCT__tp_func_erofs_readpagesblk_flags_tlinenoz_algorithmtypeCPUHP_TRACE_RB_PREPAREbi_io_vecbase_pfnERR_PTRget_inode_acl_addr_pkeymigrate_foliocustom_sliceoffset_highthread_keyringeffectivekparam_arrayutimez_fragmentoffstart_codereadahead_pagesfs_bio_setset_bitis_hardraw_atomic_add_returnfsbaseblk_status_tac_uidclock_listattrscpumask_t_SLAB_CONSISTENCY_CHECKSgid_mapworkerz_erofs_parse_in_bvecsswregs_statedqb_isoftlimitdma_iommublk_mode_tload_sp0orig_axkthread_work_func_t__REQ_ATOMICbd_claimingcompletesched_rt_entitymight_reschedtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__builtin_memsetCPUHP_AP_PERF_CSKY_ONLINEnr_cached_objectsbesteffortia_mtimetrc_ipi_to_cpuCPUHP_AP_IRQ_GIC_STARTINGerofs_map_blocksshrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldis_seenpi_offsetpclustersizediscard_granularitysize_addfopstotalreservedPG_privatelatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetrstat_cpusoftirq_pendingCPUHP_AP_JCORE_TIMER_STARTINGtime64_tREQ_OP_ZONE_OPENnuma_faults_localityhas_child_subreaperi_aclCPUHP_BP_PREPARE_DYN_ENDmemsetset_page_private___GFP_ZERO_BIToffset_middlem_deviceidwrite_newcgroup_freezer_statelazy_modepm_domaininstrument_atomic_read_writecpu_bitmapCPUHP_SH_SH3X_PREPAREucount_maxstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statePG_dirty__compiletime_assert_700__compiletime_assert_701__compiletime_assert_702__compiletime_assert_703__compiletime_assert_706__compiletime_assert_709softirq_next_timermax_active_zoneszone_wplugs_poolcheck_flags__esiz_erofs_exit_decompressorswp_entry_tbi_inline_vecs_mapcountdomain_tagarch_atomic_sethang_detecteduuidchild_ns_typeqf_fmt_idCPUHP_AP_ARM_MVEBU_SYNC_CLOCKS__compiletime_assert_715s_vfs_rename_keyevent__compiletime_assert_718__compiletime_assert_719set_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntm_bdevmodule_memorypi_entry__compiletime_assert_722__compiletime_assert_723implicit_on_dflk_sigaction__compiletime_assert_726read_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacac_exe_inode__init_worknr_to_scanfolio_iterthreaded_csetsDEVICE_PANEL_UNKNOWNfs_parameter_specdesc_structdq_offCPUHP_AP_QCOM_TIMER_STARTINGexec_maxkmap_ctrlqueue_ctxnode_stamponstackcompat_rmtpi_bytesdma_cleanupmaple_treeKMALLOC_DMAdentrylast_mergecpu_itimerfscache_cookiepercpuget_unique_idz_erofs_parse_out_bvecsrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlink__REQ_FAILFAST_DEVbio_add_pageload_tr_descpushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotCPUHP_PERF_X86_PREPAREcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesrangeerofs_nid_t__ptrcgroup_base_statfutex_exit_mutexpm_onlybio_next_foliokernfs_iattrstrc_blkd_nodeBIO_ZONE_WRITE_PLUGGINGd_spacegraveyard_linkblkszbitsxol_vaddrinplace_iosplice_readElf64_Addrd_rt_spacenameread_s64blk_mq_ctxbi_iopriou_flagsIS_ERR_OR_NULLCPUHP_WORKQUEUE_PREPnvcswac_tgetime__REQ_FAILFAST_DRIVERKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERBIO_QOS_MERGEDshared_pendingerofs_init_percpu_workersCPUHP_AP_PERF_ONLINECPUHP_VIRT_NET_DEADi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typeCPUHP_AP_TEGRA_TIMER_STARTINGread_pmcblk_integrity_checksum_SLAB_RECLAIM_ACCOUNTwrite_cr0self_exec_idwrite_cr2write_cr3write_cr4kernfs_opsbio_allocWORK_CPU_UNBOUNDPG_swapbackedCPUHP_ARM_BL_PREPAREz_erofs_pcluster_slabMODULE_STATE_LIVEstopnr_migrationsa_opsreq_listxa_flagsfreeze_raw_spin_lockbin_sizecloseREQ_OP_SECURE_ERASEgrphi___GFP_RETRY_MAYFAIL_BITCPUHP_INVALIDerofs_domainnr_sectorscpuhp_remove_state_nocallscftypeerofs_cpu_hotplug_destroyd_spc_timerjump_entriesctl_dirasync_suspendmsi_device_dataalignpv_opsFORTIFY_FUNC_UNKNOWNset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpNR_JOBQUEUESsplitcpuset_mem_spread_rotorio_optbvec_integrity_poolWORK_STRUCT_PWQ_BITWORK_OFFQ_POOL_BITSmnt_idmapdq_dqbarch_test_and_set_bituidhash_nodesaved_tfElf64_XwordCPUHP_AP_PERF_POWERPC_HV_24x7_ONLINEold_timespec32lock_class_keyexclnum_symsmodule_notes_attrsvm_lock_seqCPUHP_AP_EXYNOS4_MCT_TIMER_STARTINGCPUHP_AP_HRTIMERS_DYINGPIDTYPE_MAXroot_listPG_lockednlinkcpu_count__erofs_allocpagedefault_setavg_totalpercpu_refCPUHP_ARM_SHMOBILE_SCU_PREPAREBIO_QUIETns_commonhorizontal_positionmanaged_cacherlimit_maxPG_mappedtodiskpgd_valpref_node_forkwait_queue__int128dqi_privchunkformatrss_statCPUHP_AP_ARM_L2X0_STARTINGCPUHP_AP_PERF_ARM_HNS3_PMU_ONLINEtrace_erofs_readpagesmems_allowed_seqrefcntactionthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profileCPUHP_AP_X86_KVM_CLK_ONLINEfutexwait_maxac_niceresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightBIO_BPS_THROTTLEDBIO_CHAINvm_file___GFP_COMP_BITidr_basei_blockss_statefolio_mark_uptodatecpuhp_statelockref_get_not_zeroz_erofs_fill_other_copiesuser_sizedev_pm_ops__tracepoint_erofs_read_foliocdrom_device_infoleaveBIO_TRACE_COMPLETIONscheduledfsidfolio_flagsFAULT_FLAG_TRIEDxa_mark_tclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkerofs_grab_folio_nowaitdestroy_workqueuez_erofs_decompress_frontendkmalloc_typeqstrerofs_cpu_hotplug_initma_flagsREQ_OP_WRITEnr_ia_rangesmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cache_find_next_bitsizeZONE_DMA32_qprocwakeup_sourcef_posz_erofs_bvset_flipnext_posix_timer_id__kernel_long_ttask_fraginit_completionsrcu_gp_mutexdatalenCPUHP_AP_PERF_X86_ONLINEnr_wakeups_affine_attemptscache_strategyCPUHP_AP_CSKY_TIMER_STARTING__le16alt_len_SLAB_OBJECT_POISONusersizefolio_is_zone_devicecinblockextableexit_SLAB_PANICkernel_param_opsbus_dma_regionio_uring_cmddecompressed_secondary_bvecsdirtied_when_batch_countac_utimescaled__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexbpf_prog_arraycore_statetimerqueue_headlist_is_headpart0f_wb_errserial_nr__REQ_PREFLUSHWORK_OFFQ_DISABLE_BITSrcharfutex_pi_statekstat__kernel_uid32_tnewpage__le32q_lock_cls_keysubsys_maskDEVICE_FIXEDZ_EROFS_COMPRESSION_LZMApte_tdevice_driverdying_tasksdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockWORK_STRUCT_FLAG_BITSwq_misc_constscancel_forkepoll_watchessubmit_qtailCPUHP_IBMVNIC_DEADprealloc_pte__cpu_possible_maskCPUHP_AP_IRQ_AFFINITY_ONLINEdqb_curspacefolio_ordergp_statebitsetload_avgaccesscstimecpuidcfs_rqsynchronize_rcu_uidnr_vecsst_spacemm_cid_next_scanns_typeCPUHP_CPUIDLE_DEADdfl_cgrpac_majfltfactor1flush_dcache_pageposix_cputimers_work_uppermodule_param_attrsshort unsigned intCPUHP_POWER_NUMA_PREPARE__le64cpu_scaled_run_real_totali_mutex_dir_keyq_nodespc_warnlimitctl_table_sizeextent_SLAB_STORE_USERs_encodingqueue_workBIO_FLAG_LASTgpl_crcsorc_entrykeysinvalidate_io_bitmaporig_ptedqb_curinodesload__s8css_allocspin_lockinvalidate_lock_keydma_maskprealloc_mutexnanosleep__already_done__compiletime_assert_586CPUHP_CPUIDLE_COUPLED_PREPARE__NR_PAGEFLAGSCPUHP_MM_VMSTAT_DEADraw_atomic_long_addsrcu_gp_seq_neededpscr_ret__dq_dqb_lock__kernel_ulong_tvolnameio_minerofs_inodedl_periodsym___kernel_vsyscallptep_modify_prot_starti_fsnotify_markswakeup_pathdio_mem_alignbtimeprefixextra2__u8is_rox__UNIQUE_ID_guard653lockrlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onedevice_physical_location_horizontal_positionruntime_auto__UNIQUE_ID_guard661__readahead_folioseq_stopkf_rootkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidctl_table_argCPUHP_AP_ARM_ARCH_TIMER_EVTSTRM_STARTINGREQ_OP_ZONE_APPENDCPUHP_BP_KICK_APspin_trylocks_blocksize_bitsnuma_scan_periodutil_summigration_disablediter_typez_erofs_map_blocks_iterclass_device_is_conditionalshrinker_idbio_setpte_valroot__REQ_IDLEprojid_mapoom_reaper_listshutdown_preCPUHP_AP_ARM_ARCH_TIMER_STARTINGsym_VDSO32_NOTE_MASKm_labpf_storageno_callbacks__u16timers_activewait_count_SLAB_CACHE_DMA32_SLAB_TYPESAFE_BY_RCUsig_okCPUHP_AP_PERF_ARM_ACPI_STARTINGalloc_p4d__SCT__cond_rescheddelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedEROFS_KMAPwork_listdiscard_alignmentraw_spinlock_tbiterz_erofs_is_shortlived_pagekey_tagINIT_LIST_HEADgetgeofs_flagswordworkpgprotval_tkeytypeCPUHP_DEBUG_OBJ_DEADfortify_memset_chksigpendingmq_freeze_depthfsindexshstksrcu_ssppage_orderwake_irqcan_attach__page_1__page_2accounting_timestamp__sighandler_ts_bdevmapping_set_gfp_mask__u32ptracedtrc_reader_specialCPUHP_AP_PERF_ARM_HISI_DDRC_ONLINEHPROBE_GONExattr_shared_countactive_timethrashing_delay_totali_sequenceZ_EROFS_COMPRESSION_LZ4pool_datacachestrategydisk_statsdqb_ihardlimitCPUHP_IRQ_POLL_DEADd_lockrefREQ_OP_ZONE_CLOSErpm_requestnum_bpf_raw_eventsaddrdevice_privatecompat_robust_list_head_perfCPUHP_PERCPU_CNT_DEADz_erofs_read_folioi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesm_pacpuhp_setup_state_nocallsuclamp_reqchange_cookiedl_defer_armedwrite_infoshow_statsblock_devicekobj_ns_typefolio_posBLK_INTEGRITY_CSUM_CRC64WQ_POWER_EFFICIENTerofs_fscache_bio_allocf_iocb_flagsPG_isolatedpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_pathpidlist_mutex__u64journal_infoFORTIFY_FUNC_memmovesched_contributes_to_loadz_erofs_bvec_dequeuestatic_key_trueweighti_privatemaxrssPG_lruz_erofs_bvecflushpage_zonenumruntime_suspendCPUHP_AP_PERF_ARM_QCOM_L3_ONLINEi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsCPUHP_AP_PERF_POWERPC_NEST_IMC_ONLINEclass_irq_is_conditional_SLAB_ACCOUNTreschedule_jiffiessum_sleep_runtimera_foliosdeadlinemempool_spinned_vmtrace_erofs_read_folio_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startunused_hctx_lists_flagsfgf_tz_erofs_decompress_pclusterfaulterofs_map_devmigration_pendingalternative_gpt_sectornotify_page_enc_status_changeddl_densityfreeptr_tread_dqblkac_gidintegritydq_flagserr_workqueue_initDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusep_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_granrepeatkernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITavgs_worknum_kpin_execvetlb_flush_pendingpage_offset_baseRPM_REQ_SUSPENDs_listPG_youngFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionmax_descendantsREQ_OP_ZONE_FINISHserialclass_releasealloc_locks_dquotmax_hw_sectorsfolioqthreadedupdated_childrenBIO_BOUNCEDCPUHP_AP_PERF_ARM_HISI_SLLC_ONLINEprev_posCPUHP_SLUB_DEADCPUHP_AP_ARM64_ISNDEP_STARTINGseqcount_spinlockbio_first_folioexpire_countuid_maps_umountis_bin_visiblemmu_gatherpgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uid__list_del_entry_valid_or_reportz_erofs_decompress_kickoffCPUHP_BLOCK_SOFTIRQ_DEADio_delayCPUHP_AP_IRQ_SIFIVE_PLIC_STARTINGkcsan_atomic_nextchildrenwrite_gdt_entryrb_subtree_lastno_pm_callbackspmd_valbuild_idrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_tfolio_test_headrt_spc_timelimitsym_int80_landing_padtailia_atimeinfixtlb_ubcbi_issuequota_format_typeseekstask_struct__bitmap_weightrelease_dquotsrcu_n_exp_nodelayraw_atomic64_addsuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextWORK_OFFQ_LEFTio_tlb_memfreeptr_offsetCPUHP_MM_ZS_PREPAREsubmit_bioblk_flush_queuenr_tasksi_mtime_nsecperformancemmlisthd_geometry__compiletime_assert_0__compiletime_assert_1__compiletime_assert_2__compiletime_assert_3suppress_bind_attrsRPM_RESUMINGd_weak_revalidate_raw_spin_unlockgsbases_quota_types__preempt_count_addwrite_s64f_llistmq_freeze_lockdax_part_offoverlappedread_u64i_nlinkCPUHP_MM_MEMCQ_DEADbranchwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditional_SLAB_SKIP_KFENCEon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_tnotify_timershareFORTIFY_FUNC_strscpypagefault_disabledstate_startCPUHP_TMIGR_PREPAREsyscwil_prevwlockedfreeze_superPTR_ERRs_inode_list_lockelevator_queuehugetlb_optimize_vmemmap_keyruntime_idle__lockref_is_deadsweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgPG_large_rmappablentabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirp4dval_tPG_referencede_csetsreal_blockedarg_locknum_exentriespid_ns_for_childrenlower_firstrequeue_workbio_splitfolio_test_uptodateint32_t__UNIQUE_ID_x_581offset_ctxcur_ktimenr_failed_migrations_runningcompact_delay_totalclassesnext_timerexclusiveclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datarelease_p4dmmap_locksysfs_lockreq_flag_bitsrq_qosCPUHP_AP_HYPERV_TIMER_STARTINGfsavekeyring_index_key__WQ_ORDEREDxattr_blkaddrqrwlockoverflowfile_ra_statemax_depthuser_structdevt_slotofferofs_xattr_long_prefixon_rq__p_size_fieldCPUHP_AP_ARM_CACHE_B15_RAC_DYINGoff0fs_contextmempool_alloc_tCPUHP_AP_ARM_XEN_STARTINGprealloc_bufDL_DEV_DRIVER_BOUNDerofs_blk_tprojiddrop_inodenum_trace_evalsnum_vfbypassllseekZ_EROFS_PCLUSTER_FOLLOWEDDEVICE_HORI_POS_CENTERDL_DEV_PROBINGkcsan_set_access_masknext_offsetcommit_dqblkpv_cpu_opsi_ino_warnlimit__compiletime_assert_455__compiletime_assert_456atomic_write_boundary_sectorswritable_sizercu_nodeWQ_SYSFSpoll_queue_procload_idtunfreeze_fsintervalclasslast_mm_cidfile_lockmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagsSYSCTL_TABLE_TYPE_DEFAULTkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpupage_freeilenmnt_flagsvm_structcred_guard_mutexmajorWORK_OFFQ_POOL_SHIFTsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrattributeclass_raw_spinlock_is_conditionaldev_archdata__UNIQUE_ID___addressable___SCK__tp_func_erofs_readpages664i_deviceskey_perm_tcss_rstat_flushbio_integrity_payloadpi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsCPUHP_AP_IRQ_EIOINTC_STARTINGend_context_switchlist_lruusing_gplonly_symbolstarget_knz_erofs_destroy_pcluster_poolsival_ptrreg_offsetkaddri_opflagsz_erofs_fill_bio_veclast_subtree_bstatrobust_listsym___kernel_rt_sigreturninfix_lensym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctlalloc_ldtlockdep_mapfiltercurr_ret_stack__compiletime_assert_451dockcgroup_fileforwarddev_links_infoloff_tthread_pidfscache_volume_SLAB_TRACEsrcu_gp_seqextra_deviceschunkia_rangescgroup_rstat_cpu_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedBIO_CGROUP_ACCTinsnlennr_shrinkclass_map_typePROBE_PREFER_ASYNCHRONOUSCPUHP_AP_IRQ_HIP04_STARTINGCPUHP_RELAY_PREPAREicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1matchCPUHP_TIMERS_PREPAREmemory_typerb_rootnr_wakeups_localnr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsCPUHP_AP_MIPS_GIC_TIMER_STARTINGWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__filler__list_addsaved_sigmaskd_timeentriesenter_mmapcpu_idfop_flags_t__MAX_NR_ZONESFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secCPUHP_AP_PERF_S390_SF_ONLINEheadoffsetevent_flagssched_delayedbd_statsbi_sizemodule_state__write_overflow_fieldmq_kobjlast_used_at__mutex_initbypass_qtailhardirq_stack_ptrZ_EROFS_COMPRESSION_ZSTDvm_endlast_queuednuma_migrate_retryuser_ns__stateread_msrconst_folio_flagsRPM_REQ_NONEfirstiommu_groupdma_alignmentmigrate_to_ramPG_reservedwait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_t__REQ_NOWAITi_modenr_thpsia_ctimeproc_handlerFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progressCPUHP_PCI_XGENE_DEAD__list_delavgs_locksrcu_barrier_mutexcpumask_checki_private_dataflush_tlb_userElf64_Halfuse_autosuspendcompact_countrcu_read_unlockFORTIFY_FUNC_memcpynsproxycan_wakeupz_erofs_workqueuexol_area_SLAB_CMPXCHG_DOUBLErlockpcpu_hotfl_owner_t_resia_rangeeuidwaitbug_tabledirtied_time_whencpu_onlinem_plensequential_io_avgz_erofs_bvec_enqueuenr_pagesnum_trace_bprintk_fmtload_tlscpu_run_real_totalvm_policyraw_atomic_incperf_rdpmc_allowedrdevprivate_dataset_debugregDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__SCK__tp_func_erofs_read_folio__state_sizecallerthread_structcached_requested_keyenvp_indexbvec_iterPG_savepinnedpage_sizectimeCPUHP_RCUTREE_PREPreleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datacpu_max_bits_warnmm_usersbd_holder_lock__cpuhp_setup_states_ids_dentry_lrubp_offsetnet_nsz_erofs_decompblk_crypto_profilefolio_queuelast_task_numa_placementnr_descendantspgtable_tblock_start__REQ_FUAcgtimefolio_put_testzerosymlinkoom_flag_originfolio_set_privateCPUHP_KVM_PPC_BOOK3S_PREPAREcounterorc_unwindavailable_compr_algsWRITE_LIFE_SHORTmemstall__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapfposdonecpumask_test_cpufscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSac_btime64mg_dst_preload_noderatelimitfree_foliodebugfs_dirCPUHP_RANDOM_PREPAREqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquota_SLAB_NOLEAKTRACEshouldallocem_perf_tableswapin_countdl_timeri_dataDL_DEV_NO_DRIVERrstat_css_nodeFAULT_FLAG_ORIG_PTE_VALID__kvmalloc_node_noprofsysv_semanon_vma_namefileattravg_nr_triggerslong long unsigned intanon_name__erofs_try_to_release_pclusteropen_partitionsblkcg_gqpageofs_outia_filesival_intCPUHP_ZCOMP_PREPAREnuma_preferred_nidinstrument_atomic_write_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobecompressed_pages_Boolfillgapssleep_start__p_sizez_erofs_exit_subsystemmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatecss_idri_linklistxattr_lowertrap_nrbinfmt_misc__REQ_RAHEADasync_probe_requested__list_add_valid_or_reportcompat_long_tac_etimeactive_countctorCPUHP_AP_CLINT_TIMER_STARTINGs_iflagsprevent_sleep_timekmem_bucketsmce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_terofs_sb_infomnt_namespaceREQ_OP_DISCARDm_fps_op_SLAB_NO_OBJ_EXTsysv_shminstrument_atomic_readdq_countutf8data_tableset_latency_tolerancePG_waitersz_idataoffCPUHP_AP_DTPM_CPU_DEADfoliowake_entryxa_headsuidCPUHP_PERF_SUPERHi_readcountblk_integritylocked_vmrb_leftnew_inodemg_src_cgrpseq_nextkmem_cache_freesym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_tfolio_detach_privateclass_rcu_is_conditionalbpf_local_storageupdate_io_bitmapclockid_tquota_syncput_devmap_managed_folio_refsdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countWQ_UNBOUNDksm_merging_pagesEROFS_SYNC_DECOMPRESS_AUTOautosleep_enabledptrace_entryblkg_listerr_pcpu_workerCPUHP_NET_MVNETA_DEADCPUHP_AP_ARM_VFP_STARTINGrecent_used_cpunum_jump_entriesmount_opts_qcopatomic_tbv_pagealloc_tag_counters_flagsrqos_debugfs_dirnotify_nexte_cset_nodePG_mlockedbus_dma_limitshort intmynodepart_tblvcpu_is_preemptedZ_EROFS_COMPRESSION_MAXblk_mq_opsclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablearch_atomic_incf_ownerCPUHP_PERF_PREPAREbp_reggate_descVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invcss_offlinepad_untilDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerCPUHP_AP_PERF_X86_AMD_POWER_ONLINEprio_listatomic_write_hw_unit_max_flags_1_flags_2CPUHP_PERF_X86_AMD_UNCORE_PREPdestroy_rworklast_arrivalend1end2pagepoolpgnrem_pdtrace_event_callzero_user_segmentssyncis_guestdevice_physical_locationpm_domain_datanr_extentsnr_scannedscurpoll_table_structwrite_msr_safedirect_IOwait_queue_entry_televatormake_p4dpcpucurrent_may_mountseqlock_tbd_queuenuma_scan_offsetcgroup_subsys_statenrpagepclusterpagesCPUHP_AP_IRQ_MIPS_GIC_STARTING___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskz_erofs_decompress_backendcpumask_weightfreezerCPUHP_AP_ARM_TWD_STARTINGregfuncindex_keymemalloc_noioGRPQUOTArwsemi_ctime_nsecia_validSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYerofs_cpu_offlineCPUHP_AP_BASE_CACHEINFO_ONLINEvertical_positionWORK_OFFQ_FLAG_ENDvirtmemFORTIFY_FUNC_strncati_rcumax_distance_pagesi_atime_secWORKER_DESC_LENqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITactivecurrent_workdqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listCPUHP_AP_ONLINExarray_start__flagsp_size_fieldfadvise__compiletime_assert_663m_algorithmformatvmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atz_erofs_cache_aopslast_sum_exec_runtimeCPUHP_AP_ARMADA_TIMER_STARTINGiov_iterarch_atomic_add_returnia_gidonstack_usedumount_mutexattribute_groupcontextposix_timersselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nskcsan_check_accesssource_list_keyswap_readahead_info__fpstateactive_refpmdval_tctl_table_root___GFP_NOFAIL_BIT__REQ_FAILFAST_TRANSPORTarch_local_save_flagsgroup_infovdso_imageblk_qc_tfileWORK_BUSY_PENDINGof_match_tablepercpu_count_ptr__user_state_sizeCPUHP_POWERPC_MMU_CTX_PREPARErcu_read_lock_any_helddfl_cftypes__WQ_BH_ALLOWSbvsetmce_kill_mephysical_block_sizeuuid_tz_erofs_create_pcluster_pooldirblkbits___GFP_UNUSED_BITatomic_write_hw_unit_minclass_preempt_notrace_constructorpv_lock_opsCPUHP_AP_PERF_ARM_STARTINGcount_objectsctl_table_seterrorq_size_stimezone_device_dataEROFS_ZIP_CACHE_READAHEADnr_active_requests_shared_tagsi_flctxbase_indexdefparamlockref_mark_deadfred_csq_lockdep_mapfault_flagxa_findreventskprojid_tptracer_credtlb_genpv_mmu_opsstoreio_lock_cls_key__UNIQUE_ID_y_582__UNIQUE_ID_y_585page_mkwritekobjectaudit_ttyvariable_test_bit___p1rtpoll_triggersmce_ripvstatfsctl_table_headertag_set__WQ_DESTROYINGrescue_list__filemap_get_folioPageWorkingsetnumab_stateremovablefeatureson_list__compiletime_assert_692kgid_ton_cpumanaged_pslotsFAULT_FLAG_VMA_LOCKWORK_OFFQ_BH_BITfregs_statedrop_nsalloc_pmdnum_ei_funcsrestore_sigmasksrcu_cblistREQ_OP_DRV_OUTstoragesz_erofs_readaheadsize_mulclass_groupspsi_groupnuma_nodeerofs_pagepool_addoffsetsi_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tBIO_PAGE_PINNEDioctx_tableVTIME_SYSchangedsysfs_registeredowned_headdebugfs_mutexwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opsforce_fgsequential_iotime_namespace_large_mapcountsda_is_static__compiletime_assert_109formaterofs_onlinefolio_initftopenclavebi_privatesp_regcreateiattrWORK_STRUCT_PENDING_BITrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_list__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115get_reserved_space__compiletime_assert_117__compiletime_assert_118__compiletime_assert_119non_seqstack_refcountinvalidate_lockCPUHP_MM_WRITEBACK_DEADbmapkey_payloadtimer_rand_stated_realancestorsCPUHP_TEARDOWN_CPUdecomp__datapcluster_poolexpiry_activenextpage__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126dqi_max_spc_limit__compiletime_assert_128__compiletime_assert_129z_erofs_next_pcluster_teval_stringexception_table_entry_erofs_printkvirt_boundary_maskevent_countpreempt_countWORK_STRUCT_COLOR_SHIFTarch_atomic_dec_and_testfolio_nextfallocatei_spc_warnlimitbuddy_listi_ino_timelimit__compiletime_assert_130__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135__compiletime_assert_136mems_allowed__compiletime_assert_138pending_biosCPUHP_X86_MCE_DEAD__preempt_count_dec_and_testtlb_flush_batched_ddebug_infoxa_find_afteris_noirq_suspendedtracepoints_ptrsleaderdevmap_managed_keyload_gs_indexold_subtree_controltimemutex_trylockwakee_flip_decay_tserofs_fscache_submit_bios_max_linksnr_wakeups_syncCPUHP_AP_RCUTREE_ONLINECPUHP_AP_OFFLINEkallsymsprevdma_parmsfs_structclockiduint32_targ_startatomic_incuseroffsetblocksz_erofs_should_alloc_cache__might_reschedenterflush_tlb_multivectorFORTIFY_FUNC_strncpyalloc_pte__bi_cnttimer_list_oldEROFS_NO_KMAPd_ino_warnshiwater_vmtracepointcompound_headia_vfsuidz_erofs_endiobootstrap_nr__kernel_ssize_tCPUHP_AP_KVM_ONLINEorig_ret_vaddrpoweroff_noirqalloc_pudrenamevm_area_structrpm_statussb_writersino_timelimitCPUHP_AP_ARC_TIMER_STARTINGsplice_writei_rt_spc_timelimitdecompressed_pagesbd_nr_sectors__list_del_entry_validconstant_test_bitqf_nextPG_arch_1rangesz_erofs_bvset_inlineiommu_mmirq_enableblk_features_tcutimeem_tablepersonalityget_statetask_sizes_inodes_addrerofs_onlinefolio_splitbinfmtirq_domainsigned charpersistent_keyring_registerz_erofs_cache_invalidate_folioprioprivfolio_ref_incgetattrsched_infod_fieldmaskqueued_spin_unlock__REQ_ALLOC_CACHEuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signopacked_inodeenabledi_rdevfixupsfile_operationsbio_flaggedKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tagavg_last_update_killktime_tz_erofs_pclustersymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsitemmax_allowed_capacityi387iterd_ino_timeravx512_timestampfuncsend_datasubtree_controlsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writersPG_foreign__UNIQUE_ID_x_704setlease__REQ_INTEGRITYpins__UNIQUE_ID_x_707candidate_bvpagepacct_structmust_resume__REQ_FS_PRIVATEzone_wplugs_hashlong intout_tocachecompressed_bvecsfile_lock_contextusageCPUHP_AP_PERF_POWERPC_TRACE_IMC_ONLINEl_yeserr2siglockstatuserror_injection_entrycurrent_taskreal_addressac_stimeCPUHP_AP_TICK_DYINGsync_iofred_ss__SCK__tp_func_erofs_readpages__kmalloc_indexi_size_readvolumekvfree__write_overflownr_iosprintk_index_sizesymtabtimes_prevstandalone__REQ_PRIOkmem_cache_destroyrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegidCPUHP_AP_X86_TBOOT_DYINGdq_hashput_supererofs_cpu_onlinepushable_dl_tasksf_flags__newcodetagprocnamemq_sysfs_init_donehweight_longz_logical_clusterbitssuper_blockmark_dirtynr_dying_descendantsnum_srcu_structsbdi_writebackBIO_EMULATES_ZONE_APPENDkobj_completion_SLAB_POISON__kernel_clockid_tseccompxattr_isizeCPUHP_MM_ZSWP_POOL_PREPAREiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespecinode_isizepflagscancelled_write_bytesac_tgidsrcu_usagebitmapacpi_match_tablememcg_sigvalkvmalloc_array_node_noprofmax_perf_statebvecnameidatacancelinglatency_recordmod_kallsymsmnt_id__UNIQUE_ID_rcu654islotbitsdepthwait_queue_func_tcnvcswnuma_next_scanrelease_pmdMIGRATE_SYNC_LIGHTnr_migrations_coldz_tailextent_headlcnerofs_fscachePG_readaheadcheck_eventsssize_tCPUHP_PAGE_ALLOCiopl_emulmax_write_zeroes_sectors__UNIQUE_ID_rcu662work_structdesc_lensb_sizeflockCPUHP_AP_ARM_CORESIGHT_STARTINGtask_io_accountingmremaps_writers__fortify_panictracepoint_funcargventryfree_cached_objectsREQ_OP_DRV_INworkqueue_struct_nextBIO_REMAPPEDreversePG_has_hwpoisonedpr_opspi_lockfeature_incompat___orig_eipprobestubsectorget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqrelease_agent_pathclass_spinlock_irq_try_is_conditionaloom_mmCPUHP_AP_IRQ_THEAD_ACLINT_SSWI_STARTINGz_erofs_bind_cacheFAULT_FLAG_INTERRUPTIBLEsrcu_reader_flavorirq_safetv_nsecsrcpi_lruFORTIFY_FUNC_strcpyqueue_depthdom_cgrpwpcopy_delay_totalgfp_maskpi_state_listrcu_segcblistsubvolm_daxdevusedarch_atomic64_decfree_inodeprojid_tmg_tasksuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infortpoll_trigger_locksrcu_structrlim_curnofaultnamespacemm_countdrv_groupsstackshrinker_run_nooffline_waitqmnt_nsreadahead_lengthac_ppidfunctionki_flagsbvec_poolbd_start_sect___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashmax_sectorssgidz_erofs_shrink_scaninitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timecgroup_rootdatastrtabtty_old_pgrpold_dom_cgrp_raw_spin_trylockCPUHP_AP_PERF_ARM_HISI_CPA_ONLINEdl_throttledi_rwsemrtpoll_statesget_projidCPUHP_AP_REALTEK_TIMER_STARTINGsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1release_pte__int128 unsignedpcountCPUHP_AP_ARM_MVEBU_COHERENCYz_erofs_decompressqueuevcntrestore_noirqdma_pad_maskki_filpCPUHP_AP_ARM_CORESIGHT_CTI_STARTINGshm_clistcap_ambientdma_configurePG_partially_mappedruntime_errormdevatomic64_tanon_vmarelease_pud__compiletime_assert_513PROBE_DEFAULT_STRATEGYrlimread_folionr_events__vpp_verifyclear_bitCPUHP_AP_PERF_X86_UNCORE_ONLINEiommubi_opfstore_trprivatezerohlistcftsst_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctx__compiletime_assert_529splice_pipeblk_mq_tag_seterofs_super_blockspinlock_checkblk_independent_access_rangess_lock_keymg_nodesrcu_gp_startopentime_nsit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTCPUHP_AP_HYPERV_ONLINEnbitsKMALLOC_RANDOM_ENDxa_loadmodstqheads_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionaldeadremap_file_rangeac_commnr_hangssym_vvar_startgid_twake_cpuchainedio_uring_taskatomic_long_decpage_offsettask_worksmemory_failurerb_root_cacheds_copset_ownershipdd_key_truekmalloc_array_noprofhres_activeconfigbpf_raw_eventsclass_preempt_notrace_terr_decompressordq_dirtydl_defererofs_try_to_release_pclusterbug_listdirect_completeidr_rtlegacy_namexa_lockz_erofs_put_pclusterlist_addfxregs_stateCPUHP_AP_PERF_ARM_CCN_ONLINEload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countirq_counttop_of_stackkey_restrictionnr_rangeexit_stateuts_nsis_late_suspendedsysvsem__REQ_SYNCucountz_erofs_get_pclusterCPUHP_BIO_DEADignore_children_SLAB_CACHE_DMA_pflagsrestore_earlyclock_mutexfs_supersdom_csetroot_csetz_erofs_bvec_itemdqb_bsoftlimitpendingmax_dev_sectorsz_erofs_bvec_iterf_task_workrcu_callback_t___GFP_NORETRY_BITiowait_count__compiletime_assert_583read_cr0read_cr2read_cr3CPUHP_ACPI_CPUDRV_DEADset_read_onlyCPUHP_MD_RAID5_PREPAREthrotl_datas_kobj_unregisterCPUHP_AP_PERF_S390_CF_ONLINEdma_io_tlb_memrtpoll_scheduledstringread_countforkfutex_offsetlong long intCPUHP_AP_ARM64_DEBUG_MONITORS_STARTINGbdevatomic_flagssysvshmslab_flags_tCPUHP_AP_SMPCFD_DYINGtimer_expiresCPUHP_AP_PERF_POWERPC_CORE_IMC_ONLINEtrace_evalsactive_basesinit_namehierarchy_idkmem_cache_argsearly_initmprotectmapping_gfp_masksecurityxmm_spacem_flagsactivatenr_cpu_idsassoc_arrayf_pos_lockCPUHP_AP_PERF_ARM_CAVIUM_TX2_UNCORE_ONLINEownederofs_sb_lz4_infoi_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structWQ_FREEZABLE___GFP_FS_BITdepends_ondomain_dataidr_nextrelax_count___GFP_THISNODE_BITlinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sepkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterszone_wplugs_lockd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizeattributes__list_del_entrycached_rqsset_child_tidblk_unique_id_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_statemin_nrxattr_prefixestick_dep_maskatomic_readerofs_sb_list_locklistthrottle_disksi_errnopageflagss_inode_lruz_erofs_gbufsrcu_size_stateblk_plugtotal_blocksdomain_idneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_t__param_reserved_pagesfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolbd_mappingsym_vvar_pagemodule_sect_attrsreturn_instancearch_test_bitsoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intgendiskxattr_filter_reservedspc_timelimits_instancesdescseqcountoom_score_adjoldbitd_seqbi_crypt_contextia_vfsgidzone_typesize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxz_erofs_gbuf_idrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucountcpuhp_deads_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_heads_vopraw_atomic_readperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tdevscputime_atomicrestoredelayed_callbi_itermax_nr_cid_statusmark_dead__kcsan_check_accessd_sibdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedlimits_lockdl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdax_devicercu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollresvnr_wakeups_idleio_cqelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAsyscore__s64dqi_bgrace__UNIQUE_ID_y_619__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritevolume_nametypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionalmeta_blkaddrdma_poolsshrinker_register_addr_lsbfeature_incompati_generation_sigpollmxcsrdevtd_rt_spc_hardlimit__free_pagesbuild_timebi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qoserofs_xattr_prefix_itembi_sectormap_typef_oppids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sberofs_release_pagesarch_static_branchsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entry___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootPG_arch_2next_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockbi_write_hinthash_lenget_policy__list_add_validHRTIMER_RESTART__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedquotdl_runtimenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdxattr_prefix_countfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupPG_checkedrescue_workqueueptrace_messagenum_trace_events_sys_privatealignment_offsetopen_mutexinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocks__param_str_global_buffersstart_stackwatcherskmalloc_cachescompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolPG_hwpoisonUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsdiskbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodecurr_nrsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structcnivcswbin_attrs_newbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGPG_vmemmap_self_hostednrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idxZONE_DEVICE_head_1_head_2bd_size_lockbackstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumeshrinkwake_qfileattr_setrcuwaitPG_pinnedbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrslaunder_folioprimarydevice_blocksonlineruntime_resumedup_xol_workqueue___GFP_WRITE_BITMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdevice_id_maskdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimelist_add_taili_mmapPG_owner_2phys_addrd_lrusignal_structperf_event_mutexhprobecrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriverZONE_NORMALi_opldt_usr_semkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__task_fpstatemaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrPG_xen_remappedpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjPG_uptodatesrcu_cb_mutexstatic_call_siteput_page_testzeroMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadparam_ops_uintsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalseremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagcoredump_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatorpanelclass_idinactive_timer_pkeyfilenames_export_opfront_pad__mptrstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errshm_clistis_child_subreapercall_depthunicode_mapnum_descsis_zone_device_pagePG_workingsetexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidrseq_sigdev_pm_domainlimit0limit1nr_zonesmigrate_modebio_poolpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrstack_vmusage_count_folio_nr_pagesioctlshowunsigned charumount_beginvdso_test_bitmmap_legacy_basepipe_inode_infoPG_reportedsecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opspoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITs_vfs_rename_mutexsuspend_latewakeupcg_listsrcu_barrier_completiondriver_flagsPG_owner_priv_1elementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapraw_atomic_long_readfiemapwaitersput_pagesessionidarch_atomic_readbi_flags_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1dax_devllistZONE_DMAdebugfs_entryelem_compound_headnr_retriesflatdevsigval_talimitundo_listKMALLOC_RANDOM_STARTZONE_MOVABLEmissedreport_zonesbi_idxquota_readPG_private_2st_shndxfrees_fscachei_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wqalloc_pages_bulk_noprof_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typeatomic_dec_and_testmtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tpathmigrate_enablest_sizermtpwait_sumnum_tracepointsupidexit_codemempool_tbitmap_weightexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkPG_fscacheperiod_contribrcu_node_entryfeature_compatstart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsraw_atomic_dec_and_testiopollpagesizez_erofs_rsv_nrpagesdisk_names_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7erofs_shrinker_register_call_addrrescue_lockmax_segmentsloginuidcheckexpiryoptimistic_spin_queuespin_unlockdl_defer_runningbi_bvec_doneroot_blkg__lstatearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvinosmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotevunmapllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nexterofs_shrink_countreadlinkmigration_flags_pincounttreerq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidmax_pclusterblkswrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockgbufbd_holderend_codeqspinlock__kmalloc_large_noproflru_geninsnfilldir_t__must_check_overflowdl_non_contendingdir_contexterofs_dev_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqlong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsseq_showswait_queue_headPG_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinki_private_listhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgnodereset__param_global_buffersvm_lockno_cgroup_migrationbuild_time_nsecnextevts_writers_key__countxcomp_bvcma_areastatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentPG_activefirst_minoria_sizein_hrtirqs_master_keysconst_test_bitwchar_addr_bndkernel_symbolsubsys_databi_statustv_secma_lockpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsma_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskactoruprobenotifier_subscriptions__default_kernel_pte_maskkasan_check_writehlist_bl_nodest_otherPG_anon_exclusivei_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headz_erofs_gbuf_growsizemce_vaddrquota_offxattr_prefix_startdq_inusecachedqi_flagskfreestatic_call_trampbtrace_seq_pp_mapping_padsa_mask__folio_putrequest_queuedqi_dirty_listmax_timefreedmod_tree_nodef_sb_errwritepagecodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listPG_swapcachesched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listbi_blkgnr_hw_queuesktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidtablesbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdstmp_pagesexe_filenr_scannederofs_mount_optspcp_listpid_linkss_sysfs_namerefcountvaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classes__arch_hweight64orc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbd_holder_dirkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWERllist_headbyteswait_startatomic_long_readf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicypm_message_tioveci_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentPG_unevictablepayloadac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflinePG_reclaimatomic_write_segments_maxatomic_openbio_end_io_tstart_prevent_timecondreadahead_controlblk_trace__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_dev__UNIQUE_ID_global_bufferstype616page_ref_dec_and_testread_newsignalfd_wqhmmapmodnameasync_put_workmknoderofs_init_shrinkerfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemaproot_nidwritepagessched_statisticsheadsync_decompressminors__state_permuprobe_taskwriteback_controluclampsuper_operationsbi_cookiesplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriocap_inheritablegp_waitlookupcostdev_pm_infopacked_nidblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opserofs_global_shrink_cntvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typediskseqi_pagesZ_EROFS_COMPRESSION_DEFLATEatomic_write_hw_boundaryhlist_bl_headino_warnlimitfasynci_rt_spc_warnlimit__compiletime_assert_368__compiletime_assert_369page_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecfdevmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nr__this_modulez_erofs_gbuf_initbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handlepage_fixed_fake_headElf64_Symd_automountqueue_limitsPG_writebackphysical_block_size_nr_pages__UNIQUE_ID_reserved_pagestype617parentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typePG_idlecurr_targetis_suspended__keytimeout_workburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatecap_bsetmutex_lockopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faults__put_devmap_managed_folio_refslinux_binfmtpage_table_lock_sigfaultmax_sync_decompress_pagescounterskasan_check_readname_linkblk_mq_tagscmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_typepolicysharedold_ptrwait_queue_entrydismisslist_deld_real_typelookahead_bandseq_startrq_qos_mutexzone_wplugs_wqraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_t__param_str_reserved_pagesshow_devnamelogical_block_sizerun_delaytailsblk_flags_tlinenobi_io_vecbase_pfnget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseblk_status_tclock_listattrsarch_atomic64_readcpumask_tswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldpi_offsetdiscard_granularityfopstotalreservedPG_privatelatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendinggbuf_resize_mutextime64_tnuma_faults_localityhas_child_subreaperi_acl___GFP_ZERO_BITwrite_newlist_lockpm_domaininstrument_atomic_read_writecpu_bitmapstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statePG_dirtysoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagssme_me_maskswp_entry_tbi_inline_vecsz_erofs_gbufpool_mapcountdomain_taghang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtpi_bytesdma_cleanupmaple_treeKMALLOC_DMAdentrylast_mergecpu_itimerfscache_cookiepercpuget_unique_idrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesrangeerofs_nid_tfutex_exit_mutexpm_onlykernfs_iattrstrc_blkd_noded_spacegraveyard_linkblkszbitsxol_vaddrsplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevblk_integrity_checksumself_exec_idkernfs_opsfile_lockPG_swapbackedMODULE_STATE_LIVEnr_migrationsa_opsreq_listxa_flagsraw_atomic64_readfreeze_raw_spin_lockbin_sizecloseerofs_shrink_scangrphi___GFP_RETRY_MAYFAIL_BITerofs_domainnr_sectorsz_erofs_gbuf_nrpagesd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqbuidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keyerofs_sb_listnum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXPG_lockednlink__erofs_allocpagepercpu_refhorizontal_positionmanaged_cachePG_mappedtodiskpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_fileidr_basei_blockss_stateuser_sizedev_pm_opscdrom_device_infoscheduledfsidFAULT_FLAG_TRIEDmigrate_disableclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkkmalloc_typeqstrma_flagsnr_ia_rangesmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cachesizeZONE_DMA32em_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptscache_strategyalt_lenfolio_is_zone_devicecinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_count__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headf_wb_errrcharfutex_pi_statekstat__kernel_uid32_tq_lock_cls_keyDEVICE_FIXEDZ_EROFS_COMPRESSION_LZMApte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockepoll_watchesprealloc_pte__cpu_possible_maskdqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysorig_ptedqb_curinodesload__s8spin_lockinvalidate_lock_keydma_maskprealloc_mutexnanosleep__NR_PAGEFLAGSz_erofs_rsvbufsrcu_gp_seq_neededpscr_ret__dq_dqb_lock__kernel_ulong_tvolnameio_mindl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onedevice_physical_location_horizontal_positionseq_stopkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodutil_summigration_disablediter_typeclass_device_is_conditionalshrinker_idbio_setrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storagealloc_pages_noprofno_callbacks__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_alloweddiscard_alignmentraw_spinlock_tkey_taggetgeofs_flagsworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstksrcu_ssperofs_shrinker_infopage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequenceZ_EROFS_COMPRESSION_LZ4pool_datadisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeBLK_INTEGRITY_CSUM_CRC64f_iocb_flagsPG_isolatedpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssPG_lruflushpage_zonenumruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinevmapmempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startunused_hctx_lists_flagsfaultmigration_pendingalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkintegritydq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listPG_youngFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotmax_hw_sectorsfolioqfolio_putprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uid__list_del_entry_valid_or_reportkcsan_atomic_nextchildrenrb_subtree_lastno_pm_callbacksbuild_idrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_padtailia_atimeinfixlasttlb_ubcbi_issuequota_format_typeseekstask_struct__bitmap_weightrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometry__compiletime_assert_2__compiletime_assert_3suppress_bind_attrsRPM_RESUMINGd_weak_revalidate_raw_spin_unlockgsbases_quota_typesf_llistmq_freeze_lockdax_part_offi_nlinkbranchwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedfreeze_supers_inode_list_lockelevator_queuehugetlb_optimize_vmemmap_keyruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgPG_large_rmappablentabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirPG_referencednextentsreal_blockedarg_locknum_exentriesrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosfsavekeyring_index_keyxattr_blkaddrqrwlockoverflowfile_ra_stateuser_structerofs_xattr_long_prefixon_rqfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGkcsan_set_access_masknext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpupage_freeilenmnt_flagsvm_structcred_guard_mutexmajorsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offseti_opflagsrobust_listsym___kernel_rt_sigreturninfix_lensym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stack__compiletime_assert_451dockerofs_shrinker_unregisterdev_links_infoloff_tthread_pidfscache_volumesrcu_gp_seqextra_devicesia_ranges_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1matchmemory_typerb_rootnr_wakeups_localnr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsput_devmap_managed_folio_refsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__filler__list_addsaved_sigmaskd_timeentriescpu_idfop_flags_t__MAX_NR_ZONESFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secevent_flagssched_delayedbd_statsbi_sizemodule_statemq_kobjlast_used_at__mutex_inithardirq_stack_ptrZ_EROFS_COMPRESSION_ZSTDvm_endlast_queuednuma_migrate_retryuser_ns__statefirstiommu_groupdma_alignmentmigrate_to_ramPG_reservedwait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexz_erofs_gbuf_exiti_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_arearlockpcpu_hotfl_owner_t_resia_rangeeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvp_indexbvec_iterPG_savepinnedctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimefolio_put_testzerosymlinkoom_flag_origincounterorc_unwindavailable_compr_algsWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSratelimitfree_foliodebugfs_dirqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsblkcg_gqia_filesival_intrun_nonuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatei_linklistxattr_lowertrap_nrasync_probe_requested__list_add_valid_or_reportcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagsz_erofs_put_gbuftotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_terofs_sb_infos_opsysv_shminstrument_atomic_readdq_countutf8data_tableset_latency_tolerancePG_waitersfoliowake_entryxa_headsuidi_readcountblk_integritylocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_t__compiletime_assert_620class_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesz_erofs_get_gbufautosleep_enabledptrace_entryblkg_listrecent_used_cpunum_jump_entriesmount_opts_qcopatomic_tbv_pagealloc_tag_counters_flagsrqos_debugfs_dirnotify_nextmax_perf_statePG_mlockedbus_dma_limitshort intmynodepart_tblzone_wplugs_hashZ_EROFS_COMPRESSION_MAXblk_mq_opsclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalz_erofs_gbuf_countpagepoolem_pdtrace_event_callsyncis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOwait_queue_entry_televatorcurrent_may_mountseqlock_tbd_queuenuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskcpumask_weightregfuncindex_keymemalloc_noioGRPQUOTArwsemi_ctime_nsecia_validvertical_positioni_rcumax_distance_pagesi_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidumount_mutexattribute_groupcontextposix_timersselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nskcsan_check_accesssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BITgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizelist_move_tailmce_kill_mes_readonly_remountuuid_t___GFP_UNUSED_BITatomic_write_hw_unit_mincount_objects_stimezone_device_datanr_active_requests_shared_tagsi_flctxbase_indexdefparamfred_csq_lockdep_mapfault_flagkprojid_tptracer_credtlb_genstoreio_lock_cls_keypage_mkwritekobjectaudit_ttyvariable_test_bitmce_ripvstatfstag_setnumab_stateremovablefeatureson_listkgid_ton_cpumanaged_pslotsFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedsysfs_registereddebugfs_mutexwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavebi_privatesp_regcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_listget_reserved_spacenon_seqstack_refcountinvalidate_lockbmapkey_payloadtimer_rand_stated_realexpiry_activedqi_max_spc_limitexception_table_entryvirt_boundary_maskevent_countpreempt_counts_kobjarch_atomic_dec_and_testfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderdevmap_managed_keytimemutex_trylockwakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvector__bi_cnttimer_listd_ino_warnsnuma_mem_idhiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimit__list_del_entry_validconstant_test_bittryrsvqf_nextPG_arch_1erofs_exit_shrinkerrangesiommu_mmblk_features_tcutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signopacked_inodeenabledfixupsfile_operationsKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writersPG_foreignsetleasepinspacct_structmust_resumelong intfile_lock_contextusagel_yessiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimesync_iofred_ss__kmalloc_indexvolumenr_iosprintk_index_sizesymtabfree_diskrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegiddq_hashput_superpushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donehweight_longmark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEshrinker_allocf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idislotbitsdepthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_colderofs_fscachePG_readaheadcheck_eventsssize_tiopl_emulmax_write_zeroes_sectorswork_structdesc_lensb_sizeflocktask_io_accountingmremaps_writerstracepoint_funcargventryfree_cached_objectsworkqueue_structPG_has_hwpoisonedpr_opspi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlen__UNIQUE_ID_x_618suspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEsrcu_reader_flavorirq_safetv_nsecsrcpi_lruqueue_depthgfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infosrcu_structrlim_curnofaultmm_countdrv_groupsstacknuma_node_idshrinker_run_nofunctionki_flagsbvec_poolbd_start_sect___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashmax_sectorssgidz_erofs_shrink_scaninitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqdma_pad_maskki_filpcap_ambientdma_configurePG_partially_mappedruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_events__vpp_verifyiommubi_opfprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipeblk_mq_tag_setspinlock_checkblk_independent_access_rangess_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTnbitsKMALLOC_RANDOM_ENDmodstqheads_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truekmalloc_array_noprofhres_activebpf_raw_eventsdq_dirtydl_deferbug_listdirect_completeidr_rtxa_locklist_addfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsembd_nr_sectorsignore_children_pflagsrestore_earlyclock_mutexfs_supersrequiredpagesdqb_bsoftlimitpendingmax_dev_sectorsf_task_work___GFP_NORETRY_BITiowait_countshrinker_freepage_ref_countset_read_onlythrotl_datas_kobj_unregisterdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesearly_initmprotectsecurityxmm_spaceactivatenr_cpu_idsf_pos_lockerofs_sb_lz4_infoi_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITdomain_dataidr_nextrelax_count___GFP_THISNODE_BITlinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sepkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterszone_wplugs_lockd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizeattributescached_rqsset_child_tidblk_unique_id_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_statemin_nrtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolbd_mappingsym_vvar_pagemodule_sect_attrspartial_decodingreturn_instancesoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intgendiskxattr_filter_reservedspc_timelimits_instancesdescseqcountoom_score_adjd_seqbi_crypt_contextia_vfsgidsize_tacpi_device_idprepare_to_wait_eventcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listoutpages__kunmap_localpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucountcpuhp_deads_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicrestoredelayed_callbi_itermax_nr_cid_statusmark_deadd_sibdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedlimits_lockdl_dev_stategsindexexpires_nexti_io_listf_epout_sizesrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrFAULT_FLAG_WRITEstate_in_sysfsz_erofs_stream_switch_bufsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollresvnr_wakeups_idleio_cqelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAsyscore__s64xz_buf__UNIQUE_ID_y_619__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredsum_block_runtimepgmapmin_perf_state__UNIQUE_ID_y_624dq_oprcu_tasks_nvcswwritevolume_nametypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionalmeta_blkaddrdma_pools_addr_lsbfeature_incompati_generation_sigpollmxcsrdevtd_rt_spc_hardlimitmagicbuild_timebi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_headlowmem_page_addressdev_pm_qosbi_sectormap_typef_oppids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entry___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestedz_erofs_decompressornr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockbi_write_hinthash_lenget_policyHRTIMER_RESTART__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedquotdl_runtimenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdxattr_prefix_countfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueptrace_messagenum_trace_events_sys_privatealignment_offsetopen_mutexinit_fs_contexts_subtypeheaderfuncperf_event_contextxz_dec_microlzma_runtlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksoutputsizestart_stackwatcherskmalloc_cachescompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsdiskbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodedqi_bgracecurr_nrsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structbin_attrs_newbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2bd_size_lockbackvmemmap_base__param_str_lzma_streamsstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setkzalloc_noprofrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalz_erofs_lzma_avail_strmsioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlineruntime_resumedup_xol_workqueue___GFP_WRITE_BITMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimez_erofs_lzma_cfgsi_mmapphys_addrd_lrusignal_structperf_event_mutexhprobecrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadparam_ops_uintsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalseremovedsb_extslotsshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitinpagesac_flagcoredump_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatoruint8_tpanelclass_idinactive_timer_pkeyfilenames_export_opfront_padstashedvm_page_prottimespec64PIDTYPE_SIDinputsizebpf_ctxd_pruneprintedunused_hctx_lockresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_name__SCT__might_reschedmmu_notifier_subscriptionswait_lockbd_openersoffsdecompresslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmid__compiletime_assert_617rseq_siginbuf_szdev_pm_domainlimit0limit1nr_zonesmigrate_modebio_pool__compiletime_assert_621__compiletime_assert_622__compiletime_assert_625poweroff_late__compiletime_assert_627ftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrstack_vmusage_count_folio_nr_pagesioctlshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opspoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITs_vfs_rename_mutexsuspend_latewakeupcg_listpageofs_insrcu_barrier_completionz_erofs_lzma_initdriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidbi_flags_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistlz4_max_distancedebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedreport_zonesbi_idxquota_readst_shndxfreei_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tpathst_sizermtpwait_sumnum_tracepointsupidexit_codemempool_tbitmap_weightexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entryfeature_compatstart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollbouncedpagesizedisk_names_blocksizevm_pgoffz_erofs_decompress_reqauprobe__retnuma_workupdate_timeptrace_dr7_call_addrrescue_lockmax_segmentsloginuidcheckexpiryoptimistic_spin_queuespin_unlockdl_defer_runningbi_bvec_doneroot_blkgin_pos__lstateueventlock_countrefcount_tplugchild_countsaved_auxvinosmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincountrq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockbd_holderend_codeXZ_PREALLOCqspinlock__kmalloc_large_noproflru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqkoutlong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsseq_showswait_queue_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinki_private_listhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgnoderesetvm_lockno_cgroup_migrationbuild_time_nsecnextevts_writers_key__countxcomp_bvcma_areakmap_local_pagestatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentfirst_minoria_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symbolsubsys_databi_statustv_secma_lockpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsma_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_task__compiletime_assert_626actoruprobenotifier_subscriptionss_readonly_remounthlist_bl_nodest_otherXZ_OPTIONS_ERRORi_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offxattr_prefix_startdq_inusecachedqi_flagskfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listsched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listbi_blkgnr_hw_queuesktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uid__wake_uptablesbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permz_erofs_lzmamem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classes__arch_hweight64orc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbd_holder_dirkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headreserved2byteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicypm_message_tioveci_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentpayloadac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxatomic_openbio_end_io_tstart_prevent_timecondreadahead_controlblk_trace__param_lzma_streams__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_devread_newsignalfd_wqhmmapmodnameasync_put_workmknodxz_retfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemaproot_nidwritepagessched_statisticsheadminors__state_permuprobe_taskwriteback_controluclampsuper_operationsbi_cookiesplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockxz_dec_microlzmaD_REAL_DATAbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETchecksumctx_idd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriocap_inheritablegp_waitlookupcostdev_pm_infopacked_nidblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsXZ_DATA_ERRORvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typediskseqi_pagesZ_EROFS_COMPRESSION_DEFLATEatomic_write_hw_boundaryhlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dir__wq_entryfpu_state_permi_fsnotify_maskbio_vecmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nr__this_modulebio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_free_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetis_suspendedtimeout_workburstetypeei_funcsz_erofs_lzma_nstrmsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatecap_bsetmutex_lockopen_modearchdata_sourcepower_stateXZ_SINGLEnr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkcmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_typepolicysharedwait_queue_entrydismissd_real_typelookahead_bandseq_startrq_qos_mutexzone_wplugs_wqraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tbounceshow_devnamelogical_block_sizerun_delaytailsblk_flags_tlinenobi_io_vecbase_pfnget_inode_acl_addr_pkeymigrate_folioXZ_MEM_ERRORcustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseblk_status_tavail_outclock_listattrscpumask_tswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitymight_reschedtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldpi_offsetdiscard_granularityfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetz_erofs_stream_dctxtime64_tnuma_faults_localityhas_child_subreaperi_aclXZ_DYNALLOC___GFP_ZERO_BITwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statesoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagsswp_entry_tbi_inline_vecs_mapcountdomain_taghang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtpi_bytesdma_cleanupmaple_treeKMALLOC_DMAdentrylast_mergecpu_itimerpercpuget_unique_idz_erofs_lzma_decomprel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesrangefutex_exit_mutexpm_onlykernfs_iattrstrc_blkd_noded_spacegraveyard_linkblkszbitsxol_vaddrinplace_iosplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsXZ_UNSUPPORTED_CHECKnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevblk_integrity_checksumself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsreq_listxa_flagsfreeze_raw_spin_lockbin_sizeclosegrphi___GFP_RETRY_MAYFAIL_BITnr_sectorsd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqbuidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkpercpu_refstrmhorizontal_positionout_pospref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxresult_maskstate_syncedpp_magicagaindquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_filei_blockss_stateuser_sizedev_pm_opscdrom_device_infoscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkkmalloc_typeqstrma_flagsXZ_FORMAT_ERRORmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attempts__le16alt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_count__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headf_wb_errrcharfutex_pi_statekstat__kernel_uid32_t__le32q_lock_cls_keyDEVICE_FIXEDZ_EROFS_COMPRESSION_LZMApte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lock__intepoll_watchesprealloc_pte__cpu_possible_maskdqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidinbuf_posst_spaceXZ_MEMLIMIT_ERRORmm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned int__le64i_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysorig_ptedqb_curinodesload__s8spin_lockinvalidate_lock_keydma_maskprealloc_mutexnanosleepsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tvolnameio_mindl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtime__u8is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onedevice_physical_location_horizontal_positionseq_stopkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodutil_summigration_disablediter_typeclass_device_is_conditionalz_erofs_load_lzma_configshrinker_idbio_setrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typeXZ_STREAM_ENDmutexpgd_tnr_cpus_alloweddiscard_alignmentraw_spinlock_tkey_taggetgeofs_flagsworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstksrcu_ssppage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequenceZ_EROFS_COMPRESSION_LZ4pool_datadisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeBLK_INTEGRITY_CSUM_CRC64f_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsXZ_BUF_ERRORclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityz_erofs_lzma_max_dictsizevm_startunused_hctx_lists_flagsfaultalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkintegritydq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingpage_offset_baseRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotmax_hw_sectorsfolioqlzmaprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_idrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_padtailia_atimelasttlb_ubcbi_issuequota_format_typeseekstask_struct__bitmap_weightrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memarch_spinlock_tsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometrysuppress_bind_attrsRPM_RESUMINGd_weak_revalidate_raw_spin_unlockgsbases_quota_typesf_llistmq_freeze_locki_nlinkbranchwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedz_erofs_lzma_headfreeze_supers_inode_list_lockelevator_queueruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentriesrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalfinish_waitbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_dataz_erofs_lzma_wqmmap_locksysfs_lockrq_qosfsavekeyring_index_keyxattr_blkaddrqrwlockfile_ra_stateuser_structdevt_slotoffon_rqfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structcred_guard_mutexmajorsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offseti_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stack__compiletime_assert_451dockdev_links_infoloff_tthread_pidsrcu_gp_seqextra_devicesia_ranges_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1matchmemory_typerb_rootnr_wakeups_localnr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secinit_wait_entryevent_flagssched_delayedbd_statsbi_sizemodule_statemq_kobjlast_used_atZ_EROFS_COMPRESSION_ZSTDvm_endlast_queuednuma_migrate_retryuser_ns__statefirstiommu_groupdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_arearlockfl_owner_t_resia_rangeeuidwaitbug_tabledirtied_time_whensequential_io_avgin_sizenr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvp_indexbvec_iterctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkoom_flag_origincounterorc_unwindavailable_compr_algsWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSratelimitfree_foliodebugfs_dirqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsxz_dec_microlzma_resetblkcg_gqpageofs_outia_filesival_intnuma_preferred_nid_hugetlb_cgroupz_erofs_fixup_insizedentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolfillgapssleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatei_link__outlistxattr_lowertrap_nrasync_probe_requestedcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opsysv_shmdq_countutf8data_tableset_latency_tolerancefoliowake_entryxa_headsuidi_readcountblk_integritylocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_t__compiletime_assert_620class_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryblkg_listrecent_used_cpunum_jump_entriess_qcopatomic_tbv_pagealloc_tag_counters_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitshort intmynodepart_tblzone_wplugs_hashZ_EROFS_COMPRESSION_MAXblk_mq_opsclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOwait_queue_entry_televatorcurrent_may_mountseqlock_tbd_queuenuma_scan_offsetz_erofs_lzma_decompress___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskcpumask_weightregfuncindex_keymemalloc_noioGRPQUOTAi_ctime_nsecia_validvertical_positioni_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listpgplxarray_startfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BITgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizemce_kill_mephysical_block_sizeuuid_tdirblkbits___GFP_UNUSED_BITatomic_write_hw_unit_mincount_objects_stimezone_device_datanr_active_requests_shared_tagsi_flctxdefparamfred_csq_lockdep_mapfault_flagkprojid_tptracer_credtlb_genstoreio_lock_cls_keypage_mkwritekobjectaudit_ttyXZ_OKmce_ripvstatfstag_setnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodez_erofs_lzma_exiti_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedsysfs_registereddebugfs_mutexwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavebi_privatesp_regcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_listget_reserved_spacenon_seqstack_refcountinvalidate_lockbmapkey_payloadtimer_rand_stated_realexpiry_activedqi_max_spc_limitexception_table_entry_erofs_printkvirt_boundary_maskevent_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowedtlb_flush_batched_ddebug_infoz_erofs_lzma_lockis_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_syncxz_dec_microlzma_allockallsymsprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvector__bi_cnttimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitlzma_resize_mutexqf_nextrangesiommu_mmblk_features_tcutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tag_killktime_tsymsgroup_nodexz_erri_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasepinspacct_structmust_resumelong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ss__kmalloc_indexnr_iosprintk_index_sizesymtabfree_diskrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegiddq_hashput_superpushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donehweight_longmark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldcheck_eventsssize_tiopl_emulmax_write_zeroes_sectorswork_structdesc_lenxz_dec_microlzma_endflocktask_io_accountingmremaps_writerstracepoint_funcargventryfree_cached_objectsworkqueue_structpr_opspi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlen__UNIQUE_ID_x_618suspend_noirqscheduleclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEsrcu_reader_flavorirq_safetv_nsecsrcpi_lruqueue_depth__UNIQUE_ID_x_623gfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infosrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flagsbvec_poolbd_start_sect___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashmax_sectorssgidinitial_nsFREEZE_MAY_NESTdict_sizebucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqdma_pad_maskki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_eventsiommubi_opfprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipe__UNIQUE_ID_lzma_streamstype616blk_mq_tag_seterofs_super_blockblk_independent_access_rangess_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqnr_ia_rangesDEVICE_PANEL_RIGHTnbitsKMALLOC_RANDOM_ENDmodstqheads_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truehres_activeconfigbpf_raw_eventsdq_dirtydl_deferbug_listdirect_completeblk_mq_tagsxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsembd_nr_sectorsxz_modeignore_children_pflagsrestore_earlyclock_mutexfs_supersdctxdqb_bsoftlimitpendingmax_dev_sectorsf_task_work___GFP_NORETRY_BITiowait_countset_read_onlythrotl_datadma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesearly_initmprotectsecurityxmm_spaceactivatenr_cpu_idsf_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITdomain_datarelax_count___GFP_THISNODE_BITlinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sepkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterszone_wplugs_lockd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizeattributescached_rqsvfreeset_child_tidblk_unique_id_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_statemin_nrtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolbd_mappingsym_vvar_pagemodule_sect_attrspartial_decodingreturn_instancesoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intgendiskxattr_filter_reservedz_erofs_load_deflate_configspc_timelimits_instancesdescseqcountoom_score_adjd_seqbi_crypt_contextia_vfsgidsize_tacpi_device_idprepare_to_wait_eventcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listoutpages__kunmap_localpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucountcpuhp_deads_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicrestoredelayed_callbi_itermax_nr_cid_statusmark_deadd_sibdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedlimits_lockdl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrFAULT_FLAG_WRITEstate_in_sysfsz_erofs_stream_switch_bufsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollresvnr_wakeups_idleio_cqelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAsyscore__s64dqi_bgrace__UNIQUE_ID_y_618__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredsum_block_runtimepgmapmin_perf_state__UNIQUE_ID_y_623dq_oprcu_tasks_nvcswwritevolume_nametypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionalmeta_blkaddrdma_pools_addr_lsbfeature_incompati_generation_sigpollmxcsrdevtd_rt_spc_hardlimitmagicbuild_timebi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_headlowmem_page_addressdev_pm_qosbi_sectormap_typef_oppids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dir__UNIQUE_ID_deflate_streamstype616back_padbug_entry___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestedz_erofs_decompressornr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockbi_write_hinthash_lenget_policyHRTIMER_RESTART__bi_nr_segmentstotal_insym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedquotdl_runtimenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdxattr_prefix_countfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueptrace_messagenum_trace_events_sys_privatealignment_offsetopen_mutexinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksoutputsizestart_stackwatcherskmalloc_cachescompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsdiskbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodecurr_nrsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structbin_attrs_newbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2bd_size_lockbackvmemmap_basestate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setkzalloc_noprofrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsz_streamponlineruntime_resumedup_xol_workqueue___GFP_WRITE_BITMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexhprobecrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_complete__param_deflate_streamsvtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadparam_ops_uintsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalseremovedsb_extslotsshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitinpagesac_flagcoredump_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatorpanelclass_idinactive_timer_pkeyfilenames_export_opfront_padstashedvm_page_prottimespec64PIDTYPE_SIDinputsizebpf_ctxd_pruneprintedunused_hctx_lockresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_name__SCT__might_reschedmmu_notifier_subscriptionswait_lockbd_openersoffsdecompresslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmid__compiletime_assert_619rseq_siginbuf_szdev_pm_domainlimit0limit1nr_zonesmigrate_modebio_pool__compiletime_assert_621__compiletime_assert_624__compiletime_assert_625poweroff_lateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timedata_typerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrstack_vmusage_count_folio_nr_pagesioctlshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opspoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITs_vfs_rename_mutexsuspend_latewakeup__param_str_deflate_streamscg_listpageofs_insrcu_barrier_completiondriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidbi_flags_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistlz4_max_distancedebugfs_entryelemnr_retriesz_erofs_deflate_cfgssigval_talimitundo_listKMALLOC_RANDOM_STARTmissedreport_zonesbi_idxquota_readst_shndxfreei_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolBytesuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tpathst_sizermtpwait_sumnum_tracepointsupidexit_codemempool_tbitmap_weightexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entryfeature_compatstart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollbouncedpagesizez_erofs_deflate_wqdisk_names_blocksizevm_pgoffz_erofs_decompress_reqauprobe__retnuma_workupdate_timeptrace_dr7_call_addrrescue_lockmax_segmentsloginuidcheckexpiryoptimistic_spin_queuespin_unlockdl_defer_runningbi_bvec_doneroot_blkg__lstateueventlock_countrefcount_tplugchild_countsaved_auxvinosmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincountrq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockbd_holderend_codeqspinlock__kmalloc_large_noproflru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqkoutlong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsseq_showswait_queue_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinki_private_listhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgnoderesetvm_lockno_cgroup_migrationbuild_time_nsecnextevts_writers_key__countxcomp_bvcma_areakmap_local_pagestatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatfailed_zinitexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentfirst_minoria_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symbolsubsys_databi_statustv_secma_lockpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsma_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_task__compiletime_assert_626actoruprobenotifier_subscriptionss_readonly_remounthlist_bl_nodest_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offxattr_prefix_startdq_inusecachedqi_flagskfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listsched_rt_mutexdummylocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listbi_blkgnr_hw_queuesktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uid__wake_uptablesbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classes__arch_hweight64orc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbd_holder_dirkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headreserved2byteswait_startzlib_inflate_workspacesizef_freeptrclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqallocpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicypm_message_tioveci_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrun___GFP_NOFAIL_BITd_parentpayloadac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxatomic_openbio_end_io_tstart_prevent_timecondreadahead_controlblk_trace__kernel_gid32_twindowbitskernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_devread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemaproot_nidwritepagessched_statisticsheadminors__state_permuprobe_taskwriteback_controluclampsuper_operationsbi_cookiesplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETchecksumctx_idd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriocap_inheritablegp_waitlookupcostdev_pm_infopacked_nidblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typediskseqi_pagesZ_EROFS_COMPRESSION_DEFLATEatomic_write_hw_boundaryhlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dir__wq_entryfpu_state_permi_fsnotify_maskbio_vecmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nr__this_modulebio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_free_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetis_suspendedtimeout_workburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatecap_bsetmutex_lockopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areadeflate_resize_mutexsaved_statekernfs_elem_attrbasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkcmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_typepolicysharedwait_queue_entrydismissd_real_typelookahead_bandseq_startrq_qos_mutexzone_wplugs_wqraw_lockd_dnameget_dqblkadlermax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tbounceshow_devnamelogical_block_sizerun_delaytailsblk_flags_tlinenobi_io_vecbase_pfnget_inode_acl_addr_pkeymigrate_foliocustom_slicez_erofs_deflate_nstrmsthread_keyringkparam_arrayutimestart_codeis_hardfsbaseblk_status_tavail_outclock_listattrscpumask_tswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitymight_reschedtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldpi_offsetdiscard_granularityfopsreservedlatency_record_countcgroupsprev_scan_seqavail_inprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetz_erofs_stream_dctxtime64_tnuma_faults_localityhas_child_subreaperi_aclz_erofs_deflate_avail_strms___GFP_ZERO_BITwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statesoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagsswp_entry_tbi_inline_vecs_mapcountdomain_taghang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtpi_bytesdma_cleanupmaple_treeKMALLOC_DMAdentrylast_mergecpu_itimerpercpuget_unique_idrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instanceszlib_inflaterangefutex_exit_mutexpm_onlykernfs_iattrstrc_blkd_noded_spacegraveyard_linkblkszbitsxol_vaddrinplace_iosplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevblk_integrity_checksumself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEtotal_outnr_migrationsa_opsreq_listxa_flagsfreeze_raw_spin_lockbin_sizeclosegrphi___GFP_RETRY_MAYFAIL_BITnr_sectorsd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqbuidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkpercpu_refstrmhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAz_erofs_deflate_decompget_nextdqblks_fs_infocrypto_profilefutexwait_maxresult_maskstate_syncedpp_magicagaindquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablez_erofs_deflate_decompressrb_rightvm_filei_blockss_stateuser_sizedev_pm_opscdrom_device_infoscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkkmalloc_typeqstrma_flagsnr_ia_rangesmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attempts__le16alt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_count__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headf_wb_errrcharfutex_pi_statekstat__kernel_uid32_t__le32q_lock_cls_keyzlib_inflateEndDEVICE_FIXEDZ_EROFS_COMPRESSION_LZMApte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lock__intepoll_watchesprealloc_pte__cpu_possible_maskdqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidinbuf_posst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned int__le64i_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysorig_ptedqb_curinodesload__s8spin_lockinvalidate_lock_keydma_maskprealloc_mutexnanosleepsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tvolnameio_mindl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtime__u8is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onedevice_physical_location_horizontal_positionseq_stopkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodutil_summigration_disablediter_typeclass_device_is_conditionalshrinker_idbio_setrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_alloweddiscard_alignmentraw_spinlock_tkey_taggetgeofs_flagsz_stream_sworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstksrcu_ssppage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequenceZ_EROFS_COMPRESSION_LZ4pool_datadisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatez_erofs_deflate_initmkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesnext_inuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeBLK_INTEGRITY_CSUM_CRC64f_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startunused_hctx_lists_flagsfaultalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkintegritydq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingpage_offset_baseRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotmax_hw_sectorsfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_idrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcbi_issuequota_format_typeseekstask_struct__bitmap_weightrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memarch_spinlock_tsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometrysuppress_bind_attrsRPM_RESUMINGd_weak_revalidate_raw_spin_unlockgsbases_quota_typesf_llistmq_freeze_locki_nlinkbranchwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedfreeze_supers_inode_list_lockelevator_queueruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentriesrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalfinish_waitbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosfsavekeyring_index_keyxattr_blkaddrqrwlockfile_ra_stateuser_structdevt_slotoffon_rqfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structcred_guard_mutexmajorsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributeclass_raw_spinlock_is_conditionaldev_archdatauLongi_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offseti_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stack__compiletime_assert_451dockdev_links_infoloff_tthread_pidsrcu_gp_seqextra_devicesia_ranges_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1matchmemory_typerb_rootnr_wakeups_localnr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secinit_wait_entryevent_flagssched_delayedbd_statsbi_sizemodule_statemq_kobjlast_used_atZ_EROFS_COMPRESSION_ZSTDvm_endlast_queuednuma_migrate_retryuser_ns__statefirstiommu_groupdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexzlib_inflateInit2i_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_arearlockfl_owner_t_resia_rangeeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvp_indexbvec_iterctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenz_erofs_deflatedqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkoom_flag_origincounterorc_unwindavailable_compr_algsWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSratelimitfree_foliodebugfs_dirqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERz_erofs_deflate_headFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsblkcg_gqpageofs_outia_filesival_intnuma_preferred_nid_hugetlb_cgroupz_erofs_fixup_insizedentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolfillgapssleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatei_link__outlistxattr_lowertrap_nrasync_probe_requestedcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opsysv_shmdq_countutf8data_tableset_latency_tolerancefoliowake_entryxa_headsuidi_readcountblk_integritylocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_t__compiletime_assert_620class_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryblkg_listrecent_used_cpunum_jump_entriess_qcopatomic_tbv_pagealloc_tag_counters_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitshort intmynodepart_tblzone_wplugs_hashZ_EROFS_COMPRESSION_MAXblk_mq_ops__UNIQUE_ID_x_622class_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofnext_outDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOwait_queue_entry_televatorcurrent_may_mountseqlock_tbd_queuenuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskcpumask_weightregfuncindex_keymemalloc_noioGRPQUOTAi_ctime_nsecia_validvertical_positioni_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listpgplxarray_startfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_tz_streamgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizemce_kill_mevmalloc_noprofphysical_block_sizeuuid_tdirblkbits___GFP_UNUSED_BITatomic_write_hw_unit_mincount_objects_stimezone_device_datanr_active_requests_shared_tagsi_flctxdefparamfred_csq_lockdep_mapfault_flagkprojid_tptracer_credtlb_genstoreio_lock_cls_keyworkspacekobjectaudit_ttymce_ripvstatfstag_setnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedsysfs_registereddebugfs_mutexwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavebi_privatesp_regcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_listget_reserved_spacenon_seqstack_refcountinvalidate_lockbmapkey_payloadtimer_rand_stated_realexpiry_activepage_mkwritedqi_max_spc_limitexception_table_entry_erofs_printkvirt_boundary_maskevent_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvector__bi_cnttimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextrangesiommu_mmblk_features_tcutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateinternal_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasepinspacct_structmust_resumelong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ss__kmalloc_indexnr_iosprintk_index_sizesymtabfree_diskrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegiddq_hashput_superpushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donehweight_longmark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldcheck_eventsssize_tz_erofs_deflate_exitiopl_emulmax_write_zeroes_sectorswork_structdesc_lenflocktask_io_accountingmremaps_writerstracepoint_funcargventryfree_cached_objectsworkqueue_structpr_opspi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlen__UNIQUE_ID_x_617suspend_noirqscheduleclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEsrcu_reader_flavorirq_safetv_nsecsrcpi_lruqueue_depthgfp_maskpi_state_listrcu_segcblistsubvolzerrfree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infosrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flagsbvec_poolbd_start_sect___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashmax_sectorssgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqdma_pad_maskki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_eventsz_erofs_deflate_lockiommubi_opfprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipeblk_mq_tag_seterofs_super_blockblk_independent_access_rangess_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTnbitsKMALLOC_RANDOM_ENDmodstqheads_activeMEMORY_DEVICE_FS_DAXinitedclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truehres_activeconfigbpf_raw_eventsdq_dirtydl_deferbug_listdirect_completeblk_mq_tagsxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsembd_nr_sectorsignore_children_pflagsrestore_earlyclock_mutexfs_supersdctxdqb_bsoftlimitpendingmax_dev_sectorsf_task_work___GFP_NORETRY_BITiowait_countset_read_onlythrotl_datadma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesearly_initmprotectsecurityxmm_spaceactivatenr_cpu_idsf_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITdomain_datarelax_count___GFP_THISNODE_BITlinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrBIO_CLONEDcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterszone_wplugs_lockd_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizeattributescached_rqsset_child_tidblk_unique_id_overrunerofs_fileio_rqrestrict_linktmpfilercu_read_lock_nestingem_perf_statemin_nrtick_dep_masklistthrottle_disksi_errnoREQ_OP_WRITE_ZEROESpageflagss_inode_lrusrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionalREQ_OP_LASTdomain_idneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countz_idata_sizeqsize_tfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixoliocbvfs_inodebd_mappingsym_vvar_pagemodule_sect_attrsin_range64return_instancearch_test_bitsoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayerofs_fileio_ki_completeunsigned intgendisk__compiletime_assert_116spc_timelimits_instancesdescseqcountoom_score_adjoldbitd_seqbi_crypt_contextia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_list__kunmap_localpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucountbio_add_foliocpuhp_deads_remove_countsyscall_work__UNIQUE_ID_x_584io_retrydevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicrestoredelayed_callbi_itermax_nr_cid_statusmark_deadd_sibdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedlimits_lockdl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimerreadahead_indextrace_recursionbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdax_devicercu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspoll__SCT__tp_func_erofs_read_folioxattr_name_filterresvnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symfolio_zero_segmentlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAsyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_poolsIOPRIO_CLASS_INVALID_addr_lsbi_generation_sigpollmxcsrdevtd_rt_spc_hardlimitbi_end_ioblk_holder_opsREQ_OP_FLUSHnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_head__bad_copy_fromlowmem_page_addressdev_pm_qosbi_sectormap_typeclass_preempt_notrace_destructorf_oppids_active_resetrandomconfirm_switcherofs_onlinefolio_endseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbarch_static_branchsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entryiov_iter_bvec___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtime__UNIQUE_ID_y_679nested__UNIQUE_ID___addressable___SCK__tp_func_erofs_read_folio645nr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootPG_arch_2next_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockbi_write_hinthash_lenget_policyHRTIMER_RESTART__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedquotdl_runtime__ret_do_oncenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupPG_checkedrescue_workqueueptrace_messagenum_trace_events_sys_privatealignment_offsetopen_mutexattachedinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_autherofs_fileio_submit_biofolio_test_largevirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherskmalloc_cachescompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolPG_hwpoisonUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsdiskbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodecurr_nrerofs_off_tsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structcnivcswbin_attrs_newerofs_bufbio_alloc_cachebi_bdev_seg_countiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrendirty_foliois_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGPG_vmemmap_self_hostednrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2bd_size_lockbackvmemmap_basestate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setkzalloc_noprofrcuwaitPG_pinnedbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrslaunder_folioonlinem_fscacheruntime_resumedup_xol_workqueue___GFP_WRITE_BITMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimei_mmapPG_owner_2phys_addrd_lrusignal_structperf_event_mutexhprobecrcspgdval_tsetattr__bad_copy_tof_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modereadahead_folioki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_sembvecskobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entryfolio_sizelist_lru_nodesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__task_fpstatemask__ret_oncewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrIOPRIO_CLASS_IDLEPG_xen_remappedpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjPG_uptodatesrcu_cb_mutexstatic_call_sitefortify_funcput_page_testzeroMODULE_STATE_UNFORMEDshared_pendingexpires___GFP_HARDWALL_BITnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalseremovedshow_pathPIDTYPE_TGIDpriolevelcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitREQ_OP_READac_flagcoredump_data__tracepoint_erofs_readpagestasks_pidaddress_spacemm_context_t__call_single_nodestartupchunkbitsof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatorcompound_orderpanelclass_iderofs_kmap_typeinactive_timer_pkeyfilenames_export_opfront_pad__mptrbio_first_bvec_allstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqxendpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errshm_clistis_child_subreapercall_depthunicode_mapnum_descsPG_workingsetexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidrseq_sigdev_pm_domainlimit0limit1nr_zonesractlmigrate_modebio_poolpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasksstart1platform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscount__compiletime_assert_644GNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrerofs_fileio_scan_foliostack_vmusage_count_folio_nr_pagesioctlshow__compiletime_assert_652compound_nrunsigned charumount_beginvdso_test_bitmmap_legacy_basepipe_inode_infoPG_reportedsecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opspoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPerofs_fileio_read_folionum_kprobe_blacklist___GFP_DMA32_BITIOPRIO_HINT_NONE___GFP_DIRECT_RECLAIM_BITs_vfs_rename_mutexsuspend_latewakeup__check_object_sizecg_listsrcu_barrier_completiondriver_flagsPG_owner_priv_1elementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidbi_flags_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelem_compound_headnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTBIO_QOS_THROTTLEDmissedreport_zonesbi_idxquota_readPG_private_2st_shndxerofs_read_metabuffreei_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypebio_uninitmembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typeatomic_dec_and_testmtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tpathst_sizeREQ_OP_ZONE_RESET_ALLrmtpwait_sumnum_tracepointsupidexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkPG_fscacheperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsraw_atomic_dec_and_testiopollpagesizecopy_to_iterdisk_names_blocksizevm_pgoffauprobepto_val__numa_workupdate_timeptrace_dr7_call_addrrescue_lockmax_segmentsloginuidcheckexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkg__lstatearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrBIO_REFFEDnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_namemm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nexterofs_fileio_bio_allocreadlinkmigration_flagsfolio_putm_llen_pincountrq_timeoutDEVICE_PANEL_BOTTOMioprio_valueconv_zones_bitmaplist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockbd_holderend_codeqspinlock__kmalloc_large_noproflru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqlong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsseq_showswait_queue_headPG_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinki_private_listhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgnoderesetvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areakmap_local_pagestatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentPG_activefirst_minorIOPRIO_CLASS_BEia_sizein_hrtirqs_master_keysconst_test_bitwchar_addr_bndkernel_symbolsubsys_databi_statustv_secma_lockpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsma_rooturing_cmdnr_failed_migrations_affineIS_ERRuser_cpus_ptrpi_top_taskm_dax_part_offactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writehlist_bl_nodest_otherPG_anon_exclusivei_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITstart2modulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespaceget_currentvfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flagskfreestatic_call_trampbtrace_seq_pp_mapping_padsa_mask__folio_putrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlencodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listPG_swapcachesched_rt_mutexlocked_pendingpao_tmp__nr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listbi_blkgnr_hw_queuesktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidtablesbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTART__cpu_online_maskbd_disksp_offseterofs_fileio_aopssrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbd_holder_dirkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditional__ret_condshow_fdinfofixuprt_or_dl_task_policyhashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicypm_message_tioveci_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentPG_unevictablepayloadac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflinePG_reclaimatomic_write_segments_maxIOPRIO_CLASS_RTatomic_openbio_end_io_tstart_prevent_timecondreadahead_controlblk_trace__kernel_gid32_tit_func_ptrkernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_devpage_ref_dec_and_testread_newsignalfd_wqhmmappto_tmp__modnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapwritepagessched_statisticsheadminors__state_permuprobe_taskwriteback_controluclampbio_initsuper_operationsbi_cookiesplice_eofcheck_copy_sizeutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsto_userKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriocap_inheritablegp_waitlookupcostdev_pm_inforeq_opREQ_OP_ZONE_RESETblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsFORTIFY_FUNC_memscanvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typediskseqi_pagesatomic_write_hw_boundaryz_advisehlist_bl_headino_warnlimitfasynci_rt_spc_warnlimit__compiletime_assert_368__compiletime_assert_369page_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nrdatalayoutbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handlepage_fixed_fake_headElf64_Symd_automountqueue_limitsPG_writeback__bio_advancereadahead_count_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typecopy_overflowPG_idlecurr_targetis_suspendedtimeout_workburstetypeei_funcsmodule_kobjectactive_memcgdef_flagserofs_fileio_rq_submitbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatecap_bsetopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcounterskasan_check_readname_linkcmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_typepao_ID__policysharedxattr_shared_xattrswait_queue_entrydismissd_real_typelookahead_bandseq_startrq_qos_mutexraw_blkaddrzone_wplugs_wqraw_lockd_dnameget_dqblkerofs_put_metabufmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamelogical_block_sizerun_delaytails__SCT__tp_func_erofs_readpagesblk_flags_tlinenoz_algorithmtypebi_io_vecbase_pfnget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimez_fragmentoffstart_codeis_hardfsbaseblk_status_tclock_listattrscpumask_tswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpuerofs_map_blocksshrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldpi_offsetdiscard_granularityfopsreservedPG_privatelatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_tREQ_OP_ZONE_OPENnuma_faults_localityhas_child_subreaperi_aclmemset_copy_to_iter___GFP_ZERO_BITm_deviceidwrite_newlist_lockpm_domaininstrument_atomic_read_writecpu_bitmapstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statePG_dirtysoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagsswp_entry_tbi_inline_vecs_mapcountdomain_taghang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntm_bdevmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfolio_iterfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtpi_bytesdma_cleanupmaple_treeKMALLOC_DMAdentrylast_mergecpu_itimerfscache_cookiepercpuget_unique_idrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesrangeerofs_nid_tfutex_exit_mutexpm_onlybio_next_foliokernfs_iattrstrc_blkd_nodezero_fill_bio_iterBIO_ZONE_WRITE_PLUGGINGd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERBIO_QOS_MERGEDconst_pcpu_hoti_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevblk_integrity_checksumself_exec_idkernfs_opsfile_lockPG_swapbackedMODULE_STATE_LIVEnr_migrationsa_opsreq_listxa_flagsfreezebin_sizecloseREQ_OP_SECURE_ERASEgrphi___GFP_RETRY_MAYFAIL_BITerofs_domainnr_sectorsd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqbuidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXPG_lockednlinkpercpu_refBIO_QUIEThorizontal_positionPG_mappedtodiskpref_node_forkwait_queue__int128dqi_privchunkformatrss_stattrace_erofs_readpagesmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightBIO_BPS_THROTTLEDBIO_CHAINvm_file___GFP_COMP_BITi_blockss_stateuser_sizedev_pm_ops__tracepoint_erofs_read_foliocdrom_device_infoBIO_TRACE_COMPLETIONscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkkmalloc_typeqstrma_flagsREQ_OP_WRITEnr_ia_rangesmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_count__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headpart0f_wb_errrcharfutex_pi_statekstat__kernel_uid32_tq_lock_cls_keyDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockepoll_watchesprealloc_ptedqb_curspacefolio_ordergp_statebitsetload_avgaccesscstimecfs_rqbvec_set_page_uidst_spacemm_cid_next_scanns_typei_ino_timelimitac_majfltflush_dcache_pageposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimitm_fps_encodingBIO_FLAG_LASTgpl_crcsorc_entrykeystask_nice_iopriobio_flaggedorig_ptedqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutexnanosleep__already_done__NR_PAGEFLAGSsrcu_gp_seq_neededpscr_ret__dq_dqb_lock__kernel_ulong_tvolname__UNIQUE_ID_guard642io_minerofs_inodedl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtime__u8__UNIQUE_ID_guard650is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onedevice_physical_location_horizontal_positionseq_stopkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidREQ_OP_ZONE_APPENDs_blocksize_bitsnuma_scan_periodutil_summigration_disablediter_typeclass_device_is_conditionalshrinker_idbio_setrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKm_labpf_storageno_callbacks__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedEROFS_KMAPdiscard_alignmentraw_spinlock_tkey_taggetgeofs_flagsworkpgprotval_tkeytypefortify_memset_chksigpendingmq_freeze_depthfsindexshstksrcu_ssppage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONExattr_shared_countactive_timei_sequencepool_datadisk_statsdqb_ihardlimitd_lockrefREQ_OP_ZONE_CLOSErpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesm_pauclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typefolio_posBLK_INTEGRITY_CSUM_CRC64f_iocb_flagsPG_isolatedpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmoveerofs_fileio_readaheadsched_contributes_to_loadstatic_key_trueweighti_privatemaxrssPG_lruflushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vmtrace_erofs_read_folio_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startunused_hctx_lists_flagsfaulterofs_map_devmigration_pendingalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkintegritydq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusep_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingpage_offset_baseRPM_REQ_SUSPENDs_listPG_youngFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionREQ_OP_ZONE_FINISHserialclass_releasealloc_locks_dquotmax_hw_sectorsfolioqBIO_BOUNCEDprev_posseqcount_spinlockbio_first_folioexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchpriohintrcu_tasks_exit_listarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_idrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10bvec_set_foliopud_tfolio_test_headrt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcbi_issuequota_format_typeseekstask_structprioclassrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memis_sourcesubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometrysuppress_bind_attrsRPM_RESUMINGd_weak_revalidategsbases_quota_types__preempt_count_addf_llistmq_freeze_locki_nlinkbranchwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_t__readahead_folioshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevwlockedfreeze_superPTR_ERRs_inode_list_lockelevator_queuehugetlb_optimize_vmemmap_keyruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgPG_large_rmappablentabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirPG_referencednextentsreal_blockedarg_locknum_exentriesrequeue_workbio_splitfolio_test_uptodateint32_t__UNIQUE_ID_x_581offset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextmempool_alloc_tfolio_inodeprealloc_bufDL_DEV_DRIVER_BOUNDerofs_blk_tprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidfolio_nr_pagesmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpupage_freeilen__UNIQUE_ID___addressable___SCK__tp_func_erofs_readpages653mnt_flagsvm_structcred_guard_mutexmajorsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offsetkaddri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stack__compiletime_assert_451dockdev_links_infoloff_tthread_pidfscache_volumesrcu_gp_seqia_ranges_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedBIO_CGROUP_ACCTinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1matchmemory_typerb_rootnr_wakeups_localnr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_iderofs_fileiofop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secevent_flagssched_delayedbd_statsbi_sizemodule_state__write_overflow_fieldmq_kobjlast_used_athardirq_stack_ptrvm_endlast_queuednuma_migrate_retryuser_ns__stateconst_folio_flagsfirstiommu_groupdma_alignmentmigrate_to_ramPG_reservedwait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexcpumask_checki_private_dataElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupxol_arearlockpcpu_hotfl_owner_t_resia_rangeeuidwaitbug_tabledirtied_time_whencpu_onlinem_plensequential_io_avgnr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__SCK__tp_func_erofs_read_folio__state_sizecallerthread_structcached_requested_keyenvp_indexbvec_iterPG_savepinnedpage_sizectimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datacpu_max_bits_warnmm_usersbd_holder_locks_ids_dentry_lrubp_offsetblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimefolio_put_testzerosymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonecpumask_test_cpufscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSratelimitfree_foliodebugfs_dirIOPRIO_CLASS_NONEqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDtask_nice_ioclasssysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsblkcg_gqia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_private__get_task_ioprioi_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_tREQ_OP_DISCARDs_opsysv_shminstrument_atomic_readdq_countutf8data_tableset_latency_tolerancePG_waitersz_idataofffoliowake_entryxa_headsuidi_readcountblk_integritylocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryblkg_listrecent_used_cpunum_jump_entriess_qcopatomic_tbv_pagealloc_tag_counters_flagsrqos_debugfs_dirnotify_nextmax_perf_statePG_mlockedbus_dma_limitshort intmynodepart_tblzone_wplugs_hashblk_mq_opsclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalend1end2em_pdtrace_event_callzero_user_segmentssyncis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOwait_queue_entry_televatorcurrent_may_mountseqlock_tbd_queuenuma_scan_offsetnrpage___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmask__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTAi_ctime_nsecia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listvfs_iocb_iter_readxarray_start__flagsp_size_fieldfadvisem_algorithmformatvmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nskcsan_check_accesssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refnbytespmdval_t___GFP_NOFAIL_BIT__copy_overflowgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizemce_kill_mephysical_block_sizeuuid_t___GFP_UNUSED_BITatomic_write_hw_unit_minclass_preempt_notrace_constructorcount_objects_stimezone_device_datanr_active_requests_shared_tagsi_flctxdefparamfred_csq_lockdep_mapfault_flagkprojid_tptracer_credtlb_genstoreio_lock_cls_key__UNIQUE_ID_y_582__UNIQUE_ID_y_585page_mkwritekobjectaudit_ttyvariable_test_bitmce_ripvstatfsbio_advancetag_setnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistREQ_OP_DRV_OUTclass_groupsnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tBIO_PAGE_PINNEDioctx_tableVTIME_SYSchangedsysfs_registereddebugfs_mutexwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_static__compiletime_assert_109formaterofs_onlinefolio_initftopenclavebi_privatesp_regcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_list__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115get_reserved_space__compiletime_assert_117__compiletime_assert_118non_seqstack_refcountinvalidate_lockbmapkey_payloadtimer_rand_stated_real__dataexpiry_activedqi_max_spc_limiteval_stringexception_table_entry_erofs_printkvirt_boundary_maskevent_countpreempt_countarch_atomic_dec_and_testfolio_nextfallocatei_spc_warnlimitbuddy_listIOPRIO_HINT_DEV_DURATION_LIMIT_1IOPRIO_HINT_DEV_DURATION_LIMIT_2IOPRIO_HINT_DEV_DURATION_LIMIT_3IOPRIO_HINT_DEV_DURATION_LIMIT_4IOPRIO_HINT_DEV_DURATION_LIMIT_5IOPRIO_HINT_DEV_DURATION_LIMIT_6IOPRIO_HINT_DEV_DURATION_LIMIT_7check_object_sizei_mmap_writablemems_allowed__preempt_count_dec_and_testtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startzero_fill_bioblocksset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcat__bi_cnttimer_listEROFS_NO_KMAPd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimiterofs_fileio_rq_allocconstant_test_bitqf_nextPG_arch_1rangesiommu_mmblk_features_tcutimeem_tablepersonalityget_statetask_sizes_inodes_addrerofs_onlinefolio_splitbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387iterd_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writersPG_foreignsetleasepinspacct_structmust_resumelong intfile_lock_contextusagel_yessiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimesync_iofred_ss__SCK__tp_func_erofs_readpages__kmalloc_indexvolume__write_overflownr_iosprintk_index_sizesymtabfree_diskrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegiddq_hashput_superpushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donez_logical_clusterbitsmark_dirtynum_srcu_structsbdi_writebackBIO_EMULATES_ZONE_APPENDkobj_completion__kernel_clockid_tseccompxattr_isizeiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespec__UNIQUE_ID_rcu643inode_isizecancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_id__UNIQUE_ID_rcu651depthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldz_tailextent_headlcnerofs_fscachePG_readaheadcheck_eventsssize_tiopl_emulmax_write_zeroes_sectorswork_structdesc_lenflocktask_io_accountingmremaps_writers__fortify_panictracepoint_funcargventryfree_cached_objectsREQ_OP_DRV_INworkqueue_struct_nextBIO_REMAPPEDPG_has_hwpoisonedpr_opspi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEsrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyqueue_depthgfp_maskpi_state_listrcu_segcblistsubvolm_daxdevfree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infosrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flagsbvec_poolbd_start_sect___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashmax_sectorssgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqdma_pad_maskki_filpcap_ambientdma_configurePG_partially_mappedruntime_errormdevatomic64_tanon_vmaruntime_auto__compiletime_assert_513PROBE_DEFAULT_STRATEGYrlimread_folionr_events__vpp_verifyiommubi_opf__UNIQUE_ID_x_678privatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipeblk_mq_tag_setblk_independent_access_rangess_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDxa_loadmodstqheads_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_taskpage_offsettask_worksmemory_failurerb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsclass_preempt_notrace_tget_current_iopriodq_dirtydl_deferbug_listdirect_completeblk_mq_tagsxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsembd_nr_sectorsignore_children_pflagsrestore_earlyclock_mutexfs_supersdqb_bsoftlimitpendingmax_dev_sectorsf_task_work___GFP_NORETRY_BITiowait_count__compiletime_assert_583__compiletime_assert_586set_read_onlythrotl_datadma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestask_nicetrace_evalsactive_basesearly_initmprotectsecurityxmm_spacem_flagsactivatenr_cpu_idsf_pos_locki_fieldmasktls_arrayownerpfo_val__acct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITdomain_datarelax_count___GFP_THISNODE_BITbtf_fdlinelinkstart_timekernfs_nodercu_workRPM_REQ_IDLEsuppliersfs_value_typenr_group_reldev_tFREEZE_HOLDER_USERSPACEfront_padmap_local_storage_chargedup_xol_addrtstamp_type_accesscapture_controlBPF_PROG_TYPE_CGROUP_SKBnr_wakeupsBPF_PROG_TYPE_LIRC_MODE2startBPF_MAP_TYPE_SOCKHASHstart_brkstatic_key_modd_ino_softlimitxregs_state__BPF_REG_TYPE_LIMITWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocbtf_log_bufparameterszone_wplugs_lockcss_resetNETFS_DOWNLOAD_FROM_SERVERBPF_CGROUP_ITER_ANCESTORS_UPd_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalxa_lrunetlink_nsneed_qsarg_flagscompact_defer_shiftswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITrstat_flush_nextmap_pagesreschedule_countvfsmountcss_onlinecheck_write_beginextable_basenoinstr_text_sizeattributesNETFS_READ_FOR_WRITE__list_del_entrycached_rqsBPF_CGROUP_INET6_BINDset_child_tidblk_unique_id_overrunrestrict_linktmpfiledata_inrcu_read_lock_nestingem_perf_statemin_nrxattr_prefixestick_dep_masksreq_max_segslistthrottle_disksi_errnoBPF_MAP_TYPE_HASH_OF_MAPSbsynce_freezememcg_lrunetkitREQ_OP_WRITE_ZEROESpageflagss_inode_lrumemcg_nodeatomic_setsrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionaluid_gid_mapPTR_TO_TP_BUFFERREQ_OP_LASTunpinned_netfs_wbdomain_idneed_tsof_noderefsmmap_compat_baseline_colWB_SYNC_NONEtrace_eventsenv_startcgrp_ancestor_storagedma_addrcnivcswd_flags__compiletime_assert_11xattr_handlerfreeze_lated_inodehprobe_statebpf_iter_init_seq_priv_tUTASK_SSTEPreal_parentlockedcgroup_tasksetVTIME_GUESTbpf_tramp_imagertpoll_next_updateregsm_daxdevslice_maxFSCACHE_COOKIE_STATE_ACTIVElast_switch_countfolio_orderqsize_tblkio_delay_totaltime_ns_for_childrenfilesdqb_bhardlimitgraph_rootlivevm_faultxas_retryatomic_write_unit_maxpcrefs_staterun_listixoliocbbd_mappingsym_vvar_pagemodule_sect_attrsbuffer_tail_slotbegin_writebackmg_src_preload_nodereturn_instancearch_test_bitFSCACHE_COOKIE_STATE_DROPPEDdst_mutexsoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_iderofs_domain_register_cookie_workingsetautosuspend_delayBPF_CGROUP_INET_EGRESSunsigned intwq_offxa_padrtpoll_taskgendiskxattr_filter_reservedfd_arrayspc_timelimits_instancesstart_posBPF_TASK_ITER_TIDBPF_SK_REUSEPORT_SELECTdescseqcountlicensetokenoom_score_adjoldbitd_seqbi_crypt_contextinit_requestia_vfsgidBPF_CGROUP_INET6_CONNECTzone_typesize_tacpi_device_idmap_seq_show_elemcap_permittedTT_NATIVEzone_pgdatclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesu64_stats_syncinfo_lenrcu_tasks_idxsync_modercu_tasks_holdouttarget_listavg_write_bandwidthb_attachedpasid_activatedxa_loadpi_sezonerefget_offset_ctxcore_forceidle_sumfreeze_ucountBPF_MAP_TYPE_ARRAY_OF_MAPSfile_flagss_remove_countused_map_cntjited_lensyscall_workcompletionsdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteBPF_CGROUP_INET6_POST_BINDcallback_headmemory_failure_statss_vopperf_eventf_securityi_sb_listbtf_log_sizevm_rcupgtables_bytesget_linkfmode_tdevscputime_atomicfree_after_mult_rcu_gpbpf_tokennext_donatedrestoredelayed_callbi_iterBPF_PROG_TYPE_LWT_OUTmax_nr_cid_statusmark_deadd_sibdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedfs_typelimits_lockdl_dev_stategsindexexpires_nextrequest_pooli_io_listPTR_TO_SOCK_COMMON_OR_NULLf_ep__compiletime_assert_51srcu_barrier_seq__compiletime_assert_54BPF_KPTR_REFlinks_countreturn_consumerrelease_dqblkcache_namein_thrashinguaddr2css_extra_stat_show__kernel_timer_tclass_srcu_is_conditionalcss_releasedsleepableDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leaseerofs_fscache_register_volumemodelscan_objectspid_typewb_errcputimerbtf_sizetrace_recursionbv_lenwill_modifystart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispblkcg_nodedax_devicercu_specialclear_child_tidf_refBPF_TCX_EGRESSextable_lenper_cpu_zonestatbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageBPF_LSM_CGROUPratelimit_states_pinsattrFAULT_FLAG_WRITEBPF_MAP_TYPE_ARENAstate_in_sysfswrite_syscallsvm_fault_tthreaded_csets_nodetty_structUTASK_SSTEP_TRAPPEDdebug_direrofs_fscache_data_readblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollbtf_recordac_padmemcg_idresvnr_wakeups_idleFORTIFY_FUNC_memsetrtpoll_waitio_cqprobeelf64_symshutdown_preSCALAR_VALUElink_attach_flagslatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listctx_size_inmap_token_fdPROBE_FORCE_SYNCHRONOUSBLK_UID_NAA__builtin_strlenbpf_iter_seq_infoextension_prognetfs_read_from_holeno_unlock_foliomap_direct_value_addrsyscorewb_reason__s64dqi_bgraceBPF_XDP__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_panelpoweroff_latectl_tableuid_tnetdevflush_requiredino_tprocs_filewb_domainsum_block_runtimepgmapmin_perf_statestrnlendq_oprcu_tasks_nvcswmap_freecoherencywritevolume_name__UNIQUE_ID_rcu388anamemax_user_sectorsclass_read_lock_irqsave_is_conditionalcan_forkFORTIFY_FUNC_strlcatfor_backgroundtail_call_reachablemeta_blkaddrdma_pools_addr_lsbctl_table_pollsaved_dst_attach_typei_generation_sigpollmxcsrdevtrange_cyclicd_rt_spc_hardlimitmagiceminbuild_timebi_end_ioblk_holder_opsfreepages_delay_totalREQ_OP_FLUSHoffloadsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startBPF_MAP_TYPE_ARRAYnr_wakeups_affinewait_page_queuepteval_ti_inocgwb_listdyndbg_infocompact_cached_free_pfnindexdev_links_inforecursion_detecteddriver_datathread_headac_exe_devblk_mq_opsend_iodev_pm_qoserofs_xattr_prefix_itembi_sectormap_typeperiod_timef_oppids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqNETFS_READ_GAPSinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbcgroup_storage__UNIQUE_ID_y_665cgroupsighand_structflagsi_lock_key__refcount_dec_and_testkmem_cacheinodedrivers_dirpathnameback_padbug_entryiov_iter_bvecBPF_SK_MSG_VERDICT___GFP_NOWARN_BITcancel_attachwaiterscmin_fltrw_semdqio_semprev_sum_exec_runtimemap_allocxa_is_internalnestedrtpoll_nr_triggersnr_forced_migrationsseq_operationsnum_argsri_timerstack_canaryBPF_PROG_TYPE_SK_SKBinactiveblksizesiblingmnt_rootPG_arch_2next_scanunregisteringf_ravalue_reckern_unmountquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockcommit_linkbi_write_hinthash_lenget_policy__list_add_validshrinker_info_unitBPF_TRACE_RAW_TPnr_reclaim_startprog_btf_fd__bi_nr_segmentsfscache_cookie_statetask_iterssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalnetfs_io_requestvm_userfaultfd_ctxdevnodecss_freecpu_basedquotdl_runtimechildren_min_usagenumbersswapin_delay_totalbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdxattr_prefix_countfaultableio_comp_batchFS_CONTEXT_CREATINGiov_iter_countbuffer_tailshutdowndq_lockzswap_maxi_cdevldt_structenv_endobj_cgroupPG_checkedrescue_workqueueprogsextra1ptrace_messagenum_trace_events_sys_privatealignment_offsetopen_mutexBPF_SK_SKB_STREAM_PARSERmin_usageinit_fs_contexts_subtypeheaderfuncperf_event_contextspin_lock_offno_cgroup_ownernbp_th_nr_candcputimetlbflush_unmap_batchsoftfreepages_countcrypto_kobject__sifieldsstrlenrcu_read_unlock_specialread_byteskprobe_overridefsverity_operationsxattrwake_q_nodereplace_bpf_fdrequest_key_authfolio_test_largevirtual_dr6attachPTR_TO_TCP_SOCKkprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksinsn_offerofs_fscache_unregister_cookiestart_stackwatcherskmalloc_cachesrange_endcompletionreasonsw_reserveddevice_removablebd_meta_infobio_integrity_poolbuf_lenPG_hwpoisonUTASK_SSTEP_ACKactive_uprobebit_nrBPF_KPTRshow_optionsdiskbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodebpf_cgrp_storageexception_boundarycurr_nrcorememerofs_off_tsector_ttrc_blkd_cpuin_memstallpermission_utimekprobe_multimap_meta_equalget_dquotsnextentsnum_orcscma_pagesclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquots_kobjarrayfsverity_infonr_leaves_on_treefrequencyquota_onbpf_callback_tvm_operations_structbpf_trampolinebin_attrs_newnetfs_io_sourceFSCACHE_COOKIE_STATE_INVALIDATINGerofs_bufbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesac_pidi_statesched_classBPF_LIST_NODEfield_maskmultiprocessinvalidatepi_waitersbpf_reg_typeexp_hintd_childrennregdirty_foliois_softbindcntsRPM_SUSPENDEDreclaim_stateevictederofs_fscache_read_foliovma_numab_staterethookserofs_fscache_acquire_cookienum_symtabwrite_inoded_fsdataRPM_SUSPENDINGcacheline_paddingPG_vmemmap_self_hostednrpages_refcounti_crypt_infoprog_flagspermissionsraw_atomic_fetch_add_relaxednr_frozen_descendantslist_emptybdi_nodeerror_remove_folioiov_iter_zeroold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idxquerycgroup_namespaceZONE_DEVICEattach_btf_obj_fd_head_1_head_2subsysload_timebd_size_lockbackBPF_RB_NODEstate_add_uevent_senti_hashhlist_nodetarget_fdio_uringtask_fd_querycore_occupationcall_get_stackftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setline_infokzalloc_noprofBPF_CGROUP_UNIX_GETSOCKNAMErcuwaitPG_pinnedbio_listwrite_dquotclass_read_lock_irq_is_conditionalreadahead_posmap_lookup_batchioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsBPF_PROG_TYPE_CGROUP_SOCK_ADDRerofs_domain_list_lockmg_dst_cgrplaunder_folioprimarydevice_blocksonlinem_fscacheruntime_resumedup_xol_workinline_auxqueuewrite_charlocal_watermark___GFP_WRITE_BITMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdevice_id_maskdio_offset_aligndelay_workoublockrecent_cidkf_opskernel_paramprog_token_fddeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimei_mmapPG_owner_2phys_addrd_lrusignal_structFSCACHE_COOKIE_STATE_LOOKING_UPperf_event_mutexhprobecrcsBPF_TCX_INGRESSpgdval_tsetattr__bad_copy_tof_mappingnoinstr_text_startpreparebin_attrsprotectedsas_ss_flagsf_modereadahead_folioki_completevtime_statewakee_flipsmap_btf_idset_aclfile_name_offpids_activedriverZONE_NORMALi_opldt_usr_semHRTIMER_RESTARTbvecswpcopy_countNETFS_READ_HOLE_FAILkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorefolio_unlockcredjump_entryswap_iocbfolio_sizeproactive_compact_triggercressrcu_gp_seq_needed_expinterval_expbpf_exception_cbpath_fdaddress_space_operationsspinlock_t__task_fpstatemaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startbtf_log_true_sizehuge_faultkstatfssites__lruvecDEVICE_VERT_POS_UPPERret_flagsmem_cgroup_reclaim_iterevents_lockptracequota_disablekprobe_blacklistwork_lockcpus_ptrnotified_atPG_xen_remappedpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysrreq_linkkswapd_lockqueue_kobjPG_uptodatedirty_limit_tstampsrcu_cb_mutexstatic_call_sitefortify_funcput_page_testzeroMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswneed_freeMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tflatdevmax_integrity_segmentspgprotbstatfalsenetfs_cache_resourceserofs_fscache_req_completeremovedshow_pathPIDTYPE_TGIDreal_func_cntcurr_ret_depthac_utimeverified_dummy_pkeyiommu_mm_datamce_countswap_info_structsequenceBPF_MAP_TYPE_SOCKMAPrt_spc_warnlimitREQ_OP_READac_flagexpected_attach_typecoredump_datavm_stattasksmem_cgroup_per_node_pidaddress_spacemm_context_tuid_gid_extent__call_single_nodestartupsrc_regof_device_idseqcount_spinlock_tbio_issuei_wbcoherency_datacss_local_stat_showhas_elevatorpanelclass_iderofs_kmap_typeinactive_timersubmit_off_pkeyfilenames_export_opwrite_u64__mptrstashedvm_page_protrelax_counttimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockBPF_CGROUP_INET6_GETPEERNAMElowmem_reservepagemutex_unlocktrc_holdout_listbloborig_countget_inode_usagedevice_nodenormal_priomq_opsext_mutexdestroy_inoderelease_foliopacked_nidlast_busyi_pipebaseforce_scanhostuaddris_funcfailedcgrps_wb_errold_subtree_ss_maskshm_clistis_child_subreaperunicode_mapnum_descscontiguousrecoveredindex_key_lenPG_workingsetexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoalloc_inodeBPF_STRUCT_OPSmap_mmapuser_event_mmKMALLOC_RECLAIMd_inameraw_tracepointdevres_headi_mappinginblockrmidkfunc_tabrseq_sigm_lafs_value_is_filenameerofs_fscache_domain_putBPF_PROG_TYPE_RAW_TRACEPOINT_WRITABLEdev_pm_domainattach_btf_idlimit0limit1nr_zonespages_skippedractl__fscache_relinquish_cookiemigrate_modeBPF_PROG_TYPE_LWT_XMITbio_poolfree_areakswapd_failureszswap_lruvec_stateftrace_callsitesd_hashsubrequestsis_confidentialdl_bw__real_strnlenkobjfsyncmtd_infolru_gen_mm_listi_flagsprobe_offsetbpf_kfunc_btf_tablimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodemap_poke_runblk_queue_stats__rcu_read_unlockpushable_tasksBPF_CGROUP_UNIX_RECVMSGplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapmap_alloc_checkalloc_dquotrcu_read_lockpm_messagemay_splitlinfomem_cgrouplast_update_timerobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerssb_flagscountfolio_nr_pagesGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackstat_thresholdlevel__kmalloc_noprofconstructs_user_nssrcversionxas_findi_atime_nsecrcu_tasks_exit_cpupoll_eventfree_subrequesthlist_headprev_donateds_encoding_flagsrunnable_weightincrallowed_attachsbpf_fdstack_vm__fscache_acquire_cookieusage_count_folio_nr_pagescache_resourcesinsnsshowunsigned charzone_start_pfnvdso_test_bitmemtiermmap_legacy_basepipe_inode_infofs_value_is_blobnonresident_ageBPF_MAP_TYPE_INODE_STORAGEpriv_stack_requestedPG_reportedsecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollmap_extrabi_poolcompat_uptr_tuevent_opsWB_REASON_FORKER_THREADpoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BITblinding_requested___GFP_DIRECT_RECLAIM_BITsubtree_ss_masks_vfs_rename_mutexsuspend_latewakeup__check_object_sizecg_listpi_offsetcgwb_release_mutexsrcu_barrier_completionip_epiloguewb_completionshrink_control__compiletime_assert_58written_stampnetfs_io_streamdriver_flagsPG_owner_priv_1elementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapxa_shiftspan_seqlocksessioniddtorrefcount_warn_saturateio_iterbi_flagslast_bdp_sleep_sifields_hugetlb_subpoolkasan_check_readd_manageicq_hintfiemap_extent_infopadding1dax_devBPF_REFCOUNTllistZONE_DMAdebugfs_entrybpf_attach_typeelemnr_retriescgwb_frnavg_refaultedsigval_talimitundo_listKMALLOC_RANDOM_STARTNETFS_READPAGElinkagercharZONE_MOVABLEnr_populated_domain_childrenmissedkswapd_highest_zoneidxreport_zonesparent_could_setfcapquota_readPG_private_2st_shndxerofs_read_metabuf__compiletime_assert_63free__compiletime_assert_65pageset_high_maxs_fscachei_wb_frn_avg_timexdp_has_fragsbd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolfunc_infoprog_idsinitfiles_structwrite_iterPTR_TO_MEMfunc_proto_unreliables_securitys_dio_done_wq_dummy_bndmin_unmapped_pagessas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typewb_tcand_idatomic_dec_and_testmtimeserver_has_tasksswap_events_filezone_wplugs_err_listoriginoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_thigh_worknode_zonelistspathst_sizenr_frozen_tasksREQ_OP_ZONE_RESET_ALLlru_gen_foliowas_asyncrmtpbpf_cookiewait_sumnum_tracepointsupidexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalline_offconsumersrtpoll_min_periodkernfs_elem_symlinkfini_seq_privateclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workkeyring_semsrcu_n_lock_retriesi_fopsa_handlernew_map_fdunlinkPG_fscache__bad_copy_fromperiod_contribforceidle_sumrcu_node_entryfeature_compatstart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncxas_next_entryvm_opsraw_atomic_dec_and_testtailcall_bypassiopollpagesizecopy_to_iterdisk_names_blocksizevm_pgofftimesauprobexa_is_retrycan_swap__retrelease_agent_worknuma_workenforce_expected_attach_typeupdate_timeptrace_dr7priorityduration_call_addrexpiremax_segmentsloginuidcheckrtpoll_untilexpiryBPF_TRACE_FEXIToptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkgjit_datanbp_rl_nr_candtailcall_target__lstateBPF_MAP_TYPE_CGROUP_STORAGEupdated_nextueventlock_countrefcount_tcset_linksplugchild_countsaved_auxvinosmce_addrlast_bstatnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsinner_map_fdmod_namemm_cidFORTIFY_FUNC_strnlenmemory_tierunlocked_ioctlrseq_lenerofs_fscache_req_putmodule_attributefscache_relinquish_cookiepollfdarch_atomic_fetch_addnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalorig_objcgrseq_csnum_ftrace_callsitesPTR_TO_XDP_SOCKsoftirq_expires_nextioctlatomic_fetch_add_relaxedREFCOUNT_DEC_LEAKPTR_TO_BTF_ID_OR_NULLreadlinkmigration_flagsbtf_key_type_idBPF_CGROUP_UDP6_RECVMSGnode_zonesretirenr_valuesm_llennbp_th_startelow_pincountiov_iter_xarrayBPF_LIST_HEAD__rcu_read_lockerofs_fscache_init_domaintreerq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmapunreliablemin_seqlist_headlru_lockbtf_flagsWB_REASON_FOREIGN_FLUSHtgidbatchedBPF_LIRC_MODE2for_reclaimmax_pclusterblkswrite_protect_seqxa_mk_internalcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holderbpf_prog_opsend_codeblkio_countqspinlockBPF_TRACE_UPROBE_MULTI__kmalloc_large_noproflru_gencurr_folioqinsnfilldir_tfolio_batchlow_usagedl_non_contendingdir_contexterofs_dev_contexttracepoint_ptr_tutaskfailcntrelative_fdsched_entityd_spc_hardlimitmq_freeze_wqlockdep_keyPTR_TO_TCP_SOCK_OR_NULLlong unsigned intsleep_maxmmap_basephaserescue_workio_contextrevisionquiesce_depthhctx_tablegpl_symsgroupseq_shownetfs_priv2ctl_nodeerofs_fscache_req_io_putswait_queue_headBPF_CGROUP_SOCK_OPSPG_headcow_pageinumac_btimeblocki_spc_timelimitlog_bufreturn_instanceszone_wplugs_hash_bitserofs_fscache_req_allocbpf_map_typesched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinki_private_listhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgnoderesetfor_kupdatevm_lockwb_tcand_bytesno_cgroup_migrationbuild_time_nsecnextevts_writers_key__countxcomp_bvNETFS_UPLOAD_TO_SERVERcma_areastatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatipc_namespaceexec_update_lockBPF_MAP_TYPE_PERCPU_HASHarch_set_bitatomic_write_hw_maxl1d_flush_killfunc_idxi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimeaddrsstate_remove_uevent_sentread_charPG_activefirst_minorcgroup_nsia_sizein_hrtirqs_master_keysconst_test_bitNETFS_READ_HOLE_CLEARac_stimescaledwchar_addr_bndkernel_symbolsubsys_databi_statusnr_cgrpstv_secma_lockmap_poke_trackpid_ttask_listftrace_sleeptimeprog_ifindexrun_nodeblock_device_operationsma_rooturing_cmdpsi_filesnr_failed_migrations_affineIS_ERRREFCOUNT_SUB_UAFstrcmpuser_cpus_ptrirq_delay_totalpi_top_taskbtf_fieldBPF_CGROUP_INET4_GETSOCKNAMEiov_iter_reexpandBPF_PROG_TYPE_CGROUP_SOCKNETFS_WRITEBACKbtf_vmlinux_value_type_idstart_pagem_dax_part_offactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writeread_holehlist_bl_nodest_otherPG_anon_exclusivei_mutex_keyksethrtimer_clock_basevruntimedisable_depthBPF_CGROUP_INET_SOCK_CREATEmax_seqi_sizedl_deadline_hugetlb_hwpoisonpsi_group_cpuubufksm_rmap_itemstest_run___GFP_HIGHMEM_BITnr_populated_csetsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tmap_nameautaskBPF_GRAPH_NODEsleepable_refcntuser_namespacequery_occupancyvfsuid_traw_spinlockadvicekswapd_waittimer_autosuspendspudval_t__rcu_headBPF_MAP_TYPE_TASK_STORAGEmce_vaddrquota_offxattr_prefix_startdq_inusecachedqi_flagserofs_fscache_register_fskeyring_name_listcache_privfile_costBPF_PROG_TYPE_PERF_EVENTkfreeBPF_PROG_TYPE_SCHED_ACTread_posstatic_call_trampbtrace_seq_pp_mapping_padsa_mask__folio_putxa_entryrequest_queuealloc_factordqi_dirty_listpinsmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlencodegtimenr_populated_threaded_childrensigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listPG_swapcachesched_rt_mutexlocked_pendinghlist_nulls_nodenr_deferredfown_structfeatures_lockedlruvec_statstracing_graph_pauseavg_triggerspermdirect_bv_unpincompat_robust_listinval_counterbi_blkgnr_hw_queuesio_streamsktypelockrefin_dpm_listsrcu_struct_ptrsBPF_PROG_TYPE_SOCKET_FILTERmm_structrtpoll_wakeupvlagi_uidbpf_prog_auxref_ctr_offsetstablesbi_iocost_costspinlocknr_dying_subsystimestampspid_namespace_syscallmod_arch_specificmax_write_lennum_static_call_sitesend_pfnvm_mmvalue_type_btf_obj_fduptrdebugfs_idwb_lcand_bytesguest_permtype_idmem_dqinfotrueBPF_CGROUP_UNIX_CONNECTi_countHRTIMER_NORESTARTpart0WB_SYNC_ALLbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipcgwb_treeBPF_MAP_TYPE_CGRP_STORAGEufdsexe_fileipc_nserofs_mount_optspcp_listpid_linksfree_countBPF_CGROUP_GETSOCKOPTs_sysfs_nameBPF_SK_REUSEPORT_SELECT_OR_MIGRATErefcountvaddrrequestpglist_datarw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipdirect_bv_countpage_counterlog_sizeoffload_requestedqc_dqblkbpffs_fdfprop_local_percpuavg_next_updatemmappedseqcount_raw_spinlockbd_holder_dirdst_neededcpu_run_virtual_totalelem_countvalueskill_sbbtf_func_modeld_opnetfs_io_subrequestMIGRATE_ASYNCdevice_dma_parametersproc_ns_operationsi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failthrashing_countllist_headbyteswait_startf_freeptrnr_freeclass_raw_spinlock_irqsave_try_is_conditionalcore_relo_rec_sizemap_nr_maxget_dqblkshow_fdinfofixuprefcount_offBPF_PROG_TYPE_SYSCALLset_ownershipposix_acldd_key_falsebug_addr_dispdqi_igracecurr_folioq_slotclass_rwsem_write_try_is_conditionalnetfs_cache_opsthaw_noirqpreempt_notifierskernel_read_file_strsrcu_last_gp_endnr_outstandingenable_statsbdi_ids_fsnotify_infocpu_delay_totaluser_keyring_registererofs_map_blocksmempolicyadj_offpm_message_tioveci_private_locksegment_boundary_masksubmit_lenVTIME_IDLEjited_linfostatic_keyremovehooknums_magicdl_overrunallocd_parentFS_CONTEXT_FOR_SUBMOUNTtypetabonline_cntPG_unevictablepayloadprepare_ondemand_readac_minflti_sbmin_ratiokmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflinePG_reclaimatomic_write_segments_maxfunc_info_cntatomic_open_zonerefsbio_end_io_tbtf_log_levelstart_prevent_timeuapi_mutexBPF_FLOW_DISSECTORlru_zone_sizecondreadahead_controlblk_tracertpoll_timerdirty_limit__kernel_gid32_tcompact_init_free_pfnkernfs_open_filestate_maskf_credbpf_line_infoMODULE_STATE_COMINGnotify_countmg_dst_csetoffline_disabled__empty_rangesbd_devpage_ref_dec_and_testread_newsignalfd_wqhmmapmodnameused_maps_mutexasync_put_workmknodNETFS_INVALID_READfsnotify_sb_infostream_nr__sigrestore_tbi_idx__kernel_loff_tdetachget_unmapped_areadev_pagemaproot_nidwritepagessched_statisticsbpf_prog_statsheadBPF_PROG_TYPE_LWT_SEG6LOCALsync_decompressminors__empty_insns__state_permerofs_fscache_data_read_sliceuprobe_taskerofs_domain_cookies_listselfwriteback_controlattach_typeuclampFSCACHE_COOKIE_STATE_QUIESCENTbio_initsuper_operationsbi_cookiesplice_eofcheck_copy_sizenr_threaded_childrenutil_avgerofs_fscache_register_cookie___GFP_DMA_BITtaskrlimitsched_task_groupthaw_earlyblockedi_securitystats_lock__refcount_addD_REAL_DATAnetfilterbd_holderspt_regspipe_bufsto_userKOBJ_NS_TYPE_NETcapabilitiesctx_iddirty_ratelimitd_rt_spc_warnsctx_inq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsBPF_PROG_TYPE_TRACEPOINTWB_REASON_MAXiopriocap_inheritablegp_waitlookupcostdev_pm_infoexpected_revisionreq_opREQ_OP_ZONE_RESETbtf_dtor_kfunc_tblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsevents_filefscache_begin_read_operationFORTIFY_FUNC_memscanrelative_idntimeinamekfunc_btf_tabfs_context_phasevm_private_dataio_bitmapksymBPF_TRACE_KPROBE_SESSION__bi_remainingsubtree_bstatuprobe_task_statetimerkobj_typeb_dirty_timediskseqi_pagesBPF_MAP_TYPE_STACKZ_EROFS_COMPRESSION_DEFLATEatomic_write_hw_boundaryhlist_bl_headino_warnlimitpfmemalloc_waitarch_uprobe_taskfasyncpidlistsi_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecfdevsysctlsprotection_supportfd_typemax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkvm_node_stat_diffbio_slabd_alias__iov__fscache_relinquish_volumecpumaskdumpernode_size_lockwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsBPF_MAP_TYPE_PERCPU_CGROUP_STORAGEwrite_bandwidthd_rt_spc_timermap_redirectevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsBPF_PROG_TYPE_SOCK_OPSbuflensaved_trap_nr__this_modulekey_lenbio_crypt_ctxfreeze_fsuserfaultfd_ctxBPF_MAP_TYPE_CGROUP_ARRAYsigset_tcapacityftrace_opsrq_countrunningrseq_event_masks_rootra_pageslegacy_cftypesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitsBPF_CGROUP_ITER_SELF_ONLYPG_writebackread_syscallsreadahead_counthlist_nulls_head_nr_pagesparentnode_offsetatimecopy_file_rangexa_statetask_cputime_atomicbtf_token_fduser_definedBPF_MAP_TYPE_DEVMAPkey_type__fscache_acquire_volumecopy_overflowcgrp_linksPG_idlecurr_targetstack_depthreconfigureis_suspendeduts_namespacefor_synctimeout_workburstretry_requestraw_atomic_setetypeFS_CONTEXT_AWAITING_RECONFei_funcsmodule_kobjectmemoryorderactive_memcgbpf_local_storage_mapneed_retrydef_flagsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0rtpoll_totalno_updatecap_bsettagged_writepagesopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areaBPF_MAP_TYPE_LPM_TRIEsaved_statekernfs_elem_attrBPF_CGROUP_INET_INGRESSbasess_bdev_filenuma_faultsperiodcgroup_subsysprog_nameattach_func_namefile_offsetlinux_binfmtpage_table_lock_sigfaultmax_sync_decompress_pagescountersNETFS_INVALID_WRITEname_linknr_charged_bytescmaxrsstimer_slack_nserrno_to_blk_status___GFP_MEMALLOC_BITbus_typerstat_css_list__compiletime_assert_62policysharedmap_get_next_keynet_devicewait_queue_entrydismisslist_deld_real_typelookahead_bandseq_starttask_cputimerq_qos_mutexzone_wplugs_wqfscache_acquire_cookieraw_lockd_dnameget_treeac_schedmax_hang_timecpus_mask_pad_b_dirtysubdirscgroup_bpftask_groupinitializedstarttimemmap_missswap_peaksquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamelogical_block_sizerun_delaytailsvmstatsblk_flags_tlinenowsizebi_io_vecbpf_progbase_pfnsreq_max_lenstatBPF_NETFILTERget_inode_acl_addr_pkeymigrate_foliocustom_slicespanned_pagesthread_keyringeffectiveexception_cbkparam_arrayrefcount_setutimestart_codemap_for_each_callbackset_bitis_hardfsbaseprog_bind_mapblk_status_tac_uidinsn_idxBPF_CGROUP_INET_SOCK_RELEASEBPF_MAP_TYPE_PROG_ARRAYattrspercpu_drift_markallowed_cmdscpumask_tgid_mapswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axerofs_domain_listtarget_btf_idbd_claimingcompletesched_rt_entityfree_requesttimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__empty_insnsinr_cached_objectsia_mtimetrc_ipi_to_cpudirty_exceedednodeinfomxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldis_seenBPF_MAP_TYPE_XSKMAPdiscard_granularityBPF_TASK_ITER_TGIDfopstotalreservedmap_fddev_boundPG_privatelatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetrstat_cpudst_progtime64_tREQ_OP_ZONE_OPENBPF_CGROUP_DEVICEnuma_faults_localityhas_child_subreapersock_fprog_kerni_aclmap_release_uref_copy_to_iter___GFP_ZERO_BITm_deviceidwrite_newwb_listcgroup_freezer_statelist_lockconsumedpm_domainNETFS_READ_FROM_CACHENETFS_SOURCE_UNKNOWNinstrument_atomic_read_writecpu_bitmapucount_maxstatic_call_keyutil_estucountsraw_atomic_fetch_sub_releaseBLK_UID_EUI64qc_stateerofs_anon_init_fs_contextPG_dirtysubreq_counterpageset_high_minsoftirq_next_timermap_update_elemctx_outpresent_early_pagesmax_active_zoneszone_wplugs_poolBPF_PROG_TYPE_SK_MSGcheck_flagsswp_entry_tbi_inline_vecsmemcg_css_mapcountmap_iddomain_tagcleanuparch_atomic_sethang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keybpf_prog_offloadset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntm_bdevmodule_memorypi_entryimplicit_on_dflk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacac_exe_inodenr_to_scanerofs_fscache_req_io_allocthreaded_csetsDEVICE_PANEL_UNKNOWNfs_parameter_specaux_datadesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtpi_bytesdma_cleanupcpuhp_deadmaple_treeFSCACHE_COOKIE_STATE_RELINQUISHINGKMALLOC_DMAdentryerofs_fscache_req_end_iolast_mergecpu_itimerfscache_cookiepercpuget_unique_idprogs_hlistrel_deadlinezone_capacityclass_spinlock_try_is_conditionalper_cpu_zonestatsDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkerofs_fscache_access_aopsattach_btfpushmm_walkdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listtransferredhiwater_rsskretprobe_instancesBPF_SPIN_LOCKstart_all_reasonBPF_PROG_TYPE_RAW_TRACEPOINTrangepageset_batchcgroup_base_statfutex_exit_mutexmap_lookup_elempm_onlykernfs_iattrsbpf_func_statecompact_blockskip_flushtrc_blkd_nodewriteback_inodesd_spaceWB_REASON_PERIODICgraveyard_linkwritecntblkszbitsxol_vaddrsplice_readElf64_Addrd_rt_spacenameBPF_MAP_TYPE_PERF_EVENT_ARRAYread_s64blk_mq_ctxbi_iopriou_flagsIS_ERR_OR_NULLxa_indexnvcswac_tgetimeKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERout_batchshared_pendingpurposei_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typehighi_rdevblk_integrity_checksumlist_lru_nodeself_exec_idkernfs_opsfile_lockPG_swapbackedMODULE_STATE_LIVEstopnr_migrationsa_opsreq_listxa_flagsfreezebin_sizecloseREQ_OP_SECURE_ERASEgrphi___GFP_RETRY_MAYFAIL_BITerofs_domainnr_sectorscftyped_spc_timerjump_entrieslink_idsctl_dirasync_suspendmsi_device_dataassoc_array_ptrsuper_blockFORTIFY_FUNC_UNKNOWNset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpfs_context_operationscpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arrayerofs_fscache_biomnt_idmapdq_dqbmm_stateuidhash_nodesaved_tfElf64_Xwordold_timespec32d_rculock_class_keynetfs_io_originmemory_events_localBPF_TRACE_UPROBE_SESSIONnum_symsFSCACHE_COOKIE_STATE_FAILEDmodule_notes_attrsvm_lock_seqpdeath_signalgenerationPIDTYPE_MAXroot_listPG_lockednlinkcpu_countdefault_setavg_totalpercpu_refns_commonhorizontal_positionmanaged_cacherlimit_maxPG_mappedtodiskpref_node_forkwait_queue__int128reclaimeddqi_privrss_statmap_local_storage_unchargemems_allowed_seqrefcntthawD_REAL_METADATANOT_INITget_nextdqblks_fs_infocrypto_profilefutexwait_maxac_niceresult_maskfscache_cacheBPF_MAP_TYPE_DEVMAP_HASHstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrplon_activeREFCOUNT_ADD_UAFclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightip_after_callvm_file___GFP_COMP_BITidr_basei_blockskswapd_orderfolio_mark_uptodateuser_sizedev_pm_opscdrom_device_infoscheduledfsidfolio_flagsFAULT_FLAG_TRIEDused_mapsclass_raw_spinlock_nested_is_conditionalworker_privateis_reltag_sizekey_hashhash_linkset_dqblkkill_anon_superkmalloc_typeqstrma_flagsREQ_OP_WRITEnr_ia_rangestarget_ifindexBPF_WORKQUEUEterm_funcmax_user_discard_sectorsfreeze_mutexfutex_statenr_linfoBPF_CGROUP_UDP4_SENDMSGorig_pmdqueue_lockacct_timexpds_op__rcu_icq_cachemax_tp_accessBPF_PROG_TYPE_KPROBEsizefree_after_rcu_gpZONE_DMA32lnodeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_twb_switch_rwsemtask_fragsrcu_gp_mutexdatalenCONST_PTR_TO_MAPPTR_TO_FUNCnr_wakeups_affine_attemptscache_strategyalt_lenerofs_domain_cookies_lockcinblockextablePTR_TO_FLOW_KEYSexitcompact_considereditemskernel_param_opsbus_dma_regionio_uring_cmdaudit_namesdirtied_whenused_btf_cnt_batch_countac_utimescaled__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexerr_cookiebpf_prog_arraycore_statehas_callchain_buftimerqueue_headlist_is_headBPF_TRACE_FENTRYf_wb_errserial_nrFS_CONTEXT_CREATE_PARAMSdeferred_split_queuefutex_pi_statekstat__kernel_uid32_tend_operationis_still_validq_lock_cls_keysubsys_maskDEVICE_FIXEDZ_EROFS_COMPRESSION_LZMApte_tdevice_driverdying_tasksdl_server_has_tasks_frunnable_sumDEVICE_PANEL_TOPreal_credsysfs_dir_lockbpf_ctx_arg_auxxa_offsetcancel_forkepoll_watcheslink_createxa_update_node_tprealloc_ptekcompactd_waitdqb_curspacegp_statebitsetload_avgpseudo_fs_contextaccesscstimeBPF_MAP_TYPE_USER_RINGBUFcfs_rq_uiderofs_fscache_register_domainbpf_kfunc_desc_tabst_spacemm_cid_next_scanns_typekptrmap_check_btfdfl_cgrpac_majfltposix_cputimers_workproc_handlerrreqbpf_iter_aux_infomodule_param_attrsshort unsigned intwatermark_boostunitelem_flagscpu_scaled_run_real_totali_mutex_dir_keyq_nodespc_warnlimitctl_table_sizeextentm_fps_encodingiter_infogpl_crcsorc_entryBPF_CGROUP_INET4_GETPEERNAMEkeysBPF_XDP_DEVMAPperiod_timerorig_ptedqb_curinodesnbp_thresholdload__s8netfs_groupPTR_TO_CTXcss_allocinvalidate_lock_keydma_maskprealloc_mutexnanosleepobjcg_list__NR_PAGEFLAGSsock_filtereventdq_dqb_lock__kernel_ulong_tvolnamelruvec_stats_percpuio_minerofs_nid_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefixextra2map_peek_elem__u8is_roxfscache_use_cookielockcompact_cached_migrate_pfnrlim_maxslave_dirDEVICE_PANEL_FRONTruntime_deferred_listd_waitqueue_flagslist_lru_onezswap_writebacknr_argsdevice_physical_location_horizontal_positionBPF_MAP_TYPE_PERCPU_ARRAYseeks__readahead_folioseq_stopkf_rootPTR_TO_MAP_KEYkiocbbv_offsetclass_rwsem_read_intr_is_conditionalcompact_order_failedjit_requestedfsuidctl_table_argbtf_typeREQ_OP_ZONE_APPENDcompact_init_migrate_pfns_blocksize_bitsnuma_scan_periodmanaged_pagesutil_summigration_disablediter_typepositionclass_device_is_conditionalcollected_toattach_func_protomax_entriesshrinker_idbio_setrootprojid_mapoom_reaper_listnr_reserved_highatomicdev_stateattach_bpf_fdsym_VDSO32_NOTE_MASKrtpoll_scheduledbpf_storagebpf_map_opsmap_delete_elemNETFS_WRITE_TO_CACHEno_callbacks__u16timers_activewait_countmap_get_unmapped_areasig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedseq_opsEROFS_KMAPwork_listdiscard_alignmentraw_spinlock_tkey_tagINIT_LIST_HEADopen_flagsfs_flagsworkpgprotval_txa_updatekeytypesigpendingmq_freeze_depthfsindexshstkkernel_load_data_strsrcu_ssppage_orderwake_irqcan_attach__page_1__page_2accounting_timestamp__sighandler_ts_bdevmapping_set_gfp_mask__u32ptracedtrc_reader_specialverified_insnsHPROBE_GONEvalue_sizeactive_timethrashing_delay_totali_sequenceZ_EROFS_COMPRESSION_LZ4pool_datapgdatbtf_field_typetailcall_target_stabledisk_statsinit_seq_privatedqb_ihardlimitd_lockrefREQ_OP_ZONE_CLOSErpm_requestnum_bpf_raw_eventsaddrdevice_privateuprobe_multi_perfi_dir_seqbpf_attrkqiddefer_syncKOBJ_NS_TYPE_NONE_watermarkBPF_MAP_TYPE_HASHswap_activatemkobjcore_cookiesrcu_supd_deleteb_more_ioPRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesm_pauclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typefolio_posBPF_PROG_TYPE_NETFILTERmf_statsBLK_INTEGRITY_CSUM_CRC64erofs_fscache_bio_allocf_iocb_flagsPG_isolatedpoweroffcmaj_fltvtimeerofs_pseudo_mntmath_emu_infoiowait_sumBPF_MAP_TYPE_PERCPU_CGROUP_STORAGE_DEPRECATEDPTR_TO_PACKET_ENDblindedPTR_TO_SOCK_COMMONfs_value_is_flagf_pathpidlist_mutex__u64journal_infoarenaFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_trueb_ioweighti_privatemaxrssPG_lruflushiov_iterruntime_suspendi_blkbitsvaluefrontgroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsBPF_TIMERbpf_arenaBPF_MAP_TYPE_STRUCT_OPSclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_snext_keypinned_vmnode_start_pfn_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startsrcu_gp_seq_neededBPF_SK_SKB_STREAM_VERDICTret_sizeunused_hctx_lists_flagsfaulterofs_map_devcur_imagealternative_gpt_sectorshow_statsdl_densityfreeptr_tallowed_progsread_dqblkac_gidintegritydq_flagsprepare_writeatomic_fetch_sub_releaseDD_CLASS_TYPE_DISJOINT_NAMESp_sizedata_size_inmemcg_datatracepoint_extline_info_rec_sizekprobes_text_startrunnable_avgs_time_gran__refcount_increpeatBPF_PROG_TYPE_STRUCT_OPSkernel_cap_tnon_rcuwait_listrequest_pendingdworkhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_countBPF_CGROUP_INET4_BINDs_bdiglobalFSCACHE_COOKIE_STATE_CREATINGposix_cputimer_base___GFP_NOMEMALLOC_BITavgs_worknum_kpin_execvetlb_flush_pendingtail_callRPM_REQ_SUSPENDs_listPG_youngFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceBPF_MAP_TYPE_QUEUEversionmax_descendantswb_lcand_idREQ_OP_ZONE_FINISHserialclass_releasealloc_lockname_offs_dquotmax_hw_sectorsfolioqfoliosthreadedupdated_childrenfolio_puttagsprev_posfscache_unuse_cookieFSCACHE_COOKIE_STATE_LRU_DISCARDINGdelayedseqcount_spinlockexpire_countftrace_manageduid_maps_umountis_bin_visiblepgoffsyscall_user_dispatchumount_beginnr_disk_swapinsrcu_tasks_exit_listbpf_jit_poke_descriptorarchdataia_uid__list_del_entry_valid_or_reportBPF_MAP_TYPE_REUSEPORT_SOCKARRAYarg_sizecache_priv2childrenrb_subtree_lastno_pm_callbacksbuild_id__p_lenrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_tfolio_test_headrt_spc_timelimitsym_int80_landing_padmap_fd_put_ptrBPF_CGROUP_SYSCTLtailia_atimeinfixtlb_ubcWB_REASON_LAPTOP_TIMERprog_typebi_issuequota_format_typedev_privignoredvmstats_percpuiter_createtask_structparse_monolithicanon_costrelease_dquotsrcu_n_exp_nodelaysuspend_timerprog_cntquotalenPTR_TO_SOCKETtotalreserve_pagesf_pipei_wb_frn_historylast_wakeenextjits_use_priv_stackmin_slab_pagesio_tlb_memis_sourceerofs_domain_init_cookiearch_spinlock_tsubmit_bioblk_flush_queuenr_tasksi_mtime_nsecperformancemmlisthd_geometrysuppress_bind_attrsRPM_RESUMINGd_weak_revalidategsbases_quota_typeswrite_s64f_llistmq_freeze_lockhigh_maxdax_part_offin_batchread_u64i_nlinkbranchwrite_begingroupsBPF_PROG_TYPE_CGROUP_SOCKOPTpi_blocked_onbypass_addrs_xattrclass_local_lock_irqsave_is_conditionalon_dispatcherofs_fscache_rqclass_local_lock_irq_is_conditionalBPF_CGROUP_INET4_CONNECTbtf_value_type_idsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_treclaim_waitfbatchFS_CONTEXT_AWAITING_MOUNTnr_writeback_throttledlink_idshareFORTIFY_FUNC_strscpypagefault_disabledstate_startsyscwnr_memcgsopt_failedil_prevwlockedfreeze_superPTR_ERRs_inode_list_lockalignelevator_queueerofs_fscache_unregister_fsruntime_idleBPF_CGROUP_UNIX_GETPEERNAMEbpf_cgroup_storagesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICoffline_nodequota_enablesched_avgPG_large_rmappablentabzonedevice_typemaj_fltarch_rwlock_ttree_scannedclock_basecdevmy_qgroup_leadermkdirzonelistFS_CONTEXT_FOR_MOUNTPG_referencede_csetsreal_blockedarg_locknum_exentriespid_ns_for_childrenlaptop_mode_wb_timerlower_firstrequeue_workbio_splitint32_tio_pagesoffset_ctxcur_ktimemap_lookup_percpu_elemnr_failed_migrations_runningcompact_delay_totalclassesnext_timerexclusiveclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosmap_lookup_and_delete_batchfsavekeyring_index_keyxattr_blkaddrqrwlocksplit_queuefscache_read__p_sizefile_ra_statemax_depthuser_structbtf_mod_pairBPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATEDerofs_xattr_long_prefixon_rqPTR_TO_STACKfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGlast_old_flushxa_nodenext_offsetcommit_dqblknamespacei_ino_warnlimitdirtied_stampatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclassjited_imagecgroup_atypelast_mm_cidmax_open_zonescookiesb_flags_maskbd_stamptargethigh_minmap_pop_elema_flagstrace_overrunwriteback_sync_modessession_keyringcpusfop_flagsSYSCTL_TABLE_TYPE_DEFAULTkey_restrict_link_func_twb_bytess_maxbytesreal_timerd_ino_countlast_cpupage_freemap_push_elemilenerofs_fscache_readaheadmnt_flagsvm_structmemory_peakscred_guard_mutexmajorsigcntfiltershrtimer_cpu_basepriv_stack_ptrcb_headcheck_quota_fileFORTIFY_FUNC_memchr_uppernetfs_request_opsattributeclass_raw_spinlock_is_conditionalgpl_compatibledev_archdatai_deviceskey_perm_tFS_CONTEXT_FAILEDcss_rstat_flushbio_integrity_payloadrescue_listswappinesspi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsproc_linkrescue_locklist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offseti_opflagslink_fdlast_subtree_bstatrobust_listmap_lookup_and_delete_elemsym___kernel_rt_sigreturninfix_lenBPF_XDP_CPUMAPsplit_queue_locksym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctlctx_arg_infolockdep_mapfiltercurr_ret_stackrsizedockcgroup_fileforwardstart_idloff_tthread_pidfscache_volumesrcu_gp_seqcore_relo_cntextra_devicesupdate_i_sizeia_rangescgroup_rstat_cpu_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevmap_delete_batchmap_poke_untrackcallsunused_ati_default_acls_uuid_lenioc_nodemm_statsof_node_reusedinsnlenclass_map_typePROBE_PREFER_ASYNCHRONOUSicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1iter_info_lenmatchmemory_typerb_rootnr_wakeups_localnr_requestsHPROBE_STABLEresume_noirqrq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpaddingmax_prop_fracbuffer_head_slot__filler__list_addsaved_sigmaskd_timePTR_TO_PACKET_METAentriescpu_idfop_flags_t__MAX_NR_ZONESFAULT_FLAG_KILLABLEinodesclass_namessources_mtdkparam_stringpoweri_mtime_seckern_mountmax_pkt_offsetevent_flagssched_delayedbd_statsbi_sizemodule_statemq_kobjlast_used_atmemcg_vmstatserofs_put_metabufZ_EROFS_COMPRESSION_ZSTDvm_endlast_queuednuma_migrate_retryuser_ns__stateconst_folio_flags__compiletime_assert_451firstiommu_groupNETFS_WRITETHROUGHdma_alignmentmigrate_to_ramPG_reservedwait_pidfdptrace_bpss_umount_keymax_ratiovm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctime__fortify_strlenBPF_MAP_TYPE_SK_STORAGEFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssget_keyattach_btf_trace__list_delNETFS_READ_HOLE_IGNOREavgs_locksrcu_barrier_mutexBPF_SK_LOOKUPi_private_dataElf64_Halfbw_dworkBPF_CGROUP_ITER_DESCENDANTS_POSTcompact_countrcu_read_unlockFORTIFY_FUNC_memcpynsproxycan_wakeupbtf_idBPF_UPTRxol_areaBPF_MAP_TYPE_CPUMAPBPF_PROG_TYPE_SK_REUSEPORTrlockkasprintffl_owner_tPTR_TO_ARENAerofs_fscache_bio_endiokey_size_reslink_detachia_rangeeuidwaitbug_tabledirtied_time_whenm_plensequential_io_avgoom_grouptimer_offnum_trace_bprintk_fmtmap_set_for_each_callback_argscpu_run_real_totalvm_policyperf_rdpmc_allowedrdevprivate_dataretvalsignumfscrypt_keyringpost_modifys_mountsuse_memdelaycalledRPM_ACTIVEcookies__state_sizeterm_func_privcallerthread_structcached_requested_keyenvp_indexbvec_iterPG_savepinnedper_cpu_pagesctimereleasemax_segment_sizenr_pagessched_dl_entityBPF_PROG_TYPE_CGROUP_DEVICE__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_idmap_owner_storage_ptrs_dentry_lrubp_offsetnet_nsnetfs_privblk_crypto_profileattach_tracing_progfolio_queuelast_task_numa_placementnr_descendantspgtable_tblock_startmap_direct_value_metacgtimeWB_REASON_VMSCANfolio_put_testzerosymlinkoom_flag_originfscachecounterorc_unwindavailable_compr_algsWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionalrefcount_saturation_typesocket_pressureki_waitqnotify_timerverifier_zexttrace_eval_mapCONST_PTR_TO_DYNPTRdonesuspendinit_pseudofscrypt_operationsrelease_workinvalidate_cacheWB_REASON_FS_FREE_SPACEksm_zero_pagesmap_lookup_elem_sys_onlymountDD_CLASS_TYPE_DISJOINT_BITSac_btime64__BPF_REG_TYPE_MAXmg_dst_preload_noderatelimitfree_foliodebugfs_dirBPF_KPTR_UNREFBPF_PROG_TYPE_UNSPECqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotarefcount_incswapin_countdl_timeri_dataDL_DEV_NO_DRIVERrstat_css_nodeFAULT_FLAG_ORIG_PTE_VALIDinner_map_metasysv_semanon_vma_namefileattrwatermarkavg_nr_triggersfprop_globallong long unsigned inttoken_createanon_nameopen_partitionsblkcg_gqhashia_filesival_intdopsnuma_preferred_nidinstrument_atomic_write_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_highFS_CONTEXT_FOR_RECONFIGUREarch_uproberecord_Boolsleep_starttnodeFS_CONTEXT_RECONFIGURINGmin_fltHPROBE_LEASEDfs_value_is_undefinedclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatemm_listcss_idri_linklistxattr_lowertrap_nrbinfmt_miscasync_probe_requested__list_add_valid_or_reportcompat_long_tac_etimerefcount_dec_and_testactive_counts_iflagsprevent_sleep_timemce_kflagslog_true_sizenext_idNETFS_PGPRIV2_COPY_TO_CACHEtotal_numa_faultss_countdev_msi_infoxa_is_zerod_revalidatectx_size_outbus_groupspmd_terofs_sb_infomnt_namespaceREQ_OP_DISCARDquery_flagsnode_spanned_pagessysv_shminstrument_atomic_readdq_countutf8data_tableset_latency_tolerancePG_waitersfoliowake_entryBPF_CGROUP_SETSOCKOPTxa_headsuidi_readcountnetfs_io_terminated_tBPF_LSM_MACblk_integritylocked_vmrb_leftnew_inodemg_src_cgrpseq_nextBPF_CGROUP_ITER_ORDER_UNSPECsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_tprepare_write_subreqclass_rcu_is_conditional__MAX_BPF_MAP_TYPEbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countmemcg_completionstransferred_or_errorbpf_cgroup_iter_orderksm_merging_pagesfree_listn_accessesautosleep_enabledptrace_entryblkg_listuse_autosuspenddebug_indexrecent_used_cpunum_jump_entriesmount_optissue_writes_qcopatomic_tbv_pageNETFS_UNBUFFERED_WRITEalloc_tag_counters_flagsrqos_debugfs_dirnotify_nextoldapie_cset_nodePG_mlockedbus_dma_limitbuffershort intmynodepart_tblzone_wplugs_hashZ_EROFS_COMPRESSION_MAXdirfdPTR_TO_MAP_VALUE_OR_NULLwb_waitqPTR_TO_BUFclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invcss_offlinepad_untilDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2erofs_anon_fs_typekern_versiondestroy_rworklast_arrivalem_pdtrace_event_callsyncis_guestdevice_physical_locationpm_domain_datanr_extentsnr_scannedpoll_table_structprogs_cntfifodirect_IOparse_paramwait_queue_entry_televatorxas_not_nodepcpucurrent_may_mountseqlock_tbd_queuenuma_scan_offsetcgroup_subsys_stateold_map_fdnr_free_highatomicmax_rdwr_access___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskfreezer__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTArwsemi_ctime_nsecia_validSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYvertical_positionreadahead_lengthvirtmemFORTIFY_FUNC_strncati_rcuBPF_MAP_TYPE_LRU_PERCPU_HASHmax_distance_pagesi_atime_secBPF_CGROUP_INET4_POST_BINDmutex_lockmap_gen_lookupqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITBPF_PROG_TYPE_FLOW_DISSECTORactivedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxnew_prog_fdpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listsubrequest_poolcall_get_func_ipnr__netfs_io_originallowed_mapsxarray_start__flagsxa_allocfadvise__compiletime_assert_663m_algorithmformatvmem_altmaparg_endsyscall_dispatchthaw_superfscache_relinquish_volumerevoked_atlast_sum_exec_runtimeprivate_listshiftia_gidumount_mutexBPF_KPTR_PERCPUtree_reclaimedattribute_groupcontextposix_timersper_cpu_nodestatselectorblkcg_polsMEMORY_DEVICE_PRIVATEpstartmap_flagsdev_releasebi_nextdefault_timer_slack_nskcsan_check_accessbpf_iter_fini_seq_priv_tissued_tosource_listbpf_iter_task_typefscache_operation_validRPM_REQ_NONEswap_readahead_info__fpstateactive_reftracingpmdval_tctl_table_root___GFP_NOFAIL_BIT__copy_overflowgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizedfl_cftypes__fscache_use_cookiectx_arg_info_sizedeferred_splitjitedmce_kill_mephysical_block_sizeuuid_t___GFP_UNUSED_BITatomic_write_hw_unit_minBPF_TRACE_ITERcount_objectsctl_table_setcore_relos_stimezone_device_datakcompactd_max_ordernr_active_requests_shared_tagsdst_regpeaks_locki_flctxbase_indexBPF_GRAPH_ROOTdefparamobject_sizefs_privatesaved_errfred_csq_lockdep_mapmap_releasefault_flagprobe_addrkprojid_tptracer_credtlb_gencgwb_domainio_lock_cls_keypage_mkwriteBPF_CGROUP_INET6_GETSOCKNAMEkobjectaudit_ttyfs_value_is_stringvariable_test_bitdebug_idrtpoll_triggersmce_ripvstatfsctl_table_headertag_setinline_keyn_cookiesnumab_stateattach_prog_fdremovableaux_lenPTR_TO_BTF_IDfeatureson_listPTR_TO_SOCKET_OR_NULLvolume_keykgid_ton_cpumanaged_pslotsFAULT_FLAG_VMA_LOCKBPF_TASK_ITER_ALLfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistmap_update_batchREQ_OP_DRV_OUTstoragesclass_groupsxa_sibsBPF_MAP_TYPE_BLOOM_FILTERpsi_group__refcount_sub_and_testnuma_nodeoffsetsi_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexit__compiletime_assert_10errseq_t__compiletime_assert_12__compiletime_assert_13__compiletime_assert_14ioctx_tableVTIME_SYSchangedbdi_listPTR_TO_MAP_VALUEdata_size_outdebugfs_mutexwatch_listaudit_contextpp_ref_countsysfs_opsfs_value_is_filesequential_iocb_accesstime_namespacebypass_spec_v1_large_mapcountsda_is_staticformatftopenclavebi_privatecreateiattrrseqprog_fdnfdssigvalvma_lockmax_discard_segmentsperf_event_listgetgeoget_reserved_spacenon_seqstack_refcountinvalidate_lockbmapNETFS_DIO_READERR_PTRerrorkey_payloadtimer_rand_stated_realancestorstot_write_bandwidthexpiry_activeBPF_CGROUP_UNIX_SENDMSGoldp__compiletime_assert_47__compiletime_assert_48__compiletime_assert_49dqi_max_spc_limitvm_numa_eventexception_table_entry_erofs_printkvirt_boundary_masknr_isolate_pageblockBPF_PROG_TYPE_LWT_INevent_countnr_to_writearch_atomic_dec_and_testfs_context_purposeis_extendedfallocateiputi_spc_warnlimitbuddy_listi_ino_timelimit__compiletime_assert_50check_object_size__compiletime_assert_52__compiletime_assert_53node_present_pages__compiletime_assert_55__compiletime_assert_56__compiletime_assert_57i_mmap_writable__compiletime_assert_59mems_allowedNETFS_DIO_WRITEtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderprog_idold_subtree_controltimewakee_flip_decay_tsmemcg_vmstats_percpuerofs_fscache_submit_bio__compiletime_assert_60__compiletime_assert_61s_max_linksnr_wakeups_sync__compiletime_assert_64erofs_fscache_meta_read_folio__compiletime_assert_66kallsymskcompactdprevdma_parmsfs_structclockiduint32_targ_startbpf_insnblocksfunc_info_rec_sizeset_infofileattr_getvectorFORTIFY_FUNC_strncpyBPF_MAP_TYPE_STACK_TRACEFORTIFY_FUNC_strcat__bi_cnttimer_listrefaulted_oldEROFS_NO_KMAP__fscache_unuse_cookieprog_array_member_cntd_ino_warnssize_poke_tabhiwater_vmbtf_field_graph_roottracepointcompound_headia_vfsuidunaccepted_pagesinsn_cntlink_updatecurr_folio_orderBPF_MAP_TYPE_LRU_HASHlrugen__kernel_ssize_tfunc_info_auxorig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writeBPF_NETKIT_PRIMARYi_rt_spc_timelimitbd_nr_sectorsmarksmax_ctx_offsetseq_priv_sizebpf_map__list_del_entry_validerofs_fscache_meta_aopsconstant_test_bitqf_nextPG_arch_1WB_REASON_BACKGROUNDbpf_offload_devrangesmemory_eventsiommu_mmBPF_PROG_TYPE_LSMblk_features_tused_btfscutimeem_tablepersonalityget_stateline_info_cnttask_sizes_inodes_addrbinfmtirq_domaincoherency_lensigned charpersistent_keyring_registerprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signousercntpacked_inodexas_resetenabledBPF_PROG_TYPE_SK_LOOKUPfixupsfile_operationsbpf_prog_typeKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tagavg_last_updateBPF_MAP_TYPE_UNSPEC_killktime_tchildren_low_usagesymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387iterd_ino_timeravx512_timestampexpand_readaheadfuncsend_datapercpu_pvec_drainedsubtree_controlsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writersPG_foreignrange_startper_cpu_nodestatsNETFS_FILL_WITH_ZEROESsetleaseBPF_MODIFY_RETURNpacct_structmust_resumescanned__fscache_begin_read_operationlong intBPF_TRACE_KPROBE_MULTIpresent_pagesfile_lock_contextusagesiglockmap_pollper_cpu_pagesetstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ssattach_flags__kmalloc_indexvolumepoke_tabnr_iosprintk_index_sizesymtabtimes_prevfree_diskbpf_verifier_envrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegiderofs_fscache_io_putdq_hashput_superFS_CONTEXT_RECONF_PARAMSnext_addrpushable_dl_tasksf_flagscodetagprocnamemq_sysfs_init_doneprogmap_fd_sys_lookup_elemmark_dirtylinfo_idxnr_dying_descendantserofs_fscache_relinquish_cookienum_srcu_structsbdi_writeback_pad1_kobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEbalanced_dirty_ratelimitbatch_sizef_inode__kernel_timespecmap_fd_get_ptr_pad2_erofs_fscache_iocancelled_write_bytesac_tgidsrcu_usagebitmapacpi_match_tablememcgbw_time_stamptotal_blocks_sigvalBPF_PROG_TYPE_XDPmax_perf_stateBPF_PROG_TYPE_CGROUP_SYSCTLbvecnameidatalatency_recordmod_kallsymsmnt_idrefaultsislotbitsdepth_pad3_wait_queue_func_tcnvcswnuma_next_scanimageMIGRATE_SYNC_LIGHTnr_migrations_colderofs_fscachelistsPG_readaheadcheck_eventsssize_tsr_locknetfs_opsiopl_emulmax_write_zeroes_sectorswork_structdesc_lensb_sizeflocktask_io_accountingmremaps_writers__fortify_panictracepoint_funcargventryfree_cached_objectsBPF_CGROUP_UDP6_SENDMSGREQ_OP_DRV_INworkqueue_structprepare_readblk_mq_tagsbtf_field_kptrreversePG_has_hwpoisonedpr_opspi_lockBPF_RB_ROOTreg_typelru_gen_mm_statefeature_incompat___orig_eipprobestubsectorget_timedata_outmm_cid_activeBPF_CGROUP_ITER_DESCENDANTS_PREelemsizedirty_paused_whenBPF_PERF_EVENTblkcg_cssmaxlensuspend_noirqrelease_agent_pathNETFS_READAHEADclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEBPF_CGROUP_UDP4_RECVMSGsrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpysubmittedqueue_depthzone_idxdom_cgrpwpcopy_delay_totalgfp_maskpi_state_listrcu_segcblistsubvolfs_parameterusederofs_fscache_read_io_asyncBPF_PROG_TYPE_SCHED_CLSfree_inodeprojid_tmg_tasksuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infortpoll_trigger_locksrcu_structrlim_curnofaultmm_countdrv_groupsstackshrinker_run_nooffline_waitqmap_ifindexmnt_nsac_ppidfunctionwb_idki_flagsbvec_poolbd_start_sect___GFP_IO_BITsrcu_have_cbsaux_data_lend_in_lookup_hashmax_sectorssgidinitial_nsFREEZE_MAY_NESTREFCOUNT_ADD_NOT_ZERO_OVFbucket_idrb_leftmostthread_infop_lensuspended_timecgroup_rootdatastrtabtty_old_pgrpold_dom_cgrpdl_throttled__compiletime_assert_389i_rwsemrtpoll_states__MAX_BPF_PROG_TYPEget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextdirect_bvopc1BPF_MAP_TYPE_RINGBUF__int128 unsignedpcountdst_trampolinerestore_noirqdma_pad_maskki_filpcap_ambient__UNIQUE_ID_x_664dma_configurePG_partially_mappedruntime_errormdevatomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_foliobpf_func_info_auxsplit_queue_lennr_events__MAX_BPF_ATTACH_TYPEWB_REASON_SYNCiommubi_opfold_prog_fdiov_iter_truncateprivatehlistcftsst_infoclock_listmap_countavailsp_regexit_signalsa_restorerbpf_run_ctxswap_plugsplice_pipemap_mem_usageblk_mq_tag_setmax_rdonly_accessblk_independent_access_rangess_lock_keyBPF_SK_SKB_VERDICTmg_nodesubmit_extendable_tokswapdsrcu_gp_startopentime_nsit_real_incrwaitqmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmem_cgroup_idKMALLOC_RANDOM_ENDfc_logmodslast_pageslotstqheads_activesym_vvar_startMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalorig_progdeadremap_file_rangeac_commnr_hangskcompactd_highest_zoneidxgid_twake_cpuchainedio_uring_taskinsnsipage_offsettask_worksmemory_failurerb_root_cacheds_copdd_key_truehres_activebpf_func_infobpf_raw_eventsdq_dirtydl_deferbug_listdirect_completenbp_rl_startidr_rtlegacy_namexa_locklist_addfxregs_statememcg_cgwb_frnlog_levelload_weightoffdevkuid_tarch_datafpstateshrinker_infoblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateuts_nsbpf_prog_array_itemis_late_suspendedsysvsemucountvm_stat_diffkmemcg_idignore_childrenlru_gen_mm_walkcleaned_to_pflagsrestore_earlyclock_mutexfs_supersvalue_btf_idPTR_TO_PACKETdom_csetevents_local_fileroot_csetdqb_bsoftlimitpendingmax_dev_sectorsf_task_workFSCACHE_COOKIE_STATE_WITHDRAWINGlru_gen_memcgusernspm_subsys_data___GFP_NORETRY_BITiowait_countissue_readsysfs_registeredset_read_onlymemswthrotl_datas_kobj_unregisterBPF_PROG_TYPE_EXTdma_io_tlb_memBPF_NETKIT_PEERstringread_countpost_attachstorep_logd_ino_hardlimitforklruvecoffloadfutex_offsetvmpressureprog_attach_flagslong long intbpf_ksymatomic_flagssysvshmtimer_expirestrace_evalsactive_baseshierarchy_idearly_initmprotectac_exitcodesecuritysaved_dst_prog_typexmm_spacefscache_acquire_volumem_flagsactivatefunc_cntf_pos_lockerofs_sb_lz4_infoi_fieldmaskREFCOUNT_ADD_OVFtls_arrayownerfieldsacct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITkstrdupiter_seq_infodepends_ondomain_dataidr_nextBPF_PROG_TYPE_TRACINGlinelinkstart_timekernfs_nodedev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchreschedule_countvfsmountextable_basenoinstr_text_sizeattributesset_child_tid_overruntmpfilercu_read_lock_nestingtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugrefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tUTF8_NMAXfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqia_vfsgidsize_tcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workatomic_long_tpreallocclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicdelayed_callmax_nr_cid_statusd_sibbin_attributepercpu_counternuma_pages_migratedgsindexexpires_nexti_io_listf_epsrcu_barrier_seqreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tHRTIMER_BASE_BOOTTIMEclass_srcu_is_conditionalnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionHRTIMER_BASE_REALTIME_SOFTstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registers_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrstate_in_sysfstty_structUTASK_SSTEP_TRAPPEDbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollnr_wakeups_idleio_cqelf64_symlatch_tree_nodedestroy_work__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerma_external_lockuid_tflush_requiredsum_block_runtimepgmapdq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditional_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitnuma_groupdescriptionclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinei_inodyndbg_infoindexthread_headmap_typef_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenHRTIMER_RESTARTMOD_MEM_NUM_TYPESsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxcpu_basedquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_events_sys_privateUTF8_NFDIinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authHRTIMER_BASE_TAIvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherscompletionsw_reservedUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treequota_onvm_operations_structbin_attrs_newiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdatanrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupwake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlinedup_xol_worktotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramd_spc_softlimitreported_split_lockgfp_tseccomp_filterstimei_mmapthaw_superd_lrusignal_structperf_event_mutexcrcspgdval_tSB_FREEZE_WRITEsetattrf_mappingnoinstr_text_startbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activei_opldt_usr_semkobj_ns_type_operationsDQST_FREE_DQUOTSseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tis_dirty_writebacktrace_bprintk_fmt_startkstatfssitesptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutex_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupseqcount_spinlock_ti_wbclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedpagetrc_holdout_listget_inode_usagenormal_priodestroy_inoderelease_folioi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inameHRTIMER_BASE_MONOTONIC_SOFTi_mappinginblockrmidrseq_siglimit0limit1dqi_max_ino_limitmigrate_modeftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksd_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrDQST_SYNCSstack_vm_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalcg_listsrcu_barrier_completionrw_semaphoremnt_sb_ddebuginfofiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypeinit_modulemembarrier_statepage_poolinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_mempathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwrcu_syncvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstateueventlock_countrefcount_tplugsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttableslist_headtgidwrite_protect_seqcompat_robust_list_head_tids_inode_wblist_lockend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutask__UNIQUE_ID_srcversion473sched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextgpl_symsseq_showswait_queue_headblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfds_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceobjcgnodeDQST_READSvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvstatic_prioshrinkerdl_yieldeddqi_formatexec_update_lockDQF_PRIVATEDQF_SYS_FILE_Bl1d_flush_killi_versionprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symboltv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskSB_FREEZE_PAGEFAULTactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlock__rcu_headmce_vaddrquota_offdq_inusedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmod_tree_nodef_sb_errwritepagecodegtimesigactionclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listktypelockrefsrcu_struct_ptrsmm_structvlagi_uidspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesvm_mmmod_mem_typedebugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipMOD_INIT_RODATAqc_dqblkmmappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCi_write_hintfxsaveprocess_keyringlist_op_pendingllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyioveci_private_lockVTIME_IDLEstatic_keys_magicdl_overrunDQST_ALLOC_DQUOTSd_parentpayloadac_minflti_sbd_sbcommPIDTYPE_PIDatomic_write_segments_maxatomic_openreadahead_control__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupblockedi_securitystats_lockD_REAL_DATApt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colorbitsiopriocap_inheritablegp_waitlookupDD_CLASS_TYPE_LEVEL_NAMESvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vec__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATElf64_Symd_automountparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcestack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkDQST_CACHE_HITScmaxrsstimer_slack_nspolicysharedd_real_typelookahead_bandseq_startraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamerun_delaytailslinenoget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseattrscpumask_tswregs_statedqb_isoftlimitorig_axsched_rt_entitytimerqueue_nodeil_weightmem_dqblknr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pause_sigchldreservedlatency_record_countcgroupsprev_scan_seq_DQST_DQSTAT_LASTrcu_usersoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockUTF8_NFDICFcpu_bitmapstatic_call_keyutil_estucountsMOD_RODATAqc_statesoftirq_next_timercheck_flagsswp_entry_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aMOD_INVALIDmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalautogroupnr_threads__i_nlinkpushdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magicfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsMOD_INIT_DATAnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_infoshared_pendingi_gidmin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idHRTIMER_MAX_CLOCK_BASESkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsxa_flagsbin_sizegrphid_spc_timerjump_entriesassoc_array_ptrsuper_block_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_array__UNIQUE_ID_depends472mnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpref_node_fork__int128dqi_privrss_statmems_allowed_seqrefcntD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxresult_maskdquot_operationsmappinggrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizescheduledclass_raw_spinlock_nested_is_conditionalworker_privateis_relqstrma_flagsfutex_stateHRTIMER_BASE_TAI_SOFTacct_timexpd__rcu_icq_cacheDQST_WRITESsizef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tdl_server_has_tasks_frunnable_sumreal_credepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgcstimecfs_rq_uidst_spacemm_cid_next_scanac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysMOD_TEXTdqb_curinodesload__s8invalidate_lock_keyprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_marksdio_mem_alignbtime__u8is_roxlockrlim_maxruntime_deferred_listd_waitlist_lru_oneseq_stopkiocbclass_rwsem_read_intr_is_conditionalfsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeshrinker_idrootoom_reaper_listsym_VDSO32_NOTE_MASKbpf_storage__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingfsindexshstksrcu_ssp__page_1__page_2__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEi_sequencedqb_ihardlimitd_lockrefnum_bpf_raw_eventsaddr_perfi_dir_seqkqidKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typef_iocb_flagscmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagshrtimer_base_typestart_boottimevm_starts_flagsiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listhrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendings_listdqb_rsvspaceversionserialalloc_locks_dquotfolioqprev_posseqcount_spinlocks_umountis_bin_visiblesyscall_user_dispatchrcu_tasks_exit_listia_uidchildrenrb_subtree_lastbuild_idvfork_donenanosleeprt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelayquotalenf_pipei_wb_frn_historylast_wakeenextarch_spinlock_ti_mtime_nsecmmlistutf8_normalizationset_dqblkreg_offsetgsbases_quota_typesf_llisti_nlinkwrite_beginpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedHRTIMER_BASE_BOOTTIME_SOFTfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tquota_enablesched_avgntabmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextprealloc_bufprojiddrop_inodenum_trace_evalsllseeknext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeunfreeze_fsintervallast_mm_cidcookietargeta_flagstrace_overrunsession_keyringfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributerestrict_linkMOD_DATAi_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackloff_tthread_pidsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringma_locksched_delayedmodule_statelast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimemigrate_from_cpusrcu_barrier_mutexi_private_dataElf64_Halfnsproxyxol_areacleanup_modulerlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_datasignumfscrypt_keyrings_mountsuse_memdelay__state_sizethread_structcached_requested_keyenvpctimereleasesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_datasysv_semanon_vma_namefileattrDQST_DROPSlong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionali_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_ts_iflagsmce_kflagstotal_numa_faultss_countd_revalidates_opsysv_shmdq_countutf8data_tablefoliowake_entryxa_headsuidi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_lockiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_t_flagsnotify_nextshort intmynodeclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_ownerbp_regVTIME_USERsa_flagstesti_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivaltrace_event_callis_guestpoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keyGRPQUOTAi_private_listia_validi_rcuHRTIMER_BASE_REALTIMEi_atime_secqc_type_statekey_serial_tsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsi_wb_listxarray_startfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectordefault_timer_slack_nssource_listswap_readahead_info__fpstateactive_refgroup_infovdso_imagefile__user_state_sizemce_kill_meuuid_tcount_objects_stimezone_device_dataf_wb_errdefparamfred_cskprojid_tptracer_credtlb_genstorekobjectaudit_ttymce_ripvstatfsnumab_statefeatureson_listkgid_ton_cpufregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisti_mmap_rwsemwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadd_realexpiry_activedqi_max_spc_limitexception_table_entryfallocateHRTIMER_BASE_MONOTONICi_spc_warnlimitbuddy_listi_ino_timelimitSB_FREEZE_FSi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infotracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevfs_structclockiduint32_targ_startblocksset_infofileattr_getvectortimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrrenamevm_area_structsb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextiommu_mmcutimepersonalityget_statetask_sizes_inodes_addrbinfmtsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filercu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataki_posexecute_only_pkeysetleasepacct_structlong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typein_iowaitunregfuncegiddq_hashput_superMOD_INIT_TEXTpushable_dl_tasksf_flagsf_inodemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infoTT_NONEVTIME_INACTIVEcancelled_write_bytessrcu_usagebitmapmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_cold__UNIQUE_ID_name470ssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenDQST_LOOKUPSclass_spinlock_irq_try_is_conditionaloom_mmsrcu_reader_flavortv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idsrcu_structrlim_curnofaultmm_countSB_FREEZE_COMPLETEstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infodatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountki_filpcap_ambientatomic64_tanon_vmarlimread_folionr_eventsprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keysrcu_gp_startopenit_real_incrmodert_prioritymm_lock_seq__UNIQUE_ID_intree471KMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksrb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionexit_statesysvsemMOD_RO_AFTER_INITDQF_ROOT_SQUASH_Bfs_supersSB_UNFROZENdqb_bsoftlimitpendingf_task_workiowait_countstringread_countfutex_offsetlong long intatomic_flagssysvshmtrace_evalsactive_basessecurityxmm_spacef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesclass_rwsem_read_intr_is_conditionalclass_mutex_is_conditionalclass_preempt_notrace_is_conditionalMOD_INIT_RODATAMOD_TEXTclass_srcu_is_conditional_nameclass_rcu_is_conditionalclass_migrate_is_conditionallong long unsigned intNR_KMALLOC_TYPESclass_rwsem_read_is_conditionallong long intsigned charPIDTYPE_SIDclass_preempt_is_conditionalElf32_Wordorc_headerPIDTYPE_TGIDlong intclass_raw_spinlock_irq_is_conditional_descclass_local_lock_nested_bh_is_conditionalHRTIMER_BASE_MONOTONIC_SOFT__UNIQUE_ID_retpoline471class_rwsem_read_try_is_conditionalUTF8_NFDIDQST_LOOKUPSclass_spinlock_irqsave_is_conditionalclass_spinlock_try_is_conditionalclass_local_lock_is_conditionalhrtimer_base_typeMOD_RO_AFTER_INITn_descsz__u8DQST_ALLOC_DQUOTSSB_FREEZE_FSKMALLOC_NORMALDQST_WRITESunsigned int__int128class_irqsave_is_conditionalHRTIMER_BASE_REALTIMElong unsigned int__u32HRTIMER_MAX_CLOCK_BASESclass_spinlock_irqsave_try_is_conditionalclass_spinlock_is_conditionalshort unsigned intHRTIMER_BASE_TAIclass_local_lock_irqsave_is_conditionalclass_read_lock_is_conditionalelf32_noteboolDQST_DROPSclass_local_lock_irq_is_conditionalMOD_RODATAKMALLOC_CGROUPclass_rwsem_write_is_conditionalclass_spinlock_irq_try_is_conditionalclass_spinlock_irq_is_conditionalclass_write_lock_is_conditionaln_typeMOD_DATAclass_write_lock_irqsave_is_conditionalHRTIMER_BASE_BOOTTIMEn_nameszSB_FREEZE_COMPLETESB_FREEZE_WRITEclass_raw_spinlock_nested_is_conditionalMOD_MEM_NUM_TYPESDQST_SYNCSDQST_FREE_DQUOTSmod_mem_typeHRTIMER_BASE_MONOTONICclass_mutex_intr_is_conditionalclass_task_lock_is_conditionalUTF8_NMAX_nhdrPIDTYPE_PGID_Boolunsigned charKMALLOC_RECLAIMHRTIMER_BASE_BOOTTIME_SOFTcurrent_stack_pointershort int_note_18_note_19utf8_normalizationKMALLOC_RANDOM_STARTDQST_CACHE_HITSclass_irq_is_conditionalDQF_PRIVATEPIDTYPE_PIDDQST_READSMOD_INIT_DATAclass_raw_spinlock_try_is_conditionalclass_raw_spinlock_irqsave_is_conditionalPIDTYPE_MAXcharGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackSB_FREEZE_PAGEFAULTUTF8_NFDICFclass_mutex_try_is_conditional_DQST_DQSTAT_LASTclass_write_lock_irq_is_conditionalKMALLOC_RANDOM_ENDMOD_INIT_TEXTclass_raw_spinlock_irqsave_try_is_conditionalpid_typeHRTIMER_BASE_REALTIME_SOFTKMALLOC_DMAclass_read_lock_irq_is_conditionalHRTIMER_BASE_TAI_SOFTSB_UNFROZENclass_raw_spinlock_is_conditionalkmalloc_cache_typeclass_read_lock_irqsave_is_conditionalclass_rwsem_write_try_is_conditionalDQF_SYS_FILE_Bclass_raw_spinlock_irq_try_is_conditionalDQF_ROOT_SQUASH_B__UNIQUE_ID_vermagic470__int128 unsignedMOD_INVALID/home/thomas/Documents/kernels/stagingfs/erofs/super.c/home/thomas/Documents/kernels/stagingfs/erofs./include/trace/events./include/linux./include/asm-generic/bitops./arch/x86/include/asm./include/uapi/linux/byteorder./include/trace/stages./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicesuper.cerofs.htrace_events.hperf_event.hinternal.hlist.hpage-flags.hinstrumented-non-atomic.hbitops.hfortify-string.hsuper.cseq_file.herr.hfs.hdcache.hslab.herofs_fs.huuid.hstatfs.hlittle_endian.hkdev_t.hstage5_get_offsets.hfs_parser.hxarray.hidr.hprintk.hlog2.hbitops.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hstdarg.hjump_label.hmodule.hasm.hinit.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hdynamic_debug.hmoduleparam.hbug.hcache.hpercpu.hsched.hspinlock_types.hrwlock_types.hstatic_call_types.hstatic_call.hcpumask_types.hatomic-long.hstddef.hgfp_types.hmmzone.hsysfs.hllist.hsmp_types.hpreempt.hrestart_block.htime_types.htime32.hpoll.hrange.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hprocessor.hmath_emu.hirqflags.htypes.hshstk.hthread_info.hosq_lock.hmutex_types.hmutex.hnodemask_types.hspinlock.hwait.hrcupdate.hlist_bl.hseqlock_types.hlockref.hmount.hpath.htime64.hcodetag.halloc_tag.hpid_types.hpid_namespace.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hblkdev.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hvmalloc.hbpf.htracepoint-defs.hstat.hswait.hshrinker.hlist_nulls.hkref.hmaple_tree.hrwsem.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hsysctl.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.hwriteback.huio.hposix_acl.hbacking-dev-defs.hexportfs.hxattr.hblk_types.hpoll.hfs_context.hkobject.hkernfs.hkobject_ns.hbpf.hfilter.hrbtree_latch.hrhashtable-types.huio.hbvec.hcompat.helf.herror-injection.hmodule.htracepoint.hbtf.hrcupdate_trace.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hcpuhplock.hns_common.hcgroup.hinterrupt.hu64_stats_sync.hlocal.hlocal64.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.hpagevec.hmempool.hftrace.hkernel_read_file.hsecurity.hiomap.hdax.hblkzoned.hxattr.hring_buffer.hseq_buf.htrace_seq.hperf_event.hcpu_entry_area.hhw_breakpoint.hirq_work.hperf_regs.hinit.hstring.hsprintf.hbacking-dev.hcrc32c.hrcutree.hfile.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingfs/erofs/inode.c/home/thomas/Documents/kernels/stagingfs/erofs./include/linux./include/trace/events./arch/x86/include/asm./include/asm-generic/bitops./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/deviceinode.cinode.cdcache.herofs_fs.hblkdev.herofs.hjump_label.hinternal.herr.hfs.hcpumask.hinstrumented-non-atomic.hbitops.hpreempt.hpreempt.hslab.hfortify-string.hkdev_t.hpagemap.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hcurrent.hsched.hstatic_call_types.hstatic_call.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hasm.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hwait.hrcupdate.hlist_bl.hosq_lock.hmutex_types.hmutex.hseqlock_types.hlockref.hmount.hpath.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hrwsem.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hsysctl.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hposix_acl.hxattr.hblk_types.hkobject.hidr.hkernfs.hkobject_ns.hdevice.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hmempool.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hblkzoned.hns_common.hrcupdate_trace.hcpuhplock.hxattr.hstring.huidgid.hoverflow.hinstrumented.hkcsan-checks.hkasan-checks.hfs/erofs/data.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingfs/erofs./include/linux./include/linux/atomic./arch/x86/include/asm./include/asm-generic/bitops./include/trace/events./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicedata.cdata.cfs.huio.herofs_fs.hmm.hmmap_lock.hrwsem.hatomic-instrumented.hatomic-long.hatomic-arch-fallback.hatomic64_64.hpage-flags.hjump_label.hpage_ref.hatomic.hinstrumented-non-atomic.hbitops.hhighmem-internal.hpage_64.hpagemap.herr.hinternal.herofs.hcpumask.hpreempt.hpreempt.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hcurrent.hsched.hstatic_call_types.hstatic_call.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hsysfs.hasm.hirqflags.hrestart_block.htime_types.htime32.hrange.hpfn.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hwait.hrcupdate.hlist_bl.hosq_lock.hmutex_types.hmutex.hseqlock_types.hlockref.hdcache.hmount.hpath.htime64.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hkobject.hidr.hkernfs.hkobject_ns.hdevice.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hmempool.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hblkzoned.hiomap.hstddef.hrcupdate_trace.hcpuhplock.hdax.hhuge_mm.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingfs/erofs/namei.c/home/thomas/Documents/kernels/stagingfs/erofs./include/linux./include/trace/events./arch/x86/include/asm./include/asm-generic/bitops./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicenamei.cnamei.cfs.herr.herofs.hjump_label.hcpumask.hinstrumented-non-atomic.hbitops.hpreempt.hpreempt.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hcurrent.hsched.hstatic_call_types.hstatic_call.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hsysfs.hasm.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hwait.hrcupdate.hlist_bl.hosq_lock.hmutex_types.hmutex.hseqlock_types.hlockref.hdcache.hmount.hpath.htime64.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hrwsem.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hsysctl.hstddef.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.huio.hposix_acl.hxattr.hblk_types.hkobject.hkernfs.hkobject_ns.hdevice.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hmempool.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hblkzoned.herofs_fs.hinternal.hns_common.hrcupdate_trace.hcpuhplock.hxattr.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingfs/erofs/dir.c/home/thomas/Documents/kernels/stagingfs/erofs./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicedir.cdir.cfs.herr.hfortify-string.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hsched.hstatic_call_types.hpreempt.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hwait.hrcupdate.hlist_bl.hosq_lock.hmutex_types.hmutex.hseqlock_types.hlockref.hdcache.hmount.hpath.htime64.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hrwsem.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.huio.hblk_types.hkobject.hkernfs.hkobject_ns.hdevice.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmempool.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hblkzoned.herofs_fs.hstddef.hinternal.hasm.hfs_types.h/home/thomas/Documents/kernels/stagingfs/erofs/sysfs.c/home/thomas/Documents/kernels/stagingfs/erofs./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicesysfs.csysfs.ckstrtox.hcompletion.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hsched.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hspinlock_types.hrwlock_types.hfs.hmodule.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hbug.hcpumask_types.hatomic-long.hsysfs.hllist.hsmp_types.hpreempt.hrestart_block.htime_types.htime32.hrange.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hprocessor.hmath_emu.hirqflags.htypes.hshstk.hthread_info.hosq_lock.hmutex_types.hmutex.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.hvmalloc.hspinlock.hrcupdate.hwait.hkref.hmaple_tree.hrwsem.hswait.htime64.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hxarray.hlist_lru.hidr.hkernfs.hkobject_ns.hstat.hkobject.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.huio.hblk_types.hasm.hdevice.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmempool.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hblkzoned.herofs_fs.hinternal.hstring.h/home/thomas/Documents/kernels/stagingfs/erofs/xattr.c/home/thomas/Documents/kernels/stagingfs/erofs./include/linux./include/asm-generic/bitops./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicexattr.cxattr.cfortify-string.herr.hxattr.hxattr.hinternal.herofs_fs.hinstrumented-non-atomic.hbitops.hwait_bit.hkernel.hinstrumented-atomic.hinstrumented-lock.hslab.hdcache.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hrbtree_types.hatomic-long.hfs.hmodule.hjump_label.horc_types.hcache.hsched.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hstatic_call.hstddef.hgfp_types.hmmzone.hsysfs.hirqflags.hpreempt.hllist.hsmp_types.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hseq_file.hthread_info.hrcupdate.hspinlock_types.hrwlock_types.hspinlock.hwait.huidgid_types.huser_namespace.hasm.huidgid.hsysctl.hcompletion.hosq_lock.hrwsem.hassoc_array.hrefcount_types.htime64.hkey.hcapability.hlist_bl.hmutex_types.hmutex.hseqlock_types.hlockref.hmount.hpath.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hpid.hcred.hnsproxy.hsignal.hbio.hblkdev.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hvmalloc.hbpf.htracepoint-defs.hstat.hswait.hshrinker.hlist_nulls.hkref.hmaple_tree.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hxarray.hlist_lru.hmigrate_mode.hextable.htask.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.hwriteback.huio.hposix_acl.hbacking-dev-defs.hblk_types.hkobject.hidr.hkernfs.hkobject_ns.hbpf.hfilter.hrbtree_latch.huio.hbvec.hcompat.helf.herror-injection.hmodule.hbtf.hrcupdate_trace.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hcpuhplock.hns_common.hcgroup.hinterrupt.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.hpagevec.hmempool.hkernel_read_file.hsecurity.hblkzoned.hposix_acl_xattr.hxxhash.hoverflow.hgeneric-non-atomic.hinstrumented.hkcsan-checks.hkasan-checks.hfs/erofs/decompressor.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingfs/erofs./include/asm-generic/bitops./arch/x86/include/asm./include/linux./include/asm-generic./include/uapi/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicedecompressor.cdecompressor.cinstrumented-non-atomic.hbitops.hmm.hmm_types.hhighmem-internal.hhighmem.hfortify-string.hcacheflush.hinternal.herr.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hsched.hstatic_call_types.hpreempt.hfs.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hasm.hpage_64.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hwait.hrcupdate.hlist_bl.hosq_lock.hmutex_types.hmutex.hseqlock_types.hlockref.hdcache.hmount.hpath.htime64.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hrwsem.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.huio.hblk_types.hkobject.hidr.hkernfs.hkobject_ns.hdevice.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmempool.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hblkzoned.herofs_fs.hstddef.hcompress.hlz4.hkmsan.hpage-flags.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.hfs/erofs/zmap.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingfs/erofs./include/linux./arch/x86/include/asm./include/asm-generic/bitops./include/trace/events./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicezmap.czmap.cinternal.hfs.herr.hunaligned.hbitops.hinstrumented-non-atomic.hwait_bit.hkernel.hinstrumented-atomic.hinstrumented-lock.herofs.hjump_label.hcpumask.hpreempt.hpreempt.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hcurrent.hsched.hstatic_call_types.hstatic_call.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hsysfs.hasm.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hwait.hrcupdate.hlist_bl.hosq_lock.hmutex_types.hmutex.hseqlock_types.hlockref.hdcache.hmount.hpath.htime64.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hrwsem.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.huio.hblk_types.hkobject.hidr.hkernfs.hkobject_ns.hdevice.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hmempool.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hblkzoned.hiomap.hstddef.herofs_fs.hrcupdate_trace.hcpuhplock.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingfs/erofs/zdata.c/home/thomas/Documents/kernels/stagingfs/erofs./include/linux./include/linux/atomic./arch/x86/include/asm./include/asm-generic/bitops./include/trace/events./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicezdata.czdata.cspinlock.hfind.hlockref.hatomic-instrumented.hatomic-long.hatomic-arch-fallback.hatomic64_64.hslab.hlist.hpage-flags.hjump_label.hinstrumented-non-atomic.hbitops.herr.hpagemap.hinstrumented-lock.hinstrumented-atomic.hmm.hpage_ref.hatomic.hfortify-string.hhighmem-internal.hcompress.hinternal.hmm_types.hmmzone.hpreempt.hparavirt.hirqflags.hrcupdate.hworkqueue.hbio.hfs.hhighmem.hxarray.hsched.hcompletion.hkernel.herofs.hcpumask.hpreempt.hoverflow.hbitmap.hcpuhotplug.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hcache.hcurrent.hstatic_call_types.hstatic_call.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hparavirt_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hasm.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstddef.hgfp_types.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hpoll.hpage_64.hrange.hptrace.hmath_emu.htypes.hshstk.hseq_file.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hwait.hlist_bl.hosq_lock.hmutex_types.hmutex.hseqlock_types.hdcache.hmount.hpath.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcred.hkey.hnsproxy.hsignal.hblkdev.hiocontext.hcgroup-defs.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hrwsem.hworkqueue_types.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hsysctl.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hblk_types.hpoll.hkobject.hidr.hkernfs.hkobject_ns.hdevice.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hmempool.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hblkzoned.herofs_fs.hkthread.hpsi_types.hu64_stats_sync.hbpf-cgroup-defs.hns_common.hcgroup.hinterrupt.hrcupdate_trace.hcpuhplock.hpsi.hsprintf.hcacheflush.hcacheflush.hspinlock_api_smp.hbitops.hinstrumented.harch_hweight.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingfs/erofs/zutil.c/home/thomas/Documents/kernels/stagingfs/erofs./include/linux/atomic./arch/x86/include/asm./include/linux./include/asm-generic/bitops./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicezutil.czutil.catomic-instrumented.hatomic-long.hatomic-arch-fallback.hatomic64_64.hslab.hspinlock.hlist.hcpumask.hbitmap.htopology.hmm.hpage-flags.hjump_label.hpage_ref.hatomic.hmmzone.hinstrumented-non-atomic.hbitops.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hcurrent.hsched.hstatic_call_types.hpreempt.hfs.hmodule.hasm.hinit.hmem_encrypt.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstddef.hgfp_types.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hwait.hrcupdate.hlist_bl.hosq_lock.hmutex_types.hmutex.hseqlock_types.hlockref.hdcache.hmount.hpath.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hrwsem.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.huio.hblk_types.hkobject.hidr.hkernfs.hkobject_ns.hdevice.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmempool.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hblkzoned.herofs_fs.hinternal.hgfp.hspinlock_api_smp.hoverflow.hbitops.hinstrumented.harch_hweight.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingfs/erofs/decompressor_lzma.c/home/thomas/Documents/kernels/stagingfs/erofs./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicedecompressor_lzma.cdecompressor_lzma.cspinlock.hhighmem-internal.hmm.hkernel.hcpumask.hbitmap.hslab.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hxz.hsched.hstatic_call_types.hpreempt.hfs.hmodule.hasm.hinit.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hpage_64.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hwait.hrcupdate.hlist_bl.hosq_lock.hmutex_types.hmutex.hseqlock_types.hlockref.hdcache.hmount.hpath.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hrwsem.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.huio.hblk_types.hkobject.hkernfs.hkobject_ns.hdevice.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmempool.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hblkzoned.herofs_fs.hcompress.hinternal.hspinlock_api_smp.hbitops.harch_hweight.h/home/thomas/Documents/kernels/stagingfs/erofs/decompressor_deflate.c/home/thomas/Documents/kernels/stagingfs/erofs./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicedecompressor_deflate.cdecompressor_deflate.cspinlock.hcpumask.hbitmap.hhighmem-internal.hmm.hkernel.hslab.hzconf.hzlib.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hsched.hstatic_call_types.hpreempt.hfs.hmodule.hasm.hinit.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hpage_64.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hwait.hrcupdate.hlist_bl.hosq_lock.hmutex_types.hmutex.hseqlock_types.hlockref.hdcache.hmount.hpath.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hrwsem.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.huio.hblk_types.hkobject.hkernfs.hkobject_ns.hdevice.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmempool.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hblkzoned.herofs_fs.hcompress.hinternal.hspinlock_api_smp.hbitops.harch_hweight.h/home/thomas/Documents/kernels/stagingfs/erofs/fileio.c/home/thomas/Documents/kernels/stagingfs/erofs./include/linux./arch/x86/include/asm./include/asm-generic/bitops./include/linux/sched./include/uapi/linux./include/trace/events./include/linux/atomic./include/uapi/asm-generic./include/asm-generic./include/vdso./arch/x86/include/asm/fpu./include/linux/devicefileio.cfileio.cbio.hpage-flags.hjump_label.hbitops.hmm.hinstrumented-non-atomic.hcurrent.hioprio.hsched.hrt.hioprio.hpagemap.hminmax.hslab.herr.hbvec.huio.hthread_info.hhighmem.hhighmem-internal.hfortify-string.herofs.hcpumask.hpreempt.hpreempt.hpage_ref.hatomic-instrumented.hatomic-arch-fallback.hatomic.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hstatic_call_types.hstatic_call.hfs.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hasm.hirqflags.hrestart_block.htime_types.htime32.hpage_64.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hwait.hrcupdate.hlist_bl.hosq_lock.hmutex_types.hmutex.hseqlock_types.hlockref.hdcache.hmount.hpath.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hblkdev.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hrwsem.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hkobject.hkernfs.hkobject_ns.hdevice.huio.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hmempool.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hblkzoned.hinternal.hrcupdate_trace.hcpuhplock.hcacheflush.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingfs/erofs/fscache.c/home/thomas/Documents/kernels/stagingfs/erofs./include/linux./include/linux/atomic./arch/x86/include/asm./include/asm-generic/bitops./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicefscache.cfscache.cfscache.herr.hslab.hlist.hfortify-string.hrefcount.hatomic-instrumented.hatomic-arch-fallback.hatomic.hpagemap.hrcupdate.hxarray.hpage-flags.hinstrumented-atomic.hbitops.hinstrumented-non-atomic.huio.hmm.hthread_info.hpage_ref.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hasm.hinit.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hstatic_call.hatomic-long.hbug.hrefcount_types.hspinlock_types.hrwlock_types.hrbtree_types.horc_types.hcache.hsched.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hstddef.hgfp_types.hmmzone.hsysfs.hirqflags.hpreempt.hllist.hsmp_types.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hseq_file.hthread_info.hspinlock.hwait.huidgid_types.huser_namespace.hsysctl.hcompletion.hosq_lock.hrwsem.hassoc_array.htime64.hkey.hcapability.hlist_bl.hmutex_types.hmutex.hseqlock_types.hlockref.hdcache.hmount.hpath.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hpid.hcred.hnsproxy.hsignal.hbio.hblkdev.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hvmalloc.hbpf.htracepoint-defs.hstat.hswait.hshrinker.hlist_nulls.hkref.hmaple_tree.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hzswap.hlist_lru.hmigrate_mode.hextable.htask.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hwriteback.hbacking-dev-defs.hblk_types.hfs_context.hkobject.hidr.hkernfs.hkobject_ns.hbpf.hfilter.hrbtree_latch.huio.hbvec.hcompat.helf.herror-injection.hmodule.hbtf.hrcupdate_trace.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hcpuhplock.hns_common.hcgroup.hinterrupt.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.hpagevec.hmempool.hkernel_read_file.hsecurity.hpseudo_fs.hnetfs.hblkzoned.herofs_fs.hinternal.hsprintf.hstring.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.hfs/erofs/erofs.mod.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingfs/erofs./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/schederofs.mod.cint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hirqflags.htypes.hshstk.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hquota.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.herofs.mod.c/home/thomas/Documents/kernels/stagingscripts/module-common.c/home/thomas/Documents/kernels/stagingscripts./include/uapi/asm-generic./include/linux./include/linux/sched./include/uapi/linux./arch/x86/include/asm./include/asm-genericmodule-common.cint-ll64.htypes.hirqflags.hpreempt.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hpid_types.hhrtimer_defs.hslab.hunicode.hquota.hquota.hfs.helf.hmodule.hasm.hmodule-common.cint-ll64.h`2U2SUS/T/TTTVVVVUSTSTS S UUTPTPTsQQ5Rq/Fqq/Fqq/FqqqqQR Q T U Q T U qD% tD% T q  t   u P S PS%P%(S(0P0GS:) :) :)0:)B<$:) USUUnV&\!\)U)VUUVSS&\!\UVUV!P!SS!P!SS$ $ $ $ $   1h0ow0CPjqP H H h1ow1 H 1PP0 P  S,U,cUcjUKSKPUQRSRXu&V!VUOUTJSJOTQOQTJSJOT$U$SUSS%UllU UV]\\]]T\\\\\"U"-S-4U45U5PSPXUXSUS\!?\D\\P$P$^V^ePegViPPPPxUx S U SStTt ~ T T ~T~T~T~~+T+]~]jTj~T~(P PP+~ V VV0PPP~P~P P  ~5MPMV~hm_  SS S SSSSS$S,YSzSSSS\|~|~ \\\,=\z\|~\|~\\ p    $,:p:=*P*__ _ _ ___$_,:P:=_zP____H H PP~0~   ~ ~ ~ P ~ 0~~ ~ #P#$~,=  P    ~  P\&\\U&^^&@@&@@PQ PP#@#S#@  @@@ 8nS S S S SSn g\ \ \ \ \\0] ] ] ]8_VpPp_PP_P_00PP0P~0P0P~ P 0 00\ SS } Pp } 1P } 1P R8080008_VpPp__P_ 0 0 868666 0 1SS SSSSssssSS__#R#N~ P C^P^)^~P~~[00)0 P C^P^)^ R ~  _SSsVvv0PV-SSS SS%PPPPPJSS7]]7\\7%%7%%PQPP SPPP*U*eSejUjSP -PS p $ &UUTTQQRRUUTTQQRR U U T T Q QUSUSUSUSU<T} $ &} $ &##*(} $ &)    PP P >} $ &} $ &##*(} $ &)     QQ Q s $ & PP P >} $ &} $ &##*(} $ &      88 8PPU0S01v15t56U6DS#V#'T'(UH(6VU0S01v15t56U6DSU tv BUPQUqPQUqH H   U uU U uU:U:ZUZUTTQTTT U U T T Q Q R R X X X XX 4 8! R R<>R*34*38@ Q Q[]QIR8_ T Tz|Thq8UUTTQQRRXX X XX 1 8! R R<>R*34*38@ Q Q[]QIR8_ T Tz|Thq8 U U T T Q QQQQ 1 8!TT<>T*38QUQSUSYTY\TT\)U)SUS1T1\TT\)U)SUS P `U]] xL  T U4Y]dUd\UU\lTl_TT_hQhSQQSpRp^RR^pXpwX0U0\UU\8T8_TT_4Q4SQQS<R<^RR^<X<wX0U0\UU\ P UP]]PLP]]TQRXU4Y]^U^SUSfTf]TT]bQb\QQ\jRj^RR^,U,SUS4T4]TT]0Q0\QQ\8R8^RR^,U,SUS P tUP__84P__  T Q RU4Y_dUdSUSlTl_TT_hQh^QQ^pRp]RR]pXpwX0U0SUS8T8_TT_4Q4^QQ^<R<]RR]w0U0SUS P mUP\\0,P\\  T Q R U4Y\UUU]U]U]]T]\T\T\YQYSQQS)U)]U]U]1T1\T\T\SQS)U)]U]U] P UU^^844  T S U&Y| \RX\p1 3 \ 3 \ 3 \^QUQ\UU\YTYSTS)U)\UU\1T1STS)U)\UU\ P U]]($  T U&YSX SQ]LUL\U\U\PTP^T^T^PQPQQQPRPwRU\U\U\T^T^T^QQQQRwRU\U\U\PoZo]]]S T^T RR  QQQ 00__q(_  \3PU:# Q:: : : : Q  8]*U*SUS;T;\TT\UZSZbUbzST]\]bTbnTnz\UZSZbUbzS P 10 SYfSPUaP  \109U9VUVNTN_TT_NQNSQQSR]R]NXN\XX\UVUVT_TT_QSQQS]R]X\XX\UVUVLP]0VV PP_S]\]04U4SUSETE^TT^EQE\QQ\R]R]UnSnzUzSTu^uzTzT^Qq\qzQzQ\s]szRz]UnSnzUzS4P E0 Sq~SPmyP  ^ \ ]E09U9SUSJTJ_TT_JQJ]QQ]R\R\JXJVXXVUdSdrUrSTm_mrTr~T~_Qi]irQr~Q~]g\grRr\eVerXrVUdSdrUrS*P ;0 SivSPeqP  _ ] \ V;0.U.\U\DTDVTVTVDQDSQQSU\U\TVTVTVSQSU\U\gPPx00\\ PPVSx00v V=?Vq1 3 V 3 V 3 V*U*VUV?T?STSUVUVTSTSUVUVP 0VV PP  S0SX SU8U8}V}UVUJTJ_T_T_JQJQQQR]R]UMVMUVUT_T_T_QQQQ]R]UMVMUVU P CVVV PP %__ %]] %QQ %00!^^^ Uv QS    Q  8US$U$MSMRuоRSUTSTQSQus U#A IsINUNOU#Aus U#x IsINuȿNOU#x V;V,P#U#.S.<U<SuоUS T T#Q#Qu*s*8U#A8sUU#Asu*s*8U#x8suȿU#xsVVV9PU^S^cuоcdUdeSekUkSTTQQuZsZ_U_`U#A`asagU#AgsuZsZ_uȿ_`U#x`asagU#xgsLVQSVXqVPLSPUS$U$\S\auоabUTbTQbQus U#A XsX]U]^U#Aus U#x XsX]uȿ]^U#x VJVPU$S$0U0SuоU T TQQu s ,U#A,sUU#Au s ,U#x,suȿU#x VoV2PUS$U$VSV[uо[\UT\TQ\Qus U#A RsRWUWXU#Aus U#x RsRWuȿWXU#x VDVPUS$U$[S[`uо`aUTaTQaQus U#A WsW\U\]U#Aus U#x WsW\uȿ\]U#x VIVPU%s%,UT3V3<TSsh$SPS)U,4s4DU)T)K^KZT)Q)K]KZQ)R)K\KZR)X)KVKZXS-sh-4SPS#U&.s.:U#T#A]ANT#Q#A\ANQ#R#AVANRS%sh%,SP S*U-5s5EU*T*L^L[T*Q*L]L[Q*R*L\L[R*X*LVL[XS.sh.5SPSU"*s*3UT:\:ETQ:V:EQS sh 'SP SU%s%,UT3V3<TSsh$SPS#U&.s.:U#T#A]ANT#Q#A\ANQ#R#AVANRS%sh%,SP SUbuxb~U T bQb~T U U T T Q Q R RRRR 4 8!QQ<>Q*38@TT[]TIR8U UT TTTT 8UqXqyUyXTUTQqPqyQyP$R$qTqyRyT X XQUQUQ]UFZNZ5r1)G|r1)t urZZz ZZ zDUDUUDTP?DPD_P_P _ U ___000P_P___ _ _ ___ppu 0  0 0 0   0 ^ 0 0     ^P_P_K1 00PPP p   p   p 6161P pP____ _ _ _ _______]]]] ] ] ] ]]]]]]]\\\\ \ \ \ \\\\\\\uPTQuwww w w wwww00T00 0 T 0 0 0 T00000P^^^^^P ^ ^ ^ ^ P ^ ^^P^^ ^kRkwRR s ~"Rw R s ~"ww8R8ww00w00P w 0 0wPPwSSSS S S SSSS$PPP PXSX\P\wwSwS S Q w w S w S wwSwSSQw 0 000 0  0 0 0   0 00  000O_O\PP P_ T_ _ r T__|TQe__e^^wT wL" wL"e_H___ __P_ T__r__r  T Q{^{ww^^0000+P+wwPPw@ 6666@1"X"ywwXX ~ @@@@    @@@@    XXX ~ @@@   888PQ Q T @x T    T @x T    Q Q T T     8 8PS' s8% ss<% !PQq;;q99 Q 0 9q;;q99q;;q99H<.<.<.<.001PPpp(# P uUSUUSUUSUSTTPTTTPTTPQQQQQQVVuVV PPPvHUUUUUTSTSTTSUTSS@I$@I$TSSVTSQQ qq qq r10)qqqq  UUUUUUUUUUTTTTTTu#(u#(u#(uT$U$%U$T$%T@TUTUUp|U|UpTUT!!U!!U!!U!!U!!T!!T!!T!!T!!Q!!Q!!Q!!Q!!R!!R!!R!!R!!uHUUUTTTQQRSRSRSXXXYYYPPPPPqr"PUYUTZTQ\Q\RVRVRVRX_X_YYPPSPSSPS^^ 00  Q0  QU  ~U ~~  QU ~~ ~~  QU ~~ P0QQ00~U~~~^^^TTT111~U~~^^^Q~QQ Q^PP !U!!U T !T !Q T !qx! u( u( u( u( Q T u( Q T  u(  Q  T P  !Q T !qx! R u( u( u(UVUUVUVTSTS\\P_P_P]P]_P]PP( r $( r $SSP]]USS__UUSUST\TT\]]usUHsXVVVTTPXXP000P0 1sb $1r $1r $v s"}1!#|( s"}1!#X00USST\T\1 00PPP p   p   p 11PpPSSS\\\ssss(t2)t2)&q1r$1 !#r &t2)*s11r$1 !#r &t2)&1r$1 q!#r &t2)SSTSYU^]]TT11U]]Q}QQ]P00SS\\VV100PPP p   p   p 11PpPP U V U U V U V U V U UT \ T T \ T \ T T \ T \Q ^ Q Q ^ Q ^ Q ] T<% ] T<% ]0S P S 0 P P P 0S S P S SP P P pS S P S 10 0 6 P 6 P 6 P QS P P P] ] ] ]S P P P S P P P S P P P   6 6 6 6   S P P P  6 6 6 6  S P P P 6 6 6 6 S P P P U v ] v P S ] S S S  6  S  6  S 6 S ] A  A  A : : :  6  6  6USUSSUUsUsPPPUUs1006U6U6UP u4u4u4UUTT Q Q T T t U U U U U T P T P T Q T Q T Q T R Q R Q R Q U U U T P T P T T X X X X P T T p  U V U U V T S T S Q Q Q R Q P P U U V U V T S S Q Q Q R Q 1  0 0 P P P p   p   p   1 1 P p P UTVUV U U V UT T T TQ ~ Q ~R ~ R ~P P Z P Z PPV    P P PR ~ ~ RQ   Q1 [ ~ [ [ ~ 1_ \ \ _0 ] R ] ] 00 V V R 0 P P Z P U U z ~ u $ &32$p"# ~ z ~ R v}v } ,( R R v}v } ,( R sq"0.   ] ] V V V       R Q R R ZU\U\UUT^T^TTNQN4R4RVPVR0___0dgpgP~~P~Pd0]]S]]0d0VVSV0d ~~Y~ DRTPQPYYYY Y~Ty ~y ~Ty ~TQ~QQQ} Sv}v } ,(SSv}v } ,(SSZZZ]]]]VVVSRSS~~P~u]U]UUT\_T_\T\T__fVf~~~~~>Z>6U6"]"@P@V v *<*<0VV0 00~0 00*1*S00SS00]]"P"X\\PX~X\\Gq Gu q VTVSSSSK ~#P}s^s*<P$X$\\\\"S"$]$}t]}t]}t}t$u $T$SSSSVVVVYA~Y~~RA~R~~u^^^^^P#Qi}Q U *^^^ Q *~~~*   2   PPP_^Q}ty~[,U,GU S u/S/4u}0U0~V~UVU S Ts}TW|}\ys}y||}P6\\ U u@U u} u}U U]~UU]~U]~)T)STSQQQQQQ>R>VRV^U ^08\\\P<>PPPHUH]~UU]~U]~  ^+^  T+T  P+PP0@Q@P0@Q@P0@Q@TUT`U`qUq}U}UUQTQ`T`nTn}T}TTQXRX`Q`uRu}Q}RQTu}T`U `qu}q}U }u}U QTQ`T`nTn}T}TT0"P"'t $ &u" =RPZpPu}"*u}X"*XP#PP"S"1P1ASAFP U V !U!!U!!V T !T!!T!!T Q !Q!!Q!!Q S!!P!!S ]!!] P S P!!P!!S!!P!!S 0 P \!!0!!\!!0!!P 0!!0 P \!!P S  USUSVVPP00P0 00___0PP u4$ v4$ u4$ v4$ P}pPPPPUUV0SPsU_U_T^T^QSQSQPQQPSPSPSP0\\_USUST\T\TTQVQVQVQQR_R_X~X~X~XXPPP~P~PPpOsUHs^^^UV V  U S U S 8 U T \ T \ T T Q _ D _ D Q t | TH | TH t ] ] ] ^ ^ ^ 0 V v V V 0  ß P  ß P  ß PUVUUV8V^^^S0__  R~PuUtTs   ssxS~~1x|P|v $ & "v"T]  PU S U Sp  $Pq p ~"# ~"# ~"#P ] P ] ] P0 V 0 V T0 \ 0 \ PRu#P ] ] ]                         ]   8 v  v  v                          v   8PquU0] ]]uU] ]T U_@8UT\TS0VV^^PT ss(S~~1(|vP]     ]   8PUPUTTQUQURQRQXRXRYYXP^U^cUUSUSusUHs0VVPs(s(00V0V0 0 00 00PsXP4 up4 u2$p2$u2$p2$ 0s@0s@ 0 s@? s@?s@ ? s@0s@0s@0s@?s@?s@ ? s@ ? s@SPPP0s@0s@ U _U_U_U_UU T P TT Q ]^Q]^Q]Q] t p THt Q T,2$# Q VVV PPP0# q"#3!#U#0# q"#3!# SSS(U#( PP T P TPP0,$0s3%s3%#'s3%#UTVUVUVUVTTTSSp_pw1%w__0pSpts~SsSS0P]0 ]0P0"s3$"w~s3$"~s3$"PL^Zy^PPPS/U/7V770,Q20Pp`U]U]U]U]U])T)\T\T\TFQF_Q_Q-R-^R^VVRRRRR XXX@@*P*1U1e_Sc\c|\qr|r !Q  v  P v 1 t  t  t v  n  }  Q% % % %   }     8SS^ v,P P U >_=vs"$vs"q@<$p"uq@<$p"$q@<$p"vs"vs"UU"} $ &3$v""} $ &3$v"} $ &3$p"} $ &3$v"} $ &3$p"} $ &3$v"U^TP 5U5VUVUVU5T5TTTT u q"#<%u q"#<% u p"#<%u p"#<%u u "#<% u#u#&0&__0tr_0@0@DD0Ev s""<%np<%v s""<%v s""<%v s""<%0SSEv s"" np v s"" v s"" v s"" Q\\UQQQ^^ZZtr _ 6tr6 v#r v#rP            9 q  r PP|sn|s|sN uv u v s""   u uQ     Q   9RR P @v s""<% 3$v"v s""<% 3$v"v s""<% 3$v"IUUU@v s "~"v s "~"v s "~"IQQQPP IQQ I   I   I   I   Q 8SSUv Q  u{@<$y"v{@<$y"UU Q         Q 8vUSUSU S UTT T T~~~~~0~ ~R~~~~R~ ~/PPPP~2} ~~~~~~ ~\I0I1001111 1n0ns#1vs" 0)00s#1vs" 0) 0V # T00VVVVVv^^^:R:RR\\\\>P]PPPPP__3__~~PpVVXRXR00RXXXXX~~~~~~~~~Vs#1vs" 0)00s#1vs" 0)ZZZZZWPW# P# PBVBEvEqVVVz0'P'+p+FPz+W^We~xe^^EPE\\\PP<PT>^T^hThTTTQ'U'QUQ5R5^R^cRcRRRGQHZQs{Q{xUsQsUQ+P+/p`;[P#$U$%^%%U%%^#$T$%_%%T%%_#$Q$%]%%Q%%]#$R$%R#$X$%S%%X%%S#$Y$%Y$$P$%V%%P%%V U !V!!U!!U!#V T !S!!T!#S Q !]!!Q!!Q!#] u !v!!UH!!u!#v !0!!\!!P!"0""\""0""P"#\##0##P##\##P##P U V!!U!"V T S!"S Q ]!!Q!"]!"1  0!!0!!P!!P!!P!! p  !! p  !! p !"!!1!"1!!P!!p!!P!"!!V""V!!S""S!!]""]!!\""\""1!!0""0""P""P""P"" p  "" p  "" p """"1""1""P""p""P""UUU S U\\\ \0PV0V  PV   V  010 1>t r $st $"sI"p"# At s(# $st $"sI"p"# It s(# $st $"sL "sI"# Ws(## s(# $ss(## $"sL "sI"# P_P_ _ 1 u@ 1 u@ 1 u@> u@s@>s@ > s@1s@1s@1s@STP|1s@1s@>s@>s@ > s@ > s@ U SUSUSUSUSUS T V T VTV Q ]Q]Q]Q]Q]Q] u sUHsUHsUHsUHsUHs  ~80$0. ~80$0. ~80$0. ~80$0. ~80$0.  ~ 0$0. ~ 0$0. ~ 0$0. ~ 0$0. ~ 0$0. 0 P 0 P P~ P00 0 0 0 0 ~0  ______ 1$1| 1$1| 1$1|TQ | % | % | % \ \\\\\\ YY #r$YYY q$YY~~~~~~~~~(~(~(~(~(~~~~~~________#~#~~~~PP~~~  TPTQP|(~~~|||p   ___PS~~~~~]]]]]}}}^^^^^_____P~~~~~PPPXUXSUSU SMTMPTsTPTP\T\ T2Q2V Q-____ _ _ _ _DXUXSS S S SDM t M p TsTTsTsDVV V Q Q V Q VD__ _ _ _D   QQQRRRYYY00 ry R2 1 1Qt2$q"QQ Z ZDX_XXU_SS S S S S2 1 1t2$q" Z ZVV V Q Q Q V   ^ d d]] ] ] ]    |p P r XX X X XPYY P Y P Y P Y0U1UUp0$0.F0.F0. F0. F0. F0.PTTTt{"4T T T TZpx%3#zy3% t"zy7%x%3px%3#zy3% t"zy7%x%3Zpx%3#yq3% t"yq7%x%3#zy3% t"zy7%x%3 Z s s s px%3 !uyy3% t"%x%3QZQZQQQqpQZQ Q U U u U uP^^ ^<< < < <XT_Z3% t"7%R 3% t" 3% t"3% t" 3% t" 3% t" 3% t" up3% t" uy3% t"XTRPzyPr3% t"zy3% t"r3% t"p3% t"zy3% t"zy3% t"XTRPyqPr3% t"r3% t"p3% t"yq3% t" ur" V V [ R [ R qx%3 qx%3 qx%3 X T Z  Q z3% t" z3% t" z3% t" T X T _ P uyy  P |p 3% t" 3% t" p3% t" uyy3% t"ryRSS\\__vQvvxvxPTTp p _UPTIUIT^U^VV707p]p_]]_0]]7_ PP~ Pp|T^^ 00 VV ~~ PP~ P1  00PPP p   p   p /8?1/18?1PpP F^Jw^^^_AA0_6^Jw^^P_P_PP6P 6 P 6 P _____ 444]BUBU`T`VTTV^^PWSWcPS00TVTVJ100PPP p   p   p 5151P pPHUH[][dUdU]U]U'T'USUdTdSTSUT8Q8dQdqQqQQQ?VLVu4T4C}CLU#Lhuh}T}U#5_9_}0}"1 !#U#0U#@"1 !#s  <$u"14P u01 !#P\|P||\0u0=\Lhu\|`\TPPP$<%6F<%FVTV<%-SZjPjS SgjPjnS p3%jup3%3P3P 3 PSjtSSSS s4s4s4U <% T <%UU PSV%P5U5SUsUSUHTHQTQT:T:F s#(#FJ u#(#TP'0P0CVTTQQNUN~ U ~ U~UT^~p T ^ T^TQS Q S QSQR~ R ~ R~R]RVP] V ] V]V]V]V]P} }} ^ 2^_H^_^_^~ ~~~~#( ~~  ~~^_ ~~^_ ~~^_ ~~`^`v~pv~pYT T ^ TT^_XX~ __0~~]~ ] 0 ]~]~]~]0~0~~~~ 0 ~~~~0~0]V]_U_0_]_U_ P 0 U _VUVVUV00V0}}}0}} } 0 } 1}}00 xXqXqX}( ~ ~~~~NS | s"SP} } } } } \} 0\} ^\} \} ^\} P\} ^\} 0\} 0  0 ^ 0 ^\} ^\} ^\} ^ 0 S 0 ^ 00 0 ^ 0 ^\} ^ 0  0 ~ 0 X 0 ~ 0  0 ^ 0 ^\} X 0 T 0 X 0 ^ 0  0  0 0 0 ^\}  0 X 0 ^ 0  ^ ^\~ 000~P ~ T ~ ~ ~ ~ ~~~~~~110XQQ} ~#( ~#(~#(~#(~#(qXX_^v^^P^^ ^^P^^  PPPp^|^P^71006P6P6PQ p999999vV ~~~~~~ ~~~~~~~ ~:Q:~1~1~1~1~1~1 ~1}}}}}} }P'}#@'~~~~~ ~'0 ^ ^P ^| ^|P ^~~ ^~~ S~~ ^~~ ^~~ ^~~ ^~ ~ ^~~ ^~ ^~~ ^~ ^~ ^~~ ^~P9T9h}}Pu~~~~1p$1~#$ 1~$ 1~$ 1~$ 1~$ 1~$ 1~$}~ ~# ~# ^^S^TT^^S^11006S6S6SP 0 0 S 0 S0S>>>p3%p3%333~ s4 s4s4>> s4s4s4 s4s4s4~# ~# ~# #~XTXXTTTt~XTX.1006T6T6TPT~TTT t4 t4t4T>T>T TTTT T t4t4t4~#hP P ~#h ~# V# #0# *] *0^~0~0~0v] ]]`~`v~8 ~~vS SS~KY P YP~~0~0~0K00 P 2YP)((0Pp ]UVUUUVUVU]]]PuGuGPu<T(UH>CSIUIXUTT Z 9_9@P@w_ww_]w$Pw$w$w$w$_w0__wRwwRwwww$w0w$w$Pw$P&q&www&U&w(Xw0(w(Xw(XPw8w8w8P{www0UQUYqYQqQ0]}] ] Q ] 0 :P00\\|\0 \QPDzPPSS S S S P SSS10PU1 01 w 1 ww1w1w11www:w0:wwwSSS^_\__\_Tx\xw8PPPwwwQ5^5\  ^Vd^Y]]]4___1PPQ_w#__q8p rp FRF|QQ-p<% XI|X$p p#  t -( 'p p#  |u -(TT & & & &  8|~ qp#  p p# ppp PPPpp*1006p6p6pPU @ wATAw "0S20":0_20:: ]_S\:A]_S|AY ]_S\Y]_ ]_S\ T_S\ TS\ T_S\T_\T_0T_1]_]0n]]:0:b^by~y^2S0JwJwJb8TO] T TwP]]w P ]]wwP]]w P ]]www w www  9w wp<%1P P101U}3%UY}3%#Yf}x3%#f}3%}3%#}x3%#}3% }3% 0}3%}3%10 0w$_9__T__ _______T__TTTt__T_01006T6T6TU tw#______TTT__-1006_6_6_Tup3%333_w(w(wRPPw R PPwPP PRR R rPP01006P6P6PX rYSSS PPPSS*1006S6S6SPSPS S p P QQpw()w(w(PP0 q6% q6%# q6%#q6%w( Q q@Q00P w 8   p 3$&0 P w8 U w8 8   w8 3$U& w8 3$*w*w(*w*0SSSSSS PPPSS*1006S6S6SP1z1$100 s4s4s4HUHSUS2T2}]}T]P6\ p<& r }"<&d0P6\. . d5 1(]T(_(]T(_(^]T_^1(PzUzS~8T_T.Q.Pu0s0~~ ~ ~~)1p$VXVV V V V X VVV~V~~V909~~~~/X_XXX~\]X~ ~ X ] ] X X ~ X ] X ~]X]/x :]x  ~ | ]x  ~ ] ~  x  }  ] x  ] x  ] }  x  ~ ]x } )^)~~~~ ~ ~~~~~300~1,~! ~1,~!~1,~!0P 0 ~ P ~ 00 0~IRI^^IXI^S^sPtSS:Z:]]R\e\\ T :r#p4V[VV P *TcxPx~+_ s  *P P *T +V0 4VV _  s  _4VV+ + + + V 8}s*}p4}s vv|#V#' ~~1|P~TTTTTT 6 T 6 T6TP0~1,~! ~1,~!~1,~!0ts sts sts sPq P P-s?8P&s ssPsPsP /S/~S~ S~/s/~#s~# s~#^^^^ ^ ^ ^ ^^^^^}~ %$s(~ %}~ %s(~ % s(~ %$0$+P+9STqPrr00S]  0 P ~ PYSSYssPt~^ ~ ~ ^~P7~#~ ~~#-| $0. t2 $0. s2 $0. s2 $0.| $0. s2 $0.PjUj]]]]]] P 6SXmPSQ~~P~ PQ~cn~QP/QQ~P q<%P ~#<%  RR8P8U]]]]]0000 PPPPP#@#@#@#@#@0~Q~6]Ha]R$<R0q6% q6%# q6%#$<q6%$] Q q@$<QQ%Q QP P%0 0%R R %Q Q2s3P3}Q"s*8P"s sPsPs ssSSS S Sht#0sRVVV V VsPs~~~ ~ ~s10 02t#0#@[<$!Y0Ye_eii___ _ _s$S$Ut#0 QPI^PP^ ^ ^PR^|0"T^ ^ ^^ ^ ^ P P P^ ^+1006^6^6^P11 100 ~4~4~4sUsP  s ^^sPPPPsiPsPsPiPsPs QeoQQP\zPz|s 1006P6P6PQ rp4 p4 p4Ps_ _X x Xg ~ g |  x  v  v 0 0_ _XXXg~g\ XV VJ^ _ _ ___ _6_6_6____6_6_ 6 _ vx /Q/>v~  vx  __"J_ 6 _ 6 _ 6 _U>S>GUGqS3V:dVu\V"U"@T@\|\\P_P_PG0G]]0#@LL_P_$1qy0((___ qy  p   #@#@#@9U9=t=>U9U9=t=>U9u9=T=>UH"P0q6% q6%# q6%#"q6%u Q q@"QU S !v`!&U&[Ss s s s U\V\aUahVPGSNSPP EUEa\ajUj\ITIT u( u(#xP u(#@#<% 4$u("#x0V(P(0Uu( U > U>U>UQ&Q&(p(GQGIpT3TQ(GQGIp!1006Q6Q6QT u6\|(\>\ > \ > \\>\>\\\\\ |4|4|4,U,\U\U,T,Tv<%Vp<%0 sT4% sT4%## sT@4%##y sT4%y} sT4%#} sT@4%# sT4%T UeUsUsPalPPU]zUz|s1006U6U6U P 0 0 U 0 U0U\> > >>> u4u4u4U0s6%s6%#!s6%#U-S-SU!S  UlSlU8V?WVpq"$+pq"+5s3$p"VSPVP  .3 U0P"S"3QDKP0 T q P{V{ 0S0VPSiS|4$#xq4$#x'HT/0/@<$/^ | @ | 4$ q 4$x | 4$ | 4$#x q 4$#x\S0P0WS00PP8  p  U  p 8  p 3$ U p 3$ U  T s Q s $SP\P\ P26P69S&Ÿ& & & 0s6% s6%# *s6%#'UPU106U6U6UU'U'+U+eUerUrV~@UV~@&T&'T'YSYdudeTeSTS&Q&'Q'+Q+eQevQv\Q\0"F\y\t t UT# *2s V+EVEW~@S+WS V ~@S| | | | uv^/U/YsYdU8S8>UH>CS4U4HSHMUMRU4T4MTMRT4Q4MQMRQ4qt"4MQT"MRqt" U U U U  6  U  6  U 6 UUUUU 6 U 6 U6UUU&T&Tsp&^H^spv`/SQSP@Sx_}_#\,05t]t}P}]S&~HSvp    I UISUSUS1PPQ2S2 +S+^+ S^ 12P    UUiSijv`jnu` sU9ssUssU s 1 PPQ &U&UOSOWvp  5V 5  .V .  .\V \1=PUVUV S"iSSS S]iSS S]iSS P]gPPSS*1006S6S6SP1^z1100 s4s4s4UUU+U+FUFMUMU+T+ASAFTFSQ Q +Q+FQF]Q]Q PP(-P:IP`g0y}P}h0PP!$Pp4!$p4p4!$p4p4!$p4UUU"0"]]00VV\\S v $ &3$u" 7 v $ &3$u"B_S_a v $ &3$u"S v $ &3$u"SB_S_a v $ &3$u"S v $ &3$u" P>IPPS6SSSU v $ &3$u"1006S6S6S P1.1100 s4s4s4USUSU0ai0irPrVV~V0^^z"Z^ P a_CVQ%_%)QdsQ$00\\] 0_&&._.2P2S_SWPP_\00 P \VV~  P s 88  Uq@@@U@ 060d0P)PdP^^U0U"p 5$"P"p 5$"UBVBGUGXVS)SPSS P RpP)P). .SQP*P*: (0#PUU T T Q Qut U UTut U UT9CUCVUVT]T]S~!S4SSS PP P ^P^P^^ XspQsp@0,TQ p, v vv     aUaUUUUUUUeTeTTTTTTT<Q ; ;ADNZgrx@JV[ *1CHz '/66 66 $) "%  !+ 14Qk^l^e  $$Yz   n    /9       &3;>-J C  C '   GKUg%(-   b0         '/EQTW\_        $(  $( %16&     "                                       -4DKNRptpt             1lu 7  7// '+   #,77>J,EJ           BV $    "%I  "%I  -47H  14]f ).2    6=EEJQ '=KPT:?i?LLN (MRzz GLtt)' / >  #'+/369#'+/2"i @!]n*-D    DHQ\au|                       !"  !!!!""!!""")+. "C<#  )$+. $+.3)-)-5## e]|]]]lHW *2PW]d{'!        !&w  !' !-:$(?JJ $5    )  "zzz9%*2 %*2<(   #+2  @ $  #+2  %0;;  t HKS               /   #[`  6Ha$=$= 035WES    2"'7Q^  "'7Q   .     \`j  ii\|\\  Y` Y` Y` )38<FQ (0=DNU$0:AKOS  + & # &+' 4Bgnjt *159ahloI(I((59aot59aoty59hoty'+Dsv  "'   "%+/22m   "%+/2|||         #   $  /8? FJw6Jw  Xgl!P   $    JS */CGL(qyu P     (   aBa6U66.!$"] ]k]]^z^^ $ &-9 F1_ ' % %13[  Zeq)B   %a 11";?L\                L                                                          !!  !!!!!  !!!!!!!!!""""""""""""""$&&'''%%%%%&''%%''%%%&&'''((((()))))(((())()))*++--...++....+++---..++,,,,,,,-,,,-,,,,,,,,    "$&')*+,-/134568:<>?ACEGHJLMOQRTVWXZP^N  *PR?y    $ Wa\b,SWp 0 `@p*@   ?0aPp 5@ODP>PB& #:`Sl~P 0c6H8 p0 P ?pq` Z0!L0v"j" #!`$ % P     ,*`,4 K >aJ%|8:o0< <? =? f?@ ?` ? ? ? A6x76`}UAW6xs6A6x6)A6x6 A 6x69A(;6xR6 mA0o6x66x6 6 6 66 Z6 ~6 6 6 6 $6 K6  s6@ 6` CHC`HCHBC H^CH{CHC@H @`.pJf ~1+1G - A; R;9;<@<p<g<=` > I'PLqQdR xUW0X6`  0 6@ L% ` 04  C 6 U  0a 6n  0 6@X 6 6 6 6` 6@  6   6 2 6 J 6 _ 6 q  0} 6 6@ 6  Y#Z0Z[5]  8S@_q0` Paxe@ jl`m6ppT @( ( (% S{yPHp, S4 LM LQp4>@3[N0q ,`>PP@q3Д Rdu dnb >  t L 0зRU@  Lp@P#f| L    ? U  p9 L$ L  6 L L0 L(. L@? L8N 6 b L, Lw ~ ( @  (( P P3 LPL L\^ LH(Wp 6Fp 6 LXP ` LT  P(  e 'LpCLxXLhh 1mLt66@ C6  L`x(P;n6 L jXD~0)p@& >LY`;;tZ@O6 f6y0  x6 66`H  @$@Lps     Qp&Q`y9 [@`@4PMf@pp` @9`T !p!p"#P$$&p1%1;p;L;b;y<0<`<<p=> I!@LKQ^RrUpW XYY ZZ/]M0_k `@aejlPm0`pM{s@p` `-H kP@@0-LoХ*O0j0@` @"@`_z@5Rx `0P5T0s  2 J Pb }  #  , 5  @ !L5%!+.!+7!,. B!N!a!k!@{!!x5N!!!6%2!!z< """"6"Q"a"p"- 0I""""`""pY2K#P*#?#O#`#s###F#p#EH#J#+$%$3$I$8 ]$6$$$$$$d- %6P1n$%)0%2A%V%l%x%%3%%%` %%%%@&#[/&@G&^&3p&yE30&`&&&&&{'*'?'K['s'z'''''''p'(&; (*(,:(K(0g((((Y((((()`)h!)$3)6`0&pZB)`Z)py))))>)))L **T:\'*u.) >,0\2*A*6<O*i*3|**A***`(*++."+2+G+P+a+ +<Bp++p?++ ++9+,8PK,+,gK,X,0E'KPu,,,6 ,*Ah,, ,,0,---8-E-b-8io-v&y+?---0-L>c---.EH''.A.O.T.d.o... ......//9#/o00@00 !S000p1$1;1^1h1m11 1A1111122+222A2a2"A9Fs22222pK26@22 333?3&"pT3n333333b8`X3Ћ334(4<4[4:Nn4444' {544p4'60gf41,gW<E55$5A5K5R5d5r55'-L,=5#`3t5E@H55(X5EH66!6 gD6 5Z6q6~66666660Ps00H)p660;7%717L7W7n7773<76`7t7l777788E`Hg+0l:8(Q8\8PXw838#FX`688pi888@K99"90;9N9c9x9@99K09999::/:4 p<::( YGN:k:(::::::P;B :e; ;F;R;1f;m;y;;;;B;;;;<%<;e.9<A<Q<:`t<<</PO@<<(<m=u <B ==@>6=X;1E=[=g=u====6== >csuper.csymbols.85__flags.86__flags.87__flags.88erofs_param_cache_strategyerofs_inode_cacheperofs_fs_typeerofs_fs_parameters__key.92erofs_context_opserofs_fc_reconfigure.colderofs_init_device.colderofs_export_opserofs_fc_fill_super.colderofs_read_metadata.cold__func__.91_entry.90_entry.89__UNIQUE_ID_license768__UNIQUE_ID_author767__UNIQUE_ID_description766__UNIQUE_ID___addressable_cleanup_module765__UNIQUE_ID___addressable_init_module764__UNIQUE_ID_alias763erofs_dax_param_enums_entry_ptr.1_entry_ptr.2__bpf_trace_tp_map_erofs_destroy_inode__bpf_trace_tp_map_erofs_map_blocks_exit__bpf_trace_tp_map_erofs_map_blocks_enter__bpf_trace_tp_map_erofs_readpages__bpf_trace_tp_map_erofs_read_folio__bpf_trace_tp_map_erofs_fill_inode__bpf_trace_tp_map_erofs_lookup__event_erofs_destroy_inodeprint_fmt_erofs_destroy_inode__event_erofs_map_blocks_exitprint_fmt_erofs_map_blocks_exit__event_erofs_map_blocks_enterprint_fmt_erofs_map_blocks_enter__event_erofs_readpagesprint_fmt_erofs_readpages__event_erofs_read_folioprint_fmt_erofs_read_folio__event_erofs_fill_inodeprint_fmt_erofs_fill_inode__event_erofs_lookupprint_fmt_erofs_lookuptrace_event_fields_erofs_destroy_inodetrace_event_fields_erofs_map_blocks_exittrace_event_fields_erofs_map_blocks_entertrace_event_fields_erofs_readpagestrace_event_fields_erofs_read_foliotrace_event_fields_erofs_fill_inodetrace_event_fields_erofs_lookuptrace_event_type_funcs_erofs_destroy_inodetrace_event_type_funcs_erofs_map_blocks_exittrace_event_type_funcs_erofs_map_blocks_entertrace_event_type_funcs_erofs_readpagestrace_event_type_funcs_erofs_read_foliotrace_event_type_funcs_erofs_fill_inodetrace_event_type_funcs_erofs_lookupevent_class_erofs_destroy_inodestr__erofs__trace_system_nameevent_class_erofs_map_blocks_exitevent_class_erofs_map_blocks_enterevent_class_erofs_readpagesevent_class_erofs_read_folioevent_class_erofs_fill_inodeevent_class_erofs_lookup__tpstrtab_erofs_destroy_inode__tpstrtab_erofs_map_blocks_exit__tpstrtab_erofs_map_blocks_enter__tpstrtab_erofs_readpages__tpstrtab_erofs_read_folio__tpstrtab_erofs_fill_inode__tpstrtab_erofs_lookupinode.c__already_done.0erofs_iget.colderofs_iomap_opserofs_dax_vm_ops.LC0namei.cdir.cerofs_readdir.coldsysfs.cerofs_rooterofs_feat_ktypeerofs_feat__key.0erofs_sb_ktypeerofs_attr_opserofs_feat_groupserofs_ktypeerofs_groupserofs_feat_grouperofs_feat_attrserofs_attr_zero_paddingerofs_attr_compr_cfgserofs_attr_big_pclustererofs_attr_chunked_fileerofs_attr_device_tableerofs_attr_compr_head2erofs_attr_sb_chksumerofs_attr_ztailpackingerofs_attr_fragmentserofs_attr_dedupeerofs_grouperofs_attrserofs_attr_sync_decompresserofs_attr_drop_cachesxattr.cxattr_handler_map.0decompressor.c__compound_literal.2__compound_literal.0__compound_literal.1zmap.czdata.cz_erofs_pcpu_worker_lockz_erofs_pcpu_workersz_erofs_workqueue__key.1erofs_cpuhp_statez_erofs_cache_aops.LC1.LC7.LC2.LC3.LC8zutil.cerofs_sb_list_lockshrinker_run_noerofs_sb_listerofs_shrinker_infoz_erofs_gbuf_countz_erofs_rsv_nrpagesz_erofs_gbufpoolz_erofs_rsvbufgbuf_resize_mutex.1z_erofs_gbuf_nrpages__UNIQUE_ID_reserved_pagestype617__param_reserved_pages__param_str_reserved_pages__UNIQUE_ID_global_bufferstype616__param_global_buffers__param_str_global_buffersdecompressor_lzma.cz_erofs_lzma_avail_strmsz_erofs_lzma_lockz_erofs_lzma_headz_erofs_lzma_wqlzma_resize_mutex.0z_erofs_lzma_max_dictsizez_erofs_lzma_nstrms__UNIQUE_ID_lzma_streamstype616__param_lzma_streams__param_str_lzma_streamsdecompressor_deflate.cz_erofs_deflate_avail_strmsz_erofs_deflate_lockz_erofs_deflate_headz_erofs_deflate_nstrmsz_erofs_deflate_wqdeflate_resize_mutex.1inited.0__UNIQUE_ID_deflate_streamstype616__param_deflate_streams__param_str_deflate_streamsfileio.c.LC4fscache.cerofs_fscache_meta_aopserofs_pseudo_mnterofs_domain_list_lockerofs_domain_listerofs_domain_cookies_lockerofs_domain_cookies_listerofs_anon_fs_type__pfx_perf_trace_erofs_fill_inode__pfx_perf_trace_erofs_read_folio__pfx_perf_trace_erofs_readpages__pfx_perf_trace_erofs_map_blocks_enter__pfx_perf_trace_erofs_map_blocks_exit__pfx_perf_trace_erofs_destroy_inode__pfx_trace_event_raw_event_erofs_fill_inode__pfx_trace_event_raw_event_erofs_read_folio__pfx_trace_event_raw_event_erofs_readpages__pfx_trace_event_raw_event_erofs_map_blocks_enter__pfx_trace_event_raw_event_erofs_map_blocks_exit__pfx_trace_event_raw_event_erofs_destroy_inode__pfx_trace_raw_output_erofs_lookup__pfx_trace_raw_output_erofs_fill_inode__pfx_trace_raw_output_erofs_readpages__pfx_trace_raw_output_erofs_destroy_inode__pfx_trace_raw_output_erofs_read_folio__pfx_trace_raw_output_erofs_map_blocks_enter__pfx_trace_raw_output_erofs_map_blocks_exit__pfx___bpf_trace_erofs_lookup__pfx___bpf_trace_erofs_fill_inode__pfx___bpf_trace_erofs_read_folio__pfx___bpf_trace_erofs_readpages__pfx___bpf_trace_erofs_map_blocks_exit__pfx_erofs_show_options__pfx_erofs_release_device_info__pfx_erofs_free_inode__pfx_erofs_alloc_inode__pfx_erofs_fc_get_tree__pfx_erofs_nfs_get_inode__pfx_erofs_get_parent__pfx_erofs_fh_to_parent__pfx_erofs_fh_to_dentry__pfx_super_set_sysfs_name_generic__pfx_erofs_inode_init_once__pfx_erofs_kill_sb__pfx_erofs_statfs__pfx_perf_trace_erofs_lookup__pfx___bpf_trace_erofs_map_blocks_enter__pfx___bpf_trace_erofs_destroy_inode__pfx_erofs_fc_parse_param__pfx_erofs_init_fs_context__pfx_erofs_fc_free__pfx_erofs_put_super__pfx_trace_event_raw_event_erofs_lookup__pfx_erofs_fc_reconfigure__pfx_erofs_init_device__pfx_erofs_fc_fill_super__pfx_erofs_iget5_eq__pfx_erofs_iget5_set__pfx_erofs_bmap__pfx_erofs_readahead__pfx_erofs_read_folio__pfx_erofs_dax_huge_fault__pfx_erofs_dax_fault__pfx_erofs_file_read_iter__pfx_erofs_file_llseek__pfx_erofs_file_mmap__pfx_erofs_iomap_end__pfx_erofs_iomap_begin__pfx_erofs_find_target_block.constprop.0__pfx_erofs_lookup__pfx_erofs_readdir__pfx_erofs_attr_store__pfx_erofs_attr_show__pfx_erofs_sb_release__pfx_erofs_xattr_user_list__pfx_erofs_xattr_trusted_list__pfx_erofs_xattr_copy_to_buffer__pfx_erofs_getxattr_foreach__pfx_erofs_listxattr_foreach__pfx_erofs_xattr_iter_shared__pfx_erofs_xattr_iter_inline.constprop.0__pfx_erofs_init_inode_xattrs__pfx_erofs_xattr_generic_get__pfx_z_erofs_lz4_prepare_dstpages__pfx_z_erofs_load_lz4_config__pfx_z_erofs_transform_plain__pfx_z_erofs_lz4_decompress__pfx_z_erofs_load_lcluster_from_disk__pfx_z_erofs_do_map_blocks__pfx_z_erofs_fill_inode_lazy__pfx_z_erofs_iomap_begin_report__pfx_erofs_cpu_offline__pfx_erofs_destroy_percpu_workers__pfx_z_erofs_destroy_pcluster_pool__pfx_z_erofs_get_pcluster__pfx_z_erofs_do_decompressed_bvec__pfx_z_erofs_page_is_invalidated.isra.0__pfx_erofs_cpu_online__pfx_z_erofs_rcu_callback__pfx_erofs_try_to_free_all_cached_folios__pfx_z_erofs_put_pcluster.part.0__pfx_z_erofs_pcluster_end__pfx_z_erofs_decompress_queue__pfx_z_erofs_decompressqueue_work__pfx_z_erofs_decompressqueue_kthread_work__pfx_z_erofs_decompress_kickoff__pfx_z_erofs_endio__pfx_z_erofs_scan_folio__pfx_z_erofs_pcluster_readmore__pfx_z_erofs_cache_release_folio__pfx_z_erofs_cache_invalidate_folio__pfx_z_erofs_submit_queue__pfx_z_erofs_runqueue__pfx_z_erofs_readahead__pfx_z_erofs_read_folio__pfx_erofs_shrink_count__pfx_kmalloc_array_noprof.constprop.0__pfx_erofs_shrink_scan__pfx_z_erofs_lzma_exit__pfx_z_erofs_lzma_decompress__pfx_z_erofs_load_lzma_config__pfx_z_erofs_deflate_exit__pfx_z_erofs_deflate_decompress__pfx_z_erofs_load_deflate_config__pfx_erofs_fileio_ki_complete__pfx_erofs_fileio_rq_submit__pfx_erofs_fileio_scan_folio__pfx_erofs_fileio_read_folio__pfx_erofs_fileio_readahead__pfx_erofs_fscache_relinquish_cookie__pfx_erofs_anon_init_fs_context__pfx_erofs_fscache_register_volume__pfx_erofs_fscache_acquire_cookie__pfx_erofs_fscache_req_put__pfx_erofs_fscache_io_put__pfx_erofs_fscache_bio_endio__pfx_erofs_fscache_req_end_io__pfx_erofs_fscache_domain_put__pfx_erofs_fscache_read_io_async__pfx_erofs_fscache_meta_read_folio__pfx_erofs_fscache_data_read_slice__pfx_erofs_fscache_readahead__pfx_erofs_fscache_read_folio__pfx_erofs_module_exit__pfx_erofs_module_init__pfx_z_erofs_lzma_init__pfx_z_erofs_deflate_initerofs.mod.c__UNIQUE_ID_srcversion473__UNIQUE_ID_depends472__UNIQUE_ID_intree471__UNIQUE_ID_name470module-common.c__UNIQUE_ID_retpoline471__UNIQUE_ID_vermagic470_note_19_note_18orc_headersme_me_maskdevmap_managed_keyfilp_openerofs_file_fops__pfx_z_erofs_shrink_scaniomap_readaheadgeneric_fillattrbdev_file_open_by_pathshrinker_allocxz_dec_microlzma_reset__check_object_size__init_rwsem_copy_to_iterget_tree_bdev_flags__list_add_valid_or_reportalloc_workqueuebpf_trace_run4__fscache_acquire_volume__pfx_z_erofs_gbuf_exitidr_findfs_ftype_to_dtype__pfx___probestub_erofs_lookupparam_ops_uint__pfx_erofs_exit_sysfs__pfx___probestub_erofs_map_blocks_entergeneric_fh_to_dentry__rcu_read_lock__kmalloc_noproffs_param_is_stringLZ4_decompress_safe_partialfolio_unlock__pfx_erofs_map_dev__pfx___traceiter_erofs_readpages__tracepoint_erofs_fill_inode__this_modulememmove__fscache_begin_read_operationqueue_work_ontrace_raw_output_prepLZ4_decompress_safe__SCK__tp_func_erofs_map_blocks_exitinit_special_inodeunregister_filesystemfs_dax_get_by_bdev__bitmap_weight__init_swait_queue_head__trace_trigger_soft_disabled__SCK__tp_func_erofs_fill_inodefinish_wait__pfx_erofs_igetnop_posix_acl_accessnop_posix_acl_defaultd_make_roottrace_event_printfthis_cpu_off__xa_erasesb_set_blocksizeerofs_xattr_handlersread_cache_folioxas_findinvalidate_mapping_pageserofs_symlink_iops__SCT__tp_func_erofs_read_folioerofs_fast_symlink_iops__fscache_unuse_cookie__stop_alloc_tags__pfx_z_erofs_parse_cfgs__pfx___traceiter_erofs_map_blocks_exitskip_spacesd_splice_aliasxz_dec_microlzma_end__pfx_erofs_fileio_submit_bio__pfx_z_erofs_exit_decompressorfs_put_daxtrace_event_raw_init__pfx_erofs_onlinefolio_endtrace_print_symbols_seqmemcpyerofs_sopslockref_get_not_zero__pfx___probestub_erofs_destroy_inodepage_get_linkvunmapkfree__pfx_erofs_shrinker_unregisterdax_iomap_rwiput__pfx_z_erofs_init_subsystemkset_unregisterfs_param_is_enumerofs_xattr_trusted_handlergeneric_file_readonly_mmaplogfc__pfx_z_erofs_get_gbuf__pfx_erofs_unregister_sysfsbpf_trace_run2prepare_to_wait_eventdax_iomap_fault__wake_upvsnprintf__fscache_relinquish_cookiezlib_inflateInit2z_erofs_decomp__pfx_z_erofs_gbuf_init__pfx_erofs_init_managed_cache__pfx___probestub_erofs_readpages_raw_spin_locksched_set_fifo_low__pfx_erofs_unmap_metabuffilemap_add_foliovfs_setposerofs_global_shrink_cntsimple_get_link__fentry__sysfs_emitget_tree_nodevshrinker_freetrace_event_buffer_commit__start_alloc_tagsiomap_invalidate_folio__pfx_erofs_init_metabuf__x86_indirect_thunk_raxiomap_dio_rwz_erofs_lzma_decomperofs_fscache_access_aopskill_block_superunlock_new_inodeiomap_seek_holeposix_acl_from_xattrschedule__stack_chk_fail__pfx_erofs_fscache_unregister_fsrefcount_warn_saturatemake_kuid__pfx_erofs_breadfs_kobj__SCT__tp_func_erofs_map_blocks_enterbio_add_foliostrnlencopy_page__filemap_get_foliokthread_queue_work__pfx_erofs_xattr_prefixes_initidr_get_nexterofs_xattr_security_handlernuma_nodeconst_pcpu_hot__SCK__tp_func_erofs_map_blocks_enter__free_pagesbit_wait__pfx_erofs_fileio_bio_allocxxh32capablekern_mountpage_offset_basesized_strscpy__folio_swap_cache_indexzlib_inflatehugetlb_optimize_vmemmap_keyz_erofs_aops__fscache_relinquish_volumebio_putreadahead_expand__pfx_erofs_read_metadata__pfx_erofs_fiemapinit_wait_entryinode_nohighmemperf_trace_buf_alloc__tracepoint_erofs_destroy_inodeperf_trace_run_bpf_submit__bio_advancefputmigrate_disabledown_write__pfx_init_moduleup_write__pfx__erofs_printk__cpuhp_setup_statesynchronize_rculockref_put_or_lockmemchr_invgeneric_ro_fopsthp_get_unmapped_areaidr_alloc__rcu_read_unlockz_erofs_iomap_report_opskmemdup_nulxa_load__SCT__tp_func_erofs_fill_inode__tracepoint_erofs_read_foliokthread_create_worker_on_cpuvmalloc_noprofdestroy_workqueue__pfx_erofs_nameiset_nlinkmutex_lockkmem_cache_alloc_lru_noprofkmem_cache_freevm_map_ramzlib_inflate_workspacesize__pfx_erofs_fscache_register_cookie__tracepoint_erofs_readpagesuuid_null__pfx_erofs_fscache_submit_biotrace_event_regerofs_dir_iops__SCT__tp_func_erofs_destroy_inode__pfx_z_erofs_put_gbuf__SCT__tp_func_erofs_lookupwait_for_completion_io__pfx___probestub_erofs_fill_inodephys_basevmap__list_del_entry_valid_or_reporterofs_dir_fopskobject_init_and_addzero_fill_bio_iter__pfx_erofs_fscache_register_fsbio_add_page_find_next_bitalloc_pages_bulk_noprof__cpu_online_maskmemcmpd_obtain_alias__put_devmap_managed_folio_refs_raw_spin_trylock__mutex_init__fortify_panicerrno_to_blk_statusfolio_end_read__pfx_erofs_onlinefolio_split__SCK__tp_func_erofs_read_folioiomap_bmapbpf_trace_run1__pfx___probestub_erofs_map_blocks_exitidr_destroy__pfx_cleanup_module__default_kernel_pte_mask__cpu_possible_maskbio_initmemset__pfx_erofs_release_pageskstrtoullvfs_iocb_iter_read__pfx_z_erofs_map_blocks_iteriov_iter_bvec__pfx___traceiter_erofs_destroy_inodeiomap_fiemapwait_for_completion__SCT__tp_func_erofs_readpages__x86_return_thunkkmem_cache_alloc_noprofkmemdup_noprofnr_cpu_idsxz_dec_microlzma_allocpsi_memstall_leave__pfx_z_erofs_fixup_insizemake_kgid__kmem_cache_create_argskasprintferofs_fileio_aopsout_of_line_wait_on_bit_lockdown_readstrcmplockref_mark_deadmutex_trylock__pfx___traceiter_erofs_map_blocks_enter__xa_cmpxchginit_pseudo__tracepoint_erofs_lookupkstrduppv_ops__tracepoint_erofs_map_blocks_enterbpf_trace_run3iomap_read_folio__pfx_erofs_xattr_prefixes_cleanuptrace_print_flags_seq__pfx_erofs_init_sysfsidr_for_eachcrc32cvmemmap_base__pfx___traceiter_erofs_fill_inodegeneric_encode_ino32_fhnoop_direct_IOcall_rcusuper_setup_bdi__SCK__tp_func_erofs_readpagesgeneric_read_dirkobject_deltrace_event_buffer_reservebio_uninitkthread_destroy_worker__pfx_erofs_fscache_bio_allocmutex_unlockinit_user_ns__SCK__tp_func_erofs_lookupxa_find__x86_indirect_thunk_rcxbdi_dev_nameseq_write__folio_putkobject_set_name__tracepoint_erofs_map_blocks_exit__kmalloc_cache_noprofseq_printf__pfx_erofs_register_sysfspsi_memstall_enteriov_iter_zerofilemap_read__pfx_erofs_get_acl__pfx___erofs_allocpage__SCT__cond_resched__pfx_erofs_onlinefolio_initalloc_pages_noprof__folio_lockerofs_xattr_user_handlerpagecache_get_pagexz_dec_microlzma_run__fscache_use_cookieerofs_generic_iops__pfx_erofs_shrinker_registervm_unmap_aliaseskern_unmountfile_bdev__pfx_erofs_init_shrinkergeneric_fh_to_parentiov_iter_xarray__pfx___traceiter_erofs_lookup__fs_parsefilemap_splice_read__pfx_z_erofs_exit_subsystemz_erofs_deflate_decomp__pfx_z_erofs_init_decompressorkill_anon_superdotdot_namexa_find_afteriget5_locked__pfx___probestub_erofs_read_folio__pfx_erofs_listxattrkset_register__pfx_erofs_fscache_unregister_cookiercu_barrier__pfx_erofs_getattrstrlenwake_up_bitvm_unmap_ramkvfree__SCT__preempt_schedule_notrace__pfx_erofs_map_blocksgeneric_file_llseek_raw_spin_unlockiomap_release_foliobio_alloc_bioset__kvmalloc_node_noproftrace_handle_returnup_readzlib_inflateEnd__pfx___traceiter_erofs_read_folio__pfx_erofs_exit_shrinkerBUG_func__cpuhp_remove_statemigrate_enable__SCT__tp_func_erofs_map_blocks_exitiomap_seek_data__pfx_erofs_read_metabuf__SCT__might_resched__pfx_erofs_put_metabufkmalloc_cachesinode_set_ctime_to_tsiget_failed__pfx_z_erofs_stream_switch_bufsfs_bio_set__pfx_z_erofs_gbuf_growsizekmem_cache_destroy__SCK__tp_func_erofs_destroy_inode__fscache_acquire_cookiekobject_put__pfx_erofs_getxattr"g4GZJuzJF4JJ40AJejJ4JJ"k4GZJu4JJ4)8JavJaJ ka"J6a/SJfa  J  a*   J +   J V `   J V v   J V AvJV*wJV8UJbVmMJ `$M0J@ 0Y`hMJ ``M J1 A`OMJ z `4MC X p`J ` oMJ   "o( T l`  ol6;3Z3u = * w  ` i%J1 #? /P IXk UswJ l&" .Uc&m J & &0J"NYJt y* &J4*<*Cel q >5J:U^ r8w (J8ejJJ[Jaq{J J7lU6u `#JE,Tnh hx  h  !!5!@!DP!`!r!! .! !.! !J!"%" -"r5"8="I"U"_"f"J"""a"T""" "r"8"#{###{##J$ *$V=$e$$$$J%&%u%"%J%&#&k&(&&S&&F' |e'd'S'''~ (R(J(l(h7)D)X)`)&k))|*j* '|** * e***+_+;+G+Vp+ E+C+++J+y-,M\,sh,{,?,|,[X-,g----. .,.B.Yi.. ..*.d. ./ K#/ 5/d/k/ K/ ///?// 0%0`00@00{1.1H1J11J11J1N2'U2J22 12 12 3J3'4D4SY4w44 X4444(55F455*5586 D6QL666S66 7(7 -777J7 O7Y7k7w7,777{758=8{88 i9 l9Q9 b9 W9 Y99 999 9 99 :  : #8: @:: :+: :+: ; x;;.;D; I;S;];;;  ;5;;  ;%;;  ;m<<  %<E<L<  W<u<<<J<  <<  <<J<<  = 1=K=R=\=Jg=== ` ===J=%>9>JU>>J>>?7?tA?]?Jb?i??@@fq@J@"At)AOAJAAJAJBBC@DxDJDD(DDk4DDDEE(EE4EEEF FFFvGJG[GGG[H7fHHHHHI%IIIJIJ:KUKbKJKKJKKJK2L'L  ,LG3L 8LGQL MMLNJNNN (O"OXJeXnX .uX ;X "XUX DX ` X!XJXXHYJ%Y>YJMYUYcYHYY "YY "YYYJZZ1ZZ{ZZJZJ[[)[#\J\)\]]  ]]^{^J _A___J`J1``aJaJ1aJQaaJaa aZ)bbbbb@#c9cRcoc |cc ccccbdddeJ-e@eeeeJejfJffggg5gigggJgOhJ]h@h5hiTi.i6iHi]iii ii@i  jj-jJBj GjRjj#kt1klJlt+lNlOlllcm m%mJ4m {I{  Q{J{|*~J~~JQz łJ ( X   H ͇ ҇# (<Q VJ " /Z^ϊ x Ԋ 4  H ċ4J;C(LSk4ipw(4njufɍ=Jh .. .Ŏʎ׎ߎJ )N0 =5&;NB.Mqy &@ &Jҏ}J 1t$1J!0JHJem /{ .. .őΑJՑ.ܑ . &@' &.J: QےCJ!9JQs xÓ,Jc]AYJє   tbԙtt{֚. &@ & Pf7 +qJyؠbJ%Xb`{Jߡi?.$JJxJibĢТ&آ L %\C/Jjئft<t?t˪Ӫ{!4dJ ?#D &@¬ &ܬNO ttدL . oH/P^`!Ѳ * &@= &j Oѳ"+f x nʴYfpJC"=f߶JJշJJJAX . zʸUѸ/ . zU:Q^J:u%6D  Q?5 Fd  zC"4FCjO|&w+Ez&AJ6U bJ!)(294QIXhoQ[bJ(4j .,&3 &@8EW &_PfI J=bc] x$JJOu|J@ .$." . ")^7 "@ .$E[Jb .$gy .$" "1" "%..<4.,CSJ[`.<., " .(.,.<"@cw'., ".,J <!,.,?.<n ".(.3.,.<e+.3.,.<.<%<JPbJi.4z.4.4$.$.5.4>.$Eo+J . /" .$'."5 "@1P"\ "d .$l  .$ .$%,.1U[.Lh .\mt.D .\.@t.L.LJ .\Jt .\ .D .\").D8 .\?.DD]+(: .\?F.DM .\T.D\o "tJ ".D "ZD ISu " .T.L .\.D .\&.D2 .\9.@Bs.L ".D "Z.L!t.OI .\NU .\\.Dah "v} ".TJ " `   %+.l8 .x=D.dP .xW.``o~w}.l.lJ .x.lJitx .x.d .x.d .x.dv .x.d .x.d "@MJ "@.d "@Z %N " S Y.[f.pl.lud .x.d .x.d.l.p.l.[ "  J " %; @P X#6QP tEBJzd>< 9E,/ )ZJt?l;JBJ(SZ4qj|J(4I 5LdRq>Jm5?dKJUJq X4J P  P "Aj,vI  FJM.|` x lwJ m6J?gChJ (3JAe1JAL "Q j "py" " " ".|.x1xK=J  %[,n cJCHJ{,/ y<DkuJ,%kJ/,FJCd>! `8JUzEJ1 " %"/ "I "h" "1" " "J\B_  n} "  ",d "iJJ " " " "'\` "eJ,h.{"* "91H"T "J "`.| "J  "5IJK Wk!&)1 "R!& +0-7&<J PZ bUi&s.~ " -&J  , " ' "."3@ 2I  P "U!b "gn "s{J  J&7 &@I XpU &lN =T 2&N =T@ .N% (*&0N@ /G[b.y  ` .&lPJ #)-.> pF KRJu|N =T.,.,.#.<.$.4.4.4.$ .<AJek.OvN} =T.P.PdL .\.D .\.D.LJ.o$N+ =0T6.p=J  J $ &, (1:?.R0\ dv~+  p. `+ +0   8!- 5L `T^h+o w 8.Z.0000 *.  (0 N` hp N _ f o x z | ~( 8 h _x f o  P"H`p"p`$v` `      A  (A@ HA     HXHXXbP<hp<= @< < ; ; ; ( 8 w  I > Q 0 8 @ b   R  " (  ` 0Xh  p " W U "@"(0]8^@P`hp e Ze Y e@lHppP|X-` `m `m 'p Pз`php`xP    .( gF kt (d08@HtPX`thpxTdTdt4!""d$%&$0 1(10182@;H;P;X<`D<ht<p<x=$>T>>?ABBF$ITKKKLPLTOQRUW4X (dX0$Y8Y@YHZP0ZX[`]h@_p0`xPacee4ggijldm$ptpuy${{Pt (0p8@0H PdX`PhPp@xД$$Է@@Ttt (08@$HPX`$hTpxtd$$P44p@d @(00$8@HPXT`hpx4>KK ab\c $(,ǒ0Ԓ48i<ҡ@PDSHŭLɯPTX\`dhlpJt<xI|N[$Z*,F@G: .((P0G8:H.0PXG`:p.TxG:.tF /F( UT$](z,={0648<@DH<L;PTYy @i Y$(,7048!<R@ D H L P TX\T`d/hlptx|$X%4'iZ"!e"#$%+G111T23<<[==8>>\?p@NAAA wDuGIaKK K$KN(UP,R0T4V8W<W@WDXHXLYP=YTYXZ\Z`"\d^h_l `patax0a|aeeifgNh,jl$mnpPpHtmwzP{)~~Ă3<ގߐ/G͑-8p zIco ޶$(,04]8<@DHILPZTRX\;`adhlptx|LY:JTE52b7z Q@<t d $t(,04u8<@D HLP5TX.\e`d h l) p t x* |   _    u    @u)v7al#X@3o k t$(,048W<r@DHLPTX\`-dThllptxM|x3;Bd9T 7dptSm  w $ ( , 0!4!84!<O!@q!D!H!L"P,"T4"X<"\H"`T"d"h"l"p"t"x"|"""z####)$<$d$%%%t%%"&j&&&&&d'''6)W)j)*{**++:+F+w+++ +,,[,g,, 4-$f-(-,-0-4-8.< .@+.DA.H.L.P.T.X/\4/`c/du/h/l/p/t/x 0|$0_0001-1111M2223&4C4X4v4445C6K66666 7,767N7X7j7777<8 89999 9$?:(:, ;0;4-;8H;<R;@\;D;H;L;P<TD<Xt<\<`<d0=hf=l=p=t=x$>|T>>>@?a??@@@ABBC?DFFFGGGGHeHHHHHI$IIIJ9KTKKK LPLMMN N$N(!O,;O0TO4O8,P<-Q@QDQH[RLqRPRTRXR\US`TdyThTlTpUUt~UxU|U"V/VfVVVVVW7WcWWWWX4XdXXXXX$YLYTYYYYZ0ZZZ[[[\\ ]]^E^_ @_$_(_,_00`4`8`<`@PaDaH(bLabPbTbX"c\8c`Qcd{chclcpctcx>d|adddd,e?eheeee2ffffffgg4ghggg\hhhii-i5iGi\iiiijj FjQjjMll l$m(;m,dm0n4o8o<$p@8pDtpHpLqPsrTrXr\s`sdshslptptttx&u|>uxuuuvBwwxxxyyy&zYzazizzz{${{|~P߁(~d2 ч';U .$(S,]048ӊ<@$D3HLPËTXӌ\`tdhȍlgptxĎ|Ɏ֎4pя0 dzđPڒ P“  @ X   Д  ޖ $ Η( , a0 4 8 < ՚@ D +H L P T OX e\ ` d h xl p t Ϡx נ| ߠ  $ O W _     #   â   $ . [   i  צ     Ҫ   3      " C ۬ M  $ s( , 0 ׯ4 8 < G@ OD ӱH L P T  X в\ ` id h l гp t !x m| ɴ   X    ! <     Է  @ ɸ    0   t 5    > E c   ! 3 E i {  % v $ ( , 0 *4 D8 < @ %D @H L P T X 5\ T` d h rl p t x |    n    % - 7 P Z    $ 7 D e     < a           # N t   ( D$ f( x, 0 4 8 < @ D BH ZL _P T X \ ` !d vh l p t x |  m ~    d   $ O y    - D n     & ?       $ T l       ! C \$ ( ', >0 [4 s8 < @ D H HL RP tT X \ ` Ad h l p t  x -| M ` u       $ < _ n v        u           $ R $(,0$4)8?<W@DHLPTPXs\`dhlp8tyx|8 (k 1l4Qp4> p !$@(u,048<k@vDHLPTX\`gdhl'p@tdx|@Px0w$m2EQpGz x C$K(j,t048<@D$HjLPTXE\w`dhlptTxy|iAm|+\h&d8d 4 H$Y(,0 4%8*</@DaHrL}PTX\`dhlpt2xT|fr%W)FZ"Jtd/  $0(9,Q0c4u8<@DHL P T4XS\]`vdhlptxp` ` 0 2$ >(P>,?0A4B8B<F@PKDKHKLPOP`XT YXY\c`0gdgh plupyt {x|  0P0 RUW Y$^(`,~048<@DHLPT X \ `;d>h@lEpPtnxp|RUWY^`{}   6 7$<(@,U0X48<@DHLPTX\%`(d!h&l:p@tUxX|RWjp                       ! % +         & + $- (2 ,; 0? 4F 8 < @ D H L P T X \ ` dh l ptx|PQRTYq  $(,048<.@/D4HMLePfTgXl\p`dhlptx| $MNS`v{}~ %)ad |$}(~,048<@DHLPTX\`dhlptx|LQZaik{|} ?@^`z{#$)|   $!(&,40@48<@DHLPTX\`dhUlVpXt]x|$%*GPu49>@bp$%',APnp_`u x $ (;,@0Y4`8{<@DHLP T"X'\!` !d:!hJ!l!p!t!x!|! " "]"^"c"d"e"j"p""""### ##&#+#-#7#8#<#@########$A$P$j$ m$$% %% %$%(%,%0%4%8%<%@&D&H&L'P'T'X'\'`'d+h+l+p+t+x+|++00+030507080<0C0:1>1?1A1C1E1G1L1i1p1111122223$3h;p;;;; ;;<)<0< [<$`<(<,<0<4<8<<=@E=DF=HO=LP=PQ=TV=XZ=\[=``=dp=h=l=p=t=x=|===>>=>@>Z>>>>>>>[?\?a?o?p??????i@j@l@n@p@u@GAHAJA LA NA SA vA A A B B B$ B( B, B0 B4 mD8 pD< qD@ sDD uDH wDL |DP FT FX F\ F` Fd Fh Fl Fp Ft kGx lG| mG oG qG sG uG zG I I +I 6I 8I :I >I FI MI I I I I I I I I >K @K fK pK K K N BN CN EN$ GN( IN, KN0 PN4 @O8 [O< ]O@ _OD aOH bOL cOP gOT KPX LP\ MP` OPd QPh SPl UPp ZPt Qx Q| Q Q Q Q R R R R R R R R R R R T T T T T T T T U U U U U U U U V V V V V V V hW pW X  X$ BX( PX, kX0 zX4 ~X8 X< X@ XD XH XL XP YT YX Y\ Y`  Yd Yh *Yl +Yp Z ?Z CZ Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z [  [  [  [ [ [ [ \$ \( \, \0 \4  \8 "\< '\@ \D \H \L \P \T \X \\ \` \d ]h ]l ]p ]t ]x ]| ] #] ^ ^ ^ ^ ^ ^ ^ ^ $_ 0_ G_ I_ K_ M_ N_ O_ S_ _ _ _ _ _ _ _ _ ` ` ` `  `  `  ` ` `  ` 7` 9` >` C` D`$ E`( `, `0 `4 a8 a< a@  aD  aH aL aP aT aX a\ a` "ad #ah 'al )ap .at 0ax 5a| t?t@tBtDtFtHtMtuuuuuuuuvcwdwewgwiwkwmwrwy yyy!y"y &y$*y(z,z0z4z8z<z@zDzH{L{P*{TP{XU{\{`{d{h{l{p{t{x{|}}~ ~!~#~%~'~)~.~~~~~~~~~l*@@WY[]^bi‚ Ăɂcp $(,048<@DHLPTXȋ\Ћ`dhlp+t/x1|38T`{03468:<AlގLQ`vƏˏ  6 9$ߐ(,04L8P<j@tD̑H͑LґPTX>\@`WdXhYl]p|tx|/568=@WY[\]glnprw"0G HI $(,֔048<p@uDHLPTX\`dhlp*t+x/|xyzGHINqvw|+-/126:!%&(*, .3 $(,04ǥ8Х<@DHLPTX(\@`YdZh[l]p_taxc|h4@ !"fgikmot{|նضڶܶ޶  $(,048<@"D0HGLIPNTPXQ\R`cdShTlUpWtYx[|]b*0GOPZ :@[bglmnus y|} $(,048 <^@cDlHpLPTX\`dh l ptx|<@ACEGINS`PQRTVXZ_Q RWhp $(,048<@DHLPTX\`dhlptx|AG`af  aik5@de  $ (,048<%@DHLPTX\`Wd`h{l}ptx|45?CDFHJLQ* .c $(,048<@DH+L,P-T/X1\3`5d:h=l@pWtXxY|] OPQSUWY^7:?  $(,04 8;<F@QDHLPTX\`dhl pYt`xw|y{0GQS\`>?ACEJ /013 5$:(,048<@DHLPTX\`dh2l7pItPxj| $0Fot 79;=>?C  $(+,-054788<<@WDZH\L^P`TbXg\`dhlptx|      $(,0484<5@7D<H@L[PiTjX\`dhlptx| IJLNPU#vw|}~  $(,048<@uDvHwLyP{T}X\`dhlptx| :  %(-058@- z   $ (,048<@DHLPTXV\``zd@hElPpqtrx|A = 00$v(1042<@lH*LlTXm`dnlpox|$34F }>> ?$u@(0B4|D8k @PDDEH PQTRXg `d8hk p(tx -4;r?#lVbg!p3 $i(0438@įDH!PTwX`6d^hpMtɻxZ  WYk!W!b^ $?( 048 ` (P0p8@H`PX`@hpx@p     p` @ `(08@@HPXP`hp@xpPp` @` !!p"#P$$&0p1112p; ;(;0<80<@`<H<Pp=X>`@>h>pp?xABBFI@KpKKL@L@OQRUpW XPXYpYYY  Z(Z0]80_@ `H@aPcXe`eh gpgxpijlPmp`puy{{@pЋ`` P (@0@80@HPX`hХpx00@p`pp @(0`8@HPX@`hpx  `0P0 @  (08@HPX``Php 0!(0G      ( H P p x  # / # 2 5 9  5  >8  @  C`  Jh  N          #  /8  5@  9`  h            R  `8  @  f`  mh  r          J  v8  R@  z`  Jh    m  r        0  8  X  `            8 @   p@`)""`)`8"@")k"") 8"@" )" ")F8"@@" )@g"`" &0k@WP`K"  @"H"P"X"``"@h" p"x""" G N X e  o@ {`     "@"   @ `@hp""""""""0"08"0H"HP"H` p0G""""""""p` P (P@kH0`h0Fg"""" "("0"  "0)08)0@x`hpx" ))x P" ))x ( 0 8@" P)PX)P`x " ))x P" )) x@H #PpX`" p)px)px (0` xP@&e `8}@IHkP[p4jWX"@X`hKp;5X)5 DD E$P(E,05R48CR<@aDHLPhTXv\`dPhƌlptx|P}g4p4}Pp 0 0@Pv 0RYp1 0yp; 0@L 02 R0V 0j`Up 0Y 0j 0 {6 00 @Pv 0K `p 0`@` 0[ F 0SPv 0 0P 0$ 1 4ǖ 5' 5 7j ' 2. 4V7Z 4>f 4p 4P~ 4_  4-R 4 4V# 4qW 4t 4 4=$ 4u 4% 4 4w 4=v 4P| 4 4C 4 4N 4 4^ 4 4P 4; 4 4( 4$4 4O@ 4[L 47d 4.k 4\p 4| 4g 4 4G" 4 4[b 43J 4 4 4X 4m 4C- 4 4 4Z) 4`: 4z1F 4LR 4q1^ 4j 47v 4&  4 4 4=! 4$ 4R| 4, 4R| 42 4c 4u  4)% 4%2 4I;E 4R 4u _ 4f 4: 4u  4 4b 4 4f 4G  4w 4W' 44 4A 4N 4_j[ 41h 4au 4 4[ 4* 4 4 4v 4 4. 4 4 4u ! 4. 44; 4[ 4Ie 4r 4p 4* 4< 4 4% 4eX 4 4 4!O+ 4 9 4G 4U 4u c 4Sq 4 4MX 4 4  4S 46 4* 4  4 4 4V  4eX 4v/* 4k8 4uF 4āT 4~b 4cp 4y~ 4 4 4@ 4 4 4Q 4j 45 4  4@ 4ʹ/ 4 > 4-^ 4@m 4l| 4 4 4{5 4% 4 4& 4 4B 4 49 4=! 4'0 4;? 4N 4c*] 4Vql 4l{ 4 4$  4' 4D 4נ 4' 4: 43 4- 4+ 4_+ 4 / 4> 4 M 4ya\ 4k 45z 4 4WH 4K/ 4C 4 4- 4 4-0 4 49 4$ 4 ; 4IH 4$hv 4 4aQ 4T 4@ 4 4. 4[& 4 4 4-$ 4J1 4-? 4[zK 4X 4e 4Hr 4$ 4\ 4d 4au 4 4 4 4  4 4 & 44 4Q 4] 4 j 4Ivw 49 4c 4a 4!1 4 4 4au 4 4e 4K 4 4! 4 46 4C 4P 4!] 4jj 4 4P 4 4 4S 4H 4 4au 4)0 4> 4L 4)Z 4h 4Vv 4 4 4~& 4x 4 4 4c 4) 4 4 4G0 4W3 4*, 4: 4H 4kV 4yd 4Zr 4@ 4{ 4U. 4X 4 4W 4| 4 4 4 4g 4H  4a- 4r: 4 G 4auU 4Be 4$k 4q 4w 4} 4z6 4 4ة 4 4 4k 4 4/ 4F 4 4V) 4  4> 4 b 4- 4{ 4" 490 4j > 49(L 4Z 4auh 4v 4" 4 4]= 4L 4I1 4 4x 4t 4* 4N 4 4J 4{Y 4ҳh 4 x 4bN 4GN 4 4B 4+3 4 4 4 4 4mi 4 4- 4T8< 4$K 4oZ 4i 4x 46 4f 4 4] 46 4 4 4" 4 4{ 4u 4(, 4; 4WJ 4Y 4*/h 4w 4f 4eT 4 41 4 4 4/ 4uK/ 4X/ 4/e/ 4?us/ 4/ 4/ 4/ 4'/ 4/ 4Iz/ 4/ 4* 0 4ag0 4d)0 4K-70 4;S0 4Ka0 4o0 47}0 4<0 4p0 4c 0 4@0 40 4O0 4.1 4l81 4M1 4u[1 4o1 4Q}1 4̩1 4v1 4;1 4`.1 41 4k1 41 4!1 4e1 4 0 2 4{ 2 4_&2 4ѷ42 4=EM2 4#Z2 4U&g2 4oz2 4oZ2 42 4o 2 4 3 4h3 43 4Q3 4V!4 4*&4 40p34 4@4 4:M4 4j!4 4^4 44 485 4,5 4O 5 495 4fsF5 4*S5 4 v5 4 5 45 4!=5 4x5 4$%5 45 4?5 4ea 6 4`6 4*6 4E86 4uE6 4@S6 4R[r6 4(6 4W6 46 46 4v96 46 4.6 4)6 4.7 4o7 4&7 447 4tB7 449b7 4p7 4l~7 4(7 4I7 4B7 44*7 4q7 4&x7 4j7 4W8 4a 8 4-8 4$:8 4u G8 4(8 4Q8 48 4'8 48 48 48 4Z9 4+?9 42!9 4b</9 4x=9 4K9 4%zY9 4cOu9 4Q9 49 49 49 4Y29 4b89 49 4j9 49 4*: 4r: 4 /?: 4N: 4O ]: 4#l: 4${: 4^: 4y$: 4!: 4: 4_: 4: 4!: 4; 4U; 4.; 4=; 4L; 4[; 4j; 4"y; 4; 4qy; 4˝; 4V; 4`; 4+; 4o; 4 ; 4< 4< 4G< 4(.< 4 =< 4:i< 4x< 4f< 4_)< 4< 4-< 4&< 4)< 4B< 4 f< 4O < 48= 4`= 4p-= 477= 4D= 4auQ= 4p-^= 4hy= 4= 4$h= 4= 4= 4[&= 495= 4_= 4w<= 4> 4]<$> 4y?> 4WRR> 43j`> 4n> 4G|> 4,> 4>> 43> 4+> 4> 4a> 4M> 4> 41> 4jw ? 4? 4)? 4P7? 4K E? 4ES? 4V_? 4l? 4auy? 4V>? 4? 4{? 4Y? 4S*? 4? 4L? 4 @ 4@ 4$@ 4I;2@ 4>?@ 4u L@ 4fd@ 4q@ 47@ 4 @ 4 )@ 4@ 4zQ@ 4@ 4@ 4@ 4@ 4@ 4iA 4A 45A 4)HA 4fA 4yA 4A 4`TA 4eXA 44A 4A 4A 4 B 4!B 4%B 4Uk2B 4@ ?B 4LB 4YB 4fB 4rsB 4RSB 47rB 4u8B 4:B 4XB 4^-B 4B 4B 4C 4C 4&C 4A4C 4BC 4PC 4*^C 4#lC 4, zC 4{ C 4B"C 4;C 4C 4C 4@&C 4 C 4qC 4C 4 D 4JRD 4o.(D 46D 4:0DD 4RD 4`D 4nD 4|D 4/D 4D 4qD 4LD 4D 4D 4#2D 4$D 4D 4!E 4E 4%E 4>4E 4CXLE 4^][E 4jE 4)yE 4E 4FE 4)E 4E 4 4E 4E 4.E 4nF 4F 4. F 4QaEF 4;ARF 4S_F 4lF 4yF 4F 4mF 4F 4]yF 4wF 4(F 4F 4/oF 4:F 4G 4G 4($G 42G 4MA@G 41NG 4l\G 4cjG 4xG 4F{G 4CG 4/G 4)ZG 4\G 4)hG 4 G 4#G 4UG 4zH 4@H 4p H 4z.H 4SuZ 44LZ 4hZZ 4 hZ 4[vZ 4 Z 4}Z 4gZ 4pOZ 4Z 4%Z 4^Z 4#Z 4)Z 4i[ 4[ 4O![ 4[/[ 4\=[ 4:K[ 4=eY[ 4g[ 4u[ 4W/[ 4c[ 4[ 4[ 4[ 4&[ 4>[ 44![ 4_[ 4(\ 4h3\ 4\ 4z+\ 4]9\ 4G\ 4U\ 40Kc\ 4Rr\ 4 \ 4H\ 4^\ 4 \ 4>l\ 4K\ 4\ 4t\ 4{\ 4$] 4] 47] 4+] 4t*9] 4߼G] 4p=U] 4c] 4Wq] 4j] 4!] 4 N] 4o] 4] 4 N] 4j] 4] 4^ 4F^ 4ɡ^ 4t*^ 4#8^ 4L^ 4r^ 40^ 4F^ 4(^ 4_^ 4e^ 4e^ 4t^ 4^ 4 ^ 4au^ 4,I_ 4._ 4R/_ 4F?_ 4{O_ 4n__ 46o_ 4_ 48_ 4ڛ_ 4_ 4_ 4_ 4` 4lm` 4*` 4,` 420;` 4U` 4](c` 4q` 4fA` 4j` 4G` 4` 4u ` 4s` 4ҳ` 4ia 41Za 4)a 4$7a 4)Ea 4Sa 4ћaa 4oa 4}a 4da 4a 4_a 4fa 4aua 4 a 4pa 4/a 4a 4Fb 4)b 46b 4Cb 4b9]b 4eTjb 4qwb 4jkb 4b 4b 47qb 45b 4Ĵb 4c 4#c 4*0c 4+p=c 4VJc 4~Wc 4dc 48kqc 4L~c 4c 4$Gc 4Dc 4TTc 4Gc 4)c 4c 4hc 4ac 48d 4+ d 46d 4K'd 4qSd 4`d 4$td 4d 4+d 48d 4Kd 4Bd 4(d 4W d 4 e 4au"e 46e 4%@e 4YJe 4H?Te 42^e 4Kke 4xe 4ve 4%e 4ve 4!e 4e 4e 4e 4we 4e 4f 4 f 4uf 4d(f 45f 4@xBf 4vOf 4.\f 4if 4ƞvf 4f 4f 4kf 4auf 4f 4f 4 f 4f 43xf 4f 4Fa g 4#g 41g 4'?g 4/Mg 4Ϩ[g 4ig 4 Gg 4-g 4vg 4g 4Hg 4g 4'g 4Wg 4&g 4=h 4h 4.(h 4-h 40W;h 4 Ih 4OWh 40^eh 4sh 4hh 4h 4ݽh 4r5h 4h 4h 4Oh 4h 4>h 4Eh 4 i 4i 4)i 4a7i 4Ei 4w|Si 4iVai 4<oi 4Wi 4i 4Qi 4i 4yi 4,i 4Ei 4i 4Ti 4Li 4$hj 4(j 4*j 48j 4 -Fj 4Tj 4=bj 4pj 4~j 4Uj 4"j 4*=j 4O j 4\j 4j 4j 4?j 4j 4k 4 k 4&k 44k 4Ak 4O Nk 42[k 4Ghk 4vk 4eTk 4|Uk 4 k 4k 4k 4[k 43k 4R.k 4k 4"l 4il 4^%l 44l 4t0Cl 4Rl 4)al 4:wl 4|l 4l 4V l 4ݷl 4al 4l 4l 4l 4m 4m 4m 47-m 4;m 4 Im 4b|Wm 4=em 4sm 4M6m 4Tm 4cm 4O m 4#nm 4em 41_m 4lm 4m 4m 4 n 4n 4ʄ)n 4:8n 4mLn 4bVn 4sun 4:n 4n 4n 4n 4 n 4n 4|o 4(o 4H o 4y.o 4ݨq 4Kq 4auYq 4gq 4Auq 43'q 4q 4Kq 4/q 4-q 4lq 4#q 4r 46zr 4r 4*r 48r 4|Fr 41 Tr 4 br 4pr 4r 4r 4-r 4 r 4ir 4$r 4r 4r 4j s 4j s 4l-s 4:s 4LmGs 4uZs 4?*gs 4u ts 4Ys 4Ws 4aus 4ts 4s 4Vs 4i+s 4's 4Vs 4"s 4/t 4"t 4/t 4$w 4arew 4Wrw 4wow 4@w 4w 4Ew 4rw 4tw 4'w 41 w 4sew 4h"w 4Fx 4x 4x 4E)x 46x 4Dx 4cQx 4w}x 4Dx 4[x 4]x 4Gx 4ћx 4rFx 4.y 4V*y 4#y 4.0y 4=y 4+Jy 4Wy 4audy 4O qy 47qy 4Yy 4V y 4y 4eXy 4'y 4wz 4z 4I;*z 47z 4u Dz 4f\z 4iz 4O |z 48z 4jz 4ͯz 4wKz 4 z 4ޒz 4.z 4z 4{ 4[&{ 495,{ 4]>{ 4EpK{ 4X{ 4je{ 4r{ 4{ 4{ 4{ 4{{ 4{ 4'{ 4{ 4 | 4vS| 4* | 4M| 4 Z| 4Lg| 4|t| 4O| 4| 4au| 4a&| 4| 4̒| 4 | 4 } 4@} 4{&} 43} 4x@} 4M} 4\} 4Fk} 4+y} 4 } 4 } 4} 4 } 4(} 4} 4~ 4,~ 4d "~ 4-/~ 4%I~ 4ǺV~ 4i~ 4-Cv~ 4;~ 4~ 4$&~ 4y~ 4~ 4L~ 4~ 4{~ 4~ 4|~ 4Mc 4x 4 4, 49 4#F 4:S 4 ` 44n 4| 4j 4 4 4oA 4df 4 4/- 4  4C+ 4*8 4 O 4>\ 4 s 4n 4 4 | 4  4΀ 4V^ۀ 4 4Ŏ 4 4  4 4} 4X% 4y, 4%< 4*B 4H 4QN 4TU 4߾b 4o 4%| 4!c 4!c 4 4 4Ysρ 4 4Y 4߾ 4 49($ 461 4F9> 4K 4u f 4F~ 4F 4O 4B 4Lς 4Lق 4s 4 4 4V 4$ 41 4޲> 4X 4aue 4r 4 , 4L 4 4w 4j 4 4L˃ 4؃ 4W 4O 4 4 4 & 43 46@ 4=~M 4Z 4 g 4kt 48 4 4 4 4 4%0̅ 4F߅ 4n 4\ 4&. 4E 4u8 47qE 4R 4au_ 4y 4 4 4:҆ 4+ކ 4 4}> 4) 4a_ 4V>l 4T1 4au 4. 4& 4ȇ 4և 4(` 4 4{ 4q* 4 8 4F 4T 4!b 4w 4 4 4y 43Ĉ 4$+҈ 4 4D 4 4A 48%9 4!H 41q 4 4 4ob 4? 4 4ɉ 4׉ 4Y 4$ 4a 4~ 4' 4.1 4I? 4M 4׭[ 4i 4aw 4 4=E 4& 4 ̊ 4ڊ 4eX 4 I 4 4< 4" 40 4"> 4L 4e 4os 48* 4 4 4,ދ 4( 4 4" 4 4p& 434 4B 4oP 4GG^ 4l 4Ez 4 4Ϻ 4o 4a 4eX 4M+Ό 4WN܌ 4 4, 4e) 4eD 4B] 4V k 4y 4V* 4 4_- 4ƍ 4ԍ 4 4 4'6 4 4( 46 4D 4R 4` 4n 4| 4 4b  4z+ 4: 4EFŽ 4ю 4 4 4`. 4# 4? 43+ 4-: 4o^I 4rrX 4g 4v 4M 4' 4 43 4Џ 4Yߏ 4E" 4b 4 4 4>* 4M9 4auH 4JW 4f 4u 46 4- 4 4>c 4 4yϐ 4ސ 4ѻ 4B 4& 4 4) 48 4[wG 4VYV 4 4 4w 4 4 Ǒ 4ڑՑ 4S 4 4M 4 4auM 4%[ 4 4Tr 4. 4 4c 4 4  4}FÒ 4ɒ 4ϒ 4+Ւ 4ܒ 4^ 4L 4jv 4 4 4}z 4jH 4 4! 4c' 4- 43 4Ag9 4? 4*E 4K 4!NQ 4?*W 4k~] 4c 4Gi 4o 4P+u 4{ 4 4$ 4I 4 4I* 4 4k 4x 4U 4x 4, 4Ó 4ɓ 4iKϓ 4Փ 4$ۓ 4. 4 4 42 4Q 4 4< 4dc 4R' 4P4 4A 4 O 4+\ 4a~i 4+ 4} 4 4 4^+ 4ʦΔ 4Vݔ 4nj 4gy 4r 4 4-2( 4pU 4V 46 4L 4$h# 4G1 4f 4tt 4 4 4V 4Q 4 5Ȗ 4֖ 4H 4 46L 4^ 4m 4, 4: 4#H 4auV 4d 4's 4 4× 4!ߗ 4 4S 40 4@ 4N 4\ 4Qj 4x 4 4+ 4au 4 4 4 ̘ 46L 4E_ 4~ 45 4e(D 41R 45` 4f 4| 4N 4 4" 4 4:8 4 4Iř 4'ә 4T 44 4 4\ 4; 4' 4Z 5 4mC 4YQ 45_ 4hSm 4{ 4H7 4T 4/ 4[x 4 4eXϚ 4ݚ 4 4n 4  4+ 4' 4au6 4E 4 U 4Id 4 4fƭ 4'Lӭ 4 4 4 4 4.( 4:& 44 4hB 4,P 4q^ 4l 4~z 4i 4 4g 4 4V`® 4bЮ 4ޮ 4 4`M 4ĵ 4 4& 43 4#nA 4PN 4[ [ 4rh 4u 4 4HQ 4h 4 4 oƯ 4tԯ 4 401 4I= 4YR 4^ 4Ts 47 4.Y 4b" 4auͰ 40ݰ 4Y 4# 4 4 4,# 4!_1 4,? 4M 4\[ 4\i 42Rw 4: 4[ 4 40 4- 4˱ 4ٱ 4 4: 4 4#! 4Z\0 4? 4N 4Xk 4z 4 4 4 4 4~;Ų 4Բ 4 4) 4I 42 4 4;. 4?= 4L 4[ 4,x 4N 4 4 473 4ó 4ҳ 4ܸ 4: 4 4 4(, 4*; 4LJ 4Y 4Ih 4xw 4 4 4?մ 4. 4 4 4U 4% 42 4? 4W3L 4tY 4 g 4 4Ѧ 4< 4 4lG 4\õ 4BYɵ 4= ϵ 4&յ 4۵ 4+ 4 4 4* 4/ 4 4 4H 4 4{P 4Ii 4F# 4P? 4K 4Y 4g 4$u 4+ 4,A 4 4\ 49 4Ŷ 4˶ 4 Ѷ 4w׶ 4ݶ 4 48 4{ 4 4$ 4h* 40 4T6 4)< 4lL 4-Z 4f 4us 4ā 4v  43 4 4,η 4Yjܷ 4x 4l 4f 4V> 4JB" 4<@ 4L 43b 4qn 4J{ 4]% 4= 4 47 4ɸ 4׸ 4X 4. 4W 46  4u# 41 4X? 4M 4P[ 4i 4}w 4w 4 4 4 4 ӹ 4t߹ 4ZX 4 \ 4qJ 4 4q/ 4< 4O 4] 4qhj 4w 4S 4 43P 4c 4 43`ź 4<{Һ 41 49 4{ 4 4  4! 4v$. 4@K; 4H 4U 44!c 4q 4 4  4r 4KK 44 4E˻ 47ٻ 4 4 4T 4E 4 4K~ 4(g 4' 4 43 4ļ 48Ҽ 4z 4+ 4b 4 4ε 4K 4 4 4(Ͻ 4ݽ 4ce 4} 4 4fr 4z# 4We1 4? 4M 4 [ 4i 4/ w 4" 4b\ 4f 4au 4 4Q)̾ 4vھ 4 4w 4 4r 4Ə/ 4R= 4o K 40%j 4x 43 4* 4} 4% 4) 49̿ 4ڿ 4 4/ 4&o 4H 43! 4{/ 4 = 4zK 4Y 4g 4u 4 4e[ 4i 4auw 4 4 h 4* 4 4< 4Ռ 41" 4!0 45m 4D{ 4w 4y 4{. 4 45 4~+ 4 4^ 4` 44@ 4 4# 4x1 4Z? 4M 4w[ 4i 4w 4v] 42 4. 4M 4 4 4# 4cC 4 4 4 - 4< 4)K 4oZ 47i 4Yx 4 4V 4+ 4& 4 4 4 4z 4Ik 4 4 4C 4D 4 4. 4O; 4# 4  4 4| 4 4 4# 4g 4  4B1 4F> 44W 4*d 4T} 4 4 4^ 4n 4 45 4L 4 4K 4% 4+ 4> 4PN 4(\ 4jj 4x 4. 4g 4 4 4s 4 4o  4 4I 4^ 46 4 4<,. 4< 4J 4ܓX 4Zf 4Rt 4Z 4I` 4 4R 4< 4 4z 4Vm 4 4> 4 4- 4B: 4RG 4U 4 !c 4>q 4 4 49 4 4D 4s 4 43 4l 4 4 4 4-' 4;5 4C 4yQ 4 _ 4m 4 _{ 4 4< 4 4h 4W4 4  4 4 4  4+p" 4 1 4xD? 4M 4W[ 4@i 4w 4 4b 4t 4e& 4o 4T 4ˬ 4b 4S 4p 4h- 4; 4I 4W 4e 4> z 4$ 4l 4S 4z 4_ 4 4 4 4 4{"! 44&/ 4Ct= 4K 4OY 40kg 4¨u 4's 4D 4QF 4{_ 4 4S! 4 4 4{ 4q 47. 4W 4"+ 499 4lG 4^j 4Rw 44 4 43 4 43l 4V; 4H 4P 4 4au 4# 4eX 47, 4au9 4V u 4s 4 4^5 47 4 4  4 4 4@ 42' 4 4i- 4(c% 4j2 4? 4hL 4Y 4o%f 4us 4m 4 4 4 4Ք 4\ 4 4g 4* 4F 4Ӹ 4$ 4D1 4-> 4zK 4FX 4e 4r 4A 4# 45 42 4 4o 4 4 4 4Fb 4Tl+ 4)5 4e_ 4X 4 4N 4-X 4'f 4@t 4 4 4} 4r 4Y 4d_l 4P 4 4W 4 4 40f 4& 4i 4/ 4< 4I 4V> 4= 4 4b 4( 4P 44a 4g 4m 4 4t 4V( 4?& 4q3 4m@ 4M 46Z 4g 4Ĵ 4-" 48 4G 44 4֞ 4\ 4A 4o 4= 4 4# 4/ 4"< 4eXI 4c 4aup 4 4 4eX 4{ 4! 4: 4 4" 4z81 4b@ 4/"O 4i^ 4Sx 4a 4eX 4 4- 4Q4 43 4v 4[ 4 4S$ 4?r1 4> 4tK 4eX 4e 4xy 4 4 4 4f% 4v 4.> 4 4 4 4t 4Q@ 4 4 4e 4E 4 4# 4F 4M 4 4L 4 4W 4w 4 4s 4" 4ћ 4 4  4! 4_. 4:Z 4 4Z 4G 44 4a 4J$ 4 4K 4Z 4ǂ 4y!! 4. 420; 4!H 4eXn 4y{ 4au 4= 4* 4]% 4 4 4W 4?- 4% 43 4W3A 4gO 4w] 4uk 4+y 4V 4 4 4 4 4 4 4ܴ 4 4 4( 4\A 4N 4[ 4*i 4w 4A 4Ϗ 4V 48 4 4W' 4R 4k 4 4| 4 4] 4^ 4 4{ 4 4 4`J 4* 4> 4K 4eXX 4=o 4?{ 4g 4 4 4W 4V> 4 4V 4| 4 4 4 4T 4pb 4(p 4 4: 4V 4 4 4 4$ 4W3& 4p3 4@ 4M 4OZ 4}o 4  4B 4ǃ 4 4k)` 4ǭm 4Bz 4eX 4; 4&} 44 4(K 4J 4Z 4c` 4\f 4Tl 4r 4my 4# 4W 4M  4ɴ 4v 4h 4z 4  4, 4l 4 4eY 4SK 4e2 4O 4L{ 4S 4Y 4f 4q 4 4( 4Nt 4 4} 4 4m}& 4X, 4^2 4?8 4> 4D 4rTJ 4P 4V 4w\ 40b 4$qi 4zz 4, 4 4 4 4 4E 4 4M0 4$e 4A 486 4P 4 4 4 45) 4 - 41 4 4a 4:  4ƫ 4 4 4 4h 4 42" 4( 4{ . 4=]4 4": 4@ 4,G 4X 4Q^ 4qgd 4j 41p 4v 4p| 4) 4 4 4>n 4 4h 4PD 4t 4if 4 4 4 4; 4 4s 4N 4+ 47 40 4% 4n 48 4U 4* 4 4/ 4 4$ 4* 40 4 6 4A`< 4uB 4WZH 4N 4=T 4>Z 44` 4f 4%l 4r 4x 4C ~ 4 4 4~ 4\# 4( 4i/ 4~y 4 4 4 4z 4C 4} 4 4p 4& 4q@ 4 4 4  4* 4C 4g 4 4d 4& 4uG 4U 48c 4)q 4  4 4r 4Y 4 4 4  4X 4 4' 4O 4<[ 4w3 4*A 4H\ 4 4au 4 4Qz 4,_ 4u 4 4 4 ~ 4au 4p% 4D? 4M 4"[ 4=j 4g^y 4C$ 4v 4W 4 4(' 4 4 4J 4ؤ 4ԡ 4n 4F8# 4r1 4@ 4'N 4}b 4zp 4#b 4O\ 4 4M 4H+\ 4aux 4 4ʸ 4 4= 4} 4 4 4$ 4 4~& 4*@ 4M 4{he 4)r 4 4 4u 4M  4:  4* 4% 4V 4 4eX# 4S1 4O \ 4k 4ZOy 4m` 4h 4[ 4> 4L 4au 4' 4 4g, 4E: 4NS 4S` 4x 4 4{h 4 4r 4& 4au 4y 4] 4r4 4+B 4O h 4Lv 4"w 4au 4 4 4 4 4g 4' 4r+ 4auR 4_ 4} 4 4+ 4Q 4B 4N 42G 4l  4 4+ 4auK 4(X 4p 4} 4i 4' 4au 4' 4 4' 4au! 4S/ 4= 4auV 4aud 4|t 4 4+ 4M 4* 4j 4} 4f0 4 4 47," 4v/ 4 [< 4I 4f 4fu 4H 4 4 4+ 4] 4 4= 4]) 4)i 4v 4#n 42 4_  4 4 4 4=( 4L6 4"wD 4au] 4]l 4z 4au 4d 4r 4 4g 4' 4r 4fn 4 4au/ 4;> 4XL 41Z 4O s 4 4X 41 4Y 4d 4O  4f 4X 4O  42 4% 4O ? 4!cM 4[ 4d i 4Ϗ 4 4 4 4 4 4= 4 4}% 4N2 4? 4%M 4Tg 4!t 42G 4B  4l  4Q 4 4 4p 4 4 4ގ  4D. 4= 4K 4DY 4i,g 4qu 4x 4 44 4J 4; 4 4u  4] 4c,* 4u = 4mJ 4W 4xj 4&w 4 4x 4E  4& 4" 4æ 4J 4@ 49g 4  4r 4\2 4P 4g 4  4) 4 4 4"W 42 4* 4u  4K 4ك  4_'  4Z  4G)  46  4C  490P  4o]  4cj  4&x  4Z  4?  4eX  4B  4  4auP  4]  4j  4"  4ɚ  4  4'  4  4Y  4  4  4=)"  4k$/  4otR  4*U_  4y  4  4R  48  4!  4  4(  4  4/  4M  4)  4&  4  47  4  4c  4E  4;  4  4j  4n  4(  4W6  4VD  4"R  4<`  4n  4  48  4v  4O"  4~  4V  4a 4Ϗ 41 4? 4auM 4[ 4i 4"w 4 4p 4mC 4A 4΅ 4W 4 4 4$) 4*B 49IP 4t^ 4m 4| 4wx 46 4V 43b 4 4Z 4r, 4; 4W 4  4S! 430 4? 4M 4Ji 4 4 420 4 4 4# 4j 4 4y 4V  43- 4@ 4rM 4xZ 4ig 4t 40 4= 4au 4 > 4 4 41  4 4Z 4 u 4$" 4au/ 4gG 4UW 4e 4! 4;_ 4 4 4ab 4$ 4 4 40 4  4. 4: 4W-I 4B X 4)Dg 42v 4g 4] 4 4! 4 4* 4@ 4N 4Y 4 47?) 48 4aG 4(-V 4W3e 4Rt 4 4 4 4p 4 4  4 4[ 4 4$ 4,$ 4Ϗ2 42> 4L 4/Z 4h 4Z|v 4? 4 4U 4I 4 4 4 4; 4 4* 4XV7 4^D 40Q 4^ 4Z|k 4?x 4 4P 4$ 47 4z 4eX 4  4 4% 4:2 4)? 4c%L 4Y 4f 4XVs 4^ 4Z| 4? 4(- 4ɟ 4:$ 4a1 4eX> 4GK 4ɟX 4e 4Dr 4 4a 4'@ 4ä 4O 4}o3  4(F@  4eXM  4(-Z  4;g  4Dt  4W3  4:  4  4<  4`  4  4  4.\  4Y! 4!! 44F/! 4=! 4=L! 4(]! 4`c! 4vi! 4o! 4 v! 44! 4;o! 4r! 4a! 4r!! 4 ! 4! 4F! 4d! 4h! 4 ! 4c" 4" 4$" 4-" 4zL3" 49" 4Y$?" 4(E" 4ЬK" 49Q" 4z`X" 4'i" 4JIo" 47u" 4F|" 4 " 42" 4" 4" 4k&" 4%i" 4@" 4 >" 4j" 4_ # 4C# 4L'# 4F# 4gP# 4Z# 4d# 4Rn# 4c}# 4+# 4i# 4# 4b9# 44# 4# 4# 4$ 4g $ 4'"$ 4J,$ 4:G$ 46U$ 4Kc$ 4Fw$ 4$ 4I;$ 4h"$ 4$ 4z$ 4C$ 45$ 4% 4A% 4gq[% 4^lx% 44% 4S% 43% 4% 4% 4=% 4au% 4Kl& 41& 4-"& 4 F& 4c& 4|s& 4& 4eT& 4& 4!& 4U& 4(j' 4B#' 4!0' 4p=' 4HJ' 4!W' 4gyd' 4q' 4k~' 4Y' 4g' 43' 4(' 48' 4 ' 4' 4G.' 4( 4T( 4=&#( 4q1( 4;?( 4QM( 4[( 4Di( 4I( 4o ( 4( 4( 4( 4) 4-%) 42) 4J$?) 4X) 4aue) 4{3r) 4) 4B) 4) 4!) 4j!) 42) 4e) 4 ) 4j) 4') 4 * 4* 4%* 43* 4عA* 4IdO* 46]* 4]k* 4Wy* 4.B* 41* 4* 4 * 4W3* 4* 4Y* 4S* 4D + 4eX+ 4/&+ 44+ 4B+ 4'P+ 4,^+ 4l+ 4=+ 4 .+ 4+ 4++ 4{+ 4+ 4|+ 4w,+ 4(, 4, 4%", 40, 4?, 4aM, 4[, 4li, 4Gw, 4%, 4$, 4, 4h, 4, 4, 4O - 4jX- 4k*- 4au9- 4%H- 4eXq- 4- 4eX- 4V>- 4.- 4au- 4- 4;- 4N- 4- 4W3 . 4o. 4&. 4g4. 4wB. 4uP. 4+^. 4Cl. 4z. 4. 4. 4X/ 4/ 4P/ 4/ 4 0 4Q0 4~d"0 4/0 4}-<0 47BI0 4V0 4?ic0 4Ep0 4},}0 4 0 430 4Q0 4!0 4ݨ0 40 4w1 4O1 4N 1 4]-1 4:1 4sG1 4U1 4b1 4o1 4W|1 471 4I1 41 4W1 41 4k1 431 4W1 4m1 41 44/1 41 4P1 41 42 4' 2 462 4 O2 4_V\2 4<(i2 4v2 4H2 42 42 42 4`I2 42 42 42 4U3 43 4O3 403 4[<3 4 I3 4*W3 4 c3 4ix3 43 4H3 4 3 43 4 3 4Ǫ3 4&"3 43 413 44 44 44 4*4 4o94 4%H4 4E4W4 4f4 4lu4 44 4[4 4@4 4ʦ4 44 44 4R5 45 42!5 4.5 4D;5 4H5 4.U5 4#yb5 4Mp5 45 45 4S5 45 45 4G%5 4U-5 45 4^6 4)6 45,6 4S86 4!B6 4i6 4 v6 4'6 46 4"6 4V*6 46 4j6 4D6 4 6 46 4 6 4S 7 4%7 4%7 4jJ7 4WW7 4]d7 4&}7 47q7 4V 7 4T17 47 47 48 45O8 4Qy8 4F,8 48 4#n8 48 48 4|.8 49 49 4ɢ#9 409 4%=9 4J9 4DUW9 48Wd9 4 q9 4?(~9 4ed9 4Q9 4=9 4t9 4V9 4_9 49 4%9 49 4: 4P< : 4j: 4;': 4e4: 4EA: 4tCN: 4"[: 4ah: 4u: 4q: 4;: 4R: 4|: 4Y: 4,: 4R: 4: 4k : 4ϊ: 4\; 4:f; 4»$; 4S2; 4 @; 4hN; 4\; 4Z; 4; 4 .; 48; 4; 48; 4); 4 ; 4O< 4 "< 480< 4Y>< 4XL< 4Z< 4'v< 4< 4eX< 43< 4-< 4< 4< 4< 4&< 4l< 4` = 4ܧ= 4%= 4i? 4+y? 4-? 4#? 4ו? 4N? 4? 4m? 4? 4r.? 4@ 4n@ 4} @ 4.@ 4j<@ 4לJ@ 42X@ 4']f@ 4t@ 4I!@ 4@ 4s(@ 4R@ 4@ 4@ 4@ 4L@ 4j@ 4=A 4A 4A 4j*A 4( 8A 4FA 4TA 4ubA 4pA 4`~A 4/A 4A 45QA 4A 4bA 4A 4A 4A 4 A 4  B 4yB 4F:B 4IB 4"XB 4FgB 4-vB 4+B 4X B 4B 4 B 4NB 4eXB 4YB 48B 4B 4X.C 4n*C 49C 4HC 4JWC 4F8fC 4uC 4u(C 4ʹC 4 D 4S$E 4&E 4lE 4|E 4E 4E 4b6E 4}%E 4E 4E 4!E 4ӶE 4E 4 E 4E 4lE 4P(E 4&!E 4sE 4@E 4)F 4F 4F 4}/F 4IF 4VVF 4f,cF 4zF 43F 4$F 4?F 41F 4WF 4F 4 G 4G 4(G 46G 4DG 4j]G 4gG 4ųxG 4~G 46G 4G 4/G 4$G 4 #G 4G 4PUG 4G 4G 4.G 4G 4G 4>G 4A|G 4tG 4M&G 4xG 4G 4G 4+G 4ϪG 4|H 4 H 4[WH 4H 4H 4?&H 4Hy0H 4Z>H 4H 4+H 4-H 4ĶH 45(H 4H 4H 4H 4H 4w'H 4 I 4zI 4%I 4޳3I 4AI 4OI 4/]I 4P|I 4ɓI 4I 4eXI 4aI 4^cI 4- J 4J 4,+J 49J 4WGJ 4FVJ 4nNeJ 4tJ 4ՄJ 4J 4YJ 4B@J 4-J 4R.J 4J 4J 4-K 4au$K 42K 4@K 4yGNK 4J\K 4#"kK 4 fyK 4K 4u K 4auK 4V>K 4eK 4hK 4̀K 4K 4+HK 4{L 4V L 4 !L 4C/L 4 =L 4}OvL 4HL 4lL 4L 4L 4nL 4L 4P" M 4)M 4#(M 4(JM 4MXM 4fM 4 tM 4xM 4M 41M 46M 4}M 44M 4N 4)N 4`=N 4r)GN 4DpN 4]~N 4N 4-N 4eN 4N 4\N 4N 4%QN 48O 40$O 4=PO 4 ^O 4O 4O 4O 4O 4qQO 4-P 4P 4--P 4HP 4:VP 4W3dP 4˶rP 4XP 4P 4HP 4WP 4P 4RP 4|Q 4Q 4Q 4O Q 4NQ 4&R 4HR 4&R 4-JR 4\[R 4NaR 4dgR 4xR 4R 4)R 4R 4$R 4$R 4!R 4R 4 KR 4h7S 4S 42 S 4S 4xS 4ubS 45%S 4_h,S 4fX 4X 4jX 4X 46X 4@9Y 4i?FY 4lY 4yY 4z:Y 4Y 4`nY 4Y 4Y 4xY 4Y 48/Y 4RZ 4v Z 4Z 4mZ 4au+Z 4 8Z 4JEZ 4RZ 4Wf_Z 4zmZ 4yZ 4Z 4Z 4Z 4Z 4W3Z 4=Z 4)Z 4i$Z 4cZ 4l&[ 4q\[ 4#![ 4-/[ 4=[ 4DK[ 4Y[ 4g[ 4bu[ 4p)[ 4![ 4;[ 4t[ 4`![ 4s[ 4[ 4{r[ 4U[ 4\ 4\ 49!\ 4]/\ 4@=\ 4auK\ 4/Y\ 4,Ng\ 48u\ 4Is\ 4x\ 4o\ 4\ 44F\ 4\ 4*\ 4\ 4\ 4T] 4I] 4L] 4+] 4u9] 4BG] 4uU] 47}c] 4 q] 4_] 4] 43] 4] 4[] 4o] 4] 4F] 4] 4] 4 ^ 4^ 4'^ 45^ 4 C^ 4Q^ 4U6_^ 4 n^ 4|^ 4^^ 4^ 4ip^ 4{^ 4q^ 4^ 4 _ 4JM_ 4_ 4'_ 41_ 4M$;_ 4,E_ 4 O_ 4)Y_ 4gc_ 4q_ 4L_ 4$h_ 4RM_ 4n_ 4_ 4S` 4w` 4b[a 4ha 4Aua 4Aa 4Aa 4[a 4a 4a 4aub 4b 4! b 4V>pb 4E>b 4rb 4b 4xb 4$b 4˧b 4b 4b 4' c 4uc 4?%c 4G2c 4 ?c 4l1Lc 4ǣYc 4@fc 4rsc 41c 4c 4Oc 4ic 4c 4c 4d c 4\c 4c 4Id 4>d 4[d 4x49d 4NFd 4Sd 4jznd 4td 4xzd 4Kd 4wd 4d 43d 4td 4d 4MJd 4ad 4e 4e 4e 4%(e 4Tn4e 4Ae 4Ne 4&[e 4he 4ue 4j|e 4re 4e 4Ee 4O e 4e 4ce 4;e 4eX f 4f 4f 4!f 4M+f 4!8f 4Ef 4URf 4a`f 4`mf 4\zf 4f 4f 4g f 4;Jf 42f 4 f 4"f 4V f 4i=f 4 g 4g 4L%g 4,2g 47?g 4p+Rg 4 lg 4V yg 4Fhg 4(g 4Kg 4$g 4}g 4)Bg 4g 4g 4g 4j|h 4sMh 4 "h 41/h 4h 4l1h 4Oh 4ih 4u i 4i 4q)i 47i 4i=Ei 4Si 4cai 4Soi 4i 4ci 4i 4Ji 4K i 4i 4i 4_i 4.i 4i 4i 4jj 4j 4F8j 4tNFj 4dj 4,|j 4/j 4Q j 4j 4ңj 4j 4j 4auk 4Ck 4!k 4/k 4 =k 4,Kk 4S_k 4ܺok 4k 4'k 4k 4k 4 k 4k 4 k 4{k 4k 4r?l 4kl 4ŝ,l 4>9l 4Fl 4*l 4-l 4K m 4m 4"m 4%V.m 4 :m 4'4Fm 4[Rm 48^m 4jm 4vm 4@Pm 4Dm 4cm 4 m 4ammgmn 4nn nF/nX8n 4;'EnpTncn4n 4n`nn}n 4 n@nkno 46H o /o>oP\o 45ioxooo 4so 4o 4o 4) o 4@o 4Co 4\p 4W"p 4,/p 4\Jp 4Xp 4߭xp 4j9p 4A:p 47#p 4p 4@p 4hp 48#p 4p 4^>p 4MGp 4p 44+p 4p 4%,p 4Zp 42<p 4 Mp 4p 4p 4=q 4ɇ q 4q 46q 43Sq 4p#q 4)q 4֚/q 4G5q 4;q 4Aq 4OGq 4Mq 4QSq 4Yq 4_E_q 49pq 4}q 4:q 45 q 41q 4q 4Zoq 4W,q 4<q 47r 4r 4E r 4"<8r 4Gr 4Vr 4jer 4|Ir 4%r 4Gr 4r 4Wr 42r 4*r 4<7r 4?r 4ox s 4 s 4,s 4)  t 4%t 4,t 48 4E 4R 4 {_ 4l 4Vy 4C 4u 4k 4A1 4-ȇ 41և 4 4 4 4b 4l 4v 4Z 4b 4_ 4 4" 4^ 4 Lj 4  4R 4;  4 4f& 43 4Z 4%m 4Ӑ} 4J 4  4 4E 4/ 4 4T 4 4eXƉ 4Wԉ 4 4` 4 ? 4> 4ȆL 4a 4o 4mC} 4 4 4) 4Ê 4ъ 4F 4 % 4\3 4ϏA 4/O 4{] 4k 4oz 4u 4( 4V  4 4Bۋ 4mC 4U? 4au 4ŀ! 4LB 4BH 4oN 4T 4Z 44 ` 4xf 4l 4Zr 4x 4h 4X 4 4 4 4@ 4g 4H 4' 4@%Ì 4[Ռ 4eX 4 4-? 4_E 4DK 4Q 4LW 4p] 4ic 4i 4o 4-u 49^{ 4 4. 4M 4  45 4ij 4. 4[ 4k 4?ō 4gu̍ 4Ӎ 4ڍ 4] 4H 4 4z  4~ 4.% 4R 4 ! 4' 41- 4n3 4q9 4!U 4bk 4 4v 4au 4ǎ 49Ԏ)@ގ 4" 4ע& 4R@ 4N 4[)e 4pp"y 4 4&Ǐ 4 4 4) 4" 4 N 4[ 4ru 4 4 ])  4" 4 4| 4au 4 46#)- 4 8"A 4u 4au 4| 4B. 4"Α 4ܑ 4])` 4" 4(m; 4I 4 UV)` 4.k"t 4g 4eX 4 4 4y  4 4\ 4kĒ 4J̒ 4`{ْ"` 4+"@ 4"  4"$ 4,O1": 4EG"P 4]"v 4+w"  4#"  4" ؓ 4E"  4"  4W'!" : 4%G"` 4m"v 4%(0 4"  4y((ٔ 4@" 4(  4#)"" + 4}8(R 4_"h 4u( 4" 4(˕ 4ؕ"` 4( 4+, 4Ϗ9 45F 4S'\ 4, 4Ϗ 45 4' 4 4Ϗ 45 4t ' 4Q 4Ϗ^ 45k 4&dx'` 4 4Ϗȗ 45՗ 4Ŀ'@ 4[% 4Ϗ2 45? 4xL' U 4zk 4Ϗx 45 4-' 4(& 4bĘ 4ʘ 49И 4C֘ 4Cܘ 4 4 4 4w  46 4Db 4]p`y 4 48 4"ԙ 49 o| 4= $ 4^"#A 4&M Jl 4[@x  4  4a` 4'$˚ 4M 40 4  4&7 4.\ 4 4 4 4 4 4b 4( 40? 4 ` 4 4" 4œ 42ݜ 4 40u 4 4  4:9 4#/Y 4q 4 4 4] 4;D, 4msB 42m 4‘ 4? 4 4Yמ 4z= 4 * 4 4`F 4hb 4my 4/; 4 4Hԟ 4;  4$( 49I 4\ 4o 4  4} 4 4; 4a( 4ZҠ 4  4 4 4"& 48 4n_{ 4 4Ʌ 4~ 4ơ 4mڡ 4SC 4n 4 4v/ 4G.H 4Q 4m 49 4 4?> 4j ޢ 4 4" 4? 4zW 4y 4% 4_ȣ 4ޣ 4 4ԟ 4) 49A 4kb 4mk 4 t 4 4. 4S 4K 4 4AӤ 4 4% 4.9 4_ 4dv 4 4- 4Yܥ 4  4D+ 4ZLK 4f 4/ 4zp 6 6 ¦ 4ͦ 6BѦ 6: 6o 6k 6 6 ) 6- 66 6: 6?Xb 6 6 6 6HHէ 6٧ 6 6 6\ Ic c= 6A 6 J 6N 6Swj Uz w `Ĩ ۨ i 4E 4Uk" 68& 647 6Z; 6PJ 6N 6^ 6b 6ku 7 6 6 7 6 6ũ 7ѩ 6թ 6 7 ( 6, 6 5?[ 6!_ 6is 63 61 6Gê 6CΪ8ت 7 6a 6[8 7 6  6z 7 6 6' 6+ 65 46y=T i"s%*/4@ 4=\ 6 6 4: 4)  4' 45#0=: 7J 6;N 69W 6S[ 6Qd 6eh 6cq 6uu 6s~ 6 6 7f ɬ=Ӭ===*=?=T=i=~====ҭ===w(5J"Tan{ 4Kw" 6Ů 6ծ 6ٮ 6""  6  6" "9 6= 6B"]l""""ʯ""" # 4V_= 6A 6Q 63U 6/^h 6L 6J 6[ 6Yٰ#:R_ly< 4F0!̱ 6pб 6h 6 6 7 4B 4  6 69!# 70 64 6= 6A 6J 6N 6W9!a 7n 6r 6{ 6$ 6" 79!9! 66² 64˲ 6Hϲ 6FղT! 7 4B  6Z 6V 4 6t# 6p,q!6 7C 6G 6P 6T 6] 6a 6jq!t 7 6 6 6 6 7 6 6q!q!س 6ܳ 6 6  6 v! 7 4&%..!? L.[!e 7u 6y 6! 7 6, 6* 6; 69! 7 ȴ 6K̴ 6Iմ 6Zٴ 6X! 72 6n 6l !$ 4I,"N 6R 6{b 6f 6o"y" 6 6 " "Ƶ 6ʵ 6ϵ1"9"A"'M"4Y"Bc"P 4~^ 4l 4+w 6 6 6 6 4¶ 6$ƶ 6 ֶ 6Aڶ 6;߶8 4UB 7X 6g\ 6]k 6o 6 6 6 4e 6 6  45ķ 6 6  6j 6b 6 6"%"B 6F 6P-Z-w 6{ 6]] 6 6Ӹ&ݸ&R,}H T 4!^ 7Tt 6x 6 6N  6*  4 6  6  60  6* Ź 6t ɹ 6T ҹ'ܹ 7k 6  6  7k 6  6  61  6 ! 6 % 6 . 6 2 6` <".I'S'p 6t 6~.(.( 6 66) 7ͺ 6Ѻ 6ں 6޺ 6 6 6 7 65 61  6T 6P 7. 7A 6lE 6hNcxѻ%7;)Tn\))) 6 6¼ 6Ƽ 6ϼ 6Ӽ 6ݼ) 6 6 6 6  6 6 6 6& 6* 64)N)X)q 6 u 6~ 6 6 6 6 6  6 6  6 6+ 6)ý{)ͽ 7ݽ 6E 69 6 6| 7 6 6  6  6( 6N, 6>> 6B 6K)U)q 66u 64, 7P 6G 6C, 7b 6cž 6]ξ,ؾ 7u 6 6, 7 6  6 7 6 6* 77 6; 6D 6$H 6QU-[ 7g 6Uk 6St 6gx 6e 6x 6vU- 7 6 6 6 6 7ȿ 6̿ 6տU-߿U- 6 6  6  6k-2,?9-j----.. # 89)C 7S 6W 6`)j 7v 6Hz 6@+ 7  6 6 6 6 7  6 6 6 6 6 6 6& 6  7.  6P 6J  6 6u$,# 7. / 63 6< 6@ 6I 6M 6R 7. [ 6_ 6d1,`,l,X `  6$ 6*'So)q*+0./h z. 8S p]x  % 89 b {% /J*T 7D d 6h 6 q*{* 6' 6%#*#* 68 66* 7V  6G 6E* 7V  6Y 6W" 6k& 6i1*;*X 6{\ 6yf+p+ 6 6O+ 7f  6 6 7f  6 6U/U/ 6 6 / 7| # 6' 6 , 7| 5/? 7 L 6-P 6)Y 6J] 6Ff 6gj 6co 7 x 6| 6 6 6 7  7  6 6CCC C!C7CPCeCzCCC/V/ |+( E2 /M KWh/dz/{ K+ 7  6 6+ 7  6 6.. 6 6 ..3 6 7 6=i'\'* '* ++?+K++)+AF.N.i s... 9/ / 05: (D>^u ` 4n 4Td 4 6 6 4'  6D 6@!> 6ZB 6XLVs 6iw 6g} 8@G 4` 6 6~ 6  6 4X 6 6" 4l- 61 66ucn 4 y 6 6 6  6 4X 6$ 6  4l 6? 6; 4S $F 6ZJ 6V[ 6u_ 6qd 4o 6s 6x 4$p 6 6 4 6 6  6D 6@ 4 6c 6[" 6& 66 6: 6?BU 4B` 6d 6j 4u 6/y 6'BB 6S 6Q 6e 6c 6v 6tBB 6 6 6 6 B 6# 6,B6BS 6W 6` 6d 6jX 7 6 6 6 6 6 6 64 60` 1 6L5 6J> 6[B 6YK 6lO 6jYF c 7s 6w 6y 6 6 7 6 6r | , E R j !w! 4 4= 4y 4& 4K 4_ 46 4B 4 4; 7 6 6 6@ 6&* 6. 6> 6B 6R 62V 6,[ 4&f 6Wj 6Uz 6l~ 6d 4 6 6-%-% 6 6P% 7  6 6P% 7-  6 6b%% 7B5 679 63C|%M|%i 6Rm 6Pw%% 6a 6_%% 6p 6n%% 6  6}*%3y%Q%n'&o&&&& . 4C39 7 N 6R 6b 6f 6k 41v 6 z 6 4+S 6@  64  4\ 6  6  6  6  6! 6! 6_! 6U! 6! 6! 7  4B  6!  6! 4 6!! 6!*040L 6$"P 6""Y 6;"] 69"b0 7(  4 6Q" 6K" 4, 6" 6" 7;  4l 6" 6" 4 6!# 6# 4yp 6# 6# 4X 6# 6#  4L 6)$ 6#$  7U ) 4: 4TF 4R 4^?d 4Tq 40 7U  6Y$ 6Q$ 6$ 6$ 6$ 6$ 6$ 6$ 6$ 6$ 6,% 6&%&;Qj&0Ag0Kg0g 6S%k 6Q%u11 6b% 6`%d0121 4k 4 6{%# 6o%2 6%6 6%; 7D 4!O 6%S 6%Yg&2 4 (P 6& 6& 6B& 6:&Y 4B 4  6k& 6c&q4 79 4lD 6&H 6&Qy[ys 6&w 6& 6& 6& 6& 6& 4P 6& 6& 6& 6&b 4 4 6 4yO 4B[ 4j 4mq 6' 6 ' 6G' 6C' 4B 4 6c' 6a' 4 4.)  4%% 4.)2`; 4H%Vz` 7p 6r't 6p'}|| 6' 6' 6' 6' ! 6_ 4gi 4u 4 4zJ 4f; 4l 4 4yp 4X 4L 4 4T 4 4^? 4T 4. 4ψ5PL 4W 6'[ 6'` 4k 6'o 6' 6' 6' 4au 6' 6' 6 ( 6 ( 7K 4zJ 6(( 6$( 4f; 6A( 6?( 7K 4l 4 4yp  4X 4L' 7K, 4> 4TJ 4V 4^?h 4Tu 4TT 6P( 6N( 6P( 6N( 6P( 6N( 6P( 6N( 6P( 6N( 6`( 6^( 7[ 4zJ  6r( 6n( 4f; 6(# 6(( 7n- 4l: 4G 4ypT 4Xa 4Ln 7ns 4 4T 4 4^? 4T 4TT 6( 6( 6( 6(  6( 6( 6( 6($ 6(( 6(1 6(5 6(> 7~G 4zJR 6(V 6([ 4f;f 6(j 6(o 7~t 4l 4 4yp 4X 4L 7~ 4 4T 4 4^? 4T 4TT7 6(; 6(D 6(H 6(Q 6(U 6(^ 6(b 6(k 6(o 6(x 6(| 6( 7 4zJ 6( 6( 4f; 6) 6 ) 7 4l 4 4yp 4X 4L 7 4 4T 4+ 4^?= 4TJ 4\TfT~ 6) 6) 6) 6) 6) 6) 6) 6) 6) 6) 6) 6)^  4w 4! 49 4auJ 4zJV 4f;c 4lo 4{ 4yp 4X 4L 4 4T 4 4^? 4T 4 4zJ 4f; 4l 4+ 4yp7 4XC 4LP 4a 4Tm 4y 4^? 4T 4 4zJ 4f; 4l 4 4yp 4X 4L 4  4T 4% 4^?3 4T@ 4R 4LY0p 4{ 60) 6,) 4 6K) 6G) 4 6f) 6b) 4r 6) 6}) 6) 6) 7 4zJ 6) 6) 4f; 6) 6) 7  4l 4$ 4yp1 4X> 4LK 7P 4b 4Tn 4z 4^? 4T 444 6) 6) 6) 6) 6) 6) 6) 6) 6) 6) 6) 6) 7$ 4zJ/ 6*3 6)8 4f;C 6*G 6*L 7Q 4l^ 4k 4ypx 4X 4L 7 4 4T 4 4^? 4T 444 6)* 6'*! 6)*% 6'*. 6)*2 6'*; 6)*? 6'*H 6)*L 6'*U 69*Y 67*b 7+k 4zJv 6K*z 6G* 4f; 6d* 6b* 7+ 4l 4 4yp 4X 4L 7+ 4 4T 4 4^? 4T' 494C4[ 6s*_ 6q*h 6s*l 6q*u 6s*y 6q* 6s* 6q* 6s* 6q* 6s* 6q* 7; 4zJ 6* 6* 4f; 6* 6* 7; 4l 4 4yp 4X 4L  7;% 47 4TC 4O 4^?a 4Tn 444 6* 6* 6* 6* 6* 6* 6* 6* 6* 6* 6* 6*?+ 4e2I 4T 6*X 6*] 41h 6*l 6*| 6* 6* 7 4zJ 6+ 6 + 4f; 6)+ 6'+ 7 4l 4 4yp 4X 4L 7 4 4T 4+ 4^?= 4TJ 4\f~ 68+ 66+ 68+ 66+ 68+ 66+ 68+ 66+ 68+ 66+ 6H+ 6F+ 7 4zJ 6Z+ 6V+ 4f; 6s+ 6q+ 7 4l 4 4yp) 4X6 4LC 7H 4Z 4Tf 4r 4^? 4T 4 6+ 6+ 6+ 6+ 6+ 6+ 6+ 6+ 6+ 6+ 6+  6+: 4MG 4S 4` 4zJl 4f;y 4l 4 4yp 4X 4L 4 4T 4 4^? 4T 4  4 41 4Uk= 4auN 4zJZ 4f;g 4ls 4 4yp 4X 4L 4 4T 4 4^? 4T 4 4zJ  4f; 4l# 4/ 4yp; 4XG 4LT 4e 4Tq 4} 4^? 4T 4 4zJ 4f; 4l 4 4yp 4X 4L 4 4T 4) 4^?7 4TD 4V 4Z] t 4 6+ 6+ 4 6+ 6+ 4T 4  7 6+ 6+ 6-, 6#, 7 6b, 6Z, 6, 6,$ 6,( 6,1 6,5 6,L 7Y 6,] 6,g q  6, 6, 6, 6,    7 6, 6,  > ) 79 6 -= 6-G Q m 6-q 6-z .    4 4 4 4 4 4{& 4 2 4T> 4J 4LV 4(b 4n 4\Q 4 4ғ 4! 4́ 4 60- 6&- 4 6g- 6]- 6- 6-  4au 6- 6-+ 6 ./ 6.4 4T@ 4PZ 7j 6F.n 6<.w 6}.{ 6s. 6. 6. 6. 6. 6"/ 6/ 7 6\/ 6R/ 6/ 6/ 6/ 6/ 6/ 6/  7 6/ 6/(2N 60R 60[ 60_ 60h 6(0l 6&0u 670y 650 6F0 6D02G]g 6U0 6S0  7 6d0 6b0   6s0 6q0 9 Z h 4Vu 4 4 4au 4 4 4{ 4  4T 4 4L 4( 4 4\Q. 4@ 4ғN 4!a 472hP 4 60 60 4 60 60 60 60 4au 6&1 61 4T 4 7w 6[1  6S1 61 61 61# 61, 610 615 7w> 6.2B 6&2P 6X2T 6T2r 6r2v 6l2 62 62 7 62 62 62 62 62 62 62 62 63 62 5J_t 63 63 7 63 63WW! 6.3% 6,3.W@f3j 4L 4 4 4au 4 4 4{ 4  4T 4 4L& 4(2 4> 4\QO 4a 4ғo 4! 4б  4 6C3 6;3 4 6s3 6i3 4 63 63 4r 63 63 64 64 4T 4 T* 7A: 6P4> 6H4G 64K 6v4T 64X 64a 64e 64n 6!5r 65w 7A 6M5 6E5 6w5 6s5 65 65 65 65 7T 65 65gg 65" 65+ 66/ 668 66< 66E 6 6I 66R 6/6V 6-6ogggggrr 6@6 6>6 r", 7d< 6O6@ 6M6J&T&p 6^6t 6\6}&: 4 4 4  4 4r- 49 4E 4{Q 4 ] 4Ti 4u 4L 4( 4 4\Q 4 4ғ 4! 4 4 6w6  6k6 41 66 66. 662 667 4TC 4S] 7m 6.7q 6"7z 6n7~ 6b7 67 67 7 67 67 68 6 8 6/8 6+8 6L8 6F8 7 6/8 6+86 6p8: 6n8C 68G 68P 68T 68m 7  68  68 ) 63  7!C  68G  68R nk  68o  68y   71  68  68  71  68  68    68  68  6 9  6 9    69  69  6+9"  6)9+ 5 M  6:9Q  689Z  6J9^  6H9l v   6Y9  6W9  "    46  4  416  4B  4N  4{Z  4 f  4Tr  4~  4L  4(  4  4\Q  4  4ғ  4!  4G P  4  6p9  6f9  4#  69'  69,  4T8  4H xR  7|b  69f  69o  6 :s  6:x  7|  6::  60:  6k:  6g:  6:  6:  6:  6:  7  6:  6:    6:!  6:*  6:.  6:G \ q     7  6:  6:    7  6:  6:  7 6: 6:$ 7- 6 ;1 6;<1F 7V 6;Z 6;_ 7h 6(;l 6&;w 67; 65;z 4e 4( 44 4@ 4L 4{X 4 d 4Tp 4| 4L 4( 4 4\Q 4 4ғ 4! 4=p 4  6P; 6D;! 6;% 6;* 4Uk5 6;9 6;> 4auI 6<M 6;R 4T^ 4nx 7 6F< 6:< 6< 6z< 6< 6< 6< 6< 7 6<= 60= 6v= 6p= 6= 6= 6= 6=' 77 6=; 6=D 6=H 6=Q 6>U 6>^ 6?>b 69>g 7p 6a>t 6]> 7# 6> 6y> 75 6> 6> 75 6>  6>-D 7EQ 6=U 6=_i 7Uy 6>} 6> 7e 6> 6> 7x 6> 6> 7 6> 6> 6? 6? 6&?  6$? 67? 65?  6H?$ 6F?.pLpVpn 6Y?r 6W?{ 6h? 6f? 6h? 6f? 6h? 6f? 6h? 6f? 6y? 6w?u  6? 6?+Qz 4!. 4 4Uk 4au 4 4 4{ 4  4T 4  4L 4(% 41 4\QB 4T 4ғf 4!t 4$ 4Oe 4l 4 4yp 4X 4L 4 4T 4 4^? 4T 4% 4/,C 4N 6?R 6?W 4b 6?f 6?oy 7 6@ 6? 6.@ 6$@ 7 6\@ 6T@ 6@ 6}@ 6@ 6@ 7) 6@ 6@ 7)  6@  6@f, 6 R 6@V 6@_ 6@c 6@l 6@p 6@  <q 4P 4  4 4/" 4. 4԰: 4{F 4S 4!a 4h 4 6A 6@ 4 67A 6-A 6nA 6dA 4au 6A 6A 6A 6A 7 6B 6B 68B 6.B 6oB 6eB( 6B, 6B5 6B9 6B> 7G 6CK 6Bb 6*Cf 6(Co 69Cs 67C| 7 6KC 6GC 7 6eC 6aC 6}C 6{C 6C 6C  6C 6C 6C 6C% 6C) 6C2 6C6 6CI^s.'{=K 4DX 4d 4| 4au 4/ 4 4԰ 4{ 4 4! 4  4 6C  6C 4 6D  6 D0 6JD4 6@D9 4auD 6DH 6wDQ![ 7k 6Do 6Dx 6D| 6D 6 E 6E 6;E 65E 7 6`E 6XE 6E 6E 6E 6E* 7 6E 6E 7 6E  6E(525N 6ER 6E[ 6E_ 6Eh 6El 6Eu 6Fy 6F 6F 6F55555E#z9G 4mT 4` 4x 4au 4/ 4 4԰ 4{ 4 4! 4  4 6*F 6"F 4  6ZF 6PF 4  6F$ 6F) 4r4 6F8 6FH 6FL 6FUV _ 7o 6+Gs 6#G| 6WG 6MG 6G 6~G 6G 6G 6G 6G 7 6G 6G 6!H 6H 60H 6.H_  7  6BH  6>H  7  6ZH  6VH  9 j C j _  6pHc  6nHl  6Hp  6Hy  6H}  6H  6H  6H  6H  6H  6H  6H j j j j !j !z A! W! e! 4cr! 4~! 4! 4! 4r! 4/! 4! 4԰! 4{! 4! 4!! 4o" " 4"" 6H&" 6H+" 416" 6I:" 6HJ" 6FIN" 6) 7BN) 6NR) 6N[) 6XN_) 6LNh) 6Nl) 6Nu) 6Ny) 6N~) 7B) 6N) 6N) 6+O) 6'O)[#) 7X) 6CO) 6?O) 7X) 6]O) 6YO).$*j# * 7j* 6wO!* 6sO** 6O.* 6O7* 6O;* 6OD* 6OH* 6OM* 7jV* 6OZ* 6Om*j#*j#*n#* 7* 6P* 6P*#* 7* 6P* 6P* 7* 6,P* 6*P*#+#*+ 77+ 6?P;+ 6;PI+ 7R+ 6YPV+ 6UP_+ 6oPc+ 6mPl+ 6Pp+ 6~Py+ 6P}+ 6P+ 6P+ 6P+#+#+#+ 6P+ 6P+ 6P+ 6P+ 6P+ 6P+ 6P+ 6P, 6P , 6P, 6P, 6P ,#B,#`,#v,A$, 4P/, 4, 4Uk, 4au, 4/, 4, 4԰, 4{, 4- 4!- 4$- 4Oe)- 4l5- 4A- 4ypM- 4XY- 4Lf- 4w- 4T- 4- 4^?- 4T- 4- 4- 4- 4- 4- 4#- 4{. 4ĥ". 4.. 4F. 4au^. 4j. 4#v. 4{. 4 +. 4. 4. 4au. 4. 4#. 4{/ 47/ 4/ 4*/ 46/ 4rN/ 4Z/ 4#f/ 4{}/ 45/ 4/ 41/ 4/ 4#/ 4{/ 4Z / 4/ 4 0 40 4##0 4{90 4`#J0 4b0 4Ukn0 4auz0 40 4#0 4{0 40 400 4%0 6P0 6P0 4au1 6#Q 1 6Q1 4R1 6>Q1 6:Q,1 6aQ01 6UQ>1 6QB1 6QG1 4wR1 6QV1 6Qf1 6Rj1 6Ro11E1 1S1 4t11 4%1 6!R1 6R2 4au 2 6cR2 6_R2 4R!2 6R%2 6{R32 6R72 6RE2 6SI2 6RN2 4wY2 6WS]2 6QSm2 6uSq2 6sSv2 7_2 4222 "222 4223 3393pT3 ^33 43 3 4%3 6S3 6S3 4au3 6S3 6S3 4R3 6S3 6S4 6T 4 6T4 6fT4 6XT#4 4w.4 6T24 6TB4 6TF4 6TK4 7OT4 4a4`j44 4`484t4 44 455 4%$5 6T(5 6T-5 4au85 6'U<5 6#UA5 4RL5 6BUP5 6>U^5 6eUb5 6YUp5 6Ut5 6Uy5 4w5 6U5 6U5 6 V5 6V555 `55 4q 6p 6 4%+6 6#V/6 6V46 4au?6 6^VC6 6ZVH6 4RS6 6zVW6 6vVe6 6Vi6 6Vw6 6V{6 6V6 4w6 67W6 63W6 6MW6 6KW6 796 46666 7$7 .7\7 4g7~7 4%7 6fW7 6ZW7 4au7 6W7 6W7 4R7 6W7 6W7 6W7 6W7 6&X7 6X7 4w7 6iX7 6eX7 6X8 6}X8(%8]@8 0J8lc8 4Fn88 4%8 6X8 6X8 4au8 6X8 6X8 4R8 6X8 6X8 6 Y8 6Y8 6XY8 6LY8 4w8 6Y8 6Y9 6Y9 6Y 9,9G9 Q9j9 4|9 49 49 439 4O9 4X9 49 4o9 49 49 4: 4 :#: 4.: 6Y2: 6Y7: 4B: 6YF: 6YK: 4V: 6ZZ: 6Z_: 4j: 6#Zn: 6!Zs: 7l|: 4b: 62Z: 60Z: : 4W:: 4W:-: 4~:: 4; 4 ; 4au;; 4{ D;p[; 4f; 6EZj; 6?Zo; 4z; 6eZ~; 6_Z; 6Z; 6Z; 4au; 6Z; 6Z; 6Z; 6Z; 4; 6Z; 6Z; 4; 6 [; 6[; 7\; 4; 6[; 6[<y< 4$ <5< 4V?<c< 4m< 4y< 4< 4au< 4@<< 4< 6,[< 6&[< 4< 6L[< 6F[< 6n[< 6h[< 4au= 6[ = 6[= 4= 6[= 6[#= 4.= 6[2= 6[7= 7L@= 4K= 6[O= 6[U=f= 4Vp=3= 4V=K= 4'-== 4= 4= 4= 4r > 45=>*> 45> 6[9> 6[>> 4I> 6\M> 6 \R> 4]> 63\a> 6-\f> 4rq> 6U\u> 6O\> 6w\> 6q\> 4> 6\> 6\> 4> 6\> 6\> 7<> 4!9> 6\> 6\>> 4V>? 4V?2? 4 9?`P? 4\? 41w? 4x?? 4? 6\? 6\? 41? 6\? 6\? 6]? 6]? 4? 6<]? 66]? 4? 6Y]? 6W]? 7,@ 4@ 6h]@ 6f]@ *@ 4U4@I@ 4pVS@4k@ 4 Eu@ 4@ 4@ 4@@ 4@ 6{]@ 6u]@ 4@ 6]@ 6]@ 4@ 6]@ 6]@ 4@ 6]@ 6]@ 7A 4A 6]A 6]A.A 4U8AMA 4UWAiA 4$~sA 4A 4UkA 4auA 4}AA 4A 6]A 6]A 6^A 6^A 4UkA 6>^A 68^B 4au B 6`^B 6Z^B 4 B 6^$B 6|^)B 44B 6^8B 6^=B 7 FB 4QB 6^UB 6^[BlB 4cUvB3B 4vBKB 4)B 4)B 4B 4B 4C 4!C 40C 4,NC 4"lC 4rC 4JC 4)C 40vC 4/C 4/C 4/D 4/D 4/!D 4w0D 4Qv?D 40ND 40]D 40lD 40wD 40D 4ND 4D 4D 4D 4_3D 4D 4jE 4&E 4F.EPE 6^TE 6^eE 6^iE 6^pE 4BE#E>E 4E 4qE 4OF 4TF 4/F 4lJ 4YPJ 4gJ 4WyJ 4tJ 4RJ 4 J 4YJ 4K 4YK 4L,K 4HK 4YUK 4sK 4_K 4:K 4WK 4C$K 4ՏK 4K 4K 4 L 42L 4A'L 4Z7L 4sGL 4SL 4XaL 49L 4WL 4C$L 4mL 4L 4ϋL 4L 4L 4M 4,M 4E#M 4Y3M 4e?M 4~PM 4L_M 4ԮnM 4I}M 4bM 4M 4M 4ٍM 4M 4M 4M 4 M 4WN 4C$N 4mN 4*N 4$7N 4IN 4rXN 4!gN 4vN 4TN 4N 4N 4N 4 N 4 N 47 N 4N 4׉O 4O 4 "O 4"2O 4;BO 4TRO 4mbO 4nO 4U|O 4O 4WO 4C$O 4O 4O 4O 4O 4O 4 P 4[P 4s$P 44P 4@P 4NP 4tP 4WP 4C$P 4mP 4P 4P 4KP 4P 4Q 4lQ 4%Q 45Q 4EQ 40UQ 4HeQ 4`qQ 4xQ 4ðQ 4C$Q 4Q 4[Q 4>Q 4Q 4zR 4R 4%R 45R 4AR 4OR 4AjR 4vR 4C$R 4R 4R 4R 4KR 4R 4R 4S 4S 4S 4,-S 4D@Z 4jEZ 40SZ 4®Z 4>QZ 4knZ 4?Z 4Z 4IZ 4>[ 4̍[ 4s[ 4([ 44[ 4s@[ 4OkL[ 4X[ 4\:d[ 4w[ 4f~[ 4/[ 4[ 4ݍ[ 44[ 4}[ 4[ 40[ 4>[ 4B[ 4i[ 4[ 4L7\ 4h\ 4>\ 4+\ 4¦7\ 4C\ 46T\ 4*`\ 4l\ 4&x\ 4\ 4dG\ 42\ 4L\ 48\ 4.\ 4\ 4]\ 4\ 4] 4?d] 4 ] 43] 4Z@] 4N] 4J[] 4h] 4!] 4r8] 4] 4-E] 4K] 4 ^ 49^ 4e4%^ 4S2^ 4?^ 4L^ 4PY^ 4ag^ 4v^ 4^ 4^ 4b{^ 4^ 4^ 4A^ 4O^ 4L^ 4S^ 4M_ 4_ 4ߛ_ 4+,_ 4:_ 4.H_ 4`V_ 42hd_ 4Sr_ 4_ 4_ 4H_ 4FG_ 4_ 4J_ 4t` 4X` 4t$` 424` 4PqC` 4lR` 4K|a` 4p` 4` 4O` 4j` 4}` 4ݗ` 4` 4c` 43` 4yE` 4`a 4a 4>$a 4j73a 4\7Ba 4Qa 4`a 4Zoa 4s~a 4a 4ca 4a 4YSa 4\a 4mGa 4ra 4Qa 4Ub 4#b 42b 4Ab 4BPb 4__b 4Unb 4G}b 4(Lb 4b 4b 4Xb 4=b 4Jb 4lb 4cb 4 c 4c 4_+c 4g;c 4LKc 4|[c 4zGkc 4g{c 47c 4Lc 4H:c 4}c 44c 4[dc 4pBc 44d 4yd 4#d 4B2d 4Ad 4Pd 4_d 4nd 4 o}d 42d 4֚d 4D3d 4;d 4Md 4W~d 4Ld 4ld 4he 4e 43"e 41e 4P@e 4`0Oe 4^e 4me 4[|e 4g;e 4e 4e 47e 49Ne 4e 4cre 4oe 4ff 4f 44"f 4{o?f 465Nf 4J]f 4[lf 4CV{f 4!Vf 4uf 4f 4f 4f 4[f 4^f 4Mf 4g 4g 4a g 4\/g 4>g 4eMg 4\g 4ֆkg 4zg 4g 4Kg 4Ig 4jg 42g 46g 45Kg 4hbg 4\Ih 4fh 40h 4D.h 4}T=h 4Lh 4k[h 4=jh 4ݦyh 4h 4)h 4h 4(h 4 h 4V\h 4xh 4Th 4Τi 4cmi 4i 4I-i 45n 4n 4O o 4o 4-E+o 4:8o 45Oo 4^o 4Bko 4Co 4^o 4o 4Ro 4 Eo 41o 4o 4oo 47o 4p 4p 4#p 431p 4?p 4 hMp 4A[p 4yjip 4Ϗwp 4;p 4(kp 41p 43p 4p 4p 4p 4gp 4p 4oZq 4wq 4!q 4@M/q 4Ĉ=q 4Zq 4\iq 4sxq 43fq 4q 4q 4ǒq 4q 4q 4q 4y^r 4({r 4xr 4b-r 4Nt 4lt 4ʢ u 40u 4q#u 47u 4rTu 46qu 4~u 4nu 4u 4 u 4qu 4Q^u 4CVu 46u 4Tu 4zu 4zv 4Q^:v 4Tzv 4zv 4Z@v 4v 4kv 4EMv 4`v 4v 4 w 47Qw 47Q(w 407Nw 4tw 4w 4߬w 4TSw 4Aw 4Iw 4|w 4w 4-x 4'x 495x 4~~Cx 4tQx 4(_x 4Emx 4ax 4x 4\x 4vx 42x 4Bx 4>1x 44x 4:mx 4(y 46x5y 4uMy 4mcy 4܀y 4,y 41ny 4Ry 4Jy 4y 4gy 4R|y 4dz 4z 4Qa!z 4~a/z 4=z 4~vKz 4ٮYz 4gz 4uz 4z 4Cz 44z 4z 4 mz 4Fz 4d{ 4;b({ 45{ 42b\{ 4IIn{ 4{ 4cT{ 4c{ 4{ 4D{ 4k{ 4|{ 44{ 4S<{ 4{ 4{ 4yz | 4.S| 4]%| 4A2| 4(@| 4s\| 4-Ej| 4x| 4V0| 4NZ| 41| 4| 4p| 4\| 4s| 4| 4R| 4} 4}} 4R%} 4AB} 4fR} 4X} 4`^} 4Dd} 4vk} 4.x} 4[0} 4b} 4} 4x} 4S} 4@} 4~} 4P} 4=~ 4T~ 4o?~ 4׌L~ 4As~ 4^~ 4~ 47~ 4~ 4ȡ~ 4 2~ 4>~ 4V~ 4^~ 4Xa 4)V 47=  4b. 47< 4sJ 4X 4f 4t 4tU 48w 4 4t 4f 4r 4_ 4 4t 4i 4N 4p 4y* 4w8 4IF 4iT 4[i 4Av 4q 4; 4V0 4A 4gP 4] 4bǀ 4l̀ 4gӀ 4G?ـ 4r߀ 4 4c= 4G 4C 4Gv 4 4ţ  4 4)1 4 4ׇ2 4~C 4O8[ 4ta 4kg 4\m 4|s 4`y 4b 4. 4n 4 4 4\ 4( 4K 4A 4L 4ʹ 4 4%|ǁ 4́ 4FӁ 4Pف 4B0߁ 4 4JV 4' 42 4 4 48V 4H, 479 4~R 4^ 4nj 4w 47 4u 4 46 4y 4Sʂ 4Aׂ 4 4 4U:  4_ 4q& 43 4si@ 4S 4` 4sim 4 4 4Q^ 4P 4n̓ 4$ڃ 4u 4si 4 4 c 4! 4- 47=: 44G 4 4# 40 4nބ 4 4" 4V0 4Q^> 4Y 4BBg 4^ 4nÅ 4Ѕ 4Fu 4~ 4Aֆ 4 4 44 4vk 4Ǝx 4 4G]! 4uF> 4 4? 4 4Ǝ 4 4 4~X 4Ǝe 4r 4, 4| 4 { 4] 4\ 41< 4g 4N 4 h  4+ 41: 4I 4&EX 4gCx 4p1 4Š 4,p 4ZE 4u 4݊ 4 4 4݊ 4N 4^2 41B 4rR 4IUb 4-r 44 4w 4yt 4 4D̋ 4[ڋ 4 4 4N 4^m 4Un  45 4xB 4SO 4 48 4v 4 4A 48Ȍ 4 4zp 4 4$c  4' 4х3 4Ѣ@ 4RM 4X] 4w 4m 4Nʍ 4|؍ 4Q 4 4f 4$  4NA 4w% 42 4p? 4 @Q 4^ 4:ck 4qx 4hc 4 4-` 4RK 4? 4PƎ 4ӎ 4T 4յ 4m| 4A 4- 4-E  4. 4b 4No 4| 4St 4z 4g 4 w 4 4bjˏ 4؏ 4! 4a 4F  4 47% 4cT? 4טM 4\Y 4be 4Mxq 46~ 4Q 4A 4o 46 4 N 4̐ 46ڐ 4QR 46 4  4 4, 4VB 4RbT 4mr 4p 4 C 4 4ב 4M 40 4(x  4J 4% 42 44? 46L 4BUY 4rf 4ns 44 4T 4o 4^r 4ɧ 4I 4rՒ 4[9 4%I 4A 4$ 4Ĥ2 4m@ 4oN 4U\ 4j 4-x 4M 4Jr 4T 4u 4c@ē 4ғ 4j 4+ 4, 4  4zZ 4& 44 4?B 4nP 4}^ 4l 4pz 4 4H 4 4 4Ϊ 4JΔ 49ܔ 4oR 4  4"^ 4Λ 4# 482 4J 4hY 4Ch 4pnw 4  4 4k 4J 4pʕ 4 4w 4 4I  4u 4K 41X 4e 4br 4BU 4V 4 4`C 41 4&S 40͖ 4|ږ 4y 4"] 4۾  4ˇ 4) 4P7 4ՑE 4raS 49a 4o 4ް} 4> 4V 4R 4ϗ 4J× 4qї 4yߗ 4? 4 4>  4^ 4@% 43 41iA 48O 4v] 4Zk 4xy 4s 4 4{ 4, 4 46И 4{ߘ 4 4 4ȉ  4 4P+ 4/L: 4egI 4sqX 4g 4Gv 4; 4*o 4 4/\ 4E 42Й 4=gߙ 47 4Oj 4S  4^ 4c<* 4eZ9 4H 43g 4=v 4 4< 4 4 4dš 4ך 4| 4/u 4Û 42Л 4Bݛ 4\ 4i 4g 4_8 4 4` 4S 4si 4 4Ȝ 4A՜ 4} 4s 4 4R  4n 4p$ 4'2 4K 4{^ 4,;n 4|rt 4VQz 4P 4S 4 4m 4 4] 4( 4ĝ 4Sҝ 4mxߝ 4` 4 4:L 4U 4u! 4. 4A 4N 4U\ 4i 4v 4 4 4g 4P 4x 4Ȟ 4Ug؞ 4xnޞ 4C 4 4g 4D  4 4S' 414 4\A 4AIN 4v~u 4j 4C 4u@ 4 4syß 4П 4*ݟ 4I 4 4  4P 4$ 4AG 4T 4a 4n 4P| 4L 4u 4 4^Ơ 4/4Ԡ 4]b 4t 4 4 4y 4<" 4V/ 4q 4Xy} 4 4 4w 4s 4)ġ 4С 4ݡ 4] 4Q 4 4d# 4`30 4\= 4DT 4Qa 4n 4\ 4Q 4 4I9 4G 4Т 4^ݢ 4 4 4{Q 4R% 4Q2 4? 4V 4b 4x?n 4Eiz 4~ 4 4  4|ݣ 4a 4m 4 4nE 4 4D>6 4B 4{N 4?Z 45Pp 4} 43 42 4] 4U 4UŤ 4Ҥ 4g 4V 4n 4t% 4t2 43? 4CVM 4lZ 4`g 4t 4a 49l 4| 4] 4å 4Iݥ 4p 42 46x 4Rw 4TS  4I- 4; 4EEH 4({U 4>b 4`p 4x} 4 4?i 4 4 4E 4\w˦ 4٦ 42 4h 4- 4g; 4{ 4( 4F 4S 4[a 4n 4| 4 4+@ 4ا 4c 4A 4%6ʧ 4b  4. 4E: 4hH 4W~V 4Ld 4s 4M 4 4q 4" 4x 44 4 46 4,}ͨ 41 4W~ 4L 4l 4r" 4A0 4}> 4NL 4[ 4i 4w 4l_ 4@ 4V 4Ԃ 4* 4̩ 4`ک 4 4 4t 4  4Bt" 4p0 4> 4L 4_Z 4h 4v 4n 4e 43 4 4 4>ʪ 4Iت 44 4 4i 4  4Ą 4IB, 40: 4H 4sV 4d 4cr 48@ 4o 4^ 4S= 47 4eȫ 4֫ 4i 4E 4 4r} 4 4.+ 4D9 4G 4.~U 4 `c 4xq 4B 4j 4m 4[ 4  4Ŭ 4yӬ 4 4 4Z 4 4* 4f58 4coF 4T 4gb 4.p 4=~ 4sJ 4 4ƭ 4Uխ 4C 4j 4u 4iU  4 4) 4E7 4AE 4U 4bhe 4!eu 4r 4 4c 4q 4 bŮ 4gԮ 4R 4_ 47  47 4 gE 41S 4b 4q 4 4z 4u 4g2 4Iį 4Kԯ 4; 4E 4 4R# 4H2 4!}V 4T` 4Qn 4S| 4v 4 4  4 4° 4Mа 4Iް 4] 4 4A 45; 4q$ 4Fg2 4ʼ@ 4` 4Vm 4NZz 4 4R 4Q 4 4ձ 4C 4jF 4 4% 49N2 4Y 4ff 4gs 4 4 4 4)a 4F[ 4u 46β 4x۲ 4{ 4k 4|; 4 43p 4;~) 4E6 4C 4PP 4ި] 4j 4 4 4™ 4RFг 4Pݳ 4 4 4^m$ 41 4g> 41K 4Ad 4i3x 4o 4 4~^ 4 4[ 4V 4MǴ 4nԴ 4 4̟ 4 4 4!5 4i( 4M6 4C 4K5P 4[] 4gj 4@w 4 4?z 4` 4I 4 4Osŵ 4:ҵ 4nߵ 4A 4m 4S 4~ 4+$ 4׸1 4V> 4DL 4e 4<;s 4g; 4ͷ 43 4 4Ƕ 48ն 4$u 4W~ 4L 4  4 4l) 47 4hE 4S 4Pa 4o 4H} 4 4[ 4A 4 4T÷ 4oLѷ 4߷ 4 4 4|  4 4l% 43 4OA 42O 4ٻ] 4ޖk 4y 46 4>_ 4 4} 4hŸ 4AҸ 4߸ 4V 4s 4  4 4v  45K. 4St< 4FP 43^ 4l 493z 4 4L 4jy 4V 4tR 4gԹ 4\I޹ 4f 4Do 4 4u 4 42, 4+]9 4F 4ȭY 40h 4݄r 4V| 4d 43 4] 4Cp 4Ժ 42E޺ 4q 4? 46[ 4+ 4V5 4D? 4X6L 4Y 4 if 4hts 4ha 4r 48 4ӳ 4 4 4Kλ 4>ۻ 4 4A 41 4E 4. 4=P< 4J 4w[X 4Af 4 4U 4 4 4-d 4fǼ 41ռ 4U 4 4)_ 45  4|) 4%6D 4DR 4v` 4{n 4֥ 4t 41 4 4f 4Fʽ 4gB׽ 4 4a 4s 4 4 4+ 4A8 44cE 4R 4_ 4 Ml 4 4 4m 4 4T 4þ 4-Eо 4ݾ 4` 4 4 4 4LD! 4. 4H 4U 4 lb 4o 4 | 4 4e 4G˿ 4{ؿ 4^B 4F 4I 4hk 47 4~, 4R9 4yF 4NZS 47` 4| 43 4Jn 4 4^] 4"m 4w; 4Do 4;& 4zi2 4W>? 4R 4_ 4ir 4\ 4V 47 4cT 4ט 4l 4N 4 4Q} 4 q 4 O 4U+ 48 4E 4-ES 4` 4[m 4v 4 4" 4St 4} 4N1 4 4A/ 4= 4J 4;W 4d 4r 4 4 4WN 4n 4dL 4[ 4_ 4̳ 4l 4 ;' 44 4<A 4N 4WN[ 4Jh 4Nu 4F 4 4ķ 4gV 4  43 4g 4NZ 43 4HP 4 4Y* 47 4D 4WNQ 4^ 4bqk 4Hx 4` 4 4޽ 4 : 4 4^\ 4B 4  42 4[ 4' 4m:= 4dI 4o5_ 4xTl 4dy 4* 4 4d 4 4d 4 4] 4 4\$ 43 4'w@ 4;M 4yZ 4h 4vx 4Ж~ 44 4F 4< 44 4 4! 4 4  49M 41 4ķ 41j 41j 4ak 4Mo( 4K6 40Y 45f 49Ms 4-E 4 4 4 4W 4 4L` 4*: 4 4U) 4n7 4nA 49N 4[ 4Vh 43u 4{ 4iu 4 4M 4A 4 4[ 4  4& 4 4/ 4|D& 4 3 4@ 4Z 4g 43t 4; 4 4 45 4 4ug 4P 4z 4 4ڤ 4 4 4?C 4:5 4QJ 4W 4S 4h 4o 4u@ 4a 4: 4- 4   4)l 4\4& 44 4g^G 4^ 4>k 4y 4"t 4O 4 4Q^ 4A 4B 47 49# 4r89 4zE 4k 4r 4 4S 4- 4/c 4A 4:  4u@! 4/ 4I= 4|[ 4TSt 4< 4VJ 4ν 4< 4@ 4c 4Z 4 4E  4^J 4]) 4!7 4$DE 4j^ 4zl 4bz 4! 4Ó 4M 4S 4 4; 4u  4M 4@( 4VM6 4>D 4R 4` 4n 44s| 4) 4% 48 4i 4 4ul 4: 4C 4Hy 4& 4w;4 4C 40Q 4` 4jIn 4B| 4@ 4M 4a 4 4 4 48 4O 4b9 4M 4W 4wHe 4s 4@ 4V 4 4 4ח 4nO 42 4_a 4Ļ 4f8 4  4 4) 4C7 4<Z 4bh 4 4wL 4 43 4> 4V 41 4e 4%[! 444/ 4== 4 Y 4V^g 4lu 4/k 4ώ 4 49 4P 48 4= 4{ 4 4. 4 4 4, 4L; 4J 4XY 4#<h 4Tw 4Z 4z 4qd 4 4k~ 4d 4\; 4 40  4FF 4/+ 4]: 4R4I 4DX 4ybg 4v 4& 4ϸ 4A 4uK 4 47 4ި 4n 48j 4  4 4"A* 4m9 4lH 4UW 4E<f 4su 4 4 4j 4խ 4d 4{ 4| 4HT  4Q" 4<9 4 _M 4A} 4ef 4TS 4^ 4 4o< 4G 4 4A 4 4 4P 4U 4©  4 4 4! 4b) 4J5 4|A 4HM 4i 4Qv 4} 4)n 4 4^ 4Ň 4r 4g 4- 4xx 4 4' 4^$ 41 4g> 43K 49X 4\cr 4C 43 42 4 4IN 42 4_5 4˜A 4 UQ 4oW 4] 41d 4An 4{ 4d 4p 4 4G 4 4> 4  4 4\ 4) 46 47=C 4DP 4ېh 4?u 4 4 4Kf 4g 4&E 4 4B 4Ǒ 4M  4y 4g% 42 4Q^N 4>[ 4`h 47u 4V 40I 4 4Ƕ 4 4 4u 4  4I  4 47 4D 4&ER 4M 4[ 4M 41H 4c 4W  4 4C3 4@ 4DQW 4ad 46 4ˠ 4p 4Q^ 4 4? 4(z 4 4{ 4" 4 [ 4)h 4a 4l 4r 4 4a 4 4p 4 4Q^ 4 4?' 4C 4{Q 4j 4!r} 4r 4D 4  4h 4P 4tw 4Nu 4x 4 4Q7  4 4& 43 48ke 4Ϙ 4 4 4 4w` 4' 4'i 4 45 4K 4  4]) 46 4}C 49P 4E] 4cj 41w 4q 4w 4Q 4 4_ 4rQ 4 4@r 4 4, 4P9 4ZG 4zT 4W~a 4Ln 4x| 4F 48 4C 4t 4 4m 4[ 4>x 42R 4<( 48B 4;<L 4ޖV 4-Kc 4tq 4Ha~ 4x 4 4u 4 4%N 4R 4J 4\ 4f 48O 4v[ 4 p 4K| 4 4F 4k 4w= 4A 4Al 4' 4 4S# 4\1 47? 4cM 4[ 4/4i 4~mw 4(f 4u 4 4׼ 4 4v 4 4܋ 4f 4 G 4 4U. 4;= 4FL 42[ 4j 4| 4 4҉ 4_E 4co 4lz 4+ 4f 4 4 4(b 4!, 4ï; 4gJ 4ɚY 4=h 4w 4r 4>h 4 4A 49 4 46S 4  4r8 4e* 49 4H 4lW 4f 4Ju 4 4d 4 4g 4wk 4݂ 4x 4 + 438 4F 4=S 4V` 4m 4Az 4= 4I 4 4 4 4] 4 4T 4  4M 4K. 4[F; 4[oK 4Q 4W 4B] 4c 41i 4Uy 4 4F^ 4T 4 4J 4m 4Q 4 4  4c 4(% 4M3 4-A 4 O 4m 4y 4 4 46 4 4 4 4i 4K 4Z 4 4& 4C4 4B 4kP 4^ 4Zl 4mDz 4= 4 4A 4: 4B 4; 4q 4G 4  4 4" 4( 4/ 45\ 4i 4| 4Q^ 4- 4<5 4 4k 4 4c 4~ 4 46 4  4`n 4mh' 44 4OlA 4kN 4>[ 4qh 4u 4 4o 4k 4ׁ 4b 4Ւ 4 4@} 4 4 4 4@k" 4&0 4> 4::L 4 Q 4) 4>K 4oV 4H 41 4 4;  4 4^) 47 4jSE 4 Q 4o 4} 4e 4L  4H 40& 4j4 4OB 4P 4^ 4l 4z 4? 497 4 4x 4pu 4I 4A 4v6 4Q 4 4R 4w# 4Q? 49M 4\ 4(j 4$x 4 4 4! 4U 4f 4s 4l 4X 4 4?w 4߱$ 4MH2 4k@ 43N 4O\ 4j 4@x 4| 4 4| 4 4] 4ɂ 4A 4 B 465 4\ 4$ 42 4J@@ 4MN 4F\ 4 4N 4~l 4 47t 45I 4ޒ 4 4;  4 4% 4S3 4A 4˵O 4 ~] 41zk 4Gy 4CO 4I 4 4o2 4/a 4tH 4rV 4d 4: 4֫ 4y 4 4-6 4 4 4 4 4-{ 4e1 4Q 4 4f 4O 44 4`A 4<n 4S{ 4uD 4ޯ 4 4| 4p 4 4f 4c 4 40A 4u 48  4G. 4~< 4cJ 4X 4[0f 4`t 4 4 4B 4s 4% 4NM 4j 4 4\ 4a 4r 4w3 4* 4M8 4 KF 4IT 47m 4nw 4 4P 4-T 4#H 4.m 4 4 4,; 4 4\ 4 40, 4: 4ҦH 4yV 46}d 4} 4 4Ǜ 4 4 4B 4p 4 4F 4L  4N 47( 4BN 4t\ 4Tj 4Sx 4< 4w_ 4I 4 4x 4 4 4 4>y 4v 4 4  4. 4 [< 4FJ 4}X 4LQf 4t 4] 4B 4G 4H 4 4dD 4> 44 4 4Ԑ 4A  43\ 4k 4cu 4E 4 4  4 4n 4  4R 4 4 4|s 4~5  4mT 4fJ& 4~3 4d@ 49vM 4uZ 4;ug 4ot 44^ 4} 4F 4Y 4N 4}1 4; 4zU 4s 4eF 4heT 4+jq 4ߧ 4VD 4 44* 4~p 4B  4  4;3  4  4  44]  4  4   41 4B 41GH 40N 4w 4yO 4C 4$$ 4ѻ1 4> 4K 4yX 4je 4m~ 4w; 4e[ 4< 4J 4h 4ϱ 4> 4H  4& 4\& 4Dž3 4B@ 4iiM 4vZ 48n 4?{ 4 4vm 4b 4m 46 40g 4D 4b 4 4} 4[ 4 4^+ 4; 4A 4G 4GM 4S 4LZ 4<g 4yt 4 4 4ms 4 4#J 4 X 4Wf 4ut 4 4 4Ӌ 4 4  4 4в' 4}4 4A 4M\ 4f 4V`s 4 4k0 4V 4 4y 4 4p 4A 4 4e  4@ 4n{Z 4g 4t 4 4 4 4 4Bf 4| 4 4} 4 2 4% 4]8 4> 47=* 4s8 4ȡQ 4p 4| 4j< 4N 4#s 4 4 4e 4 4 4 43  4^ 4%( 4o8 4^VH 4QaX 4h 4ϔn 4Xut 4{ 4M 4Q^ 4 4O 4\2 4l 4 4B 4٣ 4( 4? 4{MK 4HX 4i9f 4j<t 4 4- 4VM 4 2 4s 4> 4 4ȡ 4s$ 42 4Z@ 4 4j 43 4 4oU 4[ 4v 4 4 4(= 4Ɂ 4* 4n 4P_ 4 4ѫ 4$( 4Oi]( 45g( 4͈( 4a( 4( 4->( 4( 4g( 49( 4B( 4c( 4( 41) 4\ ) 4_) 4}) 4D) 4#) 4)) 4dH/) 4B;) 4N[) 4Xw) 4N) 4) 43) 4PG) 4\) 4N) 4r) 4^) 4) 4`* 4ݫ* 4@* 4[** 4s7* 4bE* 43R* 4"_* 4CHl* 4&y* 4u* 4A* 4 * 4w;* 41* 4* 4* 4E{* 4> + 4+ 4A&+ 49+ 4{VF+ 4T+ 4q`+ 4n+ 4sM|+ 4~+ 4q^+ 4K+ 40+ 4+ 4+ 48+ 4B\+ 4\+ 44, 4u, 4#U$, 42, 4c@, 4GSN, 4\, 4Eqj, 4x, 4H, 4, 4K, 4, 4;, 4B, 4, 4U, 4NI- 4I - 4|- 4|"- 4w0(- 4.- 454- 4;- 4GI- 4W- 4Doe- 4'Js- 4- 4~- 4|- 4- 4u- 49{- 4c- 4- 4m- 46. 4Kz. 4. 4T.. 4\=. 4L. 4[. 4v\i. 4w. 4. 4jF. 4O\. 4. 4>. 4. 4. 4. 4Ih/ 4/ 4/ 4[,/ 4[:/ 4ExH/ 4ZV/ 4mbd/ 4jt/ 4/ 4/ 4L/ 4u/ 4/ 4u/ 4/ 4/ 470 4k0 4$0 4:20 4So@0 4N0 4d\0 4j0 496x0 4S0 470 40 4̓0 4]i0 4,0 40 41 41 4"1 4Ex/1 4v<1 4I1 4V1 4^lc1 4rrp1 4r}1 4S1 4-1 4=1 41 4*1 4@1 41 41 4 2 4@*2 4TF2 40T2 4 tb2 4p2 4d~2 4~|2 42 49|2 42 42 42 49 3 43 4$3 4Kb13 4>3 4K3 4qX3 4dDe3 4Kr3 4r3 4q^3 4K3 43 4w3 43 47a3 44 44 47,4 4b94 4AF4 4 S4 4$`4 4Em4 4z4 44 4q4 4dD4 4q^4 4K4 44 494 4QE5 4R5 4_5 4l5 49y5 4d5 4C5 4ə5 425 4m5 45 45 4nT6 4Oa6 4n6 4{6 4Kb6 4C6 46 4 6 46 4u6 4=6 4DR6 466 4ϯ 7 467 4oD7 4R7 4w9`7 4qo7 497 4w7 47 4k7 4P7 4F7 4h7 47 47 477 47 407 4L`7 4Ĕ7 4 8 48 4mw&8 458 4?8 4h>P8 4KV8 4d\8 4&b8 4h8 4n8 4״t8 4{8 4$88 4O8 4:8 4Sp8 4P8 48 4ϡ8 4=8 4{8 4R8 48 48 49 4,9 469 4K>J9 4h9 4r9 4zS|9 4y9 49 4l9 49 4r9 4X9 4?9 4Q99 4d9 40: 4: 4Q[+: 4ā8: 4ZK: 4~W: 4eRd: 4r: 4_~: 4: 4t: 4.C: 4: 40y: 4': 4E: 4x: 4R: 4k ; 4U; 4(; 4F6; 4GD; 4AS; 4ab; 4=q; 4f; 4D; 47; 4H; 4v; 40; 4Q^; 4r < 4< 4g$< 4N=1< 4ay>< 4l< 4|< 4< 4[< 4< 4Ǖ< 4w< 4A< 4=< 4h< 4< 4nN< 4s< 4~< 4i = 4= 4['= 45= 4C= 4ZQ= 47_= 4m= 4{= 4K= 4= 4l= 4L= 4]= 4C= 4ۃ= 47= 4= 4> 4ʾ> 4O+> 45> 4 4M> 4oU[> 44i> 4w> 4> 4> 4}> 4y> 44> 4A> 4> 4> 4> 4? 4? 4[#? 4?1? 4?? 4bM? 4}[? 4Di? 4bw? 4@? 4ҷ? 4x? 4? 4O? 4<? 4? 4w? 4? 4"@ 4{C@ 4h@ 4g-@ 4v;@ 4(I@ 4W@ 4:e@ 4#s@ 4P5@ 4a@ 4 Q@ 49@ 4@ 4D@ 4@ 4V@ 41@ 4ko"A 4<0A 4oU>A 4fLA 4{jA 4ޞtA 4A 4A 4SoA 4UA 4A 4A 4|A 4rA 4A 4A 4A 4/A 4StB 4FB 4R3#B 4)B 4/B 4=B 45nC 4C 4FC 4C 4C 4ED 4j D 4D 4QeD 4*D 48D 4YUED 47QD 4|]D 49tD 4مD 4rD 4D 4D 4D 4jD 4D 4c@D 4mD 4oE 4E 4E 4r+E 48E 4EE 4RE 4jlE 4c@yE 4mE 4oE 4rE 4E 4E 4E 4E 4RE 4TE 4)F 4XGF 4F 4+F 48F 4AEF 4mwRF 4glF 4F 4oF 4F 4XtF 4{F 4LF 4teF 4cF 4F 4ȥF 4]G 4G 4G 4`d+G 4eEG 43RG 44_G 44mG 4wG 4ŃG 4@G 4ԐG 4G 4G 43G 4G 4SG 4H 4-H 43(H 4w5H 4BH 48OH 4P]\H 4ÜiH 44vH 4KH 4\?H 4ݠH 4kH 49DH 43H 4`6H 4DLH 4H 4H 4jI 4gI 4?I 4.t,I 4 v9I 4bFI 4āSI 4>`I 4 anI 4|I 4GI 4*I 44I 4^I 4mwI 4I 44I 4RI 4I 4J 4HJ 4: J 4-J 4TS:J 4SRJ 4x`J 4:RyJ 4BJ 4 5J 4]~J 4wJ 4}J 4%J 4K 4|K 4i9K 4AFK 4%yTK 4bK 4pK 4<=~K 4$K 4Y|K 4t5K 4K 4nK 4sK 4pK 42K 4dK 4*B L 4@L 4%L 4י;L 4GL 4dTL 4aL 4XznL 4qL 4^zL 4xhL 4İL 4L 4EJL 4L 4RL 4fM 4VM 4 pM 4R+M 48M 4EM 4V\M 4oiM 4M 4M 4M 4M 4 zN 4FN 4%2N 4N 43eNNiNlN 4N 4O 4AAEO 4eO 49O 4O 4eO 4ƀO 44O 4tvP 4$P 4@P 4IP 4R`P 4zwP 4x}P 4;P 4fP 4TZP 4P 4dP 4|P 4eQ 4l(Q 4VH;Q 4^aQ 4}|Q 4 Q 4Q 4UQ 4 Q 4Q 4j`/R 4;9;R1RR 4]R 6`aR 6`fR 4_qR 6`uR 6`zR 4~R 6`R 6`R 4xJR 6'aR 6aR 4ҰR 6MaR 6IaR 4AR 6kaR 6eaR 4xR 6aR 6aR 4R 6aR 6aR 4R S1S 7 $S 6a(S 6a2S 2bTR2T 4`T 7 T 6TbT 6NbT 6}bT 6{bT 4AT 6bT 6bT 7 U 6bU 6bU$3%U 7 6U 63c:U 6c?U 7 HU 6cLU 6cUU 6"dYU 6dbU$3lU 7> {U 6dU 6dU 7P U 6dU 6dU$3U 7P U 6dU 6dU 7P U4U4U 6eU 6dV4V4-V 6e1V 6e:V4DV4]V 6eaV 6eoV4yV4V 6.eV 6,eV4V4V 6EeV 6CeV4V4V 6\eV 6ZeW40W4:W4[W 6se_W 6qehW4rW4W 6eW 6eW4W 6eW 6eW5W 6eW 6eW 6eW 6eW5 X 6e X 6eX5(X5AX5KX5cX 6egX 6epX5zX5X5X)3X 7b X 6fX 6eX 7b X 6fX 6sfX 6gX 6fX 6gX 6gY 6gY 6gY 6hY 6gY 6h"Y 6eh+Y 66i/Y 6i8Y 6iaSahazaa7a 8a 8a 6ra 6ra 7 b 6 sb 6sb 6)sb 6#sb 6Rs!b 6Ns*b 6us.b 6os7b 6s;b 6sDb 7) Vb08`b 7) lb 6spb 6syb 6s}b 6sb 6sb 6sb 6sb 6sb 6sb 6sb 6tb 6tbbbbc#cd NdW;hdK8rd 7> d 6Ftd 6Dtd 7> d 6Utd 6Std 6ltd 6jtd.:d.:d 6td 6td3e]4e45e X?e4We5oe6e7e17e e;7eS7e f]7f92f9Mf Wf9ofD:f f;f xf;f2;f9g9!g 6t%g 6t.g9Gg 6tKg 6tTg 6tXg 6tag9wg9g9g 6tg 6tg 6tg 6tg 6ug 6tg9g 6ug 6ug 6.ug 6*ug9 h9h 6Ju#h 6Fu,h 6fu0h 6bu9h9Qh/9[h/9wh 6u{h 6~uh 7N h 6uh 6uh 7` h 6uh 6uh 6uh 6uh:h hj9h 7w h 6vi 6 v ij9ij9-i 6&v1i 6$vs 4_Ks 4Afs 4otxs 4As 4;?s 4gs 4Ors 4s 4As 4u@s 4s 4t 4 Gt 4ft 4,t 4A9t 4Gt 44Yt 4gt 4t 4t 4t 4t 4t 46xt 4u 4Z u 4u.u 47n@u 4Mu 4uZu 4 gu 4ctu 47ou 4-Eu 4qu 4u 4u 4)u 4Bu 4[u 4tv 4v 47v 40v 4ѿ?v 4Nv 4]v 4lv 4|v 48v 4v 4v 4"9v 46v 4 ev 4v 4 jw 4w 40w 4=w 4[Yw 4kw 4w 4w 45w 4w 4w 4w 46w 4 x 4x 4A7x 4Dx 4Vx 4Ⱥx 4@x 4Ox 4x 4B|x 4mx 4ay 4sy 4]+y 47y 4Q^Dy 4{_y 4my 4 Jqy 4Hyy 4ip}y 4ipy 1Yy 4y 5y 5/yp;y 2s]y 4c y 4y 4Ay 42y 4"dz 43z 4z 4^)z 4U.z 45| 4\J| 4pV| 4Ib| 4Gn| 4z| 4j| 4B| 4b| 4je| 4| 4| 4| 4| 4%| 4O| 4U} 4O%} 4n6} 4OC} 4>P} 4ac} 4bp} 41K~} 4q} 4>} 4H} 4} 4>} 4X ~ 4f.~ 4f;~ 4`H~ 4U~ 4b~ 4qo~ 4J|~ 4#~ 4{;~ 4>~ 4m~ 4K~ 4~ 4l~ 4f~ 4~ 4^ 4d] 4S$ 42 4a@ 4>N 4eU\ 4pj 4Cx 4.d 4  4Z 4o 4@ 4 4e  48 4' 46 4]8E 4jT 4=d 4Es 4 4 4e 45 4 4 ̀ 4 ܀ 4: 44 4  4 4' 46 4qE 4T 4`c 4Rr 4d 4 + 4O 4u= 4@ 4"́ 46ہ 4- 4( 4 4@d 4& 45 4gS 4Ib 4)q 4q 4. 4Mo 4?o 4 4c˂ 4mۂ 4T9 4X 4  4 4X<+ 4Rg; 4]K 4@X[ 4Y k 4-X{ 4M 4 4  4 4˃ 4ۃ 4s 4@ 4Y 4& 45 4D 4=S 4b 4HBq 46 4NU 4G 4 4 4=˄ 4Eڄ 4o 4T. 4! 4 4D% 4m 4 49C 4R 4$)a 4|p 4 4: 4R 4B 4 41˅ 4\څ 4"1 4 4 N 4. 41i% 4r4 4!sC 4R 4Ao 4'~ 4 4zL 40 4 4Ɇ 4~B؆ 4 J 4vr 4 4 4a# 4p2 4^A 4(P 45_ 4fhn 4Z} 4T 4* 4< 4k 4ȇ 4ׇ 4  4@ 4G9 4 4" 481 4 @ 4O 4^ 4_m 4&| 4w: 4s 46I 4. 4.aLj 4,ֈ 4"+ 4# 41 4% 4! 4DG0 4? 4lN 4F] 4(l 4.{ 4?8 4< 4 4_ 4Ɖ 4AՉ 4" 4n, 4F 44 4O  4Q/ 4J> 4&M 46O\ 4VZk 4{ 4 4% 4R 4'$ 4pƊ 4_Պ 4 4 4 4 4*E  4 L/ 4Ok> 4N 4J>] 4qol 4?/{ 45 4 49# 4fk 4#Ƌ 4;iՋ 4 4Z 4G 4J 4  4/ 4M > 4dEM 4\ 4k 4Qz 4! 4@  4 43  4_Ō 4%MԌ 4& 4# 4A 485  4 / 4> 4_M 4ds\ 4o5k 4z 4n 4w 4R 4 4]ƍ 4.֍ 4O 4[ 4| 4b( 4V# 4( 3 4B 4 4L 4L 43 47֎ 4 4p 4B 4  4>" 4B: 4$G 4X[ 4%h 4 43 4q 4 4/Ǐ 4)Տ 46 47 4 4P  4 4s) 4>7 4]rE 4oS 4Ka 4%o 4 } 4 4_ 42 42 4Ő 4!Ӑ 4 4) 4= 47  4K 4<' 475 4C 4reQ 4_ 4+m 4d 4Q< 4F 4  4{2Ƒ 4FՑ 45 4R 4B 4/ 40 4? 4N 4] 4Tql 4L{ 4a 4 4| 4R 4 ƒ 4K'Ւ 4 4< 4  4  4a  4h/ 4s> 47M 4 q\ 4*k 4uUz 4@M 4 4\ 4 47sœ 4;Dԓ 4 4% 4; 4 4s 4. 4= 4'L 4f[ 4Ij 4#[y 4r 4/ 4, 4 4]Ĕ 4Uݔ 4 4"J 4> 4 4? 4UE< 4+F 4S 4eg 4n9 4;0 42 4_ 4 Oȕ 4z_֕ 4V 4 40 4& 4 48( 4>6 4j 4 4D 4FŖ 4e[і 4cݖ 4! 4-6  40/ 41S; 4 I 4 X 4&~ 45 4= 4OO× 4(З 4 4 4;  4M 4sN 4\6\ 4j 4"x 4~? 4wK 4  4 4R̘ 4Iژ 4 4j 4 4p 4L]" 40 4d6] 4j 4 4 4$ 4#c֙ 4 4 4 4+ 4Q " 41 4F? 4nM 4}[ 4i 4-w 4 4tQ 4<[ 4VM 46] 4ښ 4 4vr 4  46>9 4M 4b 4$Ao 4| 4% 4C 4Eɛ 4%Bڛ 4+ 4G 4C 4T  46 4 43+ 4E8 4E 4R 4 _ 4l 4(8z 4& 4X 4[ 4 4'Μ 4 4p 4 4  4 4m& 43 4,_@ 4N!O 4f^ 4{ 4H 4P 4 4^; 4 4.8 4˝ 4؝ 4XJ 4r 4 4 4ja$ 41 4B> 4K 4Rx 4/ 4 4Z 4e͞ 4s۞ 4E 4RD 4C 4 4oV! 4/ 4= 4K 4Y 4g 4Gu 4} 4o 49 4dN 4X 4ɟ 43ן 4 4% 4j 4Vc 4( 4+ 4Jf9 4`G 4U 4c 4_pq 4Y 4  4p 4 4 4Nɠ 4֠ 4 4;" 4; 4Z# 4)0 4%= 4J=J 4*W 4""p 4s| 4E 4 : 4 4U 4h 4 4Ρ 4 4 4g1 4a 4 + 47 4&D 4hQ 4 ^ 4kq 4+~ 4  4k 4b 4Ǣ 4lޢ 4 4_ 4K 4  4k  403 4-? 4=K 4X 4@e 4q 4R 4t< 4G£ 4v(ϣ 4 4s  4\C 4fk 4A 4Tb 4 4O_ 4`̤ 4H 4\( 4f5 4 4v" 4; 49H 40kU 4h 4]Ц 41ݦ 4fz 4 4 4|q 4 4"# 41 4ms 4IU 4E" 41ʨ 4J_ר 4_^ 4  4z  4 4$ 4G 4 U 4N8c 4 q 4# 4J 4e 4Q 4ݩ 4 4{C 4 4 4O# 4#0C 4qR 4.` 4-n 4N8| 4  4 4qW 4=Ȫ 4@ت 4 4' 4? 4M 4[2 4E@ 4eN 4q\ 4{j 4x 4 4P[ 4 4 4. 4 4 4m 4! 4. 4fI 4HV 41Kd 4Iq 4> 4) 4\E 4 4 4L 4 4p0 4T > 4J 4OFW 4J d 4+.q 4r~ 4y 4*V 4 4 4{'ĭ 4_ѭ 4kޭ 4 4+R 4M 43 4 4C, 4QH9 4t-F 4WR 4_ 4l 4%oy 4X 4j 4iȮ 4ծ 43 4# 4J 4T  4 41K$ 4&1 4>> 4HV 4>c 46>q 45~ 4s 4E 4; 4Dp 4O˯ 4ׯ 4 4 4; 4}  4 4% 4"=2 4@ 40U 4b 43p 4W 43 4 4 4_ذ 4 4# 4.! 4)= 4I 44f 4r 4:m~ 4P 4' 4 4 46 4̱ 4ٱ 4 4 4 4)  4J 4v' 4r7; 4+H 4m 4| 4K 4:G 4 4) 4² 4P$в 4H޲ 4 4$ 4 4 4O* 4)8 4F 4XT 4~Jb 4ep 4B~ 4? 4X 4} 4~ 4&ij 49ҳ 4 4- 4 4m  4/ 4M& 4j4 4B 4NP 4W^ 4il 4>z 4k 4 4Y 47  4.7δ 4+ݴ 4+< 4V 4S 4{\  4 Q0 4~FF 46U 4t3d 4s 4A 49 4Q 4SƵ 4l?ӵ 46 4 48 4y 4 4! 4G. 4] ; 4RH 4tU 4)`m 4*| 4< 4 44 4 4E¶ 4 4K 4EX 4y+ 4 4' 4$ 4 4  4k 4, 4G2 4,8 4P> 4D 4+K 4P 4=Q] 4k 4-0u 4JS 4 4 4.d 4W 4ż 4Ҽ 4c߼ 4- 4T 4UI  4 4p' 4UI4 4mB 4"O 4F ] 4lk 4}0x 4UI 4  43 47 4; 4F  47˽ 4mؽ 4 4! 4c. 4  4!3 4p@ 4M 4aZ 4bt 4 4Y 4Fk 4# 4db 4jȾ 4lվ 4m 4 4fh 4o 4d, 4G: 4M 4k 4Kw 4s 4F 4 4 4l 43ƿ 4;iӿ 4 4 4a/ 4; 4AG 46X 4kd 4u 4_ 4Q 4G 4 4 41 4 4a 4i 4 4 41, 4iC 4P 41] 4j 4w 4D\ 4 4R 41 4b 4 4 4+ 4U 4I  4b, 4 8 4!D 47Z 4cw 4  4 4 4BH 4 4de 4 4Y# 4N  4 4. 4d; 4H 4U 4Yc 4w 4 4$ 4A6 4 40 4J 4 4V 4Yo 4 4& 4_= 4Z+ 4#E 4@@S 4` 4n 4{ 4( 4# 4. 4p 4 4b 4yV 4j 40 4  4p@  4A 4& 43 4hA 4=<N 4} [ 4pi 4v 4 45 47` 41 4(6 45 4- 4_ 4 4*J  4 4% 42 4s 4q 4]] 4m  4! 4 43 4 4h 4 4U^ 4V 4  49 4' 4 5 4!Q 4!_ 4m 4D| 4@d 4 4^ M 4H:[ 4)i 4 w 4we 4C 4J 4`' 4! 4B 4, 4J 4 4 4 4E* 4ri- 4; 41I 4CBW 4~z 41 4" 4W 4) 4*) 4*  4C 4U] 4B 40  4}N. 4= 4K 4Y 4T3g 4Mu 4+; 43 4H: 4 4m 4  4 4 4@ 4Kq  4v8 4T- 4Q< 4X 4Zf 4t 4 4x  4f 49 4wm 4Y 4 4 4w 4 - 4s= 4cb 4p 4> 4& 4 4  4D 4 4 4Y 4_ 4l 4a 4K+ 49 4G 4b0U 4S*c 4q 4 4 4  4] 4PL 4 4' 43 4  4 4QJ$ 4lK> 4'a 4n 4:P{ 4L 4 4f 4S 4Wm 4L 4fg 44 4A 43 4* 47 4D 4Q 4fn^ 40k 4rEx 4 4! 4 4ds 4[l 4K 4$ 4n[ 4f  4< 4z9 4[lF 4dsY 4J 4 4> 4W/ 4! 4 4j 41i 4b 4 4p  4zL 4! 4F. 4<; 4'H 4 U 4sb 4^o 4| 4) 4 49 4 4j 4Se 4 4r0 4 4<$ 4/ 4Z 4) 4E7 4oP 4^ 4l 4PYz 4 4m 4a 4' 4 4! 4 4c 4~1 4D 4eO" 4m 0 4$)> 4|L 4iZ 4h 4Rv 4B 41 49 4 4O 4/ 4& 49 4 4& 4 4n 4, 4=: 4]H 49V 4Od 4r 4 4k 4E 4  4 4f 4 4p 4T 4^ 4!g  4 4#' 46>; 4I 4?(W 4:e 4Bs 4f 4 4 4S 4p  48 4  4 4Z[ 4 43  4 4}$ 4H1 4cPD 4S 4!(] 4g 4u 4 4r 4 40 4] 4 4 4 4@) 4i  4* 4N7 4FD 4 Q 48^ 4k 4Sx 4J 4V 40 4# 4 4M 4B 4 4! 4, 4~Q 4' 435 4dC 4Q 4fl 4z 4m' 4V 4= 4  4 4 % 4V 4t 4 4E  4/ 4G= 4QK 4Y 48Hm 4Lz 4! 4ri 4  4 4 4( 4 4E 4> 47  4. 4# 4Y0 4~6= 47MJ 4W 4Mj 4Tt 4eo~ 4n 4 4j 4X 4m 4.d 4; 4cX 4\g 4u 4b 4)8 4$E 4R 4zh_ 4 41C 4| 4D 4 4+ 40 4- 4o  4,- 4: 4G 4@n 4M 4. 4 4T 4^N 43 47b 4ai 43 43  4h8 47l$ 4z1 4A> 4mL 4 Y 43f 4C t 4# 4l 4& 4 4i 4  46\ 4 4%I 4}> 4 4 4:P8 4ME 4^ 4k 4)x 4 4 4+ 4 4TV 45  4,  4 ' 4.) 4 < 4I 4V 4sp 4E} 4; 4h 4 44 4  4 4 4fj 4m  4j 4X' 42(4 4(6A 4Ah 4jw 4)l 4# 4f 4_s 4 4/L 49 4 4#: 4 4(6 4j6 4! 4 4`3 4Z@ 4EM 4%nd 4 eq 4E 4)G 4E 4H 4\ 4' 4Q 4}d 4 4! 4. 4+< 4/L 49R 4X 4^ 4Ye 4u 4R{ 4zI 47 4m 4 4! 4GY 4  4  4$ 4 4  4- 4: 4G 4XT 4la 4bn 4p{ 4% 4> 4l 4 4EE 4 4L  4L 4V" 43/ 4< 4I 4r` 4m 4\z 4 4 43 4 4y[ 4}M 4v@ 4 f 4 4y[ 4m 4.. 4/; 4H 4U 4/b 4ypo 4| 4tG 4  4 4U5 4/T 4PG 4^3 4 > 4X 4  4 4J+ 44XS 4a_ 4u 4a 4@ 4Z- 4%o 4@- 4 4{ 4^ 4 4b2 4? 4K\M 4Z 4t 4:P 4 4 4]) 4s 4q 4  4f 4D%? 4)%V 4Jd 44X 4%o 4T 4 4Z- 4a 4D% 4 4;/ 4(H 46WV 4%d 4_r 4 4N 4 4 46 4?W 4- 4c 4Q  4M 42 4\@ 4n:N 44q 46 4S 4s 4[ 4 4 Y 4n 4 42 4M 4g+ 4g9 48G 4U 4:9i 4/w 4 4V 40 4, 4 4 4 4FQ 4+ 4)! 4_/ 43> 4FL 4Z 4h 4v 42 4# 4: 4J 4 4K 4 4=+ 4n5 4uC 4oQ 4*_ 4_m 4j{ 4[s 4: 4/ 4 4 4\ 4R 4w1 4) 4* 4, 48 4F 4ab 4W} 4l 4 4h 4i 4 4  4 4K  4 4c7 4E 4NS 4a 41o 45} 4 4 4 45o 4> 4_C 4.? 4o 4V( 4b  4 4S( 4d:7 4F 4U 4d 4.s 4o 4B 4! 4 4 4e 4! 4n 4"b  4Z 4i' 46 4E 4,T 4dc 4Zr 4 4V 4I^ 4s 4K 4 4  4i 4W 4F 4b< 4Xa& 45 4D 4S 4cb 4*Uq 4 4pP 4 41 4- 4* 4n 4C 4k+ 4[ 4 i 4( 4P) 4\ 4# 4 4< 4f 4=J 4 . 4k) 4 4K 4k 4iY 4#Q 4z] 4 4+ 4k# 4gB) 4/ 4$5 49; 4 A 4SG 4 M 4S 4!Y 4_ 4ce 4`Kk 4#q 41w 4b} 4%* 4 4U 4 4< 4 4 42 4i 4 4 4M 4^, 4 4  4PN 4?f 4 48 4' 4 4k 4A 4n 4bA 4& 4L@2 4@> 45&J 4ZW 4o!d 4q 4_&~ 4Z 4* 4 4  4d 4  4tq 4b* 4S 4F 4F  4, 459 4S 4"4` 4m 4z 43 4% 4 4) 4;" 42 48 4i> 4PE 4O 4c`\ 4i 4v 4m 4 4U+ 435 4P 4j. 4X 4F 46 4f 4' 4rj4 4[ 4Ch 4{ 4 4N% 4 4 4 ` 4p 4m 4E+ 4q8 41R 496h 4(t 4G 47 4KZ 4 4G 4 4N% 4 4kX 4! 42: 4M 4^W 4Df 4Cs 4  4;1 4  4 4+ 4S 4G 4P 4n[ 4f 45 4I1Z 4Fh 43 4Cs 4 4p 4  4Y% 4 4 4n 4 4pp  4  4# 4B0 4= 4$J 43B 4Xf 4 47 4 4Y 4f 4 41 41' 4l  4 4' 4!4 4A 4,O 49\ 4j 4w 4E 4> 4r0 4' 4 4 4N 4' 4 49) 4t6 4ED 4`Q 4^1^ 4qk 4x 4,F 4 4r 4 4- 4  4" 4[. 4@^C 42O 4.d 4Hp 4l} 4D 4 4 4P 4W 4f 4& 44 4  4k. 4F< 48J 4 X 41f 4\t 4] 40 4\ 4&' 4. 4  49 4J 4 42c 4( 4=. 4tC= 4, Z 4nIi 4,x 4 4) 4 4\\ 41  4H 4Z 4r 4[U 4UR 4F  4=, 4; 4BJ 4g 4 v 4iC 4,1 4 4: 4 4L6 4 4V  4?  4.] 4* 4P9 4IH 4UW 4^f 4g 4y+ 4: 4{& 4` 4*, 4[  4m  4d!  4.  4dN;  4H  4V  4bV  46;  4!  4I  4I  4O  45Y  4V  4`l  4,  4  4  4<  4 B)  4L  4NV  4Sj  4z4x  4^n  4f  4u  4%o  4 m  4@  4=  4b  4uZ  4  4_$  4X1  4 IJ  4 W  4;>e  4"s  4K  4Q  4  4zg  4  4T  4Bq  4  43  4vS  4  4d!  4&/  4U;=  4+L  4Rlo  4\{  4)  4)(  4X  48  4  4)D  47  4  4"  4-  4gr  4Q1-  4<:  4c7G  4R"T  42a  4Nn  4Y|  4  4   4l  4  4  4  4   4E`  4l  4,  4[>  4z% 4) 457 4cK 4 Y 44Fg 4&&u 4d 4 4@; 4D 4 4 4I-( 46 4HD 4$R 4` 4>n 4g| 48 4_ 4m 4> 4A 4lO 4Kd] 4F k 4y 42 4: 4( 4E 4e 4* 4b 4' 4 4/ 4( 4E! 4"0 4X> 4L 4lZ 4Hch 4>v 42 4 4 47b 4uB 4$ 4G 4- 4h 4s" 40 4 > 4aL 4ccZ 4`h 4Dv 4 4VT 4l 4 4A 4e 4T 4>b 4e  4, 4A? 4c 4P 4g& 4 4A  4'. 4 4"P 4' 46 4S 4% 4L 4W 45$ 4n2 4@ 4N 45\ 4?j 4x 4` 4K 4{ 4P 4W 4! 4 4L0 4 4 47 4  4GM 4X 4 4[ 4Z- 4?N 4x  40 4#& 4;r 4lZ  44- 4l: 4G 4 4] 4?j 4' 4 4X 4 4Gl 4 4 4pR  47 4>B! 4+ 4T: 4H 4V 4d 4x!r 4 4_ 4 4 4O 4UB 4  4 4c 4* 48d  4wR 4( 46 4D 4xR 4d` 4n 4| 4Gb 4 4*h 4zf 4 4 4B 4 4[ 43  4) 4L7 4MF 4CT 4b 4.p 4+I~ 4 4  4= 4s 4> 4r 4? 4 4 4L% 4=c4 4-XB 4P 4^ 4: 4q 4| 4m 4Gl 4 4j 40D 4T 4g 4d 4,A 4, 4'Z: 4EH 4']V 41gd 4r 4, 4 ! 4" 4 ; 4& 4 4 4" 4j 4 4P" 4; 4PPJ 4MT 4h 48v 4m 4r 4W 4W 4J 4LE 4T 4J 4t 4O 45  4~"  4  4,  4N9  4F  4S  4{`  4:m  4z  44f  4  4  4  4^  4  4%! 4 3! 4 P! 41J! 4! 4Y*! 46 " 4"O" 4W!# 4*# 4$ 4d$ 4/& 4' 4TQ' 4B' 4D( 4A!( 4P'( 4-( 4gm( 4:) 4C) 4&* 4\* 4)* 4j** 47* 4kD* 4Y]* 4+j* 4Ry* 44* 4T* 4z * 4FT* 4Z* 4* 4 o* 4P+ 4)+ 4+ 4 ,+ 4 9+ 4M+ 4Z+ 4o_g+ 40t+ 4R>+ 4+ 4+ 4 + 4/+ 4Ge+ 4[b+ 4e!+ 4+ 45%+ 4II , 4Z, 4<, 4/p, 4A%, 4,, 49, 4EF, 4QKS, 4p, 4;, 4c, 4v(- 4l+- 4Y=9- 4:G- 4fe- 42r- 4.. 4mq. 4-. 4t. 4 U. 4  / 4=/ 4354/ 4-#>/ 4vK/ 4GY/ 4f/ 4s/ 4Y/ 4/ 4)/ 4/ 4/ 4o/ 43d/ 4_0 420 4o?0 4.L0 4UZ0 4*h0 4ov0 4dN0 4 0 4" 0 4&T0 4q40 4C0 4N0 4I0 40 41 4}1 4RD)1 4eH1 4OT1 4a1 4Xk1 41 4[1 4d1 43d1 451 421 4%1 41 4C1 4N2 4u2 47 2 4}03 48@3 47F3 4 L3 4uHS3 4`3 4m3 4Wz3 43 4l3 4\m3 4]3 43 4EF3 4)4 4o4 4W#4 404 49>4 4L4 4.Z4 4%oh4 42v4 4C4 4g4 44 4a$4 4RD4 4}5 4^ 6 46 4\m6 4kz6 46 4k$6 4S6 46 4G6 4dN6 4^6 46 4l%6 4D7 47 47 4j7 4"N7 47 4 8 48 4G#8 4)08 48 4X8 4 8 4S8 48 4E8 49 4 9 4.9 4g<9 45J9 4'X9 4xJg9 4u$v9 4UW9 4Sf9 419 429 49 4U9 49 4a9 4P : 4 : 4r*: 4=9: 4>H: 4W: 4]f: 4: 4u: 4: 4$E: 4?: 4dN: 47K: 4o: 4: 4B] ; 4*; 4Z*; 4H:; 43-J; 43Z; 4'j; 4a"; 4; 4; 4T; 4a; 4; 4T; 4; 4a < 4,i< 4=#< 4 /< 4F< 4FS< 4U`< 4 m< 44< 4*O< 4< 4< 4'< 4< 4Y< 4R= 4"= 40= 4>?= 4(K= 4_LW= 4uc= 4+o= 4J|= 4"= 4-o= 44= 4>= 4HH= 4= 4H= 4b= 4)$> 41> 4'>> 4> 4jJ> 4xk> 4r> 4!> 4]k? 43? 4T@? 4F `? 4fm? 47z? 4? 4? 4? 4^? 4O? 4 ? 4S? 4@ 4Ch @ 41*@ 47@ 4D@ 4Q@ 4\^@ 4Yk@ 4Vx@ 4Z A 4JA 43*!A 4 'A 4-A 4V4A 4PA 4F `A 4&nA 4|A 4A 43A 4.A 4TiA 4gA 4_A 4mA 4B 4 ;B 4EB 4+^B 4[WmB 4+PzB 4B 4W`B 45 B 4[:B 4CB 4K C 4Q:C 43#C 40C 4o=C 4wJC 497WC 4dC 4ZqC 4LC 48C 4FNC 4C 4JC 4C 4eC 4C 4"?C 4bC 4xJ D 4D 4&D 4.@D 4+MD 4!jD 4J#wD 4cD 4D 4D 4UD 4D 4ED 4TD 4%D 4D 4-E 4OE 4"E 4*E 48E 4}*FE 4,TE 48bE 4pE 4~E 4E 4E 4E 4E 4CrE 4kE 4E 4dE 4:E 4 c F 4CnF 49&F 44F 4AlF 42c~F 4b-F 4MF 4_?F 4*F 4F 4|7F 4/[F 4F 4<F 4#F 4FCF 4F 43F 4F 4G 4QrG 4"!G 4t0G 4W:G 4IG 4WG 4LfG 4*uG 4gG 4G 4G 4waG 4rG 4AeG 4PsG 4]qG 4jG 43 H 4jH 4%H 4*3H 43CH 4SH 4=cH 4LsH 4efH 4 H 4>H 4)sH 4(6H 4},H 4H 4H 4H 4I 48I 4;&I 4o6I 4)FI 4nVI 4+rfI 4{5vI 4kI 4jLI 4PI 4uXI 4I 4I 4CgI 4I 4nI 4/ J 4J 4"7(J 4m7J 46FJ 4 UJ 4StJ 4/J 4)J 4jJ 43J 4J 4AJ 4)sJ 4}TJ 4J 4=K 4K 4RK 4`)K 4R6K 4tCK 44=PK 4jK 4YyK 4S 4NS 4%S 47K#S 4^2S 45?S 4VS 4X7`S 4nS 4!|S 4lWS 4}*S 4,S 4>S 4g%S 493S 4 "S 4DS 49T 4T 4[&T 42T 4GDT 4QNT 4XT 4FgT 4+5uT 4T 4T 4T 4T 4mT 4T 4A+T 4T 4T 4FU 4 U 4"U 4FU 4PU 4]U 4U 4U 4U 4_U 4K U 4U 4U 4#U 4)V 4@V 4V 4V!V 48(V 4S5V 4BV 4tOV 4sl\V 4b#iV 4JvV 4z.V 4k"V 4g V 4>V 4V 4oV 4dNV 4V 4GV 4 jW 4:W 46W 4r*W 4g8W 4FW 4TW 4bW 4R'pW 4s~W 4kW 4 ;W 4`W 4W 4-W 4dW 4oW 4SW 4g^W 4. X 4LX 4c+X 4B!8X 4^FX 4L]TX 4bX 4#YpX 4`~X 4<X 4~rX 4cTX 4KmX 4X 4lNX 4[X 4!X 4X 4A3 Y 4:+Y 4UY&Y 4y4Y 4.BY 4PY 4Mj^Y 49lY 4SzY 4l#Y 45Y 4Y 4 Y 4IY 4aY 4DY 4[Y 4zY 4WZ 4AZ 4"Z 40Z 4_>Z 46ELZ 4$ZZ 4CKhZ 4QnvZ 4K;Z 41Z 4Z 4SZ 4 Z 4*Z 4SA[ 4V[ 4) [ 4*[ 44[ 4tC>[ 4OH[ 4R[ 4\[ 4?f[ 4rp[ 4}oz[ 4I[ 4#[ 46>[ 4S[ 4=[ 4$[ 4j\ 45?] 4kr] 4kg] 47] 4#] 4r] 4] 4] 4s] 4] 4,] 4%o] 4T^ 4|^ 44!^ 4.^ 4D;^ 4jSq^ 4~^ 4^ 4S^ 4^ 4kg^ 4C ^ 4%o._ 4';_ 4YH_ 4_ 4oM_ 4_ 4_ 4+5F` 4hL` 4?R` 4TX` 4x^^` 4d` 4Lk` 4Cx` 4\` 4D>` 4W_` 4@` 4h` 4+` 4|(` 4w` 4D` 4m` 4 a 4Oa 4[$a 41a 4?>a 47bKa 40Ya 4ifa 4EEsa 4a 4a 4F a 4)a 4a 4z/a 4(a 4Xa 4Ua 4  b 4b 4X#b 4*H0b 4>b 4sKb 4XXb 4^fb 4*b 4b 4fb 4,b 4Hb 4<'b 4b 43b 4jGb 47Sc 4c 4|Z"c 4k]/c 4llg 4)2g 4 g 4X8g 4V$g 4/9g 48g 4Yg 4 h 4Hh 4Wd#h 4^/h 4;h 4^Hh 4HUh hhWrh 49h` h#h 48hh 4ih 4 i 4/$i 4HEi 4)i 4i 4%i 4i 4m>i 4%^ j 4D4j 4F_j 4z{j 4=j 4s6j 4G(j 4Ej 4pk 4Z2k 4Ik 4Ji`k 4'Nk 4^k 4k 4k 4(jk 4y` l 41l 4\l 4gsl 4l 4ql<l 4[l 6vl 6vl 4#l 6vl 6vl 4W,l 6Wwl 6Kwl 4l 6wl 6wm 6wm 6wm 4"m =,m =Im 6wMm 6wSm5=rmO=mV=mk=m 4,m=m 4[m 6xm 6wm 6t 4t 6{t 6{t 6{t 6{t 4rt 6{t 6{t 4*!t 6|u 6|u 4u 6C|u 6=|u 4kg%u 6b|)u 6\|9u 6|=u 6{|Bu 7M_u?iu 7Xzu 6|~u 6|u?u 7hu 6|u 6|u 7huE?uf?u 4u Iu 4v 6|v 6| v 4#v 6|v 6| v 4r+v 6}/v 6}4v 4?v 66}Cv 6(}Hv 4kgSv 6y}Wv 6q}\v 4C gv 6}kv 6}{v 6}v 6}v 6}v 6}v 4nv 6~v 6 ~v 7Ov 6~v 6~v 6~v 6~vJv 7_ w 6.w 6$w 6dw 6^&w 6*w 6z3w 67w 6@wJJw 7yZw 6^w 6gw 6kw 6pw 7yyw 6}w 6wJw 7w 6(w 6&w Kw Kw 62w 60wJwJxJ"x 6<&x 6:0xK:xKSx 6FWx 6D^xI~xIx>Kx 4%xKx 4Sx 6Rx 6Nx 6hx 6dx 4{)x 6|y 6zy 6y 6yK%yKBy 6Fy 6OyKYyKqy 6uy 6~yKyKy 6y 6yKy 7y 6€y 6y 6΀y 6̀y 6؀y 6րyKy 7 z 6z 6z 6z 6$z 6(z 61zK;z 7Hz 6Lz 6Uz 6Yz 6 bz 6fz 6oz 7xz 6"|z 6 z 6,z 6*z 68z 64z 7z 6Nz 6LzLz 4czKz 4SzK{K!{ 6X%{ 6V.{K8{KQ{ 6dU{ 6b^{Kh{K{ 6p{ 6n{ 43_{PK{ 4S{ 4:{F | 6| 6z | 6Ł$| 6)| 43| 67| 6F| 6J| 6O| 4 lY| 6`]| 6\b| 4rl| 6sp| 6o|H| 7/| 6| 6| 6| 6|6H|6H| 6ق| 6ׂ|H|H} 7?} 6} 6%} 6)} 62}H<}HX} 6 \} 6b}Hp}G}G}G}G} H}jH~H~H6~IN~ 4at~ 4#~~B~ 4~ 6~ 6~ 6C~ 69~ 6n~ 6j~ 6~ 6}~ 6~ 6 4s  6 6 41, 6ۃ0 6׃5 44G? 6C 6R 6V 6e 44Nl7Dz 4C 4o 6R 6L 4 6 6 7 4+ 6DŽ 6ńB 7u 6ӄ 6τ  6 6 6 6& 73 6'7 6%@BJ 7[ 64_ 60d 7m|D}|D 6G 6EDDʀ 6Q΀ 6O׀DD 6[ 6Y DD/ 6e3 6cADKDc 6wg 6uuDD 6 6D́DׁD 6 6DD( 6, 65DJ 6N 6ZDs 6w 6 6ʅ 6ȅD 6Յ 6ӅDłDDD  6߅ 6݅D"D;DZDd 7t 6x 6 6 6 7 6* 6$ 6K 6I 6X 6T 6{ 6uǃDу 7 6 6E 7  6  6 7 6 6&F7 GACQ 7a 6$e 6"j 7s 6.w 6,{C 7 6> 66 6e 6a 6x 6tÄ 6DŽ 6Є{Cڄ 7 6 6 6‡ 6 7  6ׇ  6чC C< 6@ 6JRFTRFl 6p 6xCCC 6 6ʅPDԅ 7 6 6  6& 6" 69 65  6L 6H 7$% 6]) 6[2PD< 7$M 6jQ 6fV 7$_EoE 6} 6{EE 6 6ɆEӆE 6 6EE! 6% 63E=EU 6Y 6gEqE 6 6EEɇE 6ш 6ψEE 6 6ވ'E< 6@ 6LEe 6i 6r 6v 6E 6  6 EEEE 6 6EE3ERKF\KFx 6$| 6"DDF 4 $ȉ 4 4!k 4 4 4GF 4#R 4e 4}b 4?Ê 6BNJ 6,͊ 4#׊ 6ۊ 6 4 6 6  4a 6b 6X 4S 6 6?( 7s8 6< 6A 7sJ 6N 6W?l?v 7 6B 6: 7 6a 6_? 7ċ 6nȋ 6j͋ 7֋u@@ 7 6 6  6 6@$ 70 64 6= 6A 6J@T 7` 6d 6m 6q 6}@ 6 6@?Œ 7Ҍ 6Ћ֌ 6ȋߌ 6 6? 7 6 6? 7' 6?+ 674?> 7K 6dO 6\X?b 7o 6s 6| 6 6? 7 6׌ 6ό 6 6?Í 7ύ 6%Ӎ 6܍ 6N 6F?? 6m 6k#?9@C@_ 6wc 6ul 6p 6y 6} 6@@@Ǝ 6ʎ 6Ԏ"@ގ"@ 6 6 6  6"@"@7 6; 6D"@N"@g 6k 6t"@~"@ 6ɍ 6Ǎ"@"@Ǐ 6Ӎˏ 6эԏ 6ލ؏ 6܍"@"@ 6 6 6 6"@'"@? 6C 6L 6P 6`@j@ 6 6@@Đ@ΐ@@@@&@? 6C 6Q@[@s 6'w 6%@@ 62 60@Ǒ@ 6= 6;@@ 6H 6F&@0@H 6SL 6QZ@s@} 7)@ 74@ 74ǒ@ђ 74ޒ 6^ 6\@ 74 6i  6g@" 74. 6t2 6rGAQArA|A@ 4o P>ӓ 6ד 6}f>f> 6  6m>)u>3 7C 6G 6L 7U 6Y 6ߎbu>w}> 7, 6 6 77 6 6}> 77ϔ 6'Ӕ 6#ؔ 77>>> 6: 68$ 6E( 6C1>;>S 6OW 6M` 6Zd 6Xm>w> 6d 6b 6o 6m> 6yŕ 6wΕ>> 7B> >.>8>V>`>>> 6 6>>Ֆ 6ٖ 6>> 6  6>/>? 4&V 4Q` 4im 4 4 4H 43 4nԗ 4\4 4 40` 4{j  42Z 492/ 4@ 42L 4X 4f 4UXs 4Y 4A 4 4 4H˘ 43ؘ 4n 43 4 40` 4xi" 4. 4F 4W 42c 4o 4} 4UX 4Y 4&C 4ș 4י 4 4 4"e# 4qg0 4YB 4Z-O 4a\ 4[j 4b| 4S 4a 4l 4S 4aĚ 4[B֚ 4S 4~ 47 4  4( 4A - 47: 4] 4!o 4( 4 4S 4= 4S› 4lOԛ 4S 4D 4( 4 4* 4 D 4oS 4L^ 4O} 4o 4Q 4( 4%؜ 47 4F  4 4- 4S; 4=M 4S[ 4-m 4S{ 4 4S 4K 4Sŝ 4(ӝ 4 4( 4# 4 43 4() 4H7 4#D 4O 4a+n 4  4UX 4Y 4ʞ 4M 4?P  4 4BL5 4NN 4[ 4i~ 4@ 4/ٟ 4,b 4 4/ 4k*R 4p 46 4`M 4.ߠ 4(" 4b/ 4; 4G 4gX 4(j 4(| 4( 4( 4`ա 4V 4?  4 ' 49AE 4a 47s 4$ 4. 4SS 4. 4ܢ 47 4 ] 47 4 4vc: 47G 4 c 47y 4 4 4H 4fϣ 4\ 4 4;a9 4?S 4d 4r 4 4 4[ 4. 4 4ܤ 4. 4{ 4.<0 64 6= 6A 6F)<o ~ >0>A 6ӏ 6яAA 6ݏ 6ۏ#A- 7?9 6= 6FAPAh 6l 6xB 6 6 6B 68 6x 6l 6 6ǦBѦ 7J 6 6 6 6 7J 6H 6B 0B0B3 6`7 6^AIBK 7_W 6n[ 6hdIBn 7jz 6~ 6IBjB 47 47ȧ 1#ͧ 4ҧ 5q!֧ 5J!ڧ@L 2{ 4! 4# 4y- 4; 4@ 4N 4X 4}f 4k 4y 4W~ 4~ 4 4 4; 4è 4_, 4n2 4D 4R 4W 4jc 4o 4{ 4- 4 4] 4 4 4[é 44}ϩ 4R 43 4\ 4 4j 4 4 4\t* 4C6 4B 4N 4za 4f 4gr 4~ 4 4 4z 4 4 4ƪ 4Ҫ 4ު 4v 4P 4{ 4 4% 4X: 4H 4T 40a 4hn 4 4 4 4} 4h 4ޫ 4{ 4h 4( 4XI 4V 4c 4wp 4"} 4 4 4| 41 4 4Ϭ 4ݬ 4͸ 47 4 4" 4# 41 4? 4/M 4p[ 4]i 40w 4 4 4 4P 4 4 4 4 4d$ 43 4B 4ݲQ 4X` 4o 4u 4 4Ъ 4| 4 4ʮ 4 ٮ 4 4J 4 4 4ߣ$ 4v3 4B 4KQ 4` 4o 4z~ 4z 4 4 4u 4ɯ 4د 4 4 4 4 4# 42 4A 4P 4n 4} 4 4- 4j 4T 4FȰ 4čװ 4P 4# 4( 4 4ٌ& 46 4F 4V 4f 4v 4  4 44 4 4LƱ 4zֱ 4< 4 } 4I 45# 4:2 4A 4&xP 4j_ 43n 4} 4e 4 4 4 4Ȳ 40vײ 4r 4v 4~ 4 4" 4{1 4?@ 4O 4^ 4wm 4.| 4֑ 4.t 4_ 4 4:dz 4?~ֳ 4( 4 4r 4 4n" 41 4@ 4QO 4V^ 4Txm 4֭ 4x 4 43 4eƴ 4Cմ 4 4 4 4 4  4^/ 4> 4M 4\ 4k 4ŝz 4e 4 4 4 4ŵ 4vԵ 4 4 4% 4W 4 4. 4= 4<L 4S[ 4tj 4'y 4 4 4; 4 4Ķ 4kӶ 4 4Z 4 46 4 4%- 4< 4K 4Z 4ji 4x 4 4K 4? 4 4÷ 4ҷ 4 4j 4O 4 4 4, 4; 4J 4Y 4!h 4xw 4 4١ 4{ 4 4ø 4Ҹ 4| 4z 4 4 4 4, 4; 4J 4Y 4i 4x 4x 4 4 4 4ļù 4ҹ 4! 4$ 4[ 4> 4 4, 4uy; 4J 4Y 48h 4w 4~ 4 4 4 41wº 4Ѻ 4 4 4  4W 4Q, 4p; 4 J 4Y 4h 4w 4 48 4G 4 4» 4Ģѻ 4 4u 4 4 4Œ  4|/ 4`> 4ɧN 4] 4 4U 4U 4̼ 4 4 4I 4ʐ 4 " 4h< 4ʐT 4a 4u 4 4Dy 4 4Z 4&ҽ 4 4  4R 4w  4u 4& 464 4B 4hP 4^ 4l 4z 4̾ 4( 4a 4 4 4qϾ 4޾ 4u 4,w 4  4\ 4$ 4H2 4e@ 4]N 4\ 4j 4x 4 4G 4 4 4wп 4߿ 4 4 4  4 4&* 4I 4X 4g 4͢v 4 4| 4 4 4n 4v} 4 4t 4 4ގ  4v 4U* 4A9 4#H 4CW 4f 4Ku 4 4@ 4 4 4w 46 4| 4- 4 4Z  4_ 4P) 48 4ݜG 4V 4be 42t 41 4h 4z 4. 4k 4 4  4 4 4 4h 4( 4:5 4)U 4t_ 4Bl 4[ 4B 4 4 4/ 4H 4f 4@ 4  4e 4' 4 4 44A 4:O 4 4 4@ 4 4 4k 4Î 4`% 4;H 45T 4gb 4gq 4tz 4 4 4 4z 4" 4 4E 4`- 4b 4p 4|~ 4 4 4  4D 4 4 4V 44 4  4] 4t( 46 4ثD 4q 4ǵ~ 4 4T 4 4 4Ϭ 4 4 4# 41 4@ 4N 4\ 4j 4x 4H 4$ 4v 4 4 4 4C 42x 4  4 4H 4\ 4{q 4r~ 4r 4) 4 4 4B 4 4s 4K 4 44  4 - 4: 4G 4T 4Ha 4n 4"{ 4( 4> 4 4 4$t 4M 4@u 43 4O 4p 4ϱ( 4D5 4B 4=O 4^ 4m 4" 4` 4 4 4 4 4. 4)t 4 4 4r 4 4:& 4!3 4`@ 4M 49Z 4 43 4" 4 4j 4 4[ 4D 4u 4" 4%0 4/> 4L 4KZ 4h 4v 4f 4 4 4j 4 4 4δ 4 4* 4e 4 4 4, 4: 4}H 4V 4.d 4wr 4 4r 4 4q 4 4\ 4r~ 4$t 4" 4ϻ 4l{  4- 4 : 4ZG 4T 4ia 4ɻz 4 4 4 4Fz 4 4 44 4S 4tb 4q 4 4 4)u 4 4 4ч 4 4z 4 4! 4a/ 4N= 4jY 4xui 4y 4r 4. 4Ex 4$ 4p 4L 4 4 4 4 4* 48 4F 4[ 4h 4u 4 4{ 44 4 4" 44{ 4  4ծ 4$ 4:1 4hM 4&Y 40f 4Ps 4: 4O 4 4 4 4G  4. 4 $ 41 4ȃ> 4yK 4X 4e 4w 4 4P 4 4~ 4- 4 4% 4؁ 4) 4 4  4u 4 4", 4,9 4F 4<T 4M 47 4 4d 4F 4l 4 4 4h 4h 4 44# 41 4> 4K 4e 4s 4 4 4޵ 4y 4 4 4 4y 4 4 4y 4 4y" 40 4E 4R 4h 4z 4/ 4@ 4 4 4  4  4C% 41 4|= 4J 4WW 4wd 4yq 4k~ 4m 4U 4x 4ʕ 4> 4 4 4 4r 4A| 4, 4w; 4~I 4W 4ce 4s 4 4 4' 4V 4 4ޕ 4 4 4 4 4 4.! 4/ 4h= 4K 4CY 4.g 4Nu 48 4 4z 4P 4܊ 4 4` 4 4v 4| 4 4 4ƞ+ 4L9 4EH 4{W 4Sn 4ا} 4C 4 4 4 4 4 4  4] 43 4" 41 4w@ 4Yj 4w 4 4 4k 49 4 4 4u 4@ 4_ 4 4= 4  4+ 4: 4:H 4#V 4d 4r 4 4p 4I 4 4Q 4 4 4 4T 4  4  4 4o( 4:6 4eD 4R 4O` 4{n 4| 4 4= 4+ 4 4 4 4 4y 4 4  4 4, 4; 4J 4ˍY 4h 4ȯw 46 4 45 4 4 4 4 4u 4k 4%{  4U 4+ 4E: 40I 4SX 4;g 4Hw 4 4< 4~ 4 4p 4z 4R 4 4  4w 4zv 4 4i  4 4A= 4:W 4W 4 4! 4 4= 4~ 4 4 4 4, 4  4 4? 4n) 43 4N@ 4N 4[ 4h 4u 4֍ 4 4 4? 4 4 4 4 4 4 4?  4 4Ƒ) 46 4D 4T 4Z 4a 4n 4| 4 4D 4 4u 4 4! 4 4 4^  4 42 4? 4L 4Y 4ul 4 y 4< 4Ƒ 4D 4" 4e 4 4* 4 4l  4) 4s5 4B 4wP 4\ 4ֲi 4v 4 4$ 4 4 4k 4ض 4 4 4k" 43 4@ 4L 4Y 4^n 4!{ 4 4i 4v 4 4G 4! 4 4 4! 4 4/|( 45 4L 4SY 4f 4=} 4 4 4 4 4i 4 4 4c 4A 4 4y5 4͹Y 4f 4s 4 4 4 4 4 4% 4; 4~ 4R 4?w 4(v 4! 45 4ږA 4N 4t 4 4Y 4ֲ 4t 4,w 4e 4E 4* 4R 4` 4  4G% 42 4? 4uY 4g 4Evt 4ǵ 4 4z 4u 4 4 4 4m 4/ 4 4 4] 4  4d- 4: 4G 4U 4b 4 o 4h} 4?~ 4 4 4# 4( 4[ 4 4 4z 4 4 4, 4"9 4yF 4 4 4 4 4 4{ 4 4# 4 47  4 4G 49x 4- 4y; 4gI 4ue 4s 4{ 4? 4 4n 4 4 4 4 4R 4 4 4 4, 4e: 4 H 4<V 4d 4rr 4Ȳ 4 4S 4 4 4 4L 4 4 4  43 4 4* 48 4|F 4T 4Jxb 4p 4~ 4 41 4҄ 4t 4 4 4 4( 4ʂ 4  4y 48& 4z5 4D 4R 4a 4o 4} 4 4 4 4F 4 4Z 4~ 4, 4 4  4^ 4% 4<3 4GA 4jO 4] 4`k 4 4 4/ 4x 4 44 4ݦ 4 4 4[ 4O4 4B 4Q 4m_ 4m 4{ 4 4 4, 4 4" 4 4 4¤ 4\ 4 4{! 4q1 4JA 4P 4ѓl 4z 4cz 4z 4; 4t 4 4 4 4 4$ 4u2 4@ 4P 4|~u 4' 4h 4  4 4\ 4 4& 4 4w 4 4a" 40 4> 4L 4Z 4h 4Jv 4" 4 ~ 4 4t 4I 4  4 4M 4 4  4* 47 4Q 4t 4 4< 4w 4 4 4 4 4r 4  4 4i# 440 4ó= 4.zJ 4W 4d 4q 4T~~ 4F 4 4g 43 4 4 4 4 4 4 4m2 4L 4Y 4l 4z 4 42 4 4u 4" 4v 4 4 4" 4 43) 46 48C 4xP 4=] 4j 4Rw 4 4{x 43 4 4 4x 4 4Ϧ 4 4~ 4  4 4' 44 4vA 4}N 4[ 4"h 4u 4 4 4 4 4 4 4  4~ 4?~ 4  4w 4' 4RC 4Q 4 _ 4m 4{{ 4@ 4 4? 4 4 4. 4֑ 4_ 4 4 4: 4# 41 4? 4M 4[ 4i 4cw 4S 4 4y 4 4 4u 4g 4 4 4y 4ҟ 4 4- 4A 4N 4[ 4h 4u 4 4 4U 4 4d 4 4dw 4h 4v 4 4+ 4  4˗. 4< 43P 4<Z 4Sg 4t 4 4 4 4v 4 4 4e 4t 4J 4 4Q 4,w 4." 46 4P 4Z 4d 4{ 4$ 4J 4 4 4y 4 4' 4i 4 4  4: 4# 40 4= 4J 4W 4d 4"r 4u 4e 4 4 4 4e 4{ 4 4  4  4'  45  4C  4uQ  4T_  4m  4{  43y  4  4y  4s  4o  4  4  4}  4u  4G%  4ԥ9  4F  4S  4`  4ǡs  4  4h  4  4  4"  4J  4  4  4  4Y  4  4l  4G  42  4'?  4L  4Y  4g  4Pt  4  4  4  4:  4   4  4  4y  4  4""  4.  4=G  4IT  4a  4t  4֋  43  4  4ٻ  4e  4j  4M  4  4  4"  4  4  4د+  49  4G  4[e  4Ks  4  4  4  4  4  4  4  4  4  4v  4! 4H 4U 4qb 4o 4| 4 4 4@ 4 4 4c 4 4} 4x 4ư 4  4 4' 44 4aN 4[ 4Nh 4v 4w 4z 4} 4 4 4" 4 4< 4 4,w 4լ 4 + 4@8 4n 4O~{ 4 4  4 4- 4L 4 4 4O 4 4" 4/ 4= 4YI 4GU 4a 4m 4uy 4y 4 4 4< 4 4[ 4[ 4_ 4V 4x, 4d9 4F 4u` 4Cm 4" 4m 4 4`~ 4! 4 4& 4@ 4Տ 49" 4/ 4[> 4M 4[ 4 4} 4 4n 4 4Տ 4 4 4x 4 4 + 4u8 4 K 4X 4e 4Mr 4Tw 4 4 4 4 4@ 4Տ 4 4 4ʊ 4 4 4/ 4|( 45 4!B 4HP 4^ 4ivl 4[z 4 4E} 4 4x 4 4 4W  4c 40 4= 4T 4 ` 4l 4y 4 4 4 4~ 4 4_ 4M 4 4x 4 4r  4 x 4# 4) 4/ 476 4C 4uP 4 ] 47k 47~ 4, 4 4 4zt 4y 4 4 47  4n 4# 4"0 4hJ 4b 4}o 4 4 4F 4F 4l| 4 4 4,w 4/ 4Q 4$" 4[< 4"I 4V 4c 4p 4} 4 4C 4 4 4 4 4 4v 4~ 4&  4 4x$ 4-1 4> 4K 4X 4e 4r 4 4 4Dž 4} 44 4 4 4 4 4) 4KE 4X 4,o 4 4۪ 4w 4 4  4E 4 4 4< 4@ 4<) 46 4"C 4g] 4j 4$ 4{ 4b 4 4q 4  4B 4,O 4Eg 4"{ 4 4 4 4 4E 4z 4 4>  4 4( 46 4D 4Λb 4{ 4 4F 4 4 4 4ͩ 4X 42 44 4( 4L 4 ^ 4l 4~z 4 4 4d 4Ԏ 4 4 4 4 4[ 4  4  4{(  486  4D  4'R  4|m  4C  4ȶ  4H  4O~  4   4  4  4J  4  4i! 4C! 4Z"! 4>;! 4I! 4g! 4{! 40! 4ݢ! 4<! 4! 4t! 4! 4r! 4 " 4" 4'" 45" 4C" 4_vQ" 4_" 4Rm" 4{{" 4" 4 " 4" 4" 4" 4" 4k# 4# 4#4# 4,wB# 4P# 4s# 4Ru# 4=# 4# 4w# 4# 4f# 4# 4# 4# 4 $ 4$ 4|)$ 4)7$ 4{E$ 4<S$ 4a$ 4wo$ 4}$ 4*$ 4p$ 4/$ 4$ 4$ 4($ 4~$ 4C$ 4% 4*% 4? % 4/% 4>% 4M% 44~\% 4(k% 4t% 4% 4% 4% 4w% 4% 4% 4Q% 4& 4& 4"& 4H.& 4=& 4L& 4[& 4oj& 4>y& 4f& 4& 4& 4& 4& 4& 4& 4ױ& 4(' 4' 4' 4r-' 4b' 4l' 42{' 4n' 4' 4\' 4' 4"' 4( 4z1( 4Z@( 4Q( 4<W( 4]( 4Ac( 4Ui( 4o( 4u( 4u{( 4Ȗ( 4( 4( 4+( 4%( 4( 4( 4( 4m( 4b( 4z( 4"( 4Ǭ ) 4) 4&) 43) 4g@) 4¦N) 4b) 4 p) 4~) 4Y) 4) 4) 4) 4,w) 4L) 4r) 4V) 4,w* 4- 4K- 4Y- 4۳f- 4%s- 4- 4- 4- 4- 4- 4`K. 45X. 4`e. 4Os. 4}. 4. 4g. 4C. 4. 4t. 4. 4y/ 4/ 4@'/ 44/ 4A/ 4O/ 4c/ 4p/ 4l|/ 4/ 4/ 4/ 4'/ 4l0 4 0 4>60 4-B0 4X0 4@e0 4Jr0 40 40 40 4"0 4I0 40 4v0 41 41 41 46,1 491 4 F1 46S1 4Rm1 4z1 4z1 41 41 41 41 42 42 4+2 482 4ƠE2 4?S2 4Ea2 4o2 4!y}2 4y2 42 4S2 42 4<2 4|2 42 42 402 4P23 4?3 4L3 4Y3 4)f3 4s3 4 3 4~3 43 4i3 4Ƒ3 43 43 43 4{3 4,3 4t4 4{4 4 4 4Ѳ-4 4h@4 4M4 4Z4 4ϵg4 4c4 4g4 44 44 44 4Α4 4Ѳ4 44 45 45 4ӳ!5 4 05 4J5 4#W5 4d5 4q5 45 4|5 485 45 45 4x 6 4@6 4t&6 4HX6 4"f6 4u6 46 46 46 46 4J6 46 4K6 4w6 46 4l7 4g7 427 4V+7 497 4G7 4^U7 4`c7 4^q7 487 4r7 47 47 47 4u7 47 4ݹ8 48 4!8 4և08 4?8 4N8 4]8 4l8 4{8 4 8 4h8 4&8 4W8 48 4e8 48 48 4#9 4\9 4.9 4|=9 4|L9 4[9 4Pj9 49 4{9 49 4-9 49 49 49 4D9 4p: 4: 4): 4AJ: 4Bm: 4y: 4`: 4: 4: 4: 4h: 4: 4: 4: 4: 4G; 4S; 4c; 4i; 4zo; 4u; 4{; 4t; 4; 4k; 4; 4-; 4e; 4); 4i; 4; 4w< 4!< 4/< 4<=< 4K< 4,Y< 4Mg< 4< 4,< 4S< 4< 4z< 4t< 4P< 4< 4== 4= 4= 4*= 4>= 4gL= 4Z= 4h= 4v= 4r= 4= 4^= 4n= 4= 4}= 4= 4 = 4K= 4> 4 $> 44> 4R:> 4:@> 4G> 4sxt> 4> 4> 4> 4Y> 4x> 4> 4> 4X> 4c> 4> 4 ? 4? 4%? 42? 4?? 4L? 4Y? 4f? 4s? 4j? 41? 4? 4<? 4? 4¾? 4֢? 4? 4? 4{@ 4@ 4S@ 4,@ 4 :@ 4H@ 4}V@ 4}d@ 4;@ 4@ 4@ 4}@ 4#@ 4Xu A 4A 4%A 43A 4AA 4OA 4]A 4;A 4A 4B 4B 4,"B 410B 4t>B 4LB 4ZB 4hB 4vB 4#B 4%B 4OB 4}zB 4B 4EB 4XB 4B 4"B 4yC 4C 4C 4-C 4;C 4WC 4eC 4xtC 4'C 4SC 4YC 4C 4C 4C 4ĥC 4C 4D 4D 4D 4մ.D 4!R 4KR 4XR 4eR 4'rR 4#R 4(R 4؞R 4MR 4R 4mR 4R 46uR 4~R 4R 4S 4^S 4ԤlS 41S 4T 4ˆ&T 4P4T 4wBT 4&T 4YZU 4  V 4}KV 4V 4SY 4Y 4VZ 4!Z 4qIZ 4ZZ 4O`Z 4btfZ 4[ 4[ 4[ 4߿<\ 4_I\ 4 V\ 4<c\ 4jp\ 4}\ 4)\ 4O~\ 4S\ 4M\ 4`\ 4\ 4 ] 46] 4$] 4%1] 4>] 4K] 4X] 4e] 4>r] 4|] 4b] 4[] 4] 4] 4p] 4y] 4^] 4] 4] 4 ^ 4^ 4'^ 4}6^ 4F^ 4L^ 4R^ 4xX^ 4^^ 4e^ 4~r^ 4V^ 4^ 4^ 4_ 4!&_ 4U_ 4ac_ 4q_ 4E_ 4_ 4_ 4W` 4` 4T a 43a 4`1a 4;a 4Ha 4Va 49tca 4pa 4}a 4ja 4 a 4@a 4"a 4a 4a 4tb 4ٸ/b 4r 4,Kr 4Xr 4[er 4r 4es 4*s 4bs 4ݑs 4!s 4=s 4Ms 40[s 4is 4Kws 4s 4s 43s 4Ds 4is 4s 4s 4m(t 4x2t 4Kt 4Zt 4-gt 4tt 4Ct 4t 4t 49t 4t 4u 4wu 4nu 4F*u 4N7u 4gDu 4Qu 4wiu 4tuu 4u 40u 4]u 4 u 4[u 4 wu 4u 4au 4(u 4u 4"v 4 v 4O~-v 4uJv 4ռWv 4Gdv 4qv 4~v 4v 4"v 4Vv 4v 4ݾv 4v 4kv 4v 4&v 4 w 4w 4b&w 4r4w 4Bw 4{Pw 4^w 4\lw 4wzw 4w 4Lw 4xw 4w 4aw 4w 4w 4}w 4uw 4px 4x 4Lx 4^x 4dx 4Ajx 4px 4.vx 4}x 4|x 4tx 4Etx 4*x 4ax 4^x 4x 4x 4x 4x 4x 4y 4(y 44y 4)y 47y 4;Fy 4Uy 47dy 4iysy 4˷y 4.y 4?y 4zy 4y 4y 49y 4y 4<y 4z 4z 4#z 4ۀ3z 4LCz 4Sz 4cz 4gsz 4$z 4nz 4[z 4(z 4ֵz 4›z 4z 4z 4z 4{ 4{ 4&{ 46{ 4`F{ 4V{ 44f{ 4#v{ 4X{ 4,{ 4|{ 4{ 4w{ 4n{ 4{ 4y{ 4۔{ 47| 4| 4&| 4{5| 4T| 4a| 4 z| 4<| 4| 4ֵ| 4_| 4n| 4H| 4| 4| 4| 4| 4 } 4} 44#} 40} 4J} 4Y} 4n} 4} 4%} 4} 4t} 4#} 4} 4x} 4} 4;~ 4jH~ 4 U~ 4b~ 4*o~ 4||~ 4,~ 4~ 4~ 4~ 41~ 4M~ 4ن~ 4y~ 4~ 4~ 4  4= 4% 4@> 4wj 4Aw 4  4 4 4 4L 4 4 4 41 4M 4ن 4  4- 4P: 4|S 4  4Ā 4 р 42ހ 4| 4 4V 4t 4* 4, 49 4F 4\Ɓ 4.Ӂ 4  4P 4 4V 4+ 4L; 4A 4oG 4N 4u] 4zl 4c| 4P 4Q 4Ă 4]|҂ 4! 4| 4 4b 4 4  4Ո 4" 4e( 4.. 4c5 4C 4RtQ 4_ 4m 4| 4 4 4 4 4>ƒ 4ȃ 4 ΃ 4ԃ 46ڃ 4 4w 4ʿ 4A{ 4А 4_}  4 4c" 4>( 4K. 45 4C 4Q 4}_ 4m 4 4 4 4! 4Dڄ 4m 4 4% 4 4O 40 45 4X? 4lM 47|[ 4xi 4bw 4r 4? 4 4{ 4Ʌ 4օ 4 40 4 4 4# 4- 47 4rF 4XT 4b 4p 4~ 40 4V 4 4! 4ņ 4Ԇ 4 4G 4 4{% 4/ 4< 4tb 4o 4 | 4 4 43 4 4އ 4 4 4ǜ 4` 4 4 4"! 4x. 4; 4H 4U 4c 4o 4ʨ} 4x 4 4 4 4ޛÈ 4fш 4߈ 4n 4K 4  4K 4V% 43 4VA 4{O 4] 4ok 4 4 4$ 4v 4 4 4͉ 4ۉ 4  4i 41  4 4I% 43 4"A 4O 4s] 4k 4y 4. 4 4ǁ 4 4$ 4Һ͊ 4Tۊ 4 4 4 4y 42! 4G/ 4= 4K 4SY 4g 4"u 4 4 4a 4 4 4?ɋ 4}׋ 4 4x 4 4P 4 4 + 4C9 4G 4U 4d 4ƭ 4 4 4 4~܌ 4 4 4 4  4 4 4Y' 41 4#; 4E 4O 4Y 4)g 4du 4 4v 4 4 4ʀI 4 4oQ 4m 4#{ 4 4 4 4v 4 4̏ 4ҏ 4ُ 4 4 4 4z  4% 4E3 4kL 4Z 4fxx 4 4 4 4 4ِ 4 4  4" 4' 45 4mC 4!Q 4$_ 4s 4x 4! 4 4 4 4ط͑ 4 4޷ 4 4; 4" 4$, 49 4 S 4` 4n 4g} 4A 4 4 4 4Ȓ 4C 4 4g# 4G 4ٓ 4mw 4u 4 4N  4 4 @I 4n 4 4ؠ 4ɔ 4^ 4!| 4{|4 4eM 4ns 4* 4Q 6 6 4Wƕ 6ۑʕ 6ӑϕ 4"ٕ 6ݕ 6 63 6/ 4p 4w 6D" 6B+Q4 7C 6TG 6LP 6wT 6q] 6a 6j 7w 6Ò{ 6Q 7 6В 6̒ 7RRٖ 6ݖ 6 R R  6 6 R" R; 6? 6M RV Ro 6s 6 R R 6 6 R R՗ 6%ٗ 6#R RR5 679 65BRKRd 6Fh 6DqR 6Q 6OR 6\ 6Z 6f 6dɘR 6q 6oR:R':R0:RH 6{L 6yU:R^:Rw:R`RvRԙRR 4PO 6  6% 4 / 63 6B 6F 6K 4pU 6?Y 67^ 45 6l 6`PPƚ 6ʚ 6Ԛ1Pݚ 72Q2QZP" 7/1 65 6?nPH 7:W 6[ 6d 6֔h 6Дq 6u 6~ 6 6 7: 6L 6> 6 6 6 6 6 6ě 6ț 6қ 7Oۛ 6;ߛ 67 6P 6J 6 6 6  6 7d! 6&% 6". 6;2 65;PQPZ 7yf 6Uj 6Qs 6nw 6j 6 6 7y 6 6iQiQɜ 6˗͜ 6ɗӜP1P2Q2QO 4` 4)x 4  4Q 4d 4[ 4  4z̝ 4; 4# 45 4ր* 46 4ZG 4U 4a 4mn 4ϝ 49 4  4 4 45 4d͞ 4[ٞ 4  4z  4# 4! 4Z: 4F 4YS 4_ 4 4 4 4WƟ 4"ן 4  4S 4  4 4>" 43 4@ 4K 4(e 4xv 41 4# 4, 4  4j 4ʠ 4ݠ 4 4A 4ǵ( 4F 4 ^ 4k 4B 4 4š 4+֡ 4 4  4 4W' 49 4yU 4b 4q~ 4 4y 4 4 4ݢ 4  4 4X% 4C@ 4^ 4w 4s 4 4ϡ 4ű 4Uˣ 4ף 4 48 4PL, 6ߗ0 6ӗ9 6= 6F 6OJ 6KS 6aW 6]` 6sd 6om 6q 6z 6~ 6 6 6 6B 66 6z 6n OLĤ 7Ӥ 6פ 6 7 6 6 6  6ߙ 7 6C# 67, 60 69 6̚= 6ȚF 6J 6S 6\W 6V` 7m 6q 6~z 6~ 6YMM 7 6Û 6¥ 6ڛƥ 6֛ϥ 6ӥ 6إ 7 6 6M 7 69  65M*NCN\Om ('M'M 6N 6L O Oݦ 6X 6V$M&O@O) 4Į- 4Į: 1P-? 4v)D 5-+H 5+L 7X 25_ 4x6 4E 4g  4[ 4 4[ 4\-Ƨ 4!ԧ 4z٧ 4] 4Z 4 4^ 4y 4# 4 a1 4v 4$ 41> 4 XǨ 4̨ 4n[ب 4 4NY 4%B 4Bo 4 4B  4:;, 4~y8 4D 4NW 4U^ 4pc 4TXo 4Z{ 4`K 4Ct 4x 4=h 49 4yé 4K ֩ 4Pw۩ 4 4 4{n 4  4 4i( 44 4@ 4kL 4# X 4d 4p 4uO 4(u 4{z 4(u 4Ԑª 45Ϫ 4Xfܪ 4Ņ 4, 4q  4- 4Xf$ 4nL 4JY 4Xff 4 4 4e 4ݏƫ 4wqԫ 4I 4L 4 4  4" 4o( 4x6 4 D 4R 4Mf` 4Szn 4| 4j 4 48 4G& 4 4 h 4  4M 4_* 4A9 4CH 4M`W 4vCf 4v 4@ 4; 4 4= α 4leݱ 4  4' 4.W  4L 4# ( 4r<7 4+9F 4`U 4+ d 4Rs 4# 4J 4ib 4kw 4-i 4Ͳ 4fZݲ 4߀ 4Y 4_!  4s 4A( 47 4ܓF 4єU 49 d 4 ? 4`  48 4r 4( 4(̳ 4C۳ 4ti 4Tp 4= 4. 40& 4 5 4D 4rS 4v3b 4/q 4a 4~ 4y 4jS 4|d 4t˴ 4ڴ 4 4E: 4Cg 4a 4% 434 4C 46R 4a 4p 43' 46P 4Eb 4W 4}o 4Wʵ 40ٵ 4U 4T 4M 4. 4G$ 4'3 4mB 4<=Q 4` 4fmo 4 R~ 4W 44` 4c 4N  4%ɶ 4@ض 4yh 4L 4{U 4 4\# 4s2 4vA 4\qP 4P_ 4tn 4~} 413 4 4I 4>x 4Nɷ 43ط 4 4d4 4' 4G 494# 4k2 4NrA 4P 4>2` 4eo 4~ 4X 4] 4%. 4XM 4ɸ 4Mظ 4 4$J 4^ 4Xn 4=$# 47 2 4QA 49P 4 l_ 4#=n 4} 4+w 4H 4+8 4>  4H6ȹ 4׹ 4s 4tP 4M 4`h# 4M]2 4A 4IP 4h_ 4n 4]} 4% 4[ 4; 43x 4 4Ⱥ 4)غ 4 4Lu 4 4o$ 4Q& 465 48E 4L'T 4#z 4<# 4_ 4/0 4(û 4g"л 4߻ 4iN 4 4O  4  407 40E 4sRS 4/^a 4lo 4} 4u 4i? 4Q 4Xf 4$ü 4Ѽ 4q߼ 4=O 4`8 4  4: 4#[% 4Z4 4;C 4Q 49 _ 4sRm 4Ne{ 4_ 4q 4Pd 4, 4F 4Ͻ 4f ݽ 4U 4= 4c 4m& 465 4ZD 4mS 4]b 4wq 4i 4lX 4W0 4mI 4 G̾ 44۾ 4# 4s 4 4 4& 45 4[KD 4PS 4db 4 q 4  41 4o 4 4~= 4}_˿ 4ڿ 4S 4cz 49s 4<" 4 % 4+4 4C 4kR 4 5a 4'p 4Jc 49 4" 4F. 4= 4K 40 4o 4u 4{  4tX 4U$ 4H3 4B 4[ 4/0g 4ips 4Xf 4d! 4m< 4k 4 4:A 4Q 4La 4X 4Z, 4^>9 4tF 4T 4{{b 4/0p 4( 4XP 4' 4I 4I 4/0 4'( 4I7 4C 4O 4;[ 4k g 4=^ 4Y 4}x 4$ 4$ 4/  4]" 4e/ 4tA 4&N 4h 4vu 40c 4s 4G 4l^ 4` 4FL 4f 4q  4- 4G37 4wE 4oS 4Ea 4o 4y 4( 4W 4= 4t^ 4F 4D 4= 4^N+ 4؆@ 4 >N 4%b 4p 41U~ 4<8 4CJ 4um 4ߐ 42 43 4V 4E 4v 4  4Os 4A' 4MD 4 Q 4=h 4<u 4e 45 4hf 4h 43 4 4~j% 4'3 45iD 4UL 4EnT 4t;a 4Jo 4^{ 4 4[ 4k 4H 4% 4/ 4 4` 4O 4 4 4@* 4,8 4qP 4\ 4d@i 4.v 4B 4R 4% 4 4K 4S% 4 4*o 4u 4&2 4 c 4D 4#` 4E5 404B 4pO 4`G\ 4&i 4 4O 4" 4i 4& 4? 4yX 4 4/) 4`7 4QE 4.lS 4ka 4o 4X} 4`{ 4i0 42 4( 4 4U4 48n 4B 4ё 4ta  4t 4(% 4E3 4[A 4CO 4N] 4k 4 y 4QR 4C 4s 4 4C@ 4eH 4m 4~ 4 : 4-  4 4q@& 43 4@@ 4N 4M#^ 4d 4@4j 4Q<p 4Khv 4| 42 4} 4 4r 4a 4D 4qT 4l 4{ 4 4[ 44T 4kL 4' 4~ 4sR  4( 4d& 4S3 4eLL 4aY 4 f 4aDv 4| 4  4 H 4& 4 4Z 4 4 41 4P 4 49" 4M5 4TB 49O 4Mk 4ޅx 4/0 4p# 4> 4 4q 49 4M 4~4 4V 4we 4 4/h) 4pb 4Qo 4 4 4 4h 4 4/0  4ς; 4I 4"ox 4 4 4Dy 4L 4 4` 4| 4*  4M 4:ZZ 4̉ 4h/ 4  4Ph 4u 4AM 4:Z 4 4Cp 4uL: 4:ZG 4ʂT 4@a 4Jn 4PI 4/ 4. 4 47 4C` 4v8 4M  4 4+ 4: 4Y 4Zi 4fjv 4? 4 4[D 4X 4z 4W 4V 4C` 40 4# 4e|3 4'C 4(hS 4* c 4Fq 4KC 4s 4 4xl 4 4z 4! 47= 4> 4 4F" 4&/ 4Wr 4^w 4E 4ݏ 4 4  4̉ 4? 4q 44 4Xf 4R 4l  4$- 4q/t 4r 4= 4! 4J 4# 4m 4P7 4W 4> 4gF 4{ 4@ 4C1 4 Q> 44K 4ٍX 44e 4wr 41 4 4w 4i 4n 4lV 4| 4^J 4 43 4 4B 4CB 4!O 4[\ 4?Cj 4 Iv 4y 4E 4q 4: 4Xf 4n 43 4e 4] 4Q 4' 4c- 4R9 4[uE 4FQ 4 ^ 4$l 4x 4E? 4  43! 4d 4  4% 4  4[ 4| 4[  4p)" 434 4j=R 4U@{ 4 4]W 4sR 4:  49\ 4F 4 4zu 4P 4  4 + 4'8 4eAE 4>R 4 _ 4Z'l 4q?y 4A 4bp 4V 4g_ 4 4 4 4r 4m 4= 4S- 4((; 4:NI 4nW 4 e 4As 4n' 4C 4 4LS 4: 4} 4p 4 4, 4f 4r} 4! 4}>/ 4P= 4aK 4?Y 4Vg 4u 4$ 4X 4 s 4& 4u 4;% 4{ 40 4U 4cd 4{s 4x 4 4Xv 4/m 4)F 4[ 4 4MD 4ca 4w, 4ex9 4fF 4'S 4(` 4 `m 4z 4 4% 41n 4J 4+H 4C/ 4 4(T 4%d 4#  4\ 43' 4Vl5 4nC 4xQ 4B_ 4tzm 4%{ 4b 4x 4LA 4G 4d 4Px 44 4t0 4Qg 4 4o9 4X# 4Z1 4-? 4+GM 4s[ 4^i 4Iw 4c 4p 4  4g 4d 4 4U 4jc 4# 4s 47 4@, 4t; 4J 4nY 4>h 4w 4[. 4| 4 47 4  4u: 4& 40 4 4,  4t 4U ; 4J 4_yY 4h 4hx 4 45 4%j 4wJ 4C 4U 4  4@ 4. 4l 4T 41  4P[ 4Ng 4%t 49 4M 4 4A 40$ 48v 4% 4=U 4= 4v 4/ 4X 4x 4& 4F 4 4 |* 4~8 4w(E 4oDR 4V_ 4 yr 4o 4w( 4Ւ 4o 4я 4L 418 4p# 4Y 4o 47  4>> 4 4c# 4181 4> 4RK 4&X 4e 4=Wr 4 4>L 4: 4h 4 4ޅ 4G 4} 4 4N! 4O. 4B; 4p#H 4RU 4x 4a 4 4  4Qn 4  4D 4r 4x 4  43 4C 4'+ 4[9 4F 4TS 4p)` 4 4G 4h 4^ 4YF 4B 4 4v 4m 4/# 4$0 45ZG 45T 4 a 4n 4< 4$ 45Z 4 4$ 45Z 4 4 4l 40 4w 4{Z2 4U$? 4{%V 4$c 4TTp 4z 4do 4 49 4K 4_ 4 4J 4R3 4=( 4n6 4C 4O 4g 4xMs 4I 4 4# 4H 4L  45  4(/ 47( 4f( 4N 4Q^  49  4(( 4x<5 4r2B 4{O 4g\ 4<j 4O 4d 4  4N 4g 4R  4F 4E 4& 4N 4W 4# 4mI0 4= 4j{K 4X 43Ye 4}9r 4g 4sh 4 4E 4ċ 4c 4X8 4- 4 4I 4] 4! 4fZ. 48^< 4]I 4VW 4d 4aq 4qp~ 45 4 4A  494 4i  4h 4+9# 4L1 4# ? 4[N 4 _ 4e 4/Ak 46q 4{w 4 ~ 4` 4  4 K 4 4L 4#  4r< 4 4  4K 4A|' 4Pq6 4]D 4\aR 4N1a 4io 4)} 4P 4Y 4\ 42 4Z 4]c 4C 4yN 4.C 4@  4V 4]' 415 4aC 4`Q 4Vw_ 46m 4 b{ 4t 4 4 4kP 4/  4~ 4: 4i 4Q 4 4 4# 4ގ1 4o? 44M 4n[ 49Xi 40w 4 4  4N6 4[ 49 4b 4S 4QK 4 4j 4p 4P" 4K0 41> 4GL 4Z 4:h 4=v 4. 4S 4= 4XH 4.Z 4Si 4- 4.Z 4L 4  4>! 4R/ 4 8= 4jK 4`Y 4 m 4Y 43t 4w( 4w 4: 4[ 4' 4b 4"\ 4b 4  40 48@ 46P 4TA` 4 hp 4 4f` 43 4Ov 4l% 40 4  4  4~7  4 . 4a= 4ǏL 4}[ 4Hu 4C 4  4 4e 4 4 4Xf 4tP 4  4K0 4k: 4$H 4&V 4bEd 4wr 4{ 4  4&r 4)  4n 4X 4S 4 4 4 A 47  4ށ 4r: 4p)G 4,T 4[a 4%{ 4$ 4p 4q 4 4 4u 4r 4_!  43 4x@ 4M 4rZ 4g 4\t 42 4- 4D 4  4F 4ZI 4 4 4l 4? 4L 4 4 4* 4oq7 4ND 4o 4| 4Xd 4 4 4 4q 47= 4,f  41X 4% 4> 4 R 4\ 4ԅf 4\0p 4z 4r 4@  4l 4u  4IQ 48 4 4 4H 4R 4 4a 4bB! 4-. 4; 4H 4YU 4&d 4&Ns 4W 4 4[) 4al 4 4 4 42~ 4+  4  4# 4?Q1 4C? 4LM 4# [ 4Ri 4'Zw 4r< 4 u 4+9 4R 4# 4U 4  4kw 4-i 4 4` 4x' 4- 4cX; 4-PI 4maW 4Je 46Ps 4< 4  4" 4 4 4a 4u 4  4 1 4 4l  48! 4v. 4ĉ; 4p)H 4BU 4yh 4rr 4S| 4 4?C 4e 4q  4Q 4  4i 4) 4G 4>) 4@% 4v70 4: 46G 4>T 4a 4Dn 4[{ 4,  4L/ 49o 4u 4 4Q 4-) 45 49  4 4? 49Y0 4: 4@D 4c 4-m 4R 4) 4 4t  4l 4Q9 4DC 43 4A 4p 4z 4P> 4M 4D* 4qs7 4iD 4R 4` 4Zn 4v 4## 4\ 4- 4 4 4' 4P 4{ 4u5 4(7# 41 4N? 4zM 4 1[ 4 i 4J 4A  4En 4ZE 4cI 4n 4XC 4 4= 47 4& 43 4GR@ 4#3S 4l` 4Xfm 4_z 4W 4 44 4^ 40s 40  4s 4y 4s 4[ 4L'  4-  4,  49  4G  4;cT  4I}a  4n  4}  4  4sR  4iN  4;  4u  4  4  476  4&'  4j4  4A  4kT  4`  4\;e  4HYr  4V  4  4VU  40  4   4g  4ls  4W  4_H  40(  4t5  4[B  4O  46\  4[i  4v  4X`  4  4=  4z   4A  46  4[  49  42M  4{  4;P  4>!  4/  48<  4^I  4V  4loc  4ep  4}  4>  4u  4qs  49   4>  4sR  4w/  4<'  44  4>F  4E{[  49g  4t  4P  4bW  4:  4.  4p)  4Q  4'  4c  4< 4! 4\ 40K& 4@2 4"S 4ތ` 4m 4Bz 4 4Q 48^ 4JE 4\ 4 4?C 4K 48 4R& 4d 4@jr 4z 4 41 4[ 4 4O[ 4}! 4h> 4 48^ 4e1 4z 4A}N 4[ 4[h 4|u 4Έ 4}! 4 4fV 4S 4 4)~ 4( 4` 4ڋ 418 4,* 4a 7 4.#D 4[Q 4#X^ 4nk 4O[x 4}! 4Ñ 4@ 4 4X2 4 f 4 4 4qr 4. 4d 4a 4v $ 48^2 4z^[ 4q 4 6} 4  4.' 4l 4k 4Y 4l 4m 4l  4n 4$ 4^Q1 4DwX 4؇g 4G2t 4Z 4G 4T 48E 4a 4  4 4 4  4sw 4o 4^ 4K 4_  4 4)~ 4W:# 4W:6 4L;C 4>[ 47i 4 4  4_  4 4L 4 4 4O 4Xf 41 4% 4kN 4F([ 4ri 4rs 4 4[ 4p) 49  4 J 4'D 4 4! 4 4[  4w- 4& 4Ys3 4g@ 49N 4X 4e 4r 4W 4[X 4  4= 4lX 4 4  4m 47 4# 4j] 4y 4m( 4[5 4eB 4O 4Sg 4$| 4Kp 4(} 4 4> 4 4Eh 4RV 43% 48V> 4;K 4 X 4f 4E0y 4 4% 4s 4C 4" 4u 4/0 4 4R 4Q  4U 4Jk 4 4 L 4Z 4| h 4qsv 4Ɋ 4 4` 4GB 4a 4W 4i 4s{ 4*Y 4>< 4( 4ME 4GO 4v] 4k 4sRz 4 4[ 4& 4I 4 4  42 4M 4b 4Iq" 4~; 4qH 4%4o 4.e 4ߐ 4] 4ё 4S 4) 4  4  4b 4T" 4l   42 4 ' 4>5 4 ZC 4sRQ 4IT_ 4m 4B 494 4 4 48 49  4  4+  49  46G  4|-U  4 c  4|q  4x  440  4t  4;  4CZ  4]  4  4#  4  4C ! 4I! 4Jj'! 4f5! 4 C! 4QQ! 4t`! 4co! 4y~! 42b! 4! 4&! 4,-! 4I! 45! 4i! 43L! 45" 4" 4#" 4A" 4P" 4_" 4~n" 4 }" 4" 44" 4U" 4" 4 " 4" 4" 4*" 4Q# 4oq# 4>"# 4^:1# 4\@# 4|O# 4^# 4dm# 4=|# 4F(# 4# 4B# 4:# 4z# 4;# 4u# 46$ 4I$$ 4V3$ 4&=$ 4a$V$ 4m$ 41$ 4$ 46$ 4&$ 4R$ 4ʀ % 4% 4% 4,d% 4K!% 4p'% 4V-% 4R3% 4T(9% 47r@% 4G% 4K~N% 4pvU% 4v]% 4ii% 4gu% 4Yg% 4O% 4~% 4K% 4>% 4P% 4/% 4"T% 4_A% 48% 4 & 4F& 4H&& 4S4& 4xH& 4mU& 418b& 49 o& 44]|& 44& 4L\& 49 & 4I & 4[& 4o!& 4I & 41Y' 4vce' 4'u' 4v?{' 4k' 4v' 4' 4' 4 6' 4O@' 4' 4' 4T' 4H]' 48 ( 4DW( 4} ( 49m,( 4 ^F( 4S( 4$j( 4w( 4 ( 4lj( 4U@( 4/0( 4O( 4*( 4H( 4) 4FI) 45) 4=ln) 4{) 43) 4I^) 48R) 4n) 43) 4~) 4U@) 4n * 4/0* 4O#* 4*:* 4Q}V* 4Jd* 4Z}* 4nA* 4g* 4* 4j* 4n8* 4Y* 4F* 4 D* 4T+ 4y+ 4P + 4u,+ 49+ 4F+ 4#;x+ 4Y+ 4l+ 4[+ 4+ 42+ 4+ 4e9+ 4O, 4 , 4!$, 41, 4/>, 4~K, 4JX, 4he, 4ir, 45, 4N, 4Ci, 4, 4$, 4_, 4w1, 4L$ - 4- 4vA&- 4\Z4- 4PA- 4p#N- 4'-\- 4uHi- 4Lv- 4# - 4G- 4]- 4- 4$- 48l- 4Xf- 4Y- 4IQ- 4F. 4$3. 4=. 4?QW. 4a. 4ak. 4x#x. 48l. 42. 4Z. 4. 4D. 4l. 4K!. 4. 4b. 4 / / 47/ 4d/ 4>p/ 4!/ 4Z/ 4W/ 4 o/ 4;/ 4/ 4/ 4 <0 4v0 4|*0 4S&80 4~PF0 4@\T0 4V5b0 4op0 4 ~0 4W=0 460 4=D0 40 40 4_Y0 40 4P0 4W0 46 1 4!1 4 q&1 40(C1 4R1 4Ra1 4p1 4_j1 4J1 4o1 4V1 41 4>1 4H1 41 4>72 49o2 4)#2 4322 4IzA2 4wP2 418_2 4_en2 4@}2 4i2 4B2 482 4Tj2 4Y2 4G2 4b2 4%3 4\^ 3 4J03 4k6?3 4gN3 49]3 4<l3 4v{3 4o3 4z3 4Y3 43 4T3 4k;4 4$P4 4NG.4 4\U;4 4H4 4V4 4c4 4p)p4 4t}4 44 4o4 4S{4 4b4 4>4 40p5 4 p5 4;u5 4~5 45 4*5 4U85 4$0D5 4&Q5 4Pd^5 4ik5 4=5 4~t5 4x5 4\5 45 425 4 5 435 4[6 4g6 4e*6 4@6 4~L6 4 Y6 4f6 4}s6 4\o6 4]96 4e6 4M6 4.r6 4v6 4q6 46 4;7 4y7 47 4+7 4b[97 4xG7 4pU7 4'c7 4dPq7 4c7 4T7 47 4Հ7 4AS7 4Q7 4i}7 4`7 4X  8 4j8 4_-8 4/0;8 4LH8 4f U8 4.b8 4Yo8 4Cd|8 4X_8 4L8 4 [8 4ct8 4}8 4&>8 488 48 4<8 4;8 4 9 4@9 4&9 439 4UA9 4eO9 43O]9 44k9 4]y9 4+9 4K9 4l9 4O9 49 4+;9 4b9 4Pk9 49 4#\: 4AVj: 4x: 4(: 4 : 4: 4e: 4: 4u`: 4M: 4,: 4+&: 4#; 44?; 4̇; 4[6; 4; 4; 4; 40R; 4ll; 4< 4S< 4h< 4Q+< 49< 48 G< 4hRU< 43Gc< 4.Dr< 4}< 4< 4| < 4< 4e< 4Z< 4E< 4$< 4< 4ki = 4N= 4%n)= 4VH= 4~V= 4;d= 4((r= 47= 4= 4= 4= 4gk= 4E= 4Dy= 4T= 4;= 4i= 4" > 4y> 4)> 4J7> 4UE> 4fS> 4na> 4Ev8? 4PF? 4T? 4b? 4` p? 4.? 4u? 4wQ? 4? 4x? 4  @ 4rJ@ 4!X@ 4G<f@ 4t@ 4#C@ 4/@ 4]@ 40g@ 4w@ 4@ 4r@ 4h&@ 4u@ 4|A 4KA 4HA 4X*A 4)"8A 4FA 4_TA 4 bA 42A 4dCA 4 BB 4B 4RV0B 4t>B 4NHLB 4XZB 4I hB 4UC 4~bC 4]oC 40|C 4rIC 4OSD 4y$D 4(gD 4TQD 4"D 4}D 4l2D 4E 4&,E 49E 4wFE 4_TE 4Ni^E 4Z@hE 4-wE 4DE 4E 4E 4KE 435E 4E 4EE 4}2E 4uE 4eiF 4F 4BF 4ц-F 4t ;F 4IF 4wWF 4/eF 4;3sF 4AF 4 F 4-F 4 F 4F 4 F 4 F 40F 4F 4#F 4&G 4*G 4= G 4.G 4[JG 4fG 4rtG 4sG 4jG 4G 4WG 4roG 4HG 4KG 4dG 40G 45fH 4U#H 4g0H 4S=H 4 @UH 4rbH 4qH 4!}H 4"H 4 H 4H 4}CH 4@'H 4Z&H 4H 4Y1I 4JI 4j#I 4BG1I 4?I 45MI 4h[I 4GiI 4~wI 4kI 42I 4cI 4j-I 4I 4iKI 4&$I 4bI 4/I 4XJ 4J 4MJ 4H-J 4PJ 4&v_J 4 xJ 4uJ 4sJ 4J 4`J 4nJ 4J 4V>J 4|J 4pJ 4kK 4yK 4BK 4 (K 4#'5K 4BK 4LOK 45\K 4DiK 4tvK 4CK 4[?K 40K 4WbK 4K 4cK 4'!K 4gK 4IK 4(K 4B#L 46bL 4+6pL 4Q:L 4xpM 4*M 4S8M 4z FM 4LM 4|^N 4S O 4OO 4O 4XR 4U/R 4v S 4i%S 4DkMS 4h^S 48dS 4~jS 4T 4_"T 4jT 4FP@U 4MU 4sRZU 4BgU 4XHtU 4:U 4d=U 4U 4-U 4U 4U 489U 44yV 4VV 4(V 4,5V 4/BV 4ROV 4\V 49iV 4)EvV 4V 4V 4ׂV 4O=V 4eV 4=V 4 V 47V 4V 4vW 4FW 4KW 4-+W 4N:W 4oJW 44PW 4cVW 4=\W 4hbW 4JiW 4qvW 4DHW 4qW 4ƒW 4BX 43*X 4QYX 4{gX 4duX 4ObX 4X 4[X 4WY 4yZ 4J Z 4%eZ 4H]5Z 4LM?Z 42LZ 4mZZ 4UgZ 4p)tZ 4}Z 4XHZ 4sRZ 4U@Z 4Z 4Z 4Z 4[ 4I3[ 4ё@[ 4WM[ 4z[[ 4wSi[ 4ёw[ 4t[ 46[ 4J[ 4y[ 4\[ 4[ 4Rt[ 45[ 4X[ 4\ 4B\ 4k*\ 4I\ 4uU\ 4b\ 4}l\ 46B\ 4\ 4\ 4\ 4]\ 4@[\ 4NO\ 49 \ 4j\ 4Rt] 4=?] 4(!] 421^ 4`A^ 4_G^ 4DM^ 4nT^ 4!a^ 4/0n^ 4|{^ 4"^ 4 ^ 4^ 4^ 4^ 4l^ 4sR_ 4_ 4 $_ 4r1_ 4?_ 4M_ 4W[_ 43i_ 4| w_ 4_ 4B_ 4X_ 4@N_ 4k_ 4B` 4 a 4W-a 4na 4:{a 49 a 4JNa 4(a 4.a 4PEa 4ta 4a 4a 4%Oa 4]kb 4>b 421b 4=b 4sb 4b 4~G c 4?c 4Qn#c 4sR0c 43c 47c 4(c 4XHc 4kc 4/0d 4 d 4(d 4-d 4];d 4qQId 4pXd 4TNgd 4N|vd 4|d 4d 47[d 4d 4zd 4.d 4ʅd 4d 48 e 4e 4e*e 4 9e 4""He 4ԁWe 4te 4De 4b'e 4ke 4k 4Zk 4m4(k 45k 4W-Bk 4Ok 4}\k 4{ik 4/k 4p l 4Sl 4NBl 4#l 4Z#%l 40<Al 418Ql 4O_l 4&ml 4&{l 4[l 4Wl 4)l 4Bl 4?l 4l 4^l 49,m 4 6m 4UOm 4T|^m 4um 4jm 4qm 4(bm 4[m 4$ m 4Wm 4.m 4C_ n 4_An 4/%n 4r=n 41In 4 tVn 4cn 4ppn 4/}n 43n 4 n 4fn 4Jn 4pn 4Dn 4n 4Wn 4o 4o 4iM+o 4Y8o 4IEo 4+Ro 4z_o 4lo 4)lo 4(o 4NOo 4@o 4Vo 4 o 4Lo 4O0o 4o 4So 4Up 4`p 4$p 4n.2p 4.@p 4 Np 4C\p 4'jp 4 xp 4ˍp 4%p 4p 4@p 4†p 4p 4zap 4(p 4h q 41q 4ZV7q 4s=q 4fCq 4 Iq 4_Pq 4q_aq 4gq 4amq 4dsq 4Myq 41jq 4q 4[q 4>q 4q 4q 4ZLq 4q 4|q 4Dq 4~I r 4rr 4T(r 4r=7r 4+ Fr 4HUr 4\dr 4ʓsr 4pr 4r 4,r 4.r 4[r 4Br 4r 4{.r 4[r 4qs 4>es 4_r&s 46s 48Fs 4fUs 4ٔcs 48^qs 4Us 4Fs 45-s 43s 4:s 4`s 4cs 4s 4 Ss 4 t 4t 4])t 4D9t 4rIt 4;Yt 4[}it 4wt 4>t 4ut 45t 4Ɛt 4U t 4v&t 4_t 4t 4^t 49u 4x'u 4W4u 4sRMu 4BZu 4[gu 4Ftu 4JEu 4ٔu 4kyu 4'<u 4Au 4Au 4 xu 4߄u 4 xu 4u 4dv 46v 4},v 4*zAv 4^ev 4ov 4'v 4v 4Bv 4'v 4nv 4oJv 4TOw 43Jw 4sR(w 45w 4rxBw 4(Ow 4A\w 4oiw 43vw 4\w 4'w 4EAw 4w 4!w 4Aw 4O0w 4w 4kw 4w 4Px 42=x 4YJx 4sRdx 4Qqx 404~x 4fx 4Mx 4x 4x 4\x 4'x 4EAx 4x 4O0x 4y 4z 4!iz 4sRz 4f 4%t 4( 46 4S 4h 4{Dž 4xRх 4>ۅ 4( 4_j 4t 4< 4B  4f 4|! 4+ 4o9 4?CG 4eV 4 g 4em 4Ns 4e 4f 4m# 4IU? 4!M 4$[ 4M~ 4+_ 4{Y 4jE 40q 4z 4Q 4_ 4j 4\%ш 4Z׈ 4]ވ 4 4RV 4 4& 4&* 4U8 4%Q 4x_ 4K } 4%L 4E 4K 4 4މ 4J 4[ 4 4G, 4: 4iH 4V 4_d 4JJx 4  4md  4Ê 4(ʊ 4: 4 4q 4, 4 &M 4/s 42 4g 7 6t 6nċ 6ȋ 6׋ 6!ۋ 6 6m 6a  6 6  6$ 63 6\7 6J< 4RF 6ŞJ 6O 7X 4b 6f 6t 6nx 6Z} 4! 6ȟ 6Ÿ 4  6 6 4% 4%nj 7Ќ 4<ڌ 61ތ 6/ 4 6S 6I 7  6 6]S!]S< 6@ 6JSS 7l 6p 6y 6} 6 6> 6< 6[ 6Q 7 6 6 7- 6ơ 6ɍ 6͍ 6֍ 6Bڍ 68 6x 6r T 7H 6  6 6Ȣ 6 7b' 6+ 64 6)8 6#A 6WE 6QNcxю%7TW{DTDT 6{ 6y 6 6 6 6Ə 6ʏ 6ӏ 6׏ 6ݏZT~TT #ZU,ZUG 6̣K 6ʣQZSuZU PU ͐RTU 40@ 4ZW 4c 4 | 4e 4! 4~ 4 4% 4S;ݑ 4sR 4e< 4/0 4jO/ 4:J 4čV 4)cb 4 4+3 4bw 4We 45’ 4͒ 4փؒ 4 4 4 46 4N 4f 4~$ 40:B 4ha 4?e 4?r 15w 4ٸ| 53 53 73 2 4 4ē 4Γ 4ܓ 4 4 4 4 4   4 4 47 4C 4GQ 4'%V 4d 4e̔ 4ڔ 4 ߔ 4{ 4X 4X 4 4 4 ' 43 4? 4V K 4˞W 4j 4q 4 v 4e 4 4ؕ 4. 4O 4  4ѕ 4 ֕ 4 4" 4 4 4 4 4* 4 6 4B 4N 4PZ 4f 4{ 4 4x  4 4#! 4Ŗ 4QҖ 4c 4^ 4 4q  4Q 4GB 4=O 4Q\ 4 44 4 42  4ʗ 4ؗ 4s 4% 4 4Ա 4 4 , 4(: 4*H 4FV 4F d 4"r 4 4 4 4 4L" 4 4  4 4   4/ 4> 4aM 4v\ 4`l 4{ 4 4V 4Q 4 4ƙ 4ՙ 4 4P 4 4 4y  4 / 4> 4#M 4\ 4k 4z 4` 4o 4K 4 4Ś 4Ԛ 4  4] 4D 4 4$ 4&. 4= 4[ 4j 4My 4$ 4, 4! 4! 4ě 4ӛ 4  4< 4 4 4k# 43 4C 4S 4*c 4s 4 4B 4ê 4 4;Ü 4<Ӝ 4 45% 4  4 4H. 4= 4aL 4 [ 4]j 4Ny 4 4/  4 4c 4ĝ 4_ӝ 4A 4* 4) 4 4{ 4- 4< 4K 4Z 4i 4߲x 4 4e 4 4# 4֟Þ 4pӞ 4 4 4 4| 4h 4H- 42$< 4B%K 4ݙZ 4w 4 4| 4= 4* 4Ÿ 4џ 4j 4 4$ 4~  4  4+ 4 #: 4I 4X 4g 4v 4 4  4w 4w 4 4حР 4"ߠ 4 4B 4/  4 4Y* 4\9 4+H 4W 4Tf 4vu 4G 4A 4% 4 4 4ϡ 4ޡ 4 4 4  4 4ζ) 48 4G 4V 4~e 4+t 4 4H 4 4 4 4΢ 4Uݢ 4 4} 42  4  4( 47 4F 4U 4md 4s 4 4* 4 4 4 4+Σ 4eݣ 4 4 4  4 4( 47 4F 4V 4e 4!t 4 4 4 4S 4 4Τ 4Rݤ 4> 4 4  4 4՚( 47 4_F 43U 4d 4s 4 4 4 4Ƙ 4 4ͥ 4ܥ 4 4  4< 4m( 467 4F 4U 4%d 4s 4" 4  4I 4 4z 4eΦ 4Qަ 4 4= 4ڳ  4 4z+ 4s; 4J 4 y 4 4$ 4z 4ا 4g 4a 4m 435 4IG 4Z 4\h 4+t 4| 4 4 4 48 4Y 4Vը 4  4 4P 4N" 40 4V> 4L 4Z 4th 4v 4% 4Q 4$ 4" 4> 4Yʩ 4ة 4 4I 4 4 4  4,. 4< 4J 4IX 4f 4ct 4E 43 4 4 4 4Ȫ 4 4 4 4O 4! 40 4? 4N 4] 4l 4߿ 4r 4 4 4~#ǫ 4}֫ 4Z 4 4J 4  4`! 40 4w? 4ׯN 4] 4l 4 { 4o 4  4 4]# 4!Ƭ 4V լ 4 4 4? 4c 4X%  4(/ 4b> 48M 4?\ 4jk 4z 4 4 4| 4 4Vŭ 4ԭ 4/ 4 4 4 4 4/ 4 < 4I 4V 4c 42p 4J} 4 41 4 4® 4Ю 4ޮ 4# 4 4 4 4Q) 46 4 C 4$c 4.m 4z 4 4V 4ѯ 49#ݯ 4% 4I 4 4 4ȴ 4+ 4: 4I 4f 4v 4z| 4 4 4 47 4 4ð 4а 4hݰ 4ʵ 4 4 4N 4) 4 6 4h 4u 4 4y 4 4%˱ 4Vٱ 4? 4f 4+ 4]  4 4c- 4; 4I 4W 4~e 4s 4 " 4~ 4 4k 4 4Dz 4ղ 4 46 4r 4}  4 4) 4x7 4E 4nS 4"a 4o 4} 4= 4 4ó 4ϳ 4w"۳ 4 4g 4m 4 4ϥ% 422 4 ? 4L 4Z 4g 4 4f 4 4" 4 4ɴ 4ִ 4 4` 4  4 4$ 4Q@ 4L 4+Y 4Lf 4 4 4 4U˵ 4a۵ 4 4 4 4Ե 4 4+ 4%8 4ĞT 4 ` 4m 4z 41 4k 4 41 4kж 4|ݶ 4 4ϲ 40 4j! 4q. 41; 4kI 4\ 4h 4jt 4 4  4#Ƿ 4Է 4 4% 4M 4i 4w 4 4& 4 4ݸ 4  4 4޹ 4 4 4i* 47 4D 4#R 4 4ƺ 4)պ 4 4 45 4 4d( 4K 4/ W 4pe 4pt 4 4 4ͻ 4߻ 4X 4 4 4%! 4. 4; 4DH 4QV 4x d 4r 4* 4n 4%ż 4Ӽ 4X 4A 4 43  4^ 45 4C 4{Q 4_ 4m 4} 4 4 4 4Ͻ 4 4b  4? 4, 4@ 4 N 42\ 4j 4]y 4 4.! 4\ 4 4 4; 4|۾ 4 4 4} 4r 4+ 48 4ΙK 4X 4e 4Ϳ 4Dڿ 43w 4Ͼ 4 4# 4 4< 4D 4% 4R 4p 4D 4! 4 4 4U 4- 4Q! 4D 4gR 4W` 4n 4 4M 4f 4 4 4 4t 4O 4 4[ 4> 4#M 4[ 4i 4Ww 4, 4 4[  4P 4 4Ι 4 4K 4Z  4+, 4: 4wH 4#V 4d 4r 4 4 4 4ʵ 4 4Q 4 42  4 4( 43C 4P 4^ 4 k 4%x 4\ 4x 4" 4 4 4 4 4 4 4 4> 4_ 4E 44 4 4H * 48 4E 4R 4 _ 4Ǯm 4ɷz 4o 4 4  4  4ɷ 4$# 4  4&  4 4 4ϲ 4-  4 . 48> 4D 4զK 4X 4f 4s 4 4ʵ 4, 48 4A 49 4Z 4 4 4| 4) 46 4C 4V 4c 4rp 4ϲ} 4 4 4 4G" 4 4 4l 4 4 4%, 4): 4NF 4S 4N` 4n 4R{ 4H 4Ӹ 4% 4 4 4 4K  4 4o* 46 4C 4$X 4,e 4?| 4/ 4] 4; 4t 4, 4? 4; 4, 4? 4ԝ 4ڪ 46 4C 4P 4g 4t 4´ 4  4i 4  4 4 4 4 4 4 4C 4P 4m] 4k 4x 4 4w 4s 4 4ߣ 4 4 4Ԙ 4 4  4 4+ 45 4xB 4O 4*] 4j 4w 4  4! 4 4 4 4G 4 4 4Ɨ 4 4# 4X0 4= 4K 4֨X 4re 4ߢr 4g  4< 4= 4 4 4O 4" 4 4 4 4 4|" 4֟ 4+ 48 4V 4pc 4_q 4 ~ 4 4e 4l 4 4Z 4 4ߚ 4 4O 4 4'+ 48 4OF 4R 4_ 4Om 4t 4O 4 4  4# 4 4 4  4{ 4( 49 4? 4 E 4K 4 Q 4™X 4f 4Ot 4 4, 4 4{ 4 4$ 4  4 4&  4 4# 4f, 4; 4I 4W 4,e 4s 47 4 4! 4R 4 4} 4 4 4  4 4 4$ 4 + 49 4 G 4 U 4c 4#q 4 4| 4ә 4 4 4 4 4! 4 4J 4  4 4' 4y5 4DC 4;Q 4_ 4`n 4} 4 4p 4 4@ 4V 4 4 4X 4 4  4@ 4#& 44 4mB 4'P 4x^ 4l 4z 4a 48 4I 4z 48 4 4' 4 4  4 4% 43 4OG 4m 4{ 4ɷ 4 4 4 4` 4 49 4 4 4f   48 4* 42: 4J 4u#Z 4zj 4 z 4  4 4e 4қ 4K 4 4i 4 4 & 45 4O 4] 4vk 4-y 4% 4 4A 4Q 4 4  4  4 41" 4ϵ0 4X> 4L 4Z 4h 4v 4 4 4 4 4 4 4 4n 4) 4 4Ӹ! 4#. 4; 4U 4&b 4o 4( 4 4 4@ 4x 4 4%  4  4' 4s4 4A 4N 44[ 4h 4u 4 4 4_ 4  4 4A 4V 4 4M 4% 4 4 4 4I 4%V 4Mj 4۩ 4 4% 4 4 4% 4< 4, 4 4,, 4H6 4r@ 4J 4"T 4=^ 4l 4y 4  4k 4 4 4^ 4 4 4 4 4@ 4% 4 4" 4"/ 4> 4*M 4Z 4:g 4t 4 4:" 4 4֟ 4C 4 4Y  4 4a  4 4' 4{5 4C 41Q 4_ 4m 4{ 4 4߲ 4 4_ 4 4# 4٥ 4 4ƶ 4 4v 4># 4w1 46? 4GM 4L[ 4[!i 4w 4` 4[ 4 4 4X 4 4/ 4 4N 4 4+ 4Ӹ" 4}/ 4 B 4L 4V 4d 4/r 4 4 4 46 4 4 4 4 4 4  4\ 4+! 4z. 4; 4H 4U 4b 4o 4| 4X 4 4 4 4 4 4% 4f 4C  4è 4 4*= 4G 4a 4tk 48u 4 4 4 4D 4s 4 4L 4  4 4 4 4 4 4, 4,: 4H 4d 4r 4 41 4 4x 4  4 4  4 4 4  4 4 ' 45 4C 4_ 4ߚz 4 4P 4h 4 4X 4, 4 4 4M 4?  4s 4- 4: 4QG 4T 4a 4n 4{ 4 4 4 4g 4  4! 4  4 4 4 4 4Q 4Y 4 + 48 4NJ 4-W 4d 4 q 44~ 43 4K 4 4b 4  4 4b 4g  4  4d 4 4!( 45 4rC 4w 4% 4 4/ 4/ 4 4z 4B  4D 4 4  4] 4+ 4(8 4ӸE 4%_ 4\l 4xz 4, 45 4 45 4K 4a 4 4U 4 4  41 4k 4] 4, 4M 9 4G 40T 4?a 4n 4} 4 4 4m 4 4 4 4 4 4t' 4*4 46A 4T 4` 4g 4 4M  4r 4 4 4_ 4@ 4 4 4/  4- 4~G 4T 4 4N 4  4 4O 4 4 4\ 4ΰ 4  4 4_$ 43 4 A 47| 4y 4 4 4> 4ΰ 4 4\ 4 4B 4: 4: 41 4> 4K 4#X 4e 4r 4 4. 4 4\ 4ΰ 4" 4 4 4 4 4  4| 4 4( 46 4D 4R 4_` 4 4ܞ 4y 40 4q 4 4  4 4 4# 4: 4MF 4R 4_ 4 4; 4 4] 4 4 4. 4H 4 4= 4 4 4%  4@ 4 4  4V) 4,6 4:C 4Q 4d 4q 4 4 4 4q 4V 4 4s 4 4" 4 4Q. 4jF 4S 4| 4 4P 4P 4 4 4Ӹ 4 4 4' 4( 4T  4- 4: 4ڼG 4T 4a 4n 4| 4% 4 4M  4 4n 4 4@ 4 4" 4Q 4- 4V" 4/ 4< 4 I 4 V 4c 4p 4} 4K 4? 4 4 4 4Z 4  46) 4H< 4!S 4.l 4y 4V 4 4Ϳ 4 4 4 4 4. 4@  4 4' 4A 4%N 4 $ 4= 4A 4 4 4 4& 4!3 4K 4_ 4Hm 4 4 4 4% 4X 4  42 4 4R  4 4( 4F 4_ 4 m 4:{ 4 4 4ͧ 4 4 48 4A 4  4 0 4%B 4P 4:^ 4l 4 z 4 4ͯ 4 4/ 4' 4 4% 4 4 4\  4p  4( 46 4wQ 4rn 4x 4N 4 4 4v 4 4j 4n 4 4< 4% 4 4- 4K 4qd 4Kq 4 4) 4.! 4 4 " 4 4Y 4O 4|%  4 4& 44 4jB 4FP 4^ 4*l 4z 4^ 4ʦ 46 4 4% 4 4_ 4$ 42 45T 4ɖb 4p 4߼~ 4. 4p 4 4 4 4 4M 4 4ɝ  42 4x& 4!4 4B 4XP 4^ 4X"l 4z 4 4 4  4. 4 4 4 4 4 4w 4. 4^. 4˟= 4L 4$j 4éy 4 4 4L 40 4j 4 4 42 4 4$ 4u 4%- 4< 45K 4 Z 4i 4 x 42 4 4 4 4 4 4 4  4 4e 4qC 4M 4W 4a 4Ak 4̳ 4 4v 4 4r 4X 4& 47 4ޠ= 4#C 4!I 4O 4U 4[ 4a 4g 4n 46u 4\| 4+ 4 4 4 4X 4 4 4 4 4 4y 4L  4= 4u$ 48 4F 4#T 4b 4 v 4 4 4 4T 4( 4# 4 4& 4  4 4   4h; 4GE 4tR 4` 4m 4Ӹz 4 4a 4 4 4 4G" 4 4_ 4W9 4 "F 4S 4 a 4o 4 "} 4 4X 4 4  4 4f 4 4 4+ 4  4 4?0 4-O 4[ 4٠h 4 w 4J| 4 4 4J 4 4  48 4j 4 4 4 4! 411 4\ 4 P 4` 4f 4l 49s 4` 4 4  4 4k 4  4 4  4R  4  4G"-  4J:  4UG  4#T  4{  4  4  4h  4_  4  4  4  4n  4  4  4l$  41  45>  4K  4Y  4"f  4s  4G"  4  4  4  4٠  4  4!  4ͯ  4f  4t  4+  4D!  4?/  4z  4S  4  4r  4a  4U  4  4  4  4  4T  4  4 ,  4:  4H  40  4U  4  4N  4f  4d  4F  4  4  4 4A% 42 4" 4 4m 4 4) 4B 4O 4\ 4i 4< 4 4 4 4Q  4G, 49 4ӸO 4Ca 4 4 4 4X 4 4 4P  4 4$ 4"1 4> 4gK 4fX 4Ie 4Cr 4 4 4 4 4c 4 4 4{ 4 46 4" 40 4> 4,L 4'Z 4zh 4>v 4T 4O 4^ 4 4 4 4p 4 4 4 4! 4>$ 42 4@ 4ңN 4\ 4 &j 4x 4B 4  4 4s  4 4 4j 4m 4 4  4 45  4s/ 4g> 4U 4d 44s 4 4 4  4  4 4 4G 4 4  4Ĭ 4M' 4mL 4Y 4 f 4ws 4I 4 4 4 4" 4* 4w 4 4( 4 4  4R 4* 4,8 4F 4}T 4~b 4p 4C ~ 4 4q  4Ѵ 4 4 4* 4 4 4  4"  4 4P& 43#4 4B 4KP 4^ 4il 44z 49 4 4 4 4* 4> 4 4 4 4 4_ 4!, 4; 4$J 4Y 42h 4Gw 4b 4m 4> 4 4 42 4/ 4 4$ 4ڵ  4 4Ҡ+ 4): 47I 4ݘh 4w 47  4 4 4 4@ 43 4} 4 4 4 4e 4B 4 4 49 4 4- 4 4L 4> 45 4/ 4} 4 4  4 4% 4z2 4@L 4Y 4r 4 4 4 4 4c 4 4 4 4 41 4' 4k 4 4 4 4 4 4' 4y 4 4M  4  4 4h& 4z4 4?> 4J 4QV 4Gp 4%} 4 4% 4J 4z 4 4 4# 45 4$ 41 4K= 4M _ 4e 4# 4 4p 4Z 4V 4  4  4&  4b3  4@  4#M  45d  4G  4   4  4L  4  4ħ  4  4  4  4! 4 ! 4.! 4 ;! 4H! 4V! 4c! 4%p! 4! 4! 4! 4! 4d%! 4" 4E#" 4$" 4.2" 4@" 4jN" 4k![" 4h" 4"u" 4" 4`" 4" 4w" 4" 49" 4# 4# 4# 4)# 46# 4oC# 4TP# 4f^# 4k# 4ϲx# 4# 4~# 4# 4{# 4## 4# 4# 4I# 4`# 4Q$ 4"$ 4k$ 4*$ 4_]$ 4g$ 4a$ 4$ 4$ 4ײ$ 4`$ 4S$ 4$ 4#$ 4$ 4 $ 4 % 4%% 4'% 4}4% 4B% 4% 4]% 4l% 4% 4% 4m% 4>% 4& 4)& 48& 4F& 4 T& 4b& 4p& 4W~& 4& 4y& 4)& 4& 4D& 4=& 46& 46& 4i& 4 ' 4' 4&' 464' 4oB' 4P' 4m' 4N|' 4<' 4`' 4m' 4' 44' 4' 4' 4( 4( 4 ( 4/( 4>( 4PM( 4)\( 4< k( 4]z( 4( 4R( 4( 4( 4( 4( 4b( 4) 4?) 4) 4:-) 4J) 4=Z) 4i) 4 x) 4u) 4^) 4) 4i) 4 ) 4) 4Q) 4 * 4 0* 45<* 4X* 4Pe* 4r* 4M * 4ѡ* 4Ӹ* 4* 4* 4c* 4P  + 4+ 4&+ 4,+ 42+ 48+ 4(>+ 4YD+ 4T+ 4b+ 4n+ 4{+ 4E+ 4+ 42+ 4+ 4g + 4+ 4 + 4, 4, 4!, 4*, 4H, 4T, 4j, 4v, 4}, 4_, 4}, 4, 4, 4, 4, 4, 4- 4- 4- 4p+- 4 9- 4l#G- 4U- 4oc- 4Q q- 4- 4- 4u- 4- 4- 4- 4- 4e- 4- 4_. 4( . 47. 4D. 4W. 4e. 4r. 4. 4$. 4. 48. 4l. 4}. 4. 4. 4 . 4. 4C/ 4/ 4/ 4)/ 4M6/ 4@C/ 4P/ 4]/ 4k/ 4y/ 4O/ 4/ 4/ 4/ 4$/ 4/ 4/ 4s/ 4/ 4 0 4x0 4'0 4D0 470 40 4B0 4N0 4ϖ0 40 4d0 40 41 4{ 1 4n 1 4D1 41 4/1 41 4,1 4\1 4=2 4R2 42 4k+2 492 4G2 4U2 4c2 4q2 42 4<2 4.2 42 42 402 4d2 42 42 42 43 4(3 4a73 4E3 4kS3 4r3 43 4%3 4z3 43 43 4Ӷ3 43 43 43 4 3 4 4 4S4 4)4 4۱74 4 E4 4S4 4a4 4o4 4}4 44 4b5 4!p5 4~5 45 45 4Q5 4(5 4 6 46 4 )6 4[76 4xt6 46 46 4`!6 46 4>6 46 4/6 4o6 46 4}7 47 47 4 *7 487 4F7 4T7 4zb7 4Ѭp7 4~7 4~7 4:7 4d#8 418 4?8 4HZ8 4h8 4Wv8 48 48 4a$9 49 4.9 4W9 4w9 4}: 4: 4': 4v: 4 : 4; 4; 4I; 4õV; 4c; 4xp; 4~; 4D; 4; 4@; 4; 4; 4Ϫ; 4; 4; 4X; 4< 4< 4< 4[-< 4;< 4I< 48W< 4ůe< 4s< 4< 4v< 4< 4< 4f< 4< 44< 4߭< 4< 4Q = 4= 4= 4T(= 4&2= 4l<= 4J= 4X= 4t= 4= 4s= 4"= 4= 4= 4= 4= 4= 4> 4> 4%'> 4.?> 4$M> 4Z> 4xg> 4> 4_> 4Y> 4> 4Y> 4s> 4> 4}> 4? 4? 4#? 41? 4?? 4M? 4K[? 4 i? 4w? 4u? 4? 4? 4? 4n? 4? 4ͼ? 4b? 4n? 4@ 4@ 4e@ 4}-@ 4;@ 4I@ 4xW@ 4 z@ 4@ 4o@ 4E@ 4)@ 4-@ 4@ 4@ 4:$@ 4A 4 A 4fA 4+A 4 8A 4mEA 4FRA 4f_A 4BlA 4yA 4TA 4A 4#A 4A 4A 4A 4SA 4A 4A 4xA 4B 4LB 4q#B 4MB 4~B 4B 4B 4FC 4TC 4bC 4pC 4~D 4-E 4E 40H 4H 4\ I 4;I 4lcI 4tI 4zI 4ޕI 4 3J 4 K 4K 4WVK 4.tK 4}K 4ޫK 4{!K 4K 4K 4K 4'K 4K 4K 4K 4= L 4L 4$L 4G1L 4l>L 4"KL 4YL 4gL 4uL 4L 4NL 4 L 4L 4[L 4L 4"L 4L 4L 4tL 4AL 4L 4#]M 4^jM 4M 4M 4M 4M 4KM 4bN 4N 4^O 4hO 4wO 4fO 4aO 4O 4O 4HO 4O 4O 4 P 4P 4>P 4X-P 4D uZ 4Z 4Z 4Z 4Z 4,Z 4dZ 4Z 4Z 4[ 4 [ 4"[ 4Q5[ 4NB[ 4jP[ 4\[ 4j[ 4x[ 4[ 4׿[ 4ѭ[ 4[ 4[ 4[ 4[ 4޽[ 45[ 4}\ 4\ 4* \ 4i$.\ 4<\ 4KJ\ 4SX\ 4f\ 4)t\ 4 \ 4\ 4q\ 4\ 4N\ 4P\ 4O\ 4\ 4N\ 4] 4] 4] 4#] 4 )] 4/] 4?6] 4D] 4R] 4z`] 4n] 4w$|] 4U] 4&] 4} ] 4] 4] 4E] 4.] 4] 4ɚ] 4 ^ 4^ 4 $)^ 48^ 4q%G^ 4#V^ 4d^ 4r^ 4r^ 4^ 4^ 4^ 4?^ 49^ 4^ 4^ 4^ 4 _ 4J%_ 4_'_ 45_ 4C_ 4Q_ 4^__ 4vo_ 4_ 4_ 4_ 4-_ 47!_ 4H$_ 4_ 4b_ 4-_ 4"` 4Q` 4-` 4;` 4I` 44W` 4!e` 4s` 4` 4(` 4> ` 4` 4` 4v ` 4` 4a 4ra 4a 4*a 4@7a 4J%Da 4C Qa 4^a 4wka 4xa 4a 4Pa 4a 4(&a 4a 4Aa 4a 4 a 4b 4Ĥ%b 4Ab 4Ob 4]b 4%kb 4yb 4ub 4pb 4Mb 4b 4b 4$ b 4 c 4hc 4c 4<,c 49c 4Fc 4#Sc 4 `c 4jmc 4zc 4׿c 4ѭc 48c 4!c 4c 4Bc 4d 4d 4%'d 44d 4Ad 4Nd 4 [d 4$hd 4ud 4d 4#d 4 d 4׿d 4ѭd 4;d 4 d 4@e 4Me 4Ze 4ge 4 te 4e 4e 4Te 4qe 4e 4^e 4e 4"Of 4\f 4if 4;vf 4<f 4f 4f 4f 4D!f 47f 4f 4gf 4f 4ig 4:0g 4,>g 4Lg 4Zg 4ig 4Kzg 4g 4]g 4g 4g 4 g 4g 4Eg 4xg 4g 4g 4Εg 4jg 4g 43h 4 h 4 h 4M /h 4<9h 4Jh 4Ph 4Vh 4O\h 4d"bh 4&hh 4 nh 4%"uh 4h 4h 4h 4vh 4ph 4oh 4Fh 4h 4d h 4h 4h 4[h 4i 4&i 4%0i 4~Di 4bi 4Vli 4~vi 4i 4i 4"i 48i 4i 4ai 4i 4ܝi 4i 4i 4j 4 %j 4<2j 4Ej 4HQj 4^j 4lj 4xj 4j 4j 4j 4j 4j 4\j 4`j 4j 4ݴj 4yk 4!k 4"k 4*0k 4>k 4ƥMk 4\k 4rkk 4zk 4Ck 4k 4Ϋk 4k 4k 4k 4l 4l 4l 4+l 48l 4fl 48vl 4|l 4l 4 l 4l 4 l 4l 4l 4l 4|l 4l 4Ol 4l 4ym 4qm 4o!m 4 "/m 4=m 4Km 4~Ym 4gm 4tum 4Om 4$m 4m 4Vm 4Qm 4m 4m 4%m 4m 4 n 4n 4%n 4/n 49n 4!Gn 4fUn 4cn 4fqn 4jn 4n 4n 44n 4n 4n 4n 4=n 4n 4$o 4) o 4o 4Q+o 49o 4IGo 4{Uo 4co 4qo 4o 4Ho 4oo 4so 45o 4o 4o 43o 4o 4&o 42 p 4_p 4'p 4|5p 4Cp 4dQp 45_p 4 mp 4{p 4p 4Yp 4p 4p 4p 4p 4 p 4p 4q 4*q 4f8q 4{Fq 4 dq 4nq 4 }q 4q 4q 4ѷq 4mq 4Nq 4*q 4q 4|q 4$q 4!q 4Nq 4/q 4 r 4Or 4t#r 4)r 43r 4hs 4s 4s 4s 4t 4?t 4t 4`"t 4(t 4 /t 4;t 4Ht 4Ut 4bt 4ot 4t 4t 4 t 4t 4t 4It 4_t 44t 4t 4g t 4 u 4u 4h#u 40u 4>u 4%Ku 4Xu 4fu 4u 4u 4u 4u 4u 4u 4Ϥu 4u 4#u 45 v 4v 4"v 4/v 4yy"y 4Gy"y 4z"z 45)z"@2z 4?z Hz 4}Uz" ^z 4kz tz 4.z` z 4z z 4z"z 43 z z 4$z"z 4=z 4{ 4,{ 4>{ 4[{ 4{ 4{ 4{ 4{ 4{ 4| 4K| 4<| 49R| 4n| 4v|Y|Y|"|Y|"| 4| Y| 6| 6} 6 } 6 }QY#}YY;}gYI} 4S}`Xs} 67w} 6-} 6o} 6e} 6} 6}X} 7 } 6} 6} 7 }X} ;}.~X~` .~ D?~XW~Xl~ 4ps~0X~ 4f~ 6̤~ 6Ƥ~ 6~ 6~ 4~BX~ 4c~U~ 4f 6* 6  4٠ 6 6) 6- 6< 6@ 6O 6/S 6)l 6\p 6T 6 6 7 4 6 6 4U 7 6 6 62 6. 6J 6F,V 7  6`$ 6^- 6o1 6m: 6> 6}C4VaVj 7y 6} 6 6 6 6ŧ 6VWÀ 7Ҁ 6ր 6߀ 6 6 6 6 W'V(kVEV^Vs }V 4B[ 5O< 5(<Y 2 45oJ 4чV 4.` 4.n 4s 4w 4j_ 4q5 4o 4j 4 4u7ʅ 4 օ 4r: 4Y 4s 4e 4GSk 4z} 4 4 4 4: 4̥ 4Ӂ 4j̆ 4؆ 4 4v 4 4 5 4> 4" 41' 4$3 4ݥ? 4zK 4zW 4&c 4.o 4s{ 4 4\0 4q 4; 4 4Ç 4#χ 4/ 4 4y 4 4! 4F 4\)( 4M4 42@ 4U 4c 4x 4 4 4#m 4 4 4^̈ 4Bڈ 4J 4 4 4@2) 46 4C 4w 4[L 4Y 4D 4]Ή 4 4 4Y 4  4 4B$ 42A 4eO 4f] 4@k 4Cy 4j( 4 4b} 4U 4 4͊ 48ۊ 4 4 4q 4q? 4u! 4P/ 4H> 4uN 4(\ 4*j 4fx 4ݸ 4 4 4* 4^ 4̋ 4<ڋ 4bN 4 4M 4" 4y1 4o@ 4O 4^ 4m 4 | 4 4< 4d 40Ȍ 4C׌ 4j 4: 4 4 4J" 4L1 4e5@ 4uO 4Ҙ^ 4>m 4N| 4* 4f 4+ 4 4yǍ 4 ֍ 4 4 4 4 4P! 4+0 4wC? 4N 4] 4ll 4X{ 4 4#E 4xQ 4` 4azƎ 45EՎ 4 46 4 40 4U  4X/ 4`> 4zM 4=f 4dr 4~ 4 4O 4:x 4$ŏ 4d'Ϗ 4\܏ 4v 4  4* 47 47{D 4Q 4_ 4Jm 4d{ 4kZ 4I 4Đ 4NҐ 4: 4 4p 4  4k? 4cQ& 4*4 4B 4NP 4d^ 4l 4z 4 4` 4 4q 4?V 4 4 4H 4F' 46 4"KE 4LT 4!c 4ʃr 4( 4e 4sw 4 4| 4߭͒ 4Qܒ 40t 4؏ 4'  4L 4gl' 4*6 4DE 4FhT 4c 4z;r 40 40 4  4 4^ 4N̓ 4ۓ 4> 4 4V 4ޚ 4F& 45 43TD 4 ZS 4Xq 4z 4l 4" 4f 4 4.˔ 4DMڔ 4H 4 4  4 4yK) 4x9 4I 4#Y 4i 4y 4sq 4 4 4F 4pɕ 40ٕ 4M 44 4p 4 & 4Xm5 4@D 4,S 4Sb 4q 4@ 4 4 4 4* 4{˖ 4v)ږ 4 4@* 46 4% 4% 4N4 4?xC 4rR 4a 4*p 4 4R 4Y& 4! 4 4ʗ 4=6ٗ 4 4 4y 4O 4% 4؀4 4C 4ZR 4}a 4,p 4p| 4?- 4 K 4 4kZɘ 4IZؘ 4h 4  4 4 4`# 4fe2 4NA 4P 4_ 4in 4b} 4Q 4R 4 4 4cș 4י 4K 4H 4Nt 4 4y" 4L1 4j@ 48IO 4go^ 4&m 4hC| 4W 4՗ 4 4b 4ǚ 4֚ 4 4G 4@ 43 4Ta! 4J0 4&X? 4N 4Ay] 4nl 4:{ 4 4 4 4C 4JNƛ 4՛ 4 4 4 4 4>  4$/ 4]E> 4M 4\ 4Xk 4Bz 4y 4*i 4 = 4Ǎ 4Ɯ 4՜ 43 4v 4Xk 45X 4  4!k/ 4> 4NM 4\ 4gl 4{ 4 4 4 4` 4|Ɲ 4;՝ 4 4 4 4I 4  4zS/ 4d.> 4AKM 4s\ 4Ik 4yz 46 4E 4 40q 4*Ş 4nԞ 4 4 4D 4T  4/ 4Ь> 4GM 4\\ 4k 4z 45 4U 4 4v 4vş 4jԟ 4 4( 4 4 4S# 4 2 4^IA 4frQ 4W` 4R 4( 4X 4 4 4d 4X/ 4> 4=J 4V 4vb 4wNn 4S 4% 4 4:SΡ 4:Sݡ 4@0 4٭) 4%6 4jH 4 VU 4k?o 4I| 4v 4 4KϢ 4ݢ 44 4Ǒ 4X 4 4E# 4li? 4 M 4[[ 4i 4w 4"A 4' 4 4x 4 4̈ 4b  4y  4_D 4Y 4zg 4|U{ 4>J 4" 4\q 4 4j¤ 4Ф 4hޤ 4h 4t 4v 4 4$ 4C2 4@ 42B] 4,j 4 4x 4s 4nХ 4ź 4ƽ 48j 4%I+ 4> 4WL 4] 4ʞe 4m 4kvz 4 4 47 4 4 4TȦ 4Uզ 4c 4k? 4 4I 4C' 425 4O&C 4^Q 4(j 4v 4~ 4Gb 4 4 4NU 4Jħ 4ǐӧ 4 U 4k? 48 4 4g 4E! 4( 45 4T&O 4k\ 4.i 4׉v 4V 4F> 4  4Q 4¨ 4WϨ 4| 4s  4k?0 4IdC 4Q 4U_ 4m 4{ 4( 4; 4/ 4e 4h 4QZϩ 48ݩ 4Ik 4 4 4s 4# 4,1 4AY? 4M 4[ 4i 44w 4 4i 4D 4 4U 4˪ 4~٪ 4l 4G 46 4s 4<`& 4?3 4 @ 46M 4O&Z 4k?h 4QRu 43 4d 4 4Q 4:˫ 4 4Q 4u  4C 4bR. 4,4 4(k: 4x@ 4oF 4;L 4ZR 4mX 49^ 4d 4j 40p 4,v 4| 4 4' 4 4 4S¬ 4Ȭ 4uά 4`Ԭ 4.ڬ 4g 4j 4 4 4 4 4a 4  4M 4? 4; 4" 4c( 4. 4|4 4: 4R@ 44&F 4L 4rZR 4X 4)d 4D|t 4l 4`f 4X 4ۈ 4 4έ 4ݭ 4n. 4xv 4w  46 4J( 4}A7 4RF 4^U 4d 4cs 4X 4L 4i 4զ 4 4Oͮ 4\ܮ 4Se 4 4  4 4S( 4j7 4F 4lU 4+Dd 4Qs 4k? 4 4+ 4 4C 4+Tί 4_ݯ 4 4 4f 4`Z 4! 4&. 4.G 4T 40a 4n 43.{ 4B 4 ~ 4B 4k 4̰ 4ذ 4A 4T 4 c0 46@ 4F 4/L 4ˊ\ 4Vv 4k? 4 4_ 44 4fű 4cұ 4߱ 4s 4 4  4s 45 4B 4dU 4Rl 4{y 4 4 4s 4 4rk 4Ͳ 4|ٲ 48 4  4, 4[9 4>'T 4 4W 4*γ 4ܳ 4d 4V 4=@ 40B 4o 4W| 4C 4b 4k? 4 4 4, 4f 4l$ 4  4bͶ 4E 4{2 4<? 4eL 4lY 4f 4 4e 4l 4Q 4y+ 4P8 4Q 4c^ 4Obk 4{7 4p 4 4q 4׸ 4' 4 4C 4A% 4(5 4B 4}P 4WD] 40k 4֤ 4 4? 4 4Ĺ 4re 4T( 4| 4Y 4  4,0 4> 4L 4Z 4Wz 4 4 4 4LP 4'E 4R 4_ 4e_ 4i2 4ǻ 4NԻ 4k? 41 4   4 4n, 4z@ 4APU 4c 4So 4| 4Up 4 4> 4l 4 4N~ʼ 41=ܼ 4 4k 4 4k 4 4g* 4L7 4;D 4Q 4^ 4(k 4w 4+ 4k? 4z 4C 4) 4 4kP 4 4H 4Č8 4[ 4#g 4Svu 4 4] 4Ŭ 4S 4^ 4Uþ 4oܾ 4k? 4d 4w 4 4g  4. 4NL 4#Z 4h 4jv 4֟ 4 4 4ɧ 4: 4z 4{ 4f 4) 4ɧ6 48C 4aCP 4bh 4G<u 4 4 4o 4Eq 4C 4 4@ 4 4  4S 4Eq% 4'2 4dN 4:[ 4mh 4u 4<[ 4I 4 4/ 4E 4 4 4 4  4 4~$ 4I7 4D 4e 4r 4C 4 4i  4s 4&b% 4<[2 4UL 4WY 4g 4xxs 4{P 4 4J 4" 4s 4 4G 4ӝ 4 4+ 4j 4 4U 4s" 40 4 < 4H 4-c 4p 4MS 4 4A/ 4 4 4d 4~ 4= 4͋ 4$ 40 4{R 4 4 4N 4E 4 4 4 4  4} 4F/( 4O4 4ǷA 4F/O 4Td 4F/q 4 4! 4 4<[ 4j 4oy 4 4EA 4[1 4fM 46NY 4v 4 4 43 4 45, 4r/ 4Y 4 4]{ 4W, 4W 4y} 4Ӏ 4+ 4~I8 4 L 43Y 4H 4? 4 4 4y 4F 4wY 4 4 49O 4  4X 4p) 4== 4K 4tuY 4g 4Tu 4L 4^ 4 4 4l< 4V{ 4o 4 4} 4 4H 4 4+ 49 4JG 4*4U 4Tc 4q 4d 4v 4 42 4 4~r 4 4{ 4S 4  4# 42 4B 4X 4g 4*v 4I 4" 4ײ 43 4 4F 4Y 4?Z 4հ 4A 4(! 4U. 4; 4H 4U 4bb 4.z 4 4 4R 4 4h 4 4  4 4t; 4 4WU 4$ 4Z2 4v@ 4N 4\ 4j 4x 4/e 4 4 4s 4c2 4 4^ 4b 4 4 4 4u! 4:0 4 /? 4_N 4w] 4m 4| 4õ 4R 4KM 4p 4 4 4G 4 4{ 4 4-a! 4C0 4(? 4pN 41] 4tl 4V{ 4:e 47 4^ 4 4-+ 49 4y 4F7 4 4v" 4m1 4.K 4D[ 4a 4d7 4)D 4@Q 4@b^ 4k 4 4of 4 4r 4k? 4ǐ" 4/ 4< 4NUJ 4W 4+~d 4r 4 4P 45 4 4_S 4 4U 4G 4*z 4S 4c 4 4- 4V 4  4- 4: 4VMH 4ߒU 4Eqc 4Rq 4Q~ 4 4p 4 { 4JO 4$ 4Eq 4B 4 4V 4( 44 4I 49 4&uF 4VBS 4=` 4z 4 4n 4 4r 4w 4) 4R 4 4k?  4Q 4% 402 4@ 4NS 4bq 4} 4) 4K 4 4 48 4<[ 4_ 4j 4N 4 4QC 4nO 4@[ 4l 4^x 4؂ 4 4 4 4vc 4MT 49 4m 4\* 4X 4C& 4MT3 49@ 4XW 4MTd 49q 4{3~ 4 G 44 4He 4 4 4S 4HU 4%T 4 4*( 44 4=<@ 4MsL 4X 4Tn 4 4Z 4i 48z 4 4{D 4 4: 4 4,  4y<, 4RB 4XO 4*\ 4n)i 4bw 4Y 4Y 4 4Eq 4<[ 4b 4) 4g 4* 4kZ 4dx, 4g9 4\F 4S 4wa 4b{ 4 4 4r 4? 4) 4̈ 4 4 V 4r 4?  4BD 40' 4;4 49B 4O 4c\ 4Gsi 4v 4 4D 4Ň 4 4{ 4q 4 4=6 4 4p 4Y 4% 4N3 4ӭ@ 4ҡN 4v[ 4O=h 4u 4l 4k? 4n. 4!k 4r 4 4N 4 4N 4 4E 4o" 4Q( 4,/ 4= 4F/K 4Y 4(u 4 4N 4?x 4 4C 4 4X 4 4 4в 4f 4}  4Z. 4< 4[J 4CX 4)hf 4t 4 4  4 47 41~ 4 4~ 4f 4v 4 4w 4Go 4- 4t; 4I 4E;W 4;e 4,s 46 4 t 4 4 4`@ 4' 4 4 4 4yk 4o=  4 4e) 497 41F 4nV 4)d 4ss 4 4_ 4k 4A 4` 4{ 4 44 4f 4Q 4@  49u 4y) 4`7 4E 4S 4Sa 42o 4} 4_ 42 4 4- 4X| 4ϛ 4%q 4` 4  4J  4EF 4NT 4Yc 4eBq 4{u 4  4'Y 4 4ɪ 4 4k? 4 4q 4n 4~ 4# 413 4EC 4iS 4b 49U~ 4e 4/0 40 4p 4' 4 48 4n 4( 4h6 4&)D 4HR 4pb 46 4D 4 4D 4H 4 4 4RT 4V  4 4& 4e4 4xB 4P 4%N^ 4Il 4z 4 4k? 46 4  4p 4 4 4<[ 4^ 4 4tU/ 43T< 4'I 4{d 4B 4O 4 4 4 4 47 4ݫ 4sh  4_ 4# 4/0 4$= 4 J 4|W 4j6d 4lq 4}~ 4O 4D 4 4 42 4 4 4 4 4d  4 4  4<[- 4-: 4{G 4T 4-a 4n 4x{ 4*- 4r 4 4L 4 47 4H 4+ 4?8 4}5E 4R 4k?_ 44l 4V{ 4 4 4 4'[ 4 4 4 6 4=6 4 4* 4 4<: 4TH 4{V 4d 4Nr 48 4 4?x 4 4r 4 4R 4 4-, 4 4  4@ 4۱( 4X6 4MD 43R 4̗` 4n 4| 4՗ 4x 4 4Q 4( 4t 4, 4 4]/ 4e 4 4&$ 4r8 4\?E 4R 4<[_ 4l 4 4 4 4L 4H 4s 4T+ 4 4* 4 4  4 4 [% 4T3 4{pG 48IQ 4go^ 4-|k 4x 4 4 4e) 4b 4a 4 4& 4ٙ 4J 4-| 4 4 4+ 43T9 4G 49U 4Ac 4Nq 4 48 4 4֋ 4- 4T 4V 4 4L 4L 4B 4@2, 4Z6 4mD 4*R 4/` 4}t 4 4C 4 4 = 4_ 4 4Z  4x$ 42 4.@ 4N 4Vf\ 4Cj 4x 4< 4 4/ 4$ 4 4e 4 4y 4ٞ 49 4v 40q  4k. 4< 4ܹK 4=Z 4&i 4_cx 4 4 4\ 4?C 4X 47 4t 4. 47 4r 4y  4h- 4: 4oG 4T 4{a 4n 4L{ 4e 4o 4k? 4( 4C 4 4%R 4 40` 4r> 4O. 4X< 4J 4X 4lf 4 pt 4u( 4 4 4e 4". 4 4n. 4 4  4& 4l/ 4< 4(I 4V 4pj 4+Fw 4@ 4: 4h 4 4 43 4? 4k? 4k 4 4E  4,N 4, 46 4C 4M 4Wk 4x 4C 4{ 4 4 4 4- 4B 4A 4f 4u  4aw 4e$ 41 4[ 4ng 4[F 4% 4@ 4 4J 4ƥ 4 4 4y 4@ 4* 4. 4`U 4?b 4fo 4e| 4& 4U 4 4 4G 4oM 47 4 45 4m- 4   4o 4& 4s4 4YAA 4xm 4 4~ 4 4a 4e 4 4 47 4q 4  45- 4: 4_G 4k?T 4-|a 4| 4e 4* 4z 4f 41c 4x 48  4B 4x' 44 4L 4M6Y 4-|l 4 4s 4: 4 4` 4s 4P 4 4{ 4) 4C# 40 4N= 4݆d 4[n 4p&{ 4N 4| 4H 4 4' 4ޛ 4k?$ 4I2 45? 4v6L 4Y 4g 4t 4P 4O 4A{ 4M 4N 43f 4y 4 45 4( 45 4iB 4OO 42J\ 4"i 45| 4? 4 4Z 4̰ 4 4Eq 4^ 4D+ 4CR 4 4ǣ 4D+ 4P8 4OE 4eR 4_ 4Hl 4gy 4 4< 4T4 4 4ya 4 A 4 4) 4N 4 451 4Qn= 4-S 4W` 4m 4 4 4 4 4 4 4 4~ 4^ 4' 44 47A 4N 4\ 4ˆl 4r 4,x 4F~ 448 4_, 4 4 4: 4 4[N 4( 4 4t 4t 4,v 46| 4L* 4&K 4-X 4[Ne 4Cr 4p 4 4 4- 4 4@g 44 4 4Y 46* 464 43A 4N 4<[[ 4*h 4P 4ׄ 4 4>O 4k? 4 4_ 4 4M 4 4 4,C 4& 4{3 4?M 4+Z 4)g 46t 4< 4 4- 4s 4p 4R 4 47 4/ 4 4< 4A 45( 4`T= 4J 4r 4~ 4{ 4= 4i 4 4z 4 4~w  4$, 4' 4d: 4LQ 4W;^ 4;l 4y 4Q 4 4d 4k? 4 4U 4  4@2-  49  4m_  4Hv  4  4  4z  4k  4k?  4  4=  4m#  4I1  4vP  4 Vi  4+w  4J  4,  48  4  4l  4O_  4ͮ  44  4J  4b  4#-  4B;  4uT  4֌b  4p  4Ѫ  4֮  4  4x  42  46  4'  4N  4[>  4N-  4e;  4I  4jW  4űe  4s  4^  4  4t2  4B  4r  4w  4O4  42B  4D  4\"  4M60  4f?  4M  4\  4NIj  4@x  4`>  4O  4dh  4;  4G  4   42 4 4k4 4H 4R 4H` 4sn 4/| 4Z 4 4 4 4P 4) 4h 4B 42 4  4f 4$ 4NA2 4o8U 4!kc 4_ 4M 4\ 4* 4 47 4.( 4Qo  4_ 4+) 487 4lS 4da 4o 4u} 4u 4߭ 4W3 4R 42 4 4 4S 4 4  4 4!& 4;M5 4D 4۳S 4m7b 4&Wq 4:_ 4 4m 4 4 4m 426 4 4Z' 4E 4% 4J4 4,C 47CR 4ja 4#p 4 4 4k? 4KL 4c 4U 42 4{ 4t 4 44 4>$ 43 4B 4YQ 47` 4o 4~ 4m 4u 4 4In 4 4P 4fW 4S 4gY* 48 4G 4 8^ 4d-r 4k? 4o 4 V 4Ȧ 4 47 4sG 4  4 4 4 4$ 4Y* 471 48 4? 4*F 4@N 4YKZ 4Kf 4r 4}~ 4X 4> 4X 4 4F~ 4f 4lu 4m 4z  4 4E& 4hc5 4D 4NS 4FIb 4q 4v 4*4 4P 4H^ 4sl 4Dz 4( 4 4  4N 4E 4 4]m 4h 4V. 4 < 4lJ 4-mX 4f 4wt 4_ 4 4k? 4 4 4 4X  4?' 45 4C 4x 4 4 4<[ 4 4+ 4 4 4k? 4w 4i 4{ 4l3 46A 4iO 4^] 4 4 4^ 4 4/ 4(c 4V 4-O 4c 4|J 4 4  4 4) 47 4dE 4US 4Eqa 40o 4} 40 4 4fd 4a 4x_ 45 4A 4 4 4JG  4f 47% 4{b3 4A 4Q 4X` 4do 4k?~ 4 4 44 4= 4 4 4 4Z 48) 4 4ƚ$ 4W3 4C 4+TR 4 40 4 4@ 4 4@  4 4b% 43 4"B 4N2P 4^ 4Թl 4Vz 4 4W 4=k 4> 4 4wz 4 4Id( 45 4B 4 qP 4d 4r 4s 4 4 4 4Eq 4* 4 4k 4 4*  4)  4%  4?  4)R  4f  4X  4~}  4#  4  4|?  4  4Qn  4~  4{  4U?! 4! 4k?+! 4^9! 4G! 4[U! 4c! 42q! 4u! 4c! 4Ex! 4! 4:;! 4$! 4t! 4! 4a" 4K" 4V " 4J/" 4z>" 4M" 4j\" 4k" 4Iz" 4" 4y" 4Ǝ" 4" 4)" 4j" 4AS" 4r" 4# 4e# 4 # 4iM# 4\# 4Fk# 45# 4TG# 4# 4q# 4# 4݇# 4# 4# 4# 4a0$ 4h$ 4$ 4)$ 4u[$ 4}$ 4L$ 4$ 4$ 4g$ 4$ 4s$ 4$ 4.$ 4L% 42% 4Tc% 4`,% 4ʏ9% 44F% 4S% 4-l`% 4m% 4о% 4p% 4S% 4% 4Ef% 4S% 4F% 4& 4& 4"& 4R/& 4_=& 4J& 4W& 4Nd& 4Qr& 4GE& 42& 4 B& 4$& 4& 44& 4^& 4Ԉ& 4T' 4)8' 4T8' 47F' 4*S' 4`' 4Sm' 4z' 4' 4' 4n' 4-' 4' 4B' 40' 4:}' 4X' 4' 48 ( 4( 4&( 4H3( 4@( 4oM( 4D[( 4Sh( 4Fu( 4( 4( 4F( 4e( 4( 4!( 4r( 4L( 4*( 47( 4D) 4Ň) 4 ) 4.) 4R<) 4ǤJ) 48sX) 4.f) 4\Dt) 4<) 4~) 4p) 46) 4) 4ӿ) 4 ) 4) 4>) 4ڗ* 4ZO* 4R* 4+* 4>t?* 4,I* 4KV* 4$d* 4hq* 4~* 4* 4* 4l* 4O* 4* 4RK* 4?* 4o* 43C+ 4O+ 4Zd+ 4Xp+ 4 + 4+ 4v+ 4P9+ 4k?+ 4w+ 4+ 4 , 4KV, 4N', 45, 4lC, 4*Q, 4+_, 4\ym, 4o{, 4, 42, 4$, 4, 4, 4, 4, 4{o, 4VF, 4- 4Y$- 43- 4B- 4(Q- 4h`- 4w}- 4- 4- 4lD- 4X|- 4G- 4`- 4Cp- 4a- 4 . 4j. 4". 41. 4Eq@. 4O. 49^. 4bm. 4. 4q. 4]. 4. 43. 4. 4U. 4r/ 4@2/ 4o / 4// 4>/ 4xM/ 4}\/ 4Ik/ 41z/ 4/ 4/ 4/ 4bv/ 4×/ 4ʼn0 40 4F)0 4{70 49D0 4<[Q0 4,^0 4y>k0 48y0 4"0 40 40 40 4c0 40 4W0 40 41 4qL!1 4E.1 4P|>1 4D1 4J1 4P1 4V1 4'\1 4l1 4Xz1 4d1 4V1 4*1 41 4y1 41 4V1 41 4t 2 42 4N&2 4z42 4B2 4`2 4l2 4Z2 42 4/2 4p2 4&2 42 4 s2 4x2 452 43 43 4_B'3 4<53 4vC3 4Q3 4(_3 4Cm3 4{3 4M3 4?3 4w53 443 4%3 43 43 43 44 44 4 4 4"4 4-O4 4\4 4mo4 4d}4 44 4E-4 4 4 44 4 4 44 4r4 4 4 44 4u5 4z 5 4r5 4'5 4w45 4vA5 4x:N5 4[5 4h5 4u5 45 45 45 4j5 45 4E5 495 4t5 4n5 4 6 4v6 4 #6 4Q16 44?6 4S6 46 4 L6 4Z6 4G6 44(6 4 6 47 4T7 47 4*7 4#V87 4S7 4|7 47 4n7 4M7 4G 8 4s'8 4'8 458 4C8 4Q8 4_8 4m8 4<{8 4I08 4[8 48 48 48 4k?8 4.8 48 4+8 4_9 4i9 4S29 4@9 48GO9 4]9 4k9 4-9 4n9 4?9 4wY9 4o9 49 49 49 4h9 4 : 4^: 4G%: 4v3: 4pA: 4jQO: 4]: 4k: 4~y: 4}: 4D: 4T: 4z; 4; 4k?; 4@; 4?-; 4Ob < 4I< 4%< 4=3< 4A< 49FO< 4< 4(P< 4w< 4< 4,< 4 I< 4< 4Ż< 45< 4 = 4= 4sV&= 4r4= 4B= 4&P= 4^= 4l= 4Pz= 4I= 4= 4L)= 4yh= 4= 4m= 4X= 47> 4E> 40> 4Pq.> 4<=> 4L> 4tm[> 4<j> 4>y> 4+> 4D> 4> 4*> 4C> 4=> 4> 4?> 4? 4B? 4e? 4-? 4z;? 4dq? 4? 42? 4? 4? 4I@ 4@ 4v.@ 4 A 4A 4_%A 4T2A 45?A 4' B 4SPB 4]B 4ivB 4QB 4B 4gB 4B 4VB 4%CB 4B 4Z C 4۾C 4~"C 4N/C 4mC 4{C 42C 4FC 4 C 4^lC 4iC 4T&C 4"hC 4C 4C 4,AD 4D 4#D 4N1D 4?D 4MD 4tb[D 4`iiD 44wD 4s*D 4=D 4OD 4KD 4D 41D 4D 4(D 46 E 4E 4˲%E 4ް2E 4?E 4.LE 4YE 4fE 4=tE 4xE 4aE 4E 40E 4ބE 4E 41E 4ME 4-E 4QF 4F 4F 4*F 4I8F 4XFF 4ETF 4cbF 4\pF 49+~F 46F 40F 4cF 4F 4QF 46WF 4GF 4xF 42F 4G 452G 4@G 4yOG 4]G 4>'kG 4?yG 4G 4G 4$G 4G 4"G 4oG 43G 4wG 4@ H 4<~"H 4t/H 4?H 4MH 4P[H 4[1iH 4 @H 4уH 4WH 4\VH 4H 4'fH 4rIH 4H 4H 4D I 4EI 4ν)I 4:7I 4cEI 4SI 4aI 4oI 41}I 4IFI 4I 4USI 4۴I 4dI 4AI 4-GI 4#I 4/I 4 CJ 4-J 4=,:J 4fGJ 4[TJ 4k?aJ 4*J 4J 4J 4DJ 4qJ 4J 4J 4/{J 4+ K 4K 4&K 4 3K 4x@K 4-MK 4WZK 4JgK 4tK 4mK 4K 4K 4K 4}K 4dK 4K 4EK 4'K 4OK 4( L 47$L 4Y2L 4?L 4LL 4YL 4XfL 4ʄsL 4L 4L 4L 4?L 4bL 4L 4r{L 4faL 4L 4M 4v#M 4U1M 4A?M 4H8SM 4GY]M 4ǂM 4VnM 4nM 4tM 4N 4BN 4 N 4+N 4N 4O 4؜qP 45P 4P 4?P 4mP 4<[P 4Q 4=Q 4XwQ 44Q 4^AQ 42NQ 4zQ 4"T 4bT 4jU 4-U 4EUU 42fU 4~FlU 4&rU 4(%V 4QV 4W 4HW 4lUW 4fbW 4)oW 4S|W 4!uW 4iyW 4M6W 4`W 47W 4JW 4rW 4NX 4A#X 4fH0X 4g=X 4bJX 4WX 47AdX 4qsqX 4~X 4 3X 4<X 4^X 4TyX 4X 4yX 4x/X 4pX 4BX 4 Y 4nY 4ސ%Y 4W`3Y 4TBY 4RY 4XY 4,^Y 4dY 4MjY 4"MqY 467~Y 4 Y 4bY 4Z 4i Z 4r3Z 4[bZ 4epZ 4~Z 4Z 49Z 4Z 4 \ 4`\ 4$\ 42\ 4%?\ 4L\ 4Y\ 4t\ 4p~\ 4\g\ 4\ 4d&\ 4<[\ 4n\ 4S\ 4f\ 4] 4k? ] 4,] 49] 4pZ] 4t] 4s] 4?] 4B] 4͜] 4s] 4,] 4o] 4`] 4] 4e] 4( ^ 4^ 42(^ 4;6^ 48D^ 4R^ 4k^ 4X^ 4^ 47^ 4^ 4^ 42^ 4^ 4^ 4ӭ^ 4m _ 4_ 4*&_ 44_ 4B_ 4|R_ 4Zb_ 4hr` 4~` 4}` 4` 4` 4gO` 4d` 4` 4Q` 4)` 4` 4ra 42A(a 45a 4fBa 4Ya 4Nea 4>Hra 43a 47a 4?a 4za 4Na 4(a 4a 4;a 4a 4a 4>c 4Lc 4e_Zc 4c 4!uc 4*c 4.c 4g 4Lg 4Mg 4%'g 4Sg 4Qg 4g 4>Xg 4ػh 4h 4ֵ h 4h 4 h 4~h 4~$h 4*h 41h 4?cBh 4Hh 4.Nh 4PuTh 4oZh 4C`h 4cfh 4lh 4?rh 4_xh 4**~h 4oh 4/h 4h 4%2h 4΢h 4Ch 4emh 4xh 4ah 4h 4lh 4{h 4h 4lAh 4ah 4ih 4^h 4h 4h 4h 4Uh 4dti 4Oi 4ͨi 4i 4Si 4 i 4:&i 4C,i 4)/2i 4{8i 4M>i 4Di 47Ji 4WPi 4Vi 4gN\i 46bi 4nhi 4zni 4gti 4Zzi 4]i 4Ki 4i 4i 4i 4i 4<i 4F>i 4i 4Yi 4i 4+j 4 kj 4!j 4#v/j 4=j 4H&Kj 4wlYj 4gj 4tuj 4M`j 4zj 49j 4j 4ҳj 4 j 4k?k 4k 4-.k 4Ȩ=k 4[}Lk 4<[Zk 4 hk 4#vk 4k?k 4k 4Jk 4k 4uk 4__k 4O/k 4k 4| l 4pl 4=(l 4I6l 4Dl 4sRl 4T`l 4Anl 4|l 4dl 4&l 4l 4Kl 4^l 4rXl 4Pl 4.l 4"m 4|~m 4 m 4M:m 4?Im 43_Wm 4,em 4 P~m 4Km 4vm 4nm 4Em 4m 4m 4_m 4D n 4Ņ%n 4{3n 4rAn 4iOn 4]n 4{*ln 4{n 4ϵn 4in 49n 4n 4n 4n 4k?n 4o 4o 4C o 4w-o 4&:o 4aXo 4fo 45o 43_o 4{0o 4Obo 4Ko 4vo 4<o 4<[p 4p 4!p 4_/p 4dDp 4GSp 4bp 49qp 4rop 4fp 4{p 4p 4^(p 46p 42p 4W q 4Pq 46m%q 4Yq 4k?gq 4Fq 4Cq 4>q 4Yq 4q 4{q 4 q 4Kq 4vr 4!r 4:r 4fSr 4k?or 4<~r 4rr 4r 4r 4r 4nr 4wir 4k?s 4ns 4E;s 4ŅTs 4ofcs 4rs 4ys 4s 4k?s 4ns 4Es 4Ņ t 4t 4i2)t 4G7t 4Dt 4^t 4Glt 4+t 4t 4k?t 4t 4gt 4nt 4Yu 4u 4k?;u 4Tu 4dmu 4{u 4k?u 4{u 4 u 4k?u 4k?u 4|u 4dv 4v 4e0v 4Ob>v 4eJLv 4W_v 4Kmv 4{v 4~v 4v 4v 4v 4Αv 4v 4 v 4|Ev 4zv 4w 4|Ew 4 O$w 47g2w 4+Aw 4Nw 4:xw 49w 4Eqw 4w 4Hw 4w 4VLw 4Hw 4x 4ƈx 4VL'x 43x 4?x 4Kx 4ubx 4ox 4|x 4+6x 4x 46x 4<[x 4[x 4x 4f y 4y 46"y 4_`>y 4AyLy 4[y 4Pgy 4sy 4'y 4y 4\9y 4IWy 4y 4 uy 4(dy 4y 4tfy 4 z 4Mz 4f@z 4 4M 4z\ 4+k 4Pz 4 4< 4V 4Xă 4Ӄ 4ѻ 4, 4H 4a 4Tb 4- 4X= 4M 4!] 4m 4݀} 4 4 4Z 4 4ʄ 4؄ 4N 4 4 4K 4 4_, 4ұ: 4 3H 4@aV 43bd 4K,r 4] 4: 4 4m 4! 4ƅ 4Gԅ 4 4Y 4 4L  4 D 4V 4\ 4b 49h 4*In 4Iu 4 4 4y& 4ܶ 4^ 4: 4T 4 4-|φ 4GJ݆ 4 4 4 4 4" 4A0 4? 4N 4wy] 4X.l 4{ 4 4H 4 4 4CƇ 4bԇ 4 4) 4E 4Ma  4; 4`:, 4͸< 4_L 4}\ 4ql 4.{ 4 4N 4 4 4C_ 4jψ 4Bu߈ 4_ 4 4M 4L 4/ 4? 4]O 4_ 4o 4v 4 44 4<| 4 4mlj 4Չ 4. 4V 4d 4` 4߮ 4es. 4eM 4uZ 4fs 4) 4 4 4݆ 4 4 4wΊ 4ۊ 4e 4c 4a 4M 4U 4ٷ) 4$=C 4nR 4g 4 4> 4dX 4>' 4͋ 4ۋ 42 4< 4֖4 4A 4fN 4v[ 4h 43u 4e 4 4j 4V9 4 4gÌ 4 CЌ 4L݌ 4 4 4K 4 4 4w7 4hc 4+p 4f 4U 4k 4% 4I 47ˍ 4&؍ 4V9 4 4g 4 C  4 4K& 4ѻ3 43L 4T 4 4fʎ 4׎ 43 4 4EB 4U  45 4f9% 42 4^? 4d{ 4̏ 4fُ 4ѻ 4j 4EB 4,$ 4I4 4: 4G@ 4:G 4TV 4/e 4u 4 4} 44 43ɐ 4/ؐ 44 4  4 4 4R 4E 4r 43 4% 4, 4=: 4&H 4@gV 4rd 4 s 4 4և 4{ 4Ý 4: 4h 4lő 4Bˑ 4ё 4ב 4ݑ 4 41 4Q 4N5 4} 4 4 4% 49, 4: 4UH 4SV 4d 4 48 4 4: 4ђ 4ے 43V 4Պ 4H 4nx 4r 4(; 4H 4tUb 4oo 4<[} 4} 40 4 r 4 4 4kJٓ 42 4 4  4vT 4B# 4V0 4<[G 4|T 4{ 4 4 4+Ӕ 4 4I  4l0 4 4^+ 4[C9 4k?G 4U 4@c 4Xq 4 4% 4m 4u 43T  4  4h# 40 4e 4r 4S 4v 4 4  4 4 4|͖ 4ږ 4/y 4} 4 4. 4, 4D9: 4yH 4$V 4+d 4r 4M@ 4 4Jg 4 4, 4i  4& 4Q3 4RA 4EN 4U?g 4Xt 4@ 4 4 4k? 4{ 4Θ 49ۘ 4J 4S 4[ 4ڍ 4F  4). 4< 475J 4MBX 4(f 4t 44 4T 4® 4? 4 E 4 ș 4;֙ 4 4 4U 4, 4 I 4, 4R< 4Y 4fg 4gu 4 4 4 4r 4 4 4o 4:D 48h 4Q 4v+ 4+9 4ASG 4jU 4c 4q 4 4vj 4 4 4+ 4Iƛ 4|f 4o 4n 4! 4/ 4SL 4V[ 4,j 4{sy 4k? 4{ 4f 4Μ 4fܜ 4z 4Sz 4k? 4! 4Eq/ 4M= 4sK 4,Y 4g 4u 4o 4` 4 4e 4cU 4mɝ 4;ם 48 4o 4,. 4|< 4I 4W 4<d 4Cq 4pB~ 4l 4ln 4) 4s 4M 4n̟ 4ڟ 4+ 4 4S. 4<; 4H 4U 4þb 4o 4| 4 4WQ 4N 4 4 4Ӎˠ 4S٠ 4| 4 4Ӎ 4 4h: 4M$ 4* 4R0 46 4< 4B 4x`H 4@mN 4U 4ao 4 4 4 4<> 4ġ 4ѡ 4jߡ 4J 4߯ 4< 43 42* 48 4_Q 4 `^ 4k 4ϩ~ 4ܑ 4T 4 4Lf 4)Ƣ 4Ң 4A 4 4, 4  4 4# 4&1 4v? 4XM 4[ 4Fi 4_w 4? 4 4# 4[o 4JC£ 41 4`n  4 45 4WE 4+K 4#{R 4Oa 4qn 4{ 41 4 4O> 40R 4ǁ 4ݤ 4 4ȳ 4 4*  4F- 4b: 4G 4T 4Ida 4y 4f 4VH 4 4?Qå 4iХ 4<ޥ 49T 47 4ש 4y 4  4. 4 ; 4J 4X 4g 4שq 4y 4 4 48ɦ 4ߦ 4* 4k 4 48 4xf 4 H 4l,ħ 4֧ 4U? 4$ 4s' 4):4 4A 4N 4pg[ 4n 4A{ 4Z 43@ 4 4; 4 4ɨ 4֨ 4:L 4 4o 4  4 4$ 4ѕ1 4M> 4K 44X 4ie 4r 4 4R 4 4 4/ 4 4sͩ 4ک 4Y 4J: 4 4W 4 4) 4&7 4,E 4S 4a 4Go 4} 4 4 4N 4Ԫ 4+ 4D 4  4F> 4( 4Y6 4D 4M`R 4+m 4j{ 4 4wl 4 4t 40qϫ 4fݫ 4 4X 4a 4' 4U* 48 4F 42T 4Db 4Bvp 4P} 4yî 4XѮ 41߮ 4 4 4`  4 42 4@ 4lSN 4ur\ 4rXj 4~x 4 4w 4s 4 4] 4.̯ 4گ 4J 4 4V< 4_ 4  4|. 4q< 4"J 4eX 4<f 4dt 4h 4F 4y 4 4_ 4Ȱ 4RVְ 4 4= 4 4 4C 4* 48 4+XG 4WV 4e 4 4 4 4. 4 4ϱ 4Jޱ 4+ 4 4 ?  4f 4P) 48 4W/G 4'e 4dt 4 4Z 4P 4& 4Ţ 4ݲ 4 4<ӳ 4e 4o 4 4Ŵ 4˴ 4UѴ 4״ 44ݴ 4 4@F 4l 4H 4 4J 43v  4 4c 4 4-% 41 4xK 4uX 4be 4&x 4, 4 4Z 4@õ 4ϵ 4T-ܵ 4Zt 4r 4? 4d1 4NT 4b 4p 4d~ 4 4d 4  4H 4tƶ 4s9̶ 4;Ҷ 4ݣض 4޶ 4v 4f 4 4 41 4D 4N 4K 4E 4+ 4l  4& 4e, 42 48 4> 4|D 4AJ 4Q 4 X 444_ 4of 4Hln 4'x 4m 4uȷ 4Ŗַ 4 4 ; 4 4˹ 4= 4* 48 4F 41U 4b_ 4j}m 4}{ 45Q 4 4 4.)ĸ 4gԸ 4>' 4f 4a  4 4T 4Nb 4,r 4 4? 4 4- 4f 4aݹ 45 43 4 4/H 4$ 42 4ӭ@ 4XN 4k?j 4Cx 4;: 4 4 4 4 4 4c 4m  4 4SZ 4Ҷh 4bv 4(j 4h 4 4ȯ» 4л 4E޻ 4 4 4r  4% 4&9 4U 4uo 4N 4_ 4Y 4Yټ 42 4N 4X 4M 4F 4- 4; 4#_I 4 4 4__ 4ǽ 4  4| 4Д( 4 ?5 4fX 4] 44k 4 4 4T 4/ 4 4>'˾ 4 4d 4 46 4* 4>'P 4d] 4j 4w 4Jq 49 4w 4̿ 4ܿ 4 4` 4j 4 4 4k? 49 4) 4\a6 4PC 4;Q 4] 4sk 4պy 4` 4s 4, 4Bl 4 4r 40 4 4 4 4M 4c! 4EB/ 4٘= 4UK 4Y 4Ĵr 4| 4Q 4 4rE 4 4 4 4 4 4H 4 4 4  4 & 4, 42 49 4E 4FQ 4] 4^j 4w 4? 4և 4Eq 4f 4{ 4 4i 46 4 4n  4l 4' 4^4 4SB 4-O 4\ 4mj 4T 4* 4 4+ 45 4Ø 4$> 4[ 4I 4  4* 4& 413 4v@ 4M 4ȟg 4t 4i 42 4b 4 4K 4L 4&< 4 4v 4B 4* 4. 4`M 4* 407 4D 4qQ 4<^ 4#k 4ׅx 4j 4 4; 4Uh 4 4G 4 4 4wd 4և 4ܡ 4+( 4)U8 4> 4E 4LHR 4_ 42l 4 Vy 4V 4 4T 4 4- 4 4R  4ΐ 4& 4IE 4] 4x 4k? 4! 4 4Y 48 4F 4 4- 4 4 4> 4*+ 4N 4cZ 4r 4 40 4K 4 4/R 4_ 4hl 4!+y 4 4= 4I 4f 4e 4?: 4?i 4=q 4(3y 4U 4 4 4G 42 4A 4-Y 4l; 4  4! 4) 4^D 4d 42n 4QW 4i 4 4:w 4V 4 41 4H 4Sh 43~ 43i 4? 6P 6F 4d 6 6w 6 6 6Ӫ 6ͪ 4[ 6 6 6  6 4" 6J& 6<+i@ 4K 6O 6T 4_ 6c 6mivi 6 6 6 6ii  j -#jEKjiVj 4fg 6ϫ 6ǫ 6 6 6 6  6, 6  6g! 6]6ShK 4V 6Z 6_ 4j 6n 6xSh 78 6 6 6Ȭ 6Ĭ 6 6Sh 78 6 6 6 6ah 7C 6. 6&h$hA 6NE 6LOhXhu 6Xy 6Vh2ihii:iLi6aiJ 4R0gs 6dw 6` 6x 6v 6 6mgg 4e 4 6 6 4h 6ح 6Э 4!+ 6 6& 6B* 6,> 4?I 6M 6V/f_ 7-o 6s 6y7fffffgg,g: 44iEc\ 4?g 6k 6p 4={ 6 6֮ 4f 6% 6 4h 6x 6p 4!+ 6 6 6 6 43 68 64 6Q 6K 6w 6s# 4mU5Kd>Kd[ 6_ 6iadr 7 6 6 7 6 6fd)e 7" 6 6 7" 6 61e Cd#d;d^dvDemee 4@_ 6Ѱ 6Ű  4? 6 6 4jV) 6N- 6B< 6@ 6{O 6бS 6ʱc 6g 6u 6y 6 6G 6= 4mU__ 6s 6q___ 4<= 4?J 4jVc 40p 4} 4 41 4mU 4PY[ 6 6{ 6ʲ 6IJ 4)  4` 6 6 4{' 6+ 60 4D@: 6 > 6C 7{W 6[ 6j 61n 6/xw\w\ 6= 69 6R 6N 6e 6c 6t 6r 6 6~\ 7p 4 6 6  4C? 6³ 6"[+[H 6L 6U 6Y 6b 6f 6o 6s 6| 6' 6%[[[ 63 61[\\& 4>1]Q 6CU 6;[ 4)k 4u 6my 6c~ 4/} 6 6 4. 6 6ִ 4I 6 6  4[ 66 64 4 6F 6> 6g 6e 7 6s 6o 6 6 ^4 4> 6B 6G 4Q 6U 6Z 4mTd 6յh 6ϵm 4sw 6{ 6 4Z 6 6^ 4B 4 4~ 4`P 4 4!^ ^# 67' 650 6A4 6?= 6AA 6?J 6AN 6?W 6A[ 6?d 6Mh 6Ko^ 7 4 6\ 6V 4 6 6 4mT 6 6 4s 6Զ 6ζ 4Z 6 6^ 4B 4# 4~/ 4`PA 4N 4!`^i^ 6 6 6& 6$ 6& 6$ 6& 6$ 6& 6$ 62 60] 7 6? 6; 6T 6P 7  6k 6e]-]6]R 6V 6_ 6c 6n]w 7 6 6]] 6 6 6˷ 6ɷ]J^$_ 4ܨ 0Z@ 6ݷD 6շS 6W 6\ 4`f 6#j 6!o 4{y 61} 6+ 6L 6H 6_ 6[ 7U 4 6t 6n 41? 6 6 7` 4 6 6 4 6ȸ 6Ƹ 4mT 6Ը 6Ҹ 4s# 6' 6޸, 4Z6 6: 6?ZT 4Be 4q 4~} 4`P 4 4!ZZ 6 6 6 6 6 6 6 6 6 6 6 6 Z4Z=ZY 6] 6cZ~ 4ae 4@ 6' 6! 4W 6D 6@ 4? 6^ 6V 4f 6 6~ 4h 6 6 4? 6Թ  6ιe  4)*ZA 4K 6O 6UZi 4 sY 4 4Pa 4? 6 6 6/ 6' 6a 6[  6| 6x 6  6/ 63 69 4@bN 4mU[ 7d 4n 6 r 6w 4 67 61b 7 6P 6N 6[ 6Y 6j 6f 6 6 6 6 7 6 6b 7 6 6 6߻ 6ݻ$bAaJaf 6j 6s 6w 6aa 6 6 6 6 aa 6 6 6% 6#aa 61" 6/+ 6=/ 6;8 6J< 6HEaNafaxaa 6V 6T 6b 6`aa 6n 6l 6z 6xa a2a;aW 6[ 6d 6h 6qaza 6 6 6 6aa 6 6 6 6b 7 6˼ 6ɼ 6׼ 6ռb&bC 6G 6P 6T 6]bfb~ 6 6 6 6bb 6 6 6 6-bfb 7  6+ 6) 7 65  63+b4bP 6?T 6=^0cg0c 6I 6GEcEc 6S 6Q\c\c 6_ 6] 6j 6h\c \c$ 6v( 6t1 65 6<fbZbw'c=cVcc c cc/ 4RK 4W 4@d 4q  4 4@ 4 4@ 4 4 4? 4mU 4x0 4.S 4Ke 4?r 4k? 4 4? 4k? 4+~ 4Ā 4? 4k? 4= 4{ 4?  4mF. 48 4NJ 4k?W 4e 4W,w 4 4( 4I 4w 4I 4 4G  4? 4b% 4-7 4E 4S 4T7a 4go 4 47 4P 4+9 4v 4 4 h 4 4 4 4 4  4Aj/ 4> 4I 4!;V 4zf 4?s 4b 4- 4) 4 | 4C 4)1 4 4B1 42 4- 4F 4_" 4(31 4< 4L 4b3Z 4h 4v 4 4 4  4$ 4= 4V 4o 4 4b 44  4a. 4a< 4J 4Y 4Վh 41dw 4R6 4Nd 46 4l; 4f 4b 4Z 4i 4 4& 41 4< 4G 4R 4^ 4j 4v 4e4 4}4 4a 4vn 4 4ђ 4 43 4_ 43 4+ 438 4O 43\ 4-w 43 4~ 43 4k/ 43 43 4 43 4μ+ 438 46qO 43\ 4Ers 43 4)s 43 4[P 4B 4? 4  4? 46+ 4?8 4)tU 4۽r 4 4  4` 4? 4d 4t 4? 4Y 4?0`. 62 6; 6? 6H 6+L 6U 6Y 6{b 6f 6o 6ݾs 6׾| 6 6 6V 6L 6 6c` 7 6 6 7 6 6`` 6 6``7 6; 6A`N`q` 4} 4} 4D 4e 4G 4E 4+J 4nH 1>J 4- 5G 5G 7 2 4; 4QL 4R  4*c+ 40 4d> 41H 4V 4[ 4ei 4bn 4 4f 4 4  4)i 4C% 4'+ 4D= 4_K 4ėP 4c\ 4h 4Bat 4^H 4[x 4ړ 4'I 4@ 4 4 4i 4A] 4ܞ 44` 4Sa 4b  4'R 4}# 45/ 4p; 4?G 4ԃS 4 f 4 k 4w 4 4x 4ew 4  4Ś 4q 4 4Ö 4 4 4" 4= 4V! 4~/ 4D 4~R 4@^ 4_:k 4nx 4 4Y1 4z 4  4n 4w 4 4n 4: 4!R 45na 4Oo 4z} 43P 4 4ߗ 4 4% 4Œ 4 4# 4 4n  4 4% 4s3 4]A 4=O 4L)] 4 4Np 4I 4 4h 4  4J 4lh 4I 4 4F. 4A= 4#QL 4 [ 4fj 4%y 4? 4Q 4  4e 4: 4  4" 4?7 4â 4 4  4 - 4< 4[K 4F1Z 4Gmi 4Xpx 4T 4g 4) 4Y 4 4ӕ 4' 4H, 4 4kx 4Z, 4; 4D6J 4 Y 4h 4"w 4 4 4Qi 4 4!! 4B 4=l 4 4 4 4h=& 46 4}F 4V 4<f 4 v 4" 4 4 4rp 4i: 4R 4  4N 4km 4g 4q, 4f; 4hJ 4lwY 4Dh 4w 4m 4  4 4^ 4R 4" 4HB 4o> 4i 4   4Z 4~&+ 4: 4jI 4.X 4pqg 4v 4}b 4  4a 4&$ 4L} 4G 4 4 4$ 4  4E* 46 9 4 H 4%|W 4,f 4,u 4!J 4q 4y 4~ 42 415 4r# 4 4 468 43 4|) 48 4G 4ZV 4le 4t 4 4\* 4&# 4:&0 4gT 44` 42l 4T%y 4 4U 4 4V 4  4_ 4_5 4Y 4Af  4 4p' 4e5 4pEC 4Q 4n_ 4[m 4{ 4{ 4V 4= 4 4.@ 4/c 4b 4@ 4 4   4Y 4m% 4h3 4:{A 4lO 4.1] 4kLk 4˖y 4-# 4\ 4O 46l 4v 4; 4b 4&v 4e  4 4q* 4L`9 44X 4Og 4Mv 48 4_ 4e| 4 41  4! 4 4"R 45X 4~  4M# 4Z * 4/69 4H 4:W 4TCf 4gu 4> 4[ 4 4| 4% 4  4{ 4: 4s 49  4+ 4k) 48 4%G 42V 4Ce 4t 4a 4x 4 4  4T` 4m] 4kO 4 4 44 4y 4n* 4+$7 4CBD 4td 4n 4sG{ 4p 4ki 4` 4b 4GD 4~ 4r 4  44 4,) 4W6 4+C 4OP 4O^ 44 4+ 4O 4~ 4ˊ 4CA 42# 4Of4 4aW 4ic 4'q 4' 4k  4e 4m 4e~ 4) 4 4$ 4lk7 4>}F 4{ 4f 4G 4S 4@o 4 { 4v 48 4 4y 4K 4͚# 43 4A 4O 4B] 4f 4M 4J 4eC 4~U 4 4C 4( 4R $ 4\2 4`=@ 4*QO 4v] 4Kk 47y 47 4m^ 4uK 4Z 4 4| 4 4| 4  4~ 4B) 4mW 4:k 4n 4p 48 4 4r 4* 4xq 4\ 4v 4#A 4Q# 4#f/ 4< 4 dI 4NtV 4_Oc 4(p 4[4} 4 4! 45L! 47Z! 4,h! 4v! 4(9! 4v! 4H! 4̠! 4i! 4}}! 4+! 4!L! 4 d! 4>I" 4U" 4 " 4C," 4Y:" 4IH" 4V" 4Td" 4tFr" 4N" 4w" 4o" 4]?" 4B2" 4" 4F" 4" 4" 4# 4K&# 4P# 49# 4/B## 4p)# 4/# 4e5# 41;# 4A# 4|G# 4% 4n&U% 4Db% 4o% 4H{|% 4?% 4U% 4Q9% 4]% 4m% 4% 4rp% 4& 4Yl!& 4 -& 4eY:& 4{U& 4& 4:& 4q& 4I& 44& 4_' 4' 4;xC' 4p' 4:}' 4VJD( 4zSc( 4( 4 i( 4( 4 ( 4) 4?b%) 4) 43) 4) 43* 4@* 4&TM* 4?bZ* 4pg* 4fy* 4IS+ 4?b+ 4Z+ 4,+ 4VQ9+ 4OR+ 4>4_+ 4T3l+ 4+ 4=+ 4bh+ 4=+ 4T+ 4+ 4 + 4, 4(%, 45, 4rB, 4EP, 4], 4Jk, 4`, 4, 4_, 4^, 4bh, 4=5, 4f, 4, 4+- 4kp- 4 /- 4wL=- 4IK- 4*}Y- 4y- 4u- 41- 4- 4$- 4 C- 4D- 4- 4L- 4)- 4_?. 4D. 4KN. 4O[. 4h. 4u. 4. 4F. 4z. 4j9. 4n. 4Z. 4t. 4'. 43A/ 4A|N/ 4Cb/ 4$w/ 4Q/ 4&/ 4u/ 4t</ 4^/ 4X/ 4L/ 4/ 4;F/ 4/ 4yX 0 490 4%0 4920 4D?0 4c6L0 4e!Y0 4f0 4?rs0 4w0 4/^0 450 41Q0 40 4џ0 40 4\0 4P1 4$1 4 d)1 4I71 4OC1 4P1 4L]1 4zk1 4@x1 4n1 4w1 4L81 4m1 4e1 41 4*1 4k1 4\2 4~2 46M2 4 +2 4'92 4.E2 4LER2 4 `2 4#l2 4ly2 4 2 4$(2 4 2 4 d2 4c2 4 d2 4-2 483 4@C3 4FH3 4U3 4._h3 4Y3 4#3 4Od3 4 M3 43 43 4 X3 4 3 4 3 4+4 4G4 4mD 4 4 -4 4j*:4 4EG4 4GT4 4ya4 4n4 4g4 44 4v4 44 4p{4 4av4 4tC4 4~Z4 4+ 5 4SU5 4w%5 4#35 4GA5 4~*O5 4)J]5 4q5 4Z5 4i@5 4_5 4y5 4ۖ5 4915 4n5 4 5 45 4fD5 4W 6 4i6 4E'6 4~^56 4AC6 4Q6 4`_6 4o|m6 4 {6 4\6 4B(6 4v6 446 4n6 4]6 46 4>6 4F>7 4?g7 4D$7 4l37 4iB7 4X7 4Njg7 4w7 4u7 4L7 4c7 4 7 4J7 4i7 4Ӏ7 498 4.o8 4+"8 4~,/8 4*h<8 4!I8 4V8 4(c8 4vp8 4Q}8 4N8 438 48 4[8 4zl8 4&8 4d8 478 4t9 49 4} 9 4.9 4<9 4(J9 4jX9 4ځf9 4Gt9 4{N9 4m9 4$9 4>9 4 59 4o9 49 4>9 49 4b: 4d1: 4M: 4 }*: 4f8: 4]PF: 4lU: 4yd: 4 s: 4Go: 4l: 4-: 4]: 4k: 4&: 4 ": 4<: 4G: 4~ ; 4j; 4x(; 4D7; 4ӒF; 42U; 4d; 4s; 4<; 4s; 4?; 4); 45; 4; 4$1; 4~; 4!  < 4< 4r(< 4s7< 4pG< 4̔V< 4:e< 4hrz< 4JQ< 4?J< 4y]f= 4D s= 4o= 4E3= 4u= 4]\= 4 6= 4 X*> 4U6> 4(C> 4?P> 4U^> 4n> 4Gt> 4:'z> 4> 4(> 4\> 4C> 4#> 4E4> 4`> 4> 4)> 4VM> 4]> 4> 4+"? 40,? 4J!? 4d^.? 4A? 4xN? 40,\? 4 i? 4xv? 4C? 4S? 4U=? 4n&? 4`? 4x? 4<? 4'D? 4? 4k? 4U=@ 4 @ 4@ 4)'@ 44@ 4_A@ 4N@ 4Su@ 4?@@ 4@ 4@ 4@ 4cN@ 4@ 4@ 4T@ 4@ 4\ A 4n&A 4$A 4GA 4|TA 4aA 42nA 4v|A 4"A 4JA 4e{A 4ݤA 4m A 48A 4IA 4SA 4dB 4B 4a"B 4-/B 4qB 4HN}B 4%qB 4fB 4LB 4IB 4B 4B 4FvB 454B 4'B 40bC 4:#C 4 0C 4=C 4TC 4'aC 40bnC 4C 4'C 40bC 4C 4C 4C 4&5C 4C 4bD 4_'D 4(%D 4'2D 4[?D 4„VD 4}xbD 4WnD 4>zD 4RD 4gD 4ՔD 4`QD 48D 4CD 4wE 4E 4E 46E 4]TBE 4PNE 4ZE 4&pE 4Z}E 4 E 4E 43E 4+E 4,E 4UE 4vfE 4 E 4,E 4NBF 47F 4F 4+F 4A9F 4WSF 41m`F 4!mF 4TF 4oF 4 F 4MF 4;LF 4)F 4TF 4_F 4F 4OF 4 G 4G 4'G 4'a4G 4>AG 4pNG 4p[G 4:hG 4ELuG 4ǙG 4"lG 4=G 47G 4G 4PPG 4eG 4 G 4}bG 4Jf H 4eH 4^&H 43H 4=@H 4yMH 49ZH 4gH 4, tH 4 9H 4H 4H 4o>H 4RI 4"I 4 dI 4#.I 44I 4hG:I 4@I 4FI 4 MI 4i[I 4 iI 4QwI 4I 4RI 4"I 4HBI 4ӕI 4I 4iRI 4I 4zJ 4J 4{i!J 450J 4Uq>J 4/-LJ 4fWZJ 4ahJ 4evJ 407J 4bJ 4kJ 4IJ 4UJ 4pIJ 4&FJ 4]J 4eJ 4&6K 4K 4i K 4.K 4;qW 4ZW 4~&W 4bW 4 W 4.W 4pqW 4W 4hW 4*W 4k"W 4C` X 4xWX 4i'X 4Q5X 4WCX 4BQX 4_X 4%mX 4{X 4`X 4iX 4~X 4 X 45X 4X 4&uX 4>X 4X 4 Y 4-Y 4H%Y 4̓8Y 4BY 4LY 4P!ZY 4IhY 4m|Y 4= Y 4=YY 4w Y 4rY 4ZY 4ZNY 4Q-Y 4G(Y 4<Z 4 Z 4;Z 4D$Z 41Z 4J>Z 4 dKZ 4XZ 43eZ 4RxrZ 4IZ 4`Z 4YZ 4@-Z 4:Z 4 Z 4Z 4EZ 4-a[ 4 [ 4&G[ 43[ 41=[ 44ZW[ 4$-a[ 4Pk[ 4z x[ 47u[ 4>[ 4I[ 47[ 4G[ 4 z[ 4[ 49D[ 4T[ 4![ 4|\ 4q\ 4"\ 40\ 4>\ 4dZ\ 4!&h\ 4dv\ 462\ 4\ 42\ 4+\ 4kX\ 4V\ 4M:\ 4L<\ 4{] 4U] 4O] 45+] 4 9] 4}QU] 4, p] 4v~] 4K] 4O] 4w] 4I] 4] 4J] 4;<] 4S] 4I^ 4Y^ 47#^ 4u0^ 4n=^ 4gJ^ 4_W^ 4d^ 4z9q^ 4f~^ 4|^ 4"^ 47}^ 4^ 4%^ 4Ǟ^ 4\*^ 4G^ 4_ 4j_ 4]_ 4wk)_ 4ڇ6_ 4C_ 4 R_ 4__ 4Yy_ 4U_ 4A_ 4_ 4_ 4B_ 4<;_ 4_ 4_r ` 4@` 4!t)` 4$ 5` 4 A:` 4a 4D"Ka 4whXa 4ea 4$ra 4P a 4Ga 4<a 4 da 4?a 4Ta 4a 4Wa 4Da 4b 4=b 4ub 4}+b 4x8b 4/nEb 4Rb 4D_b 41yb 4|b 4 b 4Cb 4Yb 44b 4Bb 4 c 4Dc 40c 4 ?f 4ܝKf 4Xf 4D$ef 4F rf 4)^f 4][f 45f 4f 4,f 4!hf 4ݙf 4U=f 41g 4-  g 4,&g 4 d'g 4_4g 4wAg 4jcNg 4D$[g 4hg 4Gug 4/g 47g 4Ong 4,g 4kg 4{g 42g 4g 41jg 43 g 4Jfh 4f1h 4Gh 4:Sh 4o ih 43*vh 4 uh 4מh 4xh 4 uh 4Pvh 4 uh 4wh 4ڋh 4Xi 4.i 4=i 46Ji 4LWi 4Ndi 4{\ri 4Ki 4ii 4 i 4Ci 4i 4 i 46i 4xi 4'gi 4i 4&#i 4i 4i 4?i 4? j 4@j 4D2j 4!@j 4Scj 4 pj 4&#}j 4j 4j 4j 4j 4Vj 4nj 46j 4j 4xt&k 4+3k 48|Ak 48|Kk 4Xk 4 dek 4-rk 4 k 4Pk 4Jk 4-k 4#k 4k 4 dk 41k 4ߊk 4| l 4pl 4c&l 4=0l 4ߊ=l 4jJl 4_dl 4;`ql 4M ~l 4/l 4L`l 4l 4 l 4vl 4 =l 4&l 4el 40l 4wvm 4c m 4mm 4'm 4:?m 4'Tm 4nyam 4m 4nm 4Dm 4m 4pm 4^m 4џm 4]n 4A#n 4 0n 4>n 44Qn 4“hn 4Jun 4n 4PIn 4%n 41n 44n 4n 4QZn 4n 4-o 4Co 4OOo 4SVuo 4Vo 4nyo 4o 4џo 4u9o 4 p 4^p 4+p 4SV9p 4Gp 4lkep 4)~p 4p 4y p 4p 4kp 4}p 4:p 41p 4f q 4q 4 %q 433q 4Aq 4Oq 4@hq 4Ovq 4xjq 4@dq 4fq 4݂q 4Ҥq 4q 4)r 4r 4#$r 42r 4C#@r 4|Nr 4\r 4jr 4hxr 4Hr 4"ir 4_r 4r 4r 4ar 4Br 4fr 4|s 48N"s 4,0s 4>s 4YMs 4[s 4 djs 4xs 4xs 4s 4#s 4]7s 4Ts 4js 4zs 4t 4"{t 48Ct 4tmWt 4Kat 4ot 4̠}t 4W[t 4 -t 4&t 4^t 4jt 4A%t 4) t 47t 4Kt 4 u 4bu 4Y%u 4[3u 4Au 4Odu 4 9ru 4u 4s"u 4u 4 u 4u 4v 4@v 4;v 41+v 4r 9v 4Gv 4”cv 44qv 4}v 4@v 4Hbv 4fv 4v 4&v 4v 4v 4Pv 4rv 4n w 4w 4EY'w 46w 4"Ew 4Tw 4njcw 4rw 4)w 41w 4Ow 4:w 4qw 4Rw 4:w 4w 4Hw 4x 4&x 4"5x 4Dx 4 Sx 4Hbx 48qx 4S]x 4۔x 4x 4x 4!x 4x 4x 4zx 4Dx 4?y 4iy 4v%y 494y 4GlCy 4URy 4+ay 4py 4Hy 4y 43y 4@y 4Vy 4:y 4uPy 4W^ z 4*z 4k',z 4Cz 45Wz 4z 4<z 4)z 4DZz 4 z 4z 4Fz 4lz 4uz 4yz 4^{ 4_Z { 4 ,{ 4{{ 4 { 4${ 4 +{ 4،3{ 4!?{ 4oK{ 4oW{ 4)Wc{ 4wp{ 4R}{ 4C{ 4SW{ 44{ 4[{ 4G{ 4)={ 4{ 4aM{ 4{ 4>[ | 4| 4v+| 4U=8| 4 E| 4QeR| 49l| 4bdy| 4 | 4 | 4 d| 46$| 4 | 4?6/} 4k;} 4+K} 4EQ} 4xW} 4^} 4h} 4 u} 4:} 4F} 4j} 4'} 4Q\} 4ee} 4} 4_} 4y} 4u~ 42f~ 4ߗ)~ 4'@~ 4M~ 4 t~ 4r~ 4F~ 44~ 4]V~ 4~ 4O~ 4~ 4O~ 4j  4tD 4ݢQ 4?8k 4[f 4Y 4v 4E8 4 4F 4v 44 4]V 4 4, 4P: 4 cS 4Gf 4ύp 4 4r 4= 4a 4]L 4^J 4n\ڀ 4 4  4 4Ԋ 4ߗ 4@N 4as 4Du 4 d 4F 46 4+Á 4>с 4hV߁ 4  4! 4 4"4 4" 4Q/ 4O< 44rI 49V 4Uc 4q 4 4' 4gɂ 45ւ 4V' 4) 4G 4ab 4X 4n&% 413 4N@ 4RM 4"Z 4Mh 4u 4J 4S 4t 4n 4` 4Xʃ 4M׃ 4( 4 4X. 48 4iB 4v&O 4t] 47j 4bw 4Ԣ 4K 4Uu 4$ 4DŽ 4 Ԅ 43 4%< 4a; 4JG 4\ 4bh 4_} 4x 4LA 4ȅ 4օ 4A 4 4H 4X) 4W 4Vd+ 4.:9 4wG 4m U 4-Cc 4;q 4J 4; 4S 4Za 4 4Xņ 4w_ӆ 4; 4 4Zz 4+ 4) 4Y8 4G 4rV 4pQs 4x 4] 4 4D 4RO 4͇ 4b<܇ 4Rx 4* 48 4u 4n' 4U=6 4mE 4;T 4qc 4TH 4= 4r 4a 4. 4jˈ 4(ڈ 4f 4 4p; 4]o% 44 4BC 4R 4 ya 4Ʉp 4 4 4]\ 4A݉ 4oW 4M 4\ 4 4j- 4: 4-G 4}}T 4a 4|o 4ͅ 4 kÊ 4Dӊ 4Syي 4Cyߊ 4~ 4 4 4ڜ 4m] 44 4)( 4l5 4_qB 4zCe 4}o 4 4d 4 4\ 4# 4џɋ 4׋ 4p 4dm 4Г 4щ# 4 0 4= 4J 4uxc 4>p 4m~ 4S 4{ 4 4 4Θʌ 4A، 4 4M 4. 4}c 4 4, 4: 4WH 4?kV 4g\e 4̜ 4 4Z 4'Y 4 43h 4.  4zs 4g 44 4S 4< , 4o9 4aF 4lS 4wg` 4VSm 4cz 4} 4ƈ 4D 4> 4 4AɎ 4A֎ 4 4F 4Ɛ 4  4J] 4n& 4V4 48B 4eP 4ud 4Qr 4]u 4W 4" 4@ 4*k 4sƏ 4ԏ 4&3 4^A 4Y!O 4,] 4qk 4Fy 4An 4/ 4h 4[ 4 40)͐ 4&Z 4;Eh 4ޕv 4`; 4" 4 4 4Y 4tʑ 4%ؑ 4{[ 4 4X 4 4t  4Y, 4M: 4JI 4kW 4e 4 s 45 4m 4b 4L 4'ǒ 4,Ւ 4q 4U 4v 4^ 4- 4; 4+I 4+<W 4ye 4Ps 4^ 4s 4(L 4W 4 4wAȓ 4Hq֓ 4% 4 43 4Q 4] 4o* 48 4 4[W 4+ 49 46 G 4T3 4 4X 4nȕ 4݂֕ 4a 4`|! 4h$/ 4%B= 4K 4eIY 4O4g 4eu 4o 4^ 4 4T{ 4m) 4ɖ 4+ז 4R 4!O 4` 4 % 4  4h+ 49 4r7f 4IЗ 4BHޗ 4 4^ 4f} 4N# 4`1 44 ? 49, 4ȉ9 4+eF 4nS 4O` 4 * 4'q 4yo~ 4X 4% 4F 47ɚ 4 4) 46 4 4g+ 4q5 4F? 4GN 4 K\ 4'j 4x 4R 4: 4y 4 4)7 4~̛ 4qڛ 4 4I 4  4;# 4˕ 4. 4y3< 47J 4HX 4 f 4?t 4# 4C! 4< 4  4K 4͗˜ 4&՜ 4)ߜ 4 4B 4 4 d! 4= 4[|K 4|Z 4rh 4{v 4_ 4x 4N 4Q 4lǝ 4ԝ 4yn 4 4Uo 4 41F, 4G|9 4*H 4V 4$d 45r 4 4I 4P* 4_)ž 4О 45ޞ 4 4s 4M 4֘ 4G$ 4p2 4.N@ 4N 4Bt\ 4j 4x 41 4y 47R 40' 4 k 4v4̟ 4ڟ 4 4S 4b 4%' 46 4 O 46^ 4|h 4E| 4h 4Ν 4 4?D 4m 4%zˠ 4tؠ 4 4H 4t  4(* 4  4S& 4:3 4RK@ 4}M 4KJZ 4bEg 44t 4j 4# 4 4# 4$ 4;ơ 4+С 4I 4:9 4;G 4?d 4y 4 45[ 4]  4Sc 45 4Z 4r& 4 4y` 43 4: 4q 4s$ 4q5 4; 4;A 4) 4L%˪ 42sժ 4W 4X$ 4Y1 4\> 4NK 4:@X 4:Cq 4~ 4$2 4 4  4|> 4G 4W 4  4ʟ 43 4Z& 43 4>@ 4KM 4na 4n 4g{ 4%C 4n 4C 4  4< 4ʬ 4ج 4y 4R 4S2 4DV 4x! 45' 4k- 4G3 42q9 4!@ 4cM 4NZ 4zg 4έ 4Hۭ 4} 4eY0 4> 4+mL 4jZ 4x 4c 4n_د 4x 4u^ 4 4 4Q 4km' 4eeB 41TL 46Y 4 4hN 4gT 4hJZ 4wa 4#n 44{ 4Q 4% 4 4 4 4 4u 4Y 4% 4h#1 4> 4L 4Z 4_h 4џv 4C# 4 4H 4 4`U 4sʵ 4H 4 41& 45{ 4:@ 4  4jU 4+ 4i2· 4KϷ 4}}ܷ 4 4 4{V 4s 4tD 45 4W 4a} 4p ָ 4M 4# 4v0 4Y= 48 4 4<ȹ 4+ֹ 4N 48t 44 4#( 4p,6 4D 4eR 4X` 4yo 4tU~ 4ц 4 4 4Ccɺ 4Tغ 4 4k3 4 4; 4=# 4ۣ2 4[mA 4e P 4%_ 4<n 4 4J 4r* 4Wt 4oǻ 4}}ֻ 4z 4ğ 4Y3 4 4H" 4G2 4,xB 4]R 4Gb 4Xr 4eS 4=G 4& 4ż 4!Ҽ 4&߼ 4 4M 4! 4 4l+ 4aM7 4@N 4L[ 4h 4u 4d 4@~ 4-½ 4a-ݽ 4X 45 4M 4 4[2 4C( 4n7 4YC 4{O 4[ 4\g 4t 4) 4ٟ 4%@ 44 4w 46þ 4N 4~" 4Y 4 C) 416 4 4y 4ޛ 4Ϳ 4R 4Û 44+ 48 4U=X 4e 4gr 4eO 4C 4 4-E 4~ 4tO 4+ 4 4Y 4b" 4@9/ 4< 41I 45V 4c 4p 44 46z 4[ 4H 4&% 4X&, 4BH 4U=X 4Vf 4)t 4) 4d 4_ 4, 4s 4 4o 4 4>3 4 = 4\V 4׆e 4" 4=s 4+{ 4dj 4 d 4  4 4"3 4bg 4G 44, 4`|D 4N6P 4m}] 4j 4.zw 4o4 4s8 4  4n 4 4y 4K 4 4_ 4 4% 4NT2 4? 4PL 4PY 4f 4s 4t 4- 4V 40G 4^ 4`# 4S 44 45! 4G[ 4t] 4h 4Y+ 429 483G 4 U 4Jc 4x+q 4A 4 4 ) 4 4F 4 4 4i 4! 4q' 49 4^? 4}E 4!oK 4Q 4X 4gi 4o 4u 4jl{ 4T 4tr 4 4 d 4D 4[  4O 4.S 4 4  4K 4 P 4-|! 4[0 4HC? 4 N 4;O] 4l 4{ 4 4S 4h 43 4 d 4\ 4 42 4c 4w 4m 4{. 4> 4=N 4bn] 4,k 4Jfy 46] 4&M 41 48 4[@ 4h 4k 4" 4Z 4T 4)! 4e1 4LA 4|Q 40Aa 4q 4| 4D 4 4: 42 4@  4{) 43g 4[ 4f 4> 4/ 4_< 4YU 4\b 4 do 4&M| 4K 4, 4~ 4B 4G 4*H 4 4A 4́ 4 4m 4% 44 4VI 4fm 4w 4* 4{ 47I 4z 4 4BQ 4V 4Q# 4Y0 4= 4FJ 4W 4d 4xq 48~ 4d 4Q 4~G 4% 4! 4G 44 45! 4s 4$ 4W 4z7E 4aR 4Yl 4y 49 4 o 4T 4 4 4d 4Q 4~G 4% 44 45! 4o 4. 4' 4Wt 4Y 4/ 4 4 4 4l 4K 4ze 4Yb 4s! 4tD 4dq 4Y 4o 48 4 4}} 4T 4a 4" 4S) 4(8 4 G 4zW 4u 4E 4} 4 4RG 4: 4 4s 4Zs 4& 4 4P> 4b 4ia 4S 4;w 4+, 46: 4gH 4W 4,e 4VLs 4j 4[ 4 4| 49: 4X 4 4%d 4D 4Ѡ 4 4k% 4 4E 4od 4) 4s 4% 4 4T(, 4: 4]H 4we 4gy 4( 4 4j` 4n 4@) 4N 4z 4XB 45e 4H 4lg 4( 46 4D 4G[R 4t]k 42x 4vV 4c 4S 48( 4i 46 4 4I 4 4t 4 N 4u! 4]e/ 4M= 4(K 4AY 4$+g 4ĝu 40 4=\ 4 48 4u 4; 4[ 4N 4 4/K 4{= 44J 4=HW 4d 4Z=q 4~ 4QN 4T 4Z 46p 42 4 4h 4 4 4 4 4fT# 4[$0 4%_> 4oSJ 4=?X 4nf 4t2t 4̠ 4}} 41 4v 4 4j 4:f 4 4z 4" 4b4 4 4l 4*yz 4K 4t 4\ 4$ 4 4P  4)8 4& 4 4it 4U 4z" 40 45k? 4Eo 42} 4+ 4< 4p[ 4p 4x 4Y 4D 48, 4r 4-~ 4P 4TH 4n 4* 4t4 4xB 4IP 4m_ 4 p 4mv 4U| 4k$ 4n 44 4~@ 43M 4Z 4g 4yJt 4N7 4Y 4$' 4\I 48 4 4|= 4, 4. 4r 4vV 4 4s) 4w6 4rC 4QP 4] 4Aj 4$Kw 4  4F 4s 4ϋ 4n 4Jg 4va 4K 4z 4` 43V 4g 4n: 4T? 4kYK 4W 4nsc 4p 4xt} 4 4VL 4U= 4Y 4D 4%` 4I 4P 4 4*; 4): 4- 4w: 4-4H 4U 4Lb 4n:p 4c[ 4  4B 4S  4ww 4&X 4 4c 4v 4o 4  4؉, 4Ɍ9 4F 4~S 4]m 4Lz 4c 4E 43 4lo 4F  4! 4. 4r 4A 4 4  4  45"# 4@0 4Y= 4J 4|=W 4d 4\Iq 4$K~ 48 4vV 4 4N7 4s 4M 4ɣ 4B 44 4VL 4^ 4S . 4; 4^H 4U 4)b 4)} 4ԡ 4w 46 47 42 4} 4( 4 4Y 4  48 4E 47R 48*_ 44l 4T`y 4Y 4JX 4] 4~ 4T 4'- 4 R 4$S_ 45bl 4* 4}; 40R 47 4_  4' 4  4e  4oz. 4A@ 4k 4 4WA 4E 4 4w 4 4c 4`"< 40T 4{] 4HOt 4\ 4 4 4c( 4Cz 4vM 4I 4 4  4WR 4H9 47U 4^ 4Vf  { 6 6ٿ 4; y 6@ 6. 6 6 6 6 4Dj 6 6 6&! 6' 4T8 4_S 6qW 6_\ 7p 6t 6y 4j 6 6 y y 60 6. z z 6? 6= y"  zD +z\ ^zw   fz xy xy 6N 6L z 7 6_ 6[ 6u 6s 6 6 6 6 7( 6, 65 69 6B 6F 6K z` y~ nz z   { 4 u 4j 6 6 6@ 62 6! 6& 4H1 65 6D 6H 6W 6[ 6k 6Po 6Ft 4k 6 6} 6 6 .v 46 .v 4v 6 6 4J 6 6 .v 4- w' 4-1 wF 4-P we 4p 6dt 6by 4 6v 6r w 4ڍ 6 6 4% 6 6 4' 6 6 4#s 6 6 4- 6 6 w 4. 4[c; 4iFH 4$[ 4̇i 4Z| w w 6 6 6 6 6 6 6 6 6 6 6# 6! w _v _v# 63' 610 _v: _vR 6BV 6@a vk v 6Q 6O 6` 6^ v w w 6p 6n 6 6}  w 77 6 6$ 6( 6- 776 6: 6C 6G 6P  wZ 7Jk 6o 6x  w 7J 6* 6( "w 7i 6> 6< "w 7i 6M 6K Gw Gw Gw# w- 7> 6\B 6ZK wU 7a 6ze 6xp ;xz 7 6 6 ;x 7 6 6 x 7 6 6 6 6 x x x2 6)6 6'? 68C 66I x^  `h xy   4Q `m 6U 6G 4Ȇ 6 6 4C 6 6 4] 6 6 6] 6Y 6 6{+ 6/ 6> 6B 6Q 6vU 6pd 6h 6m 4;x 6| 6 6? 67 6m 6e 75 4 6 6 4 6 6 bo 4+ 7X 4ڍ 6 6 4% 6" 6' 4'2 66 6; 4#sF 6*J 6(O 4-Z 6;^ 69c ox 4 4[c 4iF 4$ 4̇ 4Z o o 6L 6J 6c 6a 6c 6a" 6c& 6a/ 6c3 6a< 6t@ 6rG oZ 4W,d 7m 4Ax 6| 6 4E 6 6 m 4, 7 4\ 6 6 4a 6 6 yn 4, 7% 4ڍ 6Z 6V 4%& 6r* 6p/ 4': 6> 6C 4#sN 6R 6W 4-b 6f 6k n 4 4[c 4iF 4$ 4̇ 4Z n n 6 6 6 6 6! 6* 6. 67 6; 6D 6H 6O nk 4y m 7 6 6 m 7 6 6 n 7 6 6 6 6} 6 6 6 6 7 n) 7: 6$> 6"G nQ 7] 63a 61l 7y 6D} 6@ 6` 6Z 6 6 6 6 6 6 n n n 6 6 6 6  6 6  6# 6 , 60 6 9 6 = 6I "o` nj n o 7E 60 6. o 7E 6? 6= o o 6P 6L 6j 6f# 6' 60 o: 7qK 6O 6X ob 7qn 6r 6} 7 6 6 6 6 6 6 6 6 6- 6+ o o o 6> 6< 6M 6K& 6M* 6K3 6M7 6K@ 6MD 6KM 6^Q 6\X ow o o 7 6n 6l 4 pp 6 6} 4Ȇ 6 6 4 6 6) 6q- 6a= 6A 6G 4O =q] 4?k  qu 7 6 6 =q 7 6 6 6n 6` 7 6 6 6 6 6L 6@ 6 6 6> 68 6m 6[ 6 6) 6- 66 6S: 6IC AqM 7\ 6` 6i Aqs 7 6 6 7 6 6 _q _q 6 6 q 7/ 6 6 6U 65 6 6! 6T% 6B. 62 6; 6X? 6PD 7/M 6Q 6Z 6^ 6g 6ik 6]t 6x 6 6 6 6 6 6@ 66 r 7 6p 6h 7 6 6 6 6 7 6 6 6 6 6# 6, 6/0 6+9 6K= 6GF sd sn s 6e 6c 6t 6r 6t 6r 6t 6r 6t 6r 6 6  s #s :s  :s" 6& 6/ :s9 :sQ 6U 6a [tv _t 7 6 6 6 6 7 6 6 7 6 6 ut t Vu r* s4 7C 6"G 6 Q sj 63n 6/w s s 6V 6T 6r 6p 6r 6p s Qu Qu q+ sC sX  0n +u Cu }u 7 7 7 6 6 xr r) t3 7$D 6H 6Q t[ 7$g 6k 6r p t u 4Jw 4? 4 4  4 D 4FU 4a 4qs 4F+ 4ڍ 4_+ 4  p 6 6 4d 6 6 4$ 6 6 4; 6. 6* -p 7' 6F+ 6B4 6\8 6ZA 6pE 6jJ 7S 6W 6\ =p 4g 46 4 4F 4 4[ 4T/ 4r< 4*I 4*V 4*_ 4Jp 4B| 4_ 4ڍ 4% 4' 4#s 4- 4 4[c 4iF 4$ 4̇ 4Z  4-++ 4P6 jX 6\ 6a 4Ȇk 6o 6} 6 6 4(V 47 4wy 61 6- 4[v 6Y 6G 6 6 6 6 6 6 7i 4) 6] 6Q 4VP' 6+ 64  k>  kY 6] 6f 6j 6s  k}  k 6 6 6 6 .k 7 k k 6 6 68 66 k k1 6L5 6H> 6jB 6hK kU 7a 6~e 6zn 6r 6w 7 k k 6 6 6 6 k k 6 6 6 6 l l+ 6/ 69 WlC Wl^ 6b 6 k 6o 6u Rl l 4j 4j 4_ 4[ 4Y& F 69J 6-Z 6j^ 6fe 4Nr 4 4Ȇ 4p@ 4z9 4- 4ރ 4@ 4U 4š, 4)9 4TF 4:q 4ڍ~ 4% 4' 4#s 4- 4 4[c 4iF 4$ 4̇ 4Z 41 481 4:> 4] 4xh 4s 4  4g 4= 4) 4xE 4kb 4) 4 4) 44 4)- 4h9 4)F 4џT 4Hz 4_ 4ek 4 4 4 4+ 4D 4 4b 4{ 4! 4. 4C> 4_K 4ekX 4e 4br 4D 4 4 4 40 4I 4b 4{ 4 4 4 4ؐ. 4= 4L 4[ 4j 4ԑz 4v 4 4 4 4< 4cf 4_ 4ek 4b 4: 4Ŏ 4ގ, 4; 4K 4)[ 4Bk 4 { 4n 4 4? 4p 4R 4 41  4g 4Ђ3 4gE 46%\ 4gi 4 4_ 4 4_ 4  4g 4j 4g 4  4c. 4g; 4Z%R 4g_ 4v 4g 4> 4g 4$ 4 a 4g 4$ 4x 4g+ 4$B 4vZ 4_f 44s 4@ 4_ 4P 4_ l 6 6~ 6 6 6 6  6M 6A 6 6$ 6( 61 65 6; lH md  n @m   4F 4F 4?  4 4.M 4~ 4YU 4S 1U 4/ 5Q 5,Q { 2W 4~ 4% 4/ 44= 4d0B 4"P 4Z 4h 4"m 4{ 4t 4& 4W 40 4? 4 4,- 43 4E 4S 42X 4d 4Ap 4| 4 4 4Q/ 4 4 4! 4W 4s4 4 4#: 4 4& 4 4 4h+ 4F7 4;C 4-O 4![ 4n 4s 4 4t< 4 4 41 46 4 4. 41 4 4 4? 4 4$ 4_2 4"G 4_U 4:a 4jn 4! { 4. 4 4i 4߽ 4!  4j 4Ĭ 4!  48 4Y 42f 4-s 4ר 4R 4= 4 4 4 4  49 4a 4 48  42 4% 43 4*A 4 O 45] 4U.k 4 y 4Y" 4z< 4 4p0 4 4 4; 4  4_$ 4Һ4 4yC 4&R 4a 4p 4 4 4 4 4 41 4b 4> 4 4| 4O 4\% 4 4 4C 49R 4aa 4=p 4 4ǫ 4 40 4 4 4  4 4 4e 4 4k$ 43 40B 4\Q 4H` 43~ 4 4 4= 4( 49; 4+; 4 4#0 49 4 4$%& 4n6 4kF 4 V 4v3f 4*v 4F% 4k 43% 4 4 4 4 4+ 4C! 4?! 4-3! 4tB! 4OQ! 4%`! 4o! 4 ~! 4d! 4e! 4]! 4B"! 4! 4p! 4! 4 ! 4" 4" 4#" 42" 4jA" 4P" 4_" 4ln" 4+}" 4" 4" 4" 4" 4" 4:" 4b" 44" 4)# 4# 4## 42# 4vA# 4Q5P# 4>_# 4"?n# 4S}# 4# 4z# 4# 4# 4# 4o# 4# 4$ 48$ 4w>!$ 40$ 4?$ 4N$ 4<]$ 4+l$ 4C{$ 4[$ 44$ 4''$ 4!$ 4$ 4$ $ 4+7$ 4$ 4x% 4% 49  % 4/% 4>% 4M% 4\% 4k% 4qz% 4v% 4% 4U% 4% 4?% 4% 4F% 4-% 4C& 4& 4& 4l.& 4B=& 45L& 4[& 4j& 48y& 4& 4R& 4&& 4& 4s & 4& 4,& 4& 4i' 4' 4' 4&-' 4B<' 4ӹK' 4xZ' 4Fi' 4x' 4' 4g'' 4' 4' 4' 4' 4' 4' 4j,( 41( 4:( 4-( 4<( 4%K( 48Z( 4R7i( 4y( 4 ( 4];( 4( 4<( 4( 49( 4i7( 4( 4[5) 4) 4() 4-) 4<) 4xK) 46Z) 4=i) 4_x) 4) 4@) 4) 4&) 4C) 4>) 4N) 4 ,) 48) 4* 4-* 4P<* 4K* 4Z* 4i* 4,x* 4e?* 4* 4t* 4:* 46* 4* 4* 4>** 4+ 4+ 4(!+ 4 0+ 4,?+ 4мN+ 4Q^+ 4m+ 43+ 4+ 4+ 4+ 4, 4 , 4<, 4&, 4W3, 4! M, 4e, 4r, 4, 4, 4G, 4., 4=, 4i, 40, 4- 4- 4̸- 4l*- 488- 4DF- 4?T- 4! b- 4^>p- 4;~- 4- 4g- 4- 4- 4- 49- 4- 4- 4- 49 . 4. 4 (. 4s6. 4D. 4 R. 4`. 48n. 41|. 4. 4. 4$1. 4 . 4. 4. 4. 4/ 45/ 4w/ 4-/ 48 4z,8 4} Z8 4n8 48 4q8 48 48 48 48 4B8 49 4 9 49 4A&9 429 4N?9 4.L9 4Y9 4f9 4s9 49 49 49 49 49 4(9 49 4y9 4*: 4<: 4P!: 4.: 4;: 48H: 4"U: 47,b: 43q: 4: 4: 4: 4>: 4: 4: 4: 4: 4: 4: 4; 4; 4!; 49; 4.F; 4S; 4`; 4im; 4; 4; 4; 4[; 4T1; 4?; 4 < 4a< 4'< 45< 4u#C< 4Q< 4_< 4wm< 4={< 4"< 4< 4< 4;< 4< 4?< 4< 4< 4.< 4 = 4= 46#= 4/1= 4?= 4M= 4g2[= 4-i= 4/w= 4= 4K<= 4&= 4w= 4= 4ֵ= 4]= 4= 4= 4> 4'> 4}3> 4'@> 4M> 4Z> 4 g> 4-t> 4 > 4?> 4> 4T> 4_> 4> 44> 4U> 48> 4&? 4? 4? 4P.,? 4PH? 4T? 4a? 44n? 4{? 47? 4q? 4? 47? 4.? 4? 4? 4=@ 4o,@ 4"@ 4/@ 47=@ 4KP@ 4\@ 4# h@ 4=u@ 4-@ 4=@ 4@@ 4@ 4)A 43AA 4]A 4.kA 4yA 4C,A 4!A 4A 4)A 43 B 48B 4LB 4C 4rC 437+C 4D>C 4*C 4C 42PD 4\D 4yD 4}=D 4D 4"D 4D 4n?D 4'+E 4E 4E 4>,E 4r+E 4E 4E 4E 4E 4,F 4+F 49F 4GF 4fF 4uF 41F 4F 42F 4F 4F 4F 4F 4F 4dG 4='G 4c5G 4SCG 4QG 4mG 4b}G 4w$G 4G 4&G 4DG 4DG 4lG 4G 4(H 4H 41#H 4=1H 4A?H 4MH 4[H 4n(pH 4}H 4H 4cH 4جH 4IH 49H 4H 4EI 42I 4+I 4i9I 4dFI 4! bI 4nI 4W{I 4I 4I 4I 4RI 46J 4AJ 4yJ 4@,J 4]9J 4FJ 4ESJ 4`J 40#mJ 4zJ 4J 4OJ 4zJ 47J 4J 4J 4GJ 4J 4'J 4K 48K 4K 4$'K 44K 4AK 4;NK 4[K 46iK 45K 4iK 4.K 4PK 4OK 4K 4K 4K 4L 4+L 4!8L 4EL 4iSL 4`L 4! mL 4jL 4YL 4} L 4VL 4?L 4L 4: L 40<L 4L 4M 4M 4&!M 4-M 4 :M 4HM 4TM 4b aM 4oM 4M 4M 4.M 4$M 4.M 4)M 4M 4N 4A0N 4ȶ=N 4PN 4lN 4xN 4N 4N 4C9N 4N 4N 4N 4N 4N 4QN 4(O 4O 4"O 4L/O 4q\ 44K\ 4;X\ 41e\ 4s\ 4[\ 4\ 4\ 4?\ 4\ 4\ 4\ 48\ 4H\ 4[5 ] 4] 4)&] 4P.h] 4t] 4] 4A] 4] 4] 4t,] 4n] 4] 4] 4b] 4 ^ 4^ 4ҧ'^ 4(54^ 4K^ 4bX^ 4e^ 4(5|^ 4b^ 4^ 4`^ 4^ 4[)^ 4^ 4h^ 4I^ 4_ 4_ 4V)_ 46_ 4"M_ 4Y_ 4qe_ 4q_ 4k}_ 4'_ 4L0_ 4 _ 4_ 4i_ 4)_ 4. ` 41` 4g-` 4Y9` 4.E` 4Q` 4g` 4/1t` 4L` 4` 4n` 4` 4` 4` 4` 49` 4` 4` 4a 4#a 4E;"a 40a 4Ja 4 Wa 4'da 4~a 4w a 4/a 4a 4a 4a 4a 4ca 4a 4a 4b 4#b 46b 4+b 48b 4 Eb 4cRb 4Q_b 4lb 44zb 4 b 4b 4 <b 4bb 4b 4b 4-b 44b 4c 4Vc 4zc 4j,*c 4&7c 4UDc 4Qc 4^c 4kc 4c 4=c 4}*c 4c 4c 4jd 4.d 4)%d 44+d 41d 4h+7d 4#=d 48Dd 4lRd 4`d 4nd 4d 4d 4jd 4d 40d 45:d 4d 4S$d 4:d 4= e 4e 4'e 45e 4Ce 4:Qe 4_e 4Sme 4R{e 4e 4 e 4e 4e 4?e 4e 4e 4*e 4 e 4> f 4f 4%f 43f 4Af 44Of 4=]f 4kf 4yf 4If 45f 4f 4f 4f 4(f 4f 4u.f 4o8f 4vg 4Rg 43!g 4/g 4=g 4YKg 4 Zg 4Tig 4/wg 4Ng 4g 4~g 4g 41g 4g 4g 44g 4g 4<h 4Ih 4 h 4B.h 41r 4Lr 4@Zr 4hr 4vr 4r 45r 4r 4r 4:r 4r 4cr 4-r 4r 4s 4Ls 4s 4,s 4U:s 4LHs 4:Vs 4Gds 4rs 4"*s 4+s 4Os 4s 4vs 47s 4s 4s 4s 42t 4)t 4t 4!/t 4+9t 4E3Ct 4Qt 4P_t 4} st 4qt 4t 4t 4t 43t 4t 4t 4t 4t 4u 4u 4u 4x((u 45u 4.Bu 4 Ou 4\u 4iu 4|u 4qu 4u 4u 4u 49u 4>u 4u 4u 4v 4 v 4*v 4P4v 4Nv 4Xv 4Zbv 4ov 4|v 4v 4ev 4v 4v 4v 4"v 4v 4v 4|v 4v 4 w 4w 4'w 45w 4MQw 4_w 4Qmw 4{w 4w 42w 4_w 4Aw 4#w 4Xw 4.w 4ww 4x 4"x 4a"x 4/0x 42Lx 4gx 4ux 4x 4x 4x 4yx 4x 45x 4x 4x 4Fx 4y 4y 4'y 4! 4y 4Ay 4cNy 4[y 4thy 4uy 4Jy 4wy 4y 4!y 4Q;y 4:y 4y 46y 4y 49z 4p0z 4 z 4r%-z 43:z 4Iz 4./Vz 4pz 4}z 4vz 44z 4?7z 4 2z 4=z 4z 4@{ 4= { 4 { 4R,{ 41{ 4>{ 4K{ 4;X{ 4e{ 4\r{ 4{ 4 { 4{ 4c{ 4{ 4A{ 49| 4| 4.| 4w5(| 45| 4ϿB| 4O| 418\| 4i| 4v| 4| 4| 4.| 43| 4| 4 8| 4Z| 4K| 4"5| 4} 4M)} 4"} 4/} 4 <} 4I} 4V} 4p} 4}} 49} 4} 4} 4} 4} 4r~ 4~ 4Z#'~ 4%3~ 4z@~ 4S~ 4`~ 4os~ 4~ 4)~ 4?~ 4~ 4: ~ 4,~ 4y~ 4~ 4~ 4v~ 4 46, 499 46F 4T 4 a 4n 4t 47 4#8 4P 4! 4 4 40 4d> 4"K 4X 47e 4.s 4* 4t 4 4  4 4À 4Ҁ 4" 4\% 4( 4.5 49B 41O 4\ 4mi 4v 4< 48 4V& 4 4Ё 44݁ 4X 4y 4a 4 4. 4+ 48 4tE 4R 4;_ 4l 4Ey 4 4  4), 4 4[ 4tǂ 4Ղ 4m 4S 4 4( 4h> 4J 4` 4m 4z 4: 4M1 4 4ƒ 4ك 4p 4) 4 4% 404 4A 4N 4[ 4\i 4by 4 4 4O 4 4  4 4 4x 49 4Ȅ 4Մ 4V& 4 4 4 4) 4D7 4dZ 4g 4t 4 48 4b/ 4< 4 4! υ 4 4% 4@ 4* 48 4B 4O 4.\ 4)i 49v 4R 4[ 4) 4u 4Ά 4.ۆ 40 4( 4s 4  4-2 4G' 4(4 49A 4c[ 4h 4mu 4̯ 4 4e< 4ͩ 4I 4Ç 4:Ї 4݇ 4#! 4% 4 4[  4  4׮6 4uK 4/X 4:% 4- 4g 4p 4Jʈ 4݈ 4; 4 4 4Ψ' 4+5 4H 49/_ 4Ѳl 4b)z 4 4r 4 4 4ȉ 48 4? 4=$ 4Ĭ: 4kF 4'l 4  4/ 4:%NJ 4;Ԋ 4o 4 4 4p" 4'0 4> 4\ 4u 4A$ 4 4, 4 4 4 ɋ 4 4 4J$ 4 4x* 48 4F 4l_ 4am 4{ 4v 4# 4 ь 4? 4( 4Ư 4& 4 4) 47 4E 43S 43a 4Mo 4E} 4 4 4 4# 4ɍ 4׍ 4 4 4 4' 4r5 4D 4{,R 4.a 4o 4u} 4 4V 4 4 4'Ύ 43 4 4 4: 4 N 4:X 4f 4;t 46 4 46 4\? 4I 4ȏ 4I֏ 4 4 * 4 4 4 4* 4Ѷ8 4Ѱ[ 4i 4P. 4 48 49ǐ 4 5Ր 4"5 4< 4 4?" 40 4> 490Z 4h 4v 4 4 4b 4P 4[ 4ʑ 4!;ؑ 4 4n 4e  4; 4  4#/- 4< 4 K 4Z 4i 4sx 4 43 4 4 4Ò 4Ғ 4W 42 4 4 4., 4'; 4ĨJ 4RY 4h 4:w 4R0 4' 4 4ݾ 4\+“ 4?ѓ 4Y 4B 4 45 4% 4&+ 4 : 4.I 4X 4@g 4v 4/ 4" 4 4) 4 4 4 4 4# 4: 4XN 4~ 4 4 4+ŕ 4)֕ 4jܕ 4s 4  4?2 4h 4 4F 4  4! 47 4x& 4" 4** 4N6 4 B 4O N 4Z 4'g 4Tt 4 4' 4[ 4 4K 4Ö 4Y0ז 4& 4u= 4 4  4" 4X/ 49< 4I 4c 4p 49} 4& 4. 4 4&ŗ 4#& 4- 2 4hB 4QH 45N 4U 4_ 4?-l 4y 4; 49 4G 4 4ɘ 4ʻט 4 4% 4y 4 42 47 46D 4k 4x 4A 4 41 4 4Ǚ 4,ԙ 4u 49 4; 4=H 4Lb 4x 4 4Z 4R 4\' 4Aɚ 4f֚ 4 41 4 4z%# 4l1 4J 4Z] 4+g 4v 4 4 4 4* 4@ 4Oћ 4 ޛ 4 4p 4( 42 4E 4j 4 x 4. 4D? 4 4< 4Ȝ 4<֜ 4 4. 4: 4 4\< 4n& 43 4 @ 4M 4Z 4P 4u2 4E 4Y 4͝ 4ڝ 42 4b 4* 4 4 4* 47 4D 4jQ 4I_ 4l 4$z 4] 4 4!  4 4 4Ξ 4 4 4% 46/ 4+9 4F 4T 4a 4n 4={ 4 4 4 4> 4G˟ 4:؟ 4 4;2 4 )> 4S+S 4_ 4St 4 4+ 4y 4͠ 4ܠ 4 4$ 4 4 4" 490 48> 4L 4Z 4h 4qv 4) 4+ 4- 4) 4 4;ʡ 4ء 4 4 4 4/ 4c/ 4> 4M 4j 4y 4 4 4 4 4s)Ģ 4DӢ 4 4' 4 4O" 4< 4X- 4 < 4ֱK 4Z 4 w 4 4x 4 4˭ 40£ 4ѣ 4 4Ĭ 4q 4  4N*+ 4^: 4I 4X 4"g 4+v 43 4( 4Ԥ 4C 4} 4 4( 49$ 41 4)> 4?K 4 X 4 f 4h# 4 4ʥ 4Х 4֥ 4ܥ 4D& 4ǥ 4Q8 4T 4 4] 4 , 4)9 4<\ 4f 4f z 4 4\: 4&2 4 4; 48Φ 4  4  4G/ 4' 4'' 4d,4 4%A 4Z 4g 4 u 4 4 4f 4 43 4]ϧ 4!ݧ 41= 48 4 4]  4w# 41 4? 4M 42\ 4C8 4) 4 4 4% 4 4rۨ 48 47 4 4 4# 4h>0 4= 4 J 4W 4(d 4!q 4~ 4(& 4 4 48 4 4lͩ 46ک 4k 4!- 48 4% 4  4]+ 49 4CG 4/[ 4i 4%w 4 40 4 4 4 45˪ 4m* 48 4F 4T 4b 4Bp 4 ~ 4 4 4 4, 49 4ī 4mQ 4_ 40m 4a{ 4 4 4 4 4 41Ϭ 4Zݬ 4/ 4 4 4 4# 4b1 4b@ 4%N 4\ 4Ӫj 4/x 4J  4 4 44 4.̭ 4xۭ 4 4o 4K 44$ 4?2 4@ 4 N 4-\ 4/j 4-x 4 4 4J! 4 4@ 4ͮ 4ۮ 4! 4. 4R 4p 4x ! 4/0/ 4 4/ 4" 40 4z> 4 4 4 4E 4 Ͱ 4۰ 4 4& 44 4:B 44P 4 ^ 4Ll 4 z 4 4, 4 4 4z 4$α 4vܱ 4 4 4 4? 4e" 40 4] 4Dz 4ղ 4( 4 4( 4} 4W( 46 4<># 4}'0 4o= 48J 4W 4! 4h 4 u 4 4M 4% 4 488 4 4@ 4W 4-" 4[, 4F6 44E 4S 4a 4o 4]} 4 4], 4 4+ 4Gö 4rѶ 4߶ 4 4/ 4 4z0 4^% 43 4A 4O 4] 41k 4Ay 4 4. 4 4?4 42· 4̷ 4ַ 4 4 4( 4. 4'4 4B 4Q 4_ 4m 4c{ 4 4/ 4 4Y  4?˸ 4  4> 4  4 4# 40 4/? 43%M 4[ 4i 4 4 4 4 488ǹ 4չ 4 4? 4q 43 41 4y) 47 48'E 4 S 4G*a 4U3o 4#} 4 4 4 4x 44ú 4Ѻ 43ߺ 4 46 4/ 4- 4F 4 U 4_ 4\s 4 49 4> 4 4$ 4» 4Gϻ 4!ܻ 4 4© 4 4 4T 4* 4+7 4D 4-Q 46^ 4|k 4x 4/ 4W2 4 4  4د 4Ǽ 4 40 4> 4[ 4\ 4! 4 4 4`Z 4$, 4ۿ 4 40 4= 4 4# 4 4 4, 42 4L8 4p9 4 4 4e 4* 4( 465 4B 4*O 4h 4ru 4 4{ 4½ 4 4:! 4( 44 4: 4e 4 4* 47 4SD 4HX 4˳e 4K,r 4 4  4C 4 4 4ѷ 4j1 4. 4J 4 4 4b 4' 4\ $ 4<* 40 47 4D 4sQ 4^ 4< 4~ 4/ 4@' 4 85 4 C 4Q 42o 4| 42 4n= 49 4 @ 4! 4 4  49 4-C 4P 4^ 4#k 4)x 4!& 4 4 4A 4 4; 4u0 4d, 47 4;D 4cQ 4"_ 4m 4;{ 4? 4 4 4! 4 4 4w 4 4 4= 4 4a. 41M 4GY 4ef 4%p 44 4( 40 4u0 4V 4V 4x 49 4  4w 4 4% 45 4'E 4GK 4JQ 4\X 4e 4r 4$ 4b 4ݦ 4e9 4* 4 46 4 4; 4( 4 5 4C 4eQ 4c_ 4;m 4{ 4 4 4 4M 4a 4 4, 4 4)r 4* 49 4W 4 4 4z 4? 4, 4. 4O 4 4/ 4 46 4 4 4 4 4' 44 4 4 4 4 4 4 4 4b 4W- 4v; 4VI 4W 4f 4au 4`$ 4p2 4x 4M 4P 4" 4 4. 4g 4 4>) 4 8 4G 4V 4+e 4 4 4 4 4  4? 4o 4: 4 4b* 4m 4) 49 4I 4{Y 4i 47 4 4< 4|! 4 4< 4|! 4 4 4L5 4F " 4&. 4~E 4cR 4"_ 4Pl 4 4 4) 4 4 4 4& 4 4! 4/ 4! > 4J 4V 4b 4en 4{ 4 4; 4 4? 4/ 4 4P 4 4# 40 4y= 4 4 4{7 4> 4 4`7 42 4? 4X_ 42l 4y 4 4r 4> 4 4g 4 4 4 4M4 4a) 4:6 4eC 4P 4)] 4&j 4#w 4[ 4 4 4L& 4, 43 4O 4X_ 4m 4{ 4{ 4' 4c 4j5 443 4ټ 49 4 4: 4۩D 4] 4f$l 4y 4P 43- 48 4 4 4 4. 4" 4ܺ/ 4< 4I 4KV 4[c 4{ 42 4/ 4 4 4- 4 4 4Y  4ܻ 4 4 4 4h2 4r? 4\ 4Ji 40v 4 4ײ 4" 4 4} 4 4x 4 4] 4 4` 4 4* 4&8 4[F 4ZT 43b 4Xp 4~ 4 4 4~ 4D> 47 4 40 4 4q/ 4A: 4 45& 4^ 4/p 4v 4| 4  4 4 4 4M( 4/ 4  4 4U 4$ 4. 4 4 4R> 4 4?" 4$, 4; 4I 4X 4sg 4 v 4l 4 4%. 4> 4d1 4Q? 4L= 4 4. 46 4 4e% 45 4(E 4 U 4Ie 42u 4 4  4*? 4 4 4 4 4 4K 4 4D  4 ( 4k8 4:H 4,>X 4 h 47x 4 4 4% 4 4 4g3 4 4~: 4 4  4 49) 4,8 4G 4u f 4vs 4 46 4. 4 4t 4*? 4q! 4 4 4 4 4v- 4( 4@5 4t B 4\ 4!&k 40" 4 4 4C 4 4 4? 4b2 4 4~M 4Z 4g 44t 4  4 48 4\ 4 4% 42 41 4/ 4. 4 4 4 4Z* 4p:7 4P 4| 4h 4 4? 4 4  4 4( 45 4% 42 41 4/% 42 4? 4 L 4e 4M 4 4 4* 4 4 & 4 4 $ 4(1 4> 4"K 4X 4/ 4. 4 4  4 4 4?= 4M 4:S 43Y 4` 4o 48~ 4H 4b 4_ 4G 4 4 4׭ 4 4 4 4" 4. 4j4 4,+: 4<@ 4G 4U 4<c 4q 4< 42 4 4# 49 4 4 4 4D 4q 4; 4[ 4# 4; 4R 4 4 4# 44 4&: 4h@ 4G 4$U 4c 4%q 4 4 4 48 4n 4. 4&  4 4B 4o 4"# 40 4G 4Q 4ճ_ 4hm 4b2{ 4& 4[ 4y 4J 4 4 4 4 4 4( 4# 45 4]? 4I 4X 4f 4t 47 4f 4u 49 4< 4 4͵ 4* 4 4 4e 4+7 4$A 4N 4t 4 4 4, 4] 4T 4 4 4 4  4 4# 44 4 & 43 4@ 4d8M 4sZ 4g 4u 4A 4W 41  4 4; 4? 4  4 46 4 4 4> 4;3) 4E7 4 E 4S 4&a 4?o 4$7} 4a 4, 4V 4h 4 4x; 4 4z+ 4 4 40 4') 4f7 4l*E 4S 42&a 4c-o 47 } 4> 4W! 4T9 4 4G 4( 4 4 4 4 4d& 4% 4 3 4yA 4q6O 49] 4pk 4}y 4} 4F 4= 4 4 4 4) 4 4($ 4 46 4! 4,/ 41= 4K 4{Y 4O:g 4v 4 4 4 4 4O 4 4%# 4 4 48% 4/ 49 4vC 4 M 4< W 4>a 4i;k 4y 4P 4}  4ħ 4-  4 4[ 4l  4$7c 43p 4} 4 4 4 4 4? 4 4 4; 4 4 4i 4* 4, 4Q b 4o 4 4  4 43 4V 4; 4' 4&4 4 44 4  4! 4+ 4 4 4 4) 4  4 4I 4 4" 4 #3 4q A 42Z 4<m 4 4S% 4 4k 4 4$ 4 4@ 4 4 4 4y 4" ) 4*7 4[F 4FR 4c 4,o 46| 4@ 4 4# 4X 4 4V 4 4U 48 4z" 4+ 44, 4%9 4F 4T 4?a 4%n 4y| 4B 49 43 4 4 4 4 4 4? 4  49+ 4'8 4*E 48R 4_ 4y 4k 481 4 4 4  4z 4 4Z 4 4J 4 4 4" 4/ 4~5< 4I 46V 4c 4p 4+} 4 4 4J 4 4p 4{ 4- 4> 43 4` 4# 4! 4: 4J 4 /P 4rW 4d 4q 4(~ 4 4 4. 4 4  4e 4 4 4:* 438 45W 4&o 4 4 4 44 44 4B 4 4 4 4 4+ 49 41G 4U 4Bc 4'q 4x? 4< 4 4f 4& 4_ 4 40 4 4 4+ 4 4) 46 4C 4P 4] 4j 4.w 4M  49   4L6 4 4 4$ 4(? 4i 4\z 4U- 4H 4 4a p 4  6 6  4 69# 61( 43 6a7 6Y< 4G 6K 6P 43[ 6_ 6d 4Vo 6s 6 6 6 Í ͍ l 4y   4 6 6* 63. 6+3 4> 6]B 6SQ 6U 6e 6i 6s 4A  7. 6F 6> 6i 6c 6 6 7> 6 6  7> 6 6 7>  8 86 6: 6D ?N ?j 6n 6w ? ? 6 6 ? ? 6 6 ? ? 6 6 ? ?7 6; 6S Im Iw I 6 6 I I 6) 6' I 64 62 P 6? 6= 6I$ 6G- PF 6TJ 6RS Pe m m m 6^ 6\ m m m ( 7N 6o 6k" 6& 6~/ 63 6< 6@ 6I 7YV 6Z 6c (m 7Y~ 6 6 7Y   6 6   6 6   6! 6/ 9 R 6V 6d n  6 6   6 6    6- 6+( 2 K 6<O 6:X m 6Gq 6E}  6R 6P 6\ 6Z  6g 6e    5 6q9 6oB L e  ،  4+9  4 6 6~ 6 6" 6& 6+ 4:6 6V: 6NJ 6N 6wl 6p 6u 4{  4  4Q  4A 7 ) 8  "  H . -S Xv b ̈ 7 6 6 6 6 ̈ 7 6 6 6  6 ̈ 7  6  6 6  6& 0 M 6,Q 6*Z 68^ 66g 6Gk 6Ct ~        6\ 6Z 6h 6f     6t 6r 6 6~$  = 3c ;m ; 6 6 6 6 ; ; 6 6 6 6 ; ; 6 6 6 6 I) 79 6= 6B 7K 6O 6Z d  6 6   6 6   6 6 6 6  ' 6+ 64 68 6C M 7] 6)a 6'j 65n 63w   6A 6? 6M 6K   6Y 6W 6e 6c   6q 6o# 6}' 6{/ J m  ؊  x        ȋ 4Z P( 43 67 6G 6K 6P 4[ 6U_ 6=n 6r 6w 4 6c 6Y 4` 6 6 6B 6 4f 6  6 4@ 6> 68 4/ 6s 6o 4 6  6 6  60 64 69 4? M 4A_ ˅i 7c~ 6y 6e 7c 6 6 6 6  6\ 6R 6 6 6 6 6- 6) b N  և4  F Z_  w " 7 6B 6< 6h 6^ 7 6 6 6 6 6 6  7 67 61 6O 6M i, E  (V o  X   6Y 6W  7 6k 6a 7 6 6 6 6 6 6 6  6 6; 61! 6k% 6_. 62 67 7\ m  H   -     '   1 ,F  P @^ 4{ 4 4f 4 4A 4 49 4fj 4\=r 4A 4  4 4f 4  4A 42 {1 65 6E 6I 6N 4Y 6s] 6mb 7k 4Av 6z 6 { 7 6 6 6 6 6w 6g 7 6 6 6 6 6' 6! 6C 6= 6a 6Y  6 6 6 6% 6) 62 |? {I 7(X 6\ 6a 7(j 6 n 6 y  | 75 6 6 | 7I 6' 6 6X 6R 6w 6q 6 6 7w 6 6 6 6  66 6, 6j 6Z& 6* 63 67 6@ 6>D 64U 6pY 6db 6f 6o 67s 6| 6 6h | | 6  6  7 6 6 6; 61 } ?} 7 6f 6d 6p$ 6n- 6z1 6x: 6> 6C 7L 6P 6Y 6] 6f ?}p ?} 6 6 ?} 6 6 } 7 6 6 6 6 6 6 6 6! 7 ! 6! 6! })! }A! 6E! 6N! }c! 6g! 6t! ~! 7! 6g! 6e! 6q! 6o! 6! 6y! 6! 6! 7! 6! 6! ! ! 6! 6" " 6 " 6." 7R" 6V" 6[" 7i" 69m" 61v" 6\z" 6V" V" 7" 6" 6" 6" 6" 6" 6" 6" 6" 7" 6" 6" V" V# 6 # 6# V(# 6,# 6;# E# a# 6e# 6o# y# 7# 6# 6 # 6# 6# 6&# 6 # 6F# 6D# 7# 6U# 6S# 6_# 6]# # # 6n$ 6l $ $ 6#$ 6,$ |N$ 7W$ 6[$ 6h$ 1~r$ 7/$ 6$ 6$ 6$ 6$ 7/$ 6$ 6 $ 6!$ 6$ 6@$ 66$ 6r$ 6l$ 6$ 6$ 1~$ 7N$ 6$ 6% 7N % 6% 6% ~#% ~?% 6C% 6I% ~e% 4 % 4% 4% 4% 4)% 4#% 4I% 4r& 4A!& 4<& 4rT& 4k& 4fw& 4<:& 4n& 4& 4"& 4& 4& 4& 4A& 4: ' 4' 4B"' 43' 4n?' 4K' 4<:' 4' 4&' 4n' 4' 416 ( 4:( 4CG( 4AZ( 405f( 4~( 4( 4p( 4( 4:( 4( 4(( 4 -( 46) 4C') 4') 48) 4eD) 4$P) 4U^) 4d%k) 4&{) 4) 4) 4) 4p) 4) 4:) 43) 4() 4 - * 45* 4$* 4<* 4M* 4eY* 4$e* 4Us* 4d%* 4&* 4* 4 3* 45* 4+ 4A+ 4'9+ 4NK+ 4X^+ 4]4x+ 4+ 4+ 4+ 4;+ 4&+ 4+ 4 , 4n', 4?, 4L, 4j, 4, 4y, 4P, 4, 45, 4, 4b- 4- 4)- 46- 4kL- 4c^- 4t- 4c- 4: - 4c- 4- 4- 4,*- 4- 4 . 4/. 4+. 49G. 4`. 4 w. 4. 4I. 4. 40. 4. 4. 4. 4P/ 4}4/ 4pA/ 42T/ 4+)/ 4Ĵ/ 4-/ 4 / 4/ 4/ 40 40 4.()0 4c50 4B0 4]0 4cj0 4[0 4c0 40 40 1H`0 4*x0 5[0 5Z0 7.0 20 40 4L1 4H 1 451 41 4,1 4h|61 4ND1 4LI1 4W1 4/\1 4nPu1 41 4S1 4+1 41 4$2 4n*2 4A2 4O2 4T2 4,`2 4Sl2 4x2 4(2 42 42 42 4Ȕ2 452 4dN2 42 42 4$2 4$2 43 4[3 493 4'3 4t@33 4@?3 4ёK3 4W3 4Ij3 4o3 44T{3 4'3 43 4!3 4xI3 4$3 4k3 43 43 4Ka3 4 C3 4i 4 4",4 4jL!4 4 64 4XD4 4Y4 4Xg4 4$s4 4L4 4o4 44 4{4 44 4e4 4o4 45 4L5 4o5 4$^?5 4*[5 48gs5 44d5 45 495 4E5 4\s5 4w)5 4%5 46 4R6 46 4",6 4~:6 4+H6 4"V6 4Ud6 4'Yr6 4l6 4a 6 4O6 43j6 4a6 4d6 46 4'6 46 46 4% 7 4zr7 4&S7 4b7 4Ecq7 4a7 47 4f7 4Ǣ7 47 4V7 4B7 47 4Ε7 4 8 48 4U'8 4l68 4zE8 4T8 4c8 4r8 48 4cD8 4^8 4f8 4S)8 4U8 47J8 4J8 48 49 4{9 46&9 459 4=D9 4S9 4Mrb9 44q9 4Ta9 4>9 4 p9 4v9 4-9 49 49 4)9 4: 4%: 4%%: 4Bh4: 4~C: 4#S: 4?c: 4s: 4uf: 4^: 4e: 4: 4 : 4: 4: 4: 4; 4aa; 4#; 4dJ3; 4hC; 4 4|> 4w#> 4v2> 4A> 4P> 4_> 4*n> 4C}}> 4@> 4i> 4'> 4 > 4Ά> 4> 4(> 4> 4? 4? 4"? 4l1? 4f@? 4^cO? 4^? 4Bm? 4|? 4f? 4Ň? 4c? 4.? 4@? 4]? 4:t? 40? 4@ 4-@ 4!@ 40@ 4^?@ 4N@ 4ο]@ 46l@ 4}{@ 4ʧ@ 4t@ 4>@ 4@ 4 @ 4-@ 4@ 4@ 4A 4A 4i A 4# /A 4>A 4MA 4DZ\A 4kA 4aXzA 4}A 4_A 4=A 4cA 4A 4A 4A 4wA 4VB 4ZB 4C B 4γ/B 4~M>B 4 MB 4Y\B 4tkB 4ШzB 4.B 4B 4B 4B 4B 4B 4&B 4B 4C 4M}C 4 C 4/C 4!>C 4GMC 4J\C 4kC 4zC 4*oC 4-HC 4=fC 4C 4^C 4C 4vOC 4C 4D 4D 4DD 4.D 4> =D 4LD 4ӸkD 4WzD 4pD 4D 4aD 4D 4/D 4,D 4wD 4qD 4#E 46E 48E 4.E 4 >E 4BNE 4^E 4knE 4no}E 4E 4cE 4E 4StE 4tnE 4F 4F 4m*F 4NF 4сZF 4'fF 4lsF 4SF 4oF 4lF 4ӴF 4$^F 4F 4GF 4G 4O(G 4$\4G 4nBG 4PG 4^G 4^lG 4JBzG 40G 4ܛG 4}-G 4oG 4A*G 4p&G 4G 4G 4G 4-YH 4H 4N"H 4|1H 4@H 4BNH 4D\H 4jH 4-xH 4H 4$H 4H 4{H 4fH 4H 4iH 4H 4I 4^I 4l#I 4R2I 4AI 4PI 4_I 4nI 4}I 4nI 4I 4ثI 4I 4I 4(I 4I 4J 4dJ 4_g#J 4N2J 44AJ 4]PJ 4X_J 4inJ 4C}J 4J 4J 4J 4tJ 4J 4@(J 4*J 4J 4OK 4VlK 4E"K 4]1K 4y,@K 4OK 4d^K 4umK 4|K 42_K 4lK 4n}K 4FK 4D_K 4ZK 4?K 4K 4IJL 4vL 4!L 4٪0L 4 ?L 4SWXL 4сdL 4pL 4o}L 4&kL 4L 4OL 4AL 4tL 4L 4nL 4M 4)M 46M 4pCM 4 QM 4_M 4сmM 4w|M 4M 4=uM 4aM 4gM 4сM 4Du%N 4m4N 4\ON 4%]N 4сN 4@N 4_N 4N 4ڣN 4>N 4N 4 N 4%N 4NSO 42 O 4 O 4;W,O 4T8O 4"DO 4PO 4i\O 4O 4;O 4O 4nO 4nO 4IO 4OP 4t=P 4mJP 4\P 4;riP 4'YP 4vdP 4mP 4P 4$^P 4uNP 4XP 4P 4P 4[Q 4 Q 4fQ 4'Q 4*4Q 4AQ 4NQ 4[Q 4chQ 4uQ 4AnQ 4%Q 4eQ 4,Q 4RQQ 4Q 4EQ 4Q 4Q 4RQ 4R 4R 4gdR 4t+R 48R 4ۄER 4~RRR 4_R 4]lR 4yR 4 S 4IS 4s-MS 4D[S 4MiS 4wS 4S 4S 4_S 4S 4vS 4dS 4ˤS 4=S 4ZT 4yAT 40 !T 4/T 4LU 4U 4U 4fU 4TU 4~bU 4U 4& U 4 U 4OV 4HV 4^V 4s(V 4-5V 4BV 4+OV 4\V 4+iV 4vV 4V 4FdV 4cV 4V 4 V 4SV 4V 4#V 4V 4$V 46W 4mW 4W 4x,W 4s9W 4FW 4OSW 4`W 4:CmW 4zW 4%W 4 IW 4aW 4ePW 4eWW 4bQW 4RW 4W 4vW 4cjX 4<(X 4ڣ@X 4JdX 4~X 4X 4XY 4dmY 4d{Y 4qY 4dY 4Y 4Y 4Y 4]Y 4$Y 4Y 4&Z 4Z 4Z 4*Z 4+8Z 4FZ 4 TZ 4A\Z 45F[ 4*[ 4$[ 4R[ 4f[ 4{[ 4[ 4Q[ 4c[ 4[ 4t[ 4[ 4[ 4V\ 4U\ 4"\ 4l/\ 4fq\ 4\ 4\ 4c\ 4\ 4\ 4\ 4a\ 4\ 4P] 4] 4 !] 4.] 4r;] 4$H] 4'YU] 4c] 4Y] 4$^] 4] 43@] 4t{] 4B] 4 (] 4b] 4~] 4^ 4D"^ 4q^ 4 )^ 48^ 4*qG^ 4'Yd^ 4)u^ 46{^ 4^ 45^ 48^ 4^ 48@^ 4%^ 4M^ 4^ 4r^ 4W_ 4_ 4]m_ 4(_ 4s5_ 4=b_ 4o_ 4'Y_ 4_ 4_ 4}-_ 4_ 4_ 4B_ 46U_ 4 ` 4` 4'` 4v5` 4QC` 4JQ` 4_` 4m` 4&{` 4` 4` 4u` 4ۥ` 4` 4` 4ߵ` 4` 4` 4a 4a 4#a 41a 4A?a 4ԩMa 4]'[a 4ia 4wa 4|a 4^Ya 4oa 4Oa 43@a 4'Ya 4ma 4ua 45a 4a 4[a 4Ua 4b 4> b 4;Rb 4hb 4*b 4z!b 4'b 4i-b 4v3b 4dA9b 4 ?b 4jVb 4ذgb 4Kb 4b 4tb 4}b 4b 4Cb 4b 4n"b 4-b 4.b 4b 4}b 4]b 4hb 4hYb 4b 4lb 4*b 4Yb 4b 4>b 4-nb 4@c 4N c 4 wc 4c 4fCc 4)c 46c 4vCc 4Pc 4z]c 4Ұvc 4-c 4c 4c 4kc 4Ic 4c 4qc 4Ic 4c 4rc 4'Y d 4Vd 4N$d 4IN@d 4׃Ld 4Yd 4fd 4sd 4 d 4d 4d 4 d 4d 4сd 4%nd 4Ve 4  e 42e 4'e 4 5e 4sNe 4X[e 4we 4e 4ze 4Qe 42e 47)e 4e 4ee 4պf 4@"f 4Xf 4f 4+f 4nf 4сf 4 f 4Yf 4g 4=g 4Jg 4-h 4[0h 4'YPh 4]h 4jh 4rF}h 4 h 4h 4i 4i 4_i 4(j 4HV j 4j 4'j 4,4j 4kj 4!j 4j 4 j 4 j 4k 4 k 4€-k 4~:k 4tP]k 4Hkk 4yk 4k 4 k 4>Ak 4k 4^k 4[k 4Al 4l 4[l 4Y^+l 49l 4Yl 4A)hl 42vl 4Cl 4l 4Ll 4@Bl 4l 4ul 4+l 4rFl 4r m 4&m 45(m 4Hm 4Vm 4 dm 4A)rm 4km 4m 4m 4?m 4m 4rm 42m 4Zn 4@n 49 n 4o-n 4@|n 4+Ln 4ˤn 4"n 4'Yn 4{Kn 4n 4n 4n 4o 4oo 4ջ(o 4V5o 4[pBo 4o 4o 4o 4ko 4ao 4no 4o 4Yo 4p 4Xp 4ئ$p 42p 4@p 4VSp 4ap 4وop 4}p 4p 4p 4Zp 4fp 4Up 4p 4p 4hp 46p 4q 4'Yq 4% q 4$^-q 4;q 4oq 4k|q 4q 4 q 4sq 4[q 4q 4q 4Hq 4oq 4q 4 r 4r 4I&r 4}-3r 4tMr 4[r 4='lr 4xr 4Yr 4Ir 4or 4>Xr 4r 4Ir 4jr 4r 4Ir 4ps 4Is 4s 4r2s 4?s 4 xUs 4gs 4`s 4Ss 4[s 4s 4s 4bis 41t 4.$t 4"0t 4=t 41Jt 4EWt 49Idt 4uqt 4~t 4At 4Ft 4qtt 4t 4t 4t 4dt 4t 4%Mt 4rc u 4CY/u 4g=u 4 Ku 4Yu 4gu 4vuu 4u 4u 4ju 4u 4tu 4u 4DWu 4u 4u 4lv 4sv 4#v 4{1v 4?v 4Mv 42V[v 4:iv 4wv 4v 4Nv 4v 4=cv 4#v 4v 4v 4ev 4Mv 4pw 4w 4w 4S-w 4 x 4$ 4b 4k 4W 4$) 4~͋ 4C܋ 4q 4w 4 4q 4" 4I0 4]> 4L 4Z 4i 4x 4 4  4 4 4* 4̌ 4ڌ 4 4 4 4I) 4T 4ʸ. 4wF< 4J 4/X 4f 4_t 4Z 4@ 4 4t! 4  4ȍ 4W֍ 4 4[ 4+R 4\ 4 40, 4; 4I 4W 4*e 4s 4 4 4 4  48 4ѧǎ 4YՎ 4 4 4=} 4> 4 4) 4z7 4E 4{h 4zr 4 40G 4  47 4q 4Ə 49 ԏ 4e 4[ 4 4hv+ 4t\9 4G 4XU 4uc 4q 4 4 4'Y 4r# 4 4cː 4ې 4 4( 4+ 4 4 * 4pqF 4T 4Ib 4tJq 4 4ZA 4 4"ȑ 4ב 4 4 4B 4ic 4-+ 4OR 4^` 4ou 4Ӹ} 4Ec 4ٮ 4 4pȒ 4r֒ 4B 4> 4  4 4n 4Fi* 4nd8 49F 4LT 4'Yb 4VOp 46~ 4 4R  4 4 xȓ 4t{Փ 4 4q 4 p 4F 41 4\T 4_a 4n 4 4!k 4U 4b” 4"ϔ 4ܔ 4 4 4 4| 4 4I* 47 4D 4$Q 4O^ 4lk 4bx 4& 4^ 4, 4Q! 4v 4ƕ 4 4U 4 4_- 4Q!: 4,M 4t 4 4C 4 4B 4'Y 4MDՖ 43ߖ 4 4 4' 4| 4 x 4)$ 41 4$"> 4 K 4zX 4&e 4Fr 4 4hi 48 4F 4 4cǗ 4yWԗ 4  4P 4 4Qc 4 4|" 4N/ 4S< 4'YI 4XV 4Ise 4t 4p 4 4w 4 4&˜ 4]OИ 4Oޘ 4 4D 4$# 4$ 4ٹ2 4@ 4LN 4@i\ 4nj 4mx 4 4 4\ 4 4In 4̙ 4bڙ 4 4 4Y 4 4t 4h. 4e< 4'J 4X 4Bf 40t 42 4:% 4l 4B 4  4Ț 4֚ 4$I 4Ȃ 4"  4  4ď" 4Y/ 4< 4 xI 4V 4i 4 s 4} 4f 4  4 4E 4ɛ 4Cכ 4 4S 4 4w 4q 41 4c; 4.H 4˚U 4Ib 4ߣo 4| 4C 4~ 4 4 4@Ŝ 4Ӝ 4e 4˚ 4K* 4 4 4 p# 4H!1 4O? 4[M 4'[ 4dj 4Qy 4% 4= 4G 4] 4{&ĝ 4ӝ 4g 4 4X' 4L 4w 4 . 4D< 4+J 4r^ 4x 4)^ 4 4V 4| 4MϞ 4wٞ 4d] 4H 4 4 4 4$ 4X1 4> 4]K 4X 4e 4gr 4 4M 4'Y 4B 4] 4ҟ 4m 4 4| 4X 4% 4`u3 4A 4O 4&] 4k 4UBy 4ε 4  4 4G 4R͠ 4AH 4 4" 4Ϋ 4n& 433 4B@ 4M 4a 4`n 4ZZ{ 4{ 4L 4 4o 4¡ 42ϡ 4'Yܡ 4ӈ 4[ 4F 4Xi 4B# 4t- 4%7 4#A 4St_ 4l 4$^y 4# 4 4x 4w 4 4 ]ʢ 4ע 4 4Ӵ 4 4W 4% 4O 4[ 4`t 4 4*Z 4 4d 4 4ȣ 4գ 4 4 4t{ 4}- 4[" 4'Y/ 48< 4J 4X 4f 4t 4 4 4 4ȴ 4ʤ 4~٤ 4 4 4& 4> 4yZ 4C' 4N 4u 42 4Ω 4 4 4 4&å 4cХ 4ݥ 4mh 4 4 ! 4N 4G 4z, 49 4F 4בT 4wa 4 { 4N 4 4 4 4. 4@Oʦ 4צ 4 4'Y 4˚ 4 4& 4D? 4L 4Y 4f 4 4O 4˚ 4ѧ 4ݧ 4S 4 4 4 4~* 4 x7 4}-Q 4t^ 4l 4x 4k 4 4  4 4lɨ 4s֨ 4# 4 4$^ 4C 4  4ne 4! 4' 4- 4G3 4vi9 43s? 4SE 4 K 4#Q 4:W 4F] 4c 4#i 4to 4v 4 4 4ݽ 4 4 4x 4 4 4 4' 4T@ 4' 4oI8 4E> 4 D 4-J 4fP 4CV 4{\ 4b 4h 4 p 4ƞz 4 4 4V 4  4  4l 4Aڪ 4F 4'Y% 4,3 4@ 4OM 4} Z 4h 4 u 4 4Jk 4% 4~h 4 4Zƫ 4Vԫ 4# 4+O 4) 4|"6 4C 4JkP 4d] 4bj 4} 4! 4 4&w 4Ĭ 4Ѭ 4ެ 4t{ 4 E 4m 4 4 4N, 49 4JkF 4&S 4ʝ` 4$cm 4z 4 4k  4M 4 4-~ 4Zɭ 4׭ 4C 4 4R 4N3 4!? 49GU 4*tb 4o 4# 4 4 4 4ή 4(ڮ 4 4% 4 4z) 4ʥ6 4(PC 4BP 4]^ 4o 4u 4F{ 4s` 4>Q 4F 4 4) 4 4# 4i 4B̯ 4ٯ 4 4 4ڔ 4Ԛ 4g. 4@Q 4G^ 4ik 4$^x 4" 45 4' 46 4oǰ 4߰ 4N 4? 47v" 40 4: 4PMG 4T 4 xa 4Dn 4 4Y 4  4j 4'YƱ 4ӱ 4| 4 4 4 4O 4G] 4, 4#9 42S 4+` 4Cm 4 Pz 4n 4' 4lG 4n 47 4{nȲ 4]ղ 4 4J 4b 4 4[ 4N. 4%pC 4P 4 x 4 4 4_W 4U³ 4Nճ 4% 44 4ٕ 4E 4 - 4@ 4W 4Td 4^r 4 4=m 4 4с 4'Y 4wڴ 4}- 4) 4L2 4> 4&d 4 { 4 4  4%͵ 4Έ 4'Y 4N 4_W 4&) 4vd7 4mU 4;rn 4,| 4e 4[  4Q 4 4ԉ¶ 4*| 4z 45 4e 4d# 4h1 4\? 4X 4f 4t 4" 4 4IϷ 4- 4 4P 4 4j 4W' 4i5 4C 4Q 4?_ 4m 4a{ 4 4W 46L 4 4Ǹ 4yո 4M 4A\ 4y 4* 4O8 4G 4 U 4d 4cr 4Z 4X 4nj 4 4>ù 4Hѹ 4P 4KL 4  4= 4Q 4$[ 4bi 4&w 4 4w 4 4, 4 4nl˺ 4Cٺ 4 4k  4 L 4f 4 4- 4[; 4Q^ 4.l 4N 4h 4! 4Dʻ 4ػ 4 4B 4 4|% 4wE3 4QA 4] 4܁k 42y 4 4 4U 4L 4n 4RLͼ 4%ۼ 4 4B 4 4& 4! 40 49h? 4N 4] 4]Pl 4s{ 4| 46 4 4  4`ƽ 4ս 4O 4$ 4@ 4_ 4/ 4> 4EM 4\]\ 4ևk 41z 4 4 4'Y 4(g 4 ž 4}-Ծ 4v 4[ 4 4 4 4aX. 4o= 4L 47v[ 4Pj 4y 4K 4 4e 4! 4 4 4 4s 4`o& 4Q= 4Q 4'Y 4 4;r 4 4 4P 4a 4 4a 42 4 4 4Ev 4 4d  42 4P% 4w - 4D> 44D 4rJ 4P 4mV 4 \ 4b 4h 4n 4t 4sz 4~ 4Mi 4% 4 4 4X 4g 4 4ߞ 43 4g` 4 4H 4Z 4 4  4Q 4o] 4_ 4 4> 4f 4 4 4l 4 4| 4Pd" 4S( 4{. 4$5 4A 4UfM 4Y 4Xe 4ط 4eI 4 47 4j 4 4be 4# 4 4կ 4\ 4 4 4] 4" 4V0 4D 4P 4^ 4(l 4[z 4Z 4 4 4D 4 4 4D 4D 4CC 4 4 4 4 4ou 4 4 4 48Y 4 4! 4M 4# 4Y 4?, 4'Y: 4t{H 4V 4d 4r 4 4 4 4ߖ 4 4T 4n 4% 4- 4} 4: 4s/ 4e> 4M 4\ 4k 4z 4  41# 4| 4v 4ˮ 4vC 4n 4n 4\ 4 4  4"/ 4d\ 4Uk 4az 4 4a 4 4*T 4U 4# 4 4& 4" 4Q/ 4]< 4T 4#Va 4n 4 4j 4 4^ 4  4Z 4 4 4 4 4F 4с: 4*TG 4T 4!a 4 xn 4}c 4 4 4] 4` 4 4' 4d 4< 4Ʋ% 472 4^@ 4 4 - 4 4@b 4 4 4 4" 4U/ 4nF 4S 4Iz 4 4S 4с 40 4V 4 4k 4 4# 4K 4)X 4׆r 4 4b 4 4 4 4S 4 4с 40 4V 43 4A 4Z 4m 4 w 4\ 4 4 4 4X 45 4P 4 4I 4q 4 4U# 4U 4x 4? 4 4, 4Ʉ 4-( 4ǐ 4K 4G 4g 4J% 4 4v'' 44 4MA 4N 4y[ 4h 4 4 4o 4| 4l 4Ko 4 4 4 4C 4%n* 4 |8 4E 4LR 4@i_ 4ѧm 4i_z 4wL 4\ 4 4o 4X 4 4D 4np 43Q 4ٹ3 4~PA 4N 4|[ 4oh 4u 4D 4 4 4F 4 4\ 4n 4ƛ 4n' 4r 4Q 4 4! 46c. 4<"; 4H 4V 4Koc 4p 4} 4 47a 46 4 4 4 4h 4 4Q 4^ 4@ 4 4) 4In7 4E 4S 4ba 4^^o 4V} 4 4; 4R 4J 4 4 4 4W 45 4j 4  4m)& 4: 4D 4fQ 4_ 4ąl 4My 4d) 4 4P 4j 4+ 4Nf 4 4 4L> 4J 4 _ 4k 4 4 4+ 4[R 4'Y 4 4 4I 4r 4ݸ 48. 4< 4 J 4rEX 46f 4Gt 4o 47  4_  4 4 48 4 49 4` 4 4!v 4s, 4; 4BJ 4eY 49v 4 4 4n^ 4  4 4 4) 4 4 41 4c 4;* 49 46H 4RW 4@f 4 4J 4L 4 4M 4Q 4 r 44 4L 4Nj 4( 4 7 4DF 4U 4Rd 4 s 4  4^ 4) 4 4 4 4v 4" 4#0 4R= 4 xJ 4W 4Xd 4Qr 4 4og 4 4u 4 4L 4܃ 4* 4 4 4{ 4 4B 4 4S 4 4_M 4 4} 43# 4) 4/ 4SK 4W 4,e 4]s 4 4G 4 4m 4 46 4( 4Ӏ 4& 4at 4% 42 4Ng 4+) 4_6 4G 4M 4S 4Y 4_ 4JAe 4V!u 4 4Ɓ 4gs 4 4 4ؘ 4 4 4 4s$ 4H! 4j/ 4%= 4M"K 4i 4Su 4 4l 4PI 4  4 4 4 4 44 4v 4" 4n\0 4 > 4]L 4Z 4x(h 48]v 4  4 4X 4N 4 4 43 4?! 4  44 4 4% 4, 4FY 4f 4Zy 4с 4ѱ 4F 4p* 44 4 4 4. 4" 4 4 4י 4$ 4!1 4M> 4lK 4SX 4}e 4r 4! 4 4 4l 4 4# 4 4 4X 4ɷ 4 4 4- 4N; 4.NI 4n 4= 4f 4.w 4 b 4 B 4 4 4: 4 & 4#4 4^rB 4n 4 4I 4 4h 4"b 4A# 4Z1 4? 4M 4[ 4i 4Sw 4SV 4I 4 4 4` 4 4'Y 4H 4 4 4 4 4o< 4&J 4aY 4g 4u 4 4` 4g- 4v 4 4 4 4 4f 4 4! 4\b/ 4@= 4dK 4lY 4g 4{u 4, 4 41 4 4 4  4'Y 4Y 4F 4~ 4! 4>/ 4+W= 4IK 4`Y 4 4nk 4 4?% 4 4c 4, 4/ 4!O 4f 4>" 4r0 4{> 4,L 4Z 4gh 4#v 4Cl 4d 4 4B 4 4DE 4S 4a 4N| 4q 4 4 4IH 4* 4L 4 4! 4ݫ 4A 4xo 4  4 4l 4S1 4&> 44!k 4rx 4@] 4^ 4P 4 4X 4oX 4 4aL 4ma 4 4 4  48@% 473 4A 4O 4Z] 4Jk 4]y 4i 46 4e 4~ 4 4 4[D 4 4?j 4f 4"] 4J, 46 4C@ 4cmJ 4sT 42b^ 4l 4z 4 4MO 4 4 4 4@ 42 4 4 4# 4< 4-I 4La 4*o 4| 4Z 4 4 4~ 4 4 l 4J 4Y 4] 4Gt) 4r7 44!E 4NS 4da 4o 4} 4 4 4 4o 4 4 4  4 4v| 4` 4B 4o% 4E3 4MA 4ZO 4a] 4k 4y 4/] 4 4E 4 4 4^ 4P 4`" 4 4& 4|3 4@ 4FM 4Z 4g 4aGt 4t 4e 4 4ي 4R 4; 4" 4 4 4 4` 4y 4j 4A1 4P; 4uE 4co 4& 4u 4 4h 4]v 4R 4bE 4 4  4B 4& 4&| 45O 4 42 4Ԋ 4 x 4 4_W 4& 4? 4{L 4Y 4% 4- 4 4 48 4B` 43q 4`w 4z@} 4"0 4yl 4S 4S 4x ` 4m 4z 4 4 4C 4O 4| 4P 4e 4i 4" 4/ 4b< 4%I 4QV 4˻c 4[p 4}} 4դ 4L 4wV 4  4. 4 4ߘ 4?I 4 4\ 4G 4# 4˯1 4 }? 4N 4_ 4e 4k 4('q 4Nw 4 h~ 4?P 4 4 4' 4 4/@ 4պo 4 } 4 4 4 4 4 4($ 41 4-? 4L 4ѮY 4f 4 4 4 4 4H@ 4 x 4 4 4 4S  4'Y 4&9 4#F 4 g 47 4& 42 4 4Ƚ 4& 4 4a 4 4 4  4B 4' 4K5 46UC 4QQ 4_ 4x 4 4 4P 4& 4E 4 4 4# 4I  4k 4% 4D3 4A 4O 4_ 4wo 4 4] 4j 4? 4 4j 4с 4` 4-m 4B 4" 4 " 4Z6 4}C 4P 4&g 4is 4b 43M 4P 42 4% 4i 4B 4ߠ 46U 4W 4  4L 4+ Z 4@|h 41  4 4D 4G 4u 4#} 4  4 4+ + 4Q8 4^E 4!R 4H 4 4 4l 4*e 45Y 4Af 4s 4 4 4 4O 4 4u& 4@ 4,N 4сj 4zjx 4v 4mW 4I 48 4m 4 4 4 4+M 4b 4.B( 4>7 4~F 4U 4Vd 4 s 4+ 4J 4jE 4'l 4-  4NV 4 4t 4 4; 4& 45 4%D 4~S 4& b 4r 4_ 4 4' 4 4* 4= 40 4c 4- 43g" 4c/ 4-K 46W 43gc 4.o 48{ 4 4` 4 4 4O 4 4 4 x 4w- 4K9 47E 4tR 4^ 4}z 4 4o 4 4/ 4~A 4f 4aR 4s 4% 4V 4e 4 4# 4OH 4hU 4| 4 4t{ 4'Y 4_ 4 4+- 4?G 4n 4 4R 4 4 4 4Ӫ 4& 4a 4Z 4`* 47 4uQ 4IYj 4x 4 4b 4P 4@| 41  4 4C 4b 4s 4'y 4h 4Pn 4n 4k 4 4K 4r 4s 4 42 4V 4l* 4d8 4#F 4qUZ 4> 4zG 4 4 4 4S 4 4| 4j% 4^E 4a 4n 4{ 4D 4/a 4~ 4t 4 4 4 4  4x 4W 4 4! 4$? 4yDL 4Y 4Rbf 4ms 4 4'Y 4 4O 4B 4 4u 4 4T 4 4'Y! 4|4 4awA 4O 4#[ 4Mi 4iw 4 4 4f 4d 4 4 4L 4} 4~ 4E 4آ 4u 4'*- 4; 4rI 4W 4e 4Ds 4X$ 4 4g 4  4s 4V 4  4q 4c 4%d 4 4 4]@" 4( 4a. 45 4aC 4Q 4˚_ 4em 45*{ 4ǰ 4- 4 4  4 4 4? 4h 4!H 4\  4 4)( 4A7 4,F 4(U 4h~c 4q 4 4_ 4} 4 4zS 4 4 4 4U 45  4E, 4& 44 4KB 4|P 4ʇ^ 4ȓn 4ř~ 4 4h 4 4~ 4) 4 4  4: 4 4 4N, 4ښ: 4H 4V 4$d 4~Hr 4r 4/ 4" 4 4L 4 4I 4 4 4 4K) 46 4E,C 4"P 4\] 4(j 4Ÿw 4 4- 4 4- 4 4V 4 4D 4f 4W$ 4u@ 4@N 4\ 4,j 4x 4ڭ 4 4m 4 4h 4w 4sM 4! 4 4+ 48 4=E 4R 4/]_ 4gl 4_y 4 4f 4 4$ 4 4 4A 4! 4}-&! 4%3! 4]@! 4LM! 4Z! 4g! 4t! 4=! 4! 4/]! 4! 4f! 4;! 4sM! 4o?" 4L" 4Y" 4 f" 4sMs" 4" 4T\" 4" 4" 4/" 4" 4!" 4HN# 4[# 4h# 4;u# 4# 4T\# 4# 4L# 4#%# 48# 4R# 4p# 4I# 4G$ 4/$ 4=$ 4K$ 4AMY$ 4Kh$ 4My$ 40$ 4$ 4$ 4cn$ 4`$ 4=$ 4n $ 4$ 4۱$ 4$ 4j@$ 4$ 4_$ 4% 4]% 4Q% 4#.% 4M8% 4 TI% 4O% 4U% 4ǹ[% 4&a% 4g% 4m% 4st% 4K% 4l% 4N% 4% 4Q% 4E% 4% 4R% 4% 4$q% 4% 4% 4& 4%& 4!/& 4SC& 4b& 4l& 4nrv& 4,& 4& 4& 4& 4& 4& 4V& 4M& 4& 4d' 4' 4|&' 4Y3' 4=F' 4R' 4p_' 4m' 4sy' 4' 4y' 4[' 4' 4a' 4' 4' 4%' 4q' 4f( 4|u( 4V"#( 4B`1( 4?( 4UYN( 4]( 4 l( 4"{( 4z]( 4K( 4 ( 4@( 4Y( 4( 4( 4( 4( 4( 4( 4( 4( 4>) 4B ) 4) 4) 4') 4o-) 43) 4V9) 4?) 4E) 4;K) 4DQ) 4W) 4]) 4c) 4i) 4o) 4u) 4 {) 4LE) 4W) 4) 4~) 4) 4)) 4) 4) 4?) 4 ) 4) 4) 4) 4) 4j) 4Z) 4`) 4h) 42) 4m) 4* 4w * 4`* 4d* 4Y&* 4I4* 4uB* 4P* 48^* 4bz* 4{* 4b* 4/* 4@* 4с* 4* 4'* 4* 4&R+ 4+ 4 @+ 4fQ+ 4W+ 4X}]+ 4Hc+ 4tj+ 4w+ 4'Y+ 4R+ 4i!+ 4β+ 4ak+ 4(+ 4G+ 4+ 4+ 44}+ 4& , 4, 4:|&, 44, 4B, 41P, 4^, 4/+l, 47Hz, 4i, 4+, 4T\, 4d, 4}-, 4e, 4, 4w, 4l- 4v - 4_- 4R&"- 4u0- 4 >- 4L- 4`- 4_m- 4z- 4e- 40 - 4'Y- 4- 4- 4)- 4*- 4- 4"- 4yU. 4. 4w". 4O0. 4]>. 4EL. 4Z. 4h. 4v. 4. 4Dm. 4G. 4*. 4. 4. 4z. 4\. 4. 4o/ 4f/ 4/ 4,/ 4N:/ 4H/ 4GV/ 4d/ 4nr/ 4 / 40/ 4/ 4/ 4f$/ 4/ 4/ 4jQ0 4u0 4!0 4׾?0 4I0 4X0 4b0 4ښl0 4pvv0 4e0 40 40 40 40 4T+0 4"&0 470 4 0 40 4,D0 4a0 41 4S1 4C2 4e2 4k2 42 41&2 4fV2 4P2 4u 3 4q3 4n$3 413 4>3 4lVK3 4ՎX3 4&e3 4Ur3 43 4Y3 4 4# B> 4O> 4\> 4i> 4[v> 4l> 4n> 4> 4T> 4> 4> 4> 4H> 4 > 4OR ? 4? 4+&? 4!4? 4 B? 4YP? 4#^? 4l? 4z? 4_F? 4݆? 4@ 4J @ 4ZI@ 45%@ 4]3@ 4'YA@ 4 O@ 4pZ]@ 4k@ 4@ 4I@ 4@ 4l@ 4H@ 4@ 4YA 4A 4Z(A 45A 4ANA 4'Y[A 4hA 4ԞuA 4RA 4]A 4A 4A 4A 4:A 4CA 4A 4NA 4\\A 4 B 4B 4PN)B 4p7B 4oEB 4zYSB 4+_aB 4@oB 4U}B 4B 4+B 4vB 4B 4cB 4,B 4B 4?C 4C 4(C 4*C 4V8C 4%FC 4JTC 4bC 4-C 4C 4<^C 4XC 4C 4xC 4DC 4nC 4nC 4 D 4+D 4H&D 45D 4aCD 4dQD 4D_D 4dmD 4D 4 #D 4D 4 D 4,D 4*D 4rE 4EE 4E 4'Y.E 4=E 4fE 4tE 4E 4%E 48E 4'YE 4E 4E 4hE 4&E 4E 4 F 4F 4a)F 47F 4EF 4SF 4CDaF 4oF 46U}F 4QF 4G 4DFG 4G 4qH 4"H 4 x0H 4'?H 4IH 4SH 4hH 4L rH 43eH 4vH 4H 4T*H 4LpH 4H 44H 4 xH 4I 4/I 4 I 4TI 4gI 4RI 4I 4J 4J 4 J 4J 4NJ 4J 4^U$J 4}*J 40J 4*6J 4:wK 4DK 4IJK 4]PK 4VK 4N\K 4pbK 4֓hK 4nK 4ڂtK 4UzK 4՟K 4GK 4LK 4RK 4vK 4K 41K 4K 4yK 4K 4K 4) K 4dK 4MK 4$K 4K 4pK 4 K 4uK 4K 4+K 4UHK 4L 4 L 4L 4:L 4L 4<"L 4(L 4WS.L 44L 4]:L 4@L 4?FL 4-LL 4RL 4XL 4#^L 4;dL 4jL 4pL 4vL 4l|L 4DeL 4nL 4 L 4L 4{$L 4L 4/,L 4L 4L 4L 4-L 4dL 4L 4ZL 4&L 4!L 4^L 4ՏL 4L 4Q|L 4vL 4hM 4ͼM 4 M 4k%M 4rM 4M 4r+$M 4*M 4t0M 4)6M 4P#M 4zM 4M 4M 4#M 4TM 4PM 4M 4M 4pN 4`N 4BN 4'N 4X3N 4?N 4oKN 4WN 4dN 4;rqN 4uN 4N 4N 4.N 46N 4N 4.O 4eO 4)O 46O 4`DO 4oQO 4_W^O 4kO 4S$xO 4زO 4 O 4}O 4-fO 4rO 4ebO 4)O 42O 4O 4 P 4EP 4;$/P 4

a 6.Ba 6*Ka Ua 7-ba 6Dfa 6Boa ya 7-a 6Sa 6Qa a 7-a 6ba 6`a 6ra 6pa a 7-a 6a 6a 6a 6a a 7- b 6b 6b 6b 6&b 9b Cb 7-Pb 6Tb 6]b gb b 6b 6b b b 6b 6b b b 6b 6b c c 6c 6%c /c Hc 6Lc 6Uc _c xc 6(|c 6&c c c `c 7-c 69c 67c d w(d =d  Gd jd d d d d sd 4=d e 4e 6Je 6Fe 4I#e 6l'e 6b,e 4CY7e 6;e 6Ze 6^e 6he 4qze e 7-e 6e 6e 6 e 6e 7-e 6$ e 6" e e 7-e 66 e 62 e 7-e f f 6S #f 6Q -f 7f Sf 6b Wf 6` `f jf f 6q f 6o f f f 6 f 6~ f f f 6 f 6 f g  g 6 $g 6 j 6 Nj 6K Rj 69 bj 6 fj 6 vj 6 zj 6 j 4j 6n j 6` j 6 j 6 j 7(j 4_Wj 6 j 6 j 4Ij 6 j 6 j  j 7(j 6& j 6 k 7( k 6C  k 6? k  k  9k 6a =k 6_ Fk 6q Jk 6o Sk  ]k  uk 6 yk 6~ k 6 k 6 k  k  k 6 k 6 k 6 k 6 k k 7(k 6 k 6 k l l 6 #l 6 ,l 6l Ol 6 Sl 6 \l fl l 6 l 6 l l l 6l 6l l l 6l 6l l m 6%m 6# m =m &Vm `m 7(qm 66um 64~m 6Im 6Cm m m 6lm 6jm m m 6{m 6ym n n 5n 69n 6?n cn |n @n 7(n 6n 6n ӵn ӵn 6n 6n ӵn 6n 6n ӵo ׵#o ]Fo Ado o 4o @o 6o 6o 4o 6o 6o 6Uo 6Mo 45 p 6 p 6p p 7,.p 62p 6;p 6?p 6Ep zp p p #p :p 4Kup @q 6"q 62q 6=6q 6-;q 45 Fq 6Jq 6Oq 4,Zq 6^q 6mq 6Mqq 6/q 6q 6q 4q 6q 6q 6q 6q 4 q 6q 6sq 4 q 6q 6q 4Rq 6vq 6^q 6q 6q 4r 4r 6r 6#r 4U)r  2r 7C*;r 4$Vr 6Zr 6jr 6nr 6~r 60r 6$r 4.r 6r 6kr 6r 6r 4r 6rr 6lr 7*r 4qr 6r 6r r 4s 7x*s 7x*4s >s 7*Os 6 Ss 6 ]s gs s 6s 6s 60s 6.s 6?s 6=s 6Ns 6Ls s s s  t  $t 6](t 6[2t Eu 6`Bu 6^Ku 6pOu 6nXu ٻbu ٻzu 6~u 6}u 6u 6u ٻu ٻu 6u 6u 6u 6u u 6u 6u v Rv 7a+%v 6)v 67v RAv 7a+Mv 6Qv 6_v Riv 7a+uv 6yv 6 v v v 6+v 6)v uv uv 6<v 6:v ׼v 7s+w 6Ww 6Iw 6!w 6*w 6.w 6 7w 6p;w 6`Dw 6Hw 6Mw 7s+Vw 6F Zw 66 cw 6 gw 6 pw 6 tw 6 }w 6"w 6 "w 6""w 6"w 6K"w 6A"w 6"w 6|"w w Tw w ׼w ׼w 6#x 6# x x 7+(x 6.#,x 6,#6x @x ]x 6@#ax 6>#fx x >x 7+x 6U#x 6S#x Cx Lx 7+x 6p#x 6h#x 7+x 6#x 6#x L y Zy 7+!y 6#%y 6#.y 7,;y 6#?y 6#Hy ZRy 7,cy 6#gy 6#ly 7,uy y y y 6 $y 6 $y 6$y 6$y y y 6*$y 6($y 6:$y 68$z  z #z 6I$'z 6G$0z 6Y$4z 6W$@z ¾Uz 6h$Yz 6f$bz ¾{z mz z 7,z z z z z { { ={ 6w$A{ 6u$P{ Z{ s{ 6$w{ 6${ 6${ 6${ { { 6${ 6${ 6${ 6${ { { 6${ 6${ 6${ 6$|  | {9| C| e| o| | 6$| 6$| | | 6$| 6$| | | 6%| 6%} ν} 7*,"} 7*,+} 6%/} 6%8} νB} 7B,O} 66%S} 64%a} νk} 7B,w} 6F%{} 6D%} ν} 7B,} 6V%} 6T%} } } 6f%} 6d%} } ~ %~ C~ M~ j~ t~ ~ 6w%~ 6u%~ ~ ~ 6%~ 6%~ ~ ~ 6%~ 6%~   ' 1 J 6%N 6%\ f ~ 6% 6%        A K c 6%g 6%p z  6% 6%  À 6%ǀ 6%Ѐ  & J 7R,& J0 JR J\ Jz J J J JɁ 6%́ 6%ց J J 6& 6 & J J) 6&- 6&6 JS l {v 7d, 60& 6.&   7t,Ƃ 6G&ʂ 6C&ς ſ / ſ 7, 6s&# 6i&( 7,1 6&5 6&> ſS ] 7,i 6&m 6&v 7, 6& 6&  7, 6' 6 ' 7, ̓ ׃  6-' 6+' 6=' 6;'  / 6L'3 6J'< 6\'@ 6Z'I S k 6k'o 6i'x 6{'| 6y'  6' 6' Ä <̈́ < 6' 6' 6' 6' < <+ 6'/ 6'8 <B <[ 6'_ 6'h <r < 6' 6' < < 6' 6'ƅ <Ѕ < 6' 6' < < 6( 6(, I6 IO 6(S 6(\ If I 6(( 6&( 68( 66( I I 6G( 6E(Ȇ 6W(̆ 6U(ن N 7, 6h( 6d( N N( 6(, 6~(5 N? NX 6(\ 6(e No N 6( 6( N N 6( 6(ɇ NӇ N 6( 6( N N 6( 6() NF X ob o 6( 6( 6( 6( o o 6) 6)Ɉ 6)͈ 6)؈   6') 6%) # - F T a Jy n *Љ ډ  6<) 6:) * *, 6K)0 6I)9 6\)= 6Z)F 6n)J 6l)S 6~)W 6|)\ J~  # y :  ! . 8G a ɸk 7)| 6) 6) 6) 6) 7) 6) 6) ɸ ɸċ 7)ڋ 7)ߋ θ  z . θ 7)* 6). 6)7 6); 6)D θN 7)Z 6)^ 6)g 6)k 6)t θ~ 7) 6* 6) 6* 6*  7)Ō 6%*Ɍ 6*Ҍ 6J*֌ 6B*ߌ 6}* 6w* 7) 6* 6*   7*& 6** 6*3 7*8 #P  z] .m #w # 6* 6* 6* 6* # #Ѝ 6+ԍ 6+ݍ 6+ 6+ # # 6(+ 6&+ 6:+ 68+* RC 6L+G 6H+P 6j+T 6d+Y h 7#* 6+ 6+ x xĎ 6+Ȏ 6+ю 6+Վ 6+ގ 6+ 6+  73* 6+ 6+ & > عH عe 6+i 6+s } 7, 6+ 6+  ɏ 5   I *I 4O  q 6+u 6+ 6M, 6G, 6y, 6k, 6, 6, #Ȑ 4IӐ 6-א 6- # # 6. 6. 6). 6'.! #+ #D 6<.H 6:.Q 6L.U 6J.^ #h # 6[. 6Y. 6k. 6i. # # 6z. 6x.ɑ 6.͑ 6.ڑ 3 7# 6. 6. 6. 6. S S7 6.; 6.D SN Sg 6.k 6.t 6.x 6. S S 6. 6. 6. 6. 3Ԓ ` F 7  6 / 6/ 6@/ 6:/" 6d/& 6^/+ 7 4 6/8 6/A FK 7 \ 6/` 6/i 7!r 6/v 6/ F F 60 60 6!0 60 7!ɓ 610͓ 6/0ٓ b 7'! 6G0 6A0 7'! 6l0 6d0 b( p2 7C!> 60B 60K 7U!X 60\ 60e po 7U! 60 60 7U! 3 D DȔ 60̔ 60Ք 60ٔ 60 D D 60 60 6 1 6 1 D( D@ 61D 61M 6+1Q 6)1] Pr 6:1v 681 P 7g! 6K1 6G1 6f1 6d1 ɕ 7z!ڕ 6u1ޕ 6s1  7! 61 61  . 612 61; E ^ 61b 61k u  61 61 61 61  ʖ 61Ζ 61ז 61ۖ 61   61 61 61 61' = G 7!T 62X 6 2a k 7!x 62| 62  7! 6,2 6*2  7! 6;2ė 692͗ ח 7! 6J2 6H2 6Z2 6X2  7! 6i2 6g2! 6y2% 6w2. 8 7!D 62H 62Q 62U 62g ڣq 7! 62 62 7! 62 62  ژ 62ޘ 62   63 63 ! : 63> 63G Q j 6#3n 6!3w   623 603 6B3 6@3  ֙ 6Q3ڙ 6O3 6a3 6_3   6p3 6n3 63# 6~33 I S 7!d 63h 63q { 7 " 63 63  7" 63 63 Ú 7"К 63Ԛ 63ݚ  7" 63 63 63 63  7"$ 63( 631 635 63> H 7"T 6 4X 64a 64e 64u i 7/" 6,4 6&4 6_4 6Y4 64 6}4 7/" 64 64ś iϛ 7J" 64 64 7_" 64 64 i i) 65- 656 6 5: 65D 7t"M 605Q 6.5] g 7"x 6D5| 6@5 7" 6^5 6Z5   7"œ 6x5Ɯ 6t5Ϝ 7"ܜ 65 65  7" 65 65 7" i& w0 wL 65P 65Y 65] 65f wp w 65 65 65 65 w wĝ 65ȝ 65ѝ 6 6՝ 6 6  66 66  7") 686- 6466 6S6: 6Q6C M 7"c m 7"    Ϟ ٞ  6b6 6`6  & 6r6* 6p68 B Z 66^ 66s Ѥ  7"  7" ˟ 7#ݟ  7#  7# 66 66" , 7#8 66< 66J T 7#` 66d 66x  3 4*Ƞ 4ՠ 4  4 4 4{ 4 4f0 4Nr 4~ 4 4 4  4 4. 4 k 4N- 4I: 4;rS 4Z 4$Ea 4&i 4bt 4{z  66 66 4jg 67 67â 6G7Ǣ 6?7̢ 7@ բ 4 67 67 4P 4ũ 4P 4ũ- 7 T } 67 67  67 67 ģ Σ  67 67 7S 4 67 67 7m  4u# 67' 67, A 4K 7} P 4[ 6 8_ 6 8e 4T%u 7 ~ 4  7 68 68 Ȥ ߤ    # #7 (I S 7 d 6)8h 6'8q 6:8u 668z  # С С֥ 6R8ڥ 6P8 6a8 6_8 С С 6r8 6p8 68# 68, С6 СO 68S 68\ 68` 68i С~ 68 68 ۡ ۡ N Nڦ 68ަ 68 68 68 N N 68 68# 68' 680 N: NS 69W 6 9` 69d 69m N 619 6-9   ŧ ާ  6L9 6J9  ' P 6[9T 6Y9] r 6j9v 6h9    6{9 6y9ʨ Ԩ  69 69 7  69 69 2 J Ȣa ||  4X  4 69 69 / 69 69 / T/ \G d\ j 4x 4 4 4q 4>G Д۪ 69ߪ 69 4 6: 6: 4O- 6C: 63:' 6:+ 6:0 70 9 4qD 6:H 6:N uc 4޶q { 7( 6 ; 6: 6h; 6\; 7( 6; 6; 6; 6;ū 6=<ɫ 65<ҫ 6k<֫ 6c<߫ 6< 6< 6= 6= 69= 6)= 6= 6= 6= 6= 6>$ 6>- 6:>1 6$>: fD 7CU 6>Y 6>b 6>f 6>k 7Ct 6?x 6> 6,? 6? 6n? 6d? 7_ 6? 6? 6? 6? 6?¬ 6?ˬ 6@Ϭ 6@ݬ  7 6-@ 6+@  ' 6<@+ 6:@4 > Z 6K@^ 6I@g 6\@k 6X@p    6s@ 6q@ 6@ 6@ŭ ݭ 7 6@ 6@ 7 6@ 6@ 6@ 6@ Ι* ΙG 6@K 6@T Ι^ Ιv 6Az 6 A 7 6A 6A 62A 6.A 6JA 6FA î 7Ԯ 6Aخ 6A  7 6A 6A 7 6A 6A% 6A) 6A2 6A6 6A? 6AC 6AL j t  6 B 6 B 6 B 6 B 6 B 6 B 6 B 6 BƯ 6Bʯ 6Bѯ   7 6,B 6*B 6BB 6>B 2 < 7 M 6pBQ 6jBV 7 _ 6Bc 6Bl   7# 6B 6B 75 6B 6B Ȱ 75ٰ 6Bݰ 6B 75   ! 6C% 6B. 6C2 6C; E ] 6 Ca 6Cj 60Cn 6.Cw   6@C 6>C 6PC 6NC ˱ 6`Cϱ 6^Cر   ښ% / L 6oCP 6mCZ 7Gl v  6~C 6|C 6C 6C m mײ 6C۲ 6C 6C 6C 6C 6C 6D 6D 6$E 6E |" 7\3 6HE7 6FE@ 6XED 6VEM 6lEQ 6jEZ 6{E^ 6yEh 7o~  7 6E 6E 6E 6E 6E 6E ʳ  6E 6E 6F 6F 6F 6F 6#F 6!F  < 62F@ 60FJ T l 6FFp 6DFy   6UF 6SF ; 7Ǵ 6fF˴ 6bFԴ 6~Fش 6|F ; ; 6F 6F J J7 6F; 6FD 6FH 6FQ J[ Jt 6Fx 6F 6F 6F   lƵ l 6F 6F q 7 6F 6F 6G 6G" q, qH 6#GL 6!GV ` x 64G| 60G 6LG 6JG   6[G 6YG¶ 6jGƶ 6hGӶ ݶ 7 6G 6zG 6G 6G 7 6,H 6(H 6LH 6FH' 6H+ 6kH4 6I8 6 IA K h 6(Il 6&Iv 7 6II 67I ӗ ӗ 6I 6IƷ з  6I 6I & &( -2 7 C 6IG 6IL 7 U 6IY 6Ib -w ; 7" 6J 6J 74 6>J 6 H 7Y 6vL] 6rLg ͘q 7 6L 6L 6L 6L ͘ ͘½ 6Lƽ 6Lн ܘڽ ܘ 6L 6L 6L 6L ܘ ܘ/ 6L3 6L< 6M@ 6ML a k 7| 6M 6M 7 6>M 66M  # 7ƾ 6hMʾ 6dMӾ 7 6M 6~M # 7 6M 6M 7 l* z4 zP 6MT 6M] 6Ma 6Mj zt z 6M 6M 6M 6M z zȿ 6M̿ 6Mտ 6Mٿ 6M  6N 6 N  +* +G 6&NK 6$NZ d 7u 69Ny 63N~ 7 6\N 6VN   7 6}N 6yN 7. 6N 6N  7. 6N 6N 7. V# b- bI 6NM 6NV 6NZ 6Nc bm b 6N 6N 6N 6N b b 6O 6O 6O 6O m 6!O 6O m 0# 0@ 60OD 6.ON JX 7@i 6?Om 6=Ov 6NOz 6LO J 7P 6]O 6[O 6lO 6jO   6|O 6zO 6O 6O   6O 6O' 6O+ 6O6 K U r 6Ov 6O  7` 6O 6O 7` 6O 6O 6P 6O   6kP 6iP 7r 7 6P 6yP 4 7A 6PE 6PN 6PR 6P[  e  ~ 6P 6P 6P 6P 6P 6P 6P 6P 6 Q 6Q $ ; 6#Q 6!Q 63Q 61Q ; ;7 6FQ; 6@QD 6uQH 6sQQ 6QU 6Q^ 6Qb 6Qk 6Qo 6Qt T a a 6Q 6Q 6Q 6Q 6Q 6Q 6R 6 R j E NZ Vd 7u 6#Ry 6R~ 7 V 7 6FR 6@R 7 6iR 6cR V b 7 6R 6R 7 6R 6R b" 73 6R7 6R< 7E U &_ &{ 6R 6R 6R 6R & & 6R 6R 6S 6R & & 6S 6 S 6S 6S 1% 6.S) 6,S2 1K gU 7f 6?Sj 6;Sx 7 6XS 6VS g 7 6jS 6fS 7     $ . K i is 7 i i i i i i i i( 6S, 6S5 i? iX 6S\ 6Se io i 6S 6S i }  f  0' ? Y ;l  4p 4 4 4 4 4;r 4( 4JW: 4 M 4Z 4m 4z 4 4e 4~ 4Ŷ 4  4 4 4." 4;r6 4r] 4j 4c 4. 4) 4N# 4q6 4oC 4V 4c 4 49o 4͖ 4  4 4Cp 4 4w 4\ 4 46 4k 4o- 4? 41K 4\ 40b 0 6S 6S 4. 6S 6S 4 6T 6T 4 6.T 6*T 7 4 6XT 6VT 4 6jT 6fT q 7 6T 6~T! 6T% 6T. 77 6T; 6TD qN qk 6To 6Tx 6T| 6T   7 6T 6T 6T 6T  7 6T 6T 6 U 6U 6"U 6 U  7, 61U0 6/U9 6BU= 6>UF 6XUJ 6VUO 7X 6iU\ 6eUa  ΐ 4Gj 4;r 4A 4k 4i  6U 6~U 4I' 6U+ 6U: 6U> 6UC 4CYN 6UR 6Ub 6Vf 6Vk 4uv 6+Vz 6%V 6QV 6OV 6V 6eV 4ȿ 6W 6W 6oW 6AW 6OX 6!X 4.} 6yY 6cY 4 6Y 6Y 6UZ 6?Z 7'' 49 4qG 7'P 4] 4-k c| 4 r 7( 6Z 6Z 6Z 6Z 6[ 6 [ 62[ 6,[ 7( 6R[ 6N[ 6q[ 6k[ 6[ 6[  7.(+ 6[/ 6[8 6[< 6[E 6[I 6[R 6[V 6[_ 7.(m 6\q 6\z  7A( 65\ 63\ 6D\ 6B\  7W( 6[\ 6Y\ 7m( 6l\ 6h\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\" @ J c 6\g 6\p 6\t 6\} 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ ת ת 7( 6\ 6\ 6*] 6$]  & C 6Y]G 6W]Q %[ %x 6h]| 6f]  %  = 7/# 6y] 6w] = 7/# 6] 6]) D3 7B#D 6]H 6]Q D[ 7R#h 6]l 6]u D 7b# 6] 6] D 7b# 6] 6] D 7b# 6] 6] 6] 6] D 7b# 6] 6] 6^ 6^ D( 7b#4 6^8 6^A 6!^E 6^U =_ =| 60^ 6.^ v 7r# 6E^ 6=^ 7r# 6^ 6^ { 7# 6^ 6^ 6^ 6^ 6^ 6^ 7## 6 _' 6_0 : V 6._Z 6,_c 6@_g 6>_p 6R_t 6N_} 6j_ 6h_   6{_ 6y_   6_ 6_   6_ 6_ [) [E 6_I 6_R 6_V 6_\ R  7#   7#  ۬ 7#  ˫ 7#/ 6_3 6_8 7#A 6.`E 6"`N 6`R 6w`[ 6`_ 6`h 6al 6rau 6ay 6a       9 7.$ H " H, 7C$= 6aA 6aF 7C$O 6bS 6b\ 6=b` 6/bi 6bm 6|bv 6bz 6b 6Hc 68c 6c 6c 6c 6c   7y$ 6d 6d 7y$ 6Id 6Ad 6d 6zd 7$ 7$ 6d 6d 7$& 6d* 6d3 6e7 6e< Z d  6,e 6*e 7$ L  o .   6=e 69e  ! 6Ue% 6Se0 : W 6de[ 6be` y      6ye 6we    7$ 6e 6e %7 ղS δe %o 7% 6e 6e  7% 6e 6e 7% 6f 6 f 6,f 6"f   6f 6f 7/% 7?% 6f 6f% nA K h 6fl 6fr T ر    6f 6f 7O% 6f 6f" 6g& 6f/ 6g3 6g< íQ 69gU 65ga k  6Qg 6Og 6bg 6`g 6wg 6sg 6g 6g E 7_% 6g 6g 7_% 6g 6g 6g 6g 6g 6g U 7r%% 6g) 6g2 U< 7r%H 6 hL 6hW Ea Ey 6"h} 6 h r r 64h 62h } 7% 6Mh 6Ch 7% 6{h 6yh 6h 6h 6h 6h 6h 6h 6+i$ 6%i- 6Mi1 6Ki: 6i> 6oiG Q 7%b 6if 6ip z 7% 6i 6i 7% 6i 6i   6i 6i   6j 6j 7% 6j# 6j, 6Xj0 6Tj9 C 7%U o  M d 7& 6pj 6lj x  7+& ! ճ< F 7=&W 6j[ 6j` 7=&n x 7T& 6j 6j 7T& 6j 6j   7k& 6j 6j 7}& 6k 6 k  7}& 6!k 6k 7}&' 37 @A @] 6>ka 6' 6tn 6rn  '6 P Z 7S'k 6no 6nx 6n| 6n 6n 6n  7i' 6o 6o 6o 6o 66o 62o 6Uo 6Mo 6|o 6xo 7' 6o 6o  7' 6o 6o) 3 7'? 6oC 6oN X u 6oy 6o   6o 6o 6o 6o   6o 6o 6 p 6 p   6p" 6p+ 6*p/ 6(p8 B Z 69p^ 67pg 6Ipk 6Gpy ߨ ߨ 6Xp 6Vp ߨ ߨ 6gp 6ep 6vp 6tp ߨ ߨ 6p 6p 6p 6p' ߨ1 ߨI 6pM 6pV 6pZ 6pc ߨm ߨ 6p 6p 6p 6p 7' 6p 6p   6q 6q 65q 63q 65q 63q 3 J= 7'J 6FqN 6DqS 7'\ 6Wq` 6Sqi Js 7' 6mq 6kq 6}q 6{q J 7' 6q 6q 6q 6q J 7' 6q 6q 6q 6q n . ܦU m 8  4 4I 4# 40 4 > 4xJ 4 P @q 6qu 6q 6q 6q U U 6 r 6 r  7 6r 6r 6,r 6*r 7 # D ]Y 4( 4JW 4 4"  6=r 69r 4 6^r 6Tr 6r 6r 4e 6r 6r 4_W# <- 7.> 6rB 6rG A` j 7.{ 6s 6s 6$s 6s 7. 6Es 6As  7. 6_s 6[s 6}s 6ys   6s 6s 6s 6s 1 F g q 7. 6s 6s        8 B d n  6s 6s      6s 6s  $ A 6tE 6tJ c  m  6t 6t ( f  S 4(4 4B 4o 4u  4  60t 6*t 75 4q 6Ut 6Ot  7E 6zt 6tt 7E 6t 6t 6t 6t    , 6u0 6u: 7UC 7eL 6-uP 6'uV >s 4E 4ց 4 4^ 42p 4G 4# 46 4E 4V 4މd 4_ 4J 4] 4 4IK 4uX 4e 49s 4&`~  4I 6/v 6'v 6Uv 6Qv 6ov 6mv 4. 6v 6}v 6v 6v 6v 6v  7(, 6v0 6v: D 7(U 6vY 6vc m 7 )~ 6w 6 w  7 ) 6w 6w 6.w 6,w  7 ) 6=w 6;w 6Mw 6Kw  7 ) 6\w 6Zw 6lw 6jw  * 7)< U _ }   N 7-) 6w 6yw 7-) 6w 6w 6 7=) 6w 6w 7M) 6w 6w 6 7M), 6w0 6w5 7M)> ^N fX ft 6xx 6x 6!x 6x f f 60x 6.x 6@x 6>x f f 6Ox 6Mx 6_x 6]x  n 6px" 6lx+ nB NY c | 6x 6x 6x 6x   6x 6x   6x 6x 6x 6x  ) 6x- 6x6 6x: 6xC M e 6xi 6xr 6yv 6y   6y 6y   6"y 6 y 62y 60y   6Ay 6?y# 6Qy' 6Oy3 = V 6`yZ 6^yc m  6oy 6my   6~y 6|y   6y 6y   6y" 6y+ 5 N 6yR 6y[ e ~ 6y 6y   4 P 6y 6y 6 z 6z 4 6)z 6#z 4I3 6[z7 6Kz@ UJ 7x[ 6z_ 6zi s 7 6z 6z 7 6"{ 6{   7 6C{ 6={ 7 6`{ 6^{  7 6r{ 6n{ 7" 2 < X 6{\ 6{e 6{i 6{r |  6{ 6{ 6{ 6{   6{ 6{ 6{ 6{  6{ 6{ ( 2 T ^  6{ 6{   6 | 6 | 6| 6|   6*| 6(| 6:| 68|  . 6I|2 6G|; 6Y|? 6W|H g q  6h| 6f|  7 7     6w| 6u|, 6 N 6|R 6|` j  6| 6| ǒ ǒ ǒ ǒ 6| 6| ǒ ǒ 6| 6|0 Ԓ: 7L ԒV Ԓx Ԓ Ԓ Ԓ Ԓ Ԓ Ԓ 6| 6| Ԓ Ԓ 6|# 6|, Ԓ6 ԒO 6|S 6|\ Ԓy % ߒ 4Q  4 4 4~ 4;r 4- 4F9 4-W 4~f 4n   7. c c 6| 6| j < < 6} 6} <. I= )J <X cg 4q 4 4B 4  6b} 6\} 4 6} 6~}  4x  4" 4- 4-< F 7pW 6}[ 6}` q . Ď 7 6} 6} Ɏ . Ύ ێ 4 ` 6} 6} 4# 6}' 6}7 6}; 6}@ 7I 4xT 6'~X 6%~b 4Ml ґ 4f ґ 4 v 7 66~ 64~ 7 6G~ 6C~    6]~ 6[~ 7  /G Z d  6l~ 6j~  .  7" 6~ 6~  .  .  ɑ 40 4O 4\ 4k 4x} 4 4 44 4 4 4u~  4 6~ 6~  6~ 6~ * 4x5 6~9 6~> S 4Ab 4m 4A | ' 7 6~ 6~ 6  6 9 $ Q 4zJ 4& 4K8 42E 4ndo 4| 4 4 42 4  4Y 4 4. 4c" 413 4? 4.K 4W 4d 4r 4% 4 4e 4 4] 4 4r 4 4 4; 4 4 4VH 43qf 4 4w 4CY 4@ 4 4( 4 4T% 4 49 4" 4`/ 4; 4U 4\f 4r 46~ 4k 4o 4 4 4I 4( 4 4T% 4 49 4/ 4j< 4hH 44[b 4\s 4 46 4k 4o 4 4 4B 4 4B 4 4np  4 4K& 4ss7 4C 4;rP 4a 4;ro 4@z  61 6 4g( 4U`  4"  4m  4ͅ  4  6{  6y 6 6( 4= 7-F \P 7 .` 6d 6m 6q 6z 6~ 6 6 6 7 .  B 7. 6 6 6 6 7. 6 6  B B9 69= 67F 6JJ 6HS 6eW 6a] \x     7*.  7:.     6 6 6 6' 7J.4 6À8 6A 6E 6܀N X 7Z.n x 7j.    6 6 6 6 6 6 6I 6G 6Y 6W 6m 6i  7z.& 6* 63 67 6<  X b 7.x 6| 6 6ԁ 6΁ . ; ; 6 6 6 6  N N! 6&! 6$! K@!  /P! _b! _w! 65{! 63! _! _! s! s! 6H! 6B! s! s" 6c " 6a" 6t" 6r!" 6%" 6." 62" 67" N"  a" `n" " *" "  " " " " " " 47 # 4# 4;r# 4L.# 4I# 4;g# 4_Wu# 4eK# 4.l# 4ӽ# 4,# 4# 4 # 4$ 4K,$ 4Y :$ 4K$ 4}$ 4.$ 4s$ 4G $ 4*$ 4q$ 4o$ 4$ 4&% 46% 4fOV% 4+"v% 4g% 4 j% 4iu% 4I% 4% 4iu% 4I% 48p% 4I & 4& 4I,& 4j>& 4IL& 4'^& 4;rl& 4~~& 4N& 4u& 4#& 4F& 4I& 4#& 4[& 4I& 4# ' 4&' 4k4' 4,F' 4NT' 4kRb' 4Io' 4@|' 4*r' 4m' 4I' 4u' 4Ԋ' 4h' 4 ' 4( 4Cp( 4( 4w-( 4\?( 4L( 46Y( 4kh( 4ov( 4( 4%( 4( 4;r( 4v( 4x( 4( 4}( 4) 4 ) 4 ") 4 %-) 4UJ:) 4G) 4YX) 4Id) 4uq) 4) 4;r) 4) 4I) 4) 4;r) 4W) 4;r) 41k) 4I * 4x* 4I-* 4E|?* 4;rL* 4IZ* 4xl* 4Iz* 4* 4;r* 4I* 4* 4I* 4}* 4;r* 4R]* 4I* 4 + 4I+ 4rE$+ 4(3+ 4E+ 4;rS+ 4e+ 4Is+ 4m+ 4;r+ 4A+ 4I+ 4q+ 4;r+ 4I+ 4ɠ+ 4;r , 4(, 4I$, 4,1, 4;r>, 4(P, 4CY^, 4 p, 4v{, 4, 4U, 4, 4, 42, 4'Y, 4, 4Μ, 4(- 42(- 4'Y5- 4ΜC- 4U- 42b- 4'Yp- 4_W- 4- 42- 4`- 4- 4- 4'Y- 4B- 4k- 4. 42. 4]. 4'Y*. 47. 4nE. 4fV. 4c. 4_t. 4. 4Y. 4. 4. 4P. 4I. 4s. 4;r. 4 / 4;r/ 4_-/ 4I;/ 4sM/ 4I[/ 4i/ 4Iw/ 4/ 4;r/ 4W/ 4I/ 4u/ 4I/ 48/ 4I0 4)0 4I0 4c.0 4I<0 4 N0 4;r\0 4n0 4I0 4;r0 40 4I0 4;r0 4yt0 4;r0 4 0 41 4:1 4;r"1 4(01 4 =1 4H1 4ьZ1 4Ih1 4v1 4;r1 4%1 41 41 4B1 41 41 41 4 2 .2 4&2 4H2 4XS2 4Sw]2 43p2 42 4P2 4ũ2 4P2 4ũ2 42 42 4_2 42 4D3 43 4C&%3 433 4E3 4>#[3 4km3 4X~3 4'Y3 43 4<3 43 4[3 4S3 43 4X3 4b3 4 4 4F-4 4 ;4 4Z4 4<h4 44 4 4 4ڣ4 4'4 4a4 45 4(5 4XN5 4Ep5 4ƣ5 45 45 4$5 46 4(6 4Q6 4Īv6 4"!6 4Z6 4U6 4^6 4_ 7 4$7 4;F7 4*e7 4&t7 47 427 4f7 4P7 47 47 4$^7 47 47 48 48 4*&8 4C68 4\F8 4uV8 4Jb8 4s8 48 48 48 48 48 4L8 4,8 4E8 4L8 4k 9 49 42%9 4f29 4D9 4y S9 43 b9 4L q9 4e 9 4~ 9 4 9 4 9 4H9 4 9 4 9 49 49 4: 4Μ: 4 %: 42: 4l?: 4ΜM: 4M^: 4k: 4ݻ: 4K: 4: 4ޯ: 4J: 4: 4; 42 ; 4u'; 4H4; 4@; 43@L; 4J Z; 4c; 4q; 4HU; 4; 4|; 4; 4a%; 4< 4< 4%< 4<< 42N< 4Pe< 42r< 4< 42< 4I< 4< 4< 4G< 4= 4 != 4-= 42I:= 4 V= 4c= 43S= 4= 4:= 4= 4= 4= 4= 4 > 4ߐ'> 4=> 4kV> 4Xs> 4(> 4> 4> 4W> 4> 4? 4'? 4S5? 4TB? 4S? 49`? 4sr? 4D? 4 ? 4? 4? 4C? 4? 4? 4? 4o? 4F? 4(@ 4 @ 45@ 4A@ 4oN@ 4/X@ 4i@ 4@ 4@ 4o@ 4#[@ 4@ 4o@ 4@ 4D@ 4A 4A 4)A 425A 4сBA 4,OA 4k\A 4tA 4MA 42A 4сA 46A 42A 4A 42A pB 6‚B 6#B 7-B  PB %ZB %sB 6wB 6B 6 B 6B %B -B -B 6/B 6-B -B 6>B 6<B -C -C 6N"C 6L+C 4:C <DC <`C 6^dC 6\mC 6nqC 6lzC <C <C 6}C 6{C 6C 6C <C <C 6C 6C 6C 6C CD C(D PCD 6̓GD 6PD 6/TD 6]D 6aD 6rjD 6ȄnD 6„wD UD UD 6D 6D fD 7D 6D 6D wD E ˓E 7 E 6)$E 6#-E 6H1E 6D:E DE 7UE 6`YE 6\bE 6xfE 6vkE E  E E E E 6E 6E E F 6F 6%F /F GF 6KF 6YF cF |F 6ƅF 6ąF F F 6݅F 6مF ǓF ߓF ߓG 6G 6 G !G ;G JG eG 6 iG 6rG 60vG 6*G G ԠG ܠG G H зH 6V!H 6N*H 6}.H 6w7H 6;H 6DH 6HH 6QH ٷ[H ٷxH 6|H 6H ٷH ٷH 6H 6H ٷH ٷH 6 H 6 H ٷH ٷI 6 I 6I ٷI ٷ8I 6)N 4IJN 4VN 4ޟbN 4B4nN 4zN 4N 4N 4N 4CN 4/N 4HN 4$6N 4}N 4:N 4% O 4:O 4R*O 4`7O 4DO 4WO 4VdO 4MrO 4FO 4O 4dO 45O 4O 4AP 4G"P 4 /P 4q

P 4KP 4 Q 4FQ 4I&Q 4a4Q 4BQ 4PQ 4O^Q 4lQ 4zQ 4/dQ 4OQ 4Q 4՘Q 43EQ 4CQ 4 R 4FR 4p*R 4L9R 4DpHR 4/XR 4lgR 4hvR 4.xR 4R 4R 4KR 4eR 4xR 4ƒR 4ތR 4Z`R 40 S 4BS 4B]*S 4X9S 4;HS 44WS 44fS 4uS 4S 4|VS 4QS 4ߘS 4{S 4S 4[OS 4S 4CS 4 T 4NT 4Q)T 4ڽGT 4ѠVT 4ށeT 4tT 47\T 4T 4T 4[HT 4ZT 4T 4(T 4T 4GT 4hU 4EU 4/U 4/?U 4$OU 4c_U 4oU 4U 4CU 4cU 45U 4HU 4`7U 4U 4U 4` V 4&?V 4E2)V 4u8V 4GV 4;?VV 45eV 4tV 4ܬV 4V 4jV 4/V 4V 40V 48V 4V 4 zV 4!I W 4hW 4d(W 47W 41FW 46UW 4LdW 4.sW 4xW 4W 4 W 48W 4#W 4BW 4oW 4JW 4ڥW 4m X 41X 4(X 47X 4s2FX 42kcX 42rX 4FX 4X 4GRX 4%RX 4pX 4_X 4X 4$X 4WX 4[Y 4IY 4n&Y 45Y 4^^DY 4YSY 4bY 4qY 4xY 4Y 4”Y 4Y 4)b 4f7b 4؊Eb 4eTb 4 gcb 4/qb 4B1b 4b 4ѕb 4b 4ãb 4b 4dVb 4"sb 4b 4}Ib 4; c 45(c 4>7c 4Fc 4FbUc 4dc 4sc 4c 4 c 4uc 4c 4Zc 4vc 4%tc 4_c 4 d 4d 4(d 42F7d 4GFd 47Ud 4>ydd 4dsd 4.>d 4Id 4g0d 4"\d 4#d 4Ad 4id 4|d 4d 4( e 4e 4*'e 4dK6e 41Ee 4gATe 4ce 4re 4`e 4UQe 4xe 4nBe 4Ke 4We 4ie 4Be 4[e 4`f 4f 44&f 45f 4Df 4[vSf 4"bf 4Q=rf 4t~f 4>}f 4Zf 4f 4f 4Jf 4hf 4 f 4.f 4zm g 4Vg 4B:g 4|Wg 4dg 4ljqg 4~g 4fg 4Cg 4Zg 4GRg 4~g 4Qg 4vg 4vg 4Z h 4!Q`h 4voh 4B={h 4h 4gh 4Ih 4;h 48h 4Ϊh 4uMh 4uMi 444i 4Zi 4gi 4yi 4IOi 4v>i 4Ei 4^i 4.fi 4̥i 4j 4jj 47-j 4&z;j 4Ij 4Wj 4bBej 4^j 4j 4j 4 rj 4j 4?j 4.j 4̴j 4!ij 4r k 4s-k 4jqEk 4i[k 4|k 4k 4jk 4Nk 4LFk 4Wk 4ck 45xk 4k 4] l 4]l 4]'l 45l 4qCl 4Ql 4_l 4@ml 4{l 4k@l 4Q2l 4$l 4hl 4>l 41a m 4^ m 46-m 4^Tm 4sEfm 4wym 4Pm 4m 4m 4um 4bgm 4xm 4m 4k9m 4ڋm 4m 4Ovn 4#On 4 Zn 4v>*n 48n 4(~Tn 4Abn 4pn 4.~n 4CVn 4+/n 4n 4ln 4Xn 4Ron 4n 4Nn 4Gn 4yo 4No 4v>:o 4Jo 4Po 4\Vo 4-\o 4qco 4"po 4.o 4I_o 4`o 4yto 4Oo 4=o 4o 45Lo 4Ԛo 4P p 4Ck7p 4Dp 4v>kp 4IZ~p 4ep 4p 4Rp 4%p 4/p 4;p 4(p 4Zp 4]p 4-R q 4O:q 4Y_&q 4h4q 4MoBq 4kPq 4q^q 4lq 4Qzq 4rq 4ڋq 4oq 42}q 4,q 4q 4q 4fpq 4q 4r 4lr 4u"r 4 0r 4>r 4eLr 4War 4>nr 4l{r 48r 4.r 4v>r 4^zr 45r 4zpr 4fr 4Xr 4r 4d\r 4'_s 4 s 4s 4f|s 4s 4X"s 4q(s 4(H.s 4>4s 4ւ:s 4@s 4HFs 4xLs 4eRs 4(Xs 4L^s 4-ds 4js 4NRps 4vs 4&0}s 4s 4s 4qt 4t 4f4%t 47u5t 4OOt 4v>\t 4͉it 4Nvt 4m7t 4\t 4t 4Ӿt 4qet 4t 4t 4qet 4u 4u 4Z.u 4LEu 4jRu 4_u 4ѣlu 4qeyu 4u 4_u 4Wu 4u 4O:u 4u 4<v 4v 4.-v 4cv 45v 4v 4v 4Zv 4Sv 4>v 4w 4Hw 45Uw 4px 4z;x 4v>[x 4hx 4ux 4d2x 4x 4x 4y 4|Yy 4Cy 4 z 4<z 44{%z 42z 4F?z 4uz 4hzz 4z 4Nz 4ĵ{ 4rx{ 4v*{ 4Y7{ 4XD{ 4I9g{ 4wcu{ 4B{ 4d{ 4{{ 4.{ 4{ 4A{ 4@{ 4/ | 4Q| 4k(| 4A5| 48qC| 4db| 4Fq| 4J| 4| 4B| 4[| 4c/| 4M| 4mQ| 4| 4d2} 4.s} 4p#} 41} 4DQ} 4_} 4%m} 4F{} 4J} 4Ei} 4)j} 4в} 4s} 4O} 4J~ 45~ 4 r&~ 4H3~ 4v>@~ 4f5M~ 4h~ 4lu~ 4M~ 4_~ 4~ 4.~ 4'~ 4EN~ 4Y 4& 4i: 4JO 4x] 4UMi 4&{ 4b 4j 4> 4s 4 4Ul 4< 4 4_ 4& 4_ 4 4{\) 4wG6 4<C 4P 42] 4j 4v 4Dx 4v> 4 4A 4k 4n 4J 4ڋ 4o 4v 4- 4r: 4MH 4ZfU 4b 4dz 4t^ 4> 4 4 4PɁ 4ׁ 4 4 4s 43 4M 4=* 4k7 43E 4VJQ 4^ 43l 4mN 43 4ڋ 4ȯ 4ڋ 4RԂ 4^ 4xi 4l- 4?: 4نM 4i 4QIu 4 4s 4 4 48ă 42у 44ރ 4fQ 4m 4j 4$2 4P 4k, 4m9 4F 4ES 4fg 46t 4`E 4> 4 4Ą 4i҄ 4 4Q 4`| 4p 4!J 4m& 4P4 4pB 4K=V 4d 4fr 4 4 4ϻ 4oV 4" 4wƅ 4l<ԅ 4j 4  4 4k 4 4+E( 46 4JD 4R 4F` 47n 4N| 4î 4XZ 4ۖ 4 45Ć 4܆ 4d 4 4Dj 4 4' 4^= 4L 4\ 4Ur 4=s 4 4F 4*q 4YӇ 4G 4 4 4fQ 4R 4 ! 4@. 4/; 4OH 4aU 4xb 4nuo 4WY| 4 4Y 4q 41M 4͈ 4]ۈ 4z 4 4 4; 4! 4N/ 4= 4WK 4mY 4'ug 4u 4 4 4Z 4) 4 4 eɉ 45׉ 4 4V 4Dt 4 4ߎ 4Qw+ 4: 4lI 43X 4Ǘg 4͔v 4L 4> 4 4&M 4bHŠ 4Vcъ 4m 4 4uD 4~ 4j 4u+ 40X: 4AI 4/X 4.cg 4W5v 4q 4O 4Z 4{9 4ZV 4Ћ 4h1 4: 4ի 4-9 4K, 4z; 4aJ 4_ 4fxo 4pu 4 K 4Q0X 4C?e 4Xr 4 4܃ 4[ 48 4.| 4N( 4qe5 4C 4P 4v>] 4yj 4Row 4 4N 46 4)l 4j 4ӎ 4w 4D8 4n 4M 4_ 4O 4c 4i 4' 4Y5 4n? 4L 4OZ 4tg 4t 4Ӯ 4mH 4Q 4Lq 4 4ɏ 4%֏ 4Q 4 4% 4< 4z 4c' 4L5 4B 4%P 4Fc` 4Ljf 4?m 4ӓz 4c 4@ 4 4O 4/ 4ɐ 4kE֐ 4z 4f 4@ 4]=$ 4> 4uK 4 X 4e 4|x 4 4k 4L 4 4v>ϑ 4ܑ 4 4 4 4I 4jq5 4A 4N 41\ 4^h 4pu 4S 4ߋ 4; 4: 4R 4N 4t 4 4Ў" 4rs. 4o? 4L 4X 4e 4Yz 4%N 4 4` 40 4$œ 4xAܓ 4%N 4 4$ 4%N 4' 4h64 4DA 4ijX 4Ze 4r 48 4M 4N 4N 4ǔ 4Iޔ 4 4Q< 4Ce 4y 4$ 4A 4|xe 4:^r 4i 4# 4B 4 4A; 4k{ʕ 4w֕ 4y< 4SL 4@ 4U1 4/ 4 43 4R_= 45` 4ݴl 4dz 4 z 4!I 4ڋ 4I 4 4om™ 4ș 4JΙ 4X2ՙ 4 43 4x 4/ 4 z) 4!I7 4hF 4T 4b 4yp 4~ 4 4) 4R 4[ 4ܙƚ 4RԚ 4~ 4b 4Ռ 43] 4ԉ 4( 4qp6 4|E 4oT 4/lb 4]p 4~ 4\ 4[ 4 4 4bě 4қ 4 4N 4; 4~ 4i2 4& 4e4 4B 4!P 4>^ 4.l 4z 4  4- 4_ 4 = 4 4#[Μ 4Y:ܜ 4+5 4a 4Ċ 4e 4)% 4с3 44yA 4ĻO 4] 4k 4yy 4y 4Y\ 43t 4> 4f 4i͝ 4W۝ 4a 4h 4u 4 40! 4VD 4N 4z\ 42j 4kx 4K 4c 4 4մ 4FĞ 4L 42 4Q 4@ 4f# 4v1 4}Q? 4M 4[ 4)i 4v>w 4| 4_d 4a 4m 4՘ǟ 4ן 4e 4^ 4v 4N" 4a[0 44> 45M 4bw 4. 4 42 4  4v̠ 4pڠ 4/ 4WE 4 48+ 4EB9 4M 4~U 43Ed 4x 4ǜ 4*N 4O 4Mr 4ʡ 4ء 4Է 4 45I 4E 4 4o, 4v>: 4M8H 4JmV 47cd 4br 4{ 4R 4CV 4ڋ 4NӢ 4N 4Y 4 4@* 4C7 4D 4W 4Jd 4ټ 4Y 4 4 4ý 4̣ 4o]٣ 4GW 4vq 4X4 4t 4v 4' 484 4=A 4kN 4y[ 4QBh 4=u 4 4= 4| 4Ǥ 4ټԤ 4 4B 4 4=" 4ҢI 4EiV 4˖c 4p 4/} 4v> 40 41 4 4Zȥ 4`ҥ 4ܥ 4WI 4ߝ 42 4 4c 4o=+ 48 4#vE 4R 4?E_ 4l 4ny 47 4 4v> 4 4O 4L|˦ 4|ئ 4. 4R 4 4 4T8' 485 4HC 41Q 4o_ 44{ 4 4p 4 z 4!I 4J 4ϧ 4hݧ 4 4d 46 4L 4# 4D1 4? 4 M 4>[ 4i 4Pw 4H 4 4~ 4c 4w 4~˨ 4h٨ 4 4K 4/ 4 4‘ 4*- 44; 4[I 4LW 4ȝe 4udy 4g> 4 4R 4@o 4I 4ʩ 4~ԩ 4bG 4o 4> 41 4X 40. 4< 4TJ 4uX 4Rf 4Nt 4b 4E 4"b 4j 4ڲ 4oqƪ 4ڋӪ 4/ 4`Y 4 4ק 4r. 4:& 4R0 4`> 4B1L 4Z 4kn 4݈ 4A 4-m 4< 4+Wū 4a߫ 4R 41A 43 4ٝ 4e 4p' 4]4 4 nA 4N 4[ 4^jh 4{u 4"H 4b 4 4v> 4/ 4AƬ 4 4[L 4 4xW 4= 4-5 4(QC 4Q 4_ 4`m 4b{ 4x/ 4!} 4 4{[ 4=3 4xݭ 43 4u 4Er 4v" 46 4&pC 4/P 4h] 4bq 4jC~ 4? 4 4] 4 4Ů 4Ү 4J߮ 4v> 4_ 4 4! 4GI 4ť3 47= 4G 4Q 4Po 4V| 4A 4c 4 4i 4H 4˯ 4@گ 4) 4 4| 4g 4( 45 46_ 4ak 4C 4 4? 4 4%F 4Jg° 4ϰ 4fܰ 4 4y 43? 4y0 47 4]^ 4Jk 4ux 4[[ 4 4 4θ 4W 4Ʊ 4Hӱ 4W 4 47 42 4'n 4Xb" 4ڋ/ 4e= 4%{J 4d 4~q 4j~ 4 4Vd 4 478 4 4zͲ 4v>ڲ 4j 4 4b 4B1' 4j4 4A 4YN 4 i 48 4j 4  4xeij 4T;ѳ 4! 4ކ 4e 4X 4R 48 4PE 4S 4h` 4 Km 4z 4y 4l 4>K 4´ 4cϴ 4kܴ 4A 4K 46 45r+ 4: 4G 4oT 4ya 4.{ 4Z 4v>Ƶ 4+Ե 4 48 4l 4ڋ 4? 4,# 4J0 4vj= 4HJ 46Y 4[h 4v 41 4"8 4ڋ˶ 4ض 4 4J 4@F 4 4Ђ 4G, 4?F 4kRS 4f 4s 4c 4CV 41 4rL 4ڋ 4 4η 4,۷ 4J 4] 4 m 4E 4\ 4) 496 4%7C 4VP 4_X] 4q?k 4y 4@0 46 4x 47Ը 4Za 42 4P 4 4' 4^4 4K 4X 4o 4{ 4 4 4r 4кʹ 4\׹ 49 4t 4 4#r 4 492 4ZC! 49( 4,28 4> 4JD 4J 4Q 4vI^ 4/k 4?x 4f 4f 4Cg 4k 4Hͺ 4e. 4 3 4vI 4A 4x$ 4]1 4X> 4 ~K 4e 4\} 4B7 4 4Q 4λ 4ػ 46 4ڋ 4R 4B1 4w# 4q0 4O= 4&JW 4v>d 4ڋq 4 W~ 4  4J 4 4W 4A 4 ʼ 4c׼ 4J 4 4Z0 48 4% 4:2 42? 4/L 4fcY 4Mf 4Ms 4 4  4 4( 4? 47̽ 48N 4 4 4" 4j8 4]=D 4` 4s 4 4 4h 41 4˾ 4Z޾ 44 4; 4˳ 4o 4L7 4D 4ZQ 4v>^ 4x 4 4 45п 4vܿ 4v} 4J} 4' 4] 4j 4_ 4v> 4 4]= 4v} 4E 4^ 4IO 4 4F' 4)5 4 :C 4lQ 4j`_ 4V} 4 4 4F 4FY 47 4@ 4f 4v 4K 4 4 4C 4@l 4~ 4 48 4 4I 4= 4I 4b 4˾ 4 4Đ 4n 4, 4v: 45H 4;V 4Έd 4mhr 4 7 4k@ 4t 4 48 4 4 4ڋ 4E 4V? 4=& 4J4 4`]B 4{[ 4i 4 46 4 4>_ 4 4] 4D 4k 4 4R+ 4E9 44G 4U 4|Kc 460q 4] 4m 45 4݉ 4 4u 4? 49 4R_ 4N 4H; 4dT 4B1b 4p 4 4=/ 4 b 4W 41 4(: 4p 4Z 4 4g 4- 4; 4]6I 47MW 4 6e 4s 4w 45 4; 4 4` 4 4RH 4x 4A 4;9 4AP 4V" 4v1 4`@ 4lO 4z^ 4(am 4t8| 4< 4. 4B 4ĸ 4 41 4)A 4_ 4 4! 4&0 4v>? 4GN 4] 4l 4={ 4j 4f 4 4ۯ 4= 4O 4 4Q 4]9 4Zo 42 4/ 4f> 4M 4Ra 4w 4ۅ 4lP 4M 49 4r[ 4v> 4qb' 4IOQ 4` 4-q 49w 4QD} 4 4i 4E 4I 4 4Q 4 4S 4a 4 4 4^1 4o 4u 4H 4fL 4| 4j 4ib 45 4d 43P 4X 4S 4<` 4Zam 4lz 4c 42D 4Ѓ 4+ 4D 4 4Ұ 4_ 4 4ټ 4M, 49 43` 4Wm 4l 4Z 4} 4< 4v 4 4v 4c 4a0 4= 4g^W 4Gm 4πy 4@ 4m^ 4ر 4l 4L 4Z 4} 4< 4P 4w& 4? 4mR 4\ 4@k 4x 4d 4 4s 4p 4 4x 44 4 4 4ټ 4g: 4_ 4m 4ڋ 4 4\ 4 4e 4} 4+3 4G 4 4Y 41 4x 4 7( 4ܚ5 4)`B 4|O 4  4 4N 4Տ 4[ 4M 4$ 4m 4 4J 4L 4V 4u, 4 z9 4!IF 43tT 4Ba 416o 4B@| 4\ 4 4 4 4s 4XN 49 4 4S9$ 4‘. 4PG; 4\I 4]V 4ĉc 4ip 4q} 4 4nJ 4 4F 4Y 4b 4H6' 43 4H 4uT 4:i 4u 4g 4i: 4v> 43h 46 4 4O 4~ 4# 4y`% 43 41A 4eiO 4;b] 4qk 4]y 4o 4 4 4? 4" 4-b 4C 4ʢ 4Q 4 4$ 4/3 4JB 4x_ 4>n 4H} 4A 4k 4Bv 4ܳ 4b 4 4D 4^ 4 4Щ 4c" 4ڕ1 4:@ 4O 4nl 4;d{ 4? 4y 46 4 4+O 4Z 45 4a 4ݗ 4 4h/ 4*> 4sM 4P\ 4ݵk 4 4܃ 4Yg 4~ 4gt 4 43 4c 4:& 4R3 4@ 4=M 4:[ 4 4 4΍ 4< 4Y 4 4P 4, 4u 4G 4B 4k 4ס$ 4ǡ* 4b0 4-6 4.< 4L 4Z 4|Zf 4 Ps 4 4 4i 4} 4 4r 4 4P 4I 4 4" 4@ 4nL 4Bb 4n 4.4{ 4t 4 4۠ 4e 4C 4 { 4 4  4@ 4Ƚ 4g# 4e1 4? 4AM 4J[ 4i 4:>w 47 4~ 4$ 4 4 48 4 4B 4h 4 42/ 4< 4O 4Z] 4zj 42w 4 4 4 4W 4uz 4 4b 4 44j 4jd 4/ 4Ah 4g! 4;. 4l; 4*H 4U 4c 4hq 4} 47_ 4 4 4y 4 4=~ 4 4"g 4 4t 4R7 4IM~ 4 4kG 4sR 4|D 4C/ 4 46 4t 4 4 4lO 4IM 4nk 4ĺ 4a 4H 4D 4. 4ǀ 4 4# 41 4? 4M 4<[ 44i 4 w 4Lt 4 q 4İ 4v> 43 4 4 4| 4r 4M 4θ 4V/ 4|= 4UK 4 j 4x 4 4Q 4b 4ķ 4¹ 4 4 4r 4 4D 4g 4ϙ! 4K/ 4Z= 4ոK 4xY 40g 4†u 4f 4lZ 4~~h 4v>v 4> 42 4X 4 4 42= 4@! 4xC/ 4l 4Jz 4vh 4 4o 4 4č 4 48 4 4ݣ 4O 4 4" 4y0 4G> 4L 4QKZ 4Fh 4v 4/ 4u] 42p 4rn) 47 4R 4` 4un 4W| 43 4w 4 4 4\ 4v 4 /u 4M 4 4 4K 4 4] 4A 4ON 4A[ 4h 4v 4+ 4l 4= 4q 46 4C 4y 4Q` 4m 4. 4!] 4" 4B% 4?3 4ioA 4{O 4I] 4k 4y 4Y 4 ^ 4An 40 4% 4I 4CG 4޸ 45 4R 4Ǽ 4;L 4QP* 4D4 4iB 4P 4ڋl 4D8 4 4 4 4. 4J 4 4.u 4x 4 4d 4Ԗ7 4<E 4՗R 4`?_ 4Klw 4Ф 4 4 40K 4>5 4> 4Kp 4P 4O 4 4[) 4E7 4E 4[tS 4нa 4-o 4>} 4t 4ͱ 4ڜ 4 4 4V 4C 4gy 4M 4 4(Z 4e?% 4D3 4zA 4qO 4Ar 4M 4 2 4ħ 4 41B 4 4 4 4dj 4ү 4 4# 4m0 4n= 42J 4PW 4Fd 4zq 4a~ 4q 4 4p 4k 4jZ 4f 4.C 4 4JJ 4!/ 48 4Q 4oE 4_a 4a 4 f 4*> 4@L 4uZ 41h 4z 4~ 47/ 4,8q 4ߺ 4=< 4iY 4Ȩ, 4G 4ho 4 4C 4M. 4"? 4K 4 4~b 4zo 4| 4k 4u 4f 4ri 48 4fW 49 4F 4d 40 4q= 4EJ 4W 43Yd 4$q 4?~ 4ge 4r 4U6 4< 4[ 4]i 4_ 4i 44 4!c 4@ 4# 41 4y? 4WM 4V}\ 4l 4Or 4ۓx 4~ 4 49H 49 4 4m 4y 4n& 4+L 4{ 4 45 4^ 4 4 4# 40 4= 4K 4X 4xe 4r 4+ 4?{ 4\ 4֞ 4$. 4R 4  4u 4  4l 4v>% 4D 4Q 4tq 4:w 4k 4J 4a 4, 4k 4 4Ob 4x 4 4i 4/# 4Q1 45? 4;M 4O:[ 4Moi 4% 4ۻ 4" 49 4 4n 4 4ߺ 4 4 4! 4}/ 4B1= 4ۛK 4QY 4wki 4bRy 4] 4 4Ï 4p 4V 42J 4Z 4 4L 4/ 4 4+ 4?? 4L 4Y 4p 4I| 4D 46 49 4J 4 4I 4/ 47o 4; 4v| 4% 4MoU  4c  4Vq  4W  4f  4B1  4|  4Q  4W  4;r  4'  44  4@:A  4}N  4[  4j  4[  4f  4  4jF!  4ta  4.n  4{  4  4^  4;  48  4c  4Q.  4uH  4МV  4Zr  4J  4 R  4c=  4  4  4  4|  41  4  46  4!  4Q/0  4?  4XN  4]  45<l  4&d{  4  4e  41  4JK  4X  4<  4^q  4P 4 4 4. 4S= 4L 4X[ 4´j 4nz 4n 4 4r 4m 4 4z 4Dm 4E  4 4G* 4E7 4S 4s_ 4Gk 4,w 4 4t 4f 4Ms 4. 4m8 4x 4ͦ 4R 4R5 4 A 4[M 4Z 4<f 4Wr 4Ji 4 4 4 4. 4 4o: 4dP 4 4hf 4@Z 4)  4 \ 4du@ 4HM 4t 4Ei 4CV 4v> 4r 4  4% 4z? 4f 4Y 4M 4y: 4c 4 4 4Uv 4i 4)D 4`k  4B/ 4dv< 4QV 4>o 4`} 4? 4q_ 49 4V 4W 4 4^ 4IZg 4x 4O~ 4n 4L 4L 4_h 4c 4~ 4O 4IP 4Ӌ 4J 4J! 4m/ 4E= 4hK 4;_ 4Me 42 4D 47 4 4˛  4) 476 4ڋC 40P 4C] 4Xj 4Bw 4m 4IZ 4 4A\ 4 4= 4 4!Z 4^ 40 4/ 4D 4+ 4q8 4v>F 4Z` 48m 4/ 4\{ 4Q 4w 4; 4m 4v> 4M 4R 4} 47m 4  4I. 4z< 4ZJ 4.GX 4f 4t 4ݐ 4@6 4CX 4X 42 4p 4GQ 4 4 4 4}{ 4%x 4 4 4ê 46 4m 4 4^ 4 4E 4m  4A  4G$  4n1  4Z>  4.GK  4X  4"e  4~  4}]  4>  4  4  4I_  4|  4{! 4$! 4 ! 4,! 4E9! 4mF! 4AS! 4Z`! 4.Gm! 4z! 46! 4N! 4" 4" 4K" 46+" 4߰8" 4~@E" 4R" 4e_" 4@l" 4y" 4" 4j# 4# 4 # 4-# 4^:# 4~@G# 4k# 4{{# 4s# 4# 4:# 4`N# 4I4# 4ܩ# 4H# 4k# 4!$ 46$ 4Ym!$ 462$ 48$ 4C>$ 4D$ 4LK$ 4C\$ 4db$ 4~h$ 4n$ 4zu$ 4ϟ$ 4=.$ 4\$ 4$ 4$ 4$ 4 s$ 4c$ 4C$ 4e;% 4o% 4`% 4% 4% 4 % 4&% 4p-% 4s5>% 4KD% 47J% 4lQ% 4<b% 4th% 4,n% 4:u% 4V% 4N% 4% 4% 4% 4% 4:% 4H;% 4.& 4$& 4|O.& 4Au8& 4SB& 4hQ& 4^& 4Mnu& 4L& 4<& 4p6& 4H& 4& 4& 4RW& 4}& 4g& 4-z ' 4N' 4$' 4[0' 4E' 4\pQ' 4?c' 4m' 4tw' 4j' 4#' 4s' 4N' 4g' 4>Q' 4' 4;C' 4' 4>( 4E^( 4#( 4b2( 4GAA( 4L5e( 4Do( 4q|( 4.( 4Z( 4mn( 4̶( 4c( 4T:( 4t( 4{) 4.) 44) 4W:) 4c@) 4G) 4jT) 4v>a) 4:n) 4{) 4t{) 4J) 4) 4z) 4e) 4) 4W) 4k) 4) 4V* 4h* 4׿* 4-* 4&;* 4I* 4tW* 4He* 4Zs* 4~@* 4k* 4* 4* 4ؒ* 4* 4K* 4(* 4B* 44* 4Q + 4̵+ 4)+ 4=+ 4;J+ 4yW+ 4zue+ 4̴s+ 4v>+ 4+ 4R+ 4Ք+ 4,+ 4ǫ+ 4+ 4;+ 4!+ 4u+ 4ty , 4A, 4o), 47, 4ME, 4tS, 4a, 4Lo, 4}, 4Б, 4Zs, 4~{, 4, 4+@, 4d, 4, 4qr, 4, 4 - 47- 4ݮ%- 423- 4Q^A- 4^MO- 4]- 4k- 4}y- 4_- 4- 4- 4"k- 49- 4Q- 4zb- 4. 4]&. 4ح5. 4?. 4 kI. 4QS. 4J]. 4g. 4wq. 4n{. 4. 4. 4. 4X. 4o. 4>. 40. 4. 4|. 4:/ 4B 0 40 40 40 4L0 4*0 40 4Ur0 40 40 40 41 41 4>1 4 s(1 4cB1 4U1 4jb1 4ۇo1 4p|1 4w1 41 4a1 4t`1 4q1 4 1 4Y1 4o1 41 4`2 42 4B1(2 4M52 41C2 4M2 4U\2 4=i2 4Njv2 4%2 4Ԫ2 4B12 4 2 42 42 4M2 42 4Us 3 4I3 4,6%3 4Y23 4?3 41L3 4GY3 4(<f3 4is3 4g3 4@3 413 433 4wH3 4^3 4ހ3 4$3 4c3 4<3 4o4 4q4 4_4 4})4 4;64 4Q]D4 4[<R4 4`4 4n4 4M|4 4NZ4 4 s4 4D4 414 4q4 4t14 4ڋ4 4_5 4E5 4e}5.@(5 445.8=5 4I5.0R5 4^5.,g5 4]s5.(5 4B5P5 4c5(5 4n5 5 4Ly5@5 4266 4u6 ~.676 4/1C6.$L6 4-X6"a6 4m6. v6 46.6 4h6 4ߢ6 4n6 4'h6 4iw 7 4<!7 4_37 4gF7 42k7 4Z7 4v7 4[7 4Z7 47 4IV7 4z8 4;a8 488 4!X8 4un8 4NO8 48 4S8 4?<8 48 48 959 4#9:9 45GD9 6-H9 6)V9 6IZ9 6Ei9 6km9 6az9 6~9 69 6҈9 6Έ9 49 69 69 4Yh9 69 6 99 4N9 6<9 6499 7-/: 6c : 6a: :.$/:=8:=U: 6{Y: 6y^:Io:.$~:_:_: 6: 6:k:.$:: 7=/: 6: 6:;.$;; 7M/*; 6É.; 67; 6݉;; 6ىD;M; 7]/^; 6b; 6k;t; 7m/; 6 ; 6 ; 7m/; 6%; 6!;;;;;< 6<< 6: < 6K< 6I<2<;<T< 6ZX< 6Xa< 6ie< 6gn<w<< 6< 6< 6< 6< 6< 6<<< 6< 6< 6Ɗ< 6Ċ< 6Պ< 6ӊ= 6= 6 =(="7=K=-c=}== 4>`=p= 45G=y=y= 6> 6 >y>y+> 6/> 68>yA>yY> 66]> 64f>yo>y> 6N> 6L> 4>> 6h> 6d> 6> 6>>? 6? 6 ??.$)?2? 7o1B? 6F? 6O?X? 71d? 6h? 6ދq?z? 71? 6? 6? 71? 6(? 6$?????@ 6? @ 6=@ 6N@ 6L @9@B@ 71R@ 6]V@ 6[[@l@.$w@@@@ 4"^@@ 6w@ 6s@ 6@ 6@ 7I1A 4A.MAVArA 6vA 6{A+A.$A+A+A 6ÌA 6A 6ҌA 6ЌA2A2A 6A 6B 6 B 6B 6B 6"B2+B2GB 6 KB 6TB 6/XB 6-aB 6GeB 6EnB 6XrB 6TwBDB"B`B`B 7\1B.$BpB.$B 4@>BC 4( C 6u$C 6m)C 70.C 4IO8C 6H 6wCHSH 4]H tH 4(~H 6H 6H 6H 6H 4H 6H 6ݏH 4IOH 6)H 6HKH 4H 6[H 6YH 4ۤH 6kH 6iHTI8"I 702I 6|6I 6x?I8HI 70TI 6XI 6aI8jI 70vI 6zI 6I8I 70I 6̐I 6ȐIyIyI 6I 6I~II 70I 6J 6JJ)J 4i.JMJ 6QJ 6 ^J 6>bJ 68gJ 70pJ 4azJ 6_~J 6[JKJ 70J 6J 6vJ 70JKJ 7-0J 6J 6J 7-0J 64J 6.JKKWK 7B0K 6UK 6O'K 7R04K 6|8K 6zAKWJK 7R0[K 6_K 6dK 7R0mK}KKK 6K 6K 6K 6KKK 6ʒK 6ȒK 6ڒK 6ؒKLL 6L 6%L 6)L 65LJL 6NL 6WLpLYyL 7b0L 6L 6L 7r0L 61L 6/LYL 7r0L 6CL 6?L 7r0LkLkLkMk'MkEMkNMkkMM[M[M[M[M[M[N[ N[.N[7N[ON 6`SN 6^\N[eN[~N 6qN 6oN[N[N 6N 6N[NiNN OO$O 4g.OEO 4EOO 6SO 6XO 4|dO"mO 4jwO 6ϓ{O 6O 4aO 6O 6O 6UO 6QO 4W 4OW 4@\W 41jW 4yW 4W 4@W 4LW 4IOW 4!oW 4IOW 4vW 4IOX 4 X 4J-X 4v>:X 4)lHX 4mYX 4JfX 4v>tX 4]=X 4=X 4JX 4CX 4X 4̆X 4v>X 4ťX 4X 4~Y 4?Y 4Y 4/Y 4@BY 4PSY 4IOaY 4wrY 4IOY 4YY 4IOY 4oY 4rY 4OuY 4IOY 4Y 4oY 4rY 4^ Z 4ڋZ 4Ί%Z 4ڋ3Z 4%DZ 4ڋRZ 4dZ 4vZ 49Z 4Z 4:lZ 4G[Z 4#1Z 4X[ 48[ 4]U[ 45r[ 4Kz[ 4[ 4"Y[ 4K\[ 4[ 4ia\ 4\ 4)8\ 4WT\ 4f\ 4||\ 4J\ 4\ 4J\ 4Ok\ 43\ 4] 4] 4*] 447] 4S] 4`] 4.e|] 4] 4J] 4T>] 4] 4߼] 4V] 4B1^ 4o^ 4]x^ 4k)^ 405^ 4kB^ 4KN^ 4Z^ 4g^ 4eq^ 4'I^ 4o^ 4^ 4o^ 4^ 4^ 4^ 4N^ 4չ_ 4k _ 4,_ 4:_ 4?W_ 4c_ 4|_ 4_ 4J_ 4Z_ 4R_ 4J_ 4_ 4z6_ 4J` 4Z` 4Hf)` 4J6` 4wQ` 4Jc`z` 6I~` 6E` 6d` 6`` 6` 6{` 6` 6`` 7/` 6ǘ` 6`a 1=w a 4ba 53qa 5 qa 72"a 2`)a 4,Ja 4p Va 4-ka 4Mqa 44xa 4"a 4Oa 4#a 4Ya 4,a 4tCa 4M%a 44"a 4a 4&a 4ya 4q]b 4(b 4>vb 4fb 4Qb 4#b 4b 4 b 4mb 4~7b 4Nb 4= b 4Db 4Ab 4c 4Sc 4c 4X c 4,c 4 8c 4G"Dc 4Pc 4v<\c 4Ihc 4;0tc 4c 4UBc 4=c 4?c 4c 4*[c 46c 4c 4Tc 41c 4c 4.N d 4Pd 4!d 4-d 4 9d 4Ed 4OZd 4[=hd 4C}d 4[=d 4Yd 4d 4V.d 4 Nd 4d 49d 4d 4V.d 4!7!e 4L.e 4V.;e 4fe 4\ve 43|e 4e 4 e 4 e 4 Je 4%e 4e 4e 4!e 4e 4e 4 e 4)e 4e 4Oe 4[;f 4f 45f 4Mf 4-\f 4Xjf 49xf 4Zf 4qWf 4Qf 4f 4f 4lJf 4KAf 4f 4Mf 4K.g 4Bg 40[ g 42.g 4O/w 4}=w 4^Kw 4V.Yw 4\gw 4&Zuw 49w 4"w 4$w 4w 4w 4"w 4N"w 4w 4w 4x 4x 46-x 4'-x 4#:;x 4B,Ix 4Wx 4 ex 4Psx 4x 4^x 4`Px 4+x 45x 4x 4~"x 45x 4l%y 4l@y 4}1$y 43y 4Ry 4ay 4 py 4y 4[y 4-;y 4Ny 4Jy 4y 4 y 4y 4y 4z 4z 4i$z 43z 4MBz 4XSQz 4j`z 45'oz 4[~z 4Yz 4Bz 4l;z 4cz 4lz 4z 4]z 43z 4{ 4{ 4 +#{ 42{ 4A{ 4CP{ 4_{ 4n{ 4rR}{ 48{ 4EH{ 4m{ 4{ 4 { 4i{ 4J{ 4{ 4 | 4}| 48#| 4V.0| 4=| 4kJ| 44j| 4t| 4^| 4tP| 4(| 45 | 4"| 4a| 4<| 4K} 4"D} 4} } 4/} 42<} 4I} 4V} 4d} 4}} 4&} 4} 4} 4H} 4 ~ 4~ 4&:~ 4 ]~ 4Ai~ 4Fw~ 4F~ 4!~ 4%~ 4v-~ 4&=~ 49~ 4 4% 4*8 4<G 4 ^| 47& 4b 4 4/ 49 4 4 4d@ 488 4  4T$ 44 4B 4TJP 4^ 4?& 4<  4  4{ƀ 4C 4N 4  4! 4d/ 4z= 4K 4 Z 45h 4Yv 4G 4| 4 4  4 ? 4^Hʁ 4;؁ 4>J 4 4 4\' 44 4-b 4v 4f. 4j0 4V 4т 42 4_ 4(1 4O  4[6 4u  4l. 4%: 4G 4#T 43a 4]n 4{ 4 4 4' 4 4̓ 4Hۃ 4 4 4- 4~[ 4' 44 4A 4wWN 4[ 4Kh 4Sw 4 4 4f7 4> 4 4*ń 4^ ̄ 4'ل 4 4 48  4  4' 4? 4nML 4$Y 41f 4s 4 4 4ԅ 4I 4P 4^ 4L4 453 4- 4^; 4DI 4W 4Ne 4s 4 4 4N6 4 4?Z 4)dž 4M<Ն 4 4@  4# 4T   4 4U) 4O7 4bE 4 S 4Qa 4 Mo 4g} 4 4[ 4bG 4 4ʇ 4ׇ 4 4 4 4 4- 4)D 4 J 4 P 4XV 4F\ 4b 4h 4Wn 4N^t 4z 4*I 4i 4 4N 4 4) 4H 4 ] 4 4 4+ 4ˆ 4Ȉ 4W-Έ 4Ԉ 4Eڈ 4( 4G 4 4 4, 4" 4 ; 4]G 4i!S 4)` 4m 4 } 4S 4 4 4 4 4!͉ 4Mډ 4 4 4m 4S 4) 4oV< 4@I 4V 4oVr 4&N 4} 4 4 4 LÊ 41:Њ 4݊ 4oV 4  4M  4" 4# 4-00 4 \i 4+u 4 4 4 4Iߋ 4SR 40# 4^N1 4}? 4KZ 4<h 4^7 4IČ 4SRь 4|  4M 4׍ 4( 4U 4 4Jl 4!y 4R 4" 4I? 4[ 4 4 4! 4] 48 4Y 4!f 4Ks 4OK 46 4 4 4& 4 4 4' 4:  4Y, 4; 49QJ 4Y 4Ux 4 4u2 4 47 4  4 ݑ 4\ 4+ 4 4' 42 4eB 4 ER 4b 4&0r 4 4  4  4; 4H˒ 44ْ 4JQ 4\ 4 4# 4 4rH4 4 A 4N 4+ 4` 4  4X 4 4Ǔ 4R 4  49 4#  4V.& 42 4!4? 4*L 4 4; 4 4ɔ 4lה 4& 45 4 4H 4s 4 ) 4C6 49C 4dU 4b 49o 4 V| 4g 4@ 46 4 4 41ʕ 46ו 4 4XE 4 4  4oY 4$ 4[U2 4lTf 4s 4# 4  4 4#B 4$  49– 4nϖ 4V.ܖ 4!7 4 4- 4% 4^) 4_C 4N+Q 4Zb 4=n 4S z 4w 4 4I 4Y 4w 4Zȗ 4,՗ 4w 4R 4w 4# 4E( 4#5 4\K 4f] 4V{ 4y 4 4Ę 4 4a 4# 4.  4W  4=- 4: 4G 4T 4a 4n 4{ 4 4 4 4 48 4ə 4'ݙ 4 4 4 4Y:, 45: 4H 4=V 4d 4r 4-7 4% 4 4 4>  4̚ 4ښ 4 4uF 49 4P 4  4.. 4GF< 4J 4X 4yf 4-)t 4 4 4Z 4[X 4  47;ț 4֛ 4w 4p 4D 4N 4:. 4|V+ 4v: 4FGQ 4` 4&o 49~ 4+ 4D 4cA 4I 4>ќ 4E5 4  4V# 4 4 # 4)H 4?U 4@b 4.o 4| 4 4' 4N 4 4  4G6ʝ 4uם 4 4 4L  4 4,& 44 4l$B 4pP 4t4^ 4Rl 4 Az 4H 4C 4 4s* 4@ 4pΞ 4ܞ 4, 4@ 4Z 4 4]/" 4x[0 4C> 4ZL 4s"Z 4h 4 v 4; 4& 4} 4+ 48 4f͟ 4/ܟ 4j, 4} 4 4 4 4> 4 4'  4A 4Ϥ 4s ܤ 4O 4D 4 4O 4  4+ 4A> 47K 4OY 4i[f 47s 4X 4 4 4 4w  47ť 4zե 4Aۥ 4  4h+ 4 4  4wW 4$ 41 4> 4K 4r 4 4 4 4&N 4k 4Fͦ 4Uڦ 4 4nN 4[U 4 4wW! 4D 4SQ 4fZ^ 4CPk 4g6y 4) 4  4N: 4>^ç 4Vѧ 4qݧ 4  4LW 4# 4CT 4z 4\, 4Mn 4Pz 40 4& 4  4.  4L 4W?ͨ 45ڨ 4 4  4! 4L  4- 4,T: 4Q 4 ^ 4!k 4,T 4  4! 4 4? 4cIͩ 4ک 4]@ 4" 4  4" 4/ 4< 43CS 47_ 4k 4Ww 4{ 4\' 4O 4@ڪ 4 4 46 4K 4P 43 4-? 4K 4W 4Bm 4kPz 4 4 4m 4 4>« 4g̫ 4&٫ 4 4 4v 4 44D 4Y( 46 4P 4,] 4Gj 4 4/ 4 4<  4Z  49Ǭ 4Ԭ 4+ 4" 4 4  4D 4"U$ 4 1 4Q> 4/K 4\0X 4ne 4d r 4S 4+ 4 4Z 4 4w­ 4S%ϭ 4L 4" 4& 4% 4-# 4L0 4= 48J 4W 4d 4q 4 4\ծ 4eJ 4 4 48  4# 4+ 4S1 4S7 4EK= 4)DC 4J 4(X 4wf 4t 4 4 48 4p 4Oɯ 4Xׯ 47 4D 49 4[ 4( 4- 41; 4I 4W 4"!e 4$s 4 4! 4 + 4  4^ 4 ɰ 4$װ 4S 4a% 4 4] 4( 4?+ 4>9 4)G 40=U 4\c 4q 4E 4 4T 4 41 4ű 4Xӱ 4 4M 4W 47  4 4' 45 4C 4Q 4` 4o 4"} 4 4) 4V 4 4PIJ 42Ҳ 4)9 4 4 4  4  4&& 44 4B 4P 4^ 4fTl 4z 4! 4F1 4 4!ó 4jѳ 4O߳ 4 4 4  42 4]J% 49 4 !_ 4f<m 4O| 4 4 46# 4 4*´ 4#д 4)޴ 4 4NX 4  4 4x, 4 0< 4[L 4(\ 4'l 4>{ 4 4+ 4 4µ 42 4 47)  4X 4F' 4A 46 O 4] 4k 4+^z 4& 4 4V. 4Nɶ 4bض 4 43 4 4" 4 0 4nL> 4VL 4?MZ 4`:h 4Pv 4  4\  4 4 4 4.ʷ 4kط 4J 4: 4\ 4  4#- 4G 4T 48a 49{ 4 4> 4= 4(;˸ 4ظ 4Q 4^A  4W 4#;& 4R3 4f$@ 4M 4Z 4 g 4t 4  4 4X 4 474 4¹ 4Ϲ 4ܹ 4] 4V 49 4g 4H; 4QH 4J,\ 4&v 4V 4] 4]9 4#ʺ 4*.׺ 4 4 4  4 49T( 4N2 4< 4A[F 4:P 4g^ 44k 44x 4C 4 4 4"K 47 4.ƻ 4nӻ 4=) 4 48 4P 4 4l ! 40 4? 4RL 4GY 4Gf 44t 4YZ 4 4 4G 4ż 4AXӼ 4M 49 4I   4 48' 4uO5 4!C 4pQ 4<=_ 4m 4{ 4 4~T 4 4? 4 1 4 Ͻ 4(ݽ 4 4 4 4 4)# 41 4? 4M 4HY[ 4i 4w 4J 4[) 4K= 4 4Z 43V˾ 44پ 4 4 4Q 4\ 4! 4NB4 4K> 4RH 4V 4 d 4-x 4= 4 4 41 4kR 4b̿ 4*ڿ 4u 4* 4 4^ 4  4|H- 4 : 4#G 4T 4a 4u7n 4= 4t 4 4 44 4 4d] 4 4  4 4 4@/ 49 4S 4] 4og 4:t 44 4% 4  4f 4 49 4C 4S 4T 4H 4; 41 4 4, 4: 4?V 4Jd 4#r 4 43 4KR 4- 4 4D 4 4 4z 4  4C 4E' 45 4]Q 4l 4[6z 4  4  46 4  4 4fT 4 4 4v 4M  4 44, 4V.9 4H'F 4+S 4` 43m 4N&z 4c; 4W 4< 4 4[UK 4Y 4f 4&s 4  4uU 4V 4  4A 4 4 45 4?2C 4BP 4 ] 4SVj 4#x 4J 4" 4 4k 4 4& 4 4~C 4F 4, 4#9 4WF 4QS 4` 4Xm 4z 4# 4@W 4F 4 4' 4T 4 4 4- 4U 4#" 4/ 46< 4"I 4V 41Zc 4p 4H} 4 4 . 4K 4 4: 4 4 4) 4B 4& 4E&, 4B 4N 4Xd 4tq 44~ 4X 4|P 44 45 44 45/ 4I 4X 4?) 4O8 4E 4eR 4 _ 4+m 4 } 4M) 4 4 47 4 4? 47 4& 4X 4 4 4F 4= 4= 4V 4, 4;: 4g\ 4i 4v 4 4qW 4N 49[ 4x 4V. 4U 4 4 4 4, 4:: 4:D 4Q 4#^ 4\k 4x 4 4  4I 4* 4 4# 4t 4H 4; 4/ 4|Q 4\) 4H6 45XC 4+] 4j 4\w 4H 4 4[ 4h 46 4 4 4% 4A 45 4@# 4- 4-  4^8 4M 48Z 4E 4$M 4 4 4C0 4 4oY 4u 4  4) 4K7 4J 4Na 4!n 4jI| 4f  4 4= 4} 4 4 4^ 4Q\& 4L< 4H 4n 4 48 4E 4oY 4. 4 4 4$ 42 4@ 4*^ 49w 4D 4 4K 4 4< 4 4> 4b& 4D 4 4w, 4t?: 4H 4a 4o 4)} 4# 4k& 4EA 43^ 4H 4B 4F 4 4+ 49 4;G 4SU 4Sc 4}(q 4 4( 4L 4k 4D 4  4X 4 4 4@ 4>) 47 4F 4LT 4#c 4q 4 4! 4 4 4 4Y* 49 4 4 : 4; 4-O 4YY 4g 4?Zu 4 4 45U 4] 4{* 4{ 48 4] 4J 4@ 4! 4 4+ 49 4h\ 4j 4M 4 4]W 4 4T 4&T 4? 4H 4y# 4[1 4? 4O[ 4i 4<w 4$ 4! 4% 4 4 4 4Y 4 4Y2 4. 4wZ 4 4N. 4x= 4}AL 4)[ 4j 4y 4) 4 4" 4t1 4 4{ 4 4aQ 4 4 47N- 4vG< 4yK 4gZ 4i 4x 4O 4G 4 4 49K 4^ 49 4 4D 4T 4E 4T, 4+; 4\MJ 4Y 4h 4 w 4]O 4B 4 4> 4 4 4 4D  4$ 4!; 4<O 4 4 49 4\! 4I 4 4 4, 4Q 48 47 4 4, 4q: 4:V 4G 4># 4sJ+ 4,7 4/C 4e/O 4[ 4jGh 4du 4 4 4I 4 4 4 4O 4~  4[ 4 4VA 45# 40 4= 4$J 4[d 4#q 4~ 4 4# 4 4 4' 49+3 46C 4I 4TO 4a>V 4` 4Lm 4z 4s 45X 4i 4 4$ 4 4 4F 4O5 4% 4Q! 4S8 4TE 4rl 4{2y 4y 4} 4 4K 4  4L 4 45X 4[4< 4A\I 4c 4&y 44 4&6 4 4G 4y 426 4} 4 4K 4&F$ 42 4"K 4^ 4vKh 4w 42 42 4N! 4|  4  4 4}A 4B 46> 4H 4Q 4-F 4F+k 44y 4# 4] 4s 4[ 49 4 4 4% 4XY 4  4[ 4' 4j4 41A 4N 4[ 461 4Q 4 4' 4 4 4BR 4 4! 4 4 4$+ 48 4E 48R 4 ` 4m 4{ 4 4V4 4V. 4l  4C 4D  4= 4,  49& 40 4[): 4G 4V4U 4>b 4!o 48\| 4*  44 4r 4Y] 4% 4R 4 43 4I? 40KT 4^"` 4u 4F7 4 4 4 4$ 4W> 4kE 4 4X 4## 41 4V? 4VM 4C[ 4wi 4 w 4I 4J 4  4I 4 4 4i 4 4U9 4 4N! 40 4? 4n2N 4Pk 47z 4> 4< 4 4P 4{I 4 4u7 4G 4E 4B 4+@ 4. 4?-= 4@L 41[ 4Nx 4h 4c2 49! 4I 4b* 4 4'& 4L 4 4/ 46J, 4; 4K>J 4&8Y 4:Ch 4hKw 4-S 4  4l 4 4  4  4H 45X% 42 4\? 4M<L 4:Y 4g 4C 4* 4% 4 4 4Z 4 4 4P 4   4/ 4* 4l80 4\86 4=< 4FB 4H 4VX 4 f 4rr 4 4B, 41 4 4< 4 A 4+$ 4X 4uQ 4 4oY  4W. 4/L 4-X 4Nn 4Gz 4 4K 4TF 47 41 4- 4 4h: 4O? 4 4R! 4/ 4jB= 4[K 4MY 4 #g 4Au 4 42 4> 4* 4 4V 4I 4{ 4 4>F 4' 4; 4 3H 4l'[ 4}i 4v 4% 4\ 4}! 45, 4' 4) 4" 4< 4F 4) 4 4(W 42  4- 4: 4G 4LT 4Wa 4o 4-} 4 4 4z% 4NO 4 44 4 43P 45 4* 4n3 4+ 4 4 4 4 4 4E 4- 4MS 4-( 4DL 4hX 4\$ 4 4H 4O 4  4 4 4 4, 44! 4>Q/ 4M= 4yNK 4Y 4g 4*u 4y 4  4  4F 4 4X 4O 4|- 4e" 42  4 4AN, 4^1; 4}I 4;6W 4v 4S 4^ 4 4 4/M 4)O 4M 43 4G  4A 4 4 40- 4; 4_BI 4HNW 4}e 4&s 4 4O 4>f 4t 4 4 4 4& 4= 4q 4 4EA- 4; 4(;x 4 4a 4MY 4{  45 4% 4  4NE. 4< 4)J 4F X 4Pf 4*t 4' 4 4% 4 ' 4<5 4HC 4^ 46<l 4z 4  4 4\ 4G 4$ 4UW 4 4  4 4-/ 4N 4 4oF 4  4VM 4Z 4Ug 4F@t 4b' 4A1 4~ 4b 42  4 44 4m 4 4K 4 4 4C=# 4X11 4? 4 M 4N[ 4i 4Ow 4S@ 4K 4 4  4 4PP 4  4n 4QN 4 4iS 4Q" 4*, 46 4@ 4N 4H\ 4#x 4 4#; 4; 42 4 4+ 47 4 4 4, 4]+ 43.C 4\Q 4/^ 4k 4/ 4 ; 4O 4E 4/ 4 4 4  4  4 4V' 45 4C 43Q 4 _ 4Rm 4XP{ 40 46 4G 43 4/J 4R 4g 4 4 4g 4* 45# 41 4U? 4M 4aU[ 4D~ 4n> 4 4= 4; 4y 4J( 4W 4\ 4Y 4E 479" 44/ 4rB< 4I 4]V 4ic 4p 4U} 4q 4x  4< 4q  4o 4` 4* 4f 4Q 4N 4# 4T 4' 4 Q 4 4 47 48J  46X  4f  4Ft  4a  48 41S 4b3{ 40 4 4O 4WK 4" 42, 4 n 4J{ 4 4[U 4 4 4P 4 4 4 4 4  4A< 4&HI 47V 4hYc 4dp 4} 4 4{ 4  4 4' 4K 4; 4- 4 4 4U 4! 4P/ 4eN= 4ZK 4Y 4h 47x 4H~ 4p+ 4Z 40 4_ 4| 4 49 4Z[% 42 4VOX 4 4V 4, 4) 45R 4" 4! 4B. 4; 4 -H 4$c 4m 4_z 45 4& 4\ 4F 4 4 4y 4 4fZ 4O' 4KG 4fa 4?Zn 4+{ 4KC 4 4?Z 4M< 4 4F 4A 4"$ 4 4< 47 4^# 41 4? 453X 4Qw 4C= 4 4 4~ 4H 4 P 4O 4% 4" 43 4 42! 4</ 4Q? 4O 4G_ 4W(o 4|'u 4 { 47 46 4} 4tE 4 4 4W 4J 4 4 5" 4/ 4fZF 4R 4_ 4m 4{ 4+ 4oY 4 4 4 4^ 4% 453 4+ 4K9 4TG 4I 4 4 4/ 4 4 4  4M< 4K  4 4 $ 4{31 4 4l 4VU 41< 4 47 4D 4g6Q 4^ 4_ 4N 4 4  43  4}1  4?  4vM  4[  4%i  4kw  48  49  4D  4Q  4  4"  4S  4fC  4= ! 4N! 4+! 4C:! 4C]I! 4,X! 4Ng! 4Iv! 4J! 4! 4 ! 4! 43! 4H/! 4M<! 49! 4bY " 4+" 4JJ)" 49" 4I" 4O7Y" 4hi" 4y" 4]" 48" 4(" 4?" 4A" 4" 4?" 4A# 46 # 4*# 44T6# 4,B# 4~ N# 4e# 4 r# 4C# 4# 41$# 4=# 4\# 4:# 4~$ 4| $ 4UG$ 4@%$ 41$ 4(?$ 4V.N$ 4nZ$ 4:f$ 4r$ 44~$ 4$ 4'$ 4wY$ 4|$ 4@$ 46$ 4$ 4$ 4 % 43% 4#@% 4M% 4% 48% 4U% 4R]% 4% 4U%& 4B& 4O& 4\& 4|& 4 R& 4H'& 4c& 4& 4`& 4:& 4c=& 4& 4' 4.' 4wS<' 4!"F' 4S' 4`' 4Tm' 4Iz' 4F' 4=D' 4I&( 4H97( 4=( 4C( 4I( 4tP( 4Jl( 4|( 4( 4( 4 ( 4#( 4+( 4RT( 4R( 4( 4:X ) 4p) 4aW) 4va) 4gz) 4D) 4=) 42) 4:) 4)) 4#* 4* 4 * 4)* 4&6* 4C* 4IP* 4(;h* 4t* 4=<* 4 * 4@9* 4.* 48* 4* 4.* 4* 48* 49 * 4+ 40+ 4,+ 4I+ 4V+ 4|Oc+ 4=p+ 4'}+ 4WC+ 4+ 4G4+ 4+ 43+ 4+ 4+ 4+ 4a+ 4 , 4`, 4%, 43, 4(A, 4O, 4], 4 k, 4y, 4+ , 4, 4\, 4U, 4,, 4P, 4, 4N, 4X, 4)- 4,- 40K- 4N]- 4c- 4;i- 4.o- 4u- 4|- 4)'- 4QH- 42- 4,- 4- 402- 4F- 4#- 4- 4m- 4\- 4. 4\^. 4-E. 4> (. 4'6. 4:E. 4fT. 4^c. 4r. 4C. 4M. 4e\. 4P. 4]. 4[. 4. 4#. 4[U. 4>/ 4/ 4g#"/ 4q2/ 4&-B/ 4:R/ 4Qb/ 4sr/ 4./ 4]/ 4&/ 4/ 4K / 42/ 4/ 4/ 48(/ 4X+0 40 4C%0 4$Y50 4\E0 4@%U0 4fVe0 4:u0 40 40F0 40 40 4R0 4Q0 4Y0 40 40 4&1 4&X1 4t&%1 4o41 4/AS1 4>`1 4y1 4[U1 4#1 4K 1 4 1 4]1 4A1 4A1 41 4$1 4@1 4L2 4@2 4h^"2 4,/2 4WI2 4FX2 4Bm2 4Y&2 42 42 42 4M 2 4]2 4Q2 4"2 49:3 4G3 4T3 4Sa3 4@n3 4*{3 4fW3 473 4_3 4`$3 4jQ3 4i3 4D3 4%3 43 43 4` 4 4.34 4X$4 4=4 4-i4 4 v4 44 4^4 44 4.4 44 4H4 4T4 4`$4 4jQ4 4i5 4D5 45 4`,5 4H/95 4*R5 45 435 45 4J5 4*5 4F5 46 4Q,6 4H6 4%+6 4!86 4{3E6 46 416 46 4H/6 4_6 47 4M<*7 4:7 41Y@7 4SF7 4MM7 4E\7 4k7 47@{7 4857 47 4U<7 4 7 4=7 4U7 4>7 4S37 428 4 8 4U8 4!8 4 K'8 4 -8 448 46B8 4?P8 4U^8 4q'l8 4R{8 4@8 4u 8 45X8 4t8 48 4;8 48 4'8 4Z8 4#8 4pD8 4DZ8 48 49 4  9 49 4#!9 41G'9 4<3-9 4*49 4EB9 4P9 4]F^9 4l9 469 4M'9 43W9 49 49 4[.9 4l9 49 49: 4: 4$: 44: 4'>: 41L: 4Z: 4Qh: 4v: 4: 4: 4: 4'#: 4: 4f: 47): 4: 4H; 4 ; 4"; 4:?,; 4(6; 4Z5E; 4$S; 4% a; 4o; 4}; 4C; 4W; 4s; 4; 4; 4; 4p5; 4R; 4z< 4$< 4'.< 4U ;< 4a< 4}n< 47{< 4WL< 4< 4< 4Y< 4Y< 4< 4/< 4-< 4BD< 4d(= 4oA= 4 = 4-= 4V:= 46G= 4T= 4b= 4Bn= 4|= 4v.= 4 = 4?Z= 4M<= 4N= 4N6= 4T= 4(*= 4%= 4)]> 4R> 4$> 4!2> 4@> 4N> 4^\> 4Uj> 4*> 4L> 4> 4> 4> 4Z> 4> 4WK> 4Z> 4;> 4fO ? 4G? 4$? 4TJ2? 4@? 4FN? 4L\? 4r,j? 4\x? 4A? 4W? 4x? 4U<? 4I? 4$? 4? 4/#? 4? 4 G@ 4 @ 4 @ 4 .@ 4T<@ 4i)J@ 4 X@ 4@f@ 4%t@ 4i@ 4@ 4C8@ 4 @ 43@ 4F 4WF 4KF 4Y>F 4pF 4}F 4C?F 4F 4F 4WF 4F 4?F 4CF 4[G 4y G 4G 4'G 4G 4G 4G 4G 4yG 4G 4!G 4 H 4'H 4%H 4U3H 4@H 4V.MH 4ZH 4mH 4T wH 4{MH.\H 4?*H.XH 4rH.TH 4H.PH 4r0H.HH 4I2H" I 4II 4X*IPHI 4YSI fIoI 4MI 4>I 4I 4/I 4I 4LI 4  J 4JJ 4#?lJ 42J 4VJ 4J 4 9J 4?J 4}6J 4K 4YD)K 4EK 4-`K 4sK 4UK 4EKK 6K 6K 4PGK 6.K 6&K 6ZK 6VK 4\K 4L 6{ L 6sL 4PL 6L 6.L 6ș2L 67L 4~=L FL 72OL 4UYL 6 ]L 6 bL 4lL 6pL 6uLL 4 BL 4LL L 4eLL 4M@LL 4 L 4L 6EL 6CM 7O2 M 4H!M)M 4e1M>MOM"eMMM"MaM 4VM 6UM 6SM 46M 6hM 6bMxM 4~M7N 4N7+N 47N@N 7 2ON 6SN 6\NeN 7 2qN 6uN 6NNN 6N 6NN.\NNN NO#O 6Ϛ'O 6͚,O&=O.\LOCUO 7/2dO 6hO 6mOH~O.\O7O7O 6O 6OCO.\O[O 7?2O 6O 6O` P.\P/Par] 4g] 4] 4] 4] 42i] 4:] 4 k] 4] 4z] 49^ 4|?^ 4Q^ 4_^ 4(d^ 4ͷp^ 4,k|^ 4d^ 4 ^ 4^ 4^ 4^ 4˕^ 4|^ 4ng^ 4^ 4h^ 4^ 4j_ 4u_ 4_ 4&_ 42_ 4^>_ 4J_ 4,V_ 4b_ 4du_ 4Sz_ 4k_ 4M_ 4_ 4Hd_ 4_ 4_ 4_ 4_ 4s_ 4V`_ 4x_ 48f ` 4` 4-` 4B` 4P` 4D\` 4i` 4v` 4b` 4_` 4$` 4wv` 4` 4` 4e` 4a 4q)a 4awAa 4fPa 4N^a 4la 4դza 4a 4Ca 4Nna 4({a 4a 4a 4|ya 4)a 4a 4jb 4Sb 4/"b 40b 4>b 4~Lb 4b 4b 4ub 4sb 4^b 4vb 4b 4b 4qb 4(`c 4c 4,c 4~;c 4`Jc 4JYc 4N{hc 4wc 4c 4nc 4Nc 4_c 4Iac 4rc 4}c 4Jc 4kc 4d d 4dd 4c+d 4I:d 4LId 4uXd 4gd 4cvd 4Hd 4~d 4d 4sd 4'd 4}d 4ād 4<d 4 e 4e 4}*e 4}9e 4He 4We 4wfe 4ue 4e 4e 4^e 4ve 4Pe 4ke 4e 4+e 4f 4f 4m%f 4W5f 4sEf 4ΑUf 4*eef 4qxuf 4Zgf 4f 4f 4f 46of 4Tbf 4ff 4f 4Ko g 4g 4@*g 4S9g 4Hg 4>Wg 4p`fg 4ug 4ag 4hg 4-g 4Ug 4xg 4g 4g 4Tg 4tag 4C h 4$|h 4^)h 4ľ8h 4nGh 4Vh 4yheh 4uh 4bh 4h 4zh 4h 4qh 4h 4h 4h 4bh 4i 4b(i 4v7i 4eFi 4 Ui 4di 4ٞsi 4i 4i 4i 4i 4qi 48yi 4ri 4i 4i 4ˈ j 4j 4'j 46j 4,Ej 4Tj 4cj 4vrj 4uj 4j 4j 4j 4wj 4j 4Uuj 4j 4^j 4Kqk 4k 4&k 45k 48Dk 4$Sk 4dzbk 4qk 4k 4`k 4k 4-k 4k 4Wk 4Zk 4k 4k 4l 4l 4%l 44l 4Cl 4xRl 4al 4pl 4l 4#l 4Nl 4ml 44l 4rl 4l 4l 4l 4m 4+m 4H%m 4l4m 4Cm 4GRm 4nam 4fpm 4vm 4m 4um 4m 4qm 4Tm 4m 4m 4(m 4=n 4n 4/%n 44n 4Cn 4Rn 4an 4pn 4n 4Rn 4n 4n 4|n 4zcn 4vn 4<n 4n 4o 4Who 4.$o 43o 4jBo 4aQo 4`o 4oo 4~o 4o 4,o 4o 4o 4;to 4o 4o 4p 4ҹp 4y~$p 43p 40Bp 4<Qp 44`p 4pp 4`p 4p 4up 4.}p 4mp 4sup 4_p 4p 4O|q 4{q 4Cq 4Oq 4[q 4 {hq 4;kwq 4q 4qq 4q 4Icq 4Lpq 4q 4!q 4q 4qr 4_r 4#r 41r 42?r 4Mr 4[r 4Oir 4iwr 4ƪr 4r 4Tnr 4r 4xr 4r 4r 4 `r 4ar 4!s 4s 4X!s 4/s 4=s 44Ks 4Ys 4 gs 4xus 4s 4s 4ds 4s 4 s 45s 4s 4 s 4 t 4t 4't 40Ft 4Ut 4dt 4=st 4t 4t 4Yt 4ut 4wt 4gt 4t 4et 4-nt 4y u 4`u 4h'u 4 6u 4Eu 4Tu 4лcu 4ru 4u 4zu 4u 4zu 4au 4Zqu 4u 4u 4,u 4v 4v 4ar&v 4={5v 4Dv 4oSv 4srbv 4qv 4~v 4v 4ev 4v 4v 4v 4v 4Tmv 4v 4 w 4w 4$w 4 z1w 4>w 4^w 4_hw 4uw 4w 4w 4w 4>w 4w 4iw 4bw 4x 4x 4 #x 4֫0x 4=x 4Jx 4"Xx 4x 4x 4(x 4Emx 4 x 4x 4x y 4.y 4Qy 4]y 4|ky 4|zy 4dy 4Dy 4y 4y 4~y 4Nn z 4uz 4,z 4;z 4(pz 4Һ~z 4fz 4nz 4z 4^z 4Urz 4^z 4z 4z 4( { 4/{ 4o({ 4[_6{ 4D{ 4R{ 4ں{ 4{ 4{ 4{ 4{ 4>{ 4| 4K~| 4v#| 4 1| 4{?| 4N| 4\| 4Oj| 4Ҍx| 4| 4| 4| 4| 4| 4| 4| 4ip| 4`b} 4} 4e(} 4/V} 4j} 4} 4} 4} 4Bu} 4} 4} 4} 4} 4~ 4~ 4"~ 4l.~ 4Zi;~ 4JH~ 4EU~ 4b~ 4~o~ 4|~ 4Nn~ 4~ 48~ 4q~ 4>~ 4^~ 4~ 4_ 4 4* 4( 45 4B 4$~O 4C\ 4Ԧk 4~z 4Nn 4 4 4 4g 4 4 4^ 4h 4F 4k 4. 4m3 4@ 4{M 4QZ 4pg 4 4 4NnȀ 4ωۀ 4 42 4 4 4.`! 4k/ 4= 4BK 4ٌY 4g 4Yju 4x 4 4 4h 4Ͻ 4Ɂ 4Nׁ 4Ġ 4J 4 4_ 4g 4q+ 49 4G 4U 4c 4 q 4s 4$ 4 4v 4> 4n˂ 47؂ 4h 4^ 4Nn 4! 4e8 4> 4D 4J 4:P 4V 4F\ 4b 4ih 4n 4t 4Їz 4~ 4w 4n 4 4+ 4$ 4a 4( 4N 4| 4t^ 4ƒ 4ȃ 4H΃ 4`Ճ 4Q 4! 4 4J  4 4/ 4; 42G 4<T 4da 4tq 4w 4d} 4 48 4Nn 4\ 4$΄ 4gg 4Z 4 4& 4 40 4Ұ= 4J 4f 4{s 4 4| 4 4{ 4ą 4х 4߅ 4 4 4  4Yj 4$ 4.] 4i 4Mvu 4 4_ 47ӆ 4 44 4% 43 4ON 4n\ 4 47 4Ň 4 4ا 4Nnˈ 4Z؈ 4 4sb 4 ` 4m 4Q  4 4r3 4{ 4l 4 4 4 4 4M 4Z 4Jg 4t 4 4^ 4z 4 48i׋ 46 4 4Œ 4  45_/ 4u> 4qM 4pl 4_| 4 4; 4q 4n 4ִь 48 4 4² 4  4}& 4_6 4F 43V 4f 4sbv 4% 4F 4o 4c 4͍ 4ۍ 48 4jz 4 4 4( 45 4.B 4 4e 4( 4N 4Nn 4e 4Q֎ 4 4$ 4 4 4;& 43 4}@ 4' 4 4= 4_z 4ˏ 4|׏ 4{ 4 4 4n 4r 4W* 4Ԛ7 4lI 4V 4Ўc 4Xp 4} 4 4 4.w 4l 4d 4Zː 4Pؐ 4 4 4Nn 4  4q 4& 4Z 4yzg 4Jt 4: 4. 4 4 4$ 4Ñ 4Б 4 4 4/ 4> 42 47 4߿E 4 V 4(b 4סn 4d{ 4I} 4m 4ٙ 4d 4y 4"ɒ 4dג 4} 4d 4J 4$ 4J) 4Â? 4Q 4o 4 4o 4s 4!ԓ 4x 4 4 4 4G! 4H. 4b; 4'dH 4,U 4=b 4o 43b| 41 4 4l 4  4u 4є 4fޔ 4/u 4jn 4  4P. 4< 4ŮJ 4]X 4f 4t 4y 4X 4E 4 4Nm 4Ε 4Xܕ 4 4l 40 4? 4" 40 4vl> 4L 4Z 4h 4.v 4 4t 4 4 4 4pvʖ 4gؖ 4} 4@ 4ԉ 4 4 4f. 4E 4nT 4sc 4r 4( 43 4 4& 4%ŗ 4ۗ 44 4  4u 4` 4< 4I 4nV 4ec 4,p 4} 4s 4p 4` 4~ 4 4˘ 49ؘ 4 4 4  4 4|( 4#6 4D 4R 4` 4n 4k| 4 4-~ 4 4  4™ 4Й 4Aޙ 4Y 4 4M 4 4$ 4ۓ2 4e@ 4*N 4j\ 46j 4Nx 43 4 44 4R 4c 4К 4ߚ 4 4ձ 4  4u| 4x+ 4: 4I 4WX 4Ltg 4v 4H 4= 4 4q 4` 4Л 4{eߛ 4 4> 4X  4ji 4** 4\9 4aX 4jg 4]v 4i 4 4 4 4Ȝ 4؜ 4ޜ 4 4` 4SoΝ 4۝ 4  4 4M) 4Hx 4e 4X~ 4 4 4V 4Nnƞ 4ԦӞ 4 4 4$~ 4 4 4# 4< 47O 4>h_ 4e 4|k 4q 4c~w 4~ 4F 4l 4 4 4 4Gß 4П 4ݟ 4P 4 x 4 4 4 4 2 4C? 4M 4Z 4Cg 4Bu 4 4p 4| 40 4C 4ɠ 4Ϡ 4o֠ 4 4p 4p 4  4. 4 `% 4<2 4:u? 4ff 4.s 4p 4`m 4{ 4 4M 4Ρ 4J 4 4 4| 4 4Nn8 4E 4R 4_ 4m 4x 4 4 4Y 4aŢ 4Ѣ 4ޢ 4 4O 4 4 j 4  4$b 4Ԣn 4Jz 4$ 4d 4ѝ 4 4 4;Σ 4q 4} 4 4 4*a! 4w. 4kqE 4}R 4_ 4wv 4} 4 4wf 4s 4 4fΤ 4ۤ 4Ѷ 4} 4~ 4|}# 4C0 4G 4 S 4[l_ 4k 4w 4 4 4Υ 4iۥ 4T 4K 4q 4 4Kk' 43 4-? 4lK 4{a 4n 4a{ 4h` 4ވ 4l 4 4  4ͦ 4aڦ 4  4 4\ 4 4 4* 4AD 4_Q 4v^ 4Jx 4 4` 4 4ޠ 4~ 4Jȧ 4֧ 4q 4 4k 4  4m 4I% 42 4D? 4L 4rY 4f 48t 4: 4 4 4yh 4 4è 4 4 4 4>  4 4v$ 4m1 4> 4$K 4NnX 4ce 4q 4'ɩ 4թ 4 4U 4x 4J 4py 4% 4+ 41 47 4gb> 4TL 4dZ 43h 4 ` 4U 4x 4 4' 4˪ 4٪ 4 4 4 4 4! 4z/ 4e= 4K 4Y 4Eg 4nu 4c 4 4 4 4) 4˫ 4٫ 4 4_ 47 4h 4b 4ɐ- 4h; 4I 4@W 4ke 4s 4xb 4 4 44 4" 4oǬ 4^լ 4I 4A 4K 4  4#m 4O) 47 4cjE 4OeT 4c 4dq 4M 4z 4ޮ 4y 4% 4/ƭ 4ԭ 4z 4 4 4%  4n 4A( 46 4yD 4jR 4` 4fn 4z| 4 4{ 4z 4Ů 4bӮ 4t 4X 4_ 4/  4 4Hv- 4յS 4a 4p 4p~ 4_ 4 4C 44 4uį 4zү 4Nn 4 4 4S 4   40 4@ 4ּP 4ō` 4o 4~ 4 4d 4:e 4 4Q_ 4 48  4M 45 4ٞC 4>`Q 4&u_ 4Fn 4h 48r 4 4 4u̱ 4( 4& 4} 43 4k$ 42 4@ 4N 4\ 4xj 4ux 4 4x 4Nn 4Gh 4֛ 4̲ 4^ڲ 4; 4 4 4J! 4C~; 4}H 4?U 4So 4p 4r 4e 4 4z̳ 4C 4 4  4 4%' 44 4A 4N 4[ 4tdh 4 u 4h 4 4h 4 4B 49ô 4Drд 4ݴ 4 4 4  4/ 4C< 4P 4rj 4w 4 4 4 4˵ 4Gص 4 ` 4Nn 43a 4 4q& 450 4d: 4eD 4xR 44_ 4bl 4Ӭy 4Q 4rm 4 4 4 4uǶ 4Զ 4T 4g 4 4Nn 4% 4Q$ 43 4 @ 4iM 4Z 4h 4 4Nh 4yh 4 4ta 4uǷ 4 4ɬ 4 4U  4x 4) 4s7 4E 4S 4a 4Co 4$|} 4 4 b 4n 4 4nø 4KѸ 4O߸ 41x 4y 4  4Ƚ 4J% 43 41A 4|O 4W{] 4(`k 4y 4 4 4d 4 4~ 4͹ 4: 4?n 4I 4 4 4( 42 4< 4wJ 4:X 4/l 4az 4Y 4` 4* 4 4 4κ 4}ܺ 4 4Uu 4 4U 4! 4. 4J; 4_`H 4U 4b 4}u 4^ 4; 4 4ˏ 4a 4» 4Rֻ 4O 4q 4 4l# 4- 4nG 4ZQ 4/q[ 4ch 4.u 4 4? 4 4 4 4ü 4Әм 4ߨݼ 4w 4 4  4Nn 4 `  4q. 4J 4{X 4Xf 42t 4m 4 4 4 4 ǽ 4ս 4g 4_ 4N 4  4Њ 48c) 4إE 4c` 4n 4c| 4| 4A 4S 4 ` 4ž 4Vپ 4As 4-o 4 4: 4  4- 4: 4G 4NnT 4ʎa 4n 4{ 4x 4| 4 4 4 4׿ 4 4q 4i 4  4 4& 43 4pB 4O 4!i 4v 4v 4 4 4 4q 4hs 4 4$o 4 4u% 4* 4^7 4D 4Q 4$^ 4Cok 4`x 4h 4 4 4m 4 4 48 4 4! 4*. 4x; 4ȼH 4U 4gb 4bo 4} 4 4J 42 4r 4 4 4* 4q 4 4 41h 4( 4`5 4NnB 4UO 4ei 4v 4a 4 4! 4> 4t 4h 4U  4  4$, 4^k9 41L 4xY 4nl 4ny 4 42 4 4߿ 4 4z 4 4X 4P 4z 4R% 4i2 4? 4qM 4LZ 4g 4S 4 4 4: 4¦ 4k_ 4g 4Nn) 47 4D 4hQ 4^ 4Jl 4;y 4 4"z 4 4&x 4 4* 4 4 4h  4J- 4: 4MG 4"zT 4ua 4Jn 4 4~ 4 41 4j 4N 4p 4 4a 4{  4J 49# 4'0 4= 4"zJ 4ZW 4d 4tq 4B~ 4 45 4g 4 4@ 4wo 4U 4` 4 4  4g6 4DB 4bX 4e 4r 4 4 4 4E 4 4 4. 4 4G 4>, 419 4hF 4S 4a 4Aq 4w 4Hb} 41s 4i 4;b 4v 4h 4[ 4 4x 4 ` 4 4Ք 4Ք 4ݕ 4^  4w. 4^P 4c] 4xj 4qw 4 4 4\ 4 4 4 4 4b 4 4% 4e| 4 4 4f 4 4 4o 4g, 4}A 4N 4tv 4 45 4`m 4 46 4 4 4 4b 4+ 4> 4U 4kb 4p 4 } 4{ 4e 4 4Nn 4 42 4t 4e0 4J< 4b 4ky 4 4t 4 4Ŏ 4Nn 46 4`m 4& 4u4 4R 4~k 4sy 4+v 4% 4j 4% 4o 4 4 4| 43v 4  4. 4p< 4kU 4@c 4q 4} 4 4 4N 4> 4h 43 4Ey 4m 4 y- 4; 4I 4NW 45e 49s 4s 4 4f 4 4@ 4ߖ 4g 4ip 4Ģ 4u 4h+ 4!: 4H 4JW 4cue 4\os 4m 4y 4 4  4 4 4f 4v 4]/ 4C 4OM 4t[ 4hi 4w 4P 4 4 4  4z 4` 4 4& 4e 4l 4! 48 4o- 4iP 4q^ 4$z 49x 4 4a 4Y 4q 4_ 4Ӑ 4 4a$ 42j2 4N 4\ 4?j 4x 4 4J 4lf 4| 4 f 4 4 4 41 4 4a 4! 4w0 4? 4N 4*i] 4zl 4{ 4 4 4 4[ 4 4nh 4 4 _ 4r 4  4/ 4a> 4'qM 4$\ 4zk 4z 4a 4Nn 4Qw 4 42 4 4! 4ܔ 4 47 4m 4u. 4= 4{L 4Li[ 4j 4y 4/ 4 4 4< 4 4x 4 4 } 4i. 4NJB 4Nnr 40 4~ 4% 4M 4vi 4(t 4 4 4+ 4 4 4 4 4 4 4R 4 4v* 4 6 4B 4\N 4[ 4h 4u 4 4ω 4 4 4D 4 4 4 4 4  4 4p# 4a0 4= 4W 4d 4aq 4|`~ 4J 4z 4|` 4x 4ʿ& 46 4 < 4B 4I 4_nS 4E` 4Dm 4z 4i 4 t 4 4 4t 4C 4 4 4{ 4C 4|+ 4^8 4 d_ 4l 4 4 4 4l 4 4 4T 4i 4/ 4d< 4V 4l 4ѭx 4 4 4  4 4 4 4 4l 4 4@% 4H> 4FQ 4[ 4pj 4w 4 4 4 4 4 4 4d 4 4 4C 49 4׿^ 4;l 4J 4 4 4 4ѓ 4 4&c 4w 4 4Q 45  4 4g' 4Y4 4AA 4*N 4 4 4k} 4) 4< 4 } 4 4N 4 4Z 4| 4 4+ 4U8 4xE 4%S 4r` 4@fn 4@p{ 4 4 4% 4Ӭ 4ȡ 4} 4i 4ɬ 4Bi# 4- 4w: 4H 4ɌU 4Sb 4[o 4| 4L 4y 4t 4v 4È 4@ 4Wf& 42 4G 4S 4Գh 4t 4% 4sj 4Nn 4 4 4  4~ 4 4 4y$ 42 4a@ 4ЗN 4\ 4Pj 4}x 4k 4| 4? 4O 4 4 4cs 4 4e 4M 4# 4(`2 4A 4˥^ 4\m 4߱| 4q 4t 4ԣ 4 4} 4 4 4 4` 4 4p! 40 4j? 4N 4k 4z 4 4 4f 4 4~ 4º 4e 4 4 4 4C. 4= 4L 4[ 4j 4x 4 4 4 4Y 4* 4R  4i 4j% 4Â2 4? 4mL 4%jZ 4 4? 4+ 4I 4 4 4! 4< 4 4ww 4r  4l 4# 4) 4/ 4p5 4A_; 4#K 4Y 4e 4dr 4 4 4' 46 4 4 4 4 4Ly 4 4! 4^? 4K 4a 4Jm 4>dz 4p 4 4 4ɓ 44 4Z 4 4 4p 4* 4W" 40 4> 4 qL 4Z 4h 49nv 4g 4 4^ 4 4 4X 4 4C 4 4| 4b. 4q; 4N 4\ 4-i 4bv 4 4F 4 4 4 4V 4 4T 4 4" 4f 4 4f  4k- 4E: 43G 4TT 4qb 4Np 4~ 4V 4 4 4G 4T 4M 4v 4 4I 4 4Lg 4|} 4% 4"w 49 4St 4_ 4 4 4 4 4  4~ 4| 4ș 42 4 4ax 4at 4%_ 4ɭ 4 4z" 4߯0 4> 4L 4lZ 4dh 4v 4> 4A 4 4Nn 4c 4c 4 4 4 4R} 4 4. 4!< 4J 4i 4w 4 4] 4F 4 4~ 4 4 4ˠ 4B 4t 4: 4m  4/{. 4< 4J 4X 4DZf 4\t 4 4Y 4g 4Nnu 4n 4b 4 4M 4 45m 4  4Os. 4k 4Fzy 4 4 4 4e 4! 4 4h 4 4 4 4 4! 4/ 4= 4K 4zY 4ug 45u 4F` 4 4_ 4( 4>6 46Q 4_ 4\m 4ɴ{ 4c 4v 4A 4a 4 4 4_t 48} 4 4ެ 4]{ 4 4V 4 @ 4'M 4qZ 4g 4u 4 4  4m 4ğ 4/f 4s 4 4V 4i 4^ 4g 4 4$ 4o2 4@ 47N 4y\ 4j 4x 4 4R 4 4Aa 4 4y 4v 4 4@e 4  41 4{ 4) 4qt3 4A 4>O 4Jk 4>h 4 47 4 4_ 4 4 4 4= 4 4 46 4D 4Q 4fo^ 4ʚv 4 4X 4m 4z 4be 4n 4x 4 4  4  4( 4u6 4xD 4MR 42` 4n 4| 4 4 49 4 4 4Ά 4Vs 4 4| 4) 4 4ko$ 4s2 4H@ 4N 4qq 4 4b 4j 4> 4$r 4 4 4 4٘ 4. 4 4v" 4/ 4< 4bI 4V 4;vc 4p 4} 4  4H 4 4 4 4 4s 4 4y 4_ 4h 4T 4D 4I 4e 4ϔ 4= 4pK 4~Y 4ag 4 4 4D. 4&hp 4M 4;  4   4+  4F  4n  4<  4s  4^  4(>  4{  45  4īa  4n  4!{  4  4f  4)  4ݗ  4h  4   4i  4Zv  4  42/  4<  4tI  4V  4Ոc  41p  4o}  4  42  4df  4l  4W  4ȗ  4E  4.  4-d  4 4p 4" 40 4ۦ> 4OL 4w[ 47k 4q 4w 4} 4W 4w 4 i 4R 4D 4} 4r% 4K 4z 4 4Y 4 4 4M 4 4! 4 . 4; 4V 4` 4m 41{ 4^ 4 4M 4f 4! 4 4Nn 4  4 4p: 4T 4ha 4n 4| 49 4h 4 4 4 4 4ٸ 4.` 4 4e 4k 4Yj$ 42 4K 4<j 4v 4qi 4 4( 4> 4M 4 4> 4 4ת 4a 4P 4" 4љ2 4(B 4ҌR 4b 4h 4 n 4~u 4y 4 4 4r{ 43` 4 4 4o 4q 4!" 49 4.yE 4tR 4f` 4qin 4| 4 4 y 4.` 4 4k 4ɩ 4 4 4 , 4: 4w 4) 4a 4ө 4I 4e 4Y 4 4  4Jj  4 4$ 4 4 4 4 4"v 4* 4r_7 4D 4!Q 4 4ّ 4I 4f 4/ 4$ 4y2 4Ӂ@ 4fmN 4>\ 4j 4fy 4ݩ 4 4  4f 4 4_ 4 4 4g 4Ql 4Β- 4^< 4K 4aZ 4zi 4Tx 4l 4 49 4N 4 4 4* 4 4  4 4a, 4< 4L 4 \ 4vl 4| 4ç 4Л 4t 4t 4\w 4t 4t 4 4\w 4) 45 4A 4}X 4De 4r 4gh 4 4 4 4 4 4 4  4 4W$ 42 4A 4 M 4JY 4`_e 4ưq 4yj~ 4 4 4 4Ɖ 4Q 4R 4/ 4Dx 4!&  43  4@  4Nn  4X  4(  4m  4H  4 ! 4L5! 4V|B! 4jO! 4po! 4X|! 4! 4! 4]! 4t! 4! 4! 4! 4I" 4pn!" 4/" 4ض9" 4F" 4qiS" 4`" 4wm" 4-z" 4" 4ω# 4*# 4N0# 4@6# 4+|<# 4{C# 4і_# 4po# 4*}# 4.# 4# 4C# 4# 4# 4# 4|u# 4n# 4l$ 4J$ 4bT$ 4m$ 4|$ 4V$ 4@$ 4$ 4$ 4J$ 4ma% 4s% 4e% 4)% 46% 4ωC% 4[% 4g% 4t% 4m% 4% 4% 4֍% 4_a% 4%% 4t% 4f% 4˟% 4Nn% 4& 4h& 4 `<& 4I& 4V& 4c& 4kp& 4}& 4Nn& 4& 4E& 4ת& 4Û& 4̲& 4&y& 4& 4(& 4v ' 4' 4&' 4B4' 4OfB' 4P' 4{^' 4'bl' 4Ξz' 4 ' 4' 4A' 4~' 4V' 4u' 4(' 4' 4ս' 4w( 4'>( 4MP( 4>V( 4d\( 4Xb( 4Guh( 4uo( 4Ļ( 4( 4^( 4( 46( 4( 4s( 4J( 4U( 4 v( 4( 4( 4w) 4 ) 4П) 4)) 4m8) 4G) 4V) 4nce) 4ǣt) 4) 4) 4) 4) 4) 4X) 4J) 4) 4r) 4 * 4* 4k%* 45* 4E* 4U* 4e* 4t* 4* 4* 4]* 4ϡ* 4* 4* 4J* 4* 4* 4Qx+ 4ˮ+ 4X(+ 48+ 4޹H+ 4X+ 4Uh+ 4 x+ 4+ 40g+ 4d+ 4+ 4+ 46+ 4c+ 4+ 4g+ 4Z , 4, 4', 4F, 4S, 4!l, 4y, 4J, 4ϡ, 4S, 4, 4i, 4Ȗ, 4, 4؜, 4), 4|, 4- 4- 44"- 4l<- 4MK- 4A`- 4- 4m- 4- 4_- 4- 4- 4- 4- 4ݪ-. 4u:. 4!G. 4T. 4{a. 4fn. 4{. 41. 4. 4. 4. 4. 4q. 4w. 4. 4(. 4v. 4 / 4(/ 4%0/ 4\/ 4ǵi/ 4!/ 42/ 4h/ 4D/ 4!/ 4C/ 4`/ 4/ 4/ 4/ 4q0 4(0 4v0 4,0 4fE0 4s}0 4N0 4!0 4G0 4f0 4"0 4|p0 41 41 41 4+1 481 41 41 4!1 41 41 4|p1 42 4!-2 4e32 4^92 4j@2 4}O2 4Od^2 4n2 42 42 42 4f2 42 4f2 4,2 42 4]2 4>|2 4s3 4x3 4z3 4 3 47'3 453 4^C3 4Q3 4 _3 4Qn3 4a|3 43 4i3 43 4ok3 4&3 43 43 43 4b3 43 4m3 4e3 4{3 4g3 4b4 44 44 4 4 4j'4 454 4~C4 4Q4 4:_4 4|4 44 4q4 4Rk4 44 44 4~4 4!4 4*4 45 4k5 4˜'5 415 4l?5 4fM5 4[5 4i5 45 4 5 45 4޷5 4u5 4}5 45 4C5 455 46 4o6 46 4)6 486 4F6 4T6 49~b6 4`p6 4~6 46 4s6 46 4n6 4t6 46 4ݐ6 4:q6 4pe7 4t!7 4.7 4_T7 4a7 4n7 4{7 4u7 4^j7 4ݢ7 47 47 4x7 47 47 47 48 4Nn8 4j 8 46-8 4:8 49zG8 4SU8 4ͧa8 4Vo8 4}8 4p8 4h8 48 48 48 48 4Ӿ8 48 4D8 4 9 4x9 4%9 4|p39 4lA9 42O9 4]9 4v9 49 4f{9 4ײ9 4r9 419 4I9 49 49 49 49 4Ȧ : 4E: 4%: 4Nn3: 4^A: 4iO: 4]: 4k: 4Oy: 4 : 4 l: 4: 4: 4: 4xq: 4: 4x: 4: 4r; 4; 4{!; 49/; 4!=; 4LK; 4˨Y; 4Zg; 4)pu; 4K; 4; 4; 4; 4; 4g; 4Z; 4b; 4; 4|< 4< 4`< 4=+< 469< 4G< 4TV< 4|< 4i< 4I< 49< 4ԯ< 4< 4:< 4&< 4d< 4= 4= 4s= 4#= 4-= 47= 4RA= 4K= 4vY= 4:g= 4/v= 4a= 4= 4= 4j;> 48> 4K? 4W? 4-d? 4q? 4l~? 41? 4? 4? 4|? 4? 4/? 4l? 4? 4? 4Dl@ 4 @ 4@ 4k'@ 4el@@ 43M@ 4"Z@ 4g@ 4pt@ 4D@ 4ܟ@ 4c@ 4@ 4~@ 4@ 4s@ 4@ 4"@ 4\@ 4A 4#A 4#UA 45bA 4oA 4o~|A 4rA 4A 4cA 4YA 4nA 4A 4A 40A 4 B 4!eB 4qB 4QB 4c}B 4eB 4B 4B 4~B 4B 4 C 4C 4 %C 4=C 4PC 4\C.xeC 4"qC.tzC 4C.pC 4=C.hC 4C"@C 4CC 4XyCx D 4|nD *D3D 48D 4TD 4uD 4%D 4~D 4D 4D 4qD 4D 4E 4'E 4[@E 4\E 4iE 4)E 4E 4OE 4^dE 4xE 4F 4r8F 4pKF 4a]F 4gFF 6=F 65F 4F 6kF 6cF 6F 6F 4F 45F 6F 6F 4F 6ܠF 6РF 6F 6 F 4G G 4-GG 7D3$G 4/.G 6q2G 6o7G 4kAG 6EG 6~JG[G 4\iG 4qGG 4€GQG 4GG 4G 4BG 6G 6G 73G 4GG 4€HH%H"@;HXHiH"@zH 7d3H 4EH 6H 6H 4kH 6ءH 6ҡH!H 4ۀH 4HH 4H:H 743 I 6  I 6 I: I 743,I 60I 6;IDI_I 6-cI 6+hIyI.xIIIIII 6EI 6CII.xJJ 7T3J 6]#J 6[(J9J.xHJQJlJ 6upJ 6suJJ.xJJ 7t3J 6J 6J J.xJJ Kz%KPKhKK!K"@KK KKK 4cL %L 6)L 68L 6N 6BN 6GN 4QN 65UN 61ZNgNyNNN 6KN 6INN.xNN 73N 6cN 6aNN.xOOW-O" 7OLO" VO qO {O)O" O.ODO O\O O 4CPP"'P"CP"LP"jP4{P 4P P 73P 45P 6P 6yPdP 6P 6PsP{P5Q5"Q 6&Q 6+QAR 4KR 4NnYR 4]jR 4wR 4NnR 4`mR 4R 4R 4zsR 4R 4fR 4NnR 4|R 4R 4J S 4nS 4J&S 4w8S 4JS 4[S 4iS 4S 4S 4S 4S 4S 4xS 4xS 1{S 4 T 5T 5TT 2vT 4u( ET 49 QT 4[T 4Q iT 4{ nT 4S |T 4 T 4T 4u T 4T T 4IQ T 4GT 4AV T 4\ T 4w T 4X T 4$q _U 4 eU 40 wU 4N U 4 U 4sR U 4m U 4O U 4J5 U 4h U 40 U 4?6 U 4- U 42t U 4hV 4 V 4K V 4< !V 4? -V 4cn 9V 4EV 4` QV 4 , ]V 4ut iV 4|V 4q V 4 V 4Α V 4h V 4g V 48V 4H V 4b V 4f V 4 V 4 V 4 W 4 W 42"W 4rD 7W 4mo EW 4/u ZW 4mo hW 4 tW 4m' W 4^ W 4E W 4% W 4-k W 4 W 4^ W 4\h W 4 X 4^ X 4v KX 4 lX 4 yX 43 X 4X 4 X 4 X 4j X 4B X 4[ X 4]^ X 4 X 4k Y 4= Y 4 Y 4 *Y 4 8Y 4 FY 4n} TY 4s bY 4 pY 4 ~Y 4^ Y 4u Y 4ԑ Y 4c Y 4 Y 4* Y 4  Y 4 Z 4~` (Z 4 7Z 4 GZ 4]W VZ 4 eZ 4,7 tZ 4W Z 46 Z 4cZ 43 Z 4. Z 4o> Z 4҆ Z 4>U Z 4 Z 4, [ 43? [ 4|Z )[ 4=T 8[ 4' G[ 4V[ 4 e[ 4$ t[ 4 [ 4 [ 4[ 4[ 4Յ [ 47J [ 4 [ 4M] [ 4` [ 4A \ 4OV \ 4 (\ 4iG 7\ 4 F\ 4 U\ 4o d\ 4t s\ 4 \ 4h \ 4H \ 4; \ 4# \ 4x \ 4j \ 4H \ 4" ] 4 ] 4X )] 4x 9] 4 I] 4{/ Y] 4\ i] 4 y] 4} ] 46x ] 4T* ] 4#x ] 4m ] 4 ] 4) ] 4] 4 ^ 4T^ 4 (^ 4` F^ 4w' U^ 4 d^ 4s^ 4>< ^ 4q] ^ 4 ^ 4 b ^ 4GV ^ 4t ^ 4g ^ 41 ^ 4^ 4] _ 4g_ 4'_ 4M 6_ 4@ E_ 4 T_ 4/ c_ 4K+ r_ 4fX _ 4_ 4H _ 4 _ 4_ 4 Z _ 4q _ 4a _ 4_ 4Q ` 4| ` 4>P '` 4j 6` 4m E` 44 T` 4w c` 4X r` 4 ` 4G` 41 ` 4n` 4 ` 4l ` 4 ` 4 ` 4H7 a 47b a 4i %a 4 4a 4 Ca 4! Ra 4 aa 4 pa 4~ a 4$ a 4 a 4 a 4z a 4t a 4H a 4\ a 4< a 4% b 4/ b 4, $b 4_ 3b 4X Bb 4Z Qb 4% `b 4u ob 4( ~b 4b 4 b 4 b 4:E b 4Y b 4? b 4i b 4>N b 4 c 4K c 4bJ #c 4SB 2c 4g Ac 4: Pc 4n _c 4)g nc 4/ }c 4: c 4f c 43G c 4N c 4W c 4[ c 45 c 4 c 43 d 4` d 4GA "d 4oK 1d 4a @d 4#T Od 4 ^d 4pq md 4j |d 4E d 4 o d 4*z d 4$ d 4 d 4= d 4r d 4B d 4e 4S e 4& "e 4s 1e 4; @e 4% Oe 4d ^e 4l me 4c |e 4# e 44^ e 4 e 4N e 4U e 4 e 4A e 4z e 4>B f 4 f 4:> "f 4z 1f 4g @f 4 Of 4c^f 4 mf 4, |f 4e f 4/ f 4af 4q f 4< f 4;* f 4f 4E( f 4~ g 4m g 4E 1g 4tB @g 4` Og 4T ^g 42 mg 4= |g 4u g 4ߔ g 4T g 4 g 4' g 4A. g 4r g 4% g 4} h 4Th 4o $h 4{ 4h 4 Ch 4 G Rh 4 ah 4+ qh 4* h 4, h 4l h 4l h 4H h 4 i 4V &i 4]! 2i 4` >i 4 Ki 4 Xi 4^ ri 4 i 4hC i 4v i 4~D i 42i 4&S i 4U i 4 j 4! j 4G %j 4U 3j 4U Aj 4!Oj 4"p ]j 4/2 kj 4/ yj 4^ j 4 j 4Ր j 4~k j 4ED j 4p* j 4 j 4- j 4Q j 4\Q k 4- k 4G#k 41k 4G ?k 4] Mk 4WW [k 4k ik 4s\ wk 4 k 49 k 4 k 4M k 4J k 4 k 4[ k 4f k 4( l 4Q l 4f %l 4T 4l 4ir Cl 4Mb Rl 4N al 4! l 4r= l 4: l 4% l 4 l 4l l 4< l 4! l 4 l 4m 4? m 4F %m 4 4m 4{ Cm 4?Rm 4" am 4 pm 4R m 4&0 m 4V m 4F m 4I m 4u m 4!m m 4b m 4m 4 n 4 n 4c $n 4& 3n 4 Bn 45[ Qn 4K `n 4 on 4 ~n 40 n 4] n 4c n 4hi n 4z n 4n 4N n 4K n 4< o 4} o 4 -o 4]! 9o 4i Eo 4^ Ro 4o _o 4/ lo 4e o 4<o 4&4 o 4) o 4X o 4^O o 4Q o 41 p 4n p 4? &p 45v 4p 4]! Bp 4 Qp 4gE ^p 4 kp 4= xp 4= p 4]! p 4 p 4= q 4w q 4&{ !q 4-. -q 4R 9q 4U \q 4P q 4s q 4 q 4 q 4q 48U q 4] r 4%o r 4 r 4 :r 4 Gr 4[ Zr 4m ir 4% r 4U r 4r 4@ r 4b_ r 4sk r 4? r 4$ s 4ar s 4i *s 48 8s 4P Fs 4G Vs 4ds 4V} rs 4/ s 4U s 4e: s 48 s 470 s 4]C t 4f !t 40 /t 4{ Ct 4; Qt 4K _t 4L* mt 4v> |t 4f t 4ď t 4J$ t 4$ t 4L t 48 t 4;q t 4z t 47m t 4@} u 4 %u 4%2u 4 Iu 4/ Vu 4&^ u 4' u 4Y% u 4a u 4P% u 4b u 4gc v 4 v 4a %v 4J -v 4g 5v 4 . Bv 4> Pv 4kU \v 4oiv 4&S vv 4d v 4< v 4 v 4 v 4 v 4W v 4D v 4v v 4p{ v 4 w 4 w 42w 4. >w 4P3 Kw 4 Xw 46 ew 4 rw 4: w 4  w 4 @ w 4  w 4 w 4h w 4(p w 4# w 4Z w 4l8 w 4W w 4x 4% $x 4=j 1x 4; >x 4L Kx 4 cx 4ς px 4E }x 4b x 4 x 41 x 4N x 4 x 4)! y 48 y 4/ 'y 42e 5y 4 d Cy 4iQy 4( _y 4v my 4! {y 4i$ y 4 y 4Sy 4& y 4g y 45 y 4 y 4Y y 4:n y 4 z 4B9 z 4&S #z 4V6 1z 4C ?z 4 Mz 4 [z 4G iz 46 wz 4o z 4e z 43 z 4K< z 4 z 4y z 4S, z 4W z 4 z 4]3 { 4{ 4"{ 4 0{ 4 @{ 4 F{ 4% L{ 4. R{ 4` X{ 4n ^{ 4 d{ 4x j{ 4p{ 4vl v{ 4X |{ 48 { 4NJ { 4,f { 4v { 4{ 4 { 4J { 4@ { 4{ 47 { 4- { 4 { 4y { 4&# { 4% | 4; | 4p | 4C | 4{ | 4 !| 4BH '| 4 -| 4) 3| 4I 9| 4/{ ?| 4ݓ E| 4I> K| 4L Q| 4[ W| 4 ]| 4c| 4] i| 4 o| 4w u| 4|| 4Pz | 4G | 4 | 4] | 4nI | 4@ | 4 | 40 | 4Y | 4f} 47 } 4ۉ } 4\$} 4; 4} 4V N} 4 [} 4P h} 4 u} 4a} 4" } 4E } 4 } 4+ } 4 } 4J } 4+ } 4 ~ 4^ ~ 4]! -~ 4 D~ 4_1 Q~ 4X ^~ 4k k~ 4+ x~ 4 ~ 4/& ~ 4L ~ 4!R ~ 4S~ 4` ~ 4ߒ  4\  4  4!G ) 4,D 4q| z 4  4na  4  4]!  4,  4|  4h 2 4q| _ 4 l 4}7 3 4 A R 4 r 4lX  4D  48 4}  4P  4Ň  4]  4 ڂ 4 " 4 / 4A < 4P I 4 V 4i  4@  4P  4'  4^~  4> ( 4U= A 4 N 4 [ 4M~ 4)  4W  4*  4*B DŽ 4[ք 4  4o  4  4$ 4Oc 1 4m2 ? 4 L 47 Z 4FO y 4  4[N  4L  4W  4! ΅ 4ޅ 4Xw  4  4`  48 49 , 46 : 4m H 4{ h 4|e v 4  4  4  4/  40  4 { ц 4A: ކ 4L  4[N . 43 48 = 4 J 4 W 4id 4Ň  42  4-k  4H&  4^ Ç 4G χ 4e ܇ 4  4f 0 4l = 4b0 Q 4 f 4> t 4r  4Jf  4U)  4nM  4  4:  4u Έ 42 ۈ 4*  45F  4^&  4  4& ! 4q . 4=# ; 4o H 4G U 4b b 4*h o 4vL | 4w  4>  4  4P  4v  4׋ ʉ 4  4  4&S  46 & 4%= 2 4Ct ? 4&9 L 4-k Z 4, g 4^ t 4\h  4%  4&^  42U  4/  4 ۊ 4v[  4  4o  4|:  4 4 ( 4V 4 4 2 A 4O 4> [ 4\ h 4v 4  4 4&S  4w  4&S ȋ 4p ދ 4p%  40  4A3 7 4j D 4M W 4G s 4!  4hS  4W:  4W  4o  4E Ό 4ی 4 4  4Q4  4J1  4 4H ) 472 6 44 C 4i P 4 ] 4V q 4~ 4C  4  4k  4g ΍ 4F0 ܍ 4H  4   4B  4hh  4 " 4{4 0 4\ > 4P7 L 4 ` 4H n 4V- | 4x  4cj  4  4  4_ Ž 4x Ў 4 ގ 4C1  4E  4*Y  4`2  4L $ 4 2 4 @ 4,O N 4l \ 4 j 4 x 4  4v  4.!  4^  4  4 Ώ 4y  4"+  4V  40  4[ " 4v 1 4s G 4`| V 4p f 4yf | 49  4R  4  47  4X ݐ 4q  4r  4P_  4  4  4rW + 4 8 4=E 4 R 4g _ 4? l 4; y 48  4  4J  4?\  4N ɑ 4T ב 4$  4Ze  4  4s  4  4(u + 4C 9 4`Z G 4r U 484 c 4; q 4]  4r  4l  4!  4_  4( Œ 4+ Ӓ 4 4Q  40  4:  4m  4:V ' 4= 5 4[ D 4Ij S 4b 4i_ q 4\  4  4L  4U[  4C  4O ̓ 4) ۓ 43  4n  4C  4vh  41 & 4 5 4, D 4e S 4Mb 4) q 4Z 4,  4\  4!  4 4 ˔ 4n ڔ 4% 4  4t  41& 4#a 6 4B E 4' T 4c i 4> y 4f7  4K U 4)b 4 o 4 | 4e  4J  4" ʖ 4E  4B % 4 2 4+ ? 4 M 4 Z 4 g 4 @ t 46  4  4:  4@u  42  4bh ė 4z ݗ 4>  48 44  4  4p  4  4K  4k0 $ 4q 1 4 ? 4PO I 4s V 4e d 4: q 4 ~ 4v  4Z  4\  47  4L  4s Ә 4-i  4\  4  4-i  4  47A # 4A* 1 4 ? 4O L 4-i Z 4) j 40 p 4~ w 4[  4A*  4n  4  4L  4Gƙ 4M ә 4Z  4@  4,-  46 ! 4 . 4^ H 4; U 4y b 4Z o 4B  4݃  4׋  4  4  4 ٚ 4  4  4  4g  4 ! 48 ? 4k K 4` X 4f 4{% r 4%7  4  4+S  4  4 4p  4  4v;  4a  4+V , 4 : 8 406 I 4] V 4fq b 4g o 4  4u  4P  4'  4œ 4j Ϝ 4#  4u  4P  4j  4u $ 4P 1 4q> 4 K 4)| b 4! o 4Zr | 4/Q  4  44  4L ĝ 41J ѝ 4Su  4h  4  4+  4A@  4 W . 4K K 4> o 4$ | 4y0  4h  4  4  4 Ȟ 4A Ԟ 4>  4  4c  4  4 4) 4 7 4 K 4K W 4C a 4U n 4{ 4  4/  4#  4Gv  4  4. ˟ 4D  4.]  4uz  4B  4` ' 44 4e: B 49 O 4 \ 4B i 4[N w 4  4r=  4  4$v  4  4O Ơ 4+ Ӡ 42`  4`  4  49  4+  4[ " 4h* / 4e = 4J 4= W 4T d 4Ā  4Q  4U  42U  4SM  4S š 4H ҡ 4j ߡ 4&  4  4m 4% G 4ؒ j 4g} v 4K+  4@  4  4&S  4  4 Ƣ 44 ̢ 4T~ Ң 4 4b L 4F Z 4 h 4!v 4,  4  45i  46&  4U  4N ʥ 4! إ 4 4  4K(  4Q  4*, ! 4Y / 4H = 4? K 4 Y 4c g 4{j u 4F  4Z@  4#  4:  4T  4?- ɦ 4A0 צ 4  4AI  4  4><  4P  4b + 4A N 4P X 4'A f 4t 41  4H  4%*  4c  4_}  4 Χ 4P  4Sn  4\  4E  4]- - 4R ; 4 I 4Z W 4QS e 4Y s 4  4ގ  4*  4(  4@4  4~` Ѩ 4  4W  4(%  4p  4% , 4*" : 4H 4 W 4)  4w 44Y  4  4y  4o< ש 4H7  4 4:  4M  46 4 D 4^ X 4E ` 4 o 4E?  4d  4z  4Q  48 Ǫ 4 ժ 41  4  4k  4  4  4O ) 4OI 7 4 E 4AS 43 a 4) o 4} } 4Ll  4p  4  4&S ī 4s ޫ 4o  46j  4hk  4^ 5 4 B 4o O 4l b 4j o 4  4s  4t  4l  4ˈ ʬ 4S ׬ 4"$  4  48  4N  4:  4_= % 4x 2 4? 4e L 4t2 Y 4g@ f 4 s 4ߔ  4z  4 k  4C  4Q{ ҭ 4 ߭ 4\  4  4z  4ߔ - 4j T 4/ a 4^ n 4N { 4G 4  4 4w  4T ɮ 4! Ӯ 4 ݮ 4l  4'  4e  4 4sF  4* ) 4 6 4!~ C 4< P 4 ] 4" j 4:Y w 45  4 4i  4  4O  4o ǯ 4B ֯ 4N  4hz  4[  4ee  4 $ 4H2 4@ 4Uy N 4\ 4ю j 4  4iF  4[7  4@  4  4 ̰ 4P ڰ 4/  4;o  4K+  4H  4  4ϊ . 4 < 4q J 4a X 4; f 4]X t 4f  4  4N  41E  4Y  42> ȱ 4:E ֱ 4O/  4  4  4c 4}  4XY * 4]o 8 4F 4Y" T 4nj b 4e p 4*  4  4  4p  45  4nt ˲ 4~ ղ 4 ߲ 4Z  46  4&^  4A 4F + 4\9 4b G 4\ U 4; c 4> q 4  4{)  4u  4(  41  4{ ij 48 ѳ 4&S ޳ 4 4A  4h  4p  4' 4F 1 4- ; 4' I 4W 4j e 42 y 4O  4{  43  4 ƴ 4 д 42H  4  4  4  4e  4{+ % 46 2 4$ ? 44 L 4oj Y 4u f 4O s 4%B  4  4Ym  4hb  4  4Gõ 4A ѵ 4Eq  4k  44S  4K  4* % 4 @ 4 N 4'F \ 4v j 4[' x 4-)  4, 4C  4u  4D"  4!̶ 4>  4m 4g  48  4h= - 4h A 46 N 4G[ 4 h 4) | 4,  4  4G  4$  4e ÷ 4^ з 4V ݷ 4[N  4  4X&  4U  4m  4 + 4m > 4\t H 4 R 4' \ 4* z 4‹  4v  4Ŏ  4  4&[  4Yx ɸ 4 ָ 4  4  4G  4hC  4t. & 4 3 4P @ 4 j 44( v 4S  4c  4  4d  4 ȹ 4- ͹ 4O ڹ 4)L  4  40K  4  4Q 4V` B 4Tm i 4[N v 4E<  4$"  44n  4R  4  4 ĺ 4R Ѻ 4d ޺ 4W  4V  4 4 44  4( - 4&S : 4, H 4A U 41 o 4?E | 4m1  4d  4*  4|  4+ 4h ˻ 4W^ ػ 4  41  4o  4Ym  42 40 ? 4G L 4l Y 4/  4 41  4u ļ 4, м 4 ݼ 4E  4M  4K,  4  4p * 4/ D 4 Q 4v[ _ 4// k 4  w 4S  4u?  4v3  4<  4s ɽ 4Ŏ ֽ 4׋  4v  4F  4U  48 2 4 A 4H N 46 [ 4? h 4 4+H  4 ; 4)c ۾ 4t  4 4  4&S  4}  4IR * 4 7 4.1 D 4u Q 4U ` 4" o 4u } 4Cx  4ſ 4&S ҿ 4I ߿ 4  4  4/  4pL  4I & 4ڍ 3 4Ly M 4 Z 4iW m 4A z 4A*  4  41 4  4&S  4N  4h  4IR  4  4  43  4  4# # 4^ 0 4~ = 4J 4+l W 4o d 42 r 4Y  4 4U  4U  4y 4(  4 4   4e  47 . 41 ; 4e R 4g _ 4e v 4_  4h|  4F  4q  4  4#  4  45;  4J  48  4JY  4 " 4 ( 4/ 4? 4q E 4Ri K 4bV Q 4 X 4F e 4Gr 4Ly  4,  4,  4-  41  4  4 4 4F  4v  4 + 4A 8 4ݑ E 4D R 4^ l 4\#  46 4d  4+  4l  4l  4 4&S  4p  4 4> * 47 7 4| D 4 ^ 4 k 4&S x 4  4\{  4Am  48`  4/  4  4\{  4Ŏ  4[N  4N  42 4 4N , 4 9 4F 4Og S 4) ` 43 m 4T z 4s  45g  4R  4^  4  4 4  4i  4*x  4 ) 4x1 ? 4 K 4` g 4\L z 4P  4BL  4.  4 4~  4~!  4  4  40|  4h6 $ 4% > 4o K 4]! X 4 e 4\H  4/  42  4 4A=  4D  4C  4i . 4*x d 4P q 4S&  4  4\L  4  4D  4  4[  4  4w  4b . 4~ < 4J 4n X 4%' f 4  4V  4 w  4j  4'  4q  4  4i-  47=  4Y  4YS ; 4 V J 4~s s 4U  4p{  4 4x  4  4  4q  4Ym  4  4  4;X  4x5  4X 3 4|N A 4O 4-v ] 4O k 4. y 4 4  4f;  4 q  4 4G  4d  4&S  4  4  4 - 4 ; 4$ I 4[B b 4FZ p 4j  4 4k  4%  4z]  4ď  4  4  4wI $ 4 2 4 @ 4֔ N 4hZ \ 4z j 4x 4p$  4|  4 4P  4G  4&J  4s  4 4%  4 ' 4 B 4 [ 4i 4L w 4d  4 4(  4  4 4, 48  4m!  4n  4- & 4P 4 4>U B 4fP 4T ^ 4l 4` z 4=  43c  4_  4&  4G  4  4?  4s  4Y  4?  4  4n ) 4< 8 4|' G 4Db V 4@ e 4' t 4x 4  42 4  4o  4y  4 4  4%  4K  4i ( 4`z 7 4 F 4 U 4H~ d 4/ s 4 k  4d1  4,  4֊  4w  4a  4 \  4  4+  4a  4 6  4 ' 4t 6 4- E 4p T 4'  4=  4L  4  4  4 4;"  4  4( . 4 X 4eP g 4| x 4~ 4  4O\  4A  4"j  4]M  4jH  49  4k  4Ό  4ny  4p  4u}  4 4&K  4 <  4 b  4v  4C  4 Y  4(  4hs  4q+  4  4  4  $ 4 * 4\k 0 43B 6 4! < 44 B 4!I H 4Z4 N 4u T 4 Z 4F\ ` 4< f 4  l 4:R r 4. x 4n/ ~ 4  4 -  4_K  4#  4P  4n  4d  4  4HX  4  4  4#  4a  4  4Da  4  4`  4_  4D  4y  4*@ ) 40 6 4 E C 4)! P 4I ] 4K4 j 4 * x 4p  4:  4  4^I  4s  4f  4A*  4 4vT  4&  4{S % 42 4? 4&S M 4 g 4z 4#  4a[  4  4<2  4  4p  4  4 ! 4( . 4&3 ; 4Ŏ I 4 d 4J q 4T ~ 4v  4M  4x  4f  4zU  4  4  4  4  4Uc - 4A3 @ 4]! M 4D Z 4 h 4|< | 4  4K=  4Ŏ  4Ae  4"  4%  4U - 4G 9 4`g O 4 % [ 4z q 4A3 ~ 4lg  4]!  4D  4  4ax  4(>  4Q  4i4  4~  4{ + 4}c 8 4~* E 4WP R 49 _ 47 l 4J  4s  4 4Dp  4Q{  4  4-  4n[  4f - 4&S G 4 T 4z# a 4: o 4+ } 4D  4 4  4  4  4  4%?  4 4b  4&  4C  4a N 4} [ 4; h 4=W u 4"  4  4  4q4  4P  4E  4  4Q  4[<  4@  4  4:  4o ! 4:/ 4 < 4  4Fi . 4 L = 4 L 41 [ 4< j 4A| y 4C)  4h  4~z  4F%  4t  4r  4A*  4]  4#  4[b  4@5 , 4* ; 4=c J 4HP Y 4h 4OZ w 4  4U  4 4h(  4_  48}  4a/  4Yp  4{i  4Zu  4w~ + 4 P 4ep V 44 \ 4+ b 4 h 4 z 4  4  4  4́  4  4  4/  4P  4J  4.  4(E  4:  46K $ 4{ 1 4Ŏ ? 4L 4p Y 4:n f 41 s 4 4 v  4Z  4U  4 H  4  4E  48  4E  4H  4 ( 4 5 41 E 4i K 4i Q 4o W 4:y ] 4gc 4 s 4K  4R!  4  4s\  4a  4L0  4n  4Cs  4S  4p  4(  4 - 4P ; 4 I 4L` g 4j] s 4&  4Iz  4. 4M  4x  4h  4+  4+^  4A  4k  4^q  4? . 4Ј < 4U. J 4t X 4 f 4 t 4gR  4:s  4  4 4sE  4Z  4J  4q  4|  4H  4F  4yx " 4{W ) 4fV 4c c 4W v 4]!  4QA  4t 4  4rP  4f\  4V  4@  4Q  4n  4y  40  4* ! 4 . 4. ; 4d. H 4b U 4k3 b 4Ҁ o 4 | 4K  4E^  4;D  4%  4 U  4  4d?  4f  4D  4  4-  4Z * 4Ed 8 4FF 4f  4KL  4c  4  4J  4 4s^  4G  4W  4( # 4 1 4 ? 4f  41  4  4X(  4  4X  4K  4G . 4pe < 4 J 4I X 4 f 4F t 4  4 4G  4:  47  4x  4  4 4  4]  4sQ  449  4 9 4 G 4.b V 4C d 4ug r 4L  4ʉ  4  4   4 )  4P  4  4o  4\d  4I9  4s  4 , 4K. : 4a H 4 V 4t d 4 r 4 ?  4K  4M  4.  4p  4E  4  4K  4n 4  4o  4F , 4g : 4~s H 4: V 4l  4  4.  4  4t6  4N  4U  4_  4  4  4k  4- - 4Np ; 4w I 4L@ W 4 e 4oO s 4O  4  4IW  4 4($  46 B 4.5 P 4p{ ^ 4\L y 4 n  44<  49O  4u 4~  4@z  4PT  4  4w=  4 4  4_  4~F  4  4x . 4# ; 4f h 4E u 4  4Ir  4W  4b  4F3  4o  428  4) 4  43@  4&  4F  4" 4# 0 4Uo > 4b L 4Q Z 46 h 4_ v 4[  4  4Pr  4  4$  44  4 4  4  4,  4  4) 4c 3 4 = 4K G 4 Q 4h [ 4/ i 4p{ w 4&S  48 4l  4wm  4oc  4, 4[N  4i  4;  4Z?  4\ 9 4 F 4^ ^ 4ѓ l 4_ y 4!  42  4l  4  4#x  4.  43 4D  46  4 & 4 4 4f B 4" P 4 ^ 4c l 4: z 4؈  4  4a  4\;  4z  4d  4%}  4  4  4A  4?  4 " 4Z 0 4 > 4& L 4 Z 4}A h 4݋ v 4  4p  4 4o  4~m  4  4W  4-  4`  4 1 # 4w 0 4j = 4d J 4t W 45 d 4q 4 ~ 4r  4A  4'  48  4n  4r7  4!2  4@!  4Z  4  4Y  42  4. 48 4 B 46 l 4 (  4((  4,  4j e 4 s 4UI  4 4A  4w  4I V 4  4  4O c 4J 0 4q S 4b n 49d  4va  4v  4 4 f 4 = 4c G 4UE  4|  4G  4׋  4><  4'-  4 0  4 49  4 4  4X+ , 4s W 4z d 4 q 47 ~ 4  4G  4\  4+  48  4^ 4  44  4/  4<^  4S0  4! 4) . 4f < 4] J 4ԃ X 4 @ f 4h t 4C  4!i  4z  4[  4u  4a  4&  4! 4e  4Mk  4 A  45 N  4 t  4!G  41  4(]  4Z  4  4Q  4*N =  4t J  4=? W  4q] d  4T   4A  4f#  4f  4  4p  4y  4><  4G  4A3  4   4 6  4 C  4M c  4= }  4  4[N  4ku  4 I  4  4:n  4(  4>  4s  4S   4i  4rn #  41  4( ?  4SM  45 [  4 d t  4  4Uo  4  4[G  4g5  4p{  4  4  42U  4R  4VD ! 4/ 4c = 4rn K 42 [ 4 k 4J$ { 4 X  4+W  47  4Nh  4  4]!  4w  4  4 4y  4}  4W 1 4@f > 4G K 4 b 4 n 4 { 4 4 4[N  4P  4q  4i 45  4(  4"C  4 d  45 G 4~ U 4 c 4|  4'-  4 4,C  4  4~  48  4:n  4~ & 4D3 4-D @ 4Rd M 4Q1  4k"  4ҋ  4n  4Y  4.; S 4` 4g m 4G z 4i%  4 4)  4  4>< - 4d ; 4]! W 4 e 4 s 4  42U  4F  4]j  46C  4)w  4x  4 4 R  4 4u $ 4 3 4J B 4 Q 4* ` 4I o 4a] ~ 4 4H  4}  4  48  4P  4d  4_  4:n  43k " 41 1 4 @ 4L} O 45 _ 44 o 4h  45L  44  4F  4@  43  4  4*t  4  4  4*t 8 4_: D 4 P 4r \ 4\ h 4: t 4{-  49  48u  4q 4S  4o  4p  4N  4F & 4{" 2 4y ? 4r K 4p g 4/ u 4^  4G  4[l  4 4J  4 4  4X  4-  4 !  4!h  4"  4; 5 4 B 4G i 4/ v 4  4  4Oj  4  4X  4v@ 4 4q [ 4z x 4 4A*  4̇  4V  4<  40  4  41  4uo  4< $ 4 > 4 W 4 e 46Q o 4& | 4 4  4|  4x  4Pv  4)! O 4j ` 4/I f 45 l 4 r 4 y 4.  4A*  4D  4L  4  4S  4[N  4  4u  4 % 4ʎ 3 4. G 4+  4 4J  4/w  4o  4|  4  40*  4c % 4k A 4Y N 4&S [ 4h 4 u 4  4V  4K4  4)!  4l  4#  4n  4  4j  4   49%   4  4_ )  4 6  4]j C  498 P  4 ^  4`N x  4  4G  4A  4  4=  4  4wu  4  4-e ! 4 ! 4VD ! 43 *! 4M 8! 4 F! 4A T! 4! b! 4 p! 4gI ~! 4K ! 4TX ! 4I! 4? ! 4 ! 4! 4=7 ! 4 ! 4 ! 4 " 4 " 4ȅ &" 43 4" 4P B" 4U P" 4Y ^" 4 l" 4aa " 4u " 4dL " 4m " 4C_ " 4g " 4 " 4V " 4z " 4" 4/\ " 4~B " 4c # 4 # 4&S !# 41 /# 4D =# 4 K# 4@ Y# 4~ h# 4zw r# 4>8 # 4= # 4l # 4I # 40 # 4W# 4< # 4܂ # 4F # 4W $ 4˔ $ 4 %$ 4 3$ 4&S A$ 4׋ O$ 4 ]$ 4L k$ 4R {$ 4T $ 4] $ 4l $ 4 $ 4* $ 4^ $ 4 $ 4U $ 4~K % 4t: % 4w % 4% .% 4H- >% 4W N% 4[ ^% 4 n% 4H ~% 4͏ % 4n % 4T % 4 % 4fl % 4. % 4kx % 4*% 41 & 4 & 4' && 4 4& 4B& 4; Q& 4V `& 4 o& 4V ~& 4+ & 4Rs & 4nN & 4G & 4׋ & 4&S & 4t: & 48 ' 4 ' 4t ' 4. -' 44 :' 45 G' 4r T' 4' a' 4r n' 4 {' 4] ' 4 ' 4y ' 4t ' 4U ' 4 ' 4| ( 4,( 4O6 ,( 4 :( 4Sw H( 4> V( 4\D ( 4]> ( 4G ( 4҉ ( 4r ( 4( 4 ( 4i ( 4i% ( 4S ) 4 ) 414 ") 4 /) 4 <) 44 I) 4! V) 4 c) 4d p) 4 }) 4E ) 40$ ) 4 P ) 4G ) 4/ ) 4% * 4/_ * 4iB * 4u{ ** 4S 7* 4S D* 4 Q* 414 ^* 4 k* 4! x* 4 * 4_ * 4* 4C + 4d + 4G )+ 4} 6+ 4C+ 4x P+ 4. ]+ 4\ j+ 4z w+ 4T + 4P + 4Rd + 4Q1 , 4a +, 4G 8, 4_ E, 4i% R, 4. _, 4:n , 4iB , 4 , 4 , 40 , 4 , 4?, 4(r , 4lf - 4J2 - 4Bn - 4*- 44 9- 4J- 4p P- 4*d V- 4c \- 4 c- 4 t- 4,+ z- 4~ - 4O - 4[A - 4g - 4- 4\# - 4 W - 4Ň - 4r - 49 - 4Ŏ - 4I . 4 . 4fm . 4:' &. 4WF ,. 42 2. 4>S 8. 4v >. 4 E. 4V. 4 \. 4b. 42 i. 4S z. 4y . 4d . 4 . 4aw . 4 . 4x . 4KK . 4g . 4V . 4͍ / 4 / 4O 3/ 4^ =/ 4 G/ 4; Q/ 43k [/ 4%/ j/ 4ZT w/ 4 5 / 4V / 4 / 4y/ 4Sw / 4gI / 4K / 4% / 4(D 0 4R 0 4@ "0 4 /0 44Y =0 4" I0 4g{ ^0 46 j0 4 |0 4Uq 0 4N; 0 4f 0 4T 0 4N: 0 4O 0 4^. 0 4 0 4# 0 4 1 4J 1 4 1 4$ -1 4f <1 4( K1 4 Z1 4O1 48~ 1 41 4\ 1 4AK 1 4L 1 4% 1 4L 1 4>M 1 4h 1 4 1 4zH 1 4 1 4G 1 4q 1 4Q 1 4J8 1 4/ 2 4M 2 4 2 4s 2 4}I 2 4S 2 4$2 4B *2 4V 02 4{\ 62 4Q8 <2 4" B2 4 H2 4} N2 4oU2 4JE c2 4~s q2 4B 2 4; 2 4 2 4 2 4 2 4c8 2 4,2 4]! 3 4)5 3 4m 3 4F* (3 453 4; B3 4*B p3 4H 3 4f` 3 4 3 4Uv 3 4"X 3 4s 3 4 3 43 4 3 4B 3 4 3 4M 3 4@ 4 43, 4 4^ 4 4 +4 4 94 4:n G4 4 U4 4g c4 4; q4 4/Z 4 4U 4 4/ 4 4| 4 4 4 4 4 4. 4 4 F 4 4/ 4 45 4 4Z 5 4 5 4  /5 4,M 95 4 C5 4 Q5 4 _5 4f~ m5 4M {5 4l 5 4 5 4? 5 4; 5 4V} 5 4 5 4(y 5 4 5 4\ 5 4 6 4t 6 4h '6 46 56 4Bn C6 4{ Q6 4? _6 40 m6 4R {6 4zJ 6 4Zy 6 4; 6 4N 6 4, 6 4Z 6 4fY 6 49 6 4B 6 4YU 7 4 7 4* #7 4i 17 49 ?7 4ld M7 4{ [7 4i7 4v w7 47 4$ 7 4{ 7 4m 7 4d 7 4C 7 4?k 7 4c 7 4Z 7 41 &8 448 4 B8 4( P8 4I n8 45a x8 4u 8 4G 8 41 8 4d 8 4Hc 8 4n 8 4 8 4@5 8 4^ 8 4= 8 4 8 4`i 8 46 9 4&^ 9 4u'9 4] -9 4C 39 4H 9 4#_ r: 45 : 4'G : 4 : 4c ; 4 ; 4d !; 4 .; 49 ;; 4A* U; 4G h; 4I ; 4; 4D ; 4{; 4g ; 4E ; 4 ; 4 ; 4NU ; 4 ; 4\L ; 4p{ < 4 < 4L ,< 4K :< 4 S< 4ss a< 4Y< 4@ < 49 < 4@ < 41 < 4 < 4> < 4R = 4 = 4C; .= 4 <= 4 J= 4xX= 4nV f= 4}> z= 4= 4A = 4W = 4T = 4l = 4' = 4C = 4y = 4 > 4nZ > 4 %> 4D 3> 4] A> 4Q O> 4, ]> 4W k> 4C {> 41 > 4J> 4n> 4m > 4M > 4 > 4R > 4> 4 > 4? 4 j ]?Yf? 4X? 4. ? 4X ? 4 ? 4j ? 4K ? 4S @ 4A{ $@ 4c ,@ 4 4@ 4B T@ 4Az@ 4Q @ 4nZ @ 4? @ 4! @ 4A A 4 A 4? JA 4 cA 4wG {A 4< A 4n. A 4b! A 4@ A 4y A 4 B 4g !B 4 =B 4lv ^B 4' zB 46 B 4X BB 6 B 6B 4 B 6.B 6*B 4~s C 6A C 6=C 4Y &C0CLC 6TPC 6RZCdC 7f7tC 6^xC 6\CC 7q7C 6jC 6fC 6C 6{C 6C 6C 6C 6C 7|7C 6C 6CC 7|7D 6Ŧ D 6D 7|7D'D@D 6ئDD 6֦NDXDtD 6xD 6DDD 6D 6DDD 6D 6DD E 6E 6E)EAE 6EE 6]EwEEE 6,E 6*EEE 6;E 69EE 6FE 6DFF 6Q!F 6O*F 6[.F 6Y7FPF 6fTF 6d]FoFFFF 6pF 6nFFFFEG 77G 6G 6}!G 77*G 6.G 67GEAG 77RG 6VG 6[G 77dG 6֧hG 6ҧqG{G 77G 6G 6GG 77G 6G 6GG 77G 6G 6GG 77G 6G 6 H 6 H 6HH 77(H 6#,H 6!5H 6.9H 6,BHLH 77XH 68\H 66eH 6CiH 6AtHH$H 77H 6OH 6KH$H$H 6`H 6^H$H$I 6jI 6hI$I$2I 6t6I 6rDI$NI$fI 6~jI 6|sI$}I$I 6I 6I$I$I 6I 6I$IJ6%Jq2JGJ QJ`J 4 iJJ 4p{ J 6J 6J 4~s J 6J 6J 6J 6JJ 7P7J 6J 6J 60J 6&J 7[7 K 6^K 6\K#K 7[74K 6k8K 6g=K 7[7FK?VK?oK 6~sK 6|}KFKFK 6K 6KFKFK 6K 6KFKFL 6 L 6LF$LF O 4j O 6O 6O 76O 6O 6vOOO 6P 6 PP 756$P 6(P 61P 6Ʈ5P 6Į>P 6ЮBP 6ήKP 6ڮOP 6خXPbP 7@6nP 6rP 6{P 6P 6P 6P 6P 6P 6 PP 7K6P 6P 6P 6/P 6)P 6UP 6MPP 7V6P 6Q 6{ Q 6Q 6Q 6Q 6"Q 7V6+Q 6˯/Q 6ǯ8Q 7a6EQ 6IQ 6ޯRQ 7l6[Q 6_Q 6jQtQQ 6*Q 6(Q 64Q 62Q 6>Q 6<QQQRR 6I"R 6G(RFRvRRR%R 75R 6SR 6QRpR 75R 6_R 6[RpS 75S 6rS 6nS6(S 768S 6U 6<U 6KU 6GUUU 6^U 6\U 6kU 6iU 6xU 6vU 6U 6V V$V 6(V 61V 65V 6>VSV 6WV 6`VjVV 6V 6V 6ıV 6±VVVnV 76W 6ѱW 6ͱW 6 W 6)W 6/-W 6%6Wn@W 76MW 6QW 6{ZW 6^W 6{gW 6kW 6tW 6xW 6W 6ҲW 6ȲW 76W 6W 6WnW 76W 6W 6WnW 76W 6 W 6 W 76W 6W 6Xn X 77X 6)X 6''X 64+X 624Xn>X 77JX 6>NX 6<WX 6I[X 6GdXnnX 77zX 6S~X 6QX 6^X 6\XnX 77X 6hX 6fXnX 77X 6rX 6pXXY 6|Y 6zY%Y>Y 6BY 6KY 6OY 6XYbY{Y 6Y 6Y 6Y 6YYY 6Y 6Y 6Y 6YYY 6ijY 6³Z 6ϳZ 6ͳZZ 7*7-Z 6ٳ1Z 6׳6Z 7*7?Z 6CZ 6LZVZ 757cZ 6gZ 6pZ 6tZ 6}ZZ 757Z 6 Z 6 Z 6Z 6ZZ 757Z 6 Z 6Z 6+Z 6)Z 7@7Z 65Z 63Z[[ 6G#[ 6E,[ 6Y0[ 6W9[ 6Y=[ 6WC[f[~[=[~[[ [=\-#\p;\O\ 4 V\w\ 6i{\ 6c\\ 4Y \ 6\ 6\\ 4& \0\ 4 \ 6\ 6\I ] 77] 6ʴ] 6ƴ] 77'] 6+] 6ٴ4] 77H] 6L] 6U]I_] 77k] 6o] 6x] 6&|] 6$] 63] 61] 6@] 6>]I] 77] 6M] 6K] 6Z] 6X] 77]I]I^ 6g ^ 6e^ 6t^ 6r^V>^ul^ 4 }^ 4 ^ 4 ^ 4l ^ 4< ^P^ 6^ 6}^ 4 ^ 6_ 6 __ 75$_._ 75:_D_ 75P_ 6ȵT_ 6ĵY_ 75b_ 6ߵf_ 6׵o_ 6s_ 6|___ 6<_ 6:___ 6F_ 6D__ 75_ 6R_ 6N``)` 6c-` 6a6` 6m:` 6kE`O`g` 6wk` 6ut` 6x` 6` 6` 6`x```` 4`a 4a 6!a 60a 6ٶ4a 6϶Ba 6Fa 6Ta 6>Xa 6 ]a 73fa 4Y pa 6Jta 6>~aa 73a 6}a 6ya 6a 6aaaa 6a 6ab:b 73/b 63b 6l 6Bl 6Kl 6Ol 6Xlblzl 6~l 6l 6l 6lll 6l 6l 6(l 6&ll 64l 60lm 7Y5m 6Im 6E(m 6_,m 6]5m?m 7n5Um_m 7~5qm{m 75mm 75mm 75m 6im 6gmm 75m 6tm 6rmn 75n 6n 6})n?nIn 75[nen 75wnn 75nn 75nn 75n 6n 6nn 75n 6n 6o o 75o 6o 62o t 4B Kt 4P bt 4 zt 4B t 4$< t 4Qt 4 t 4 t 4~s t 4` u 4 u 4~s !u 4X 3u 4~s Au 4 Su 4 au 4c su 4~s u 4u 4~s u 4,u 4 u 4@w u 4 u 4 u 4w u 4- u 4$w v 4g !v 4~ 4v 4~ Cv 4ڏ Nv 4Zv 4V gv 4* xv 4 v 4Q v 4 v 4y$ v 4V v 42 v 4 v 4 v 4z w 4~s w 4Z .w 4~s 'z 4. 9z 4~s Gz 4] Yz 4~s gz 4rb yz 4~s z 4k z 4~s z 4 z 4 z 4 z 46 z 4u9 { 4; { 4 "{ 4_ 0{ 46 ={ 4\9 H{ 4 k{ 46 |{ 4V { 42 { 4^ { 4Kx { 4y { 4< { 4[N { 4p { 4q | 47 | 4l >| 4o ]| 4e: k| 4>l | 4n | 48 | 4" | 4Q$ | 4A } 4U *} 4[N 7} 4[ D} 4y V} 4~ e} 4 t} 4 } 4 } 4 } 4 } 4 } 4} 4; } 4T } 4y, ~ 4a '~ 4F~ 4,a~ 4 }~ 4V ~ 4@C ~ 4[N ~ 4#s ~ 4[N ~ 4~ 4V  4 }  4V + 48 4τ T 4V a 4+ } 4V  4  4  4_  4  4{  4 3 4 Q 4w_ j 4f> { 4/  4$  45  4-  4\R ɀ 4$ ۀ 45  45  45  45  4z 4 4[N @ 4]! M 4, h 4[N u 4>  4[N  42  42  4B  4lA  1Y 4( Ɓ 5)ʁ 5΁ށ 2 4  4 # 4< 0 4;# > 4do C 4|$ Q 4 [ 4u i 4X n 4' | 4"  4Z  4)  4z  4  4D- ǂ 4$Q 6 4z < 4| N 4B \ 4r a 4# m 4 y 4  4  4D  4Sm  48  4e  4U ̓ 4 ك 4Ru  41  4}  4  4L  4  4) ( 4"9 4 4 @ 4GV L 4 _ 4R d 4 p 4| | 4E  4C  4Z  4~w  4; „ 4k ΄ 4p ڄ 4  4  4o  4  4,  40N - 4W B 40N P 4}~ \ 4 i 4h6 v 4k  4  4G  4<  4h6 Å 4;D  4  4h6  4 6 4 _ 4G m 4 { 4(  4_  4  4O  4  4 φ 4h6 ݆ 4ƃ  4  4SH  4  4b # 4^ 1 4i ? 4a# M 4k" \ 4> l 4O z 4  4  44  4A+  4H  4W2 · 4 ܇ 4  4q  4  4"  4p 1 41 @ 4A O 4! ^ 4" m 4&B | 4'  4R  4;  4  4 ׈ 4  4J  4  4*  4J " 4{k 1 4j @ 4ý O 4i ^ 4 m 4` | 4  4F  4  4  4fj lj 4u ։ 4'  4*  4  4u  4WW ! 4!K 0 4 ? 4 N 4 ] 4م l 4> { 4  4  40  4ŵ  4i Ɗ 4& Պ 4  4׵  4s  4E  4_  4A / 4  > 4 M 4 \ 4Zd k 4 | 4(  4  4  4A ‹ 485  4  46  49 & 4 M 4 _ 4= r 4  4:  4  4>C  4  4  4}( Ì 4 Ќ 4$ ݌ 4>  4  4  4p  4X  4x+ , 4x H 4 V 4` d 4 r 4  4  4q  4pF  4h6  4 ʍ 4 ׍ 4_?  4  4  4Mp " 4- ? 4 f 4 r 4  4  4  4|  4  4f  4< ώ 4u ގ 4X  4D  4O  4g  450  4 $ 4~+ 1 4 K 4 X 4F e 4 r 4  4m  4Fj  4  4S<  4z ˏ 4  4+  4X 1 4 D 4tp R 4 ` 4? n 4.> | 4q  4  4X  4  4  4 А 4ͨ ސ 4  4$C  4  4U  4- $ 4pL 2 4 @ 4 N 4$ \ 4O j 4d x 4w  4m  4  4  4Zr  4i ̑ 4F ڑ 4  4@  46^  4  4 ' 4h 4 4* X 4q d 4̀ p 4 } 4  4h6  4  4U ɒ 4 ݒ 4R  4  4  4  4  4X + 4 8 4 F 4Z [ 4kJ h 4 | 4=  4  4E  4N  4|  4 Ǔ 4b ͓ 4 ӓ 4l  4  4  4  4 " 47U 5 4YE B 4 P 4΁ ] 4YE j 4| x 4"  4  4BM  4w  4X  4q ɔ 4: ؔ 4  45  4|  4G . 4 < 4{ J 4r X 4X f 4T t 4 d  4T  4  4j  4]6  4GW ȕ 4 ֕ 4=  4o  4  4  4z G 48 V 4h e 4P u 4G+  4h  4  4+  4[  4k Ж 4 ߖ 4  4j  4Sq  4>(  4 * 4, 9 4M H 49s W 4& f 4 u 4A  4  4  4ނ  4y  4/ ϗ 4 ޗ 4o  4  4  43  48 ) 4 8 4) G 4s V 4 e 4 t 4o  4  4  4xt  4D Θ 4@ ݘ 4  4  4~  4f  4 ( 4o 7 4} G 4r- W 4q[ g 4 w 42  41  4t  4gd  4[ Ǚ 46 י 4[  4K  4  4f  4l ' 4[ 7 4 G 4 V 49 t 4  4  4  4x  4i4  4ΰ Κ 4.; ݚ 4)  4W  4C  4[  4 ( 44 7 4 F 4ʦ U 4 d 4 s 4  4  4  4,  4{  4{ ͛ 4 ܛ 4  4/  4LR  4:  4k ' 4! 7 4b F 4g U 4 d 4#L s 4  4v  4S  4Å  4#  4 ۜ 4p  4Q  4J  4:  4 & 43 5 4u; D 4HF S 4 b 4 q 4  4u  4  4f  4}  4 ˝ 4eu ڝ 4}^  4oV  4  42  4x % 4ڼ 4 4 C 4J R 47 a 4J- p 45  4p  4  4  4n  4 ʞ 4 ٞ 4  4.  4Ȇ  4,E  4 $ 4j 3 4q B 44 Q 4 ` 4 o 4Q ~ 4  4B  4  4z  4A ɟ 44 ؟ 4^  4+  4B1  4  4g # 4 2 49 A 4w P 4 _ 4 n 4a& } 4  4Q  4G  4  4M Ƞ 4^ נ 4  4"  4:  4S  4: # 4 2 4f A 4 P 4 _ 4 n 4 } 4&?  4I  4/y  4  4L5 ɡ 4 ء 4b  4(  4  4  4fy # 4 2 4v A 4 P 4_ _ 4QC n 4 } 4؞  4  4  4?  4 Ȣ 4= ע 4Q  4  4  4  4T " 4Pf 1 4J @ 4 _ 4 n 49 } 4'  4C  4  49g  4 ȣ 4' ף 4  4}  40  4S  4 " 4Xc 2 4\ B 4iN R 49a b 4 q 4  4A  4@  4F  4 Ԥ 4{  4&  4%  4+  4q = 4- } 41  4  4a`  4  4  4( ߥ 4  4T  4m  4m + 4Ӡ Q 48( w 44  4M  4a  4X  4Ǻ ʦ 4f0 ݦ 4L  4 " 4( 0 4 > 4> L 4Q7 Z 4HH h 4 v 4A  4R  4E  4  4w ʧ 4> ڧ 4P  4c  4y  4( 7 4 D 46 W 4T n 4?  4m  4#  4 ɨ 4 ר 4Z  4  4q  4A  4~  4g , 4 : 4 H 4{ V 4HQ d 40` r 4iK  4c  4  4y  4l  4 é 4 ɩ 4}9 ϩ 4 թ 40l ۩ 4R\  4  4I  4]-  4/  4   4@  4;Y  4;  4Qz  4 . 4 L 4 R 4 X 4; ^ 4] d 4 j 4 p 4C| v 4 | 4  4`a  4_  4  4  4ۯ  41  4y`  4  4&  4  41 Ī 4 ʪ 4 Ъ 44 ֪ 4A ܪ 4[[  4+  4  4  4.  44 + 4 : 4. I 4i X 4QT g 4 v 4  4s  4*9  4X9  4  4$ Ы 4@ ߫ 4  4w  4  4a  4b * 4 9 4k H 4 W 426 f 4 u 46  4;u  4z  4C  4  4(# Ь 4 ߬ 4  4  4X  4+  4ܚ * 4u : 41r I 4 X 4 g 4., w 4_  4  4/  43  4  4 ѭ 4h. ߭ 4  48  4  4c  4 $ 4G 2 4 ? 4h6 [ 4[ g 4|? t 4  4  4 Ϯ 4u ծ 4 ۮ 4  4  4X  4!  4j , 4 H 4 T 4 a 4u n 4h { 4Cz  4  4h  4Cz į 4k ѯ 4q  4  4,  4f  4H " 4h / 4Cz = 4g P 4 \ 4# h 4ͨ u 49  4  4 Ȱ 4  4kb  4is A 4p: ] 4k k 4q y 4f  4K  4D ѱ 4kb  4is  4 Ҳ 4  4X  4,  4y + 4 > 4Fd  4!  4s P 4 \ 4 y 4t  4 δ 4 ۴ 4!  4<  4 F + 4  4!  4f  4e  4 ǵ 4t  4  4  4`  4 + 4+ 9 4x G 4{ f 4 v 4hq  4y  4,  4 Ķ 4< Ѷ 4d ߶ 4  4  4  4 ) 4 7 4  E 4+ S 4% o 4ї  47Z  4  4 9  4  4 ͷ 4 ۷ 4K  4`  4$@  4~q % 4 3 4H A 4 O 4^ ] 4D` r 4  4  4  4z Ǹ 4 Ը 4  4h6  4 G 4 L 4 V 4| c 4X p 4 } 4s  4V  4A  4' ¹ 4g й 4 ޹ 4h  4X  4  4F  4 ) 4 7 4y E 4 S 4xR a 4 o 4J } 4ث  4p<  4 D  4s  4Z  4 κ 4X ۺ 4A  4  4'x  4v 7 4\ D 4$ Q 4 _ 47  4  4d  4  4}3 ̻ 4 ٻ 4'  4x  4  4  4* & 4X 3 4 @ 4 N 4 \ 4 j 4po x 4(  4  4n  4J  4 μ 4R  4! & 4 3 4t @ 4} M 4y Z 4u g 4! t 4ͨ  4  4g$  4a  4#  4J ؽ 4E  4  4y  4hc  4 " 4 & / 4 ' I 4x V 4 c 4F p 4q  4  4"  4z  4  4ѹ  4?  4\  4u  4O  4J . 4j` ; 4 I 4 V 4{ c 4 v 4a  4-  4  4y  4 ' < 4 I 485 W 4 d 4 q 4  4  41  4  4l  4%  4  4  4g  4 '  4  4  4 % 4 2 4h ? 4Cz M 4\ Y 4aA e 4(  4r  4  4w  4؟  4<  4kQ  4q  4  4-  4 5 4zg B 4] N 4} p 4?  4r  42  4S  4/{  4  4HG 3 4 @ 46 M 4z Z 4O g 4X  4#  4  4  4(  4  4B  4  4^  4kQ ( 4C 5 4q B 4 O 4- f 4[  4  4"  4  4f  4  40  4W  4G  4@  4h6 - 4;D E 42( R 4 _ 4 y 41  4  4xN  4  4ݟ  44  4  4  4ݟ  4j  4O3  4ݟ  4 1 4ݟ > 4$ L 4Z a 4$ n 4  4O  4  4kQ  4m  4  4  4 & 4$ C 4 O 4l| [ 4 i 4 v 4*  4  4  4K  4  4d  4d  4  4  4VF  4~  4*  4 & 4ƹ L 4 \ 4H j 4[B x 4q  4  44  4s  4sD  4  4  4  4;  4  4h  4 & 4\ 4 4F B 4#q P 4 ^ 46 l 4[ z 4  4  4  4-  4W  4  4`  4R}  4d  4J  45  4; " 4: 0 4Y > 44 L 4L6 Z 4Kz i 4Ϣ x 4]  4X  4)  4  4R1  4Y  4T  4b  4P  4WA % 4 4 4/$ C 4Ѻ R 4 a 4-  4Q  4S  4?7  4  4  4\+  4%  4E  4  4C  4%  4 " 4c / 4g G 4 W 42 e 4! s 4P&  4  4@  4s  4  4s  4~W  4  4~/  4dS  42  4  43 ) 4S 7 4 E 4 S 48 a 4݁ o 4 } 4  4"  4  4i  4K  4v)  4.  4t1  4F  4  4X7  42 * 4w : 4 I 40 X 4 g 4ƾ v 4  4e  4M  4T  4D  4  4k  4  4o  4U  4  4 * 4 9 44 H 4 W 4 f 4 u 45M  4  4  4U  4D  49  45o  4]  4<  4 # 4` ) 4  4g  4ְ  4 & 4b@ 3 4 Z 4= t 4  4t  4X  4<  4  4|  4  4W  4 , 4cD : 4p T 4 g 4 w 4 } 4  4SP  4  4  4  4P  4  4  4dT  4Q  4*  4o  4Y  4Ѿ  4g  4 + 4 9 4  F 4YE T 4 d 4 j 4 q 4#1 ~ 4  4  4|  4  4O  4  4  46  4z  4  4 ( 4k B 4 O 4A] \ 4y i 4 | 4Ml  4'x  4  4|  4X  4eu  4u  4o  4JC  4  46 9 4H E 4 R 4{ _ 4$ m 4v z 4~  4  4j  4  4  4  4X  4  4: # 4g) 4 4Z @ 4" R 4f _ 4xQ k 4FB x 4  4  4T!  4L  4  4ev  4  4  4T!  4ev  4 - 4T! : 4 G 4Ƿ T 4a k 4 x 4R  4@  4  4  4  4  4W  4 E  4W  41  4 ! 4* 7 4>o T 4 x 4^  4  4C  4  4p  4  4$  4  4  4  4%p  4 & 4 3 47 A 4b U 4 a 4n n 4  4  4[  4  4(  4  4:  4  4  4X  4  4 + 4 E 43 R 4P_ _ 4 y 488  4  4  4  4a  4  4  4ʹ  4  4  4X  4w  4@ & 4+ 3 48 @ 49 M 40 Z 4 g 4v u 41  4Z  4  4k  4(  4'  4g  4!  4(  42(  41  4f % 4d 2 4xF ? 4 L 4X Y 4 f 4  4  4  4  4$  4  4u  4  4e  4X  4  4,  4ݟ  4 # 4O ? 4 M 4 [ 4 j 4o x 4}  4  4Z  4G  4  4-  4  4:  4  4  4I  4& " 4 0 4 ! > 40 L 4 Z 4e i 4 y 4  4  4'  4  4  4,  4!R  4  4.  4M  4Ԃ  4D ! 4 / 4 = 4=w K 4 Y 4"< g 4h u 4e  4  4k  4R{  4aE  4  4  4  44  4  4  4n  46# . 4 = 4. K 43 Y 4 g 4q u 4=  4G  4  4  4  4X  4  4  4l  4  4  4v  4x + 4M! 9 4); G 4$ j 4M! t 4J  4̝  4  4  4  4=  4c  4  43  4L  4 - 4IJ ; 4 I 4$ W 4 e 4/ s 4$  4.  4X  4,}  4  4  4:  48  4!  4+  4  4P , 4 H 4~ V 4  d 4 s 4U  41  4-  4|  4A]  4  43  4  4  4ֆ - 4 T 4e b 4h6 v 4 ~ 4h  4x  4>  4  4  4  4Hg  4z  4i  4H  4 + 4 9 4 G 4 U 4X c 4$ q 4  4  4e  4I  4  4  4$  4  4  4F  4=H 2 4 U 4 b 4r  4T  4|  4J  4)t  4&  40  4[  4i  4  4<  4~  4*~ % 4 2 4? ? 4k L 4 Y 4 f 4 s 4/{  4G  4n  4`  4v  4k  4  4  4J  4  4&  4:  4| " 4; / 4LM < 4Z I 4[ V 4 i 4¿ w 4@  4  4  4  4  4De  4/  4  4  4-  4V  4  4p  4X - 4 : 4[ I 4O X 4. e 42_ r 4  4 @  4b  4+  4k  4]  4{  4}  4wj  4  4F $ 4 2 4 @ 4n N 4,! \ 4 j 4M x 4  4{  4  4w  4"  4LR  4:  4  4,  4  4  4  4 . 4- < 4 J 4 X 4 f 4~ t 4  4k  4c  4.  4N  4  4  4y  4@  4  4I  4r  4 - 4 : 4@V M 4f W 4s a 45 o 4 } 485  4=  4  4ݙ  4<  4s  4  4  4b  4M  4  4 , 4 9 4N` F 4b S 4$ ` 4 m 4l z 4D  43O  4n  4  4  4  4  4!  46  4  4&{  4' # 4 1 4W ? 4< N 4 ] 4I l 4 { 4+  4O  4#  4IU  4  4c  4;  4  4  44  4  4u . 4{ B 4 \ 4 f 4 p 4"  4  4  4  4  4v@  4  4b  4$ + 4 9 4% G 4 U 4 K c 4A q 4  4  4  4(  4n  4  4N  4o  4  4  4#  45  4 ) 4b 8 4 G 4z V 4R e 4 z 4  4  4Dv  4  4c  4@  4  4  4  4  4G  4(X # 4 0 4p = 4k J 4K W 4; d 4X r 4O  41  4RQ  40  4$  4  4  4as  44  4  4{Y ' 4 5 4 C 4 Q 4> _ 41X m 4 { 4  4  4  4>C  4  4  4C  4  4O  4v % 4 9 4 F 4 S 4 ` 4 s 4l@  4h6  4*  4  4X  4  4!)  4L  4  4L  4.V  4  4}  4F : 4x G 4 T 4} a 4o o 4q0 | 4[  4t  4C  4l  4  4U  4  4mu  4 y  4q * 4C 6 4 O 4< \ 4 i 4> | 4]  4  4  4u  4  4ư  4  48  4K $ 4 1 4 > 4x K 4jL X 4Z$ e 4k r 4v  4L$  4  4+  4z  4  4  4  4g  4$  4  4  4a < 4Ƃ W 41 d 4A"  4  4z  4  4sZ  4Dv  4  4a  4  4E  4w%  4X # 4 0 4O K 4K X 4 q 4D ~ 4  4  4a  4]  4G  4P  4h6  4;D  4{ ( 4 ; 4X P 4o \ 4Ū i 4 | 4  4  4  4w  4}  4'x  4  4  4(  4 3 4gx = 4ҕ J 4( w 4z  4  4"  4`  4  4X  4<  4V  4  4'z ( 4$ 6 4wd C 47/ P 4 ] 4 j 4 w 4(  4  4!X  4[  4ե  4$  4Q|  4@q  4  4x , 4S 9 4+ L 4{ Y 4v] s 4^  4S+  4!v  4  4  4-  4Z  4$  4l  4C  47/  4  4G " 41 / 4G < 4 I 45 V 4f c 4} p 4yI } 4  4)  4.  4V  4(  4)  4!  4  4՝ $ 4 1 4E@ > 4} U 4mp b 4E@ y 4PB  4E@  47  4Ab  4&  4R  4o  4  4  4  4 - 4 = 4. C 4 I 4ض O 4 V 4l f 4TR l 4~E r 4) x 4}  4  4O  4v]  4  4  4  4  4S  4N  4? ) 4 6 4 C 4{ P 4rm ] 4 j 4U w 4h6  4  4  4A?  4q  43J  43J  4ʣ  4$  4 , 4 9 4 P 4 ] 4b j 4  4X  4$  4  4`  4sK  48  4q  4  4`  4}  4  4 + 4 8 4 E 4 R 4 _ 4 l 4B y 4  4  4Y'  4{U  4B  4$  45  4  4  4  44F  4[ C 4i O 4R e 4 q 4w9  4?  4A  4%  4  4  4(f  4  4l " 4V / 4a = 4a J 4 d 4O q 4q ~ 4X  4  4  4  4  4S  4 0 4p G 44F U 4[  4A  4  4X  4?  4  4  4Ǻ  4f0 " 4a ; 4Y I 4 W 4f e 4 s 4L  4  4~  4@)  4Y  4  4A  4Q  4  4 & 4I 4 4. B 4$ f 4I) u 4T  4ކ  4`  4ڦ  4 ]  4  4  4<   4K   4u  4t .  4h, <  4- J  4/- ^  4( l  4Ģ z  4X  4N  4  4`  4  4V  4P  4{   4   4f $  4$ 3  41 A  4 O  4 ]  4 k  4! y  4  4./  4G  4  4jH  4  4r4   4~ )  4 7  4U E  4 S  4 a  4w o  4 }  4/  4  4L  4  4b  4i  4%!  4  4  4v  4l ,  4 :  4j V  4 p  4{  4  4,v  4Dv  4  4  4  4ś  4   4+o *  4v 8  4M F  4E T  4! b  4>( p  4 ~  4'  4  4g  4  4<  4 7  4  4  4l  4  4-U  4. * 4R 9 4 H 4P W 4 f 4 u 4;  4  4  4`  4q  4ז  4G  4k  4u^  4  4 ) 4 8 4M G 4Do V 4*_ e 4X t 4  4e  4  4G  41  4  4w  4[  4  41  44j  4q ( 4t 7 4 F 4n U 4V d 4 s 4iO  4  4  4  4  4  4$  4Z  4$  4 5 4 I 4X y 4  4a  4  4b  4  40  4 2  4q  4F  4L  4  4  4H  4y  4]  4P  4 d % 4 5 4 ; 42 A 4_; G 4; M 4 S 4- Y 4 _ 4T e 4 k 4 q 4m w 4 } 4n  41H  4  4  4  4  4  4W  4̶  42  4'  4߰  4#  4dw  4%  4ʳ  4W  4  4  4+  4NL  4r  4  4u,  4O  4  4x  4: % 4V~ , 4 9 4U8 F 48 S 4 ` 4 m 43 { 4  4V  4  4p  4  4  4  42  4L  4  4 & 4k 5 4 D 4Xl S 4Mp  4  4x 2 4 @ 485 N 4@ \ 4k  4  4f  4nt  4L  4D  4  4  4  4f  4^w , 4 : 45 H 4 V 4 d 4v r 4X  4Lm  4  4(*  4  4d  49  4Z % 4$ Z 4\L j 4$ x 4  4c  4f?  47  4E  4X  4I  4i  4e  4^w  4 # 4b 1 4r ? 4Ah n 4?_ | 4r  4  4P  4  4  4  4F  4»  4F  4:  4+  41"  4*'  48[ ' 4R 5 4 C 4 Q 4 s _ 4 m 4 { 4  4  4  4r&  4  4r  4  4  4  4h  4  4 # 4;u 3 4 B 4l Q 4X ` 4$ o 4u  4  4˭  4$  47&  4  4  4  4%  4z  4  4v % 4 4 4Ah  4  4:  4{z  4A;  4L  4$a  4B  4$=  4~ $ 4 2 4u @ 45 N 4( \ 4G3 j 4  4  4i^  4\  4  4  4  4:  4E $ 4 2 4Ko F 45 T 4c b 4 p 4T  4^  4  43  4 n  4j>  4^  4  4  4 . 4x < 4p Q 4܀  4  4  4r  4  4d  4  4P  4j>  4-^  4( . 4 = 4B J 4 W 4 d 4& q 4  4 %  4  4  4$  4  4  4 <  4m L  4 R  4*w X  44P _  4 i  4Oh v  4  4R  4}  4B  48  4X  4  4T=  4M  4t ! 4_2 ! 4+ ! 4S -! 4 ;! 4 W! 4/ f! 4 u! 4 ! 4q ! 4y ! 4j ! 4= ! 4 ! 4 ! 4 ' ! 4e ! 4m; " 4z " 4} )" 4 8" 4C G" 4W W" 4; f" 4 u" 4t " 4 " 4 " 46- " 4{ " 4 " 4[ " 4Z # 4g # 4 -# 4^= :# 4p G# 4 T# 4 a# 4 n# 4 # 4-U # 4 # 4O # 4` # 4r # 4N # 40 $ 4@ ,$ 4$ F$ 4 S$ 4U `$ 4 n$ 4 |$ 4 $ 4 $ 43 $ 4~ $ 4 $ 4Y $ 4? $ 4! $ 4[< $ 48 % 4 % 4; M% 4ur Z% 4o g% 4 t% 4 % 4 % 4Xs % 4 % 4! % 4F % 4 % 44 % 4 % 4 % 4 & 4X & 4 & 4 .& 4W ;& 4 H& 4h6 [& 4 h& 4 u& 4 & 4 & 4 & 4 & 4j & 4W2 & 4 ' 4o ' 4 ' 4 )' 4u 6' 4 C' 4I P' 4wP ]' 4 j' 4VK w' 4 ' 4Q ' 46 ' 4ݨ ' 4` ' 4/ ' 4Y ' 4 | ' 4 ' 48S ' 4 ( 4Xs ( 4 #( 4! 0( 4 =( 4J\ J( 4 W( 4l d( 4 q( 4q ~( 4? ( 4 ( 40 ( 4 ( 4v ( 4{ ( 4 ( 4 ( 4 ( 4Q" ) 4 ) 4 #) 4 1) 4) ?) 4O M) 4I [) 4?< i) 4v x) 4 ) 4# ) 4  ) 4$ ) 4z ) 4 ) 4: ) 4. ) 4# ) 4 * 4O * 4 * 4 -* 4y :* 4@ I* 4 d* 4. q* 4 ~* 4 * 4 * 4W * 4Ya * 4je + 4{" + 4 '+ 4D 3+ 4 A+ 4" s+ 4X + 4; + 4*P + 4Z + 4 + 4 + 4$ + 4a + 4oz + 4 , 4 , 4 , 4 +, 4b 9, 4e G, 4 U, 4sb c, 4; q, 4 , 4 , 4 , 4@G , 4[ , 4m , 4U , 4k , 4< - 4 - 4rE .- 4 =- 4 L- 4 [- 4w j- 4a y- 4 - 4D - 4Y_ - 4 - 4!W - 4R - 4 - 44 - 4 . 4; . 4 ,. 4 ;. 4< J. 4q Y. 4 h. 4m/ w. 4$ . 4( . 4 . 4 . 4x7 . 4yc . 4 . 4O . 4E / 4W / 4f +/ 4t E/ 4 f/ 4 / 4 / 4 / 4 / 4` / 4} / 4t / 4 / 4pL 0 4 0 4 0 4X d0 4/ p0 4( 0 4 0 4 0 4 0 4T 0 4 0 4p 0 4 0 4\ 0 4 0 4E 0 4E 0 4XN 0 4d] 0 4! 0 44{ 1 4 1 4f (1 4n 51 4W2 B1 4: O1 4 r1 4L |1 4T 1 4% 1 4"~ 1 4q 1 4 1 4A 1 4"| 1 48 2 4 4 2 4l $2 4^ 02 4- =2 4f J2 4[ W2 4E p2 4 }2 4=5 2 4 2 4H 2 4pQ 2 4 2 4Ct 2 4W 2 4\V 2 4 3 4 3 4# 3 4T +3 4 93 4{ G3 4 U3 40 c3 4 r3 4{ 3 4b 3 4X 3 4 3 4[ 3 4o+ 3 4A 3 4> 3 4* 4 4q 4 4 ,4 4v 94 4 F4 4 S4 472 `4 4p* m4 4 z4 4# 4 4L 4 4H] 4 4q 4 4 4 4w{ 4 4V 4 4f 4 4 4 4 4 4/h 5 4e{ 5 4D %5 4~5 35 4 A5 4 O5 4 ( ]5 4wn q5 4 5 4@ 5 4 5 4o 5 4V 5 4/ 5 4~> 5 4Ϥ 5 49 @6 4. N6 4> \6 4v j6 4[ x6 4 6 45 6 4t 6 4+ 6 4g 6 4|} 6 4 6 49 g7 4\ u7 4o 7 4{ 7 4K 7 4Q 7 4 7 4 7 4@ 7 4rq 7 4i 7 4l 8 4\ 8 4 8 4ܠ +8 4 98 4 G8 4 V8 4\ d8 4X r8 4 8 4m 8 44 8 4" 8 4e 8 4R 8 4k 8 4 8 4 8 4C 9 4ĝ ,9 4vu :9 4 H9 44 V9 4 d9 4*i r9 4m 9 4i 9 4> 9 4 9 4U 9 4 9 4: 9 4: 9 4[ 9 4QV 9 4k : 4< : 4 ): 4 7: 4o E: 4`P ; 4 *; 4X 8; 4 F; 4p T; 4 ; 4N ; 4G ; 4 ; 4T ; 4 ; 4J .< 4$ << 4 J< 4~ X< 4v f< 4ֹ t< 4( < 47 < 4˥ < 4Xg < 4H < 4 < 4O < 4Z < 4 < 4 = 4 = 4 = 4< *= 43+ 8= 4Ҙ F= 46 s= 4= = 4h = 4= = 4%r = 4k = 4% = 4 = 4 = 4 = 4 = 4 > 4n > 4 *> 4 9> 4 F> 4 S> 479 `> 4 n> 4ab > 4 > 4| > 4o2 > 4X > 4? > 4O > 4' Q? 4 _? 4` m? 4? ? 4=L ? 4n ? 4~ ? 4 ? 4 @ 4- @ 4& @ 4{ @ 4 @ 4w A 4# A 47 B 4 B 4 *B 4g\ CB 4 PB 4{ }B 4 B 4 B 4R B 4* B 4$; B 4 B 4خ B 4 B 4 B 4 C 4 C 4 C 4f *C 4 8C 4 FC 4N TC 4;; bC 4H pC 4 ~C 4m C 4& C 4o C 4R C 4 C 45 C 4@ C 41 C 4 p C 4 D 4 D 4k &D 4 ?D 4-u ZD 4O gD 4[> tD 4] D 4- D 4e+ D 4 D 4 D 4 D 4r D 4Jv D 4> D 4B D 4 E 4M E 4 #E 4u 1E 4 ?E 4 ME 4 [E 4z iE 4a( wE 41 E 4I E 43 E 4 E 4V E 4 E 4y E 4 E 4 E 4a F 4: F 4r )F 4 3F 4 =F 4v GF 4m UF 4` cF 4$ F 4 F 4J F 4K F 4F= F 4 F 4 F 4!E F 4 F 4 G 43 %G 4w 2G 4E6 KG 47 YG 4p7 fG 4 sG 4 G 4{J G 4m G 4[ G 4 G 4 G 4 G 4 H 4" H 4 "H 4{ 0H 4 >H 4r LH 4 > ZH 4 hH 4Kt vH 4p H 49 H 4L H 4^ H 4> H 4ac H 4s H 43 H 4 H 4 I 4 I 4/ I 4 ,I 4 :I 4 HI 4 VI 4-x dI 4 I 4AP I 4J I 4 O I 4K I 4K I 4+ I 45| I 4m J 4 J 4Z J 4"G +J 4V? 8J 4dV EJ 4 RJ 4ߝ _J 4 lJ 4 yJ 45 J 4v J 4 J 4 M J 4v J 4 J 4T J 4. J 4 J 4r J 4^ K 4 K 4 6K 4 DK 4e QK 4 ^K 4; kK 4 xK 4 K 4 K 4`H K 4F K 4g K 4( K 4 K 4 K 4 K 4R L 4yX 'L 4~u 5L 4 CL 4; QL 4- eL 4 oL 4 L 4 L 4% L 4 M 4F M 4M M 4 M 4 M 4A N 4~Z N 4 O 4ߥ O 4o O 4 O 4q O 4 P 4_Y P 4 P 4 -P 4$ FP 4 SP 4` `P 4A P 4K 4S 4u T 4P $T 4; ?T 4r> gT 4x: xT 4; ~T 4 T 4| 7U 4 V 4= (V 4 5V 4 BV 4Vb OV 43I \V 4 ' iV 4G vV 4LM V 4 V 4F V 4 V 4 V 4 V 4H? V 4dS V 4 V 4 W 4 W 4z1 'W 4W 6W 4f< KW 4` W 4c W 4 W 4'x W 4x W 4u W 4 W 4{ W 4z X 4ѧ X 4 !X 4 0X 4U JX 4 XX 4 fX 4? tX 4 X 4 X 4V X 4X X 4_ X 46 X 4 X 4 Y 4Q Y 4_ Y 4U *Y 4 7Y 4d KY 4ݬ XY 4f eY 4 rY 4u5 Y 4 Y 4 Y 4x Y 4 Y 4p Y 4Dl Y 4I Y 4 Y 4| Y 4ME Z 4d_ Z 4+1 Z 4 Z 4: #Z 4 *Z 44 7Z 4-@ DZ 4"H QZ 4 Z 4 Z 4n Z 4 [ 4z )[ 43 7[ 4. E[ 4Ks c[ 4# p[ 4 \ 4P \ 4 \ 44 \ 4~V \ 4e ] 4i4 ] 4 ' -] 4 7] 40 D] 4 $_ 4/q C_ 4N O_ 4 \_ 4] f_ 4 _ 4` _ 4o _ 4o _ 42( _ 4~# _ 4# _ 4 _ 4= _ 4L _ 4 ` 4U ` 4g +a 4+ ;a 4+ Aa 4 Ga 4-D Na 4F [a 4q ha 4Z ua 4 a 4 a 4| a 4Rd a 4N a 4A a 4 a 4u b 4a b 4ܸ +b 4 9b 4 Gb 4 Ub 4A cb 4< qb 4q b 4 b 4 b 4 b 4.> b 4 c 45f d 4 d 4E hd 4u ud 4 d 4 d 4 d 4 d 4 d 4pL d 45f d 4 d 4 d 4> d 4 e 4 e 4"x e 48L e 4 e 4 f 4g f 4JC f 4 *f 4H f 4k f 4 f 4 b f 4 f 4V f 4^U g 4 g 4=y g 4I g 4( g 4 -g 4p 3g 4!+ 9g 4q ?g 4 Eg 4 Kg 4 Qg 4]% Wg 4l ]g 4f cg 46m ig 4m\ og 4 ug 4¡ {g 4 g 4 g 4= g 4 x 4U x 4 x 4> x 4U x 4 x 4 x 4v x 42 x 45 y 4 y 4 )y 4W 6y 4M Cy 4% [y 4M yy 4 y 4 y 4T y 4 y 4^ y 4*S y 4 y 4 y 4h6 z 4 z 4I z 4U )z 4 5z 4. Bz 4 Oz 4T \z 4N iz 4 vz 4D z 4B z 4 z 4 z 4 z 4 z 4 { 4X i{ 4F v{ 4y { 4' { 4 { 4]y { 4 { 4#s | 4* | 4 !| 4 .| 4 ;| 4 H| 48N k| 4 x| 4 | 4 | 4Bu | 4 " | 4< | 4 | 4 | 4E | 4] } 4Y } 4 } 43G } 4 } 4B } 4 } 4 } 4s } 4 } 4j ~ 4 ~ 4 #~ 4$ 1~ 4 O~ 4v ]~ 4s k~ 4g y~ 4 } ~ 4l ~ 4; ~ 4 ~ 4G ~ 4!Z  4N - 4 9 4q F 4& S 42 ` 4 y 4S  4  43a  4%  4;A  4^f  4  4L  4-  4  4;  4 + 4 : 4x I 4] X 4[ g 4H v 4q  4w  4  4k ʀ 4A] ؀ 4<  41  4Ҩ # 4 0 4 = 4K J 4I W 4X d 4 w 4F  4W  46  4  4F  4 Ł 4X Ӂ 4   4{  4O  4 % 4n 2 4 ? 4\ L 4v Y 4X f 4? ~ 4q  4  4x  4> Ă 4q  4  4  4  42(  4A & 4F 5 4 D 4Z S 4e q 4  4u#  4  4X  4  4k ˃ 4M ڃ 4  4  44  4  4 % 4d 4 4 Q 4* ` 4{ o 4? ~ 47  4pL  4G  4  4 Ʉ 4c ؄ 4o  4  4D  4  4 ( 43 8 4 N 4 [ 4# i 4 u 4  4Y  4A  4 O  4Ӽ  4 Ʌ 4 ׅ 4,  4O  4  4  4X  4( + 4 9 4 G 4y U 4E c 4o q 4  4m  4~  4-  4D  44:  4m  4G  4K  427  4  4  4* 1 4#` 7 4ە = 42 C 4 I 4< P 4y ^ 4$ l 4 z 4  4  4\  4(  4YZ  4 ͇ 4 ۇ 4J  4  4  4̞  4S & 4Sj 5 4A D 4p S 4 b 43 q 4`  4$  4'x  4u  4  4@$ Lj 4h ׈ 44  4!I  4r  4  46 & 4˅ 4 4( B 4& P 4 ^ 4r l 4u z 4  4+  4 1  4;  4  ʉ 4~ ډ 4y  4'  4:z  4+W  4 * 4[ : 4 H 4 V 4t d 4Q r 4j~  4  4  4)  4|  4R) ʊ 4I ي 4T  4  4  4'x + 4$ 8 4 E 4 R 4˅ _ 4U l 4j y 4  4q  4mS  4h  4WS  4 Nj 4a3 ԋ 49  4A]  4W  4,) 6 4@ @ 4 \ 4 j 4H x 4e  42Z  4  4 ߌ 4:  4  4~u  4 T  4٣  4{ - 4GE : 4H G 4( T 4q a 4# n 4 { 43  4  4 O  4Ӽ  4'>  4H~ ɍ 4  4>  4  4 5 4 B 4 O 47 \ 4 i 4` v 43v  4(  4q  4#  4  4 O Ď 4Ӽ ю 47 ގ 4٣  4 [ 4? h 4 u 4d  4٣  4\  4  42  4_ Ï 48 Џ 4! ݏ 4>  4 j 4: w 4  47  4H  4  4pL ϐ 4 ߐ 4~  4D  4ש  4  4a  4R  4JA J 4. X 4xL f 4 t 4  4  4P  4L>  4=  4  4  4b đ 4+e ʑ 4 Б 4 ב 4  4  4  4*  4s  4S , 4 : 4} I 4 S 4֪ d 4V j 4l p 4 v 4 | 4$  4iY  4K  4'  4  4R  4  40% Ē 4] ʒ 45> В 4 ג 4@Z  4o  4'\  4  4fC , 4* @ 4{ J 4 ^ 4< } 46  4  4  4G  4  4& “ 4v  4  4  4  4 + 4D : 4` D 4 N 4(T c 4hf m 4  4G  4n  4  4 Ŕ 4G Ҕ 4; ߔ 4  4"  4hZ * 4wC 7 4x ^ 4k  4R  4A  4  4m Ε 4 ە 4  4X  4d  4  4 ! 43O E 4 b 4%  4  4  4" Ɩ 4 Ӗ 49  4s  4d " 4x / 4Mp < 4oI I 4Z V 4 c 4p p 4 } 41  4  4Q  4u  4W Η 4 ܗ 4  4^  4n'  4{  4Hc " 4R 0 4Z} > 4 L 4g Z 4ܜ h 4  4kC ֘ 4  4N  4[  4B  4 $ 4ΰ 1 4i4 > 4P W 4X d 4W q 4t ~ 4  4Z  4x  4M  4M ™ 4W# Й 4p ޙ 4SY  4;  4  4  4~A $ 4 2 4N @ 45) N 4 \ 4 j 49 x 4  4  4a  4   4pL  4 ̚ 4 ܚ 4  42  4  4W % 4 ' 3 4R A 4O O 4` ] 4 k 4  4#  4Ŵ  4  4P ͛ 4C ۛ 4͚  4t  4  4  4mB ! 42 / 4; > 4 L 4 Z 4Ӛ h 4 v 4J  4|  4% Ü 4 ќ 4 ߜ 4  4/  4  4_ ) 4X 8 4y G 4 p 4b ~ 4  4A  4  4X  4v ѝ 4 ߝ 4  4U  4pL  47  4= % 40 3 4 A 4UU O 4% ] 4 k 4f7 y 4  4ͨ  4  4 ޟ 44  4r  4;u  4ͬ  4U ! 4ϲ . 4 ; 4 H 4q U 4P b 4| o 4Z | 4u  4'  4c ˠ 4x ޠ 4  4r  4:  4 ;  4 _  4w , 4 9 4H F 4( T 4Q a 4 n 4F { 44  4n  4  4F  4$  4p Ρ 4n ԡ 4M ڡ 4  4  4T5  4QO  4  4  4T  4  4o 5 43O M 4DL Z 4c g 4+G t 41  4  4V  4T*  4  4 ̢ 42Z ڢ 4  4  4f  4  4# . 4S : 40 G 4- U 4 a 4` v 4  4ӱ  4bQ  4>  4A  4' ţ 4 ӣ 4+  4`  4  4+|  4  4S ' 4 6 4B E 4A T 4 c 4ճ r 4  4  4c  4  4  46T  4 Ť 4$& ˤ 4 Ѥ 4 פ 4* ݤ 4{2  4  4Z  4Yx  4d  4  4 & 4q 3 42 Q 4? a 4ߛ g 4 n 4 } 4:  4$  4  4#  4v  4G ˥ 4 ٥ 4=  4sH  4. " 4$ / 4e < 4~ I 4} V 4* c 4E p 4 } 4J  4  4&  4 Ҧ 40 ߦ 4&  4t  4  4Dv  4# " 4 / 4Ƃ < 4;u J 4f X 4u g 4 u 4mq  4#  4  4  4^ ͧ 4  4O  4  4 - 4҄ ; 4UG U 4j  4  4y  4!  4B  4  4_ D 4 Q 4N( ^ 4_* k 4D x 4 n  4'  4f  42  4b  4 ̩ 4x ٩ 4y  4xO  4{  4B  4<  4d ' 4AD 4 4E A 4 N 4' [ 47@ h 4o? u 4n$  4 <  4u  45  4\  4t ê 4p Ъ 4! ݪ 4w  4RD  4  4R  4M  4= + 4s 8 4' F 45 T 4V b 4M p 4 ~ 4۷  47K  4  4  4 ī 4  4.n  4P  4 ) 4m 7 4J E 4) S 4& a 4 o 4_  4R  4d  4  48 ¬ 4 ެ 4  4  4Q  4  4.p + 4 9 4 G 4wf U 4[ c 4! q 4  4  4 ѯ 4w  4  4  4q  4n  4F ' 4 5 4; P 4n ^ 4 l 4O z 4  4a  4  4K[  4  41C ΰ 4@ ܰ 4z  4  4}  4(  4p " 4N 0 4 > 4J L 4 v 4  4#J  4l  4Ѓ  4 ʶ 4  4!  4  4V  4  4 ! 4q O 4( s 4&  4$  4q  43a  4F ķ 4 η 4 ߷ 4  4E  4L#  4  4e  4%  4=  4]F  4݃  4,  4 ! 4$6 ' 4 - - 4 3 4w 9 4( ? 4c E 4 K 4J Q 4X W 4 ] 4N c 4O i 4`X p 4c w 4E ~ 4  4~  4  4  4  4  4t  4  4  45 - 4 ; 4A' I 49 W 4 ? e 4 t 4n ~ 4  4d/  4&  4(%  4T4 Ĺ 4  4  4  4  4 , 4-R < 4t t 4(  4̜  4$w  4  4  4 ̺ 4 ۺ 4  4  4*  4n3 ( 4͸ 6 4I D 4p R 42( ` 4 n 4X  4  4  4u  4Z » 4/ ѻ 4  4~  48  4 * 4K 9 4 z 41  43  4  4  47 Լ 4=*  4  4  4g  4  4 ) 4x E 4#J Y 4j= u 4>  4(  4F. ǽ 4w! ѽ 4I  48  4(  4 $ 4r 2 4 @ 4 ^ N 4/ \ 49 j 4  4  4 ھ 4  4 + 4 5 4c I 4! V 4 y 4]: ~ 4-  4t  4_  44d ǿ 4 Ϳ 4] ޿ 4  4  4q " 4) / 4h ? 4J; E 4T K 4Q R 4j b 4a h 4[ n 4>9 t 4 z 4Ut  43R  4lA  4  4bR  4-  4c  4  4  4?f  4'  4  4  4`  4z  4q / 4 < 4ZX J 4K W 4`$ r 4ƀ  4r  4  485  4  4  4X  4  4  4Z  45  4- ! 4G  4!  4_  4Q  4Ǭ  4  4  4Cr  4  4  4  4 $ 4' * 4 1 4T W 4@ e 4. s 4]  4  4Z  4  4q  4xx  4  4  4{  4O  4C  4K  4 ) 40 7 4rW E 4 S 4@O l 4Q  4Y  4V  4?c  4  4$  4s  4  4  4B  4S  4(  4Jb " 4iD / 4X < 4O I 4 V 46 c 4c p 4  4@#  4  4P  4  4e  4  4  4  4+ ' 40 4 4rW A 4 N 4- [ 4& h 4 u 4F  4tg  4  4q  4A]  4  4(  4  4!  4(  4  4  4 , 4 9 4 F 4 S 4B m 4tg z 4;W  4T  4F  4  4  4%m  4  4X  4  4  4]4 , 4?c 9 4 L 4 Z 4 h 4q v 4  4rW  4q  4xx  4U  40  4  4  4  4  4?  4ڝ - 4 : 4K G 4B T 4 a 4 n 4* | 4X  4~  4mq  4  4SM  49  4}  4$  4?c  4`C  4C  4 $ 4 2 4$ @ 4B N 4ez k 4 z 4tg  4  4  4#F  4  4  4  4_  4&  4  4B  4 = 4X L 4w [ 4 u 4  4y  4)  4Ȯ  4  4]g  4  4H  4W  4$j  4S  4]  4(  4-  4XI  4  41  4  4b  4п  41  4  4 % 4+ + 4#3 1 4C 7 4 = 4] D 4C ^ 4c k 4V x 4?c  4  4B  4  4(  4`  4  4$  4X  4Vo  4  4 4 4c V 4` m 4 r 4  4  4q  4  41g  4  4  4  4{ ! 4o 1 48 7 4 = 4 Y C 47, J 4U W 4X d 4 q 4G{ ~ 4  4  4  4  4  46  4  4U  4pL  4M  4$C  4qw " 4/ 0 4g > 4Ą L 4s Z 4u h 4 v 4  4g  4  4x  4/  4g  4  4  4  4  4  4  4 , 4J @ 4n M 40 Z 4  h 4c v 4X  4R]  4sh  42  4'  4U  4}|  4ǫ  4xL  4Ea  4  4  4# , 4L : 4] H 4 V 48 d 4 r 4w  4!.  4B  4I  4k(  4@  4,  4E  4>  4>  4ra  4  4Y ( 4 6 4p D 4V R 4f ` 42? n 4- | 4H  4~  4/  4  4O  4  4y  4W  4 : ) 4. 8 4F B 4 L 4 V 4< ` 4^M j 4x t 4 ~ 46  4؄  4  4E  4  485  4  44  4  4  47 # 4x  4=  4'b  4F5  4*  4  4"  4uG  4BX  4$  4  4Pw  4A?  4 * 4 7 4 Q 4 d 4A q 4 ~ 4  4  4hW  41  4\  4[  4C  4N  4  4\  4  4J * 4 7 4s D 4 W 4K d 4`$ q 4B  4T  4  4^  4d  4{  4CN  4  4  46p  4  4 - 47 : 4Xv G 4 T 4@ a 4= n 4D { 40  4l  4k  4۾  4v  4  4w  4J  4Ҭ  4m  4  4  4 $ 4 1 4 ? 4x M 4i [ 4 i 4s w 4*  4  4;  4  4~  4gl  4V(  4  4?  4`  4a  4  4 5 4+ C 4 Q 4J _ 4 m 4 { 4W^  4]  4/  4:  4c  4  4"  4  4+  4  4  4 #", 4 8"A 4 M"V 4 b"k 4, w. 4Y "` 4u  4  4mq  49  4A  4D8  4?  4  4ez % 4tg @ 4s h 4  4Mn   4  4qJ  4O  4 & 4F < 4 X 4 j 44  4`  4Y  4  4k  4x  4?U  4S ? 4Q V 4ul w 4 i  4  4f  4%  4\  4  42  4  4 + 4 G 4` _ 4. h 4 p 4  4/  4O  4cG  4  4 2 4 S 4& f 4|  4r  4eh  4  4G  4  4$Y # 4 ? 4 [ 4 n 4  4  4: 0 6 6  6& 6" 67" 653LMY^m 4p x 6S 6? 6 6 6Կ 6̿ 4(N  6 6 4X  6 6 7< 6. 6$ 7<# 6X' 6R0 6x4 6r= 6A 6Jc 6g 6q  6 6A 7< 6 6A 7< 6 6 6 6A 7< 6$  6 6C 6=! 6b% 6\* 7<3 6~7 6x@AJAf 6j 6s 6w 6AA 6 6 6 6AA 6 6 6 6A 6 68Yc 7=t 6x 6} 7= 6  6 61 6) 6T 6N 7= 6p 6j 6 6 7= 6 6 6  6 6 6 * 7=7 6; 6D 6H 6Q 7=Z 6^ 6gq 6 6  6 65 7 = 6' 6# 68 665 70= 6M 6I  6^$ 6\- 6q1 6o:5D 7;=T 6}X 6ya 6e 6n 6r 6w 7;= 6 6="X5 7F= 6 6 6 65  7F= 6 6% 6) 625< 7F=H 6L 6U 6Y 6b5l 7F=y 6} 6 6 6 6 6 6 6"` #;H`v"+i""" 3 6'7 6%=Uid 4'  4  4  6= 6/ 4  6 6u 4X  6 6 7`<  6 6  6H 6>$ 6( 6o- 7`<6 6: 6C 6G 6P"i 6,m 6*w? 66 64O 7p< 6D 6> 6c 6] 6 6| 7p< 6 6 6 6q q& 6* 64> 7<O 6S 6\f 7<s 6w 6 6 6 7< 6 6 6- 6) 6B 6> 7< 6W 6Q 6o 6m 6z 6x&> 6B 6K 6O 6Xb{ 6 6 6 6 6 6 7< 6 6 6! 6*4L 6P 6Y 6] 6f 6j 6s} 6 6 6 6 6# 6! 6/ 6+"n.M`'j 7<{ 6G 6?' 7< 6p 6h 6 6' 7< 6 6 6 6 6 6 7< 6 6''. 62 6 ; 6? 6H'R'j 6#n 6!w 6.{ 6,'' 68 66 6C 6A' 6O 6KF","6K"Umr  U 4  4  4X  4  4  4  46 7 4 D 4X ^ 4 m 4t s 6g 6_ 6 6 6 6 6 6 0 64 6= 6A 6FZg t 4J @ 6 6 4  6 6 4X  6W 6K 4s  6 6 6  6 4A?  6 6/ 63 68 4 C 6G 6W 6[ 6ips 4 { 78 4bl  4J  67 6+u 78 6d 6b 6q 6o 6} 6{u 78 6  6 6 6" 781u;uX 6\ 6e 6i 6oz 7-8 6 6 788 6 6  788 6 6!;Eb 6f 6o 6s 6| 6 6 6 6 6 6 6 6 6 6$ 6+( 6)5?\ 66` 64i 6@m 6>v 6Kz 6I 6U 6S 6_ 6] 6_ 6] 6_ 6] 6j  6h 6t 6r<Fc 6g 6}p 6t 6~ 7C8 6 6 6 6 6 6 6 6 6 66Cp_ x o{|  4Y!  4  4  4  4B = 4 f 4bl s 4J  4 p 6 6 6 6 4  6  6 4s  67 6+ 4  6j 6b" 6& 6/9V 6Z 6c 6g 6p 6t 6} 6 6 7 8 6 6   6 6$ .F a P q& P  4  4  4J@  6 6 6 6  & 62* 604$> 7Z;O 6>S 6:\ 6Q` 6Mi 6dm 6`r 7Z;{ 6} 6s 7j; 6 6$ 7j; 6 6 6 6 6 6$ 7j; 6 6  6  6 7j;%$/$L 6P 6Y 6] 6c)@@ 6  6  6 6@@ 6# 6! 6/ 6-@@  6:$ 68- 6F1 6D:@D@] 6Qa 6Oj 6]n 6[} 7z; 6h 6f 7; 6r 6pG 7; 6 6z 7; 6 6 G 7;$ 6( 6- 7;6 6: 6CuM 7;^ 6b 6kuu 7; 6 6u 7; 6 6u 7; 6 6 6  6 u 7; 6 6 6"  6 u 7;* 6,. 6*7 67; 65FoYc| 6A 6? 6K 6I 6U 6S 6_ 6]#-E 6iI 6gR\u 6uy 6s 6 6 6  6%9 4 D[ 4` f 6j 6o 4T z 6~ 6 6 6 6 6  7; 6 6  7; 6 6  7; 6 6 ) 7;6 6$: 6"C M 7;Z 6.^ 6,g 69k 67t ~ 7; 6C 6A 6N 6L  7; 6X 6V 6c 6a, 7; 6o 6k,  7; 6 6~)N3 7<D 6H 6Q 6U 6_ 7<h 6l 6u 7< 6 6N 7< 6 6 6 6 6 6N 7< 6 6 6 6 7<NN9 6= 6F 6!J 6PJsa}a 6, 6* 68 66aa 6C 6A 6O 6Maa  6Z  6X  6f  6d' a1 aJ  6qN  6oW  6}[  6{k  70<}  70<  6  6 |    47  4 -  61  66  4? A  6E  6J  4 U  6Y  6h  6l  6{  6  6  4x~  6  6  4  6Z  6F  6  6  7:  4mq  4   6G  6A,  6g0  6]9 C `  6d  6n x  7:  6  6  6  6  6  6   7:  6  6  6  6  6  6  7:  6(  6$  7:  6A  6;  7:&  6*  65 ? X  6\  6e  6i  6r  6v  6{   U U  6  6  K d o y   4mq  # 7: 46~ " 6& 6+ 40 6 6: 6sDN 7:_ 6c 6h 7:q 6u 6~ 6% 6 6X 6N 6~ 6| 6 6 6 6 6! 6* 6. 67L 6P 6Yc 6 6 6 6% 7; 6 6% 7; 6N 6B 6  6% 7;( 6, 65 69 6B 6F 6K 7;T 6X 6a%k% 67 65 6B 6@%% 6L 6J 6W 6U%% 6a 6_  6l 6j%/ 6x3 6t<Snsx 7; 6 6 6 6s 7; 6 6 6 6s 7; 6 6 6 6s 7; 6 6" 6& 65? 7 ;P 6T 6Y 7 ;b 6 f 6oy 75; 6& 6  7J; 6D 6< 7J; 6l 6d 6 6 7J; 6  6 6 6 6# 6( 7J;1 65 6>He 6/i 6-r 6:v 68 6D 6B 6O 6M 6Y 6W 6e 6c 6q 6m6-@-X 6\ 6a@uHPL} !5 4Ek > U 4} _ 6c 6h 4T r 6v 6 6 6 6 6 6S 6K 6w 6qNJ 79 6 6J  7 : 6 6&J0JI 6M 6VJ`Jy 6} 6JJ 6 6 6 6JJ 6 6 6 6J J! 6% 6. 62 6BXL 7:\ 6` 6iXs 7: 6  6v 7$: 6 6 6' 6% 7$: 69 6/ 79: 6_ 6]v 79: 6i 6g 6v! 6t* 6. 67vA 79:N 6R 6[ 6_ 6h 79:wvv 6 6 6 6r 6 6 6  66 6: 6C 6G 6PZr 6v 6 6 6 6 6 6 6 7I: 6 6 7I: 6? 65 7Y: 6g 6c" 6~& 6x/9 7Y:E 6I 6R 6V 6_ 6c 6lv 7Y: 6 6 6 6 7Y: 6 6 6 6 6 6 7d:. 6 2 6;E 7d:R 6;V 61_ 6gc 6clv 7d: 6| 6x 6 6 6 6 7d: 6 6 6 6 6 6 6! 6* 6. 67AZ 6^ 6g 6'k 6%t 63 6/ 6E 6C 6R 6P& 6]* 6[3 6j7 6h@Jb 6uf 6so 6s 6| 6 6 6 6 6 6 6 6",E 6I 6R\u 6y 6 6 6 6 6 6 6 6 6 6! 6* 6. 6>H 7o:X 6 \ 6 eo 7o:| 6 6# 7: 6  6# 7: 6* 6(= 7: 66 62 7:  6I  6E J% u; #X 7p V   4j P  6f  6X  6  6  6  6  4 !~,!D!\!u!! 4P, !! 4x~ ! 6 ! 6! 6-! 6%! 7;<! 4bl ! 4J ! 6X! 6P" " 7;<" 6}" 6{$" 6(" 61" 7;<@"J"g" 6k" 6t" 6x" 6~""0" 7U<" 6" 6" 6" 6"0" 7U<" 6" 6" 6" 6#0# 7U<# 6# 6(# 6,# 65#0?# 7U<L# 6P# 6Y# 6]# 6f## 4J #`# 4o # 6# 6 # 4V # 6F# 6># 4~ # 6q# 6i# 6# 6#$ 4>^ $0$I$X$ 4z a$0x$ 4A? $ 6$ 6$ 4z_ $ 6$ 6$ 65$ 6'$ 4F $ 6u$ 6m$ 4 $ 6$ 6$ 4mq $ 6$ 6$ 67$ 6-$ 79% 4 % 6c% 6]*% 4X 9% 79B% 4[ L% 6P% 6yU% 79Z% 4%^ d% 6h% 6o% 79x% 4[ % 6% 6 % 79% 4%^ % 60% 6.%P%P% 6=% 6;%%& 6I& 6G& 6U& 6S&(& 798& 6g<& 6]E&O& 79\& 6`& 6i& 6m& 6v&& 79& 6& 6& 6 & 6& 6,& 6"& 79& 6\& 6V&&& 6t& 6r& 6& 6}'''' 6+' 64' 68' 6A'K'd' 6h' 6q' 6u' 6~'' 6' 6'''' 79' 6' 6' 6' 6( 6 ( 6( 6( 6 ( 6$( 6-( 61( 66( 79?( 6C( 6L(V( 79g( 6k( 6r(A(_( 79( 6( 6( 6( 6()) ()>) V)S`)S|) 6*) 6$) 6H) 6@)\)\) 6j) 6h) 6u) 6s)\)\) 6) 6* 6 * 6*\*\5* 69* 6B* 6F* 6N*|n*x* 7w9* 6* 6** 4! * 4bl * 4J * 4" *+ 4o + 6+ 6+ 4V + 6#!+ 6&+ 4~ 0+ 6W4+ 6MB+ 6F+ 6U+ 6Y+ 6b+l+ 78x+ 6|+ 6+ 78+ 6G+ 6;++ 79+ 6+ 6|++ 79+ 6+ 6++ 79+ 6, 6 , 6  , 6, , 79-, 6 1, 6:, 65>, 61G, 6LK, 6FP, 79Y, 6k], 6gf,p,, 6|, 6z, 6, 6,,, 6, 6, 6, 6,,- 6 - 6- 6- 6!-6- 6:- 6C-^-h-- 6- 6---- 4N - 4 - 4? . 4 *. 4bl 6. 4J D. 4& ^. 4 w. 4T . 4( . 4 . 4Ҁ . 4.t . 4 .0. 6/ 6/C$/ 40= 6/ 4 C/ 4 P/ 4mq ]/ 46 j/ 4. w/ 4K / 4 / 4 / 4A? / 4 ` / 4 / 4M / 4A? / 4 0 43 0 4A? (0 4r 50 4Jb C0 4$ Q0 4A? ^0 4T l0 4 }0 4s 0 4 0 4[ 0 4 0 4r 0 4_| 0 4Jb 0 4^ 0 4s 0 4? 0 4 1 4F 1 4c !1 4ݤ -1 4? 91 4Vo F1 4M f1 49\ 1 4m 1 4 1 4K 1 4T 1 4}% 1 4K 1 4T 2 4 , 2 4T 2 4 22 4a @2 4}) Y2 4W g2 4} 2 4 2 4/ 2 4 2 4o 2 4 2 4* 2 4 3 4 3 4T 13 4 C3 4T Q3 42 _3 4T m3 4M 3 4T 3 4 3 4a 3 45 3 4T 3 4 3 4a 3 4 4 4 4 4X $4 4 64 4 C4 4X Q4 4 `4 4~s r4 4 4 4* 4 4G 4 4 4 4X 4 4L 4 4X 4 4 4 4'x 5 4 +5 4'x 95 4Cp U5 4Z g5 4 u5 4 5 4'x 5 42 5 4 5 4 5 4 5 49} 5 4S 6 4'x 6 4< !6 4'x .6 4% J6 4 \6 4T j6 44 |6 4T 6 4 6 4T 6 4@ 6 4T 6 4a 6 4G 6 4T 7 4a 7 4I %7 4 -7 4 >7 4* J7 4 V7 46 n7 4[ |7 4%^ 7 4 7 4 7 4 7 4Ri 7 4 7 4H 8 4R0 8 4i .8 4* =8 4i L8 4j [8 4j k8 4R {8 4 8 4-k 8 4 8 4ck 8 4k 8 4y 8 4R0 8 4| 9 4 9 4== *9 44 =9 4g K9 4g Y9 4h g9 4:i u9 4e 9 4di 9 4|i 9 4 9 4i 9 4i 9 4( 9 4 9 4e 9 40 : 4 : 4 %: 4 2: 4'x ?: 4̙ L: 4'x Y: 4MI f: 4k r: 4h6 : 4e : 4k : 4 : 4=F : 4k : 4h6 : 4se : 46n : 4'x ; 4k !; 4h6 /; 4 L; 4k X; 4h6 q; 4( ~; 4 ; 4Re ; 42 ; 4c ; 4 ; 49 ; 4lg < 4tg < 4AS 9< 4i V< 4g d< 4d < 4g < 4jP < 40 < 4g < 4Q = 4g = 4 A= 4d d= 40 = 4S = 4" = 4n = 4v > 4 E> 4 j> 4n > 4 > 4h > 4 > 4 ? 4* ? 4. .? 4* @? 4" W? 4 i? 4Q ? 4 ? 4mT ? 4 ? 4O ? 4* ? 4-c ? 4* @ 4 @ 4en +@ 4* 8@ 4 P@ 4* ]@ 4 y@ 4* @ 4W @ 4_ @ 4 @ 4q @ 4$ @ 4 A 4R A 4 /AJA 6NA 6WAaA 7N8qA 6[uA 6Q~AA 7N8A 6A 6A 6A 6AA 7N8A 6A 6A 6A 6A 6 A 6A 7N8A 6AA 6;A B 7m8B 6YB 6W'B 6d+B 6b4B>B 7m8KB 6pOB 6nXB 6{\B 6yeBoB 7m8|B 6B 6B 6B 6B 7m8B 6B 6BB:B 7x8B 6B 6B:C 78C 6C 6C 78#C 6 'C 60C 614C 6-=C 6RAC 6NJC 6iNC 6eaCkCCCC 78C 6|C 6xC 6C 6CCC 6C 6CD!D 6%D 6.D8DUD 6YD 6bD 6fD 6oD 6sD 6}DDD 6D 6D 6D 6DDD 6D 6D 6D 6DE 78E 6E 6!E 78*E 6.E 67E 6@;E 6>DENE 78_E 6LcE 6HmEwEE 6_E 6]E 6jE 6hE 6tE 6rEE 6E 6EE%E%F 6F 6'Fg1FgIFlWFuFFFFF 6F 6FF 78F 6F 6FG 78G 6G 6 G 6$$G 6-G7G 78DG 6CHG 6=QG 6bUG 6\^G 6bG 6{gG 78pG 6tG 6}GG 78G 6G 6G 6G 6GG 78G 6G 6G 6G 6GG 78G 6G 6H 6 H 6H 78H 6 !H 6*HELHVHnH 6rH 6wH$H,H@H 66H 6$HUH 769H 6H 6HUI 769 I 6I 6I 6I 6'IU1I 769>I 6BI 6KI 6OI 6XI 6\I 6aI 769jI 66nI 60wIUIUI 6NI 6LI 6YI 6WIUIUI 6cI 6aI 6nI 6lIUIUJ 6xJ 6v%J 6)J 62JUGJ 6KJ 6TJuJtJ 7F9J 6J 6JtJ 7V9J 6J 6JtJ 7a9J 6J 6JtJ 7l9K 6K 6  K 7l9K 6-K 6)K}7KAKYK 6?]K 6=fK 6IjK 6GsKKKK 6SK 6QKKKK 6fL 6d L 6p L 6nL 6pL 6nL8LML"WLeL~L LUL"LtL"LL"LM 6 M 6yM$M 7<5M 69M 6>M 7<GM 6:KM 62TM^M 7<oM 6`sM 6X|MM 7<M 6M 6M 6M 6MM 7<M 6M 6M 6M 6M 6 M 6M 7<M 60M 6*MN$N 6H(N 6F1N 6S5N 6Q>NHNaN 6]eN 6[nN 6hrN 6f{NNN 6rN 6pN 6~N 6|NN 6N 6NN+N 7<O 6O 6O+'O+?O 6CO 6LO+VO+rO 6vO 6O 6O 6O0O<O<O 6O 6O 6O 6O@OP"P#&P"0PaHPm]P"gP|vPP 4 P 4 P 4 P 4 P 1GP 4 P 5P 5P 2P 4 P 4 P 4a P 4 P 4 Q 4- Q 4o Q 4~ &Q 4 +Q 4- 9Q 4 >Q 4 VQ 4 bQ 4 pQ 4w uQ 4 Q 4 Q 4 Q 4M Q 4 R 4 R 49 "R 4Ƕ .R 4- :R 4 FR 4i RR 4e ^R 4 jR 41 vR 4 R 4r R 4p R 4ý R 4 R 4t R 4 R 4 R 4 R 4% R 4X R 46 S 4 S 4 S 4 %S 4 1S 4 =S 4q IS 4 US 4 aS 4͈ mS 4ǚ yS 4\ S 4l S 4 S 4l S 4 S 4Ѭ S 4n S 4Z S 4 T 4 T 4@ T 4n -T 4 UT 4 bT 4n oT 4 T 4 T 4 T 4 T 4 T 4 T 4 T 4 U 4 U 4 ,U 40 :U 4 HU 4e VU 4n dU 4 rU 4ô U 4 U 4n U 4 U 4 U 4 U 4 U 4 U 4 U 4ذ U 4 V 4, V 4> *V 4 8V 4 FV 40 TV 4 bV 4 pV 4 ~V 4 V 4 V 4 V 4 V 4 V 4 V 47 V 4 V 4 W 4 W 4\ +W 4 :W 4L IW 4 XW 4 gW 4| vW 4 W 4J W 4{ W 4 W 4d W 4 W 4Q W 4 W 4# X 4r X 4 +X 4 :X 4ϒ IX 4I XX 4= gX 4 vX 4 X 4m X 4 X 4p X 4C X 4V X 4 X 4 X 4 X 4 Y 4= Y 4 *Y 4 9Y 4} HY 4\ WY 4D fY 44 uY 4 Y 4 Y 4j Y 4F Y 4 Y 4 Y 4 Y 4U Y 4 Y 4 Z 4л Z 4 )Z 4A 9Z 4 EZ 4O {Z 4 Z 45 Z 4 Z 4z Z 4 Z 4W [ 4 3[ 4O `[ 4 m[ 4Q 4\ 4 S\ 4 s\ 4v \ 4/ \ 4 \ 4 \ 4z \ 46 ] 4 +] 4 7] 4 C] 4) Q] 4) `] 4 ] 4 ] 4 ] 4 ] 4 ] 4* ] 4z ] 4 ] 4n ^ 4 ^ 4H "^ 4v B^ 4ʇ L^ 4) Y^ 4K m^ 4 ^ 4 ^ 4e ^ 4γ ^ 4 ^ 4 ^ 42 ^ 4z ^ 4 _ 4 _ 4 $_ 4 2_ 4i @_ 4 N_ 4h \_ 4 j_ 4 x_ 4 _ 4U _ 4 _ 4! _ 4c _ 4 _ 4 _ 4 _ 4 _ 4. ` 4 ` 4L K` 4 Z` 4 i` 4 y` 4 ` 4T ` 4 ` 4& ` 4 ` 4 ` 4̵ ` 4 ` 4 a 4 a 4 a 4- .a 4a =a 4Q La 4 [a 4 ja 4 ya 4y a 4Õ a 4 a 4 a 4i a 4C a 45 a 4 a 4 b 4 b 4n b 4 -b 4 s 4+ s 4 s 4{ s 4, s 4 s 4] s 4 t 4 t 4? &t 4 Ct 4 Tt 4 Zt 4/ `t 4 ft 4 mt 4 zt 4X t 4 t 4A t 4κ t 4 t 4_ t 4 t 4U t 4' u 4U u 4r Au 4 Nu 4 uu 4X u 4Z u 4 u 4 u 4 u 4 u 4y u 4 u 4 u 4ت v 4 v 4 "v 4ϫ 0v 4P >v 4' Lv 45 Zv 4 hv 4 vv 4 v 4c v 49 v 4y v 4= v 4 v 4< v 4 v 4 v 47 w 4o w 4` w 4p ,w 4 :w 4 Hw 4; Vw 4ͦ kw 4 xw 4 w 4 w 4S w 4 w 4 w 4 w 4z w 4 w 4 x 4 x 4 x 4 Cx 4f Tx 4Ќ `x 4] mx 40 zx 4 x 4I x 4; x 4` x 48 x 4ۋ x 4 ؁ 4  4  48  4f % 4( 3 4 ? 4 L 4 Y 4 s 4}  4[  4  4o  4]  4ԡ  4 Ђ 4< ݂ 4  4  4ԡ  4  4 % 4 3 4 @ 4ۮ N 4 \ 4 i 4 w 4  4  4  4  4ۮ  4  4 ʃ 4 ׃ 4  4  4O  4Q % 4 2 4 ? 4M L 4i f 4 s 4  4B  4  4  4  4 DŽ 4 Ԅ 4  4  4G  4  4i , 4͚ ? 4 ] 4$ i 4 v 4މ  4  4  4X  4>  4$ Ņ 4j ҅ 4 ߅ 4 ! 4 - 4K 9 4 J 4ٹ V 4Z g 4 t 4  4  4  4  4 Ɔ 4 ӆ 4h  4  4N  4  4  4 5 4 B 4 O 4 \ 48 i 4%  4ܨ  4  4  4y  4W Շ 4ߞ  4  4  4O  4  4 * 4 6 4 L 4 i 4  4  4O  4  4 ˆ 4 Έ 4  4)  4  4ő  4s  4B - 4 : 4߈ G 4 U 4 i 4á u 4  4  4  4  4S  4{  4D Ή 4 ۉ 4  4  4X  4  4 7 4. E 4 R 4, ` 4} m 4 z 4  4  4  4J  4<  4! ʊ 4 ׊ 4  4  4^  4  4ە  4 % 4 3 4 @ 4 M 4 [ 4O h 4u u 43  49  4  4  4 ȋ 4_ ֋ 4  4  4'  4u  4  4Y $ 4ȫ N 4 [ 4 i 4 u 4  4  4  4.  4  4& ̌ 4 ٌ 49  4  4 - 4 9 4 G 4@ U 4ܚ c 49 r 4  4  4  46  49  4k  4  4  4n ̍ 4  4@  4ܚ  4M  4 ! 4 / 4ٽ = 4 K 4 Z 4 h 4 v 4k  4e  4F  49  4`  4ư ˎ 4 َ 4  4W  4  4  4 ! 4 / 4 = 4A K 4 Y 4K g 4 u 4^  4˭  4d  4A  4  4K ɏ 4 ׏ 4|  4v  4E  4  4w  4^ + 4 9 4A G 4. U 4 c 4 q 4)  4P  4  4  4  4 ǐ 4 Ր 4*  4v  4  4  4  4 * 4i 8 4 F 4 T 4թ b 4 p 4A ~ 4  4-  4  4  4G đ 4c ґ 4  4  41  4  4 ) 4ڊ 7 4Y E 4` S 4ʮ a 4 o 4 } 4  4J  4 Œ 4ԡ Ԓ 4  4  4  4  4  4G ( 4v 6 4 D 4 T 4C d 4M t 4<  4  4[  4?  4T ē 4 ӓ 4H  4,  4  4q  4Z D 4 R 4 _ 4 l 4 y 4  4'  4  4;  4 ʔ 4  4  4n  4  4 ( 4c L 4E V 4 d 4 r 4?  4  4  4  46  4 ƕ 4 ԕ 4  4,  4  4  4  4[ ( 4 6 4k V 4 c 4ڥ p 49 } 4z  4  4:  4 ˖ 4  4  4  4  4 ( 4h O 4h \ 4 i 4 v 4  4  4  4  4ʸ  4Ë ė 4m ї 4A ޗ 4  4d  4  4  4$  4 , 4 9 4 F 4 S 4 ` 4  4h  4  4 Ƙ 4 Ә 4  4  4  4B ' 4H 4 4 A 4 Z 4] n 4 x 4_  4  4  4  4  4  4 ș 4< ՙ 4  4S  4  4  4  4# # 4 0 4 = 4 J 4y W 4 d 4 q 46  4  4  4u  4u  4 Ě 4: ݚ 4  4O  4  4  4 # 4 ? 42 M 4: [ 4@ i 4ܚ w 4m  4  4M  4M  4  4K ˛ 4 ٛ 4M  4  4j  4t  4(  4 - 4 ; 4 I 4s W 4K e 4 s 4ݼ  4T  4}  4  46  4 ǜ 4 ՜ 4*  4\  4  4=  4  4 ) 4Y = 4 J 4n W 4 d 4 q 4  4S  4  4  4Չ  4\  4߭ Ý 4B Н 4 ݝ 4ø  49  4ֈ  4ŧ  4$  4 1 4 @ 4 J 4W T 4 b 4 p 4j ~ 4  4$  4  4  4 ߞ 4  4v  4;  4#  4n ! 4ŷ . 4 ; 4G H 4# \ 4 i 4| v 4  4  4  4  4  4[  4͠ ȟ 4 ՟ 44  4i  4  4  4  42 # 4 0 4 = 4! J 4 W 4O d 4 q 4 ~ 4ə  4  4:  4  4 Π 4 ۠ 4  4  4  45  4@  4 * 4 9 4 F 40 ` 4 m 4ձ z 4  48  4  4k ʡ 4ږ  4Z  4s  47  4՘  4~ ! 43 . 4 ; 4G H 4] U 4 b 4O o 4  4!  4 ʢ 4j ע 4&  4  4'  4  4@  4 % 4g 2 41 ? 4 L 4 Y 4Ċ f 4  4  49  4  4  4 ģ 4 У 4; ܣ 4_  4B  4  4  4a * 4% 7 4 J 4 W 43 j 4g w 4  4  4  4}  4] Ť 4 Ѥ 4 ݤ 4  4  4  49  4  4œ > 4 K 4 X 4 e 4 s 4  4  4/  4 å 4 Х 4 ݥ 4  4  4o  4 O 4o ] 4[ j 4p w 4  49  4  4  46  4س Ʀ 4x Ӧ 4  4  4  48 9 4ގ F 49 S 4 ` 4 m 46 z 4  4  4D  4L  4 Χ 4' ۧ 4  4  4ۮ  4ڥ  4ʼn " 4{ / 49 < 4: I 4 V 4 c 46 p 4' } 4޵  4  4a  4/  4  4 ˨ 4X ب 4O  4Ɠ  4Q  4  4  4 F 4X \ 4> h 4 ~ 4  4  4k  4S  4 ө 4  4  4  4F  4Q  4L C 4 R 4P _ 4ˏ l 4ܺ y 4  4  4  4G  4  4V  4: ª 4r Ȫ 4 Ϊ 4@ Ԫ 4K ۪ 4  4  4  4  4 # 4w 0 4K H 45 V 4 x 4  4  4  4  4  4 ƫ 4 ӫ 4n  4  4  4o ; 4 H 4 V 4 ` 4 m 49 z 4  4  4  4t  4n Ŭ 4 ߬ 4  49  4  4  4  4d - 4% ; 4 E 4 R 4 _ 4 y 4k  40  4  4|  4  4 ǭ 4 ԭ 4  4  4  4  4  4 " 4 / 4 < 4 T 4 i 4 v 4  4  4"  4M ̮ 4  4  4  4 + 4 8 4 E 4a S 4 f 4 } 4]  4,  4  4 ԯ 4#  4U  4I  4 + 4 a 4 n 4  4  4  4M  4U ʰ 4 ذ 4*  4  4y  4 + 4 9 4t G 4 U 4 c 4Z  4  4  4  4 ı 4 ұ 4˔  4  4  4  4O 8 4 G 4O k 4 } 4  4  4  4s  4h ò 4? Ѳ 4& ߲ 4Z  4R  4s  4  4 + 4 9 4( G 4* U 4= c 45 q 4  4  4  4  4_ ϳ 40 ޳ 4  49  4j  4  4m % 4 3 4 A 4X Z 4 h 4  4=  4  4 Ӵ 4  4  4ї  4ȫ  4 4 4 N 4i g 4 u 4  4  4P  4խ  4 ϵ 4 ݵ 4  4  4  4 # 4E 1 4 ? 4 M 4 [ 4 i 4D w 4  4  4y  4  4X  4 ˶ 4 ڶ 4B  4y  4  4  4_ % 4Q 4 4 C 4 R 4 a 4F p 4#  4D  4  4  4 ʷ 4z ٷ 4  4  4  4  4 $ 4 3 4m B 4 Q 4 ` 4* o 4 ~ 4  4  4  4T  4 ɸ 4 ظ 4  4  4  4  44 # 4d 2 4k A 4/ P 4 _ 46  4  4/  4  4 й 4' ܹ 4:  4  4  4 & 4 3 4 F 4 S 4 ` 4 | 4&  4  4  4  4f  4* Ϻ 4ѹ ޺ 4  4f  4m  42  4` : 4 Q 4h l 4c x 4_  4  4M  4  4a  4O Ż 4 ߻ 4{  4  4  4z  4 % 4 3 4x R 4G _ 4 m 4 z 4n  4  49  4 ˼ 4u ݼ 4  4r $ 4 1 4 D 40 ` 4 l 4^  4  4  4  4  4 ǽ 4 Խ 4m  4Y  4  42  4  4˴ " 4y / 4 < 4 I 4f ] 4 j 4D  4  4/  4  42 Ⱦ 4 ־ 4  4Ŀ  4  4  4t  4 * 4/ 8 4; L 4 Z 4 h 4 v 4u  4  4  4  4  4 ʿ 4 ؿ 4  4  4޴  4  4  4$ , 4 : 4 H 49 V 4ߍ d 4: r 4_  4]  4R  4  43  4  4  4L  4  4  4R  4m 2 4r A 4 Q 4t g 4 v 4  4  4  4  4!  4  40  4m  4  4  4< # 4y 0 4 = 4I J 41 W 4W d 4 q 42  4s  4  4  4  4ߪ  4  4  4)  4c  4  4f $ 4 2 4 @ 44 N 43 \ 4@ j 4 x 4  4è  4  4%  4֯  4  4Q  4  4  4J  4  4{  4 / 4M > 4 M 4 \ 4 k 4 { 4  4d  4  4R  4  4  4  4  4  45  45  42 / 4u > 4 M 4v \ 4 k 4 z 4#  4Ψ  40  4  4  4  4  4  4  4# ! 4 0 4 ? 4c T 4 e 4E k 4 A 4' N 4 [ 4t h 4 u 4  4  4  4  4 , 4Y 9 4 F 4 T 4: a 4 n 4 { 4W  4  4  4B  4  4&  4  4  40  4  4 L 4 Y 4ۮ f 4 s 4  4C  4e  4  4  49  4(  4  4Ʃ ] 4p i 4O z 4д  4c  4Z  4  4Y  4>  4l  4  4S  4  4  4  4c  4  4~ " 4 < 4h I 4B ` 4 m 4  4  4r  4z  4_  4  4  4&  4-  4 + 4 d 4 q 41  4  4  4(  47  4,  4r  44  4z  4_  4 0 4H L 4ü Z 4o s 4b  4H  4”  4  4  4w  4  4Y  4  4y  4*  4E " 4 / 4h < 4N n 4  4  49  4  4  47  4̯  4j  4  4.  4 ' 4 4 4 A 4C N 4ҍ [ 4/ h 4 u 4*  4  4  4y  4y  4B  4  4  4)  4  4  4  4@  4Ȟ # 4 0 4 = 4p J 4 W 4j d 4 r 4  4  4A  4  4@  4ܚ  4  4X  4d  4W  4  4n  4 $ 4< 1 44 > 4 q 4K { 42  4  4*  4  4  4Ȫ  4  4  4ڸ  4.  4 ! 4_ . 4u ; 4 H 4 V 4s  4  4!  4<  4  4  4  4 / 4 = 4 L 4 m 4  4B  4  4m  4Q  4(  4z  4۠  4  4j  4  4Q  4  4  4  4 " 4 ( 4 8 4 F 4o R 4 c 4[ i 4޿ o 4 v 4I  4  4o  4ʬ  4  4@  4  4  4V  4  4 * 4j 7 4G P 4į ] 4 k 4ھ y 4>  4  4  4  4±  44  4R  4  4  47  4ے  4 ' 4 5 4 C 4 R 4 u 4W  4  4v  4j  4  4  4R  4  4  4  4  4z  4 + 4 8 4( E 4 R 4 _ 4W l 4} y 4}  4  4  4  4N  4A  4  4˱  4  4  4G  4=  4{ $ 4 2 4 @ 4 N 4Z \ 4\ { 4{  4  4  4  4ͼ  4G  4ۛ  4F  4f  4  46  4  4  4V  4  4  4 " 4  4  4  4/  4  4V  4!  4b  4N  4  4,  4ԟ  4  4  4  4  4  4  4ه  4  4  4 & 4J 4 4 B 4k P 4ԑ ^ 4 l 4% z 4  4{  4  4  4v  4.  4  4C  4U  4  4 # 4 2 4! @ 4= N 4M m 4 { 4  4  4  4  4I  4  4'  4j  4  4ȗ  4  4X $ 4 2 4) @ 4 N 49 \ 4 j 4 x 4  4 ] 4. k 4 y 48  4  4  4  4V  4| ; 4M I 4> W 4 e 4 s 4G  4c  4  4Ԏ  4!  4  4  4O  4  4  4  4  4Μ ) 4˜ 7 4 E 4 S 4  4ѷ  4 x 4  4  4G  4<  4s  4u  4 D 4 Q 4 ^ 4 k 4 y 4  4w  4  4  4S  4-  4  4  4  4X  4  4T  4 ( 4 6 4C D 4 R 47 ` 4 n 4 | 4  4  4  4q  4'  4  4  4  4w  4~  4V  4[ # 4o - 4 7 4 E 4 S 49 o 4  4  43  4  4  4  4]  4:  4x  4%  4 " 4K : 4? H 4 U 4 b 4( z 4  4  4'  4{  4  4r  4#  4  4  4  41  4 " 4 0 4 > 4 L 4v Z 4 h 4 v 4  4(  4/  4  4  4  4N  4  4  4}  4͖  4̽  4J , 4 : 4D H 4 V 4? d 4Ⱦ r 4  4  4g  4$  4  4:  4  4Y  4  4  4I @ 4C  4_  4  4. 9 4 u 4 G 4  4 8 4  4  4Χ  4  4  4 6 4= G 4 M 4z S 4  4  4  4d ) 4| 6 40 C 4 P 4c ] 4 j 4  4_  4  4<  4#  4  4  4  4ަ  4  4n  4 ' 4z 3 4 ? 4 K 4ǐ X 4 e 4 r 4ϰ  4O  4  4  4M  4K  4[  4  4  4  4  4  4h ' 4 4 4 A 4c N 40 s 4r  4  4G  4  4  4  45  4  4  4 ) 45 7 4 E 4 S 4 a 4 o 4r } 4  4  4ތ  4y  4  4'  4  4  4T  47 " 4 , 4ض E 4 R 4 _ 4 m 4 { 4  4  4  4  4  4  4  4Ѫ  4f  4  4c  4  4Û " 4z / 4 < 4E I 4 V 4 c 4  4  4S  40  4G  4\  4  4  47  4  4 * 4? 8 4 F 4 T 4y b 4ʿ p 4 ~ 4'  4n  4j  4v / 4 < 4 I 4Կ V 4 c 4 v 45  4  4n  4  4x  4  4 G 4O T 4 a 4 n 4  4պ  4!  4i  40  4n w 4  40  4  4ڥ  4 * 4S 7 4t D 4X \ 43 v 4Y  4  4ѐ  4ۮ  4}  4  4ʻ  4X  4J ) 4~ 6 4t Y 4ٻ f 4  4  4  4  4  47  4j  4v  4  4M  4X  4w  4  4  4ǝ  4  4'  4ۮ  4  4t  4k  4  4  42  4=  4 " 4 ( 4 / 4 = 4 K 4g Y 42 g 4  43  4  4  4  4  4  4  4$ - 4 < 4 o 4 z 5G 4d  , 4   4   4  4 , 1f1 4 6 5q: 5J> 2E 4 L 4 X 4K _ 4P d 4 r 4 y 4  4  4  4B  4  4  4X  4e  4  4  4  4S  4a  4h  4f % 4 2 4 B 4x H 4 N 4 T 4\ Z 4 a 4 n 4 { 4  4  4  4  4  4  4  4  4  4w  4  4X  4< $ 4 1 49 > 4 K 4i X 4K d 4h p 4N | 4  4"  4<  4&  4  4  4  4  4  40  4  4n  4 . 47 4 4~ : 4 @ 4 F 4 L 4 R 4 X 4_ ^ 4 e 4 v 40 | 4.  4  4  40  4  4  4  4`  4\  4  4;  4  4l  4j  4  4  4?  4C  4  4  4  4 3 4u 9 4 ? 4H E 4# K 4 R 4 ^ 4w l 4 x 4  4Y  4*  4  4`  4  4  4  4  4  4  4w  4   4  4  4 ? 4 KZ 4 d 4 o 4  4  4M  L 4#  @" 58& 5_* 5h. 52 56 5: 5> 5B 5F 5J 5*N 5?R 5VV 5eZ 5^ 5i 5n 5s 5x 5} 5 5 5 5 5 5 5, 54 5? 5E 5J 5S 5Z 5e 5l 5u 5 5 5 5 5 5 5 5 5 5 5 5  5 5  5 5 5," 55' 5;, 5B1 5T6 5d; 5t@ 5E 5J 5O 5T 5Y 5^ 5c 5h 5m 5r 5 w 5| 5* 58 5A 5M 5V 5^ 5f 5r 5| 5 5 5 5 5 5 5 5 5 5 5 5  5 5" 5* 52 5@ 5K 5Y 5a  5r 5} 5 5! 5& 5+ 50 55 5: 5? 5D 5I 5N 5S 5 X 5] 5b 5,g 5?l 5Oq 5^v 5l{ 5| 5 5 5 5 5 5 5 5 5 5  5 5' 5< 5Q 5X 5g 5m 5z 5 5 5 5 5 5 5 5 5 5  5 5 5 5  5 % 5* 5/ 5,4 539 5@> 5HC 5ZH 5fM 5vR 5W 5\ 5a 5f 5k 5p 5u 5z 5 5 5 5 5 5  5  5  5$  5+  57  5A  5L  5[  5j  5s  5  5  5  5  5  5  5  5  5  5  5  5  5  5  5  5&  53  5= $ 5F ) 5S . 5Y 3 5b 8 5q = 5 B 5 G 5 L 5 Q 5 V 5 [ 5 ` 5 e 5 j 5 o 5 t 5 y 5 ~ 5  5  5  5  5(  54  5@  5I  5U  5f  5n  5x  5  5  5  5  5  5  5  5  5  5  5  5  5  5!  5/  59  5E  5R  5c  5s  5~ # 5 ( 5 - 5 2 5 7 5 < 5 A 5 F 5 K 5 P 5 ZmEEFBJ 51 FJ 5X JJ 5a NJ 5q RJ 5 VJ 5 ZJ 5 ^J 5 bJ 5 fJ 5jJ 5nJ 5(rJ 5CvJ 5YJ 5pJ 5xJ 5J 5J 5J 5J 5J 5J 5J 5J 5J 5J 5J 5J 5J 5 J 5J 5!J 5*J 54J 5?J 5JJ 5XJ 5`J 5hJ 5rK 5zK 5 K 5K 5K 5K 5!K 5&K 5+K 50K 55K 5:K 5?K 5&DK 56IK 5FNK 5[SK 5mXK 5v]K 5bK 5gK 5lK 5qK 5vK 5{K 5K 5K 5K 5K 5K 5K 5K 5 K 5K 5 K 5(K 56K 5>K 5JK 5[K 5jK 5uK 5|K 5K 5K 5K 5K 5K 5K 5K 5K 5L 5L 5 L 5L 5L 5L 5 L 5&%L 55*L 5H/L 5X4L 5g9L 5u>L 5CL 5HL 5ML 5RL 5WL 5\L 5aL 5fL 5kL 5pL 5uL 5)zL 59L 5NL 5cL 5jL 5yL 5L 5L 5L 5L 5L 5L 5L 5L 5L 5L 5L 5L 5L 5L 5L 5L 5L 5#L 55L 5AL 5QL 5\M 5cM 5m M 5~M 5M 5M 5M 5$M 5)M 5.M 53M 58M 5=M 5BM 5GM 5LM 5QM 5VM 5[M 5`M 5+eM 5:jM 5AoM 5JtM 5ZyM 5l~M 5vM 5M 5M 5M 5M 5M 5M 5M 5M 5M 5M 5M 5M 5M 5M 5M 5M 5 M 5M 5.M 57M 5DM 5NM 5]M 5bM 5nN 5tN 5} N 5N 5N 5N 5N 5#N 5(N 5-N 52N 57N 5] 5M] 5h] 5~] 5] 5] 5] 5] 5] 5] 5] 5] 5^ 5^ 5 ^ 5 ^ 5^ 5(^ 55^ 5@$^ 5I)^ 5c.^ 5l3^ 58^ 5=^ 5B^ 5G^ 5L^ 5Q^ 5V^ 5[^ 5`^ 5e^ 5j^ 5o^ 5t^ 5y^ 5~^ 5^ 5$^ 52^ 5;^ 5H^ 5T^ 5`^ 5s^ 5^ 5^ 5^ 5^ 5^ 5^ 5^ 5^ 5^ 5 ^ 5^ 5*^ 50^ 58^ 5>^ 5I^ 5Y^ 5f_ 5o_ 5w _ 5}_ 5_ 5_ 5_ 5#_ 5(_ 5-_ 52_ 57_ 5<_ 5A_ 5F_ 5K_ 5 P_ 5U_ 5#Z_ 5+__ 5;d_ 5Ei_ 5Nn_ 5Vs_ 5]x_ 5f}_ 5r_ 5~_ 5_ 5_ 5_ 5_ 5_ 5_ 5_ 5_ 5_ 5_ 5_ 5+_ 54_ 5B_ 5L_ 5[_ 5y_ 5_ 5_ 5_ 5_ 5_ 5_ 5_ 5` 5 ` 5` 5` 5` 5 ` 5"` 5!'` 5+,` 551` 5G6` 5N;` 5V@` 5aE` 5hJ` 5uO` 5T` 5Y` 5^` 5c` 5h` 5m` 5r` 5w` 5|` 5` 5` 5` 5 ` 5` 5%` 5/` 56` 5D` 5K` 5U` 5`` 5o` 5~` 5` 5` 5` 5` 5` 5` 5` 5` 5` 5` 5` 5` 5 a 5 a 5 a 5" a 5( a 5/ a 58 !a 5> &a 5M +a 5_ 0a 5h 5a 5u :a 5 ?a 5 Da 5 Ia 5 Na 5 Sa 5 Xa 5 ]a 5 ba 5 ga 5 la 5 qa 5 va 5 {a 5 a 5!a 5!a 5,!a 5;!a;{ 5!{ 5!{ 5!{ 5!{ 5!{ 5!{ 5 "{ 5("{ 5>"{ 5S"{ 5j"{ 5y"{ 5"{ 5"{ 5"| 5"| 5" | 5"| 5"| 5"| 5"| 5"#| 5#(| 5#-| 5(#2| 52#7| 5=#<| 5H#A| 5V#F| 5^#K| 5f#P| 5p#U| 5x#Z| 5#_| 5#d| 5#i| 5#n| 5#s| 5#x| 5#}| 5#| 5#| 5$| 5$| 5$$| 54$| 5D$| 5Y$| 5k$| 5t$| 5$| 5$| 5$| 5$| 5$| 5$| 5$| 5$| 5$| 5$| 5$| 5$| 5%| 5 %| 5%| 5%| 5'%} 53% } 5D%} 5S%} 5^%} 5e%} 5p%"} 5z%'} 5%,} 5%1} 5%6} 5%;} 5%@} 5%E} 5%J} 5%O} 5%T} 5%Y} 5%^} 5%c} 5&h} 5&m} 5$&r} 54&w} 5C&|} 5Q&} 5a&} 5r&} 5&} 5&} 5&} 5&} 5&} 5&} 5&} 5&} 5&} 5'} 5'} 5*'} 5?'} 5F'} 5U'} 5['} 5h'} 5o'} 5u'} 5'} 5'} 5'} 5'} 5'~ 5'~ 5' ~ 5'~ 5'~ 5'~ 5'!~ 5'&~ 5'+~ 5(0~ 5(5~ 5(:~ 5&(?~ 56(D~ 5A(I~ 5H(N~ 5R(S~ 5c(X~ 5i(]~ 5p(b~ 5{(g~ 5(l~ 5(q~ 5(v~ 5({~ 5(~ 5(~ 5(~ 5(~ 5(~ 5(~ 5(~ 5(~ 5(~ 5 )~ 5)~ 5()~ 5/)~ 58)~ 5H)~ 5Z)~ 5a)~ 5k)~ 5v)~ 5)~ 5)~ 5)~ 5)~ 5)~ 5)~ 5)~ 5) 5) 5)  5) 5) 5) 5)  5*% 5** 5*/ 5'*4 50*9 5=*> 5G*C 5V*H 5[*M 5g*R 5m*W 5v*\ 5~*a 5*f 5*k 5*p 5*u 5*z 5* 5* 5* 5* 5*PLW 5<+[ 5c+_ 5l+c 5|+g 5+k 5+o 5+s 5+w 5+{ 5+ 5, 50, 5G, 5M, 5S, 5X, 5^, 5o, 5z, 5, 5, 5, 5,Ň 5,ʇ 5,χ 5,ԇ 5,ه 5,އ 5, 5, 5 - 5- 5%- 51- 5A- 5S- 5c- 5s- 5- 5- 5- 5-$ 5-) 5-. 5-3 5-8 5-= 5-B 5.G 5.L 5.Q 5.V 5*.[ 52.` 5:.e 5H.j 5P.o 5\.t 5m.y 5|.~ 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5 /Ĉ 5/Ɉ 5/Έ 5+/ӈ 5:/؈ 5M/݈ 5]/ 5l/ 5z/ 5/ 5/ 5/ 5/ 5/ 5/ 5/ 5/ 5/ 50 50# 5-0( 5B0- 5W02 5^07 5m0< 5s0A 50F 50K 50P 50U 50Z 50_ 50d 50i 50n 50s 50x 50} 50 50 51 51 51 5(1 541 5D1 5O1 5V1 5`1 5q1 5w1 5~1É 51ȉ 51͉ 51҉ 51׉ 51܉ 51 51 51 51 51 51 51 52 52 5$2 5+2 542 5D2 5V2" 5]2' 5g2, 5r21 5|26 52; 52@ 52E 52J 52O 52T 52Y 52^ 52c 52h 52m 52r 52w 52| 53 53 5"3 513 563 5B3 5H3 5Q3 5Y3 5b3 5m3 5x3 53 53Š 53̊R. 53Í 53Ǎ 54ˍ 54ύ 504Ӎ 5F4׍ 5[4ۍ 5r4ߍ 54 54 54 54 54 54 54 54 55 55 55 5+5 535# 5;5( 5C5- 5U52 5e57 5u5< 55A 55F 55K 55P 55U 55Z 55_ 55d 55i 55n 56s 56x 5(6} 566 5>6 5F6 5R6 5\6 5l6 5y6 56 56 56 56 56 56 56Î 56Ȏ 56͎ 56Ҏ 56׎ 57܎ 5 7 57 5$7 527 5:7 5F7 5R7 5X7 5f7 5u7 57 57 57 57" 57' 57, 571 576 57; 58@ 58E 5 8J 5/8O 5M8T 5X8Y 5h8^ 5}8c 58h 58m 58r 58w 58| 58 58 58 58 58 58 58 59 5 9 59 5"9 5)9 509 5=9 5E9Ǐ 5M9̏ 5V9я 5h9֏ 5z9ۏ 59 59 59 59 59 59 59 59 59 59 59 59 5: 5:! 5:& 5:+ 5$:0 5.:5 58:: 5B:? 5K:D 5S:I 5Z:N 5e:S 5r:X 5:] 5:b 5:g 5:l 5:q 5:v 5:{ 5: 5: 5: 5: 5: 5 ; 5; 5; 5(; 52; 5:; 5C; 5M; 5S; 5_;Ɛ 5e;ː 5n;А 5t;Ր 5{;ڐ 5;ߐ 5; 5; 5; 5; 5; 5; 5; 5; 5; 5; 5; 5; 5 < 5<% 5</U 5`< 5< 5< 5< 5< 5< 5<# 5=' 5=+ 51=/ 5@=3 5[=7 5q=B 5=G 5=L 5=Q 5=V 5=[ 5=` 5=e 5=j 5=o 5=t 5=y 5>~ 5 > 5"> 56> 5=> 5F> 5Q> 5\> 5j> 5r> 5z> 5> 5> 5> 5>ĕ 5>ɕ 5>Ε 5>ӕ 5>ؕ 5>ݕ 5> 5> 5? 5? 5$? 56? 5F? 5V? 5k? 5}? 5? 5? 5? 5?# 5?( 5?- 5?2 5?7 5?< 5?A 5?F 5@K 5@P 5@U 5+@Z 58@_ 5A@d 5I@i 5R@n 5]@s 5e@x 5m@} 5x@ 5@ 5@ 5@ 5@ 5@ 5@ 5@ 5@ 5@ 5@ 5@ 5A 5AÖ 5AȖ 5)A͖ 5:AҖ 5CAז 5IAܖ 5VA 5`A 5nA 5vA 5A 5A 5A 5A 5A 5A 5A 5A 5A 5A" 5A' 5B, 5B1 5!B6 51B; 5BB@ 5MBE 5ZBJ 5bBO 5kBT 5yBY 5B^ 5Bc 5Bh 5Bm 5Br 5Bw 5B| 5B 5C 5 C 5C 5C 5"C 5+C 57C 5EC 5NC 5[C 5eC 5oC 5uC— 5CǗ 5C̗ 5Cї 5C֗ 5Cۗ 5C 5C 5C 5C 5C 5C 5D 5 D 5D 5#D 5*D 55D 5:D 5GD! 5OD& 5XD+ 5cD0 5rD5 5|D: 5D? 5DD 5DI 5DN 5DS 5DX 5D] 5Db 5Dg 5Dl 5Dq 5Ev 5E{ 5E 5"E 5+E 55E 5AE 5GE 5SE 5fE 5rE 5|E 5E 5E 5E 5E 5EƘ 5E˘ 5EИ 5E՘ 5Eژ 5Eߘ 5E 5E 5E 5F 5F 5F 5!F 5-F 53F 5 5FC 5FH 5FM 5FR 5FW 5F\ 5 Ga 5Gf 5'Gk 50Gp 5;Gu 5PGz 5_G 5nG 5}GY 5G 5G 5G 5H 5+HĪ 5;HȪ 5QH̪ 5lHЪ 5HԪ 5Hت 5Hܪ 5H 5H 5H 5H 5 I 5'I 50I 55I 5@I 5SI 5]I 5nI 5{I" 5I' 5I, 5I1 5I6 5I; 5I@ 5IE 5IJ 5IO 5IT 5IY 5I^ 5Jc 5 Jh 5Jm 5,Jr 5LS 5DLX 5RL] 5aLb 5tLg 5Ll 5Lq 5Lv 5L{ 5L 5L 5L 5L 5L 5M 5 M 5M 59M 5DM 5TM 5iM 5~M 5M 5MƬ 5Mˬ 5MЬ 5Mլ 5Mڬ 5M߬ 5M 5M 5M 5M 5M 5M 5N 5N 5N 5!N 5(N 55N 5=N 5ON% 5[N* 5kN/ 5vN4 5}N9 5N> 5NC 5NH 5NM 5NR 5NW 5N\ 5Na 5Nf 5Nk 5Np 5Nu 5 Oz 5O 5O 5(O 57O 5FO 5MO 5VO 5fO 5xO 5O 5O 5O 5O 5O 5Oŭ 5Oʭ 5Oϭ 5Oԭ 5O٭ 5Oޭ 5O 5O 5O 5P 5P 5P 5P 5%P 57P 5@P 5JP 5YP 5^P 5jP$ 5pP) 5yP. 5P3 5P8 5P= 5PB 5PG 5PL 5PQ 5PV 5P[ 5P` 5Pe 5Qj 5Qtjy 5SQ} 5zQ 5Q 5Q 5Q 5Q 5Q 5Q 5R 5$R 5;R 5JR 5eR 5{R 5R 5R 5R 5R 5R 5R 5R 5R 5R 5R 5R 5S 5#S 5+S 58S 5BS 5LS 5VS 5aS 5lS 5zS! 5S& 5S+ 5S0 5S5 5S: 5S? 5SD 5SI 5SN 5SS 5SX 5T] 5Tb 5&Tg 56Tl 5HTq 5XTv 5hT{ 5}T 5T 5T 5T 5T 5T 5T 5T 5T 5T 5T 5U 5 U 5U 5U 5%U 5-U 55U 5CU 5KU 5WU 5hU 5wU 5U 5U 5U 5U 5U 5U 5U 5U 5U 5U 5U% 5U* 5U/ 5V4 5V9 5V> 5&VC 55VH 5HVM 5XVR 5gVW 5uV\ 5Va 5Vf 5Vk 5Vp 5Vu 5Vz 5V 5V 5V 5 W 5W 5(W 5=W 5RW 5YW 5hW 5nW 5{W 5W 5W 5W 5W 5W 5W 5W 5W 5W 5W 5W 5W 5W 5W 5 X 5X 5#X 5/X 5?X 5JX 5QX 5[X$ 5lX) 5rX. 5yX3 5X8 5X= 5XB 5XG 5XL 5XQ 5XV 5X[ 5X` 5Xe 5Xj 5Xo 5Yt 5Yy 5Y~ 5&Y 5/Y 5?Y 5QY 5XY 5bY 5mY 5wY 5Y 5Y 5Y 5Y 5Y 5Y 5Y 5Y 5Y 5Y 5Y 5Y 5Y 5Y 5Y 5Z 5Z 5&Z 50Z 5?Z 5DZ 5PZ 5VZ 5_Z 5gZ# 5pZ( 5{Z- 5Z2 5Z7 5Z< 5ZA 5ZF 5ZK 5ZP 5ZZ{ 5.[ 5U[ 5^[ 5n[ 5[ 5[ 5[ 5[ 5[ 5\ 5\ 5%\ 5@\ 5V\( 5m\- 5u\2 5}\7 5\< 5\A 5\F 5\K 5\P 5\U 5\Z 5\_ 5\d 5\i 5 ]n 5$]s 5-]x 53]} 5=] 5Q] 5g] 5l] 5w] 5] 5] 5] 5] 5] 5] 5] 5] 5] 5] 5] 5^ 5 ^ 5^ 5^ 5#^ 5+^ 58^ 5A^ 5I^ 5S^ 5]^ 5h^ 5q^ 5~^ 5^ 5^ 5^" 5^' 5^, 5^1 5^6 5^; 5^@ 5^E 5^J 5_O 5_T 5'_Y 57_^ 5H_c 5T_h 5d_m 5v_r 5_w 5_| 5_ 5_ 5_ 5_ 5_ 5_ 5_ 5_ 5` 5 ` 5` 5(` 55` 5>` 5E` 5O` 5W` 5`` 5k` 5s` 5{` 5` 5` 5` 5` 5` 5` 5` 5` 5` 5` 5` 5 a! 5a& 5a+ 5"a0 5+a5 55a: 5Aa? 5MaD 5YaI 5_aN 5maS 5|aX 5a] 5ab 5ag 5al 5aq 5av 5a{ 5a 5b 5b 5b 5%b 5/b 5>b 5Ob 5mb 5xb 5b 5b 5b 5b 5b 5b 5b 5b 5b 5b 5b 5c 5c 5c 5$c 5.c 5@c 5Gc 5Oc 5Zc 5ac 5nc 5vc 5c% 5c* 5c/ 5c4 5c9 5c> 5cC 5cH 5cM 5cR 5cW 5d\ 5da 5df 5"dk 5+dp 59du 5@dz 5Ld 5Vd 5ad 5pd 5d 5d 5d 5d 5d 5d 5d 5d 5d 5d 5d 5d 5d 5e 5 e 5e 5 e 5)e 5/e 56e 5?e 5Ee 5Te 5fe 5oe 5|e 5e 5e 5e 5e$ 5e) 5e. 5e3 5e8 5e= 5eB 5eG 5eL 5fQ 5fV 5!f[ 5*f` 56fe 5Gfj 5Sfo 5Yft 5cfy 5pf~ 5}f 5f 5f 5f 5f 5f 5f 5fHL 5-gL 5TgL 5]g L 5tg$L 5g(L 5g,L 5g0L 5g4L 5g8L 5ghOL 5UhTL 5]hYL 5eh^L 5{hcL 5hhL 5hmL 5hrL 5hwL 5h|L 5hL 5hL 5hL 5hL 5hL 5hL 5iL 5iL 5iL 5!iL 5;iL 5DiL 5OiL 5ZiL 5hiL 5piL 5xiL 5iL 5iL 5iL 5iL 5iL 5iL 5iL 5iL 5iL 5iM 5iM 5i M 5 jM 5jM 5$jM 50j!M 5@j&M 5Rj+M 5bj0M 5rj5M 5j:M 5j?M 5jDM 5jIM 5jNM 5jSM 5jXM 5j]M 5jbM 5jgM 5jlM 5 kqM 5kvM 5k{M 5%kM 50kM 58kM 5@kM 5NkM 5VkM 5bkM 5skM 5kM 5kM 5kM 5kM 5kM 5kM 5kM 5kM 5kM 5kM 5kM 5kM 5kM 5lM 5lM 5lM 5(lM 5.lM 5N 5lCN 5mHN 5#mMN 5.mRN 5>mWN 5Sm\N 5hmaN 5omfN 5~mkN 5mpN 5muN 5mzN 5mN 5mN 5mN 5mN 5mN 5mN 5mN 5mN 5mN 5mN 5nN 5 nN 5nN 5nN 5'nN 59nN 5EnN 5UnN 5`nN 5gnN 5qnN 5nN 5nN 5nN 5nN 5nN 5nO 5nO 5n O 5nO 5nO 5nO 5nO 5n$O 5o)O 5o.O 5!o3O 50o8O 57o=O 5@oBO 5PoGO 5boLO 5loQO 5woVO 5o[O 5o`O 5oeO 5ojO 5ooO 5otO 5oyO 5o~O 5oO 5oO 5oO 5oO 5oO 5oO 5oO 5pO 5pO 5#pO 5-pO 5c 51wCc 57wHc 5@wMc 5LwRc 5UwWc 5_w\c 5iwac 5{wfc 5wkc 5wpc 5wuc 5wzc 5wc 5wc 5wc 5wc 5wc 5wc 5wc 5wc 5 xc 5xc 5xc 5$xc 51xc 5:xc 5Exc 5Rxc 5axc 5kxc 5rxc 5xc 5xc 5xc 5xc 5xc 5xc 5xc 5xd 5xd 5x d 5xd 5yd 5 yd 5yd 5y$d 5&y)d 5,y.d 58y3d 5By8d 5Ky=d 5XyBd 5ayGd 5gyLd 5nyQd 5wyVd 5}y[d 5y`d 5yed 5yjd 5yod 5ytd 5yyd 5y~d 5yd 5yd 5yd 5yd 5yd 5zd 5zd 5zd 50zd 59zdPk`Om 5zSm 5zWm 5z[m 5z_m 5zcm 5{gm 5{km 5,{om 5C{sm 5R{wm 5m{{m 5{m 5{m 5{m 5{m 5{m 5{m 5{m 5{m 5{m 5|m 5|m 5|m 5|m 5(|m 53|m 5A|m 5I|m 5Q|m 5Y|m 5m|m 5w|m 5||m 5|m 5|m 5|m 5|n 5|n 5| n 5|n 5|n 5|n 5|!n 5}&n 5}+n 5#}0n 53}5n 5H}:n 5Z}?n 5c}Dn 5s}In 5}Nn 5}Sn 5}Xn 5}]n 5}bn 5}gn 5}ln 5}qn 5}vn 5}{n 5}n 5}n 5}n 5 ~n 5~n 5~n 5'~n 5/~n 5;~n 5L~n 5[~n 5b~n 5m~n 5w~n 5~n 5~n 5~n 5~n 5~n 5~n 5~n 5~n 5~n 5~n 5~n 5~n 5o 5o 5 o 5$o 57o 5Go 5V o 5d%o 5t*o 5/o 54o 59o 5>o 5Co 5Ho 5Mo 5Ro 5Wo 5\o 5ao 5,fo 5Ako 5Hpo 5Wuo 5]zo 5jo 5qo 5wo 5o 5o 5o 5o 5o 5o 5o 5ʀo 5рo 5ـo 5o 5o 5o 5o 5o 5o 5.o 59o 5@o 5Jo 5[o 5ao 5ho 5sp 5p 5 p 5p 5p 5p 5p 5$p 5ρ)p 5ց.p 53p 58p 5=p 5 Bp 5Gp 5Lp 5)Qp 5;Vp 5E[p 5P`p 5Zep 5bjp 5kop 5utp 5{yp 5~p 5p 5p 5p 5p 5p 5p 5Ƃp 5̂p 5ۂp 5p 5p 5p 5p 5p 5 p 5&p 5/p 57p 5@p 5Kp 5Vp 5ap 5lp 5p 5q v w 5Ѓ w 5w 5w 5w 5'w 5D!w 5Z%w 5o)w 5-w 51w 55w 5΄9w 5݄=w 5Hw 5Mw 5Rw 5!Ww 5'\w 54aw 5Afw 5Jkw 5Opw 5iuw 5szw 5|w 5w 5w 5w 5w 5w 5w 5w 5w 5w 5ͅw 5ׅw 5w 5w 5w 5 w 5w 5!w 5,w 5Bw 5Yw 5bw 5mw 5xw 5w 5w 5x 5x 5 x 5x 5Ɔx 5ӆx 5߆x 5$x 5)x 5.x 53x 5%8x 55=x 5GBx 5WGx 5gLx 5|Qx 5Vx 5[x 5`x 5ex 5jx 5ɇox 5҇tx 5އyx 5~x 5x 5x 5x 5x 5x 5'x 5/x 58x 5Cx 5Kx 5Sx 5ax 5ix 5ux 5x 5x 5x 5x 5x 5x 5Ljx 5Ոx 5݈x 5x 5x 5y 5y 5 y 5y 5"y 5.y 5:y 5F#y 5L(y 5Z-y 5i2y 5|7y 5 5C 5H 5ȏM 5ߏR 5W 5\ 5a 5f 5k 5)p 52u 5Lz 5R 5W 5e 5p 5{ 5 5 5 5 5 5 5 5 5ѐ 5œ 5ʓ 5ϓ 5ԓ 5!ٓ 5.ޓ 5> 5L 5` 5n 5| 5 5 5 5  5‘ 5Α 5֑ 5ޑ 5$ 5) 5 . 53 5$8 54= 5=B 5IG 5RL 5ZQ 5eV 5o[ 5w` 5e 5j 5o 5t 5y 5~ 5Œ 5͒ 5Ւ 5 5 5 5 5 5  5) 56 5A 5I 5WĔ 5`ɔ 5fΔ 5sӔ 5}ؔ 5ݔ 5 5 5 5 5 5œ 5ϓ 5ۓ 5  5 5 5 5 5*# 59( 5G- 5W2 5h7 5s< 5A 5F 5K 5P 5U 5Z 5֔_ 5d 5i 5n 5s 5"x 5(} 5/ 59 5B 5H 5Q 5] 5k 5t 5 5 5 5 5 5Õ 5ȕ 5Ǖ͕ 5ԕҕ 5ەו 5ܕ 5 5 5 5! 5( 52 5C 5I 5P  5[ 5h 5p 5{ 5" 5' 5, 51 56 5; 5Ö@ 5ҖE 5J 5O 5T 5Y 5^ 5c 5(h 52m 5:r 5Cw 5O| 5b 5n 5{ 5 5 5 5 5 5 5 5ŗ 5̗ 5՗ 5ۗ– 5ǖ 5̖ 5і 5 ֖ 5ۖ 5% 5* 56 5< 5E 5M 5V 5b 5n 5w  5 5 5 5! 5& 5Θ+ 50 55 5: 5? 5D 5I 5'N 52S 5=X 5H] 5Rb 5[g 5jl 5q 5v 5 5 5  5 5/ 5E 5Zľ 5jȾ 5̾ 5о 5Ծ 5š߾ 5ؚ 5 5 5 5 5 5 5! 5.  53 5< 5B 5I  5R% 5^* 5q/ 54 59 5> 5C 5H 5M 5ɛR 5ۛW 5\ 5a 5f 5k 5-p 56u 5Fz 5T 5Z 5n 5| 5 5 5 5 5 5 5 5͜ 5֜ 5 5ſ 5ʿ 5Ͽ 5 Կ 5ٿ 5-޿ 5; 5I 5X 5k 5{ 5 5 5 5  5ʝ 5՝ 5 5 5$ 5) 5. 503 5;8 5K= 5`B 5uG 5|L 5Q 5V 5[ 5` 5e 5j 5Ğo 5Оt 5ٞy 5~ 5 5 5 5 5 5 5( 55 5= 5E 5W 5c 5s 5~ 5 5 5 5 5 5 5 5Ɵ 5ϟ 5ٟ 5 5 5 5  5 5 5 5- 57# 5>( 5L- 5S2 5]7 5h< 5wA 5F 5K 5P 5U 5Z 5_ 5 d 5̠i 5Ԡn 5ݠs 5x 5} 5 5 5 5 5# 55 5> 5 5 5 5ӡ 5 5 5 5% 5; 5K 5V 5^ 5i 5s 5~  5 5 5 5 5$ 5) 5. 5Ϣ3 5֢8 5= 5B 5G 5L 5Q 5V 5 [ 5 3 \ 3`pt 3x 3 3 3`  3T 3Xl 3p 3p 3  3< 3@Pt 3x 3  3P< 3@ 3  3  3 D 3H  3  3D 3H 3 3 3L 3P 3p 3 4 38 3 3 3 30, 30PD 3Hpt 3x 3 3P 3< 3@ T 3X  3 ` 3  3  3 P 3  3 L 3P `d 3h  3  3 p 3  3 0 3 P4 38 pt 3x 0! 3 " 3 " 3  #l 3p  3 `$ 3  3 %D 3H l 3p & 3  3  0L 3P 3p1 3p1 3p1 3p2 3pT 38X;l 38p; 38; 38< 38@< 38p< 38<4 388=t 38x > 38P> 38> 38?L 38PAd 38hB| 38B 38F$ 38( I 38PK 38K 38K 38L 3PL\ 3`PO 3Q  3Rl 3p 3U 3W 30X, 30T 3X`X 3 Y 3Y  3Y$ 3(Z< 3@0Z 3[, 30] 3@_ 30` 3Pa 3c< 3@eT 3Xe 30g 3g< 3@i 3xj 3xl  3x`mt 3xx 3x p 3xpp4 3x8u 3xy 3x {4 38{ 3P  3l 3p 3p$ 3(L 3Pt 3xp 3 30 3  $ 3( `T 3X l 3p P 3 P4! 38!@l! 3p!Д! 3!! 3! " 3 "d" 3h" " 3"<# 3@## 3# $ 3$з4$ 38$@$ 3$@$ 3$P4% 38%% 3%% 3%% 3&,& 30&& 3&&p& 3&&& 3&&,' 3&0'D' 3&H'pl' 3&p'' 3&'' 3&' ( 3&(T( 3&X( ( 3&(( 3&(( 3&() 3& ) L) 30)P)P) 30))) 30))p4* 30)8*`|* 3`** * 3`*** 3`**,+ 3`*0+ t+ 3X+x++ 3X++P, 3X+,t, 3X+x,, 3X+,, 3X+,0$- 3X+(-T- 38-X-|- 38--0- 38--p- 38--@L. 38-P.. 38-.. 38-.`/ 38- /d/ 38-h/@/ 38-/0/ 38-0 T0 38-X00 38-01 38-1d1 38-h11 38-1P1 38-1L2 38-P22 38-243 38-830pCppHH Icc* U9["4Hb8888y<=G T=f=v==P""""4M\q0!T!T!0!0!0!0!%0!70!I0![q!uv!q!q!q!q!q!q!q!q!!-!<!L![!o!""" "%Bh`$$$$k"-]& O &  * 1 ('G u * z 'Y V ' V2 ' V '& V '?V'.(6)6)6)$66)CUH)m>)y)))))))) )),)F{)p{)))O-)'7)H,d,,,,,-%-VU-hU-yU-U-U--U-U-)$I)W.eS.s+C+C ,<,CB,'g,<CQ$,hC<,C$,$,$,$,*(*9#*H*Z*l*|*+O+CV+U//C./:CK/WCh/vC/C//C++. .E [j```` %@[vppEd[B0[TBfBwBBBBBB`5M\mF F F %A%%% 3%%IX%m-%|%-%P% P%%%4&8b%DY&S|%b%q%% 0 0  0( A  0p  0  g0!!w0I!`!0!!0!!0!!0"%"0<"0R"0"0""0""#07##0##0#*$0C$Z$0o$$0$$0%-%0D%T%g0c%1|%%%&PC&tl&t&y&y&y&P&P'H'd's'z'|''P'P'P'P(P)(TB(TQ(Ta(Ts(T(T(T(T(T(T(T(T)T)T1)0L)0g)0)0)0)4)4)4)4*4*4**4:*4L*4e*4t*4*4*4*4***+*+9+I+[+t+++ + + ., c, ,1 , , , , 0, , -> - 1-h--- .G.~...#/]/////00 00)080G0V0e0 t0 0P0P0P'1P\1111/2Y2s22222 0F2233 3/3WD3 t3 3 3 4 Q4T4T4T4T"5TN5Tx55r55o5g5 06g6g!6g06gA6rP6_6&x666/7o7778%08M8q8|8 0888868n888 99,9;9K9Z9q9P9P9x :x;:xl::::: 0 :::: ;;1);<8;Q;p;p;p<pG<<<<==w=====>'> 03> 0@>b>>>>>>>p>p?p'?p8?pI?pZ?pi?pz?p???@/@]@@@ @@@ @ 0@ @ A8AoAAA B9BpBBBC+C.:CLCfC~CC 0OCCCCCC D KD D D!D! E! 0+ 0u 0 0 0 0 0N 0N 0A 0AuRR "RSnS SS]SƞSRSLo]SɟpSS#2STS|S]SS֠S.?S\S~SǡSS*CSfy6T Tɢ T T* TCXTm|DTDTDTDTDTͣZU Y 2Y8`XpXXXͤ0X0X+UUUU0U]U4VUU3UKUa,Vp,V,VVVƧVWWW1WqWWWMWWĩWWW9){ AyyCyy'yrxyyy1y@zOxy`zvzzzzzuAuuuv vQSvvv.v.vewwrwwwwwwww$w4_vC_vRvavqww w w"w"w w+ w?"wN"w]w{w;x;xxx*x9xV`m`mlm om^omomomnwnnm@nnnboboo oo+o<oModouommnn[nsnnnnnnnmm nnnn%n4nEnannnnnn!n1o@oQokoooooo oo.o?oNo_ooopppp=qr=qp q=qo=q=q=qM=qq?sn_qsqTsAqAqq_qqVqqUqc 0 o 0 { 0 0 0 0 0 0 0 q 01 01  01  01  01 & 01 2 01 > 01 J 01 YqqqjrrrrArq srrsss0sLsfsuss:s:s_t_t_tut#s4sWsssxrtt p p p/=pG-p]-pq-p-pjjj2jZjjjj^ kk k k k kk9kMkkkkkkkkklWlWl:klllNllll! 0 e 0c 4 0 x 0 0j 0j  0j  0q" M 0j P 4w`w0Nn%%%%%%/ 0L_ % 0L_ ./@/X=gBw=U 0!_  0!_ /ETcs):`Km% % 7 D T c r       0wg     ( 3  0Lg J   % (L (  @o ( ]  ' D b  r         &7Jm|@ӵ׵@@V@>@@@Nɸiɸɸwɸɸɸ1ݺs ( 0q 1@O^ wEEE M2ɻDMQɻaٻqٻٻٻٻٻRRR,=uX׼f 0r r 0r ~ 0r  0r  0r  0r  0r ׼׼q׼׼G   ("q#"L"{"#׼/#A#V#>q#L#P#Z##Z# $$+$;$J$Z$i$ƾx$$$$$$$$$%%ѽ7%νG%νW%νg%x%%%%%%%%%J&J &J1&{H&t&ſ&ֿ&&''.'>'M']'l'|'''<'<'<'<'<'<'< (<(I)(I9(IH(IX(Ii(N(N(N(N(N(N(N(o(o)o)o()=)L)*])*o)*)*)ɸ)ɸ))θ)θ)θ)θ*θ*θ&*K*~****#*#+#+#)+#;+#M+Rk+k+t+x+x++ع++ N,Bz,F,{-ڣ.#*.&=.#M.#\.#l.#{.#.#.3.3.S.S.S.S.S/F/ 0 (/ 0 4/ 0 A/Fe/F/Y/F/F0F"0F20H0bm0f0p030p030D0D0D 1D1D,1D;1TL1g1v111111111222-2<2K2[2j2z2222ڣ2 0 2 0 2 0 2 0 2233$333C3R3b3q3333333333 44-4i;4 0 G4 0 S4 0 `4i4i44i4i5i!5i15E5_5y55i55i5w5w5w5w5w6w696ѤT6Ѥc6s6666667H7777777 88*8;8S8Сb8Сs8С8С8С8С8С8ס8N8N8N8N9N9N29N>9UM9\9k9|9999 9A9Д:ДD:I:N:i ;i;;;><l<<=:=f==͘>;>>f>f?-?o???ʙ? @.@=@L@]@t@@@@@AΙAΙA43AKAVAAAAAA BB-B)CBHqBBBBBBCC!C1CACQCaCpCCCCmCuC|E%E|IE|YE|dE 0 mE||E|EE 0 E 0 EEE 0 E 0 EE 0 FF$F3F>F 0 GFVFgF;F;F;FJFJFJFJFlF 0 FqGq$Gq5GMG\GkGGGG 0 G 0 G 0 H 0 H 0 "H 0 -HMHHI)IJI˗IӗII-I1J;?JQJ;^JnJ~JJJJJJ"JCJd!KdDKheKr}K?KrK?KLKLKLKLKLKL L\#Lz6LwFLwVLwfLwLLDL͘L͘L͘LܘLܘLܘMܘM?MiM#MlM#MlMzMzMzMzMzMzN'N+:N]N~NNVNNVNbNbNbNbObOb"Oq1O0@OJOOJ^OJmOJ}OOOOOOO P P&@0P&@EP&\P&@lPP P P$P P P P Q $Q;4QTGQ;vQ;Q;Q;Q;QaQaRaRa$RVGRVjRZRbRRbRR&R&R&S&S& S&/S5@SgYSkSgxSSiSiSiS0S0T/TYTqkTTqTqTqTqTqTTT U#U2UCUYUjUUUUU=V=,V=RVDVWUpWPXzYeYHVZUZcZc[r3[rS[rr[[[[[\ \ת\6\E\\\m\\\\\\\\\+]Z]i]%z]=]=]D]D]D]D]D]D]D^D^D"^D1^=F^v^^{^{^{ _/_A_S_k_|____[_[_˫/`˫`֫`֫a֫aaHbH>b^bjbtIcccdJddd&@dde-e>eVeeezee e%e f1-f1Bf&@Uf&@jf&f&@f f1ffífʭgí gí:gíRgcgxgggEgEgEgEgU hU#hE5hrNh}|hhhh,iNiiۮiiiijj{Yjqjdjjjjk3"k/k3?k@Ok@^k@nk@}k@k@kOkįkkįkkɯlɯlɯ-lNl]lnlճlճlճlճlllmPmqmmwmmwm~m~m~m~m~ n~n3nDnUnfn^unXnnno7oVo}oo(oooooo pp+p:pJpYpߨhpߨwpߨpߨpߨpߨpߨpߨpߨpq6qGqJXq(nqJ~qJqJqJqJqJq@qM rUr-r>r_rrfr3r<sz%szFs`sz~szssssstt 1tVt{tttt&@t&@t&u&@u.uSu}uuuuuu vv0vVvpvvvvvwww/w>wNw]wmww6w6w6w^w6x^xf"xf1xfAxfPxf`xfqxrxxxxxxxxyy#y3yByRyaypyyyyyyyP zP*zf\zfzPz#{D{a{s{{{{{{{{{ { ||+|;|J|Z|i|x||||ǒ|ǒ|Ԓ|Ԓ|Ԓ|c}<%}&@8}&@M}&c}}}}.}Ď}.}`}}(~ґ7~vH~^~m~x~.~~.~.~~~~- '2,|>B\\\BBB:BKBfB_Ā  JZn Ձ;N'N6_Idsus s`sÂu؂&@&@& !)0-?4O-_<o<~<<<<΃P0PPɄfPf*˓I˓ayDžޅߓ 1Wз~зз†ззз зз*з:зIзYзhзxзÇӇ.Jlӈ. =do.$|=.$_.$.$ĉω"މ&=L[ju""NJ֊"pp*7pBOpZi.$‹)@O^i.$x.$Č+ӌ+ތ"22"2!202;"H2Y2v̍-EWdtŽюW W):K\-kDz   *,\KlT}888͐8y?`KK5OVW}W˒ے Y2kDYQka[r[[Г 5.@Vl\ߔ.( I)p   ̕ !!0!F\i\˖.0ߖ.@ .0.@3X?n)}?W&Ǘٗ.0 .@)9JeȘ/[b|ə FVxixÚ.\Кۚ.\C.\7 .\[#.\>pppApݜQ|F͝ݝ.\.\ A.\%F0.\=`H.\Y|Ҟ,>N`p{.\.\xɟ.H՟e.\.\.\>l'ݠ r!١! ::.9.xFQ.x^i.xv.x.x  H  ԣ-3rQnrrrrrȤrܤrrr6LW.xdo.xHj5.xɥ_ԥ.x.x3 0Ew 0mE٩ 0L 0L 0Jaĸ 0Jaи 0Ja 0Ja 0Ja 0Ja 0Ja 0Ja?"e"""""Z" - =M]ym }dd1".2BTU\exnn   6 3 I [J k D  5 _  **:P`s4 44,4<4LT\ToTTTy8$6FVfy{F 9!]!! ! !3!C0#Y[#kj#n#w###)`$% P%.P%Cb%U&`l'V~(~(~({)AQ,c,v,,,U-))  +$ C/ +E *W *g O+} / C / C / C / C + +  0  0) 0< 0K V 0` k v     1 2 2  $3  $34 ? $3Q $3c )3  -3 3 4 4 44 a55 f5E 5U 5e 6{ 6 6 6 t7  t7 7  7  #8 * 084 ? K8O ;9a ;9x j9 9 : p1 RCSSSS#.S>ISXcSuRUU'VVVW kX!kX4U?jk kkmmnnndn&n6boFoYorooo-p q4qAqAq0qrrs_tetririr%t8 wK wj ww;xxyzjq'uqj#6 F VfyUԒf{{)aDa`aa/ $6H ]|p;q˗ -#;5;GCWdndrr͘##/AJQJas  VVbbg g i1 iA T n ~  ͢  ͢  F F!F!P(!bD!pV!ph!{!!!!!!ڣ!! " "0"iK"i`"iu"w"""""""Ԥ#Ԥ#Ԥ #30#C#2S#2c#2s#v#{####Ҭ#˫/$/D$Hz$$$$$$%% % 0%1@%1P%`%s%%}%%%%&d,&>&U&l&~&&į&į&&&& ''/'?'KT'j'''''D'D' '(/(B(X(n(((@(((((()).)6>)6N)6^)n)~))U)U)U)θ)**$*t4*D*Dy*D***7*7+7*+E<+MR+Mb+Rt+++(+L+Z,Z,+,ƽC,ƽS,Je,nu,,ſ,,,N,,{--*-<-/L-U\-{-----`---; .;.B+.;.K.[.k.{.....z.z..//./>/}N/^/n/~/y/y////// 00K.0KC0WS0Wc0Ys0Y0800000011(181J1]1`p11111`11p1e11} 22025@2JP2`2222/2R2222@2`35%3M53:E3U3e3u333r333.symtab.strtab.shstrtab.rela.text.rela.static_call.text.rela.exit.text.rela.init.text.rela.text.unlikely.rela.altinstr_replacement.rela.altinstructions.rela.rodata.rela__tracepoints_ptrs.rela__mcount_loc.rodata.str1.8.rodata.str1.1.modinfo__tracepoints_strings.rela.smp_locks.rodata.cst2.rela__param.rela.retpoline_sites.rela.return_sites.rela.call_sites.rela.ibt_endbr_seal.orc_unwind.rela.orc_unwind_ip.note.gnu.property.note.gnu.build-id.note.Linux.orc_header.rela__bug_table.rela__jump_table.rela__patchable_function_entries.codetag.alloc_tags.comment.note.GNU-stack.rela.data.rela.exit.data.rela.init.data.rela.printk_index.data..read_mostly.rela__bpf_raw_tp_map.rela_ftrace_events.rela.ref.data.rela__tracepoints.data..once.rela.static_call_sites.rela.gnu.linkonce.this_module.bss.rela.debug_aranges.rela.debug_info.debug_abbrev.rela.debug_line.rela.debug_frame.debug_str.debug_line_str.rela.debug_loclists.rela.debug_rnglists @@@&\+8&@p'\B @=@'\R`AM@ئ' \b ]@'(\ v q@'0\  8@H'\  @@'h \ @p'\ @'\2`&2 239 ;;@'\&<8<3@`'\EH=X@@'\[= V@'\ n@|i@'n\"J