ELF>pI*@@NMAHAAHBHu^ff.HPHBHtAHP HtHrHD9uD9uʋr8D9u9u1Ht1{yUH8SHHHHXH=uZ@HSHZHtEH{(uHS H9tDtH; uHHtH{ HH1[]DAVHAUATIUSIHH=Hh1I H=HE HtjH@Ht^LR RIIH MD΃HLEHuHARI<HH)HHXHEHhHlLHH[]A\A]A^1@AVHAUATIUSIHH=Hh1AH=tZHE Ht@H@Ht4Bt.HHuHLI<HH)HHHEHhHvLHH[]A\A]A^1AVHAUATIUSIHH=Hh1AH=tZHE Ht@H@Ht4Bt.HHuHLI<HH)HHHEHhHvLHH[]A\A]A^1AWHAVAUATIUS1HL5H$IE1AIV8IcLH)I<AFDJ8HRPEHAFAAAPAFPAFPAIF8H H@H]H9u2fIcDHD@LH)KLHHAH9t6HCAvIcH4$HHH[]A\A]A^A_M6ItAf.AVHAUATIU1SHIHtSA HtBCDCLI<,KH)HAPAAHHHXHvLHH[]A\A]A^fATH(USH8eL$%(Ld$0IH\$D$HD$HHD$HD$ HD$(HD$ID$(H@(HHl$ H|$HHH|$1uHD$0eH+%(u H8[]A\ff.fAVAUAATIHUSIHH=uFfHH=t29Xup9uD9huLHL[]A\A]A^A\$HLHAl$El$HtL%I$I\$L#[L]HA\A]A^fAWAVAUAATAUSӅAAA 9D9H= IHfDDLn1[]A\A]A^A_1ۉDD<uك u[]A\A]A^A_EADHHE1DDAuAu냸yoff.AWAVAUIATUSH0Lg(HeL4%(Lt$(AIl$h(,Hw(H Ht+H@Ht"L8H4H0fAL$pMA|$dIt$pLHEID$p_Ad$p,HT$(eH+%(AH0[]A\A]A^A_IE D4HD0HH8PXG1HH$IHD$_HD$HD$HD$ LHHUHuHttLHID$pIt$pr;HEu,HHA|$d1A|$d1LHID$puff.fAVAAUAATAUSHDDDHHHtt&P x.HHH[]A\A]A^HҾHÐ=Ht@0fDATUSHH_ eH,%(Hl$HL@DHH=tHMtIt$HH{nt9HCHt$HD$C8fT$D$…uzHLHHǃ@HfFHHD$eH+%(u9HH[]A\HHHtAWAVAUATUSHHHH eH,%(Hl$HLl$Lt$ D$Ld$L|$D$MD$ LLD$D$AULL$ZHcD$t<tNMLD$LLHHD$/HcD$<L$T$ t$|$HHHp L@MxDAT$ЃЃ AT$uxE1 EEHcHT$eH+%(CH []A\A]A^A_MMLLHHD$ AT${ED$IL$,HHHAEAAA"MLLHHD$H6MLLHHD$D$ -HL1AK<DI@Ht`C$D$0MtAED9t 1L]K$C$D$0A1ftDHSHft(I9utWu9AB AK<DC$D$0SC$D$0BC<1ft$ND$0DD$0=VAB jLADtI HT$NAB(D$N{< HIH.K<1ff.ff.ff.ff.@HcIHt&frD$S<9rۉLLLL$1LL$NSf1f1HqAD1f.AUATUSHeL$%(Ld$IHЉH u(A1HT$eH+%(uIH[]A\A]HT$LD$A9T$t9t CDLff.AUAՉFATIUSHeH,%(Hl$HIHHHDt3DuHE1HT$eH+%(uiH[]A\A]tPDHDuDtHT$LD$U9T$tD9t E둉LHff.@ATAUHSHeH%(H\$HT$D$uT$1ځt"@tHT$eH+%(uH[]A\DHUHSH3ff3UfC f[]f.UHH=S Ht8HH¾HŅu H[]HHcH[]HfDAWAVIAUAATAUSHHL@eH%(HD$11fD$HH~ LA ft DHAfMAGtAD1 =fE.u AGHT$DHu+T$fD9fCfADHD HT$eH+%(H[]A\A]A^A_fADHA4f4DHM=fE.=1uHfHMAgA dtDHMbAOXHHHHMu,HHHHHHHHHHHHAZfHDHf HHHGHHHf.UHH= S HH‰؃0uHC CE@HC(CEBH-CHtHHHkH]1[]򐐐fSHHCt W<9CtW>9uyCtW@9uiCtWB9uYC 3GD#C$uNHtHHHtHHCHBHHHHH"HC1[HHNH11ff.AUATUS1 ujH/ALLDHHtHH9u$1ff.ff.@HH9t%HXS8D1uLH[]A\A]1ff.@AWAVIAUIATMUHSHLLH11HH9uDff.HH9t.H9huAAEU8 A$HH9u҃HuL[]A\A]A^A_fAUAATUHSHLLHHH9uuff.HH9taH9kuHtHHCHBHHHkHHH"HCLHtGEu[H]A\A]HL9tHHHHH[]A\A][]A\A]ATI  UH=SHtDHHHHHHfHHRHH9uI,$1[]A\f.AWAVIAUATUSHHH|$HD$IHH$M<$ILM9udHIotIIGHAHH"M7LHIGLHLLIHHL9uH$II9zH|$HD$HH[]A\A]A^A_fDAWAVAUATIUSH(F8L/T$~GHL$$GH=I HH>LpMLADt $M1ff.I teLcIMII9tIH@Dt@8tINHPHH697uH9uAV83P8I uM1f.LcIMII9I uI|$(HLHH([]A\A]A^A_H(HI|$(Hf.fHGHHGG8Aff.AWAVAAUAATAUSH/L}LHEH9uRf.HH9t@HXHsHD9'uD9uD9s8uLH[]A\A]A^A_1@AVAUATIUHSHHLkLL3L9t4IFHpHV8HtSH H9t>HHH9t1H9PuM6L9u1LD$D$H[]A\A]A^HBHP8HuHH0.uM6L9sff.@AWAVAUIATUH SHL'H=T$HL$HtyHhMt$HLM|$LHLtI\$L#L{ILHEM8LDD$H0HD$H[]A\A]A^A_H[]A\A]A^A_ff.AWIAVAUATUSHL'T$Ml$LI$L3I91ff.ILM9tOIL9{uHtH;HCHGH8HHHkHH"HCLIM9uLHtJ|$uHH[]A\A]A^A_HHHHHH[]A\A]A^A_H[]A\A]A^A_LUHH=0S Ht.HHxHHH1H[H][]fAWAVIAUATUSHL'H<$M<$IM9udHLIotIIGHAHH"M7LHIGLHLLIHI9uLH$HH[]A\A]A^A_I|$ HHI|$ HHfATIUHSHtI\$L#HkH][]A\HHHHHHHHHHHHHHHHHAV1AUATAUSHeH%(HD$1$T$T$HIH_ fHHHHHuH Hx>IH<HH@HuHI},HfHHHHHHHAąfHHHHAą{ntPHCHt$ HD$C8fT$ D$…ttHHfHHHHHIEHuHHMfHHHH=u HHŅ=t_tV=tMHL$HT$HHŅtHHOT$t$<$Ņu9$AF0fHHHHfF&HAA1LH@HD$eH+%(tHD[]A\A]A^I} HHI} HHeDž,DHHHHHHHHHHHHHHHHHHHHHHHHHHs H{(HH@(H1HHAHHAHHHHHHHAHHAHHHHHHHAHHHHHHH$JHx HH$HHx HH$HHA[D]A\A]A^E1LHLDH=8 HHHHE H1EHEE0=IDHH}HFLHMtHCK8LH0E1HLH(HLHHHHAIEtYHHLEtQHyHLHHH}H=H5HHHHU,HeM(HALHHCIHPHCIHL$LL$ PH|$ L$Kdev_lock6xen_pciback: backend is %s xen_pciback6%s %s: 34%s %s: xen_pcibackxen_pciback: enable xen_pciback: disable xen_pciback: set bus master 4%s %s: 3xen_pcibackset power state to %x xen_pciback7%s %s: &vpci_dev->lock6%s %s: vpci&dev_data->lockpassthrough%02x:%02x.%01x %04x:%04x:%04x:%04x /local/domain/0/backend/pci/%d/0xen_pciback: error %d when start xenbus transaction xen_pciback: error %d when end xenbus transaction xen_pciback: initializing config xen_pciback: MSI-X preparation failed (%d) xen_pciback: save state of device xen_pciback: Could not store PCI conf saved state! xen_pciback: resetting (FLR, D3, etc) the device xen_pciback: Fail to get gsi info! xen_pciback: wants to seize %04x:%02x:%02x.%d 3xen_pciback: Error parsing pci_devs_to_hide at "%s" xen_pciback: error %d initializing device xen_pciback: failed to get pcifront device xen_pciback: aer_op %x dom %x bus %x devfn %x xen_pciback: pcifront aer process not responding! xen_pciback: pcistub_device_release xen_pciback: Could not reload PCI state xen_pciback: MSI-X release failed (%d) xen_pciback: %s fake irq handler: %d->%d xen_pciback: xen_pcibk_error_resume(bus:%x,devfn:%x) xen_pciback: device is not connected or owned by HVM, kill it xen_pciback: guest with no AER driver should have been killed xen_pciback: device is not found/assigned xen_pciback: found device to remove %s xen_pciback: ****** removing device %s while still in-use by domain %d! ****** xen_pciback: ****** driver domain may still access this device's i/o resources! xen_pciback: ****** shutdown driver domain before binding device xen_pciback: ****** to other drivers or domains xen_pciback: xen_pcibk_slot_reset(bus:%x,devfn:%x) xen_pciback: No AER slot_reset service or disconnected! xen_pciback: xen_pcibk_mmio_enabled(bus:%x,devfn:%x) xen_pciback: No AER mmio_enabled service or disconnected! xen_pciback: xen_pcibk_error_detected(bus:%x,devfn:%x) xen_pciback: guest may have no aer driver, kill it xen_pciback: No AER error_detected service or disconnected! xen_pciback: enabling permissive mode configuration space accesses! xen_pciback: permissive mode is potentially unsafe! xen_pciback: removed %04x:%02x:%02x.%d from seize list xen_pciback: can't export pci devices that don't have a normal (0) or bridge (1) header type! xen_pciback: pcistub_device_alloc xen_pciback: deferring initialization drivers/xen/xen-pciback/pci_stub.cremoved %04x:%02x:%02x.%d from seize list wants to seize %04x:%02x:%02x.%d xen_pciback: %s IRQ line is not shared with other domains. Turning ISR off xen_pciback: %s: #%d %s %s%s %s-> %s xen_pciback: %s: failed to install fake IRQ handler for IRQ %d! (rc:%d) xen_pciback: %s: #%d %s %s%s %s xen_pciback: error enabling MSI for guest %u: err %d xen_pciback: error enabling MSI-X for guest %u: err %d! drivers/xen/xen-pciback/pciback_ops.cexporting dom %x bus %x slot %x func %x Couldn't locate PCI device (%04x:%02x:%02x.%d)! perhaps already in-use?Stealing ownership from dom%d. Error reading configuration from frontendversion mismatch (%s/%s) with pcifront - halting xen-pcibackAttaching to frontend resources - gnt_ref=%d evtchn=%u Error mapping other domain page in ours.Error binding event channel to IRQError switching to connected state!Error reading number of devicesError reading device configurationError parsing pci device configurationError switching substate of dev-%d Error while publish PCI root buses for frontendError switching to initialised state!Error while publish PCI rootbuses for frontendremoving dom %x bus %x slot %x func %x Couldn't locate PCI device (%04x:%02x:%02x.%d)! not owned by this domain Error switching to reconfigured state!frontend is gone! unregister device Error allocating xen_pcibk_device structdrivers/xen/xen-pciback/xenbus.cxen-pciback: read %d bytes at 0x%x xen-pciback: read %d bytes at 0x%x = %x xen-pciback: write request %d bytes at 0x%x = %x xen-pciback: Driver tried to write to a read-only configuration space field at offset 0x%x, size %d. This may be harmless, but if you have problems with your device: 1) see permissive attribute in sysfs 2) report problems to the xen-devel mailing list along with details of your device obtained from lspci. xen-pciback: free-ing dynamically allocated virtual configuration space fields xen-pciback: resetting virtual configuration space xen-pciback: free-ing virtual configuration space fields xen-pciback: added config field at offset 0x%02x xen-pciback: initializing virtual configuration space drivers/xen/xen-pciback/conf_space.cxen_pciback: driver data not found xen_pciback: clear bus master xen_pciback: enable memory-write-invalidate xen_pciback: cannot enable memory-write-invalidate (%d) xen_pciback: disable memory-write-invalidate xen_pciback: Unsupported header type %d! drivers/xen/xen-pciback/conf_space_header.cFound capability 0x%x at 0x%x drivers/xen/xen-pciback/conf_space_capability.cquirk didn't match any device known drivers/xen/xen-pciback/conf_space_quirks.cCan't export bridges on the virtual PCI busError adding entry to virtual PCI busxen_pciback: vpci: assign to virtual slot %d func %d xen_pciback: vpci: assign to virtual slot %d No more space on root virtual PCI busdrivers/xen/xen-pciback/vpci.calias=xen-backend:pcilicense=Dual BSD/GPLdescription=Xen PCI-device stub driverparmtype=hide:charpparm=passthrough:Option to specify how to export PCI topology to guest: 0 - (default) Hide the true PCI topology and makes the frontend there is a single PCI bus with only the exported devices on it. For example, a device at 03:05.0 will be re-assigned to 00:00.0 while second device at 02:1a.1 will be re-assigned to 00:01.1. 1 - Passthrough provides a real view of the PCI topology to the frontend (for example, a device at 06:01.b will still appear at 06:01.b to the frontend). This is similar to how Xen 2.0.x exposed PCI devices to its driver domains. This may be required for drivers which depend on finding their hardware in certain bus/slot locations.parmtype=passthrough:boolparmtype=permissive:boolsrcversion=2FDAA609FAD18B263B7041Edepends=intree=Yname=xen_pcibackretpoline=Yvermagic=6.13.0-rc1-MANJARO+ SMP preempt mod_unload $$ (080( 0 (0( 0 (0( 0 (08@HPX`@80( @ (080(  X X (00( 0(  (080( 80( 8 (08h80( hph (0( 0 0 0 (08X`X80( X             (08hpxhpxh80( h (08X`X80( X (08X`X80( X (08`h`80( ` (08hphh80( h (0 (080( 8 (00( 0      (0( 08@H0( 08@HP0   (0880( 80(  (00(  (0xx0( x (08@80( @H@H@ H HPX`hpxH (0880(  (0880(  ( ( ( ( ( ( (    (08h80( hh (08X80( XX 0 0 (080( 8   (080( 8 (0( 0( 0 (8( 8 (8( 8 0 0 (08H80( H      @ @(( (8( 8 (080( 80( 8 (( ( (0880(  (( ( (    (08P80(  (08``80( ` (0880( 8 (080( 8 (08H80( H80(  (08@@80( @80( @80( @ (08@80( X  (0H0( h0 `0( 0 0@X8H `80( ` (08X`X80( 0GNUGNUOQmL|.h6vJLinuxLinux]2X;,[%$9  GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910$$  EgHt]zP_>C) v[5#q,{iOg^XUNG0xen_pciback\5*= (i< \kX< -<q ,<$<,0#V++2+S+dSV]Vi V V V V int i ,V * Vis8uiu8is16iu162is32Aiu32Pis64iu64i8  V +  1i 2i H I X ] ^ _ `]VV <i  P M    " #V % & *+ 4 = B hA l m2 nP } _  i  i  i  i  i Z +-  ~- _   9 99>9]S+2{{ S{+WA      q$H # S  < "K n  ( %0 i8 @ e#H e#H e#H sH e#H e#H e#H e#HF@A VP·hSS; i`5Lkp i(i,0 8@ABiD HPrmem@x+ i"'1; .(0i8@iHiL@PiXE`ihJp xii%Tiii% i!%"i%&)9i:?AD F P Qi(T%0o # !; Ocs!=iOsl!?iOwfe!Ai !E Oss!GiOsti!Ii!KiOnmi!Mi!Pi !Si0!Vi8Olm!Xi9!]i:!di<(!H Acs!2Acsx!i!M (!u Ass!2Assx!i! !g{ r15!m+ r14!n+ r13!o+ r12!p+ bp!q+ bx!r+( r11!u+0 r10!v+8 r9!w+@ r8!x+H ax!y+P cx!z+X dx!{+` si!|+h di!}+p!+x ip!+" !+ sp!+"H "B3 "C2"D2"E2 "E2(Os"E2,Odpl"E2-Op"E'2/"F20Oavl"F24Ol"F25Od"F26Og"F%27"F+28 #+ #+ #+ #+ #+-# pte#3 #"o -# pmd#? #" $% $%%c M$%/ P$' &pgd$'W M$'" P$p &pud$pK M$p"M$8=2@%H%I+Wrd"d0% 4%+8(&e&f+&g&h &u&vA&wA key&x &U&V "&j/&key&k&nL&key&o ';'<('=('? i '@ i$'A i('B i+F-@( h(3(i(i(  (8(( i,(!i0(( 4()18(*iH(++P(,hX(5 `(6 d(8 h(: l(; p(< t(=ixsse(?C@Lrt(@;Erdl(AE(BE(FOHZ(I5(J+(Ki(OYH(X^H(]^HZ(`"2B@(d(hi(ki (l+(m (nnH (osH((p)0(q X(s`(ub(x d(yGh(zp({}H(+((( (( (( ( (G((( (3A((5(Z(5PLmm( h( p(qIx( ( ( ( (+(i( i,( i,( i,( i-( i-( i-( i-( i-( i-( i-( i-( i-( i -( i -( i -( i -("i -(+(3Lpid( q( q(+(h( h(((h((0(@(JP( JX( ("CJ(% (( (+ (- i(. i(3 i(4Y@(6@(: ((=+0(>+8(A i@(D iH(G+P(H+X(K{>`Z(N>(TK(WK(ZK(^L(k 0(mL(p4 (q4((t+8(u+@Lfs(xLH({LP(~LX(L`(fPh( Pp( A9x( A9( A9(<(+( (i({(P( *@(i(8(#=( i ( i (15 (# (H (,6( (h8 (P@ ( H (PP (PX (P` (ZQh (dQp (+x (iQ (= (i ( i ( i ( i (}8 (? ( (sQ ( ( P ( P ("}Q ()Q (  ( Q0 ( `58 ( iX (Q\ (Q` (`5h ( (Q ( ( ( (  (!i ("i (# ($+ (& i (' i (( i Z()S (3Q (C% (D+ (LQ (N+ (RR (SP( (TP, (Y+0 (] 8 (^ < (_ @ (` D Z(aSH (d=X (gR (i= (lR (w (x (z+ (} (~!R ( i( i( ( (%( ( ( ( (+(i(6R(@R(JR(R (i((i,(Z(S( (!"f1($"f1Z(.S(<RZ(Fm@@F@@) )0&sp)+&es) &ds)")$)&)+()+0)08)+X)+`&cr2)+h)+p)+x)0)+)i)P)+)+) t0sfpu) /@i (*  * )  F@@% !WOk@%o@   !j%*"WHi% % "fi %(%,%i0[%i8%X%ih%%jp%+x%Xh% %j%)%Q%j%]hB+S"++B+w"+2+2(+"Aval+ 6/"6S" +""w" +,"B,",,""+(,#, 6" , '#""," ,# - `#- - `#u ..  /#/" /w# 0$0#000 00i0+,1j$&fmt1S1S1S1i1S1S$$26$2728/282 %2S2S2S2SQ2iQ2iQ24i key29o$(=i2=5% 82U%2V mod2W%2XS2Y% 2Z (2[ ,2\ %0#S 2u%2v%2w%2xi2yi$5%+] &+ 3/K&31i set338 get35Q37 1 &t.(% * M p  O( O08!@" ԢH# P$ X% `&$h'=p($x)`*~+,Σ-ӣ./ 0 #1 2U3 x5 9 Ĥ; >`?@2P& 4!u(4% 4+ 4-4/ 5 (5!A key5"A(5?(5A+5B)5C) 6)6) mod6%6)(u( 5=+)5>"(=i 3)     +)+ * ; ) *?) )+ 7 i9*      0:c*:dS:e":g@:i ^:lc ")(* ;+;i end;i5< 5<  p=+ cwd=P swd=P twd=P fip=P fcs=P foo=P fos=P=+=PlP++B=*+ rip=+i rdp=,iB=.%, fip=/P fcs=0P foo=1P fos=2P (=)9,6+6+(0=@[,=A[,=B[,Pk,+ u=$, cwd=%2 swd=&2 twd='2 fop=(2"%,=5P=6P=9, =<-=>[,9,P-+P-+? =Q- cwd=RP swd=SP twd=TP fip=UP fcs=VP foo=WP fos=XP=Z+=[l=\m=]n=^o rm=_p=`q=a-x=bP8#.+i .+@=:Y.=; i=< i== Y.ii.+F@@=O.[=Pk,=Q .=R.@.^+@=^ /*=_0+k=`k,*=a-k=bi.@*=c //+F@@=f/=hi=ki=ni=qi&xfd=ti=wi=zi=i=i[=.@@=/= i=i=i fpu@=o0=i=+=o0=o0=/ =/0[=/@@/ > 0> i>i]0+]0+'{ 0+00+002 ??1?i?i?S?S?S5@5@5@ A81A91 A<1A=11(B<1B=iB>  B:1B;1"1 srcBA2 dstBA 222=iC12-(C2C2 valC PC!P C"PC#iC$2 P(C*2C+&2C,#2 D2DMUD A2-C'3C(}C)2"2C.i- C1d3C2i3C3C4 C5+C6+d3((C3C%12C/2C73 8C3C+ fnC 3"n3 3333 E>$4E?+E@+EAP cpuECP FL4FiFi2(Fs4\ctF0F&s4 $4=iG4 H4H 44 I 4I J 5J (K5Kw# K15"5 K5-L T5L'# L"=5 M)5M*)M+# osqM-4 M/ (N 5N N N2O 6O+O 6O 65 O ,6O  6 OT6O6O 62 P}6bP 5P  P 6P,6=iQ 62@Q',7bQ(T6Q)  Q*@7(Q+70Q,8Q-9Q.:Q/; 6;7;76,72@@R/7R0R1iR2 } seqR3?R4;7R5}6 R60R7 8E7 (S8S S+S 8SP  8 878 TL8TT TQ8L8-U m8Um8+}8+ U8V8 V8V  V8 W+8W,W- xX9X9Xi`X+h maxX+p+*9+ -Y A9 sigYm8 Y*9 ZR ZSe9M9 ZU$ ZV9j9}[9[ [  [ 9-['9[([)-[-:[.[/[0 9[1-[5L:[6[7[8 9- [<:[=[>[?[@ [A -[S:[T %[U[V- [Y:[Z %[[ -[^;[_+[` [a ([Jc;[L[Q [W:[\:[b:- [E;[F";-[g;[h _fd[i-[m;[n[o[pi } [%7<[*9[29A_rt[9:[BL:[dc;[j;[q;B0\ u<\ \ \ \ ; 0\ <"7< \u<< \ <\!\" A9 \% =\'Y9\(+\.v9\0 A9 \3#= sa\4< ] e=] .] + len] +]  (^=^  _$=_%8_'_( 0_D=_M#e=_P(_W) 8` S>`i`i`i`i`i `#i(`,i0 a){>a*ia+}6 Pa8>a9>a:iHa;iLS>>+28aD>baESaF`5aGi02 b>_?bKbZbpbbb endb_?]n?^+ c!?c" i c&n? cD?cD? cD? cE?cE? cE?-cT @cY?cZ 15 c[?-d *@ vald d @-d M@ vald  d 6@(S@(U i(V i(W#Hi([@0(h3A(i?(j (k@&cpu(li(mi(ni (oi( (zA(+( ( ( (A(+( Pj@@(2B( i( i( i( P( P(+ (+((+0(i8F@(C( i( i( i( i( i ( i(( i0( i8( _@( iH( iP( _X( _`( ih( ip( ix(  i(  i(  i(  i( i( i( i( i( i( i( i( i( iF@(,E(zA[( 5(! i((" i0(# i8(%@(&P('Q((R()S(, iX(- i`(. ih(/ ip(0 _x(1 i(3 i(6 (7,E(96E(;6E(=+savg(GA@C1E0(KE(L(M+(N+(Oi (P$(Q&(SE(;EM(]EE EEEj(`:G[(a5(h i(i i (j i((k i0(l i8(s _@(t iH(uiP(i(i(i(i(i(i(i(i[(6X[(6&rq(`G(E(:G(EM(^GGLG h[GErq[G(G3(i 3(i 3(i3(iP(G(((((Hb(Gs(P(7H(7HH(EHJHTHeGnH+))xHjqIy,sLX B@ D H,6P+` +h)7p+x ފ15LX Hpidpe7Je9 8e:ie; 15e<v inoe=ie?i e@@eB_WH\rcueCS`eDypvIJ+ fCJfifXJ2goKgp) uidgq *@ gidgr M@ gs *@gt M@gu *@gv M@gw *@ gx M@$gy i(gz0g{8g|@g}Hg~PgXgL`gLhgLpgLxg ggfog<gW܆HJKkeyh×Lh8hWh semhLX(h Ph X"0`h h uidh *@p gidh M@thxh|h~h h+""߅hKLLLLLuXi^fPi_8i` iaib icie_W ihh8ik<@inXiq`isdithhiwpixitiz|xQiiQiiiiiibi6i  itiii{>ihi iJi~ttyiii @iii iiiiiiiiiiY@i+i+i+i'+i+ i+(i"+0i,+8i+@i+Hi"+Pi,+Xi+`i+hi=pi ii9iʉi iiԉiiii i`5iLX0Lv iPi15i8i_Wi) kPPPPPP XjcZQjd)je jg jk 15jm,sjnw(jo0jq%Y8P_Q<nQxQ kQkXk@kLQQQ+QQQ+R+> RR81R+1R;RER2hlyRlz^l|il}G`W_l__(l70l+Xl#L``ORRRRRR5#555!5%5'5,5/155355595<5A5D5H5L5Q5U5Y2 T m@Tmmm m vTm!m" m$i Hm'Tm(S keym)/m*Tm+ m,(m-0m. T8 extm/T@ ) T@T m32 m8HU tpm9HUm: m;Pm<PvT DA nVnPn enin  nini inon)i devn* Y(n+ Y, uidn, *@0 gidn- M@4n. 8n/@n0Pn1`n2pn3in4in5Pn6Pn7in8in9Pn:Pn;PV+ (oWoio oWo  oWW 2W2WiV o#_Wo$15o% o' 7WIpɕIpʕIp˕=ilW W 85qr r"W(rXr15rW rGX"Wrir (s0Xs1)s7) osqs94s;#s<IsLXIsIsIsIs t+Yt,#t- u YY Y Y%Y uZYu)uuY XvqYvr%Yvs7 wqvvYH cpuvwPY{ xwZw{wZwZ( lenw)Hw&ZPwpYZ++&Z+6Z+u@x[x[x[x bx15@@x YHx!+x"+x#x$7x%%Yx&S x'[0x(+8~cpux*@~sspx+[H)![+ `x6[x715x8Zx:Z(x;+Hx<[Px=Xx>\![ xe[xfi sdaxg$]xhn#xi)][vxxD]xE[xF]xH xI`5(xJ15HxK`5PxL+pxM+xxN+xO+xP+xQ+xR+xS+xTxU+xV`5xWJxY x\+x]+x^ZYx_[p[$]+6Z[5y z3G]L] e]e]+j] z6]z7;]z8e]z9({]{.{.-{"]{#A{${%-{'^{({)-{+:^{,{-({!h^{&]{*]{.^ {^"] ops{^":^^^ {2^{4+{6i{7i =il@^=ilH%_ lpZ_lq^lrls__Z_Bl_l^l+l_blSl+wl_6d__2@lG`l%_l+l+l+ l (l,lG`0\rculS8lx`H_h^ lx`l idlQ``^+ l`l`` (|`|#|_|| -} a}i}& })LX ldt}*a8}.+@}9`5H}:h};bp}= x}C2|}D(~a ~ b~~+ alt~+~+~+ ~+(~0~8~@~H~P~X~`~h~p~x~~ ~!ab }F`B%\b%^ %`i(%XcAlru%Y6b%d%e(%i%c%j +%k+B(%RUc"b%hqI"c%s+ B(%uc%z+ pp%{c%|+%}+%~) cB%c%+B%c%md%  mdp ref8JHhil+p ops x"cw(%Qd6%c6Uc6c6c%S(%d%i% P% d&val%+M%dl%M e%N %Pi]%J(elru%K6d]%WMe*%X *%Ydl@%Ge%I+" e%UqI%V + "(e(%[ 0%\ 4%^+8x@%Fe6Mek%j=l(%mCf%n+%o+%q %r %s %t %vi x@%laf6ek%z=l0%}f%~+%+% % %  % (l %f%+%+%x@%|g6af6fk%=j%DW%@_?(%Xh%YLX(%\!i%b+%h+%tC%w %}$l%Hi%+%+x%fi6!ik%S]%i*%Ig*%^+- vali  #i=i  B I v{+v h h2hl̓\rcuhmShn8ho Bhvhx2hy C(hu 6̓Axh+ (hrRht+"h\hahS RR} hhh f+ h ЄLЄՄLW hh keyhLh\wh0hh5(hRh h B(hh+h+h\hah . ((hh 6Rl h߅hh N] h*hf6ڄ  8`+0)8@ uid *@P)X `$#h g͆g 8g gidg ͆M@܆^+wggrcugSu@@RgRh# cpuRiiRjiRki RliRmiRniRoiRpiRriRsRtRuiR{  R|;7(R} 0R~;78bR@@ q E7@)+ =9+? 8ii i! i"+i#ii#i i$+(i$+0 i'ʈi(ii)i i0i1 i2 i3  iCiDʈ iLBiMhiNB 8iQ|iR iSiTJG+J+8ʼn+ʼnω h207_WbS 2` \rss  0ى8_W@ X   fn 1 arg +- Ҋ b   P(jS jTjUwjW-jXjYS28jIm qjJr iocjKZQ"W  j\i0m-|- val - val  <؋ in+v28_{`)a{b{c d \rcueS reff0̋- v + %Hi T++  n= ;-. R0  4; 45i67+( *@ ( M@ P~i e""  (8 XhHП(:)*+ ,0-`5@. 15`/ d0~h1Əp2 x3+4 - ] val : F=i6 B(EƏAuidF *@AgidG M@H ] D"Ji Hj      ( 0 8 @ H4+ i(i, 0 8@ 4!ߖ%4@89ё:ё;ё<ё= >(?0@89 ё~ ~֑ ~ƏXDEFʒG ڒHI J(Kё0N 8O@Q*HSP ~ʒ~ڒ~ϒ yߒ y ] *yxYZ[i\i]i^i _i(`i0a_8c_@dHeLfiPgiXhi`i_hjp8iiii iii&ino   6( 60i+ siii iiiiX?ёXXё {(08@ږHXPs ?~$! X~iD v~v] ~Ə/ ~ Ֆ~Ֆt8 : i LX :0 JHLops!Z yJ+jZ+ߖj+]w*}*  t *C \ v (ڙ0 8 @ &H 6P OXr`h p Úxܚ  2— 8 %Xh%g CqI/ \qI%Hllqa XhqIiGX%{ ڙXhqIii% *qI*ߙ % &%B6%+ Ott; rqI%%T %w %% ܚqI%Ț Xh*Xh 2tt]a*p*ix*kS]*!* .(y]*R** .* i F@Z[P\s]^`ͥ b(d0e,8fO@hrHj,PkXmǦ`ohppr 5xsbu{vyƧ{}/H(/Xh T5&pidJx4&uid *@*@ $  +ii ii ] *`5* ix )k*S*+1*,/*-MPF0W  [W7i+&è   ب ( 0 8ё@.HBP.XB`ehp x ĩ    n  %*4>C^R\fp]+]+$M ԡԡSii١ &pos M i *Xh MXh.Ir/ pXhSIrR tiu Xhԡ AʢXhʢϢ Xhi+٢ Xh! $yXh =Xh) `XhB ~Xhe Xh +ΣXh++++S RXhIriأ #XhIrRi FXhFGXKP( xXhZXh} ĤXhXhi XhXhiɤ  i 2 i vPyvi7 SnvynU yx y ͥv. yveҥ vyv ,yv OyvS1 ryveT yveYw Ǧyvyvi v̦ $Pi^U 5v. XyXii]: {yg yvXhie ƧyXhe v˧ v %v%* Hv%4 w&mt X + yMwHi yè~بyȨ yݨ y~ .~ B~3 [v[`G ~ .j v ĩ~. ~Sɩ y~ ~ 227#AF vniSPe#+ @@6ASBC;Dʳ E0( sdF.0GW8QIiQJiQKiQLiQMi * A . PkukL     u  O+6T rev+O t.2.  .S\rb5 ns0i8< e>"N@ idi` hp\rcuSxt u ops?!I .h:^ n"$ % & ӯ(( 02 89@: H= P@(XA F`u:D( |Adir Y3| J kn.Xh `5 `5@`h .x    @  A %j YYJnYc s Ir Irӯï Y.د AYʢ (Y! FY-=in 0'ʰ(K) Dr* ԰+, - 1(nqϰ ٰq :):S: e(:mK:n:o&X:0:1:2 :3 :4m :5 (:7 Dz0:9 8:; Dz@:= H:?PKK e; e@;' ^;EqqIh Xh;.r DzXh;. Xh;̲ Xh;!:B: `:  `;.G ;Se `ʳ 15 X 0t+u @vEw!Jx*my z (ϳ+@;5BO* cchʰ6T hrhNrSrv }~~buf .+.+?]$+ Yr$ mh^m Shw hY ̵S̵3 (3E33FS mod3G% ops3H!3I <3J3K"V ѵ Q.̵=(3LAarg3M Astr3NAarr3O 3V3Wi3X. 3\ max3^i3_i num3`  ops3a!3bK&3&K&20(>b)>5P+  x+  i   L]·+7 `-. mod/%@0;H mp1P2CJX 85v67 9 ; Ѹ <(= 0 .·v SѸ%S %ָ%Hi>$j8EP&modF%[G"jPpqrstismtnw$  i..Kѵ P"+3(,6T[UYO SS+^$P + (,.--.. //01  t id cls3ȩzz Ż@y]ջ+]+]+ @kf endfS++ k(k0&k8]+/ (ϼ+++++ 20\rcu1S2W3^+ HoIoJK LM+No ϼyFCt@&pFHSPX&busO`h p x`5[KPZ Lmsi3(i8n@iHiP}X `hx 9 YLidP15 m!!J# $%'#)+ `, a- b. c/ d9 e< fy :c; <H  !"# $(%0&8'@(H)P*X+`,h-p.x/012345o ttHUHilJHxy 15zi|i}`5~0@F8c3  3 !3 "3 #3 $3 %3 &3 '3 (3 )P15 J @ @ A B C D E[6Pi%Y_W  i                iiiii  *(Lqos40 +,S id-./15 0(1702+X3 `4 h5 p6 x7 8+9+:+;+<+ dev=tQ> Q?  J*tA/&opso   t ti MNSOSP!JQ!JR!J T(U,0V8W @X HY P[X\`^Eh_paxcd pmfJh t ` aS busbOd%eSg h $j-(k20m8n @oHp PqEXr`s!Jht!Jp pmvJxw py< ''C Etc1Hi  `2?3S5!J6!J8,9 ] ; r(< 0>8@(c@AHC P pmEJX .X'XeDmm?b 'w'NrSr 0XYSZ!J[,\ ^ pm`J(=i--t7 v  A .{ S .'XNrSr ijk 7m Z 2t2. Zt2S<ii+HiHi83 0^!:r"c^Hi1HiBHiOcAd&he2f4g &lidh A9U_disx_cma 091S2 3S4>6X7`89h99p:9x>+? @/0 ops1" dev4t56(78>>5=i   h 2@z{| }~ h(0 irqi8i<+@+HSP dirXI8 E&irq iW%Y Z( o0UUnHEjjW_023 4i@Hi=i  get put   ( 038V@jHjP~X`hpx~2F QXRi idSiTX Pfghii.  X X' X  XS 3XSi VXS%8 SjX[ ~Xo X XS XSSii] X$  2Xi F7}!q"iAptr# hL busM>NOHP Q(F 9>(8@sPp&opsi p trdevyi i C   iiƄ "=i @ccccc "(536`5&len7i &cap8$]X*]*XF` JK&busL>M>O  P(Q0Si8T<U>V@WBXiDYHZI\2J]P`Xa`cPhdlemfngxhp&piniqj2rk%xmnit_vMyzi(|i-}i.~i/i0i1i2i3i4i5i6i7i8i9i:i;i<ii2iiiYsdevyLirqi@iBi Bi Bi Bi Bi BiBiBiBiBiBiBiBiBiBiBiBiBiBiBiBiBiBi Bi!Bi"Bi#Bi$Bi%Bi&Bi'Bi(Bi)Bi*Bi+Bi,Bi-Bi.Bi/BF H 15LP i@M2 i`MiaM  # Lvpd 2 iPO  3 2  2 P i`P 2  2  ,s 20 2 LromZ8  @ SH  +P #X bbqtS6 O 1 h  |( 10 8 @ H#P!JX!J`h+P+++(i ! "#$ k+ >> >i >i2 >iP;@<15=MH iHiJ8_a e!h!k 1l 1 o 1(r 10 @ Y @!1&. O6; hcT |m  PM=iE N%T 5ZIel58* oIo: lmd++NBq*^+(*6v%l(0&vma1!2 B3 +4+5+ ]>D*? *@ O!D h!+T |!m !+++ ooi oo++ +! !+ S&! ?!Q+ Q]!+%D 8v!+b5G (a   FaPg>P`?pt&pnp x/ v Ldir Y 8Lhp^ @%c H"r PXrdevy`iPiTX`5h  rwu@@C}D}EthF/GfHIiJiKiLiMiNiO+PiQ RS#T4U W XUZ)]+0^ 8__W@aiXbi\ci`did~dirghrcunSpoq`5rs%tSv hii o))@ ho irqii devt msgp (20 .8@ 2H"P 8P irqir:r ( 0}tS    ( 0 8 @ H P (X A` Ah p x     V (        ! # ($ &+t i   ( Ai-VFkkp ="a""[   i  / cnti =i"t , pin-./P@0PA1PB 4567+8 .(R)StAuvT HIJ9KPLPMrN Oo P ("00+++&ack+&eoi+ +(tPcf8P@PD 2Hx!n"##$ }% & ' ((i0)i4*P8+P<,P@-iD. H/+P0+X1:r`2h3x P}nPc^+Hi@ R[SiTiUiVi WX &gcY[ j^+=i      =iPOOPQiR.SOl*m*n*o*pstrq2+P+i+S +]jE*k*r efSg hi" E  P .  P?$@AB Pefh mapjk (lZ q}(s 0u8v @wH$ :r9j :rj :rir(:ri U:r9Ui% Z- }:rii_:rii :r:r :r%  ?_@PAPBPCP DSE _t:ri^+ )BPPP P PP( 6P !"  B P!P"P#P$P%P &P B()P*P+P,P-P.P ( 6-6 " 1 6U7P8P 9+(>? P@(BC PDU(FG PH!(mnPoP-qTrstuvw x i(zv{| l"y"T}iAptr K(Apcivt.oP      ( 90 N8 N@ vH rH Pji&ops{  f( 0S8 @ :rir:ri :rt:roo  9:rt N:rt> q:rq rS3 t:r:rIfI/ &seg &bus   =ioo o &GL [P ŀ iMŨMń PPŎŏtŐiPœŔtŕPŖ .PřŚtśPŜ3#PşGŠtšPŢŌ*ōt*ő*ŗ*ŝ*ţ*ũ*Ű*Ŷ@GGPťŦtŧtŨgPū@ŬtŭPŮ[ůPP ŲuųtŴPŵP2 Xuvw@x HQyQz aa t ids2   ( 0 8 @zH S2t a2  aP aP  ?a PPPPPP PPPPPPPPPP P P P P P  % i 0 ջ  PPPPP p .&ids 0X3P3P3P3P3P3P3PPJ333  !$%&!'!(J+6 37P;/ 3<3=:v > ?@AD EF GH! / L 3M3NQ R * &devSt% %   PV WgXiYiZ[" (\$ 0&ws]@^H_L0q r st u t(    ,.Pi   P +P +E +E + +: : J O )T iEJ +O  h m =i  0 2 3S  +<6  08Q :=S?iE o  I ( j j SS Q  j SSt uOiPSQSRSST  \devUyPVw @WJHX%YhY\ ] ^ _ `i  ȏ idȑP 01 2 v$4@ cmd6  err9 <  bus=  > A B E G  I@$P+ M cmdO  errQ T  busU  V v<XZ  op[\P(v "c # $`5 %i( & 0 '` (d )ch *+p +%Yx op , 0 /  0 1 2i 3i 4i 5i 6i 7i 8+ irq 9i( :_?, o >_Wo @ ^9> aaiiii arw aii @ h iS j k * lR ok  p ( add r0 get t8 a *a Ra   / kafWap a- aiiio {(   ,  DI gP sx 2    2  #u /4 R3#--v.8/-12g3-567#,Adw0RAw4vAb8 P$g%i&i'i()*, + |( u90:@wwl (=>?@iA g @8R#. $ R(LX dO+?R)O )3 d+)  +,- bus./iR1 R215  84t5W67 15 dev9 :a( gsi<0RC15 RD RI RJ .+# ( ! A A A +A SA A A A j]   d!+&:! dM+=:M dy+i:y  >Oe]p1Dv>5# (S 8E#>He>I   XXX#> TDo> S7We#> '.S_X>>͠ YSS>o>D<iiEpo2WX(9 Xo2Wpo 2WDU#>ȣ>n>ȰdnSSS_>Ȣzzn> .+S_D2'S_>`#D2%S_. X 2 BX 8,BX ?HB>cwDuw>.S_>X*%S>1S_>SS_ptDM*;>EOe]  SprD Wp D4'S_XD2%'S_>nX\Ds ,X> BD UTD VfD PxD8'S_pXDs XDtW8(^  # U0 B T 0+Si(Jerr+$+'+G4+GA+GN+G[+Gh+9u++ A!U Q  y!T QR}X~Y !T QR}X~Y| !T QR}X| "T Q}R~XY| J"T Q}R~X| u"T Q}R| "U 0C] "U T  "U T  %#U T  Q#U T  }#U T  #U T  #U T  $U T 0+'Ϧܦ $O %[7ht?5+%F%RU|'f  %fd*%/:&U Tso&&UvQ  'U Ts :'U  R'Uv q'T  'U|xU 0R0E0+ *'T   (U 0S z*/nb5e]C+C%Jdevtn)(%z**"k**%*** \)y* )*y*)*  )N* 2*U U U 04z*++>nz*+*++*84"+`pos$`err%&`bus&&&'zout+ 8j$ + d++ +j$ - .,U T  Z,U T  ,U T  ,U T  ,U T   -U T  6-U T  b-U T U So0/drvC/buf.z*o0 +9.++ c. . . (/2!^ /! h !)v : "0U T} A0U uU|s"T~sQ hSf5/drvD/bufSC#gbusJerrz*o0hout`-3``aa!a%G.a 2UsT QR|X~Y S2UsT Q|R~XY} 2UsT QR|X~Y} 2UsT Q|R~X} 2UsT QR|X}UsT Q|R}   32! ^ }572&?q@5#E # 3 %$  s56A!  !   *E4 5T3000S8/drv6/bufA.z*o0 +n6++ 6 6 6 ]72!^ 7! h !)v :W8U T} v8U uU|s"T~sQ {>/drv7/bufHSC gbusJerrz*o0houtT>9j$ + 9j$ + `;``aa!a%G.a :UsT QR|X~Y :UsT Q|R~XY} !;UsT QR|X~Y} X;UsT Q|R~X} ;UsT QR|X}UsT Q|R}   $<2! ^ }*>72&?q@>#E # 3 %$  >6A!  !   *E4 5T3000 c>T T d>+>Sh6A/drvh2/bufh=.jk+l!Amo0no#Ahout?q+q+)?r ?)? @rqJ@ @2#^ @U T@ AU  uWAU  $ &|"T } $ &Q uU  $ &|"T } $ &Q SULG/drvU3/bufUDSCVXgbusXXXgregXX$X*JerrYhoutbS`[Ce`r```````%G` \CUsT QR|XYUsT Q|RXY}G[`GY[f[s[[[[[%[[[[9[d[bE[[#G fYf#t    CE T QP}uG72&?q@_G#E # 3 %$  BG6A!  !   *E4 5UT3U0 HGU~TsUs0S-M/drv->/buf.SC.$0z*1o02gbus222Jerr3houtLTM)I:E$  H.E)XIE# E%9U Q R|,`5FK``aa!a%G.a .JUsT QR|X~Y lJUsT Q|R~XY} JUsT QR|X~Y} JUsT Q|R~X} KUsT QR|X}UsT Q|R} ? K2!^ }NM72&?q@M#E # 3 %$  M6A!  !   *E4 5UsT3Us00dM+MSP/drv8/bufC.z*o0 +N++ N N 2O O2!^ !P# h !)v :(yPU T} PU uU|s"T sQ SR/drv1/buf<.R +mQ++)Q)Q Q ARU T} `RU uU|v"T~vQ S7X/drv8/bufISC gbusJerrhout`U``aa!a%G.a SUsT QR|X~Y 9TUsT Q|R~XY} vTUsT QR|X~Y} TUsT Q|R~X} TUsT QR|X}UsT Q|R}\X#\0\=\J\%W\d\o\|\Ud\U\y\V\y]8V]O7W['htK5VFRUs'fd\Wf\d]W]# %9U T QvR|X}Y~iX MXU U  XU Us0SG[/drv5/bufFSCgbusJerrhout`,[``aa!a%G.a ZUvT QR|X~Y RZUvT Q|R~XY} ZUvT QR|X~Y} ZUvT Q|R~X} ZUvT QR|X}UvT Q|R}0C]04  \+ 1bus,+5+?1regi+&i+i`errz*`devwzout8 \ L44 .]+)1bus5+>+HR`t)R`err+>] \++\\]:$ ].88d>]+.]Sd 5S`Cd&/busd2Cd;CdEfRJrcggTy ^ \!tE  ^ T Q )_:$  4_.)_# %9U T QvR|XsY} `UTvQ|R~ C],`UvT|QsR}C]UvT|QsR}4P`1bufP,S+P6 1busPC +Q +Q 1regQ" +Q, +Q7 S4+]zend)h:$  5h.)h#%9U TvQ hj$ + ,ij$ + )i:$  ki.)i# %9U TvQ )j:$  =j.)j# %9U TvQ @ (kQ'^- oTkep'f w'$}m72&?q@m#E # 3 %$  m6A!  !   *E4 5UsT3Us nU 0 ]}KnUsT|Q6R2 jnU  ׈nUs ׈nUs ׈nUs nUvT  nUvT  ׈oUsUvT {{@Kv/dev{@}z*~@T{gzend)mp:$  o.)=p#%9U TvQ pj$ + pj$ + qj$ + )q:$  Bq.)q# %9U TvQ @ -rQ'^- oTrep'f w'$}t72&?q@t#E # 3 %$  t6A!  !   *E4 5UsT3Us uU 0 ]}OuUsT1Q8R5 nuU  ׈uUs ׈uUs uUvT  uUvT  vUvT  6vUvT ׈Us{B@]}/devB>Dz*E@TMzendk)w:H$  v.H)OwH#H%9U TvQ wRj$ R+ wWj$ W+ x_j$ _+ )x:g$  Tx.g)xg# g%9U TvQ @L ?yQ'^- oT]yep'f w'$}m|72&?q@{#E # 3 %$  {6A!  !   *E4 5UsT3Us -|U 0 ]}a|UsT1Q9R5 |U  ׈|Us ׈|Us |UvT  |UvT  "}UvT  H}UvT ׈Us{@C?z*C YC+C@Jres@acJretT҈b~ j$  + )3:$  ~.)# %9U Q Rs)=" 2"!T"ep'f w'$) ""V")" h"!T"ep'f w'$ U TQ2Us āUT0 U TU T!J"0o-j$ -+ QvRvXvj'F R]'F R] K '  V  EY' T0T'ep7f w7$5'" *.9(-K '  V  EY' T0T+ep'f w'$/h'" *.900 T T Pd҈+ˆC:z*gxbtnJerr0Ty}j$ + j$ +  ډUsT(Q  dUv >$TsQ R  #;T00 gT T /dev,z*!z*+T҈):$  -.)# %9U TvQ ++  4):$  s.)֌# %9U TvQ )^Uj$ + j$ + j$ + j$ + i# h !)v : Q0 Y͎Uv UvT  UvT  <UvT UvT ~++ )  U T|U ^O]['htK5 FRUs'fU Tv}72&?q@# E # 3 %$  6A!  !   *E4 5T3 ړU  oUvU {o Ţ/devo*/idoK6JerrqqrRTբhout)q:t$  ޔ.t)At# t%9U TsQ ~j$ ~+   \!tE   T Q іj$ + v ͘%!. ~Yd[t`~9#@kQ'^- o NU  mU U ynoU ڢ  J u% d-fIdWX7P%9U T}Q yfZgs'GR fYf!t  E  ; T Q8?X\Gd7r~7x}7D#C OY '_UsUvPd[fd,# ]%9U T}Q ^UvT a,  U T~U T~@gQ'^- oSU T~X}e/72&?q@#E # 3 %$  6A! !  *E45UvT3Uv[UvT  U  U| ԡU| Uv  U U| >?T  >^T  >}T  UsT xU}T dբ+ Ţ4C 1devC*+DRFz*G+`errHբ aP+P+X+X+8:]$ .]8]% /new%BRC&/bus&C&.i(R)+*,+,+ . ؤ. , = fU T~U :7?yp%U|TsQ f* U UU4z*+`err *++=  oj$ + 8++d+S C7z*o0Jdevggsi @JerrThout [:$  . +! 9U TsQ  )  \  /! h !)v :d wY0#G fYf#t  T :$  U. ʫ! 9U TsQ  [e# U T Q  K:$  . ! 9U TsQ )tDj$ + @ Q'^- o% Q7DQGRPG_UGlTYyYYUsT  d:$  . 4! 9U TsQ j$ +  :$  . V! 9U TsQ j$ +  :$  . x! 9U TsQ #c# h !)v :  ̲UsUs}#c U},T  Us ҳUs Us Us (UsT  @Us elUsTQR@ UsT 0E fUs rϴUs U}04x ~1devx*zR{+|[~+~+n84d 1devd.+e#R(/dev(**z**!z*++,o0Jret-T`/+/+ 1 1)9%9Pj$ P+ >\+\+ /s8 ƷU U D6 !UvUv F 2!^ \ĸ^ Uv}` 72&?q@ # E # 3 %$  6A!  !   *E4 5UsT3Us ?U  ^U  vUv Uv fUv TUv BֻUv ,UU Uv|&U |EU |dU xUvT  C >a/dev  z* +/++ Y  e)v%K?? U~U~Ke2vYY'2'?2K'2- !2",'9 2EYOeKR  cm'  !   *E4 5 UsT1UsT2U~U T|U aFaabusaaNz*NN+<+<+K ev%? 1? }U|U|?ev%YY77?K7- #",79 EYO%eKR  cm'  !   *E4 5 UsT1UsT2U|TU Tv sU XUsT|Q~R :ea3iNz*NbusNNUU@%TU $QU3%ORU7@$La$ z*<<+8<+<+z*Xa7busCa aNz*N+t<+<+K ?7?K7- #",79 EYO%eKR  tcm'  !   *E4 5 UsT2UsT1KU Tv 1U XUsT|Q}R~z*}a>busJa RNz*)N N'@Q'^- o;$>z*;$>z*p ap1jNrz*devsNto0T{g*<v )z$  hUz)Nz7 z%9U TsQ )Rj$ R+ )cRTerrRj$ R+ ?@ Q'^- o?% @7DQGRPG_UGlTYyYYUsT K  x 2! ^ K( UsUs?#cK ,Us UsT| Us f)Us AU| BYUs rqUs _Us|UU0xUsT @e ,deve7@Lz*,devLD<Nz*M fP$ WUP8<P8<R \<R ; $ ?a$ i@ $ >$ $a$  ,bus  $  ; %$ Ga,dev $ %4 1cmd 1arg &8  +  +  +  +  +  +mP +P ;mL +L 94fS+f:nma +a4+a@4\@+\5@+^,bus+1>@##||,bus#H94,1dev,:m 1dev 6tm1dev3t+>4 1dev:'4pS)1devp9'@WSG$W>h4 %t+ ;+ GB4 |.+ |D+ |PB8 i4 %i+ <+ 8. 4 z0+ zCB+ zX+@>?$>)j$>6o;+X$+*j;q$+j4C!1rCC41!1r1E+1M 41i"1r1+9 `oldm1r-;9,r/$7 ;r,i,r($0 nold;{,r{-,n{4m+@cS+T+8++4D(S+DCcSD+S+> +$S4M1i1v+M@x,i,v+M;A,vAM,iA41i"1v/M41i"1v/Mm1vM1i!@[C,i[6,v[CM8<] ;d,v7M,i> 61p 9X `ret . . . . . 8. e. e. e(. e8. e "J,p AX$ T< < nret n__p .< < 8< U U U U U 8U eU e.U e=U e8U eG@},nr+$;}=@ R,nr R5$ RQ7; ',nr ',$ 'H; ,nr *$ F;^,v^O$^Y;PC,vPJ$PT;Bf,vBI$BS@,nr+$?}@,nr4$V}<@,nr4$V}@",nr$:8nc ;HF,nrH$H1;4j,nr4$4/@Ӧ,nrӦ+$Ӧ@}npӨS<ө+nvalӪ+@",key"J$"Z(4s+s68.u 4jO+j8+jV;h$/;$7;$2$K8U;,new4$K;,new/$F;5,new1$$8U@jy$jFnretl8<o<p@A,newA@$B$CnretE;,ptr<$H$@,,p,;$,Ki@(<,p(:$(Ji/KyUsTvQ|f*A+2+r+r2+Q+]2V2b z2 2 2 2 int b ,2 *2Fs8nFu8Fs16Fu16&Fs325Fu32DFs64Fu64yb,  2 +  1b 2b H I X ] ^ _ `V22 <b  D @     #|2 % & *+ 4 = B h5 m& nD } S  ]  ]  b  b  ] < + w `w S  V5+]] m5m]bzrzSH  Q   "  -  (  0 L8 @  H  H  H 2H  H  H  H  H(@ Ph{QQ b-73kp b(b,0 8|@|A|BbD HP_mem@d+ b & !(r0b8r@bHbL+PbX0`bh5p 5 xbb ?b~bb&r b!&"b%&9b:?AD F wP Qb(T 0l+W5# # &&. &val w B  ,. #r r  +  w N    B   ss  B   j   b+, fmtQQQbQQ$j e f+g5 h? u5 v5w5 keyx : Ue V w j keykD n keyoD 6 7e 8 8> QQQQ7b7b74b key9 (%b=g 8U V modW XQY Z ([ ,\> 0Quvw!xbyb g +bV@+ /1b set3 get57 @`e    C  8( 80k8!@" H# P$ X%`&h'p(x))*G+o,-.o/ 0 1 23 A5 V9 ; >)?@ !5 key"5?A+BC   mod   j= >r4Q4(EFQ modG  opsH!I 0J K 9 !4rL&argM r&strN)&arrOV$WbX!$ \} max^b_b num`+ opsa!br.}(-@! H"!i3!b!b! r !q:(! b,!!b0!( 4!)48!*bH!++P!,H"X!5 `!6 d!8 h!: l!; p!< t!=bxTse!?E@3rt!@G_dl!AG!BG!FJ8!I7!J+!Kb!O#J!X(J!](J8!`"C@!d!hb!kb !l+!m !n8J !o=J(!p'0!q rX!s`!ub!x d!yIh!zp!{GJ!+!!! !! !! ! !I!!! !C!!o7(8!7P3mm!F&h!F&p!;Kx! ! ! ! !+!b ! b, ! b, ! b, ! b- ! b- ! b- ! b- ! b- ! b- ! b- ! b- ! b- ! b - ! b - ! b - ! b - !"b -!+!*3pid! d! d!+!H"! H"!!!H"(!0!@!KP!KX! !" L!%&!(&!+ r!- ]!. ]!3 ]!4&B!6B!: w(!=+0!>+8!A ]@!D ]H!G+P!H+X!KH@`8!N@!TpM!WpM!ZpM!^_N!k %3!miN!p6 !q6(!t+8!u+@3fs!xsNH!{}NP!~NX!N`!.Rh! uRp! ;x! ;! ;!l>!+! !b!]!R! A!b!9!>! ] ! ] !m4 !  !I !7( !H"8 !R@ ! rH !RP !RX !R` !"Sh !,Sp !+x !1S !? !b ! ] ! ] ! ] !J: !A ! !;S ! ! D ! D !"ES !)S !  ! S0 ! -78 ! bX !S\ !S` !-7h ! !S ! ! ! !  !!b !"b !# !$+ !& ] !' ] !( ] 8!)5 !3S !C& !D+ !LS !N+ !RS !SD( !TD, !Y+0 !] 8 !^ < !_ @ !` D 8!a5H !d?X !gS !iM? !lS !w !x !z+ !} !~S ! ]! ]! ! !&!!! w! w!+!b!S!T!T!T !b(!b,!J0_rcu!50!q:@! D!H"H!9P!Tx!q:! r! "T! T!T!r! ! ] !  ! !>8!5! !!"3!$"38!.5!<T8!F$@@"""#;"#<#=#? b #@ b$#A b(#B b+$B#$C&$D&$E& $E&(-s$E&,-dpl$E&--p$E'&/$F&0-avl$F&4-l$F&5-d$F&6-g$F%&7$F+&8 %+ %+ %+ %+ %+% # pte%# %"#% $ pmd%# %"#&%+$&%%#4&%/$a&' Q$pgd&'#4&'"8$a&p w$pud&p#4&p"^$4&$$@'H$'I+5. cwd6D swd6D twd6D fip6D fcs6D foo6D fos6D6>.6DlDN.+#6*r. rip6+] rdp6,]#6.. fip6/D fcs60D foo61D fos62D 6). N. r.06@.6A.6B.D.+ U6$/ cwd6%& swd6&& twd6'& fop6(&.65D66D69/ 6</6>.j.D/+D/+?6Q0 cwd6RD swd6SD twd6TD fip6UD fcs6VD foo6WD fos6XD6Z>.6[l6\m6]n6^o rm6_p6`q6a0x6bD-0+]0+@6:06; ]6< ]6= 0]0+(@@6O0196P.6Q06R01@?1>+@6^16_-H6`.6a/H6b0@6c11z+(@@6fJ26hb6kb6n]6q]xfd6t] 6wb 6zb 6b 6b96?1@@626 ]6b6b fpu@626b6+62626J2 6J20961@@17 %37 ]7]V53+"E3+U3U3+Z3 _38>38?+8@+8AD cpu8CD9839939<39=33:<4:=b:> w::C4:;33 src:A& dst:A &;Y4; ;m4C4 ;Y4< 4< <"y4====!=%='=,=/m4=3=5=9=<=A=D=H=L=Q=U=Y>#5>$m4>% >' 5%b? 5 ?5 @J6@b@b@Q@Q@QAr6A]A](A6:ctA5A&6 J6%bB6 C6C 6 6D 7DE -7E w F)o7F*(F+  osqF-7 F/(G 7G G GH7H+H7H77H 7H 7H!8H7H7 IJ8AI 7I I e8I7%bJ 8@J'8AJ(!8J)  J* 9(J+90J,8J-9J.:J/;e89988@@K/9K0WK1bK2 p seqK3}AK49K5J8 K6W0K7 89(L9L L+L 9LD 9999M:MM wM: :N ::N::+J:+ N8#:Oq:O w OV:P+:P,P-xQ:Q:Qb`Q+h maxQ+p+:+ R ; sigR:: R: SR SS2;; SU SVO;7;bTz;T T r T T;T';T(T)T-;T. T/T0 z;T1T5<T6T7T8 z; T<d<T=T>T?T@TATS<TT 0TUrTVr TY<TZ 0T[ T^<T_+T` Ta TJ0=TLTQ TWd<T\<Tb< TEM=TFr<Tgq=Th _fdTiTm=TnrToTpb b T%>T*;T2;&_rtT9;TB<Td0=TjM=Tqq=#0U B>U U U U =0U V>> UB> b>U >U!U" ; U%>U'&;U(+U.C;U0 ; U3> saU4> V 2?V !V + lenV +V |(WM?W &&X$?X%$X'X( 0XD?XM#2?XP|(XW|)8Y  @Y]Y]Y]Y]Y] Y#](Y,]0Z)H@Z*]Z+J8PZ8}@Z9}@Z:bHZ;bL @@+8ZD@AZE5ZF-7ZGb0 [>,A[K[Z[p[[[ end[,AV;A>+\!VA\" b \&;A\D}A\DVA \DbA\EA\EVA \EA\T A\YA\Z m4 \[A] A val] ] A] B val]  ] B!S_B!U ]!V ]!W .b![B0!hC!iVA!j!k_Bcpu!lb!m]!n] !o]( !GC!+!!!!rC!+! DG@@!C! ]! ]! ]! D! D!+ !+(!+0!b8(@!E! ]! ]! ]! ]! ] ! ](! ]0! ]8! S@! ]H! ]P! SX! S`! ]h! ]p! ]x!  ]!  ]!  ]!  ]! ]! ]! ]! ]! ]! ]! ]! ]! ](@!F!GC9! 7!! ](!" ]0!# ]8!%@!&P!'Q!(R!)S!, ]X!- ]`!. ]h!/ ]p!0 Sx!1 ]!3 ]!6 !7F!9G!;G!=+Tavg!GrC@E F0!KyG!L!M+!N+!Ob !P$!Q&!SyG(G4!]GG|GGGG!`I9!a7!h ]!i ] !j ](!k ]0!l ]8!s S@!t ]H!ubP !b !b !b !b !b !b !b !b9!8X9!8rq!,I!~G!I!G4!^IIH"(IG{rq(I!|I/!b /!b /!b/!ba!I!!!!!Itb!|Its!D!J!JIs! JJ J1I8J+'' BJG;K ] $@ wD wH7P+` +h)p+x m4 ] rLJ|pidp^7K^9 q:^:b^; m4^<Ͱ ino^=]^? ^@@^B5H:rcu^C5`^D,p@KK+ _ L_b_]K`okM`p( uid`q A gid`r B `s A`t B`u A`v B`w A `x B$`y b(`zR0`{R8`|R@`}RH`~RP`X`_N``_Nh`_Np`_Nx` r`s`4s`g>`x5PLkM|keya_Naq:a5au sema ](aPa rX`a Th uida Ap gida Btaxa|a~a a+SauM dN nN xN N NUXb^.Rb_q:b` wbabb bcbe5 bhH"8bkl>@bnXbq`bsdbtH"hbwpbxbtbzx7bb7bbbbbbAb8b  itbbSbH@bhb wbKbcttybbb Ab]b ]b]b]b]b]b&Bb+b+b+b'+b+ b+(b"+0b,+8b+@b+Hb"+Pb,+Xb+`b+hb?pbb bbb bb(b|bbbF&b-7b ]0NV buRbm4bq:b5b} 3R zR R R R RXcc"Scd(ce wcg ck m4cmcn(co0cqW8R 'SV> 6S @S dSdZdBdNJS SS+ S S S+S+@ S S:S+ S T  TheyTezbe|be}d5yce)c(e90e+Xe#d`T T T T T T2T ff Uf Tfg;Ugrgrgg qUg!g" g$bHg'Ug(Q keyg) g*Ug+r g,r(g-r0g. U8 extg/U@U;U g3 g8CV tpg9CVg: rg;Dg<DqU 25h)iɈ)iʈ)iˈU@@KgWKh cpuKibKjbKkb KlbKmbKnbKobKpbKrbKsKtKubK{  K|9(K} 0K~98AKW@@VSWk9@W+jWj q: k WWWWW kXk(kkW%bWEXW@ XqXrWs9 wqvXH cpuwP X}!X mXmm m hXX5Xr@zY{X| r}r~YX H"(Y0 irqb8b<+@+HQP dirYXX Y)8 Zirq bWW 3Z( HZ0.Z.Z8JYZCZCZW8Z02zZ3&& 4b@.bZ n ZZZZZU@@oC\oD~oEhoF9oGZoHYoIboJboKboLboMboNboO+oPboQ woRoS oT>oU!&oW!&oX.ZoZ'o]+0o^ w8o_5@oabXobb\ocb`odbdcdirogYhrcuon5pooŠoq-7oros otQov~p p"\p\pm4p\p]\pbprr(q0o]q1(q7( osqq97q; q<)q)q)q)q)qr+]r, r-]xs4^s]s4^sD^( lens(HsT^Psp]D^++T^+d^+U@t?_t?_t?_t Atm4@@t ]Ht!+t"+t#|t$9t%Wt&5 t'_0t(+8ccput*@csspt+_H(O_+`t6_t7m4t8D^t:D^(t;+Ht<_Pt=Xt>\O_te_tfb sdatgRath tiWa_VxtDBatE_tFBatH tI-7(tJm4HtK-7PtL+ptM+xtN+tO+tP+tQ+tR+tS+tT|tU+tV-7tWKtY wt\+t]+t^EXt__p_Ra+d^`uvav0v0v"av#5v$v%v'av(v)v+bv,v-v!2bv&av*av.a vYbia opsvcbb Yb^bv2bv4+v6bv7b %be@b%beHbep$ceqberes)c $c#eRcehbe+eycAe5e+Xec .cRc@edebe+e+e+ e |(e,ed0:rcue58eBdHc2beBde idedQd>+eldeqd ld(wdw wSww x Qex]x& x) ] ldtx*Ve8x.+@x9-7Hx:rhx;efpx= wxxC&|xD~ Qey `fyry+ alty+y+y+ y+(yu0y8y@yHyPyXy`yhypyxyy y![e`f xFd#'\f'^ r'`b'Xf&lru'Y vf'd'e'if'j +'k+#('Rgf'h;Kf's+ #('uig'z+ pp'{ng'|+'}+'~( ig#'g'+#'g'7h' rz7hzt refz|8zKHzhzblz+p opsz xzrzgX('Qeh f g sg gd'5'h'b' wa' hval'+4'hI'Mh'N r'Pb?'Jhtlru'K h?'Wi'X r'YhI@'Gi'I+h'U;K'V + h('[ w0'\ w4'^+8Y@'Fi iH'j$I('m j'n+'o+'q w'r w's w't w'vb Y@'l*j iH'z$I0'}j'~+'+' r' r' r ' r(I 'j'+'+'Y@'|j *j jH'$G'Dk5i5 j@5j4'+kG !l ; m4 0  ;K r (b0b4pM8߹@vP p  rx#$ % '5k'5Clctx'6Hl Cl'=xl'>W'@,A('Xl'Y ]('\l'b+'h+'tA'w '}$I'm'+'+Y'/m lH'5?'Tm'k'k '}mTrb'7'+xl m{b{n{c {h {j{k{q {s({t 0{u'8{w;@{{H{~P{cX{w`{h{p{xm{nMll'n']cid'' @@' n' wa 'o''+' S@@'r5n@'\@'+P'+X'+`'+h'+ppgd'  q&x') w'5 w'?r'E+'Lb'S w'Z ']('_'am4'p ]'r''+'+'+'+''+ '+('+0'+8'VA@'m4D'+H'+P''+X'3+`'+h3brk'+p'!+x'+'+'%+'0+'r' s@' s'jf'+h'm4p'*sx'H"'4s'!l'&>s'+'+'' w' w'Qd'('W'Hs'+'+'(' nn+ s+3vds+ s %s /s 9s Cs+\s>+4' bnsp{/sk{7s(pmd{9 {&0pud{; '8p@{E$H{F$Ppte{L v&Xptl{P5`{T $h.b'^t @WWWWW)|6)|9)|<)|G8ztz+z2z2z+z+ z+(z|0}v}}Q ops}} r }b(}b,}-70}vP}vX}t` gc}"h dev}zp}zx}v}} }T}b}}tS| v%b~:v@~/v~0v ops~1"w dev~4z~5~6(~78:v:v~w get~'{ put~ 7{~ K{~i{~ K{ ~}{(~ {0~{8~{@~{H~{P~ |X~"|`~;|h~m|p~"|x~ |~'{~|~|~|~|vw(zŠz@p(HQPXbus`h rp rx-79}-2< 3msi(K8@]H]PZX _`hix s{v L3idDm4 !!# $}%'#) + |` , |a - |b . |c / |d 9 |e < |fww~Qz~Rb id~Sb~TzvP~f{~gv~hb~i0v'{v{7{v,{|K{z<{ud{zd{zP{v}{zn{|{zQ{{zQbr{{zQ {Q{z{v |z{v"|zv|v;|zQ'|h|zQQbbh|z@||z|zr|r|v||zb||v| <||||i}n+v}8_}`(a}b}c |d |:rcue5 reff|0|} } v + %}.b T}} } ~++ } n}hu~bb r ''@h  irqbb devz msg u(0 8r@ &HPu~8D irqbTiv n( r0~`iQ    ( 0 8 @ H P āX ݁` ݁h p x      ā  6 6 Y w   ! # ā$ &+bnsnn!&|ān݁nbɁn n =6$FTnzZT|;wnzZ|^nr|nbn!&,- m4/ $0r03K4678 | xa9  +7 rev+ ll w wlQ:rb7 nsu0b8< X>@ id]` rhp:rcu5x  ops}! lhx "ņ$ %  & (( 902 89|@: 9H= \P@uXA `x  &dirKq  knl!l r-7 -7@`h !x    |@  |A %nąņrrކކʆrrކr9!4RRW >u&az%b0'() v* !+?,I - (Sru55: &SuDD Xb  ]] ino)] dev* L(+ L, uid, A0 gid- B4. 8/T@0TP1T`2Tp3]4]5D6D7]8]9D:D;D.ɉ.Q. X.m.n.o&X.0.1.2 .3 r.4ʋ .5 (.7 $0.9 8.; $@.= LH.?oPXzŠ@@uAQBCD' E( sdFl0GW87Ib7Jb7Kb7Lb7MbŠXzS;Kŋ!l!ϋ$!l!L!l)o!l&Q.. . tz!zQŒ`' m4Š X0tu vw!x*ʍyލ z (,)ōuuލōύōABV }Y~Yicbufy !i+!y+?Vz+؎ӎōĎӎQōݎ ō o9 cntob&&%b"~ ,Џ pin-./D@0DA1DB4567+8 !R3S~&uvTЏHIJCKDLDMTN!&O  P r(00+++ack+eoi+ +(`PmZ8D@DD )Hx!x" #r$ % & ' ((b0)b4*D8+D<,D@-bD. rH/+P0+X1v`2h3xDrxDrmŒ>+.b@ ReSbTbUbVb WŒX gcYe t>+%b      b!"]&ptr#r!+ 6 b ! +(,Ĕ--.. //0B1 N  idB clsɔȌV[[ k@uVk+V{++  D ٕ!r ٕ0{1Q2 3Q4:v6ٕX7ٕ`8{h9{p:{x>+?rޕP}?}@v}A}B DŖ+P}eU}fs}h map}j}k ɗ}l }q(}s 80}uV8}v k@}wHŖsv{tZvtxvbTɗvbv{b&+NΗvbbr8vbb#Vvn|=kvn[v&+pU ?@DADBDCD DQE v n)>+ 3#DDD D DD 5D™ #: D!D"D#D$D%D &D #()D*D+D,D-D.D  Ι : 167D8D 9̚>$? D@BFC DDFhG DH™mnDoDqrstuvw x bz{|rl>hybp]&ptrrr>&pcipMZ ijk m <  rPb   Ǟ  ( 0 )8 )@ QHT]H] DtbopsVi r Z( r0Q8 r@)vbT]gvbǞvz]v] ̞] vz)vzLvL+T.Vk+/|zvvk])f(+++++ 0#:rcu152W3#2>+ HIJK LM+NMs @ H endHQ++  ( 0& 8:); <  !"# $(%0&8'@(H)P*X+`,h-p.x/0123455zz.U.blHxsy m4zb|b}-7~0x@ s(8)/ | / |!/ |"/ |#/ |$/ |%/ |&/ |'/ |(/ |)Dm4 K ̧@  |@  |A  |B  |C  |D  |E98P]W5֧ w w b  |  |  |  |  |  |  |   |   |   |   | b]]]]ۧ  (3qos0+̧,Q id-./m4 0֧(1902+X3 `4 h5 p6 x7 8+9+:+;+<+ dev=z7> |7? | ѧz5 pops5   z|pzbMNQOQP!Q!R! TԪ(U0V8W @X HY P[X\`^h_paxcd pmf h|ȩzȩϪ`ϪaQ busbd eQg| h$j(k0m8n @oHp PqXr`s!ht!p pmv xw pyͩd{ ٪z)`23Q5!6!89 ܫ ; (< 0>8@(@AHC P pmE X!׫d{׫Xëud{d{ 0XYQZ![\ ^ pm` ($+rr ƬBEDEEJFYGhHIr OT ^c#AK :@ mNӭO+PQ (+!,-|.|/  0pq!lr s t ru v&$S(!ӭ"#׮&׮'׮' ܮ׮#m4 Xd 45#3X4D len4D2s 46]1X8 sijk5rstdu5RȰTbUAVWͰXs Y0[8_"ȴ``ha+pbrxAdmn:d_uv(x{| X}~ A Bb !k (;K0 r8+@ H LL P TX T` ThDpDtDxD|m4 D ]++u&& E0@H wP wT wX w\jk`h8LJp8jH P(X`h rpҰ +'@ôɸɸ( <( L0 L8 a@ H P*XC` ô(@ L+  L(!0!8@"H+P+X+`Ͱh ]p wr&#$+0  : !l D Nb (8` rDTT!D"X/ [0 614 ]6b<-7 BQ@D"ȴHF{PI(XL`O dRXhSpZ4sxab_rcuc5dWf-7k08nm4@@oHqm4Xr`ʹ%bɸͰbȰsθbQ(<Ͱ-LͰAaͰQ!Ͱ!f EƹFͰGHIչչڹ߹ mnt չ Ͱ߹ƹ%%|ͰCͰ/ "#$ nid&-+4+7SRgSUXYZ bc q: dK(:rcue5HgrXj` idmpptqQxrͰu+{{Hg( Ļ " $m4@@- lru/0( Ļ^2 nr^3 ns^46,+;>+ R val] ; b%b )+  a aalA:rcuam5anq:ao |#aveax&ay %au~ A&xa+(arƽat+eaнaսaQ ƽƽ b aara ڽr+ a!&D_NDI_N˽aa keya_NaнXaƤada7aƾa Ta T#(aa+a+aнaսa ! (a,a~ ƾI aSaa ¼? apaڽ , p zN  q:vd+0(8@ uid AP(X w`$ h`A` q:` gid` ABP>+X`s`rcu`5 >+?8bb b! b"+b#]b#] b$+(b$+0b'b(]b)]b0Sb1 b2 b3 bCnbDbLbMH"bNn8bQbR wbSnbTK+K+  }:+  #HH"05A5 ` :rss H+0-85@ wX  fn  arg r  DcS/cTcU}XcWPcXdcY58cI qcJ ioccK"S 5/ c\b0 P  val  val % $. ;0  4$ 4|5b6|7+   A  B Pgb X  TT(T8 !lHlЮ(#)*+ ,0--7@. m4`/ wd0h1p2 x3+4  F val # /%b6u BE&uidF A&gidG BH FDJRHS u u u u u  u( u0 T8 T@H+ b(b, u0 u8r@ ! @89:;<= >(?0@8"gXDEFG HI J(K0N 8O@QHSPgguFxYZ[]\]]]^] _](`]0aS8cS@dHeLf]Pg]Xh]`iShjp8bbbb bbbino  ( 0b+ \bbb bbbbX(AA d(08@HAP\(% Ab-__Fi`8 # b  ] #0 3H3ops!C 3+SC+S+?wx}} xr, E _ (0 8 @ H P 8X[`oh p x $ !lj,;K|E;K1UUZ J!l;Kb]d!l;Kbbr ;K |$8$[;K=o`|tTT;K!l  !l?EibYkH5?! e?S ! b  (@Zf[\2]P^n` b(d0e8f@h1HjPkYXm`ohppr xs!u:vby{}Jf p z   (!l 4pidK6uid AA $ v +bb bb ? -7 ]Y )H*5+3,-}4Pr(0;  9;kL+    ( 0 8@HPX`$hBp x[[[[     Q     !&G 5 ? I SVm+$4z|Q]b mpos 4 b!l !l!ކC!lQކ%aabf H!lp4!lR!lb+!l&!l!l)!l G!l.e!lej L+!l++++tTS!lކb!lކSb!l] A!l#V!lF!l!lb[!l!lbb abͰͰbQ-Ͱ-P7n|UͰ!sͰX|ͰͰͰͰQ1ͰXYͰXL6ͰͰb^Ͱ%DbNͰ!]] :&bͰ!lbX?!lXgͰͰͰ Ͱ 6mt \ +EE 6.bssOͰ B&!)[ͰG!`Qg  Ͱ-LQr B+ * 5 . DdwdN    w 0(+A)+k7<+ d+ b & t"V+7`-.Š mod/ @0H mp1P2 LX 85b67 9 ; <(= 0{{!b{Q Q  .b>G8E<modF 9GGPpqrrrs|tbTmtnw  b!! ?9Xk< +'  !U_V D:~QQ+Ij <%b-V ͩ!d{׫z!<zQzbb+.b.b8 z0@!v"E @.b1.bB.bOc#d&Je2f4g| lidh| #2 7 AF PUA{cmad n x )/hL busMrNO|P QŠ(( rr(Y8@ Ppops rY[ z_devw b b  w   b " "(56-7len7b cap8$?Y (` JTKbusLrMrO r PY(Q^0Sb8T<U>V@WBXbDYHZI\&J]hP`rXaY`cDhdlemfn gxhppiniqj&rk&xmgn]tAvy zb( |b- }b. ~b/ b0 b1 b2 b3 b4 b5 b6 b7 b8 b9 b: b; b<bb&q b b bTdevw3irqbv|@ bB b B b B b B b B b B bB bB bB bB bB bB bB bB bB bB bB bB bB bB bB bB bB b B b!B b"B b#B b$B b%B b&B b'B b(B b)B b*B b+B b,B b-B b.B b/BF wH m4LP b@M& b`M baM r  3vpd & bPO  j &  & D b`P &  &   &0 2 3rom<8  @ QH  +P #{X  c m`gQ    ( 0 8 @ H#P!X!`ͩh|w l++  ( (! 8"V#~$ T +(r8r-rVrb=~rb)[rbD;<m4=4H b8_Tamehk l o (r 0mYYYrYĔYY)YYD YT%bzEBzNwzT zZzeB$|\sis7h++~z#zzz8+>+zz8+ wI({0kvma{1&{2 ${3 +{4+{5+ ?{>{? #{@ $&&+&&+++\s isb\s'is+++;&,c&+r@Qw&h&S|S&+&$&+noDp&G%bK0s2 3QK++6s08:=Q?bE I (|QQQQUOPQQQRQST :devUwPV@WKHXWhY^\ w] w^ w_ w`b0#1 2 V$4 cmd6  err9 <  bus=  > A B E G  I$+M cmdO  errQ T  busU  V V<XGZ  op[#\(V " #r $-7 %( &0 '` (d )h *+p +Wx op ,#0 /~ 0 1 2b 3b 4b 5b 6b 7b 8+ irq 9b( :,A, ~>5 ^bbbbG abb@ hl iQ j k  l o  p ( add r0 get t18qY+++Y|YY1bbb{(AlJJ |gXWK>br5N*]QeN<bbJ{Yu J 2r $J 8r,}$J ?rH$l ZuK}pbN4d{QeK, Q JzYNUK ZYDK XY)KJbXX+QrN8bd{QeKxKubrN2d{QeNd{QeJ&J  &l<!Ylu3YlwEY5nirq2v=rdevYfn6  @F%(5 X%E%^ %Bb"JUh#T Qv,]+s  5q irq(v3rfOeoi|ZKPZ/f"U C( ( (,* H &* 1*g=*h>*Ed  p0!}C+ CB(  S( ^(,Y) j) u),) $ ) )D( ( (,* H &* 1*g=*h>*@@',  R'E`' mr' ~'"FU @Qs@B(1 S( ^(;Y) j) u);) $ ) )@B(2 ;  S( ^(;Y) j) u);) $ ) )@$9Q  $ $Lp(   ( (,)  V ) )g*h *,$ m$ $"T1"gT3Q1R0v*Wfw% fr@[ 0!!!,!8!EC%3M  % !% -% 9%UCF%R  X%D%^ %C(  ( (,J* * V* a*C(   ( (,J*  * V* a*@M` ^ j v0!!<$i < !;(  ( "(0Q.("U TQ LF%  X%D%^ %<"U T =UBZ"pUT @c   0<i0<=!>;(  ( "(0Q.("U TQ n!! LF% X%D%^ %"!UBZnQ8!R@j|   0< i#<2!3E(  ( "(0Q.("U TQ n!m!CF%X X%D%^ %"3UBZ@Xg i u 0!!!!<i<!;( ( "(0Q.("U TQ L% %n!! , & )& 6& & )& 6&!C&EQ&  c& p&"T of% 9 x% %m%0!%"UT<-iG*@$ $ $Lp(  ( (,)  V ) )g*h *;$ m$ $T0B:+A_'A:OdevCYPDnOopE_PFOnrHb*Oi{b#%'%EOeoi'|1|'G1C'5MdevYMop/_pS 6 Pn*  62u*P|]S+C$4devYop._+n[i+ +[cmd&p 6\ 6]*+|6-+ + r6c\ 6T]*+|*x_rs *^ ^ ]+r6$M4devYop._p 6+n*\ 6=]*+|$&3devYop-_+n+p6 6x_rs *^ ^ *\ 6]*+|]6+&mdevm-Yxcmdo&fo%} %E'4 ';'! 'E' '=.UsT1=FUs=!^Us=3vUs=UsT4Qf=UsT4B:+ $dev3Y<qnrcqout^Z!\> w ]>Z q>|;( > ( "(0Q.(L%>! %D'4 ','! 'D' '"U TsQ Rv,6"^S ^S Z#\_ wX"]_Z"q_|;( _ ( "(0Q.(L%_# %D'4 ','! 'D' '"U TsQ Rv,oF% $ X%E%^ %L&O$ ' ' ' '' 3'"T Q0R X~Ys=x$Ts"UsT Q~R % ? b$ YF% 0 Cbbus b (b1\rf%'\5Y1}%Mdev}9Y'~'~&Orc12%'22Y1,Y%Mdev,:Y1r &Mdev:d{1 (rQ&Mn D' N' Z$P  1 |.r&' |D' |P$*P b1 %b&' <' |*u 1 z0}&' zC$' zX+$@'irqb-XD+Qdevr1|`''6W1|'Mwq8X'W$'v'1'Mv!'$'v='$3!|(3<|$"|8(key"J=("Z(D 8($ |k(nr + ;k(<$ R|(nr R5 RQ(7$ D|(nr D3 DO(R '(nr ', 'H(R^)v^O)^Y|RP6)vPJ)PTRBY)vBI)BS$ |)nr + ?k($ |)nr 4 Vk(+ |$ |)nr 4 Vk($ |*nr  :(*[c |$ |J*nr  8(*[c |R Hn*nr H H1($|*nr+@k([pT++[val+R*ptr<)H$,|+p,;),Kb$(|:+p(:)(Jbh86++G+S6L6X p6 6 6 6 int X ,6 *6Ms8dMu8wMs16Mu16Ms32+Mu32:Ms64Mu64X! v 6 +  1X 2X H I X ] ^ _ `L66 <X  : 7     #s6 % & 4 = B h+ m n: } I S S X X S ' + b  K  I n           L+ C C SSCH`gWqH p G   " 6   (   0  E8  @   H   H  H ;H  H  H   H   H/@      ӎP h  G G y    X 57kp   X( X, 0  8 s@ sA sB XD  H bP_mem @ m +  X     % /  ( X0 X8 X@ XH XL 4P XX 9` Xh >p " x X X   H X  X X  X X ! "X % & 9X : ? A D l F b P  QX( T 0jp+W+&   &  -val b" " /  , &_  _  o +  b";   o /   vv   /  W   X+, fmtGGGXGG$W e f+g" h, u" v+w+ keyx ' UR V b jo keyk1 n keyo1 6 7R 8o 8+ GGGG<X<X<4X key9 (+X=T  8U V modW XGY Z ([ ,\+ 0pG u v wxXyX T +XL-+ /o1X set3 get57 -` R       )  L   ,(  ,0 t8 !@ " H # ĽP $ ĽX %ݽ` &h 'p (x )2 *P +x , - .x / ; 0  1  2' 3 J 5 _ 9  ;  >2 ?ܿ @t  !+ key"+?A+BC  mod W = >X!G! (EFG modG  opsH!tI &JK  & !XL-argM X-strN-arrOo VWXX \j max^X_X num` opsa!tbXjo&o !% + -/  XXGGG/-@ "\4XX X 9( X,!X0( 4)$8*XH++P,"X5 `6 d8 h: l; p< t=XxXse?RD@7rt@E_dlAQFBLFFH=IQ6J+KXOHXH]H=`"B@dhXkX l+m nH oH(p0#0q XXs`ubx dymHhzp{H+      mH A6(=Q6P7mm-h-pIx    +X  X,  X,  X,  X-  X-  X-  X-  X-  X-  X-  X-  X-  X -  X -  X -  X - "X -+&7pid [ [+" ""(0@~JPJX "J%,(,+ X- S. S3 S4@6+8A S@D SHG+PH+XK>`=N:?TLWLZL^Mk 4mMp&5 qK5(t+8u+@7fsx#MH{-MP~7MXAM`Ph %Qp 9x 9 9=+ XC/Q @X8= S  S 5   H 6( "8 9Q@  XH CQP MQX WQ` Qh Qp +x Q d> X  S  S  S 8 Q@  Q   :  : "Q )3R    =R0  58  XX BR\ WR` 5h  aR       !X "X # $+ & S ' S ( S =) 3kR C D+ LpR N+ RR S:( T:, Y+0 ] 8 ^ < _ @ ` D =aH d/>X gR i= lR w x z+ } ~R  S S   b b+XRRR7S X(X,H0_rcu09@ D"H:8PSx9 X "S SSX  S    >= !"l$$"l$=.<S=F+@@ ( #  ##+0#+  ;#0# ?M##]#+ X"$      0#cg$#dG#eRz#gpz#i z#lz x($ $8$$9$ $<$$=$$%<$%=X%> b %:%%;$$ src%A dst%A +X&'%(&%&% val& :&!: &":&#S&$% :&*%&+&%&,#% '%'' % (%(V( +%&'7&&(g&)%%&.S &1&&2&&3&4 &5+&6+ &(&&&%'%&/&&77& 8&&&+ fn& &&&&&& )(')S end)S *;^'3cs*=S3sl*?S3wfe*AS *E'3ss*GS3sti*IS*KS3nmi*MS*PS *SS0*VS83lm*XS9*]S:*dS<*#(-cs*-csx*S*('*P(-ss*-ssx*S*^' *gV) r15*m+ r14*n+ r13*o+ r12*p+ bp*q+ bx*r+( r11*u+0 r10*v+8 r9*w+@ r8*x+H ax*y+P cx*z+X dx*{+` si*|+h di*}+p*+x ip*+'*+ sp*+#( +B*+C+D+E +E(3s+E,3dpl+E-3p+E'/+F03avl+F43l+F53d+F63g+F%7+F+8 ,+ ,+ ,+ ,+ ,+, a* pte,* ,"J*, * pmd,* ,"m*-%*-%%>*8-%/*a-' *pgd-'2*8-'"*a-p *pud-p&*8-p"*8-++@.HZ+.I+9cc0. b4.+8 /;+/</=/? X /@ X$/A X(/B X+/@@0,0(4sp0+es0 ds0"0$0&0+(0+008480+X0+`cr20+h0+p0+x0W40+ 0X0:0+0+0 3Xfpu0 f3@# -/@@.3-9j@.n@*a**G-N.R.9h.-. *h .s(.,.h0>.h8.X.hh.%ip.+x.g. X.i.]#.aR.i.g* 1 .1 1 .P(2 2  p3!/ cwd3: swd3: twd3: fip3: fcs3: foo3: fos3:3!/3:l:1/+&3*U/ rip3+S rdp3,S&3./ fip3/: fcs30: foo31: fos32: 3)/"1/"U/03@/3A/3B/:/+ Y3$k0 cwd3% swd3& twd3' fop3(/35:36:39k0 3<{03>/k/:{0+:0+? 3Qh1 cwd3R: swd3S: twd3T: fip3U: fcs3V: foo3W: fos3X:3Z!/3[ l3\ m3] n3^ o rm3_ p3` q3ah1x3b:W. }1+S1+@3:13; S3< S3= 1S1+/@@3O2>3P/3Q13R2@ "2A+@3^w23_.O3`/3a0O3b1@3cw2 2w+/@@3f-33hX3kX3nS3qSxfd3tS 3wX 3zX 3X 3X>3"2@@3f33 S3X3X fpu@333X3+33333-3 3-30>32@@2 4 44 S4SL4+L(4+?V)84+H4H4+M4 R4 5>45?+5@+5A: cpu5C: 646S6S(64?ct66&4 4+X7!5 8A58 F5 A5 9 f59 : 5: b;5; ;55 ;5< 5< <"5 =)6=*]#=+  osq=-f5 =/ (> Q6> > >?6?+?6?6Q6 ? 6? 6 ?6?6?6 @6F@ Q6@  @ 7@6+XA /7@A'7FA(6A)  A*7(A+580A, 8A- 9A. :A/ ;777/77@@B/58B03B1XB2 g seqB3*@B47B56 B6=0B7 87 (C|8C C+C 8C: 88:8|8 D8DD bD8 8E 8E8+8+ E88 F9F b F9 G+R9G,G- xH9H9HX`H+h maxH+p+9+ I 9 sigI8 I9 JRv JS99 JUq JV99bK':K K X K :K'W:K(K)K-:K.K/K0 ':K1K5:K6K7K8 ': K<;K=K>K?K@KAKSB;KT KUXKVX KYf;KZ K[ K^;K_+K` Ka KJ;KLKQ KW;K\B;Kbf; KE;KFX;Kg<Kh _fdKiKmO<KnXKoKpX b K%<K*3:K2W:-_rtK9:KB:Kd;Kj;Kq<&0L <L L L L O< 0L =< L< = L A=L!L" 9 L%=L'9L(+L.9L0 9 L3= saL4A= M =M M + lenM +M s (N=N # O$/>O%+O'O( 0ODd>OM#=OPs(OWs) 8P >PSPSPSPSPS P#S(P,S0 Q)>Q*SQ+6 PQ8*?Q9*?Q:XHQ;XL>:?+8QDp?FQEQF5QGX0 R>?RKRZRpRRR endR?L?A+ S!@S" X S&? SD*@SD@ SD@ SEQ@SE@ SE6@ST @SYQ@SZ 5 S[]@T @ valT T @T @ valT  T @S AU SV SW 4X[ Q6! S(" S0# S8%@&P'Q(R)S, SX- S`. Sh/ Sp0 Ix1 S3 S6 7E9E;E=+XavgGB@RD E0K&FLM+N+OX P$Q&S&F(E8]8F=FsLFLFQFN`G>aQ6h Si S j S(k S0l S8s I@t SHuXP X X X X X X X X>/7X>/7rqG+FGLF8^GG"GLFrqG*H5X 5X 5X5XamH    Hxb*Hxs:HHHv HH HGH+<#0# HN I A q X  @  bD  bH 6P +`  +h )p +x   5  X  XHpidpU7~JU9 9U:XU; 5U< inoU=SU?f U@@UBXH?rcuUC`UDvpIJ+ VJVXVYJWoLWp]# uidWq @ gidWr @ Ws @Wt @Wu @Wv @Ww @ Wx @$Wy X(Wz0W{8W|@W}HW~PWXWM`WMhWMpWMxW XWWnW=W9٢JLkeyXMX9X}9 X semXX(XPX XX-`X Th uidX @p gidX @tXxX|X~X X+ܡX $L M M (M 2M YnhY bY~JYcttyYYY @YSY SYSYSYSYSY@Y+Y+Y+Y'+Y+ Y+(Y"+0Y,+8Y+@Y+HY"+PY,+XY+`Y+hYd>pYYYYY XYYsYYY-Y5YX0FMZ Y%QY5Y9YXY P *Q 4Q >Q HQ RQ XZcQZd]#Ze bZg Zk 5ZmqZnT(Zo0ZqV8\Q Q= Q Q [3R[c[K[WQ 8R RR+ RR \R fR+R+p? R RR9R+ R R Rh\y7S\z^\|X\}_9^\^(\:80\+X\#_`R @]4S]5S]6 X]7+]8+]9T ];X(]=X,]>'0]?[8\Z kep[kfX sdakg\kh ki\.[ZxkD\kE)[kF\kH kI5(kJ5HkK5PkL+pkM+xkN+kO+kP+kQ+kR+kS+kTskU+kV5kWJkY bk\+k]+k^XWk_p[p)[\+Yu[lm\mm1mm1m"-]m#+m$ m% m'Q]m( m) m+u]m, m- m!]m&\m*-]m.Q] m]\ opsm]u] ]] m2^m4+m6Xm7X +X\@7^+X\H`^ \p^\q7^\r\s^ ^&\^\]\+\^F\\+[\^"^^@\_\`^\+\+\+ \ s(\,\_0?rcu\8\_H^] \_\ id\__A+ \_\_ _ (n)`n nInn o `oSo& o)X ldto*`8o.+@o95Ho:Xho;apo= bxoC|oD~ ` p apXp+ altp+p+p+ p+(p[0p8p@pHpPpXp`phpppxpp p!`a oF)`&.\ b.^ X.`X.X>b-lru.Y"a.d.e.i`b.j +.k+&(.Rb b.hI>b.s+ &(.ub.z+ pp.{b.|+.}+.~]# b&.b.+&.c.c. X qcqo refqŦ8qJHq_hqXlq+p opsq bxqXqGc[(.Qc"`b"b"b"bd..c.X. ba. dval.+8.cP.MEd.N X.PXB.Jbdxlru.K"dB.Wd.X X.YdP@.Gd.I+Ed.UI.V + bd(.[ b0.\ b4.^+8\@.Fe"dO.j+P(.m}e.n+.o+.q b.r b.s b.t b.vX \@.le"eO.z+P0.}e.~+.+. X. X. X . X(P ./f.+.+.\@.|Rf"e"eO.+N.Dvf9d9}e@9/f8.+vfN g / 5      I  X  A( X0 X4 L8 )@oP  p  Xx #Թ $  %  'ٹ9f.5gctx.6g g.=g.>X.@?(.Xh.YX(.\[h.b+.h+.t7.w .}$P.h.+.+\.h"[hO.B.h.f.vf .hXrb.Q6.+g hrbirc rh rjrkrq= rs(rtV0rut8rw@r{Hr~PrXr`rhrprxhigh.9j.Scid.. @@. Tj. ba .j..+. R@@.gn99j@.^X@.+P.+X.+`.+h.+ppgd.  3-x.) b.5 b.?gn.E+.LX.S b.Z .]]#._.a5.pX.r..+.+.+.+..+ .+(.+0.+8.@@.5D.+H.+P.'+X.3+`.+h7brk.+p.!+x.+.+.%+.0+.ln.|n@.n.a.+h.5p.nx.".n.g.&n.+.+.. b. b._.]#.V.n.+.+.]#. Tjj+|n+3_n+ n n n n n+nA+8. Xnpr/jor7jo(pmdr9 =-0pudr; R.8@rE+HrF+PpterL 8-XptlrPTT`rT +h4X.o @eeeee0s60s90s<0sG 8qhpq+q2q2q+q+ q+(qs0 tyqttG opst7t X tX(tX,t50tyqPtVXt` gct"<h devt~pt~xtyqtt t?tXtqthpWs~qu,qu- 5u/ u0Xq 0v3rv46v6v7v8 s xav9q wVrw+w6w[r revw+ Vr w{rw5sw5sw bw bw5swG?rbwQ6 nsw[0wX8w<w O>Ut@ idwS`w Xhwtp?rcuwx{r w|s opswFtw!Ptw w5shwAtwouw uw"uw$ uw% u w& u(w( v0w2 8w9s@w: vHw= /vPw@HvXwA fv`|sAt Kt wt-dirwrw`rw:s tt w[u knw5swgwtw Xw5 w5@w`whw xw   w  s@ w  sAw %ijujut[uujutuutXuXutuuXutXuuutXu vjuu+%vju%v*v vHvjuB-4vfvjuMv+Xxv 0x'vx(kvx) qx* vx+wx,w x- (vWXv[ww w vW[w ytxy:y OyXy  ySyS inoy)S devy* C(y+ C, uidy, @0 gidy- @4y. 8y/U@y0UPy1U`y2Upy3Sy4Sy5:y6:y7Sy8Sy9:y::y;: #x#G# O#mx#n^y#o&hyX#0Yy#1tx#2 #3 X#4z #5 z(#7 z0#9 z8#; z@#= {H#?B{PxcyxryYymyOyyMzy @z@HzzAGzBzCyzD{ zE`|( sdzF5s0zGX8<zIX<zJX<zKX<zLX<zMXytxwyOpzymyWzzymyuzMzWIzzgycyzzgymyz{gymyzB{gymyB-${#r{# {# {G{{yMzw{{yMzG{ `z{zz 5zyz }X{ 0zt[|zu p|zvu|zw!z|zx*|zy| zz |({[|p|ye|r{|g$|||vHz|[|||||||@@|Z z},}z~,}z<}zcbufzL}z <}+L}+?L]}w+ z}z}z}z}]}}|}}G}|}}}|}|}}} ({@~{+{+{+{+{+ {0u~?rcu{1{2X{3u~}~A+ {H~{I~{J{K {L{M+{Nn @~~/y~@pHGPΎXbusZ`ih Xp Xx5>… 7msi( 8%@SHSP4X 9`hDx NnV C7id:5 6!!z|# $`%j'#o)y + s` , sa - sb . sc / sd 9 se < sf~ @|/|3 end|3|G|+|+ |/(|/0|&/8Y@@Bg3Bh cpuBiXBjXBkX BlXBmXBnXBoXBpXBrXBsBtBuXB{  B|7(B} 0B~78FBB@@4W8l7@S+ }:n}; }<S}˄}߄}  }!߄}"߄}#߄ }$߄(}%߄0}&߄8}'߄@}(߄H})߄P}*߄X}+߄`},߄h}-߄p}.߄x}/߄}0߄}1߄}2߄}3߄}4߄}5߄z߄~Є~4}U%4X}lUH}x}y 5}zX}|X}}5}~0}@ /8}}n5} s 5} s!5} s"5} s#5} s$5} s%5} s&5} s'5} s(5} s)}:}5 }}J }@ } s@ } sA } sB } sC } sD } sE>}/7P}S}V}X}} b} b }X } s } s } s } s } s } s } s  } s  } s  } s  } s }X}%}}}}}S}S}S}S} } 5(7qos}?0 ~+~,G id~-~.~/5 ~0(~1:80~2+X~3 `~4 h~5 p~6 x~7 ~8+~9+~:+~;+~<+ dev~=~<~> s<~? s U5~+% :}ops}z}߄} Ŋ}߄} } }ފŊ~sފ~Xʊ MNGOGP!z|Q!z|R!z| T(U70V߄8W @X HY P[߄X\߄`^Ph_߄pa߄xc߄d pmfUhs ~  `aG busbZd eGgs h$j(kZ0m߄8n @o߄Hp PqPXr߄`s!z|ht!z|p pmvUxw pyd22}P~n<˄ `23G5!z|6!z|879 & ; ;(< 0>߄8@(|@AOHC iP pmEUX_!2!O 66+[O2@i2||T 0XɎYGZ!z|[7\ ^ pm`U(nɎ+  X 8X BDEFGHqIX 8  &Aԏ=K :@"NO+P Q  (+k, -s.s/ ԏ 0 pԐ qg r  s  t X u  v$G(k "#! &!'!' &!&O5 [id"+~9O&34: len4:2"~6S 1ޑ8 ijkXr:stduRTXUQ@VWX YA0[F8_"``ݚha+pbXxFdimn?d_uv ::/x {A | O } ~ @  @ X    !d  ݚ( I0  X8 +@H  CL  P  TX  T`  Th :p :t :x :| 5       : X + +   n       >0 @ H  bP  bT  bX  b\kd` xh= Hp 8kH  P (X ` h  XpV+'@ 6^r ( 0 8 @ ɛHVPtX`V /@ ݚ   C  +    E( !ʻ0 !ϻ8 Ի@ "H +P +X +` h Xp   b X & #   $$ )  ސ  3 g = G  X  (= `  X : T T !: "Q / V 0  1  4 f 6X <5  BG@ D"H FŝP I]#X L` O d RWh Sp Znx aq bq_rcu c dV f5 k0= n5@@ oH q5X r`+XX,,1Y,XGYޑ;r,cwAɛ EFGݚHI^$Λ) Q mnt  )oosQ[y "# nid&-+4+7RRSϝUϝXYZ Xc 9 dJ(?rcueHgXXj` idmpptqGxruԝ+ŝŝʝ]# vv v" v$5@@v-6 lruv/ٝv0]#  U2a nrU3 nsU4a!5v+;A+ valS  ݞ X+X   ? 0 sx+ s X XXlʟ?rcuXmXn9Xo s&XvXxXy Xu"ʟ-xX+ (XrOXt+XYX^XG OOb XXXX cX+ X͠M͠ҠMT X X keyXMXY[X-XdXQ6XOX TX T&(XX+X+XYX^X  (XX"OP XܡXX KB XXc"  נ  9_+0]#8@ uid @P]#X b`$ h WʢW 9W gidW ʢ@٢A+[WWrcuW=+? 8YY Y! Y"+Y#SY#S Y$+(Y$+0 Y'Y(SY)S Y0ܣY1 Y2 Y3  YCYD YLYM"YN 8YQYYR bYSYTJ$n+~J~+ ~ *9+   Ѥ"0XF ` c?rss Ѥ08X@ bX   fn  arg Xw+ b   :ZSZTZU[ZW ZXdZY8ZIJ qZJO iocZKQǥ9 Z\X0 J Y z val c val  <Ŧ in+v]8_X`]#aXbXc sd s?rcue reff0 w v + %b4XTէ++ n+ . /0  4 4p5X6p7+    @ z  @ P [ X O   U U( U8 gH`М()*+ ,0-5@. 5`/ bd0ݚh1p2 x3+4Ī  : val  #+X6i BE-uidF @-gidG @H : DĪuJF HG i i i i i  i( i0 T8 T@ Hʫ+ X(X, i0 i8X@ ! ʫ@89:;<=¬ >¬(?¬0@8ݚ¬[۬ݚ۬ǬXDE¬FG H¬I¬ J¬(K0N Э8O@QHSP[ݚ[˭˭AiA:խA˭xYZ[S\S]S^S _S(`S0aI8cI@dHeLfSPgSXhS`iIhjp8XXXX XXXino  ( 0Xѯ+ PXXX XXXXX55 X({08{@H5PPݚo5ݚX!SݚSѯ:vݚv ]ݚ۬vݚ`8  X X 0 'H7ops!7 A'+G7+G+B wl }q  lXvԐ Ƴ      9  S  ( 0  д8  @  H  P  ,X O` ch  p  x     ߳+߳ ˳gRf I߳ s9I%IIN >gIXXXgIXXXдIմs,ԐِOIݞ1cTshsI׵׵gܵ gԐِƳB > _ X\ d O B  !  RAB ݶ R     X ݶ /@ Z_ [ \; ]Y ^w `  b( d0 e8 f@ h:H jP kbX m` oh pp r x s* uC vk y { }   S_ i s }  (   g  5pid ~J 4uid  @ @  $ o  + X X  X X  B  5  S\  )ԹO * +$ ,  -w8 PX/0 4     > 4lE+s Ż          (  0  8 @ H  P X  ` -h Kp  x d d d d           JŻ ٻ޻    ; . 8 B LLf+Lv+$8 sGSX   vpos  8  Xg)gu LgGu.jԐjXo Qgy+g%vĽgX+ݽgB-ɽAgg޹2gPg7ngns U+g++++}.U;RguXguRXҾgX" Jg,_tgOggXdggXҿҿX׿ ҿjXAXG6A6cY^A@wAs^|^AOsAA^AG:^AOb^AOC?^AAXg^^o:X!w A SS% CA/kAgXOH^AgOp^^^  ?mt ^X +NNA?4X |Aݚ|AA߳AݚݚX ݚ##( Kݚ,2dtPݚiݚGA[ݚʝ   6EGX K+ * + . :[[W       0(4F)4lQ6E+  m+  X , Z+L+7 ` - .y mod / @ 0yH mp 1 P 2JX  8 5k 6tx 7  9  ;  <( = 0kG G  4X >N8 EEmod F > GNP p qX rX ss tXXmtn w    X   5& lE+  *-Vp[9V MC GG+RW E+X-Ȥ VV @[ U id* clsU _2!||x ijtxk m ~~GOXX+4Xy4X8 O0!yq" 4X1[4XB4XOcd&e2[f4gs lidhs D~  S */cma> I 01G2 3G46X7`8h9p:x>+?XS @/Q0V ops1"t dev4~56(7 8 [ e J+X 02 3G +16  08s:=G?XE I (sGG$sGGYOPGQGRGST$ ?devU~PV@WJHXVhY\ b] b^ b_ b`X ehV ltmG idsn!tospsqs u (v0w8x@yHz{| ty}  id:+X +  hCH+\X@z{7| X}X~7 "(0 irqX8X<+@+HGP dirX\ 08 irq XXV ( 0H.X023# 4X@4X  %%*Y@@C DEhFRG HIXJXKXLXMXNXO+PXQ bRS TWU-W-XZA#]+0^ b8_X@aXXbX\cX`dXdcdirghrcunpoyq5rs tGv+XC o get put  3  G( `08@HPX`h7pxUnCo QRX idSXTQ PfgVhXi}1VVVs [32 G8s`GLGXXeG GVVVVG2GGXX2 PPy<XnVZXsV hXX XA#A#@ h irqXX dev~ msg^ [(0 s8X@ H<P 8 : irqX? yq ( X0`G      ( 0 8 @ H 7P KX d` dh p x     y K        ! 2# K$ &+X 7-sK<dXPyti =~sXX 2-" R cntX7#+X" , pin-./:@0:A1:B 4+567+8 RLS-uvT HIJ\K:L:M?N-O P X(+00+++ack+eoi+ +(`P 8:@:D %Hx!" #X$ % & ' ((X0)X4*:8+:<,:@-XD. XH/+P0+X1yq`2h3x:X:XA+4X@ R~SXTXUXVX WX gcY~ A++X      b!*"S-ptr#X + (,--.. //0*1 6L+ +  : X  Pt?Yt@VtAtBY :i+ Ptetfth: maptjXtk mtl tq(ts 0tu8tv @tw2Hiyq5yq5$XyqX??myqX]yqXDryqXXXyqXXyqsyq2yq5 ?@:A:B:C: DGE AyqA+ L&7::: : ::R": f7 R& :!:":#:$:%: &: &(<):*:+:,:-:.: P"r" d< 1P 67:8: 9p>? :@dBC :DF G :Hfm.n:o:qr s t u v w  x Xz{ |X l y.bS-ptrXX <^-pcisXcP   1 K  `( ~0 8 @ H?'',H :Xops X  ( X0G8 X@yq'X?yq'X1yq~Kyq6`P~yq~eyq~yq5?xs~yqyq'0f0/ hLO busMNOP Qy(/ (8@UPpopsP XW ~_dev~cycy X X O   X " "(5@65len7X cap8 $Bej e/` JKbusLMO X P(Q0SX8T<U>V@WBXXDY HZ I\J]P`Xa`c:hd le mf n g xh ppini qjrkxmnStvy  zX( |X- }X. ~X/ X0 X1 X2 X3 X4 X5 X6 X7 X8 X9 X: X; X<XX X X XXdev~7irqXs@ XB X B X B X B X B X B XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB X B X!B X"B X#B X$B X%B X&B X'B X(B X)B X*B X+B X,B X-B X.B X/BF bH 5LYP X@M X`M XaM  X  7vpd  XPO   k@     : X`P     q 0  2 7rom'8  @ GH  +P #X o  `G     (( 0 A8 A@ UH#ZP!z|X!z|`hs +cy+  (P t! "#$ /e+teyXXX%X:;"<5=8H X8_aehk l o (r 0/""n(A-:UF+XqE qNqT qZqe +nn c++q&q8qq8'GA+qbq'"P(r0vmar1B-r2 r3 +r4+r5+ gBr>r? a*r@ *B-B-+B- =B-+++nVnXBntn++[+B-yB-+XGB-B-aRaRB-++B-+G 0N1 2 Z$4 cmd6  err9 <  bus=  > A B E G  I$&+ M= cmdO  errQ T  busU  V Z<XrZ  op[N\(Z"#X$5%(&$0' `(d)h*+p+Vx op,N= ^::XXXXr aKPi:XX @hiGjk l+oD p ^( addr0 gett8i::+:D:?0^:sI:c:XXXjy'jz'j{(Ts S+ T G S7+'G7 Scw+RGc +~f& f / C:m2Xm8X0m?XLC^VCdY zWGz )G) C22GJ)) C8 2GJ)CJ:)pGGGJ)XGGX) +GJ)GGGJ) +X)*!7+GX)FFXX) fGGCGJ)GJ)G.~))C 2GJCd (W)CXmc[ sZVC6qXXCd W[C) G)GJ nU  Xo7 zf f U nU Q  v pdev;U:Q""5"@;!cH!VUsq`"en"{"Us!Us0 pdev9pid$tyerrU:zoutQ_ " p '#| r    # K") """"@"  ""## #  $#1#!T Q   2  Z # K# ,##'*#!U TvQ Rs  !^UsT Q !, K#6g#2#2#q~!8c !VUsq`"= n"{"!UsQ @    '# ; .* UsT3!)Us] UvT2 UvQs0R0X !fUvT|Q { (5(G()G$:%$XR2 (2=:$5Dbus5$5$5Derr6Di7$7 $84$94|out]  EC  :C%$Cs%DlPS+9:s>sU :oJHFE  h: HU s@#  ##'*#!U TvQ RsHE) h:)HU)s@# )##'*#!U TXQ Q" "?"^ZUU#PrU|^UUT5^ .T7U|UvT6Uv^ UX^+UUT4 $SJ+:Rj (j;:(kDerrm$n$oDbuso$o$o$pXDiqDlenq $r4$s4] |out XEv  H:v%$vs E  :%$s%E  :%$sS+.s.@:s/Xpbus/+X}d1X~}b1Xyi2f2 Dlen2yerr2}str34oJzoutfHE5 h:5HcU5s@# 5##'*#!U Q HbE[ h:[H-U[s@# [##'*#!U Q X|Y}U0Q R XUsT@Q JU0QsR X|Y}J,U0Q R ]UsT@Q R~U0QsR X~Y;a8R (=:( ~bus(()DerrDdev] |out* bE  R:%$s E  :%$s%E#  :#%$#s iI=:I busII)I deverrozout HtG  hLH9sK# ##'*#!U Q RvX|Y} T T  T T "-ZE"!"-"9"VUsTQDR  UsTvQ|R}X~fTvQ RTX|Y}U|T UU<U|T TU!U I?:IXbus*XIXI)Xerrlenstr4out^UvT@Q RXJU0QvR X|Y};a8S ,6:err111out]  ?G   0L%1s vG   gL%1s%G   L%1sS+Sk ,k9:,kC,lerrn1oX] out \Gq   MLq%1qs%G   L%1sS+tX ,X0:C Z_ IC;:q UvZ! TsC: Us;(nUU#S%!:!!,%B1':out?]1!  1) 6!1) X G,   L,%1,s !T0 %16 S1!+ !!4tU!,G:S~!,H:icb ?S!,C:S!,0:,CXibusX,(Xt",G:idev,%sS}R",}B:idev~, ,Js{"~dev3~(>XRX"~dev:2R %X"( ;( GR|.X#(|D(|P%$XR%XJ#(<(s%:Rz0w#(zC(zX+{c #(c 4V(c >t##,#5 #L%%L&S"s$ikey"J$,"Z(1 $u)#..@.H*%2#0$#1K# ##'*#!U Q qW''#.Pr%&2@M%#NK#q##'*#!U Q X|\&2s&#K# ##'*#!U Q !&TDQ1RP'T|R0X Ysf:'Q !fQ ?(2Zg'#hK# ##'*#!U Q v(2(#K# ##'*#!U Q R|q(Uv;(Uv;;K)U0Q R XY f})T Q X )T4f)Q f)T|Q ;a8u ..&~.3~.?~.L~#Y#e.o~.|~.r+2*#@# C##'*#!U Q w,[+UvT@Q R|+U0QvR X~Y~+UsY|+U}T@Q R|J,U0Q}R X3f0,Q fU,T Q !fQ R|QU!~,r!f!VUsT q,U~;&-U0Q R X~=-T3f\-Q t-U~-U~ $-Usf-Q -U~-U~f.Q ;a8uO&7an#{.~.~.~.~.~##.~.*y/29HP/#I@# v##'*#!U Q *02/#@# ##'*#!U Q RQ 3g'##r!(g12CR#1#S@###'*#!U Q R~X~Y~Q!1g!!!!VUsT~Q~R~7~3$!22e2#@# ###'*#!U T|Q !%(2"g!!VUsT|Q1b32}3## ##*#!U Q R~X~Y~!U|X42sj4#@# ##'*#!U Q RQU! 4r!gf!VUsT q4U~; 5U~X5U0Q R X~5UvT@Q Rp5TvQ05U}T@Q R6U0Q}R X~Y~&6T8fE6Q fd6Q 6U}T@Q R6U0Q}R X~Y~6UsYJ7U0QvR X3f?7Q Rf^7Q f7T Q f7Q ;a8u Ba8   #  8# ;^ .H8UU0T3n)UU0!.++G+S.L.X s. . . . int X ,. *.Bs8gBu8zBs16Bu16Bs32.Bu32=Bs64Bu64sX% x . +  1X 2X H I X ] ^ _ `L.. <X  = 9    #u. % & 4 = B h. n= } L V V X X V  + X  A { L d        L+ > > NN>CX+W.xOH  G   " (   (   0  G8  @   H   H  H -H  H  H   H   H'@ <PhvGGdz X6/kp X(X,0 8u@uAuBXD HsPXmem@_+ X ! (d0X8d@XHXL&PXX+`Xh0p  xXX :XyXXd X!"X%&9X:?AD }F XP QX(T 0t"   "  #val X  '  , "W  W  g +  X3   g '   ll  '   O   X+, fmtGGGXGG$O e f+g h$ u v.w. keyx  UJ V X jg keyk) n keyo) u6 7J 8g 8 GGGG2X2X24X key9 (&X=I 8U V modW XGY Z ([ ,\ 0Gu v wxXyX I +XL"+ /d1X set3 get57 "Y G   Ҽ      >   .(  .0 f8 !@ " H # P $ X %Ͻ` &h 'p (x )$ *B +j , - .j /  0  1  2 3 < 5 Q 9 ~ ;  >$ ?ο @i t!. key".?A+BC mod L=>dtG}(E}FG modG  opsH!iI )JK  dL#argM d#strN #arrOdVWXX \_ max^X_X num`  opsa!ibd_dv&dz+ !% + -/   b{  +(,p--.. //01   id{ clsu @SL+L'+@) end)G++ (0&8''-@ ^$ 86 X X  d  ;( X, !X0 ( 4 )&8 *XH ++P ,^$X 5 ` 6 d 8 h : l ; p < t =XxPse ?HF@/rt @GXdl AGH BBH FJ3 IG8 J+ KX OJ XJ ]J3 `"D@ d hX kX  l+ m  nJ  oJ( p$0 q dX s` ub x d ybJh zp {J +               bJ     C  8(3 G8P/mm .h .p Kx         + X  X,  X,  X,  X-  X-  X-  X-  X-  X-  X-  X-  X-  X -  X -  X -  X - "X - + (/pid  ]  ] + ^$ ^$   ^$( 0 @ rLP wLX  "L %. (. + d - V . V 3 V 4B 62C : X( =+0 >+8 A V@ D VH G+P H+X K@`3 N0A TN WN ZN ^O k 5 m O p7  q7( t+8 u+@/fs xOH { OP ~*OX 4O` Rh  Sp  ;x  ;  ; ? +   X > "S  B X : ?  V   V  $     J  8(  ^$8  ,S@   dH  6SP  @SX  JS`  Sh  Sp  +x  S  Z@  X   V   V   V  :  GB    S     =   =  "S  )&T    0T0  68  XX  5T\  JT`  6h    TT           !X  "X  #  $+  & V  ' V  ( V 3 )  3^T  C  D+  LcT  N+  RsT  S=(  T=,  Y+0  ] 8  ^ <  _ @  ` D 3 aH  d%@X  g}T  i?  lT  w  x  z+  }  ~T   V  V         X  X + X T T T *U  X( X, J0Xrcu 0 ;@  D ^$H 0:P 4Ux ;  d ">U HU RU d    V    >3    !"'& $"'&3 . <\U3 F-@@!y$! !$c$ !y$" $" ""$(# $# $$+$+ # ;$$ #? %$%+ $ {sX&%     0'c"&'dG'e&{'gD{'i b{'lg{ py(%(8B&(9]&(<]&(=]&B&)<&)=X)> X):&);B&b& src)A dst)A ***&X+ '(+d'+d' val+ =+!= +"=+#V+$d' =+*'++&'+,#',',, '-'-jY- .'+'(+(i+)&i'+.V +1g(+2l(+3+4 +5++6+ g((+(+% '+/'+7(8+(++ fn+ (q(((((. ).V end.V/;C)+cs/=V+sl/?V+wfe/AV/E)+ss/GV+sti/IV/KV+nmi/MV/PV /SV0/VV8+lm/XV9/]V:/dV</*#cs/#csx/V/ )/5*#ss/#ssx/V/C)/g;+ r15/m+ r14/n+ r13/o+ r12/p+ bp/q+ bx/r+( r11/u+0 r10/v+8 r9/w+@ r8/x+H ax/y+P cx/z+X dx/{+` si/|+h di/}+p/+x ip/+)/+ sp/+*0B+0C0D0E 0E(+s0E,+dpl0E-+p0E'/0F0+avl0F4+l0F5+d0F6+g0F%70F+8 1+ 1+ 1+ 1+ 1+1 F, pte1+ 1"/,1 i, pmd1+ 1"R,2%,2%%#,02%/u,Z2' ,pgd2',02'",Z2p ,pud2p ,02p",02,,@3H?-3I+1dd03 X43+84;-4<4=4? X 4@ X$4A X(4B X+'@@5.56sp5+es5 ds5"5$5&5+(5+05685+X5+`cr25+h5+p5+x5365+ 5X5=5+5+5 5Pfpu5 R5@$.'@@3/1]k@3o@,F,i,,/C3701Vi3.3 ,ti 3u(3,3i043i83X3ih3%jp3+x3fh3 d3j3%3TT3j3kh, 6 i06 6 i05*7 7 p8 1 cwd8= swd8= twd8= fip8= fcs8= foo8= fos8=8 18=l=1+"8*A1 rip8+V rdp8,V"8.1 fip8/= fcs80= foo81= fos82= 8)11A108@18A18B1=1+ [8$W2 cwd8% swd8& twd8' fop8(185=86=89W2 8<g28>1f1=g2+=w2+?8QT3 cwd8R= swd8S= twd8T= fip8U= fcs8V= foo8W= fos8X=8Z 18[ l8\ m8] n8^ o rm8_ p8` q8aT3x8b=A0 i3+Vy3+@8:38; V8< V8= 3V3+'@@8O348P18Qy38R3@ 46+@8^c48_0D8`18aw2D8b3@8cc4 t4w+'@@8f58hX8kX8nV8qVxfd8tV 8wX 8zX 8X 8X484@@8R58 V8X8X fpu@858X8+858585 85048t4@@t49 59 V9VL6+;+6+$6$6+)6 .6:>z6:?+:@+:A= cpu:C=; 6; X <)6<*%<+  osq<-z6 J7>X>X>G>G>G?r7?V?V(?77ct?6?&7 J7&X@7 A7A 7 7B 8B(C G8C C CD|8D+D|8D|8G8D 8D |8D8D8D|8 E8:E G8E E 9E8&XF %9@F'9:F(8F)  F*9(F++:0F, 8F- 9F. :F/ ;999%99@@G/+:G0G1XG2 i seqG3 BG49G58 G60G7 89(Hr:H H+H :H= }:}:0:r:I:II XI: :J :J:+:+ J8:K;K X K:L+H;L,L-xM;M;MX`M+h maxM+p+;+ N ; sigN: N; ORx OS;; OU OV;;\P<P P d P ;P'M<P(P)P-<P.P/P0 <P1P5<P6P7P8 < P<=P=P>P?P@PAPS8=PT PUdPVd PY\=PZ P[ P^=P_+P` Pa PJ=PLPQ PW=P\8=Pb\= PE=PFd=Pg>Ph _fdPiPmE>PndPoPpX \ P%>P*)<P2M<#_rtP9<PB<Pd=Pj=Pq>"0Q >Q Q Q Q E>0Q >> Q> ?Q 7?Q!Q" ; Q%y?Q';Q(+Q.;Q0 ; Q3? saQ47? R ?R R + lenR +R u(S?S $T$%@T%,T'T( 0TDZ@TM#?TPu(TWu)8U @UVUVUVUVUV U#V(U,V0V)@V*VV+8PV8 AV9 AV:XHV;XL@0A+8VDfA:VEVF6VGX0 W>AWKWZWpWWW endWALA6+X!AX" X X&AXD BXDA XDBXEGBXEA XE,BXT wBXYGBXZ $ X[SBY B valY Y BY B valY  Y B SC U V V V W ,X [2C0 hC iA j kCcpu lX mV nV  oV( C +    D +  =C@@ D  V  V  V  =  = +  +( +0 X8'@ HF  V  V  V  V  V   V(  V0  V8  L@  VH  VP  LX  L`  Vh  Vp  Vx  V  V  V  V  V  V  V  V  V  V  V  V  V'@ G C4 G8 ! V( " V0 # V8 %@ &P 'Q (R )S , VX - V` . Vh / Vp 0 Lx 1 V 3 V 6  7G 9G ;G =+Pavg GD@HF G0 KH L M+ N+ OX  P$ Q& SH(G0 ].H3HuBHBHGHC `I4 aG8 h V i V  j V( k V0 l V8 s L@ t VH uXP X X X X X X X X4 %9X4 %9rq I !H I BH0 ^II^$IBHxrqI J- X - X - X- XZ bJ         Jmb Jms = J JJl  JJ JIJ+$$ JC K  \r AW  @  XD  XH 8P +`  +h )p +x   $  AW  dJypidpZ7rLZ9 ;Z:XZ; $Z< inoZ=VZ?Ϟ Z@@ZBVH7rcuZC`ZDߞpKL+ [L[X[WL\oN\p% uid\q B gid\r B \s B\t B\u B\v B\w B \x B$\y X(\z0\{8\|@\}H\~P\X\O`\Oh\Op\Ox\ d\0\yo\ ?\51 LNykey]O];]1@]2 sem]AW(]<P] dXa`] Wh uid] Bp gid] Bt]x]|]~] ]+Ρ]AN O O O %O /O[X^^R^_;^` X^a^b ^c^eV ^h^$8^k?@^nX^q`^sd^t^$h^wp^xXt^zx2^X2^X^X^^:^%9^  it^^^@^h^ X^rL^]tty^^^ wB^V^ V^V^V^V^V^B^+^+^+^'+^+ ^+(^"+0^,+8^+@^+H^"+P^,+X^+`^+h^Z@p^^Ƥ^J^ۤ^ X^^u^^^.^6^AW09On ^S^$^;^V^: R S 'S 1S ;S ESX_cS_d%_e X_g _k $_m\r_nW(_o0_qY8OS S> S S `&T`U`=`IS +T ET+ ET OT YT+sT+fA xT TH;T+ T T Thay*Uaz^a|Xa}V`1_an_(a0:0a+Xa#[``T /U 9U CU MU WUbbbb!b%b'b,b/$b3b5b9b<bAbDbHbLbQbUbYVcd#Vd$$d% d' VeVe ;zf f"VfWf$fVfxmxZm>mxZmZ( lenm%HmZPm pZZ++Z+Z+[@n[n[n[n :n$@@n ZHn!+n"+n#un$0:n%Yn& n'[0n(+8]cpun*@]sspn+C\H%[+`n6[n7$n8Zn:Z(n;+Hn<[Pn=Xn>\[neC\nfX sdang]nh ni]\nxnD]nE[nF]nH nI6(nJ$HnK6PnL+pnM+xnN+nO+nP+nQ+nR+nS+nTunU+nV6nWLnY Xn\+n]+n^Yn_C\p[]+ZH\op]pY3pY3p"^p#.p$ p% p'%^p( p) p+I^p, p- p!w^p&]p*^p.%^ p^] opsp^I^ ^^p2^p4+p6Xp7X &Xa@ _&XaH4_api_aq _arasn_ i_"a_a^a+a_:aa+Qa_s__@aV`a4_a+a+a+ a u(a,aV`07rcua8a`H_w^a`a ida```6+a`a` `(q`q qLqqi r arVr& {r)AW ldtr*a8r.+@r96Hr:dhr;bpr= XxrC|rD~ as bsds+ alts+s+s+ s+(sS0s8s@sHsPsXs`shspsxss s!ab rF`"3\b3^ d3`X3Xc#lru3Yb3d3e3i4c3j +3k+"(3Rdcb3hKc3s+ "(3uc3z+ pp3{c3|+3}+3~% c"3c3+"3c3|d3 dt|dtp reftȦ8tLHthtXlt+p opst xtdtcQ(3Qd4cdccc^33d3X3 XZ3 dval3+03dE3Me3N d3PX83J6emlru3Kd83W[e3X d3YdE@3Ge3I+e3UK3V + 6e(3[ X03\ X43^+8R@3Fe[eD3j,E(3mQf3n+3o+3q X3r X3s X3t X3vX R@3lofeD3z,E03}f3~+3+3 d3 d3 d 3 d(E 3g3+3+3R@3|&goffD3,C3DJg1e1Qf@1g03+JgC fh 1 $      K  d  ( X0 X4 N8 @qP  p  dx #ֹ $  %  '۹1\g35hctx36h h3=h3>V3@A(3Xh3YAW(3\/i3b+3h+3t73w 3}$E3Vi3+3+R3ti/iD383i3Wg3Jg 3iPrb3G83+h iubjuc uh ujukuq us(ut0uu%8uw9@u{Hu~PuaXuu`uhupuxijhh3 k3Vcid33 @@3 (k3 XZ 3]k33+3 T@@3;o1 k@3W@3+P3+X3+`3+h3+ppgd3  /x3) X35 X3?;o3E+3LX3S X3Z 3]%3_3a$3pAW3r33+3+3+3+3{3+ 3+(3+03+83A@3$D3+H3+P3'+X33+`3+h/brk3+p3!+x3+3+3%+30+3@o3Po@3eo3b3+h3$p3oox3^$3yo3fh3&o3+3+33 X3 X3`3%3Y3o3+3+3%3 (kj+Po+3``o+ `o jo to ~o o+o6+03 Xopu/>piu7>p(pmdu9 "/0pudu; 708n@uE,HuF,PpteuL /XptluPU`uT ,h,X3p @_____(v6(v9(v<(vG8t)u@ idzV`z dhz\up7rcuzxOs zPt opszuz!$uz z thzuzCvz Svz"lvz$ vz% v z& v(z( v0z2 8z9u@z: vHz= wPz@wXzA :w`Ptu u zWu#dirzrz4szt Wufu z/v knz tzfhzauz dz6 z6@z`zhz xz   z  u@ z  uAz %j>v>vku/vSv>vHvlvaudXvdvauvqvdvaudvvvaudvv>vv-v>vvv vw>v'/w:w>v!w&X{bw0{'w{(?w{) Wr{* w{+w{,w {- (bwOdwSwww wOSw|Hy|=| Q|X|  |V|V ino|)V dev|* E(|+ E, uid|, B0 gid|- B4|. 8|/X@|0XP|1X`|2Xp|3V|4V|5=|6=|7V|8V|9=|:=|;='py'G' Q'my'n2z'o& u2? ue . opsH .H X XG.uGX3M]NGOGP!N}Q!N}R!N} T(U0VH8W X@X XHY XP[HX\H`^h_HpaHxcHd X pmfhuLvv}`}aG busbÍd eGgu h$j(k0mH8n X@oHHp XPqXrH`s!N}ht!N}p pmvxw X py{b~׃4]`2q3G5!N}6!N}89 ; (< X0>H8@(g}@AHC ҎP pmEXȍQvqSҎ}}0X2YGZ!N}[\ ^ X pm`(׎2L+tdLd yBDEF GHrIdt  "A=K :X@L NO+P Q (+Ԑ, -u.u/ =X 0 p= qfh r  s  t d u  v$I(Ԑ"b#&'' b"$ Qґ^1"3 4= len4=2&6V1G 8n&injknVrstb^uR{TXUGBVbWX& Y0[8_"{``Fha+pbdx:dґLmn7d_uvs'x { | Q } ~ B  B X    !f  F( K0  d8 +@H  EL  P  WX  W`  Wh =p =t =x =| $       = AW + +   p       @0 {@ {H  XP  XT  XX  X\ff` zh3 Jp 8fH  P (X ` h  dp+'@v||Ǜۛ ( 0 8 @ 2HPݜX`v'@ F   E  +    G( !̻0 !ѻ8 ֻ@ "H +P +X +` h AWp   X d & #   $& +  G  5 fh ? I  X  ñ(3 `  d = W W != "S /  0  1  4 X 6X <6  BG@ D"{H F.P I%X L` O d RZh Sp Zyox ar brXrcu c dY f6 k03 n$@@ oH q$X r`&Xh|Xh{&›XG›G̛ۛ2 EyFGFHIa7 mnt  y؜؜uĜK "J# nid&-+4+7TRS8U8XYZ Xc ; dL(7rcueHgdXj` idmpptqGxru=+..3J% ywy y" y$$@@y- lruy/By0% wZ2ʞ nrZ3 nsZ4ʞ7ߞ+6+  valV &X 4 4 s (+  ] ]]l7rcu]m]n;]o u"]v"]x]y ]u;#x]+(]r]t+"]]]G ɟ\ ]]d]  dҠ+ ]ޠOO]@]Ҡ key]O]Q]a]^]G8]] W] W"(]Ρ]+]+]]]  (]];E ]]] 8 ]-] - 7 ɢ ;`+0%8@ uid BP%X X`$ h\\ ;\ gid\ B 6+Q\0\rcu\Fɢy?J+?8^^ ^! ^"+^#V^#V ^$+(^$+0^'ۣ^(V^)V^0^1 {^2 {^3 {^C+^Dۣ^LS^M^$^NS+8^Q^R X^S+^TLX+rL+   ;֤+ ֤ ^$0HV: ` 7rss  08V@ XX  fn  arg d  =_S_T_U9Q_W _X^_Y8_IM q_JR ioc_KSʥ1 _\X0 M \ } val f val  <ææȦin+v`8_[`%a[b[c ud u7rcue reffæ0 z v + %e,XT§9ا++ vn§& . 10 { 4 4r5X6r7+   ¨ B }  B P ] X Q¨   X X( X8 fhHbМ()*+ ,0-6@. $`/ Xd0Fh1p2 x3+4ƪ  < val  %&X6k BE#uidF B#gidG BH <DƪwJHHI k k k k k  k( k0 W8 W@H̫+ X(X, k0 k8d@ ! ̫@89:;<=Ĭ >Ĭ(?Ĭ0@8FĬ]ݬFݬɬXDEĬFG HĬIĬ JĬ(K0N ҭ8O@Q HSP]F]ͭͭk<׭ ͭxYZ[V\V]V^V _V(`V0aL8cL@dHeLfVPgVXhV`iLhjp8XXXX XXXino  ( 0ïXïӯ+ RXXX XXXXX77 Z(}08}@H7PRF؜7FX#UFUӯ<xFx_FݬxFY8  X AW 0 )H/ops!9 )+I9+I+8 wn }s  ndx= ȳ    "  ;  U  ( 0  Ҵ8  @  H  P  .X Q` eh  p  x     , ͳfh&g"Ku;K'KKP @fhKXfhGv \=\Xa Cfhk-fhvfhX+Ͻfh'/fhԽfh$fhBfh)`fh`e G+fh++++opV}TfhvXfhv}TXľ fh  C8E7modF 4G CPpqdrdsutXPmtnw   X 8>g7+  YC\$Y ?5yGG+~DO 7&X- {}} i0jHyk Nm qII0qIGSXX+,X,X8J 0u!Mr"z u,X1,XB,XOcXd&e2f4gu lidhu Xh l v{V vxcma 0O1G2 3G4T6X7`8Oh9Op:Ox>+?d@/0 ops1"6 dev456(7 8TT  &X   h!5d@z{| d}d~ ^$(0 irqX8X<+@+HGP dirX5 (8 \irq XVY q( 0llJ\Vv023$ 4X@,X&X1 get put    ( "0J8m@HPX`hpx0I]1QoRX idSXToPfghXii3uoSo ou"oGJoGXd'moG OGoroooGoGGXXto;d0IoX5]N\!"V#ptr#dhL busMPNOZP Qiz(' PP(78@Pp'ops d~ Xdev7z7z X X  U   X " "(566len7X cap8 $87 '` J2KbusLPMPO d P(Q<0SX8T<U>V@WBXXDY HZ I\J]FP`PXa7`c=hd le mf n g xh ppini qjrkxmEnVtvv_y  zX( |X- }X. ~X/ X0 X1 X2 X3 X4 X5 X6 X7 X8 X9 X: X; X<XXO X X XkPdev/irqXT'u@ XB X B X B X B X B X B XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB X B X!B X"B X#B X$B X%B X&B X'B X(B X)B X*B X+B X,B X-B X.B X/BwF XH $LdPtt X@M X`M XaM  d  /vpd  XPO   f     = X`P     \r 0  2 /rom8  @ GH  +P #X  A KYEG    ( 0 8 @ H# P!N}X!N}`{huU J'd+=t+7z+   +( &! 6"T#|$ 2+&P6P+dTPX;|PXd'YPX=;<$=0H X8_Rakehk l o (r 0k7kW7p7p77׃77=7R&XtE@tNutT tZte@,zoo|d++zt"ttt(6+tt(uE(u0ivmau1'/u2 u3 +u4+u5+ 8u>u? F,u@ i,'/'/+'/'/+++ooXo%o++ +9'/*a'/+d>Gu'/f'/TTzTT'/+,'/+G02 3G+h6 (-88=[@@C3D3E*hFGHIXJXKXLXMXNXO+PXQ XRS TU.W.XlZ$]+0^ X8_V@aXXbX\cX`dXd]dirghrcunpoizq6rs tGvhXX d%$$@h% irqXX dev msg& S(I0 )8d@ HP8= irqX5Mr ( d03YG    ( 0 8 @ H P X ` h p x        F F d    ! # $ &+*X.uX au!!& =F\~dKuidX. cntX$&X"* ,| pin-./=@0=A1=B4567+8 RS*#uvT|HINJK=L=M5N.O% P d(00+++ack+eoi+ +(YPN8=@=D d'Hx!$" #d$ 3% H& ] ' ]((X0)X4*=8+=<,=@-XD. dH/+P0+X1Mr`2h3bx=3d$H=d8XXMq6+,X@ RSXTXUXVX WqX ]gcY X 6+&X        = d Pw?w@wAwBd Pwewfwh mapwjwk #wlU wqx(ws 0wu8wv @wwHMrO Mr MrX5#MrXPMrOPX G(xMrXXdZMrXX}MruMrMr  ?Z@=A=B=C= DGE ZoMrd6+ "=== = === " =!="=#=$=%= &= "()=*=+=,=-=.= ( 16P7=8= 9&>~? =@BC =DPFG =Hmn=o=qOr s t u v w  x Xzq{ |dlyO\V#ptrddb#pciq)%dP      ( 40 I8 I@ qH5}H} = Xopsv d ( d0G8 d@MrX5}MrXMr}Mr}%}%4MrIMr9lMrl 5N.uMrMr{(f(/0/Y01^2X3X4X5X6X7X8+ irq9X(:A, Y otd7 7d  7=d 7d $)G7 d SXv7d'd 7d 7<0d-./G1!23v5E67u,l#dw0#w4#b8!P$%X&X'X(c)* + ( u9E0:@ll(=I>?N@XAd tI uS S+ ri `} S+` S7S7S,7S5#uLH<2dq<8d9<?dS7XS`#uS{4 G|{& G|<G=<h< <d'<<<0jjdETdev/7Ierr EJZout!ca )H!3 u9u! !!=F!* U  Ts Q >(9^ > !!b!!b/!5 Us5/ UsK UUSZ+JjTdev77}$N}XIerr E ItmpdoutJ! d9+,k<  MZ*q T Q(!a )'H! u9u! !!=F!* U  T| Q >(9^ k9!8J!k* %M4 @ cM !W c o o 6   d *, Us T| Q~b{ kW! h!5 U|p U|* UsS+!r7~u Tdevu07 wE xItx) yNJZ!2a{ )H{!{u9u!{!!=F!* U  T} Q !P d!n d) d>w(9^ > co ׇ  d * Usc  b p  U}L~cr Tdevc17 eE f#  gNJ !9 ai ) Hi! iu9u!i!!=F!* U  T| Q )c  md)  md>e( 9^  U|IS + I"TdevI77 KE LItL) MNJ2!Z aO ) HO!' Ou9u!O!!=F!* U  TU# Q !x  Td!  Td)  Td>K( 9^ >\co ׯ d * Usc  b L* UsS2+ "jTdev27Ierrval VIret!5 Us T4 Q|5 Us Q|5 Us Q|L!?dev,75AK=err%%E%# %Ni=%%J!`  )NM!%uqu! !!=F!* U  T~ Q  R} X| Y)%d!7%df  ϣeeG ,G9JGIGW eht=ddp U~ Tv U~ Tv> 50 U~ Ts Qv R5hZ U~ T| Q5G U~ T| Q  5& U~ T| QL!* U~ T  Q| R}S+ N?dev+74@ d'err%E%# %N%%i=i=Jout!`  )UM!%uqu! !!=F!* U  T~ Q  R Xv)%d)A%d!`  )}M!%uqu! !!=F!* U  T~ Q  R XvTeeG ,G G9 JG 5E U~ Tv Q5r U~ T Qs RLLL!S+; @err);s=@vals#=$s,=$s9=$t;k9$k%$k1;a=W$a ;F @devF-7$G) $H $H=rretJhKN* IT?dev*,7+( , ,d'ret.%/N UUN(?dev(7((=(dK& UU TT QQN'z?dev'7'''dKG UU TT QQ N&?dev&7&& &dKh UU TT QQN$?dev$7$$d'$dK UU TT QQN#0?dev#7###dK UU TT QQN"?dev"7""<0"dK UU TT QQU\dA\57Uddev:U|.d<A|DA|PVXU%XsA<AuVHUz0AzCAzX+UjAj8AjVW$/W$7W* $2$KVMWM @new4$KW @new1$$VM;ju $jFrretluVhohp;Au !@newA@$B$CrretEuW#9!$#5/!M%VM&;A!uW!@ptrAs8g>u8z>s16>u16>s32.>u32=>s64>u64dX& x , +  1X 2X H I X ] ^ _ `L,, <X  = 9     #u, % & 4 = B h. n= } L  V  V  X  X  V  + X AX L iL+>> NN>CXX+W.~HH  G   "   ^(  0 ָ8 @  H  H  H H  H  H  H  H&@ ɍPhaGGx X+5-kp X(X,0 8u@uAuBXD HyPRmem@J+ Xx (d0X8d@XHXLPXX`Xhp  xXX %XdXXd X!"X%&9X:n?AD F XP x QX(T 0     val X  !  , Q  Q  a +|  X-   a !  | ee  !   I   X+, fmtGGGXGG$I e f+ g h u v.w. keyx  UD V X ja keyk# n~ keyo# q6 7D 8a 8 GGGG0X0X04X key9~ (%X=C 8U V modW XGY Z ([ ,\ 0Gu v w xXyX C +XL+ /^1X set3 get527 J%SA a   ͻ  ( 08!@" 'H# EP$ EX%^`&wh'p(wx)*Ѽ+,!-&./ N0 v1 23 ˽5 9 ; :>?]@{c n!. key".? A+ B C mod F=>dnz + !N% + -/  c b N +( , - - . .  / / 0o 1 { 7 id  o cls       @ S<L+L+@  ) end ) G + +  #( #0 &#8&-@! "!4!X!X! d !9(! X,!!X0!( 4!)%8!*XH!++P!,"X!5 `!6 d!8 h!: l!; p!< t!=XxIse!?D@-rt!@DFRdl!AF!BF!FUI1!I6!J+!KX!O_I!XdI!]dI1!`";C@!d!hX!kX !l+!m !ntI !oyI(!pw#0!q dX!s`!ub!x d!yHh!zp!{I!+! ! ! !! !! ! !H!!! !+8!A V@!D VH!G+P!H+X!K?`1!N?!TL!WL!ZL!^M!k 4!mM!pk6 !q6(!t+8!u+@-fs!xMH!{MP!~MX!M`!jQh! Qp! J:x! J:! J:!=!+! !X!>!Q! 3A!X! 9!,>! V ! V !# !  !!I !57( !"8 !Q@ ! dH !QP !QX !Q` !^Rh !hRp !+x !mR !> !X ! V ! V ! V !9 !@ ! !wR ! ! = ! = !"R !)R !  ! R0 ! +58 ! XX !R\ !R` !+5h ! !R ! !  ! !  !!X !"X !# !$+ !& V !' V !( V 1!) !3R !C !D+ !LR !N+ !R S !S=( !T=, !Y+0 !] 8 !^ < !_ @ !` D 1!aH !d>X !gS !i> !l S !w !x !z+ !} !~%S ! V! V! ! !!!! X! X!+!X!:S!DS!NS!S !X(!X,!CI0Rrcu!0!9@! D!"H!8P!Sx!9! d! "S! S!S!d! ! V !  ! !>1!! !!"$!$"$1!.!<S1!F7,@@-"# " "#" "## ;## #"$#($ b#$ g#G#+w#+ $ ;G#w# $?#G##+ % dX'X$     0(c$(dG(ey(gy(i y(ly w(X$)8$)9$)<$)=$$*<% *=X *> X*:J%*;$$ src*A dst*A O%Z%d+++%X,%(,%,% val, =,!= ,"=,#V,$% =,*#& ,+&K& ,,#x&-K&-- #&.x&.W. .P&,'&,(i,)%&,.V ,1&,2',3,4 ,5+,6+ &(,7' ,%% ,/}& ,7&8,d',+ fn, x' 's's'7'd'/'/V end/V0;''cs0=V'sl0?V'wfe0AV0Es('ss0GV'sti0IV0KV'nmi0MV0PV 0SV00VV8'lm0XV90]V:0dV<0( cs0 csx0V 0'0( ss0 ssx0V 0'0g) r150m+ r140n+ r130o+ r120p+ bp0q+ bx0r+( r110u+0 r100v+8 r90w+@ r80x+H ax0y+P cx0z+X dx0{+` si0|+h di0}+p0+x ip0+s(0+ sp0+(1B*1C1D1E 1E('s1E,'dpl1E-'p1E'/1F0'avl1F4'l1F5'd1F6'g1F%71F+8 2+ 2+ 2+ 2+ 2+2 * pte2* 2"*2 + pmd2* 2"*3%*+3%%*.3%/ +T3' P+pgd3'*.3'"7+T3p v+pud3p*.3p"]+.3++@4H+4I+/ c3c04 X44+85;7,5<5=5? X 5@ X$5A X(5B X+&@@6{-64sp6+es6 ds6"6$6&6+(6+06486+X6+`cr26+h6+p6+x646+ 6X6=6+6+6 b4Ifpu6 3@b#-&@@4-/i@4n@P+*+-?4./g4-4 *+g 4u(4,4Kh024"h84X4Uhh4%Nip4+x4f4 d4Si4#4R4Xi4fv+ 7 /7 7 /(8 8 p9/ cwd9= swd9= twd9= fip9= fcs9= foo9= fos9=9/9=l=/+9*/ rip9+V rdp9,V9.0 fip9/= fcs90= foo91= fos92= 9))0//09@K0 9AK0 9BK0=[0+ U9$0 cwd9% swd9& twd9' fop9(095=96=990 9<09>K0_)0=0+= 1+?9Q1 cwd9R= swd9S= twd9T= fip9U= fcs9V= foo9W= fos9X=9Z/9[ l9\ m9] n9^ o rm9_ p9` q9a1x9b=. 1+V2+@9:H29; V9< V9= H2VX2+&@@9O229P[09Q29R2@ 23+@9^29_ /@9`[09a 1@9bX2@9c2  3r+&@@9f39hX9kX9nV9qVxfd9tV 9wX 9zX 9X 9X292@@939 V9X9X fpu@9]49X9+9]49]493 93029 3@@ 3: 4: V:VL4+)4+44+4 4;>5;?+;@+;A= cpu;C=< +5< X =)m5=*#=+  osq=-5 =/#>#>#> ?5?X?X?G?G?G@ 6@V@V(@264ct@5@&26 5%XAf6 B6B 6 6C 6C(D 6D D DE7E+E7E76E 57E 7E]7E7E7 F77F 6F F 7F57%XG 7@G'587G(]7G)  G*I8(G+80G, 8G- 9G. :G/ ;7D8D8758@@H/8H0)H1XH2 i seqH3@H4D8H57 H630H7 8N8(I 9I I+I 9I= 998 9JU9JJ XJZ9 U9K v9Kv9+9+ K8_9L9L X L9M+9M,M-xN#:N#:NX`N+h maxN+p+3:+ O J: sigOv9 O3: PRx PSn:V: PU PV:s:VQ: Q  Q d Q :Q':Q(Q)Q-$;Q.Q/Q0 :Q1Q5U;Q6Q7Q8 : Q<;Q=Q>Q?Q@QAQS;QT QUdQVd QY;QZ Q[ Q^&<Q_+Q` Qa QJl< QL QQ QW; Q\; Qb; QE<QFd&<Qg<Qh _fdQiQm<QndQoQpX V Q%@= Q*: Q2: _rtQ9$; QBU; Qdl< Qj< Qq<0R ~=R R R R <0R =@= R~= =R =R!R" J: R%>R'b:R(+R.:R0 J: R3,> saR4= S n>S S + lenS +S u(T>T G#U$>U%+U'U( 0UD>UM#n>UPu(UWu)8V \?VVVVVVVVVV V#V(V,V0W)?W*VW+7PW8?W9?W:XHW;XL\??+8WD?7WEWF+5WGX0 X>h@XKXZXpXXX endXh@Lw@3+Y!@Y" X Y&w@YD@YD@ YD@YE@YE@ YE@YT AYY@YZ # Y[@Z 3A valZ Z AZ VA valZ  Z ?A!SA!U V!V V!W (X![A0!hI!>I!Ie! KIPI ZImHtI+#w# ~I?wJ7pU @ XD XH57P+` +h)p+x L#U dItpidp[7 K[9 9[:X[; #[<  ino[=V[?\ [@@[B:UH4rcu[C`[Dlp|J K+ \HK\X\VV K]oL]p# uid]q 3A gid]r VA ]s 3A]t VA]u 3A]v VA]w 3A ]x VA$]y X(]z0]{8]|@]}H]~P]X]M`]Mh]Mp]Mx] d]]n]=]á/MKLtkey^ÛM^9^?/Ο^ sem^U(^ʠP^ dX`^ ~Vh uid^ 3Ap gid^ VAt^Kx^|^~^ ^+\^ϠL M M M M MUX_^jQ__9_` X_a_b _c_e:U _h"8_k=@_nX_q`_sd_t"h_wp_xXt_zx0_X0_X_X__7_7_  it_ __?_0h_ X_ K_Wtty_E_O_ A_V_ V_V_V_V_V_bA_+_+_+_'+_+ _+(_"+0_,+8_+@_+H_"+P_,+X_+`_+h_>p__T_ء_i_ X_s_u___-_+5_U0Mg _Q_#_9_:U_ȡ oQ Q Q Q Q QX`c^R`d#`e X`g `k #`mp`n(`o0`q!X8Q cR= rR |R aRaaaR R R+ R R R+ S+? S S95S+ 5S ?S IShbySbzk]b|Xb}^/G^b](b80b+Xb#^`SS S S S S Scccc!c%c'c,c/#c3c5c9c<cAcDcHcLcQcUcYUde#:Ue$#e% e' UfaUf 9ug g"aUgU g# geUgUqUgXgdd(h0Vh1#h7# osqh95h; h<#h#h#h#h#hi+~Vi, i- jj Vj ~VjkVkdkdkk Wk!yk" k$XHk'Wk(G keyk)a k*Wk+d k,d(k-d0k. W8 extk/W@VV k3 k8W tpk9Wk: dk;=k<=W .. l  XXXX!X lVXl#llXXmqXmr!Xms8 wqmvXH cpumwP X>xnYn>nYnY( lenn#Hn"YPn pXY++"Y+2Y+U@o Zo Zo Zo 7o#@@o XHo!+o"+o#uo$8o%!Xo& o'Z0o(+8Wcpuo*@Wsspo+ZH#Z+`o6Zo7#o8Yo:Y(o;+Ho<ZPo=Xo>\ZoeZofX sdaog \oh oi%\ZgxoD\oEZoF\oH oI+5(oJ#HoK+5PoL+poM+xoN+oO+oP+oQ+oR+oS+oTuoU+oV+5oW KoY Xo\+o]+o^VXo_ZpZ \+2YZpqY\ q1 q1q"\q#.q$ q% q'\q( q) q+\q, q- q!] q&Y\ q*\ q.\ q']7\ opsq1]\ '],]q2k]q4+q6Xq7X %Xb@]%XbH]bp]bq]brbs] ]b ^b6]b+bG^7bb+Jb\^] ^@b^b]b+b+b+ b u(b,b^04rcub8b_H\^]b_b idb^_3+b:_b?_ :_(r_r rLrro s `sVs& s)U ldts*$`8s.+@s9+5Hs:dhs;3aps= XxsC|sD~ `t .atdt+ altt+t+t+ t+(tS0t8t@tHtPtXt`thtptxtt t!)`.a sF_4\ha4^ d4`X4Xa lru4YDa 4d 4e4ia 4j + 4k+(4Raha4hwJa4s+ (4u7b4z+ pp4{huXlu+p opsu @xudu%|bJ(4Q3caaAbXbX44Uc 4X 4 XT4 ncval4+.4UcA4Mc4N d4PX54Jcflru4K{c54Wc4X d4YncA@4GOd4I+c4UwJ4V + c(4[ X04\ X44^+8K@4Fmdc@4j+A(4md4n+4o+4q X4r X4s X4t X4vX K@4ldmd@4z+A04}We4~+4+4 d4 d4 d 4 d(A 4e4+4+4K@4|edWe@4+?4De/Od/d@/e.4+e? f  #   wJ d 7(X0X4L8@P p  dx#e$ L% L'j/%e45gctx46g g4=Fg4>FU4@h@(4Xcg4YU(4\g4b+4h+4t74w 4}$A4g4+4+K4gg@454"h4e4e 4KhIrb464+Fg PhvbIivc vh vjvkvq vs(vt40vuR8vwf@v{Hv~PvXv`vhvpvxZhIigcg4i4Vcid44 @@4 i4 XT 4i44+4 :S@@4m/i@4U@4+P4+X4+`4+h4+ppgd4  -x4) X45 X4?m4E+4LX4S X4Z 4]#4_4a#4pU4r44+4+4+4+44+ 4+(4+04+84@@4#D4+H4+P4'+X43+`4+h-brk4+p4!+x4+4+4%+40+4m4m@4m48a4+h4#p4mx4"4n4f4& n4+4+44 X4 X4_4#4!X4n4+4+4#4 i]i+m+3D_m+ m m m n n+*n3+.4 Xs@ id{V`{ dh{sp4rcu{xq {r ops{s{!s{ {rh{s{t{ t{"t{$ u{% 5u {& Ju({( mu0{2 8{9u@{: muH{= uP{@uX{A u`rs s {s dir{uq {q {r ss {t kn{r{f{s{ d{+5 {+5@{`{h{ x{   {  u@ {  uA{ %Nittstttttsdtdusutd5usduuJusd:umutOu-utuu ruut-uutu%X|u0|'Kv|(u|) p|* Uv|+sv|,}v |- J%(uHdPvSivivnv ZvHSxv}w}=} Q}X}  }V}V ino})V dev}* E(}+ E, uid}, 3A0 gid}- VA4}. 8}/V@}0VP}1V`}2Vp}3V}4V}5=}6=}7V}8V}9=}:=};=(w(G( Q(mx (nx (o&xX(0x(1w(2 (3 d(4y (5 +z((7 Xz0(9 +z8(; Xz@(= zH(?zPxxxxxxQxxyx@~@y~AG~B~Cx~D[{ ~E{( sd~Fr0~GFU80~IX0~JX0~KX0~LX0~MXxwxQyxxyyxxyyHwJy+zfxxzXzfxx0zzfxx]zzfxx-z(z( z( {zzxyz{xyGz`~[{~~ #~x~ M}X{0~t{~u {~v{~w!{~x*{~y| ~z 6|(`{{{x{z{${{{Kvy{S|{|,|{,|1|3AVA|g ~}|~~|~|~Wbuf~|~ |+|+?L|r+~|~ }~%}~H}|}{|}G }{} }>}{>};|*}C}|Lb}+/(}+++++ 0}4rcu12FU3}b}}3+ HQ~IQ~JK LM+Nn }[~&%xV~@pHHGPčXbusP`h dp dx+52MR\ -msi5(k8p@VHVPX `hx : E-id=# ,!!{# $%'#) + u` , ua - ub . uc / ud 9 ue < uf[~U@@Hg)Hh cpuHiXHjXHkX HlXHmXHnXHoXHpXHrXHsHtHuXH{  H|D8(H} 0H~D887H8@@*H.`N8@I+:d; <IՃ  !Ճ"Ճ#Ճ $Ճ(%Ճ0&Ճ8'Ճ@(ՃH)ՃP*ՃX+Ճ`,Ճh-Ճp.Ճx/Ճ0Ճ1Ճ2Ճ3Ճ4Ճ5ՃpՃV~ƃV~ڃ(U(XlKHxy #zX|X}+5~0@ &8d) u ) u!) u") u#) u$) u%) u&) u') u() u)=#  K @  u@  uA  uB  uC  uD  uE27PV!X:U X X X  u  u  u  u  u  u  u   u   u   u   u XVVVV  +(-qos50+,G id-./# 0(1802+X3 `4 h5 p6 x7 8+9+:+;+<+ dev=V~0> u0? u  K+V~. 0opspՃ Ճ  ԉV~uԉV~XMNGOGP!{Q!{R!{ T(U-0VՃ8W @X HY P[ՃX\Ճ`^Fh_ՃpaՃxcՃd pmfKhuىV~ ` aG busbPd eGgu h}$j(k0mՃ8n @oՃHp PqFXrՃ`s!{ht!{p pmvKxw py((>}%FV~d2`23G5!{6!{8-9  ; 1(< 0>Ճ8@({@AEHC _P pmEKXU(Q,,!SE(6_(,|1|J0XYGZ!{[-\ ^ pm`K(dٍ+dٍ.d B D E F G H"q Id.  Aʎ3K : @ٍN O+ P  Q (+a, -u.u/ ʎ 0pʏqfr s +t du v$ذ(a"#&'' E# J_X!t/E34= len4=2t 6V1Ԑ8ti j k:Ur0 s tXuRTXU@VW X Y70[<8_"``әha+pbdx7d_ِmn4d_uv00&x{7| Q}~ 3A VAX }}! ә(wJ0 d8+@H EL P ~VX ~V` ~Vh=p=t=x=|# t =U++ ϴ0@H XP XT XX X\_` h1Ip8_/H P(X`'h dpL+'@  ,Th |( 0 8 @ HLPjX`L&@ә E+  ָ(![0!`8e@"tH+P+X+` hUp Xd&#$ԏ  ĺ f κ غX R(1|` d=~V~V!="/ 0 c1 4 6X<+5 BG@D"HFPI#XL`O LdRXhSpZnxa'qb'qRrcucd!Xf+5k01n#@@oHq#Xr` %X  X""'O"XGOԐ1h"Y| m  7  EF GәHIĚG mnt   eeuGQ  ؙo "כ# nid&-+4+7:SRSŜUŜXYZ Xc 9 d K(4rcueHgdXj` idmpptqGxr uʜ+כ# zz z" z$#@@z-, lruz/Ϝz0# [2W nr[3 ns[4Wf6l+1{3+ valV {%X    #5:+ 5 ^ ^^l4rcu^m^n9^o u^v^x^y ^uɞ x^+(^r^t+^^ ^G WV ^K ^d ^ P%d`+ ^lqMMK^Ο^` key^M^J^ ^X^6^ ^ ~V ^ ~V(^\^+^+^^ ^  (^w ^ɞA ^^^  5 ^^%w  ŠW 9D_+0#8@ uid 3AP#X X`$ h]] 9] gid] VA3+J] ]rcu]ԠW>ء+?8_A_ _! _"+_#V_#V _$+(_$+0_'i_(V_)V_0_1 _2 _3 _C_Di_L_M"_N8_Q_R X_S_T KA0+ K@+ @ J9d+ d n"0֣:U7 ` %4rss 0x8:U@ XX L fn J% arg d  =`Sz `T `UƝJ`W `XX`Y8`Iۤ q`J ioc`K^RX/z `\X0 ۤ  val  . val  <FQQVi~n+v8_`#abc ud u4rcue reffQ0:~  v + %(XTPƝf++ nP% . 0  4 45X67*+   %Q  3A  s  VA  .PX Q/Q  VV(V8 fHО()*+ ,0-+5@. #`/ Xd0әh14p2 x3+4U  ˨ val %X6 BE4 uidF 3A gidG VA H ˨DUJרHة      ( 0 ~V8 ~V@H[+ X(X, 0 8d@ !M [@8&9?:?;?<?=S >S(?S0@q8?ә+SDlәl4XXDESF8G HHSIS JS(K?0N a8O@QHSqPv8ә$H=\\7Mz7z˨f7\xYZ[V\V]V^V _V(`V0aL8cL@dHeLfVPgVXhV`iLhjp8'XXXX XXXino  ( 0RXRb+ XXX XXXXX?ƯƯ? ( 0*8 @HHƯPәeƯәXәb˯ә4*әlCәC'/&S8  X U 0 H-ops!Ȱ 7+ةȰ+Mذ+5w}  d+ʏWz ʲ (H0 a8 {@ H P X`h p 1xJw 0p+pu \fewJpuʲwJڲڲ߲ ϲfwJXUHfwJXXdawJM{fuʏϏwJ³u,,,uJwJ6hhfrm Of|ʏϏW5ϴ_XK@5! *A*75nSs  X n x&@Z[\]ھ^` b>(d\0eu8f@hHjuPkXm`o3hp`pr ~xsuvy{-}Px     "(f ;#pid K76uid 3A3A $  +XX XX 5 %+5 VK )e@*+$,-,.Pd&0Ÿ  2Ÿ`ָ֣+V  * * !: N( *0 ^8?@wHPwX`hp ^x  5N g g ^۸V jo y~   ̦  ɺ Ӻ ݺL+$. u11GVX6a pos . XfnfuͻfGuʏX һf1-'fuEfX+,^f-Jw7fcfo|fѼff ּ+!f++++TNSfuX+vfuSXSfU {˽fsfн ffX:ffXSSXX ?{SXb 7 XG 7%ھ7}7u߾ >7 Qu\ 7 Cu7 a7 Gz7 Q7 QE7 7 X. .s[e[=Xv8~ e7VV 77 fXQ7fQ}- P }2n ns U n} mt U +7(X7 ә!7:7p&N7?^әSwәcә|  ә{-s  ә5әGII7:gәS{{ l  ָGd + * . . =aa     % 1G(EFG modG  opsH!I )JK 7 2Le argM d strN arrOVWXXe \ max^X_X num` opsa!bd^0(7)`6"+ J+ X {- +L+7`-.x mod/ @0xH mp1P2HKX 85H6w7 k9 ; <(= 0aafHafGp G  (X>?8E"modF 2G?PpxqdrdsutXImtnw  X 8˝`"+ x  WZW * dGG+i/sI "%X-7 (,|1| ijwk 9m \4V~4\V~4G>XX+(X(X85 0`!p"e `(X1(XB(XOcCd&je2f4gu lidhu C:} W afV uzascma 0:1G2 3G4?6X7`8:h9:p::x>+?d@/0 ops1"! dev4V~56(7 8??  %X   h d@z{| d}d~ "(0 irqX8X<+@+HGP dirX #8 Girq XFU!X \( q0WWtIGllFUa023G# 4X@(X%X get put   ( 058X@lHlPX`hpx4HQZRX idSXTZPfghXi1uZSZ(Zu ZG5ZGXdXZG :GlZ]ZqZZGZGGXX_Z&d4ZX H9V!s "V ptr#dhL busM;NOEP Qx(& ;;(d8@4Ppops* dR} V~Rdev[~xx X X  @dX`     X " "(56+5len7X cap8 $5d &` J_KbusL;M;O d P(Qi0SX8T<U>V@WBXXDY HZ I\J]sP`}Xad`c=hd le mf n g xh ppini qjrkxmrnVtavy  zX( |X- }X. ~X/ X0 X1 X2 X3 X4 X5 X6 X7 X8 X9 X: X; X<XX| X X XIdev[~-irqXu@ XB X B X B X B X B X B XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB X B X!B X"B X#B X$B X%B X&B X'B X(B X)B X*B X+B X,B X-B X.B X/BF XH #LP X@M X`M XaM  d  -vpd  XPO   _     = X`P     p 0  2 -rom8  @ GH  +P #X $$s n xSrG    ( 0 8 @ 4H#9P!{X!{`hu w+=+x+   +(* S! c"#$ _#D+S;Dc;Xd;Xh;X%;X=;<#=.H X8_aehk l o (r 0ddddddd d =4d%%XuEmuNuT uZuem+*n7nc++uuuuu}'%3+u@ u}'A(v0vmav1-v2 v3 +v4+v5+ E5v>v? *v@ +--+--+++*n47nX *nR7n++9+f-W-+dkG--RR-++-+G0,2 3G<+6, UZeejU@@C`D`EWhFGIHIXJXKXLXMXNXO+PXQ XRS TU-W-XWZ#]+0^ X8_:U@aXXbX\cX`dXdWdirghrcunpoxq+5rs tGvhXX dR##@hR irqXX devV~ msgSA S(40 V8d@ HP8= irqX5p ( d0`SG    ( 0 8 @ H P X $` $h p x     9   s s     ! # $ &+WX-u $X9s)NNS =s>,xudX- cntXG#%X"W , pin-./=@0=A1=B4567+8 R SW uvTHI{JK=L=M5N-OR P d(00+++ack+eoi+ +(SPF{I8=@=D %Hx!Q" #d$ `% u& ' ((X0)X4*=8+=<,=@-XD. dH/+P0+X1p`2h3x=`dQu=deFz3+(X@ R>SXTXUXVX WX gcY> M3+%X        = d Px?Lx@xAxB Pxexfxh mapxj;xk Pxl xq(xs 0xu8xv @xwHLp:MpM;pX5"PpX@}p:}XGUpXXdpXXpupp ?@=A=B=C= DGE $p3+  === = ==5 =I 5 =!="=#=$=%= &= ()=*=+=,=-=.= 3UG 136}7=8= 9S> ? = @GB C = D}F G = HIm n= o=q|r s t u v w  x Xz {  |dly|V V ptrd dMA pci vVRdFP    .  C( a0 v8 v@ H5  H =MXops d I( d0G8 d@p X5p XpV~.pRCR3apV~HvpV~fp5{[uV~pp #f#/0/012X3X4X5X6X7X8+ irq9X(:h@,  dd dd  d=d $)Gdd SXvd d d%d dd d.d -, . /v 1P 2 3 5t 6G 7q , dw 0 w 4, b 8PP $ %X &X 'X ( ) *  + 1( u 9t0 :@,,! I uc valH  val==+L," +Lt" +L" hP<d6X6]/MItdMGd6DdM@dM?dM<d6#di (Gj6'/6H/ 6i/.hzd dhtd.dv62d68dƝ6?d MS6@/=6a/%i4x(Gji2(Gjwdev8dxerryoutZ$[L L) BNN\ _ !U|Q0 X]]BNN\ _ !U|Q01 ]]NN\ _ !U|Q0!xU|T S$+" a#wdev'dk0k; kHdL Wxerryout($HUvT|QW$'UvT|Qs^a}ldev+dU;4T;A.Q; dRa ldev 2dU; ;T; Q; dRa1ldev2dU;;T;Q;dRzCdev)d"2"@d UQzdev'dU{0T{>dQ*barhmdCdev'd"0*posX*res(*bar+#8d<b  |}~ l!T Q<n]\ 6cCdev%d"."<%"Id*barZ[9 9) !aUU#T S+cI Cdev&d"/";="Hd*bar*posX*res(8=ZY [ 9 9) D: 9=L$@ U|TsQL!U|Ts^!aU|T SY + I c Cdev&d"/";="HdobarZY [ 9 9) D:e 9=L$@J U|T}QL!U|T}^!aU|T c>UCdev>*d">3">?">Ld8@U*errAvalB*cmdCZZo+ OG D PG+ 8Gu< GBQ !U TsQ + ON DK PN+ 8Nu< NBQ !U TsQ +OU DPU+v8Uu< UBQ !U TsQ +pOX DPX+@8Xu< XBQ !U TsQ +:O^ DP^+ 8^u< ^BQ !U TsQ [j9a 9a) +4Og DPg+8gu< gBQ !U TsQ +E<bi^ znJFF[Q 4 a\q !  JM[bQ4 adF U$6=\dJ:\5d=2i:22d=dpdev:(= %d: ;: G=|.d:|D:|PX=%X%:<:uv=z0Q:zC:zX+GlEvld=pv!lGEv=l= )pres D(G'#dF'0G "uEkey "JF "Z (# BEEvBIEFBSZ|Eptr6s646u64s[ |  & .  1[ 2[ H I X ] ^ _ `O&& <[  > =    #y& % & 4 = B h/ n> } M W W [ [ W ! . \  E  M h        O. B B RRBG\tu.W/z@vH  J   "    (   0  8  @   H   H  H H  H  H   H   H#@ aPhJJw [m4'kp [([,0 8y@yAyB[D HuPHmem@. [+0:D (g0[8g@[H[LIP[XN`[hSp  x[[ ][[[ g [! "[%&9[:?AD F \P Q[(T 0       val \    , L  L  \ .w  \(   \   w ZZ     D   [., fmtJJJ[JJ$e f. g h u v/w/keyx  U: V \ jW keyk nt keyo c6 7: 8W 8 JJJJ,[,[,4[key9t (![=9   8U VmodW XJY Z ([ ,\ 0Ju v w x[y[ 9 .[O. /T1[set3Qget5j7 $I 7            (  0 -8 !F@ " _H # }P $ }X %` &h 'Ⱥp (x ) *  +1 ,Y -^ .1 /  0  1  2 3  5  9 E ; r > ? @Y d!/key"/? A. B Cmod <=>gd|. !D% + -/  Yb D .(,--.. //0e1 q -ideclsy~~ @W2O.O.@-end-J.. (0&8#-@ "4[[ g L8( [,![0( 4)S$8*[H+.P,"X5 `6 d8 h: l; p< t=[xAse?C@'rt@DHdlAEBzEFG-I5J.K[OGXH]H-`"A@dh[k[ l.m nH oH(pc#0q gXs`ubx dyGhzp{!H.      G @J5(-5P'mm,h,pIx    .[  [,  [,  [,  [-  [-  [-  [-  [-  [-  [-  [-  [-  [ -  [ -  [ -  [ - "[ -.{&'pid a a." ""(0@IPIX "I%,(,+ g- W. W3 W4@6j@: \(=.0>.8A W@D WHG.PH.XK#>`-Nh>TJKWJKZJK^9Lk 3mCLp 5 q/5(t.8u.@'fsxMLH{WLP~aLXkL`Ph OPp 8x 8 8G<. [BYP ?[7< W  W #   G 5( "8 cP@  gH mPP wPX P` Ph Qp .x  Q = [  W  W  W %8 ?  Q   >  > "Q )]Q    gQ0  m48  [X lQ\ Q` m4h  Q       ![ "[ # $. & W ' W ( W -) 3Q C D. LQ N. RQ S>( T>, Y.0 ] 8 ^ < _ @ ` D -aH d]=X gQ i(= lQ w x z. } ~Q  W W    \ \.[QQQaR [([,G0Hrcu0L8@ D"Hh7PkRxL8 g "uR RRg  W    >- !"#$"#-.<R-F{+@@"  #" "  '#  "#(! N#! S#3#.c#. ! ;3#c# !?#3##. " 0#c##dJ#eKx#gix#i x#lx v(#$8$$9,$$<,$$=,$$%<S$ %=[ %> \%:$%;$1$src%A  dst%A $$g&&&!['$  ('@%'@%val' >'!> '">'#W'$@% >'*g% '+&% ',#%(%(( g%)%)V) /%''%'(m')$E%'.W '1C&'2H&'3'4 '5.'6. C&('{& '%$ '/% '7%8'&'.fn' &M&&&{&&*&*Wend*W+;'$cs+=W$sl+?W$wfe+AW+E'$ss+GW$sti+IW+KW$nmi+MW+PW +SW0+VW8$lm+XW9+]W:+dW<+' cs+  csx+W +&+( ss+  ssx+W +'+g)r15+m.r14+n.r13+o.r12+p.bp+q. bx+r.(r11+u.0r10+v.8r9+w.@r8+x.Hax+y.Pcx+z.Xdx+{.`si+|.hdi+}.p+.xip+.'+.sp+.',B),C ,D ,E  ,E ($s,E ,$dpl,E -$p,E' /,F 0$avl,F 4$l,F 5$d,F 6$g,F% 7,F+ 8 -. -. -. -. -.- "*pte-) -" *- E*pmd-) -".*.%n*.%%)(.%/Q*J.' *pgd.')(.'"{*J.p *pud.p)(.p"*(.**@/H+/I.)aa0/ \4/.80;{+0<0=0? [ 0@ [$0A [(0B [+#@@1,13sp1.es1 ds1"1$1&1.(1.01381.X1.`cr21.h1.p1.x1 41. 1[1>1.1.1 3Afpu1 +3@N#,#@@/,)h@/l@*"*E*-7/.)zf/,/ n*f /y(/,/f0./f8/X/fh/%gp/.x/e/ g/g/#/Q/g/e* 2 E.2 2 E.(3 3 p4.cwd4>swd4>twd4>fip4> fcs4>foo4>fos4>4.4>l>..4*/rip4+Wrdp4,W4.Y/fip4/>fcs40>foo41>fos42> 4)m/./04@/ 4A/ 4B/>/. K4$10cwd4% swd4& twd4' fop4( Y/45>46>4910 4<A04>/Rm/>A0.>Q0.?4Q.1cwd4R>swd4S>twd4T>fip4U> fcs4V>foo4W>fos4X>4Z.4[ l4\ m4] n4^ orm4_ p4` q4a.1x4b>. C1.WS1.@4:14; W4< W4= 1W1.#@@4O1.4P/4QS14R1@ 1/.w@4^<24_d.84`/4aQ084b1@4c<2 M2d.#@@4f24h[4k[4nW4qWxfd4tW 4w[ 4z[ 4[ 4[.41@@4+34 W4[4[ xfpu@434[4.434342 420.4M2@@M25 35 W5WO3.)3.33.4 46>R46?.6@.6A>cpu6C>7 m47 \ 8)48*#8+ osq8-R4 8/"9"9"9![:5     ;%5; *5 %5< J5<(= 5= = =>5>.>5>55> 5> 5>5>5>5 ?%61? 5? ? @6?5![@ ]6 @@'61@(5@)  @*6(@+c70@, 8@- 9@. :@/ ;@666]66@@A/c7A0A1[A2 m seqA3X?A46A5%6 A6ˀ0A7 86(B7B B.B 7B> 77h77C7CC \C7 7D 8D8.%8. D87EL8E \ E18F+8F,F-xG8G8G[`G.hmaxG.p.8. H 8sigH8 H8 IR| IS 98 IU IV*99LJU9 J  J g J /9J'9J(J)J-9J.J/J0 U9J1J59J6J7J8 U9 J<?:J=J>J?J@JAJSp:JT JUgJVg JY:JZ J[ J^:J_.J` Ja JJ ; JL JQ JW?: J\p: Jb: JE(;JFg:JgL;Jh_fdJiJm};JngJoJp[ L J%; J*a9 J29 _rtJ99 JB9 Jd ; Jj(; JqL;0K <K K K K };0K 1<; K< =<K o<K!K" 8 K%<K'9K(.K.9K0 8 K3<saK4o< L  =L L .lenL .L y(M(=M 3#N$]=N%*N'N( 0ND=NM# =NPy(NWy)8O =OWOWOWOWOW O#W(O,W0P)#>P*WP+%6PP8X>P9X>P:[HP;[L=h>.8PD>1PEPFm4PG[0 Q>?QKQZQpQQQendQ?O?/.R!1?R" [ R&?RDX?RD1? RD=?RE?RE1? REd?RT ?RY?RZ # R[?S ?valS S ?S ?valS  S ?S:@U WV WW *[[j@    0h@i1?jk:@cpul[mWnW oW( "A.MA. >7@@A W W W > >. .(.0[8#@C W W W W W  W( W0 W8 M@ WH WP MX M` Wh Wp Wx  W  W  W  W W W W W W W W W W#@D"A. 5! W(" W0# W8%@&P'Q(R)S, WX- W`. Wh/ Wp0 Mx1 W3 W6 7D9D;D=.AavgGMA@C D0KTELM.N.O[ P$Q&STE(D(]fEkEyzEzEE7`F.a5h Wi W j W(k W0l W8s M@t WHu[P [ [ [ [ [ [ [ [.]6X.]6rqGYEFzE(^FF"GzEerqGWG%[ %[ %[%[JG    yG[bWG[s>GGGZ GG G GH.o#c# H7 I ϓ o dT  @  \D  \H 5P .`  .h )ݲp .x   #  dT  g&HfpidpT7IT9 L8T:[T; #T<inoT=WT? T@@TBSH2rcuTC`TDpII. UIU[UTIVoEKVp#uidVq ?gidVr ? Vs ?Vt ?Vu ?Vv ?Vw ? Vx ?$Vy [(Vz*0V{*8V|*@V}*HV~*PVXV9L`V9LhV9LpV9LxV gVVVlVB<V[)3IEKfkeyW9LWL8Wל)fWX semWdT(WbPW gX`W UhuidW ?pgidW ?tWxW|W~W W.6WgOK >L HL RL \L fLKXX^PX_L8X` \XaXb XcXeS Xh"8XkG<@XnXXq`XsdXt"hXwpXx[tXzx,X[,X[X[XX1X]6X itXX6X#>XȡhX \XIXMttyXݡXX ?XWX WXWXWXWXWX@X.X.X.X'.X. X.(X".0X,.8X.@X.HX".PX,.XX.`X.hX=pXXXpXX [X XyXXX,Xm4XdT0pL\ XOPX#XL8XSX`  P TP ^P hP rP |PXYcPYd#Ye \Yg Yk #YmoYn}(Yo0YqV8P Q1< Q Q Z]QZZZ$Q bQ |Q. |Q Q Q.Q.> Q Q8Q. Q Q Qh[yaR[z\[|[[}z])\[\([h70[.X[#]`Q fR pR zR R R\\\\!\%\'\,\/#\3\5\9\<\A\D\H\L\Q\U\YS]^#S^$#^% ^' S_S_ L8g` `"S`1T `# `T`_TT`[`gg(a0Ta1#a7#osqa9R4a; a<"a"a"a"a"ab+Ub, b- cc PUc UcdUdgdgdd Ud!ud" d$[Hd'1Vd(Jkeyd)W d*1Vd+g d,g(d-g0d. 6V8extd/;V@PUU d3 d8Vtpd9Vd: gd;>d<>U )/ e VVVVV eVe#eeVXfq5WfrVfsh7 wqfv:WHcpufwP 5WBxgWgBgWgW(leng#HgWPg p?WW..W.W.K@hXhXhXh 1h#@@h DWHh!.h".h#yh$h7h%Vzh& h'#Y0h(.8Mcpuh*@Mssph+jYH#X.`h6#Yh7#h8Wh:W(h;.Hh<#YPh=Xh>\XhejYhf[sdahgZhh hiZ(Y\xhDZhE#YhFZhH hIm4(hJ#HhKm4PhL.phM.xhN.hO.hP.hQ.hR.hS.hTyhU.hVm4hWIhY \h\.h].h^Vh_jYp#YZ.WoYijZ j31 j31j"'[j#/j$ j% j'K[j( j) j+o[j, j- j![ j&Z j*'[ j.K[ j[Zopsj[o[ [[j2\j4.j6[j7[ ![[@1\   ![[HZ\   [p\[q1\[r[s\ \[\[[[.{[\1[[.B[\\|\@[z][Z\[.[.[. [ y([,[z]02rcu[8[]H\[[][id[]]/.[][] ](k!^k kMkkk l ^lWl& l)dTldtl*^8l..@l9m4Hl:ghl;_pl= \xlC |lD~ ^m _mgm.altm.m.m. m.(mW0m8m@mHmPmXm`mhmpmxmm m!^_ lF!^/\`/^ g/`[/X6` lru/Y_ /d /e/iX` /j . /k.(/R``/hI6`/s. (/u`/z.pp/{`/|./}./~# `/`/./a/a/ gnanmrefn8nIHn4hn[ln.popsn 6xngnaB(/QaX````N//a /[ / \J/ bval/.(/a9/M=b/N g/P[0/JZb[lru/Kb0/Wb/X g/Y b9@/Gb/I.=b/UI/V . Zb(/[ \0/\ \4/^.8C@/Fcb8/j*9(/muc/n./o./q \/r \/s \/t \/v[ C@/lcc8/z*90/}c/~././ g/ g/ g / g(9 /'d/././C@/|Jdcc8/*7/Dnd)b)uc@)'d(/.nd7 e  #     R I  g  ϓ( [0 [4 JK8 @8P  p  gx # $  %  ')]d/5ectx/6e e/=e/>S/@?(/Xe/YdT(/\Sf/b./h./t:/w /}$9/zf/./.C/fSf8/0/f/{d/nd} /fArb/5/.e fobgoc oh ojokoq os(ot*0ouH8ow\@o{Ho~PoXo`ohopoxfgee/0h/Wcid// ~@@/ Jh/ \J /h//./ Q@@/\l)0h@/1T@/.P/.X/.`/.h/.ppgd/  ,x/) \/5 \/?\l/E./L[/S \/Z /]#/_/a#/pdT/r//././././/. /.(/.0/.8/1?@/#D/.H/.P/'.X/3.`/.h'brk/.p/!.x/././%./0./al/ql@/l/_/.h/#p/lx/"/l/e/&l/./.// \/ \/]/#/V/l/././#/ Jhg.ql.3]l. l l l l l.l/.(/ [lpo/_mo7_m(pmdo9 ,0pudo; .8@oE*HoF*PpteoL ,XptloPS`oT *h*[/m      @ OOOOO"p6"p9"p<"pG8nann.n5n5n.n. n.(ny0qroqqJopsqq g q[(q[,qm40qroPqXqB`gcq"hdevq|pq|xqroqq q9q[qoqan@ywor,or- #r/ r0go0s3 ps4ěs6s7s8 yxas9o  tOpt.t5tTprevt. Opttpt.qt.qt \t \t.qtJ2rbt5nstW0t[8t<t U>Nr@idtW`t ghtrp2rcutxtp tuqopst?rt!Irt t.qht:rthst xst"st$ st% s t& s(t( t0t2 8t9y@t: tHt= (tPt@AtXtA _t`uq:r Dr t|r dirt p tYp t3q |rr tTsknt.qtetrt gtm4 tm4@t`tht xt   t  y@ t  yAt %gcscsrTsxscsmssrg}sgsrssgsrgsssrgstcss1tcst#t  tAtcs--t_tcsFt![ut  0u'tu(dtu) |ou* tu+ uu,u u- $(t@gtWuuu t@Wuvmvv>v Uv[v  vWvWinov)W devv* I(v+ I,uidv, ?0gidv- ?4v. 8v/(U@v0(UPv1(U`v2(Upv3Wv4Wv5>v6>v7Wv8Wv9>v:>v;>#v#J# U#mv #nWw #o&awX#0Rw#1mv#2 #3 g#4x #5 x(#7 x0#9 x8#; x@#= yH#?;yPv\wvkwRwfwUwwFxw@w@AxwAJwBwCwwDy wEYz(sdwF.q0wGS8,wI[,wJ[,wK[,wL[,wM[wmvpwUixwfwPxxwfwnxFx@Ixxew\wxxewfwxyewfwx;yewfw-y#ky# y# y@yywFxpyywFxJy`wyww #www {Xy0wtTzwu izwvnzww!szwx*zwyz wz z(yTzizw^zkyxz#zzztAx}zWzzzzzzz??z\ w}%{w~%{w5{wMbufwE{w 5{.E{.?OV{d.w{w{w{w{V{{z{{J{z{{{z{z{{{O{./(xI|x.x.x.x.x. x0~|2rcux1x2Sx3~|{|/. xH|xI|xJxK xLxM.xNl I||#w|@pHJP\Xbus`h gp gxm4&.P 'msim(8@WHWPX `hx r I'id># ċ!!sz# }$%'#) + y` , ya - yb . yc / yd 9 ye < yf|K@@AgAh cpuAi[Aj[Ak[ Al[Am[An[Ao[Ap[Ar[AsAtAu[A{  A|6(A} 0A~681AЀ@@@ƀS6@.y:y; y<yYymy  }y!my"my#m y$m(y%m0y&m8y'm@y(mHy)mPy*mXy+m`y,mhy-mpy.mxy/my0my1my2my3my4my5mm|^}|r*yU   *[yl    HyxFyy #yz[y|[y}m4y~0yK@ F#8yy%y y %y y!%y y"%y y#%y y$%y y%%y y&%y y'%y y(%y y)y>y# yyI y@ y y@ y yA y yB y yC y yD y yE.y]6PyWyVySyy \y \ y[ y y y y y y y y y y y y y y  y y  y y  y y  y y y[yyyyyyWyWyWyWy y Ç('qosy͇0z+z,Jidz-z.z/# z0(z1h70z2.Xz3 `z4 hz5 pz6 xz7 z8.z9.z:.z;.z<.devz=|,z> y,z? y Ç|/ ȇyCopsyymy Symy }y }ylS|yCl|[X{M{NJ{OJ{P!sz{Q!sz{R!sz {T({UŊ0{Vm8{W }@{X }H{Y }P{[mX{\m`{^ފh{_mp{amx{cm{d }pm{f{hyq||`|aJbus|b|d |eJ|gy |h$|j(|k0|mm8|n }@|omH|p }P|qފX|rm`|s!szh|t!szppm|vx|w }p|y{ފ|ʊY`}2}3J}5!sz}6!sz}8Ŋ}9 }; ɋ(}< }0}>m8}@(z@}A݋H}C Ppm}EXUċċW݋΋zz0XWYJZ!sz[Ŋ\ ^ } pm`(Wq.~~g~qƌg B D E" F1 G@ Ho Igƌ ', 6;AbˌK :} @qEN O. P  Q (+, -y.y/ b} 0 pb qe r  s c t g u  v $("#&'' ݎ# BN )ݎ304>len4>2K 6W1l08pKi j kSrȏ s tNuRT[U?VWXK Yϓ0[ԓ8_"``kha.pbgx1dqmn2d_uvȏȏ#x {ϓ | U } ~ ?  ? [    !-  k( I0  g8 .@H  IL  P  UX  U`  Uh >p >t >x >| #       > dT . .   7         0 @ H  \P  \T  \X  \\R-` Ah- &Hp 8RgH  P (KX U` _h  gp.'@Ę ( $0 $8 9@ WHPX`#@ k   I  .    ( !0 !8 @ "H .P .X .` h dTp   \ g & #Ը ޸ $   l   e    [  (- `  g > U U !> " / ~ 0 Y 1  4  6[ <m4  BJ@ D"H FSP I#X L` O d R:Wh Sp Zlx ao boHrcu c dV fm4 k0- n#@@ oH q#X r`![ [K[Jlɘ$9ϓ)W> EFGkHI\ߙmnt  yߙp "o# nid&-.4.7QR?S]U]XYZ [c L8 dI(2rcueHggXj`idmpptqJxrub.SSXo ?# ss s" s$#@@s-ělrus/gs0# T2nrT3nsT45.ɛ/. *valW ![ Y   Y  "͜Ҝ. ͜ W WWl$2rcuWmWnL8Wo yWvHWx Wy Wua$ xW.(WrWt.HWWWJ L W Wg W g. W '9L',9LWfWkeyW9LWBWƇ WNW5W W U W U(WW.W.WWW  (W Wa9 W6WW 0 WSW S ]1 L8].0#8@uid ?P#X \`$ hV$V L8VgidV $?3/.BVV VrcuVl<p.?8X٠X X! X".X#WX#W X$.(X$.0X'X(WX)WX06X1 X2 X3 XCQXDXLyXM"XNyQ8XQXR \XSQXTI~٠ȡ.Iء. ء X8.  +"0nS1 ` 2rss + 08S@ \X fn $arg g  >YS YT YU^BYW3 YXNYY8YIsqYJxiocYKP) Y\[0 s3  val  ƣval  <ޣin.v8_`#abc yd y2rcue reff0ң v . %!     . 0  4 495[697bII.S N X]  ?   ? ƣP $ [ Ug   (U (U( (U8 eH)З()*+ ,0-m4@. #`/ \d0kh1lp2 x3.4  val ![62   BEl uidF ? gidG ? H D>JH 2 2 2 2 2  2( 20 U8 U@Hڨ. [([, 20 28g@ ڨ! ڨ@8^9w:w;w<w= >(?0@8ߨwkc$|klXDWEFpG HI J(Kw0N 8O@QЪHSP$pk\$uϓ2ϓЪϓxYīZ[W\W]W^W _W(`W0aM8cM@dHeLfWPgWXhW`iMhjp8_[[[[ [[[ino  ( 0[ī. [[[ [[[[X­ww !(D0b8D@HPkǭk[k?kl?ժ&bk?I{k{_g^I8  [ dT 0 H'ops! ϓ...0 w5 }:  N 5Ng?cbS   а       N( 0  8  @  ̱H  ܱP  X ` ,h  Jp  ix     زh* ˰e˰JdIհyI˰ IeI[I_T˰!eI[[˰gSI˰y̱˰ ܱ˰ѱbgI˰˰6,˰yJ˰1d˰ddyOI˰ne eزbgIJ0  b [C - 8 0 R !R  b7bϓW0  Q     [  #@ Z( [Ѽ \ ] ^0 `N  bv( d0 e8 fн@ hH jP kX mH` okh pp r x s u v$ yG {e }  ɿ  ( 2 < F P Z( յ e  '#pid I 4uid  ? ?  $ 8  . [ [  [ [  0 ] m4  WC  )8 * +$ ,յ -d( Pg#0      . Sn.  D  b  b  Y r  (  b0  8 w@ H P X ` h p  x      E  m       W­  Ÿ ʸϸ ٸ     O/.$( <AyiiJW[n   /pos  (  [eesĹeJs#b#[(  Fei21_etK}e[.de-ϓeȺeeͺ e'e', .Ye....6SQes[cesQ[ѻeѻ_Tֻۻ ereEee[ree[J[ w#[Ѽϓ[Jϓּϓ0ϓyN5vϓUySϓ{ϓнϓJϓUսϓUIHϓϓ[ ffM>[upپϓپWW޾ ϓ$ϓe[UGϓeU)eLj ɿ mt 1T .ϓο*[ 5   ϓDk5YϓIrϓ^ϓwkkk k,r Ek"mkJJϓ$rkX  Jg . * / . >Z9Z    QE9] iJL(ELFJmodG opsH!(I *JK o jVL argM g strN arrO#VW[X \max^[_[num` opsa!(bgT0(I1)IS5Z. . [ , +O.7`-.wmod/ @0wHmp1P2IX 856mv7 9 ; <(= 0$J J  *[>.   78EZmodF .G-7Ppqgrgsyt[Amtnw.  [ 9cSZ+. 5 ?@VjYLV bXJJ.gD Z![|-  y- zz iSjmvk qm l|lS|lJv[[.*[   *[&   8m 0!ro" *[1      *[B  *[O&  c{d&e2f4gy lidhy {҇|  W ecma 0r1J2 3J4w6X7`8rh9rp:rx>.?g@/0ops1"Ydev4|56(7 8ww  &![ &    h>C&Wg@z{2| g}g~2 "(0irq[8[<.@.HJPdirXW "8 irq [SV ( 0H*S0233# 4[@*[   ![(  Tgetput   ,( E0m8@HPX`hpx:Sl(TQR[idS[TPfgh[iC1yW,yEJ1mJ[gJJ rJJJJ[[55^!gS?l[XqL! "W ptr#ghLbusMsNO}P Qw(# ss(Z8@*Ppops  g{ |Hdev|\w\w [ [  x   [ " "(56m4len7[ cap8 $0Z #` JUKbusLsMsO g P(Q_0S[8T<U>V@WBX[DY HZ I\ J]iP`sXaZ`c>hd le mf n g xh ppini qj rk xmhnWtvy  z[( |[- }[. ~[/ [0 [1 [2 [3 [4 [5 [6 [7 [8 [9 [: [; [<[[ r [ [ [Adev|'irq[wy@ [B [ B [ B [ B [ B [ B [B [B [B [B [B [B [B [B [B [B [B [B [B [B [B [B [B [ B [!B ["B [#B [$B [%B [&B ['B [(B [)B [*B [+B [,B [-B [.B [/BF \H #LP [@M  [`M [aM  g  'vpd   [PO   R       > [`P       o  0  2 'rom!8  @ JH  .P #X  d nIhJ    ( 0 8 @ *H#/P!szX!sz`hyx m.>.\w.   .(  I! Y"w#$ U:.Is:YsNgws[^s[@%|s[>;<#=(H [8_uaehk l o (r 0ZzZZZZZZ>*Zu![nEc     nNnT nZnec*lla..gnn nn &/.n6 n&9(o0vmao1-o2 o3 .o4.o5. ;0o>o? "*o@ E*--.--...l*l[lHl../.\-M-.gaJ--QQ-. *-.G0"2 3J2.h6" JOZZ_K@@CUDUELhFG>HI[J[K[L[M[N[O.P[Q \RS T U,W,XZt#].0^ \8_S@a[Xb[\c[`d[dMdirghrcunpowqm4rs tJvh[[ gGt#t#@hGirq[[dev|msgH6 W(l0 K8g@ HP8>irq[9ro ( g0UIJ    ( 0 8 @ H P X ` h p x     .   h h     ! # $ &.L[,y[.rCCH =h~3dmyg[,cnt[3#!["L        ,pin-./>@0>A1>B4567.8 R SL uvTHIpJK>L>M9N,OG P g(00...ack.eoi. .(IP;p>8>@>D @%Hx!F" #g$ U% j&  ' (([0)[4*>8+><,>@-[D. gH/.P0.X1ro`2h3x>UgFj>gZzz;o/.*[@      R3S[T[U[V[ WX gcY3 zB/.![             > g Pq?Aq@qAqB Pqeqfqhmapqj0qk Eqlw qq(qs 0qu8qv @qw HArorB ro B 0ro[9Ero[5rrorr[  HJro[[g|ro[[royro ro    ?|@>A>B>C> DJE |ro/. >>> > >>* >> * >!>">#>$>%> &> ()>*>+>,>->.> (J< 1(6r7>8> 9H> ? > @<B C > DrF G > H>m n> o>qqr s t u v w  x [z {  |glyqL W ptrg g6 pci KGg;P    #  8( V0 k8 k@ H9H >B[ops g >( g0J8 g@ro[9ro[ ro|#roG8G(Vro|=kro|[ro  9pPy|roro"f"/0/}012[3[4[5[6[7[8. irq9[(:?,  gZ Zg  Z>g #AZ g MRpZ g |Z@%g Zg  Z.g-&./p1J235n6A7c, dw0 w4& b8JP$%[&['[()* + +(u9n0:@&&I y3  0.3" .3N" .3" ?  [ 3 3 D" D " D+W D+W D +W D$+W E5#yEx7Z@%gTRZEtwZ.gT% EZT%EPZ0[EvZg1 JT LZ)& + ] $  < > =(8DP:\4U TsQ Ui E, < E$  < > =(8DP:\4U TsQ Ui E-Q < E$  < > =(98DP:\4U TsQ U E. < E$  < > =(8DP:\4U TsQ U> =Fdev1Z+:+F + gPerr3 Vh&=?#BV#?4U@Y .j x ^  ;wQs ;/U@TLQVW?}>gjdev.ZUk7T>gjdev-ZUk6T>gFdev+Z+4Perr3 ^Xout=iiy;UsTvQ^;wUsTvW>r Fdevr*Z+r3+r? +s gPerru3v N?wXoutlQCm V^Q ?y] no4U TvQ R};gUvT|QN;7UvT};wUvT|WV. >^ ` Fdev^)Z+^2+^?+_ gPerra3b fXoutj; UUTTQfW>D - FdevD.Z+D7+DC +EgwUUTTQQ ' Fdev' x I a        K* ; ; KK;@Uop*W+s<}qH { F  a "p    :(   0  8  @   H   H  H H  H  H   H   H"@     ` P ph = F F x    W 5(kp   W( W, 0  8 r@ rA rB WD  H nPDmem @ & *  W    T    ( c0 W8 c@ WH WL P WX ` Wh p  x W W    W @ W W   c W !  "W % & 9W :J ? A D x F U P T  QW( T 0     val U    , E  E  U *p  U!   U   p SS     =   W*, fmtFFFWFF$= e f* g h u v+w+ keyx  U8 V U jU keyk nr keyo [6 78 8U 8 FFFF+W+W+4W key9r ( W=7 8U V modW XFY Z ([ ,\ 0{Fu v w xWyW 7 *WK* /R1W set3 get57 4%E 5   =  c      (  0 ѻ8 !@ " H # !P $ !X %:` &Sh 'lp (Sx ) * +ռ , - .ռ / * 0 R 1 c 2 3  5  9  ;  > ?9 @WW b!+ key"+? A* B C mod :=>cbx* !B% + -/  W b B *(,--.. //0c1 o + idc clsw|| @P0K*K*@& end&F** (0&8"-@ "4WW c 9( W,!W0( 4)$8*WH+*P,"X5 `6 d8 h: l; p< t=Wx=se?D@(rt@,FDdlAFBFF*8A S@D SHG*PH*XKl?`,N?TLWLZL^Mk r4mMpS6 qx6(t*8u*@(fsxMH{MP~MXM`QQh Qp 2:x 2: 2:=* W;Q AW9> S  S #   I 7( "8 Q@  cH QP QX Q` ERh ORp *x TR > W  S  S  S n9 @  ^R   :  : "hR )R    R0  58  WX R\ R` 5h  R       !W "W # $* & S ' S ( S ,) 3R C D* LR N* RR S:( T:, Y*0 ] 8 ^ < _ @ ` D ,aH d>X gR iq> lS w x z* } ~ S  S S    U U*W!S+S5SS W(W,*I0Drcu09@ D"H8PSx9 c "S SSc  S    >, !"$$"$,.<S,F!,@@"  #" " %# "#( L# Q#1#*a#* ;1#a# ?~#1##* ! xZW#B$     0$c$$dF$ey$gy$i y$ly w(B$%8$%9$%<$%=$$&<$ &=W &> U&:4%&;$$ src&A dst&A 9%D%c'~'~'~ W(%((%(% val( :(!: (":(#S($% :(* & (+&5& (,#b&)5&))  &*b&*W* +:&('&((f()k%%(.S (1&(2&(3(4 (5*(6* &((!' (%% (/g& (7&8(N'(* fn( b'&]']'!'N'+'+S end+S,;'#cs,=S#sl,?S#wfe,AS,E](#ss,GS#sti,IS,KS#nmi,MS,PS ,SS0,VS8#lm,XS9,]S:,dS<,(cs,csx,S ,',(ss,ssx,S ,',g) r15,m* r14,n* r13,o* r12,p* bp,q* bx,r*( r11,u*0 r10,v*8 r9,w*@ r8,x*H ax,y*P cx,z*X dx,{*` si,|*h di,}*p,*x ip,*](,* sp,*(-Bu*-C-D-E -E(#s-E,#dpl-E-#p-E'/-F0#avl-F4#l-F5#d-F6#g-F%7-F+8 .* .* .* .* .*. * pte.u* ."*. * pmd.* ."*/%+/%%*)/%/*F/' :+pgd/'*)/'"!+F/p `+pud/p*)/p"G+)/z++@0H+0I**bc00 U40*81;!,1<1=1? W 1@ W$1A W(1B W+"@@2e-24sp2*es2 ds2"2$2&2*(2*02482*X2*`cr22*h2*p2*x242* 2W2:2*2*2 J4=fpu2 3@L#t-"@@0-*i@0m@:+**-60.*g0o-0 +g 0r(0,0.h0-0h80X08hh0%1ip0*x0f0 c06i0#0R0;i0f`+ 3 .3 3 .(4 ~4 ~p5/ cwd5: swd5: twd5: fip5: fcs5: foo5: fos5:5/5:l:/*5*/ rip5+S rdp5,S5./ fip5/: fcs50: foo51: fos52: 5)0//05@50 5A50 5B50:E0* G5$0 cwd5% swd5& twd5' fop5(/55:56:590 5<05>50M0:0*:0*?5Q1 cwd5R: swd5S: twd5T: fip5U: fcs5V: foo5W: fos5X:5Z/5[ l5\ m5] n5^ o rm5_ p5` q5a1x5b:. 1*S1*@5:225; S5< S5= 22SB2*"@@5O2-5PE05Q15R2@ 2/*r@5^25_ /75`E05a075bB2@5c2 2\*"@@5f35hW5kW5nS5qSxfd5tS 5wW 5zW 5W 5W-52@@535 S5W5W sfpu@5E45W5*5E45E453 530-52@@26 r46 S6SK4*)4*44*4 47>47?*7@*7A: cpu7C:8 58 U 9)U59*#9+  osq9-4 9/!:~!:~!:~ ;5;W;W;F;F;F<5<S<S(<60ct<|5<&6 5 W=N6 >n6> s6 n6? 6?(@ 6@ @ @A6A*A6A66A 7A 6AE7A7A6 Bn73B 6B B 7B7 WC 7@C'83C(E7C)  C*18(C+80C, 8C- 9C. :C/ ;7,8,878@@D/8D0 D1WD2 f seqD3@D4,8D5n7 D60D7 868(E8E E*E 9E: 8888F=9FF UFB9 =9G ^9G^9*n9* G8G9H9H U Hz9I+9I,I-xJ :J :JW`J*h maxJ*p*:* K 2: sigK^9 K: LRu LSV:>: LU} LVs:[:HM: M  M c M x:M':M(M)M- ;M.M/M0 :M1M5=;M6M7M8 : M<;M=M>M?M@MAMS;MT MUcMVc MY;MZ M[ M^<M_*M` Ma MJT< ML MQ MW; M\; Mb; MEq<MFc<Mg<Mh _fdMiMm<MncMoMpW H M%(= M*: M2:_rtM9 ; MB=; MdT< Mjq< Mq<0N f=N N N N <0N z=(= Nf= =N =N!N" 2: N%=N'J:N(*N.g:N0 2: N3> saN4= O V>O O * lenO *O r(Pq>P 1#Q$>Q%z+Q'Q( 0QD>QM#V>QPr(QWr)8R D?RSRSRSRSRS R#S(R,S0S)l?S*SS+n7PS8?S9?S:WHS;WLD??*8SD?3SESF5SGW0 T>P@TKTZTpTTT endTP@K_@/*U!z@U" W U&_@UD@UDz@ UD@UE@UEz@ UE@UT @UY@UZ # U[@V A valV V AV >A valV  V 'ASAU SV SW $W[A0h$Biz@jkAcpulWmSnS oS( kB*B* :6@@#C S S S : :* *(*0W8"@D S S S S S  S( S0 S8 I@ SH SP IX I` Sh Sp Sx  S  S  S  S S S S S S S S S S"@FkB- 6! S(" S0# S8%@&P'Q(R)S, SX- S`. Sh/ Sp0 Ix1 S3 S6 7F9'F;'F=*=avgGB@D "F0KFLM*N*OW P$Q&SF(,F)]FFrFFF6`+H-a6h Si S j S(k S0l S8s I@t SHuWP W W W W W W W W-7X-7rqPHF+HF)^8H=H"LHF]rqLHH%W %W %W%WFH    tITbHTs:%I%IIS 2I7I AIUH[I*m#a# eI6 ^J  p U  @  UD  UH 7P *`  *h )p *x  ) #  U  coI^pidpW7JW9 9W:WW; #W< inoW=SW?: W@@WB!UH0rcuWC`WDJpcJK* X/KXWX=VKYoLYp# uidYq A gidYr >A Ys AYt >AYu AYv >AYw A Yx >A$Yy W(Yzp0Y{p8Y|p@Y}pHY~pPYXYM`YMhYMpYMxY cYYmY=Y*y4KL^keyZÂMZ9Z*Z semZU(ZPZ cX͟`Z eVh uidZ Ap gidZ >AtZ)xZ|Z~Z Z*:|ZL M M M M MGX[^QQ[_9[` U[a[b [c[e!U [h"8[k=@[nX[q`[sd[t"h[wp[xWt[zx+[W+[W[W[[3[7[  it[[{[l?[ h[ U[J[Itty["[,[ @[S[ S[S[S[S[S[JA[*[*[*['*[* [*(["*0[,*8[*@[*H["*P[,*X[*`[*h[>p[[1[[F[ W[P[r[[[o-[5[U0MU [Q[#[9[!U[ VQ Q Q Q Q QX\cER\d#\e U\g \k #\mp\n¤(\o0\qX8Q JRz= YR cR ]R]]]mR R R* R R R*R*? R S9S* S &S 0Sh^yS^zQ]^|W^}^*,^^](^80^*X^#^`:S S S S S S_~_~_~_!~_%~_'~_,~_/~#_3~_5~_9~_<~_A~_D~_H~_L~_Q~_U~_Y~T`~a#!Ua$#a% a' TbHUb 9_c c"HUczU c# cLUcUXUcWccc(d0Ud1#d7# osqd94d; d<!d~!d~!d~!d~!d~e+eVe, e- ff Vf eVfgVgcgcgg Wg!ng" xg$WHg'zWg(F keyg)U g*zWg+c g,c(g-c0g. W8 extg/W@VV g3 g8W tpg9Wg: cg;:g<:W *+ h WWXXX h=Xh#hhWXiq~XirXis8 wqivXH cpuiwP ~X;xjXj;jXjX( lenj#Hj YPj pXX** Y*Y*G@kYkYkYk 3k#@@k XHk!*k"*k#rk$8k%Xuk& k'lZ0k(*8Icpuk*@Isspk+ZH#Z*`k6lZk7#k8Xk:X(k;*Hk<lZPk=Xk>\ZkeZkfW sdakg\kh ki \qZUxkD[kElZkF[kH kI5(kJ#HkK5PkL*pkM*xkN*kO*kP*kQ*kR*kS*kTrkU*kV5kWKkY Uk\*k]*k^=Xk_ZplZ\*YZl~m?\ m1 m1m"p\m#+m$ m% m'\m( m) m+\m, m- m!\ m&?\ m*p\ m.\ m ]\ opsm]\  ]]m2Q]m4*m6Wm7W W^@z] W^H]^p]^qz]^r^s] ]^^^]^*v^,^3^^*>^@^]w^@^^^]^*^*^* ^ r(^,^^00rcu^8^^H@^\^^^ id^^_/*^_^#_ _(nj_n nInnd o `oSo& xo)U ldto*`8o.*@o95Ho:cho;apo= UxoC|oD~ `p apcp* altp*p*p* p*(pP0p8p@pHpPpXp`phpppxpp p! `a oFj_0\La0^ c0`W0Xalru0Y(a 0d 0e0ia 0j * 0k*(0RaLa0h^Ja0s* (0ub0z* pp0{ b0|*0}*0~# b0(0Qcaa%b-U0@P@(0XGg0YU(0\g0b*0h*0t60w 0}$80g0*0*?0gg7010h0e0ex 0.h=rb060**g 3hrb,irc erh erj~rkrq rs`(rt0ru8rw@r{`Hr~`Pr(Xr<`rUhrsprx=h,ifGg0yi0Scid00 y@@0 i0 UF 0i00*0 !Sz@@0m*yi@0zU@0*P0*X0*`0*h0*ppgd0  -x0) U05 U0?m0E*0LW0S U0Z 0]#0_0a#0pU0r00*0*0*0*0x0* 0*(0*00*80z@@0#D0*H0*P0'*X03*`0*h(brk0*p0!*x0*0*0%*00*0m0m@0m0a0*h0#p0mx0"0m0f0&m0*0*00 U0 U0_0#0X0m0*0*0#0 i@i*m*3(_m* m m m m m* n/*)0 Wnpr/n0r7n(pmdr9 -0pudr; .85@rEz+HrFz+PpterL -XptlrPIT`rT m+h$W0 o @KKKKK!s6~!s9~!s<~!sG~8qoq*q1q1q*q* q*(qr0tpttF opstt c tW(tW,t50tpPt|Xt` gct"h devt7~pt7~xtpt%t 5t2tWtpt:os@ idwS`w chwsp0rcuwxq wr opswsw!sw wwrhwswtw tw"tw$ tw% u w& +u(w( Nu0w2 8w9r@w: NuHw= quPw@uXwA u`rs s wsdirwVq wq w|r ss wt knwwrwfwsw cw5 w5@w`whw xw   w  r@ w  rAw %1ittstttttsctctsttcusctt+uscuNut0u*gutgulu Suut-vuutu Wxu0x',vx(ux) px* 6vx+Tvx,^v x- 4%(uA4y. 8y/qV@y0qVPy1qV`y2qVpy3Sy4Sy5:y6:y7Sy8Sy9:y::y;:$w$F$ N$mx $nx $o&xX$0x$1w$2 $3 c$4y $5 z($7 9z0$9 z8$; 9z@$= azH$?zPxxxxxxNxxyx@z@yzAFzBzCxzD<{ zE{( sdzFwr0zG-U8+zIW+zJW+zKW+zLW+zMWxwxNyxxyyxxyy<^Jy zfxxy9zfxxzazfxx>zzfxx-fz$z$ z$ zzzxyzzxyFz`z<{zz #zxz .}Xz0zt{zu {zv{zw!{zx*{zy{ zz |(A{{{x{z{${{{,vy{P{{{ |{ ||A>A{U z}n|z~n|z~|zIbufz|z ~|*|*?K|\*z|z|z}z)}||{||F}{|}}{}| }$}|KC}*/({}{*{*{*{*{* {0}0rcu{1{2-U{3}C}}/* {H2~{I2~{J{K {L{M*{Nm }<~"x7~@p$HFPXbus0`h cp cx5-).8 (msi(G8L@SHSP[X ``hjx t| B(id:#  !!{# ƃ$%'#) + r` , ra - rb . rc / rd 9 re < rf<~G@@Dg Dh cpuDiWDjWDkW DlWDmWDnWDoWDpWDrWDsDtDuWD{  D|,8(D} 0D~,883D@@ <N68@**|:E|; |<*|||  ƃ|!|"|# |$(|%0|&8|'@|(H|)P|*X|+`|,h|-p|.x|/|0|1|2|3|4|5Q7~ƃ7~$|U{$W|l+H|x|y #|zW||W|}5|~0|@ "8|҇|E%| r %| r!%| r"%| r#%| r$%| r%%| r&%| r'%| r(%| r)|:|# ||K |@ | r@ | rA | rB | rC | rD | rE-|7P|S|X|!U|| U| U |W | r | r | r | r | r | r | r  | r  | r  | r  | r |W||˃|˃|||S|S|S|S| | ((qos|0}+},F id}-}.}/# }0(}180}2*X}3 `}4 h}5 p}6 x}7 }8*}9*}:*};*}<* dev}=7~+}> r+}? r҇ + 7~+ |ops|Q|| || ƃ| ƃ|7~r7~W~Mʊ~NF~OF~P!{~Q!{~R!{ ~T(~U 0~V8~W ƃ@~X ƃH~Y ƃP~[X~\`~^&h~_p~ax~c~d ƃ pm~f+~hr7~`aF busb0d eFgr hY$j|(k0m8n ƃ@oHp ƃPq&Xr`s!{ht!{p pmv+xw ƃ pyϊ}&7~Eʊ`2ތ3F5!{6!{8 9 ; (< ƃ0>8@({@A%HC ?P pmE+X5N  ތP%? ||*0XYFZ!{[ \ ^ ƃ pm`+(D*cc Be De Ej Fy G Hq Ic ot ~AK :Ŏ @N O* P  Q (+A, -r.r/ Ŏ 0 p qf r  s  t c u  v$(A"Ϗ#&'' Ϗ%# >?JT*%3x4: len4:2T 6S1x8iiې j kې!U|r s tϏJuRTWU@VϏWX Y0[8_"``ha*pbcx3d?mn0d_uv"x { | N } ~ A  >A W  Y Y !Ѷ  ( ^J0  c8 *@H  BL  P  eVX  eV`  eVh :p :t :x :| #    P   : U * *   ۶       }0 x@ xH  UP  UT  UX  U\MѴ` h, oIp 8M H  P (X ` h  cp**'@ 2F Z( j0 j8 @ H*PHXa`*"@    B  *    ( !70 !<8 A@ "PH *P *X *` h Up   U c &_ #x  $      f    W  .(, X`  c : eV eV !: " / | 0 W 1  4 ú 6W <5  BF@ D"H FP I#X L` O )d RXh Sp Zmx aq bqDrcu c dX f5 k0, n#@@ oH q#X r` WәWә-WF-F7ZKj_o EFGHI̤% mnt  CCr%/aM "# nid&-*4*7!SRSUXYZ Wc 9 dK(0rcueHgcXj` idmpptqFxru*f# vv v" v$#@@v- lruv/v0# W25 nrW3 nsW45N6J*Y/* p valS Y W   ޝ !~*  Z ZZlj0rcuZmZn9Zo rZvZxZy ZujxZ*(ZrZt*ZZZF 5H Z) Zc Z .c>* ZJOmMmrM)ZZ> keyZMZ>Z͟ ZJZ6Z Z eV Z eV(Z:Z*Z*ZZZ  (ZU Z8 Z|ZZ 1 ZZU  w5 9(_*0#8@ uid AP#X U`$ hYjY 9Y gidY j>Ay/*>Y Y~rcuY5=*?8[[ [! ["*[#S[#S [$*([$*0['F[(S[)S[0{[1 x[2 x[3 x[C[DF[L[M"[N8[Q[R U[S[TKâ *J*  '9A* A Kp"0!U3 ` 0rss p 0U8!U@ UX ) fn 4% arg c  :\SW \T \U>\Wx \XJ\Y8\I q\J ioc\KER5*W \\W0 x Ǥ val Ѥ val  <#..3i[n*v˥8_ƥ`#aƥbƥc rd r0rcue reff.0[ v * %Х$WT-C** n-  . 0 x 4 4ݦ5W6ݦ7*   - A  O >A P ȧ W N -   qV qV( qV8 fHͧК()*+ ,0-5@. #`/ Ud0h1p2 x3*41  val  W6֨ BEuidF AgidG >A H D1JH ֨ ֨ ֨ ֨ ֨  ֨( ֨0 eV8 eV@H7~* W(W, ֨0 ֨8c@ ~!) ~7@89:;<=/ >/(?/0@M8/ȧ HH4XDE/FG $H/I/ J/(K0N =8O[@QtHSMPRȧ$ȧ88֨)VVBt8`xYhZ[S\S]S^S _S(`S0aI8cI@dHeLfSPgSXhS`iIhjp8WWWW WWWino  ( 0.W.h>* WWW WWWWXf ů(08@$HPCkW>yʯH E8  W U 0 H(ops! **)*1 wٰ }ް  ٰc 3 V t      ( $0  =8  W@  pH  P  X ` гh  p  x & S  c | Lz+LQ 8ofoe[^JLyr^Jo f^JWUoŲ$f^JWWoc=^J)WoBrpo\ou^Joo|гoroճor&^JoDDfNI +cfX|h31  ^ W? Ѵ 7 1  !  51 J R O    W J T"@ Z̶ [u \ ] ^Ծ `  b( d80 eQ8 ft@ hH jQP kX m` oh p<p r Zx s u v y {  }, T m ^̶ ֶ    ( y f  %#pid J 6uid  A A  $ ܷ  * W W  W W  1  5  S?  )A7 * +$ ,y -) Pc"0      - N*~ 2          *(  0  :8 @ SH gP SX g` h p  :x         *  C  C  :2f FK UiZd ns }     KӺ*$) r  FSW =  Ӻpos  )  WcfJfthfFtǻǻW̻ f ֻ*fgu!fW*:f-&Sf?lfKXfqf˼f˼м *f****ڼT*RftWRftRW/ufuUz WfsfffWffW//W4 W/ǻW>uW\Fz̤YԾrپ̤Nr8Q=t̤FV̤Ny̤NB̤WĿ ̤ O7̤C7:WcvZA}}SS _fWN̤fNY ̤,̤YJ̤JO 1mJY mt zU *r$W L*:/S?gX le-sF%%ȧC/WW\ H fkFcu * * + . :]]    i  F(EFF modG  opsH!I &JK  uLAargM cstrNnarrOViWWXAi \ max^W_W num`  opsa!bcsR0(3)N6* &*[ W e- [+Kp*7` - .x mod / @ 0xH mp 1P 2/KX 8 5$ 6w 7 G 9 j ;   <( = 0==Bp$j=BFL Fo  $W >68 Emod F - G6P pT qc rc sr tW=mtn w    W  i 5N*T  WZW @FF*E O=  W-|w+  || ijwk m 87~87~FvWW*$W$W8 v0<!p"A <$W1$WB$WOcd&Fe2f4gr lidhr } 3 =BS QV=]cmae o01F2 ]3F46X7`8h9p:x>*?cy@/w0| ops1" dev47~56(7 8  ~ W   hc@z{| c}c~ "(0 irqW8W<*@*HFP dirX !~8 #irq W-UX 8( M033[I#HH-U=0231# 4W@$W W get put   ( 084@HHHP\Xu`hpux\$Q6RW idSWT6wPfpg|hWi1||p|r6P66r6F6FWc46F FH69|\6M|u6|a|6Fz6FFWW;6c|6W$|H!O "Sptr#chL busMNO!P Qx(" (8@Ppops c3} J7~Ddev<~xx W W     W " "(565len7W cap8 $1 "` JKbusLMO c P(Q0SW8T<U>V@WBXWDY HZ I\J] P`Xa`c:hd le mf n g xh ppini qjrk xm nSt=v&y  zW( |W- }W. ~W/ W0 W1 W2 W3 W4 W5 W6 W7 W8 W9 W: W; W<WW W W W2=dev<~(irqWr@ WB W B W B W B W B W B WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB W B W!B W"B W#B W$B W%B W&B W'B W(B W)B W*B W+B W,B W-B W.B W/B>F UH #L+P;; W@M W`M WaM  c  (vpdV  WPO  P M     : W`P    Z p 0  2 (rom8  @ FH  *P #_X O  E F[ t V  ( V0 8 @ H#P!{X!{`hpr +*:;*xK* K U o*( ! "#C$k o*cWCW% kW:H;<#=)H W8_a2eFhFk Vl V o V(r V022F7VKt[`Ey: WqEqN<qT LqZ`qeLz+A n`nQb**e_qqqqg'/*q qg'<8(r00vmar1-r2 r3 *r4*r5* 1r>Zr? *r@ *e-Z~-*j--*** nnW nn***-(-*cF<--U-RARs-* Zz+-*xG~02 3F*@6 G@@CDEhFGHIWJWKWLWMWNWO*PWQ URS TUj-Wj-X3Zr#]*0^ U8_!U@aWXbW\cW`dWdIdirghrcunpoxq5rs tFvhUWW cr#r#@h irqWW dev7~ msg P(0 8c@ HPU8f: irqW2fIp N( c0EIFb r r r  r( r0 r8 r@ rH P X ` h rp rx r r r r   r   * H a  v! # $ r&*kWbNSrNgNj-rwNNWNsN = "Df*NHNr/aNcMvNWfNj-{ cntW1# W" ,B pin-./:@0:A1:B4567*8 R SuvTBHIJK:L:M2Nj-O P c(00w***ack*eoi* *(EPk8:@:D %Hx!" #c$ % & # ' #((W0)W4*:8+:<,:@-WD. cH/*P0*X1p`2h3(x:c:cw7/*$W@g RSWTWUWVW W7X #gcY /* W ]       : c iPt?t@|tAtB+ Pteutfth maptjtk tl tq>(ts X0tuv8tv @twHpzppW2pWpW  D>pWWc XpWWCvpNr]pN{p  ug ? @:A:B:C: DFE _ 5p*NI/* ::: : ::U : Z :!:":#:$:%: &: ():*:+:,:-:.: Z 167:8: 9>D ? : @Bf C : DF G : Hm n: o:qr s t u v w  x Wz7 {  |cl^yH Sptrc c^)pci7 RcPH p    ( 0 8 @ 7H2CHC :Wops<I c ( c0F8 c@IppW2CMpWup7~CpCCp7~p7~2p2 2r_7~ppA!f~!/~0/!01&2W3W4W5W6W7W8* irq9W(:P@, !@ DIc] inc i :c c  c (-K%c W\zzc .c-./123K567[,Adw0w4b8P$%W&W'W(8)]* + ( u90:@AA(=>?@WAc @Xo8+ 4`#r)FFP45#r`V2cV8cV?c,4PLW4~q:c4x%c4|c4vzc4z c4t*.c~Odev~49!aretWoutX ubBLLc,M%=HLA&U &TU#&Q XoPcn  L Ak&UsPd A&Us#yey7&UUY_oOdev_29a!fretbWoutubM!d o9d cQd   &  .7DA&T &Q@QgtrQ 0 ) Q6  Y A M X  V   L A&Us&Tv&Q de 5YBd0OdevB7eC aerrEWout[PUYfrA,&UU&TT&Q0Y3V]Odev3,reg3>WTfret596]97bg99cg99cP6(^ ~B...BR ':dev L@"!out*" h@$ch@$cCi i' R"* R[U:id.[:devHRT:devT>.U$;\c2\5;cdev:; %c2 ;2 G;|.c&2|D2|PCW;%WY2<2rC`;z02zC2zX*;j2j82jVB./B.7B .2.KCjB6 :new4.KBn :new1..CjRjr .jFkretlrC@o@pAr:newA@.B.CkretErt+**F*R+K+W o+ + + + uint W ,+ *+:s8c:u8v:s16:u16:s32):u328:s64:u64dW s~ + *  1W 2W H I~ X ] ^~ _ `K++ <W  8 4     #p+ % & 4 = B h) m n8 } G Q Q W W Q $ * _  H  G k        K* E E UUEJvawxr*W)dW "     $-@  1 W W  Z  M6( W, !W0 ( 4 )x28 *WH +*P ,X 5 ` 6 d 8 h : l ; p < t =WxEse ?E@,rt @&GMdl AG BG F6J/ It6 J* KW O@J XEJ ]EJ/ `"D@ d hW kW  l* m  nUJ  oZJ( p'0 q ZX s` ub x d yIh zp {dJ *             I     C  9(/ t6P,mm h p XKx         * W  W,  W,  W,  W-  W-  W-  W-  W-  W-  W-  W-  W-  W -  W -  W -  W - "W - * d),pid  X  X *     ( 0 @ KP KX  "L %e (e + Z - Q . Q 3 Q 4DB 6B : _( =*0 >*8 A Q@ D QH G*P H*X K A`/ NPA TeM WeM ZeM ^TN k 1 m^N pN9  qs9( t*8 u*@,fs xhNH {rNP ~|NX N` #Rh  jRp  V<x  V<  V< ? *   W E tR  B W ; 8@  Q   Q  2   "  J  6(  8  ~R@   ZH  RP  RX  R`  Sh  !Sp  *x  &S  z@  W   Q   Q   Q  5  >5    0S     8   8  ":S  )xS    S0  g48  WX  S\  S`  g4h    S          !W  "W  #  $*  & Q  ' Q  ( Q / )  3S  Cp$  D*  LS  N*  RS  S8(  T8,  Y*0  ] 8  ^ <  _ @  ` D / aH  d5X  gS  i5  lS  w  x  z*  }  ~S   Q  Q     p$    _  _ * W S S T |T  W( W, $J0Mrcu 0 M6@  D H /;P Tx M6  Z "T T T Z    Q    >/    !"2 $"2/ . <T/ F@@"  !) key")?9 A* Bn Csnn mod$s9=>Z |||FyH  F   "   ( $0 8 @ !H !H !H H !H !H !H !H$@PhFF(z Wg4,kp W(W,0 8p@pApBWD HPMmem @r* W *4 (Z0W8Z@WHWL9PWX>`WhCp NxWW$MWWWp$Z W!p$"W%&s9W:?AD F _P QW(T$$0e f* gN hXuNv)w) keyx SU~V _jkeyk]nkeyo];<=? W @ W$A W(B W+BCDE E('sE,'dplE-'pE'/F0'avlF4'lF5'dF6'gF%7F+8 * * * * * # pte "  F pmd "/%o%%-%/RN' pgd'-'"|Np pudp-p"-@HI*.aAa0 _4*8$@@`1sp*es ds"$&*(*018*X*`cr2*h*p*x1* W8** m1Efpu 0@W(  &o$@@.g@)l@#F; .e o f p(,Yf000f8Xcfh%\gp*xd Zag.'Sfge ! &!F!!val _ !Z!&! ,F! !!!*!  _f! !!Z! !__  "Z! ! " " W*, "fmt F F F W F F$"z!6 # !7~ !88!#!F!F!F!F1!W1!W1!4W key!9"("W!=#8!U$!V mod!W$!XF!Y$ !Z (![ ,!\#0F!uf$!vf$!wk$!xW!yW ##*K$* "/$"1W set"3A get"5Z"7 2$O&$  һ  ( 08!6@" OH# mP$ mX%`&h'p(x)ۼ*+!,I-N.!/ v0 1 2н3 5 9 5; b>ۼ?@$ #!&#% #+ #-#/ *'*  ;o' ?'o.'* $ 0%c'%dF%ez%g{%i &{%l+{ 4y(:'& |& |"W''(')(')( val' 8'!8 '"8'#Q'$)( 8'*P( '+&x( ',#((x((( P()()V) )}(''('(d')'.('.Q '1,)'21)'3'4 '5*'6* ,)('d) '%' '/( '7(8')'* fn' )6)))d))*)*Q end*Q+;*'cs+=Q'sl+?Q'wfe+AQ+E*'ss+GQ'sti+IQ+KQ'nmi+MQ+PQ +SQ0+VQ8'lm+XQ9+]Q:+dQ<+*!cs+!csx+Q +)+*!ss+!ssx+Q +*+g, r15+m* r14+n* r13+o* r12+p* bp+q* bx+r*( r11+u*0 r10+v*8 r9+w*@ r8+x*H ax+y*P cx+z*X dx+{*` si+|*h di+}*p+*x ip+**+* sp+**, (,, , (,*p-, cwd-8 swd-8 twd-8 fip-8 fcs-8 foo-8 fos-8-,-8l8,* -*, rip-+Q rdp-,Q -."- fip-/8 fcs-08 foo-18 fos-28 -)6-,,0-@X- -AX- -BX-8h-* G-$- cwd-% swd-& twd-' fop-("--58-68-9- -< .->X-Z6-8 .*8.*?-Q. cwd-R8 swd-S8 twd-T8 fip-U8 fcs-V8 foo-W8 fos-X8-Z,-[l-\m-]n-^o rm-_p-`q-a.x-b8, /*Q/*@-:U/-; Q-< Q-= U/Qe/*$@@-O/0-Ph--Q/-R/@/4*{@-^0-_-,<-`h--a.<-be/@-c00e*$@@-f0-hW-kW-nQ-qQxfd-tQ -wW -zW -W -W0-/@@-0- Q-W-W |fpu@-h1-W-*-h1-h1-0 -000-0@@0. 1. Q.QK1*1*11*1 1/>2/?*/@*/A8 cpu/C8086209Q20<Q20=Q2621<x2 1=W 1> _1:21;62V2 src1A dst1A 22Z22 2!222 223 33! 3"24|4|4|4!|4%|4'|4,|4/|243|45|49|4<|4A|4D|4H|4L|4Q|4U|4Y|5#@45$25% 5' 46 g46 _ 7)47*.'7+ " osq7-L4 7/#8|g4#8|#8|9!49" W 9&49D59D4 9D49E>59E4 9E#59T n59Y>59Z 2 9[J5: 5:5*5* :8z5(;5; o<$5<%<'<( 0t6> M6?6?*?6?6t6? 6? 6?6?6?6@|fA A"6A07 A2 A7A^77AWAZZ(B07B1.'B7.' osqB9L4B; "B<#B|#B|#B|#B|#B|C+8C, "C- DC8DWD7 EE w8E C8E F8FWFWFFFFFFG8GQGQ(G92ctGw8G&9 8"WHI9 Ii9I n9 i9J 9J(K 9K K K L96L t6L L :L6"WM $:@M':6M(9M)  M*:(M+*;0M,8M-9M.:M/;:::$::@@N/*;N0`N1WN2 d seqN35N4:N59 N6j0N7 8:(Oq;O O*O ;O8 |;|;/;q;P;PP _P; ;Q+;Q,Q-xR/<R/<RW`R*h maxR*p*?<* S V< sigS5 S?< TRs TSz<b< TU TV<<PU< U  U Z U <U'<U(U)U-0=U.U/U0 <U1U5a=U6U7U8 < U<=U=U>U?U@UAUS=UT u$UUZUVZ UY>UZ u$U[ U^2>U_*U` Ua UJx> UL UQ UW= U\= Ub> UE>UFZ2>Ug>Uh _fdUiUm>UnZUoUpW P U%L? U*< U2<!_rtU90= UBa= Udx> Uj> Uq> 0V ?V V V V >0V ?L? V? ?V ?V!V" V< V%@V'n<V(*V.<V0 V< V38@ saV4? W z@W W * lenW *W p8X @XQXQXQXQXQ X#Q(X,Q0Y) AY*QY+9PY8@AY9@AY:WHY;WL@PA*8YDA6YEYFg4YGW0 Z>AZKZZZpZZZ endZAKA4*[ B val[ [ A[ 8B val[  [ !B S}B U Q V Q W "(W [B0 hC i4 j k}Bcpu lW mQ nQ  oQ( eC *    C *  8;@@ D  Q  Q  Q  8  8 *  *( *0 W8$@ E  Q  Q  Q  Q  Q   Q(  Q0  Q8  G@  QH  QP  GX  G`  Qh  Qp  Qx  Q  Q  Q  Q  Q  Q  Q  Q  Q  Q  Q  Q  Q$@ G eC0 t6 ! Q( " Q0 # Q8 %@ &P 'Q (R )S , QX - Q` . Qh / Qp 0 Gx 1 Q 3 Q 6  7G 9!G ;!G =*Eavg GC@E G0 KG L M* N* OW  P$ Q& SG(&G- ]GGpGGG; `%I0 at6 h Q i Q  j Q( k Q0 l Q8 s G@ t QH uWP W W W W W W W W0 $:X0 $:rq JI G %I G- ^2I7IFIGgrqFI I) W ) W ) W) WN I    } J`b I`s 8 J JJ_  ,J1J ;JOIUJ* '' _J;XKn rc7 @ _D _H6P*` *h)ʹp*x 2c7 ZiJhpidp\7K\9 M6\:W\; 2\<D ino\=Q\? \@@\B@4H2rcu\C`\Dp]KL*8]o`M]p.' uid]q B gid]r 8B ]s B]t 8B]u B]v 8B]w B ]x 8B$]y W(]zɞ0]{ɞ8]|ɞ@]}ɞH]~ɞP]X]TN`]TNh]TNp]TNx] Z] ]l]?]%.L`Mhkey^TN^M6^.0^" sem^c7(^,P^ ZXQ`^ C8h uid^ Bp gid^ 8Bt^x^|^~^ ^*^1jM YN cN mN wN NGX_^#R__M6_` __a_b _c_e@4 _h8_k?@_nX_q`_sd_th_wp_xWt_z}x1_W1_W_W__6_$:_  it___ A_h_ __K_Qtty___ n5_Q_ Q_Q_Q_Q_Q_DB_*_*_*_'*_* _*(_"*0_,*8_*@_*H_"*P_,*X_*`_*h_z@p___:_ˤ_ W_դ_p____g4_c70N@ _jR_2_M6_@4_* (R oR yR R R RX`cS`d.'`e _`g `k 2`m r`nG(`o0`q1V8R S? +S 5S axSa aa?S }SS* S S S*S*A S S;S* S S Thby|Tbzz[b|Wb}\.U\b\(b/;0b*Xb#\` T T T T T TTcTcZcZcc -Uc!c" c$WHc'Uc(F keyc)c*Uc+Z c,Z(c-Z0c. U8 extc/U@xTT c3 c8U tpc9Uc: Zc;8c<8-U )) d V!V,V,V1V dfVd.'ddVXeqVer1Ves/; wqevVH cpuewP VExfWfEfWf"W( lenf.'Hf2WPfpV"W**2W*BW*G@gXgXgXg 6g2@@g VHg!*g"*g#pg$/;g%1V~g& g'X0g(*8Qcpug*@Qsspg+XH.',X*`g6Xg72g8"Wg:"W(g;*Hg<XPg=Xg>\,XgeXgfW sdagg/Zgh!gi4ZX@xgDZgEXgFZgH gIg4(gJ2HgKg4PgL*pgM*xgN*gO*gP*gQ*gR*gS*gTpgU*gVg4gW8gY _g\*g]*g^fVg_XpX/Z*BWXh|ihZ i. i.i"Zi#)i$i%i'Zi(i)i+Zi,i-i![ i&hZ i*Z i.Z i6[FZ opsi@[Z 6[;[i2z[i4*i6Wi7W "Wb@["WbH[bp\bq[brbs\ \ b/\bE[b*bU\6bb*Hbj\ \/\@b\b[b*b*b* b p(b,b\02rcub8b]Hj\[b]b idb\-]4*bH]bM] H](j]j "jGjjp k -^kQk& k)c7 ldtk*2^8k.*@k9g4Hk:Zhk;A_pk= _xkC|kD~ -^l <_lZl* altl*l*l* l*(l\0l8l@lHlPlXl`lhlplxll l!7^<_ kF] \v_^ Z`WX_!lruYR_ d ei_ j * k* (R_v_hXK_s* (uE`z* pp{J`|*}*~.' E` f`* `a Zmamnm refmo8m8HmhmWlm*p opsm !xmZm`H(QAa__O`f`Rca W  _N |aval*-ca=MaN ZPW5Ja`lruKa5WaX ZY|a=@G]bI*aUXKV * a([ _0\ _4^*8I@F{ba<j=(mbn*o*q _r _s _t _vW I@lc{b<z=0}ec~** Z Z Z  Z(= c**I@|ccec<;Dc.]b.b@.c-*c; d  2   BXK Z n(W0W4eM8V@(P p  Zx#$ % '.Mc5ectx6$e e=Te>Y6@A(XqeYc7(\eb*h*t6w }$=e**I fe<50fcc YfErbt6*Te ^fnbWgnc nh njnknq ns(nt0nu38nwG@n{Hn~PnoXn`nhnpnxhfWg)eqegQcid @@ g _N g* S@@k.g@07@*P*X*`*h*ppgd  x) _5 _?kE*LWS _Z "].'_a2pc7r***** *(*0*84@2D*H*P'*X3*`*h,brk*p!*x**%*0*kk@kF_*h2plxld&l** _ _-].'1V$l**.' gkg*k*3R]k* k l  l l l*8l4*- WJlpn/lwn7l(pmdn9 0pudn; 8|@nEHnFPptenL XptlnP3`nT h(W:m @SSSSS#o6|#o9|#o<|#oG|8mmm*m1m1m*m* m*(mp0pnppF opspp Z pW(pW,pg40pnPpXpF` gcp"h devpppxpnpp p<pWp rpmFpn q<ooooqi;oqn*qvo8q_oq`.'qaoqboqc pqd p2rcuqe refqfo0n;o o v * %o(WT pp  p-p** npvKp*s `p bs;p sKp t*(t,pt-t-t.t. t/t/t0lpt1 xp t4q idt;ptlp clsttptqtqtq tq@t\9qKq*Kq*@uru0 endu0uFu*u* ur(ur0u&r8qv,Yrv- 2v/ v0Z r0w3rw4cw6w7w8 p xaw9 r  xrx*x6xr revx* rxsxsxsx _x _xsxF2rbxt6 nsx\0xW8x<x L>t@ idxQ`x Zhx up2rcuxxs xt opsxtx!tx xshxtxvx vx"0vx$ Nvx% lv x& v(x( v0x2 8x9p@x: vHx= vPx@vXxA v`tt t xu!dirxr xr xs u*u xu knxsxdx%ux Zxg4 xg4@x`xhx xx   x  p@ x  pAx %\gvv/uuvv v0v%uZvZIv%uIv5vZlv%uZIvSvv%uZqvvvv(vvvv vvvvvvv"Wy&w0y'wy(wy) ny* wy+wy,w y- 2(&wFZw\www wF\wz yz8z LzWz  zQzQ inoz)Q devz* @(z+ @, uidz, B0 gidz- 8B4z. 8z/O8@z0O8Pz1O8`z2O8pz3Qz4Qz58z68z7Qz8Qz98z:8z;8%4y%F% L%mVy %ny %o&zX%0y%1 y%2 %3 Z%45{ %5 b{(%7 {0%9 b{8%; {@%= {H%?{PVyyVy zyzL(z(zz-z@{@z{AF{B{C(z{D| {E|( sd{Fs0{GY681{IW1{JW1{KW1{LW1{MW-z yzL{(zzz&{(zz {zFXK0{b{d(zy:{{d(zzg{{d(zz{{d(zz{% |% (|% K|{(|(zz|K|(zzF-|`{|{{ 2{-z{ ~XP|0{t|{u }{v }{w!}{x*5}{yI} {z m}(||}(z| |}'+}+}0}wz}\I}0}:}c}0}c}h}B8BN}@ {}}{~}{}{Qbuf{}{ }*}*?K}e*{*~{C~{\~{~}>~0}/~>~FW~0}H~W~u~0}u~r}a~z~*~K~*/(|~|*|*|*|*|* |02rcu|1|2Y6|3~,4* |H|I|J|K |L|M*|N)l ~$\-z@ppHFPXbus`h Zp Zxg40uz ,msi](8@QHQPX `hx b @,id82 c!!}# $%'#) + p` , pa - pb . pc / pd 9 pe < pfG@@Ng`Nh " cpuNiWNjWNkW NlWNmWNnWNoWNpWNrWNsNtNuWN{  N|:(N} 0N~:86No@@aFe[:@*}:}; }<}} }  }! }" }# }$ (}% 0}& 8}' @}( H}) P}* X}+ `}, h}- p}. x}/ }0 }1 }2 }3 }4 }5  (}UR(W}lH}x}y 2}zW}|W}}g4}~0}@ $8})})} p )} p!)} p")} p#)} p$)} p%)} p&)} p')} p()} p)}8}2 }}8 }>@ } p@ } pA } pB } pC } pD } pE0}$:P}Q}1V}@4}H} _} _ }W } p } p } p } p } p } p } p  } p  } p  } p  } p }W}R}!}!}}}Q}Q}Q}Q}M } b(,qos}l0~+>~,F id~-~.~/2 ~0H(~1/;0~2*X~3 `~4 h~5 p~6 x~7 ~8*~9*~:*~;*~<* dev~=1~> p1~? p) Cb)R g}ops}} } } } } } p WM!NFOFP!}Q!}R!} TF(Ud0V 8W @X HY P[ X\ `^}h_ pa xc d  pmfhp::A`AaF busbd$eFgp h$j(k0m 8n @o Hp Pq}Xr `s!}ht!}p pmvxw  py?&__u~\K}i!`253F5!}6!}8d9 S ; h(< 0> 8@(+}@A|HC P pmEXN_NL:cc5X\|_m_c}h}0XYFZ!}[d\ ^  pm`(*8ZeZ =B D E FЏ Gߏ HYr IZ8e Əˏ Տڏ AjK : @NJ O* P Q (+,-p.p/  0pqdr s St Zu v$(J"&#N&N'N' S&N |2 HRX.| 3ϑ48 len482 6Q1 ϑ8ui2 j k2@4rg s t&RuR?TWU>5V&WDX Yn0[s8_"?`` ha*pbZx6dmn2d_uv7gg$x{n| L}~ B 8BW !  (XK0 Z8*@ҴH @L P C8X C8` C8h8p8t8x8|2 8c7**' 0@H _P _T _X _\Z`1h/iJp8ZWH P(;XE`Oh ZpI*'@:@@c ( Û0 Û8 ؛@ HPX`:$@  @*  (!0!8@"H*P*X*`Dhc7p _Z&#ĺκ$ݺ    d  W z(/` Z8C8C8!8" / q0 `p14 6W<g4 BF@D"?HFPI.'XL`O dRVhSpZlxa^rb^rMrcucd1Vfg4k0/n2@@oHq2Xr`D"W,@DW,YY^?EYWF hYDÛD؛DnțDݛ E=FDG HIQLLQV~ mnt L DV=p~DD "#  nid&-*4*7SRޝSUXYZ Wc M6 d8(2rcueHgZXj` idmpptqFxrDu*ޝ.' w;w w" w$2@@w-c lruw/w0.' ;\2 nr\3 ns\4I9*h4* ɞ valQ   "W"W - b #|*  ^ ^^l2rcu^m^nM6^o p ^v^x^y ^u+!x^*(^rs^t*^}^^F ssP ^ ^Z ^ Z * ^ΠӠTNTNx^0^  key^TN^}H^Q ^R^t6^s ^ C8 ^ C8 (^^*^*^}^^  (^١ ^+s= ^^^ o5 ^^١  ' M6R]*0.'8@ uid BP.'X _`$"h]] M6] gid] 8B4*H] ]rcu]6@:*?8__ _! _"*_#Q_#Q _$*(_$*0_'ˣ_(Q_)Q_0_1 _2 _3 _C_Dˣ_LC_M_NC8_Q}_R __S_T8H*K*  ;Ƥ* Ƥ Ф08@46 ` 2rss `0ڤ8@4@ _X  fn 2 arg Z  8`Sܥ `T `U pH`W `XR`Y8`I= q`JB ioc`KS.ܥ `\W0 = L m val V val y" Ѧ. 0  4Ѧ 4)5W6)7R99*C > HMy  B  m  8B  PW LWy  O8O8(O88 dHК(Ш)*+ ,0-g4@. 2`/ _d0 h1\p2 x3*4}  val Ш ܨ"W6" BE\!uidF B!gidG 8B H D}.JH " " " " "  "( "0 C88 C8@Hʪ* W(W, "0 "8Z@ ʪ!u$ʪ@8N9g:g;g<g={ >{(?{0@8Ϫg S{l \XDGE{F`G pH{I{ J{(Kg0N 8O@QHSP` Lpen"unnxYZ[Q\Q]Q^Q _Q(`Q0aG8cG@dHeLfQPgQXhQ`iGhjp8OWWWW WWWino  ( 0zWz*  WWW WWWWXկgg (40R84@pHP կ  Wگ   / \/ŬR /9k kOWNO8 а W c7 а0 H,ops! n**u*5w%}* > %>Z/SCٲ  >(p0 8 @ H ̳P X`h :p Yxr ȴX dcٲXKŲpXK޲ 9dXKW9^7pdXKWWZCXKup ̳ѳXK  p:!TTTp?rXK^d wdȴ5^WI<5B!B R&RnG5S  W  $@Z[\]^ `> bf(d0e8f@hHjPk Xm8`o[hppr xsuvy7{U}x " , 6 @ J(ŷd 3pidK9uid BB $ ( *WW WW 5 Mg4 QI )<*+62,ŷ-oT-PZ$0  0[8*~4 R R Ib v( R0 8g@HPX`hp x     5 ]v   ~G    ɺ Ӻغ    K*$-,1pYYFQW^ pos - WdһdIvdFIv׻W 6dY"(Odv;mdW*Tdrnddۼddd *Id****&TvSdIvWSdIvSW{d^7ƽ˽ dս%ud5ddW bddW:{{W g{WDnDWF߾Dn߾ƾQn np>D%fQnDLpCDnDknDQnDFQnDLſ QnDL@8QnDnDWVQDV=Q8Ww`DnQQ nnDdWL7QndLUQD<xQDZQD }D mt 07 *n(W%n4 %In9bnNvng {  D  e %uD5 ] F:qqnb {  DFZ!* * ) . 8a)a    A5)M YF<("E<"FF mod"G$ ops"H!"I $"J"K_ ZF"L!arg"M Z!str"N!arr"O"V"WW"X "\ max"^W"_W num"`` ops"a!"bZ$0(96)9[t6J* r* W e K*7`- .-z mod/$@0(zH mp1P2LX  85p6 y7 9 ; <(= 0pF$F$$(W>;8EJmodF$0G;PpqZrZsptWEmtnw  W 3-[J*& % /UXU RHFF*W"J"W-q4q ? _Nc}h} iCj yk am \\C\FfWW*(W(W8] 0!n" (W1(WB(WOckd&e2f4gp lidhp kq,  Q gcma 0b1F2 3F4g6 X7 `8bh9bp:bx>*?Z@/0 ops1"I dev456(78gg  |"W   h.3GZ@z{"| Z}Z~" (0 irqW8W<*@*HFP dirXG #|8 oirq WY61V ( 0UJoY6023o 4W@(W"WD get put   ( 50]8@HPX`h px*C\pDQRW idSWTPfghWi /p\_ p5F!]FWZ:F$bFFFFWW%%NZC/\WHpaP! "Q!ptr#ZhL busMhNOrP Q-z($ ch(J8@Ppqops Z~ Mdevyy W W  m  W " "(56g4len7W cap8$5 J $` JJKbusLhMhO Z P(QO0SW8T<U>V@WBXWDYHZI\J]YP`cXaJ`c8hdlemfn gxhppiniqjrkp$xmXnQtvwy zW( |W- }W. ~W/ W0 W1 W2 W3 W4 W5 W6 W7 W8 W9 W: W; W<WWb W W WEdev,irqWgqp@ WB W B W B W B W B W B WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB W B W!B W"B W#B W$B W%B W&B W'B W(B W)B W*B W+B W,B W-B W.B W/BF _H 2LwP W@M W`M WaM Z  " ,vpd  WPO  Z    8 W`P      r 0 2 ,rom$8  @ FH  *P #X  T ^OXF    ( 0 8 @ H#P!}X!}`?hph ]qw*8*y*  *( 4! D"b#$ r%*4h%Dh9ZbhWIhW)(ghW8;<2=-H W8_`ayehk l o (r 0yJeJ~JpJJJJ8J`"WmENmNmT mZmeN8lEla**fm mmm)4*m! m)=(n0wvman1n2 n3 *n4*n5* &5n>n? #n@ F****8lElW8l3El***G8o*ZLFtSS*p$*G|(AF Z ZJ A"W02 3F*T608%:=F?WE C I ](p>>FF%]>FFHGO=PFQFRFST 2devUPVK@W8HX1VhY՞\ _] _^ __ _`Wb NS^^cG@@CYDYEPhF GBHIWJWKWLWMWNWO*PWQ _RS "TUjWjXZ']*0^ _8_@4@aWXbW\cW`dWdQdirghrcunpo-zqg4rs$tFvhWW ZK''@hK irqWW dev msgL: \(\0 O8Z@ HP88 irqW<n ( Z0YOF    ( 0 8 @ H P X ` h p x     2   l l     ! # $ &*PWjpW 2%u"GGL =l7TqpZWj cntWo"W"P , pin-./8@08A18B4567*8 R SP!uvTHItJK8L8M<NjOK P Z(00***ack*eoi* *(OP?tB88@8D )(Hx!J" "#Z$ Y% n& ' ((W0)W4*88+8<,8@-WD. ZH/*P0*X1n`2h3x8YZJn8Z^~~?s4*(W@ R7SWTWUWVW WX gcY7 ~F4*"W        8  Z  Pp?Ep@pApBw Ppepfph mappj4pk Ipl{ pq(ps 0pu8pv @pwHEnbFnF4nW<InW9vnbvWp$`BNnWWZnWWnpnnp$` ?@8A8B8C8 DFE n4*  888 8 88. 8B .  8!8"8#8$8%8 &8  ()8*8+8,8-8.8 ,N@ 1,6v7888 9L> ? 8 @@B C 8 DvF G 8 HBm n8 o8qurstuvw x Wz { |Zly uP Q!ptrZ Zu:!pci OKZ?P    '  <( Z0 o8 o@ H<H 8FWops Z B( Z0F8 Z@nW<nW n'nK<K,ZnAon_n`<tTpnn#f|#/|01 2 @$4 cmd6  err9 <  bus=  > A B E G  I$*M cmdO  errQ T  busU  V @<X*Z  op[\(R devJ@"#Z$g4%=(&0'`(d)h**p+1Vx op, ^WWWWR a+0IWW@hiFjk l o$ p >( addra0 gett8I J```$>Jp)aJCJWWWfy'@ g4* J8Y 4F!i`pJH*Ji5pHab2Zk b8Z p b?Z \J8_FjJ=FjJ8 4J8 4\ I%9J%%`]bus*`%`ITN7ZKZ*4U&U*k%%BNKAeIAtmpI7Z7'ZKAdevJB>>8GWUc&U>?By&U}8ju&U}*UvZ&U\ %C%TUUT0Q0\ vR%>NK# R ZV l m &kT Q KW! &UsT Q >??8kQ %B]devJ% pTNJnout7_t AeI7;Z7dZB_ >8G WUc&Us>?&Us8 &Us8j u* U|* U|o*C UvoE %E=]devFJ%F!%GAerrIIIAtJIJIKNnoutK TRTZVTlUm &kT QH7l kZ> kc Wq" Wq c W}" W} 89 h J?WBp B&> 6>C- SV&>6>C- S89 |8J?W8MBV&2B+pU&*UvTQ?>8<sJV&2B3pU&*UvT}Q?>*bU*T Q *U*Uv*T Q *T Q *-U~T Qs*EUsUUT0Q0X&U~T QsRR*"L<Cl<.JCrL+CCbus+1hL##``Cbus#Hecqrdev1qrdev/X|.Z9|D9|P DWX%W 9<9pDaXz0o99zC 9zX*Xsc9s6cDau Xj9j8c9jVcY3/Y37Y323KD^YCnew43KYGCnew133D^Ljp3jFsretlpDToTpLApCnewA@3B3CsretEp#3#5c^%D^&s(**F*R(K(W o( ( ( ( tint W ,( *(7s8c7u8v7s167u167s32)7u3287s647u64dW! s~ ( *  1W 2W H I~ X ] ^~ _ `K(( <W  8 4     #p( % & 4 = B h) m n8 } G Q Q W W Q $ * _  H  G k        K* E E UUEJuavw*W)v* e f* g h u v) w) key x  U V _ j:key k nWkey o\@fxH d F   "    (   0  8  @   H   H  H H  H  H   H   H$@      P h  F F x    W 5)kp   W( W, 0  8 p@ pA pB WD  H WPImem @ l *  W     $ .  ( Z0 W8 Z@ WH WL 3P WX 8` Wh =p x W W   G W  W W  Z W ! "W % &# 9W : ? A D a F _ P  QW( T 0     !val _    , . . > *Y  _  z >   Y ^^     &   W*, fmtFFFWFF$y6 7 8:8' FFFF,W,W,4W key9 ("W=P 8U V modW XFY Z ([ ,\' 0dFuvw xWyW P *WK)* /k1W set3; get5T7 =%)J N       ̻    ߳(  ߳0 8 !0@ " IH # gP $ gX %` &h 'p (x )ռ * + ,C -H . / p 0  1  2ʽ 3  5  9 / ; \ >ռ ? @p !% + -/   bz  *(,8--.. //01  ~ idz cls= @\K*K*@e0 end0F** e(e0&e8$-@ &"4WW Z 9( W,!W0( 4)%8*WH+*P,&"X5 `6 d8 h: l; p< t=WxAse?D@)rt@5FIdlAFBFFEI-I6J*KWOOIXTI]TI-`",C@dhWkW l*m ndI oiI(pj#0q ZXs`ubx dyHhzp{sI*    H -B6(-6P)mmx-hx-pgJx    *W  W,  W,  W,  W-  W-  W-  W-  W-  W-  W-  W-  W-  W -  W -  W -  W - "W -**')pid X X*&" &"&"(0@JPKX "8K%n-(n-+ Z- Q. Q3 Q4SA6A: _(=*0>*8A Q@D QHG*PH*XKu?`-N?TLWLZL^Mk v4mMp\6 q6(t*8u*@)fsxMH{MP~MXM`ZQh Qp ;:x ;: ;:=* WEQ $AW9> Q  Q U"   I &7( &"8 Q@  ZH QP QX Q` NRh XRp *x ]R > W  Q  Q  Q w9 @  gR   8  8 "qR )R    R0  58  WX R\ R` 5h  R      !W "W # $* & Q ' Q ( Q -) 3R C D* LR N* RR S8( T8, Y*0 ] 8 ^ < _ @ ` D -aH d>X gS iz> lS w x z* } ~S  Q Q   _ _*W*S4S>SS W(W,3I0Ircu09@ D&"H8PSx9 Z "S SSZ  Q    >- !"$$"$-.<S-F*,@@jA"  U"+" A" x"z "a" "!) key")?" A* B# C### mod #""=:#>Z"( U# Z#:#*j#*  ;:#j# ?#:##* dW"K$     0#c$#dF#ey#gy#i y#ly w(K$$8$$9$$<$$=$$%<% %=W %> _%:=%%;$$ src%A dst%A B%M%Z&|&|&|"W'%('%'% val' 8'!8 '"8'#Q'$% 8'*& '+&>& ',#k&(>&(( &)k&)W) )C&''&'(d')t%%'.Q '1&'2&'3'4 '5*'6* &('*' '%% '/p& '7&8'W''* fn' k'&f'f'*'W'*'*Q end*Q+;'%cs+=Q%sl+?Q%wfe+AQ+Ef(%ss+GQ%sti+IQ+KQ%nmi+MQ+PQ +SQ0+VQ8%lm+XQ9+]Q:+dQ<+(!cs+!csx+Q +'+(!ss+!ssx+Q +'+g) r15+m* r14+n* r13+o* r12+p* bp+q* bx+r*( r11+u*0 r10+v*8 r9+w*@ r8+x*H ax+y*P cx+z*X dx+{*` si+|*h di+}*p+*x ip+*f(+* sp+*(,B~*,C,D,E ,E(%s,E,%dpl,E-%p,E'/,F0%avl,F4%l,F5%d,F6%g,F%7,F+8 -* -* -* -* -*- * pte-~* -"*- * pmd-* -"*.%+.%%**.%/+K.' C+pgd.'**.'"*+K.p i+pud.p**.p"P+*.++@/H+/I*+b c0/ _4/*80;*,0<0=0? W 0@ W$0A W(0B W+$@@1n-14sp1*es1 ds1"1$1&1*(1*01481*X1*`cr21*h1*p1*x141* 1W181*1*1 N4Afpu1 3@U#}-$@@/-+i@/n@C+**-8/.+g/x-/ +g /p(/,/8h0./h8/X/Bhh/%;ip/*x/f/ Z/@i/#/R/Ei/fi+2 .2 2 .(3 |3 |p4/ cwd48 swd48 twd48 fip48 fcs48 foo48 fos484/48l8/* 4*/ rip4+Q rdp4,Q 4.0 fip4/8 fcs408 foo418 fos428 4)0//04@90 4A90 4B908I0* B4$0 cwd4% swd4& twd4' fop4(0458468490 4<04>90T080*80*?4Q1 cwd4R8 swd4S8 twd4T8 fip4U8 fcs4V8 foo4W8 fos4X84Z/4[l4\m4]n4^o rm4_p4`q4a1x4b8.1*Q1*@4:624; Q4< Q4= 62QF2*$@@4O2.4PI04Q14R2@22*z@4^24_/94`I04a094bF2@4c22e*$@@4f34hW4kW4nQ4qQxfd4tQ 4wW 4zW 4W 4W.42@@434 Q4W4W {fpu@4I44W4*4I44I443 430.42@@25 v45 Q5QK4*)4*44*4 46>46?*6@*6A8 cpu6C87 57 _ 8)Y58*#8+  osq8-4 8/#9|5#9|#9| :5:W:W:F:F:F;5;Q;Q(;#6/ct;5; 5"W<W6 =w6= |6 w6> 6>(? 6? ? ?@7@*@7@76@ &7@ 7@N7@ 7@7 Aw75A 6A A 7A&7"WB 7@B'&85B(N7B)  B*:8(B+80B,8B-9B.:B/;758587&8@@C/8C0C1WC2 d seqC3@C458C5w7 C6 0C7 8?8(D8D D*D 9D8 9988EF9EE _EK9 F9F g9Fg9*w9* F8P9G9G _ G9H+9H,H-xI:I:IW`I*h maxI*p*$:* J ;: sigJg9 J$: KRs KS_:G: KUf KV|:d:LL: L  L Z L :L':L(L)L-;L.L/L0 :L1L5F;L6L7L8 : L<;L=L>L?L@LALS;LT LUZLVZ LY;LZ L[ L^<L_*L` La LJ]< LL LQ LW; L\; Lb; LEz<LFZ<Lg<Lh _fdLiLm<LnZLoLpW L L%1= L*: L2:!_rtL9; LBF; Ld]< Ljz< Lq< 0M o=M M M M <0M =1= Mo= =M =M!M" ;: M%>M'S:M(*M.p:M0 ;: M3> saM4= N _>N N * lenN *N p(Oz>O :#P$>P%+P'P( 0PD>PM#_>PPp(PWp)8Q M?QQQQQQQQQQ Q#Q(Q,Q0R)u?R*QR+w7PR8?R9?R:WHR;WLM??*8RD?5RERF5RGW0 S>Y@SKSZSpSSS endSY@Kh@2*T!@T" W T&h@TD@TD@ TD@TE@TE@ TE@TT ATY@TZ U" T[@U $A valU U  AU GA valU  U 0ASAU QV QW &W[A0h-Bi@jkAcpulWmQnQ oQ( tB*B* 88@@,C Q Q Q 8 8* *(*0W8$@D Q Q Q Q Q  Q( Q0 Q8 G@ QH QP GX G` Qh Qp Qx  Q  Q  Q  Q Q Q Q Q Q Q Q Q Q$@&FtB. 6! Q(" Q0# Q8%@&P'Q(R)S, QX- Q`. Qh/ Qp0 Gx1 Q3 Q6 7&F90F;0F=*AavgGB@D +F0KFLM*N*OW P$Q&SF(5F*]FFpFFF8`4H.a6h Qi Q j Q(k Q0l Q8s G@t QHuWP W W W W W W W W.7X.7rqYHF4HF*^AHFH&"UHFfrqUHH'W 'W 'W'WKH|I_bH_s8.I.II^ ;I@I JI^HdI*v#j# nI8 gJ $ p U  @  _D  _H &7P *`  *h )Ǵp *x  n U"  U  ZxIgpidpV7JV9 9V:WV; U"V< inoV=QV?I V@@VB*UH/rcuVC`VDYplJK* W8KWWWFVKXoLXp# uidXq $A gidXr GA Xs $AXt GAXu $AXv GAXw $A Xx GA$Xy W(Xz0X{8X|@X}HX~PXXXM`XMhXMpXMxX ZXXmX=X+=KLgkeyYËMY9Ya+Y semYU(YPY ZX`Y nVh uidY $Ap gidY GAtYmxY|Y~Y Y*~YL M M M M MBXZ^ZQZ_9Z` _ZaZb ZcZe*U Zh&"8Zk=@ZnXZq`ZsdZt&"hZwpZxWtZz=x,ZW,ZWZWZZ5Z7Z  itZBZZu?ZRhZ _ZJZMttyZgZqZ AZQZ QZQZQZQZQZSAZ*Z*Z*Z'*Z* Z*(Z"*0Z,*8Z*@Z*HZ"*PZ,*XZ*`Z*hZ>pZZvZZZ WZZpZZZx-Z5ZU0MC ZQZU"Z9Z*UZ _Q Q Q Q Q QX[cNR[d#[e _[g [k U"[mp[n([o0[qX8Q SR= bR lR \R\\\vR RR* R R R*R*? S  S9%S* %S /S 9Sh]yS]zZ]]|W]}^+5^]](]80]*X]#^`CS S S S S S^|^|^|^!|^%|^'|^,|^/|U"^3|^5|^9|^<|^A|^D|^H|^L|^Q|^U|^Y|T_|`#*U`$U"`% `' UaQUa 9hb b"QUbU bU" bUUbUaUbWbZZ(c0Vc1#c7# osqc94c; c<#c|#c|#c|#c|#c|d+nVd, d- ee Ve nVefVfZfZff  Wf!Wf" af$WHf'Wf(F keyf):f*Wf+Z f,Z(f-Z0f. W8 extf/W@#VV f3 f8W tpf9Wf: Zf;8f<8 W )) g WX X XX gFXg#ggWXhqXhrXhs8 wqhvXH cpuhwP XExiXiEiXiY( leni#HiYPipXY**Y*"Y*B@jYjYjYj 5jU"@@j XHj!*j"*j#pj$8j%X}j& j'uZ0j(*8Mcpuj*@Msspj+ZH# Z*`j6uZj7U"j8Yj:Y(j;*Hj<uZPj=Xj>\ ZjeZjfW sdajg\jh ji\zZCxjD[jEuZjF[jH jI5(jJU"HjK5PjL*pjM*xjN*jO*jP*jQ*jR*jS*jTpjU*jV5jWKjY _j\*j]*j^FXj_ZpuZ\*"YZk|lH\ l1 l1l"y\l#)l$l%l'\l(l)l+\l,l-l!\ l&H\ l*y\ l.\ l]&\ opsl ]\ ]]l2Z]l4*l6Wl7W "W]@]"W]H]]p]]q]]r]s] ] ]^]%]]*~]5^5]]*D]I^]^@]^]]]*]*]* ] p(],]^0/rcu]8]^HI^\]^] id]^ _2*]'_],_ '_(ms_m mGmmp n `nQn& n)U ldtn*`8n.*@n95Hn:Zhn; apn= _xnC|nD~  `o aoZo* alto*o*o* o*(o\0o8o@oHoPoXo`ohopoxoo o!`a nFs_ /\Ua/^ Z/`W/Xa!lru/Y1a /d /e/ia /j * /k* (/RaUa/hgJa/s* (/u$b/z* pp/{)b/|*/}*/~# $b /Eb/* /ib/b/ ZpbpMo refpx8pKHphpWlp*p opsp xpZpibD(/Q caa.bEbN//Bc /W / _K/ [cval/**/Bc:/Mc/N Z/PW3/Jc_lru/Khc3/Wc/X Z/Y[c:@/G6U/@Y@(/XPg/YU(/\g/b*/h*/t6/w /}$:/g/*/*E/gg9/3/h/e/e /8hArb/6/*3g =hqb6iqc qh qjqkqq qs(qt0qu-8qwA@q{Hq~PqiXq}`qhqpqxGh6igPg/i/Qcid// @@/ i/ _K /i//*/ *S@@/m+i@/U@/*P/*X/*`/*h/*ppgd/  -x/) _/5 _/?m/E*/LW/S _/Z /]#/_/aU"/pU/r//*/*/*/*//* /*(/*0/*8/@@/U"D/*H/*P/'*X/3*`/*h)brk/*p/!*x/*/*/%*/0*/m/m@/m/%a/*h/U"p/mx/&"/m/f/&m/*/*// _/ _/ _/#/X/n/*/*/#/ iJi*m*31_m* m m m m m*n2**/ W)npq/nqq7n(pmdq9 -0pudq; .8v@qE+HqF+PpteqL -XptlqPRT`qT v+h&W/o @OOOOO#r6|#r9|#r<|#rG|8pop*p1p1p*p* p*(pp0spssF opss s Z sW(sW,s50spPsXs@` gcs"h devsC~psC~xspss s<sWspso@ppt,qt- U"t/ t0Zp0u3bqu4u6u7u8 p xau9p  vqv*v 7vq revv* qvqvrvrv _v _vrvF/rbv6 nsv\0vW8v<v L>s@ idvQ`v Zhvsp/rcuvxq vr opsvsv!sv vrhvsvtv tv"tv$ uv% "u v& 7u(v( Zu0v2 8v9p@v: ZuHv= }uPv@uXvA u`rs s vs!dirvbq vq vr ss vt knvrvfvsv Zv5 v5@v`vhv xv   v  p@ v  pAv %;ittstttttsZtZtsttZ"usZt u7usZ'uZut~zI>~zJzK zLzM*zNn }H~$xC~@pjHFPXbus=`h Zp Zx5.ot~ )msiW(8@QHQPX `hx \ @)id8U" !!{# ҃$%'#) + p` , pa - pb . pc / pd 9 pe < pfH~B@@CgCh cpuCiWCjWCkW ClWCmWCnWCoWCpWCrWCsCtCuWC{  C|58(C} 0C~5885C%@@@U?8@6*{:Q{; {<6{{ƒ{  ҃{!ƒ{"ƒ{#ƒ {$ƒ({%ƒ0{&ƒ8{'ƒ@{(ƒH{)ƒP{*ƒX{+ƒ`{,ƒh{-ƒp{.ƒx{/ƒ{0ƒ{1ƒ{2ƒ{3ƒ{4ƒ{5ƒ]ƒC~҃C~ǃ&{U&W{l8H{x{y U"{zW{|W{}5{~0{@ $8{߇{Q'{ p '{ p!'{ p"'{ p#'{ p$'{ p%'{ p&'{ p''{ p('{ p){8{U" {{K {@ { p@ { pA { pB { pC { pD { pE.{7P{Q{X{*U{{ _{ _ {W { p { p { p { p { p { p { p  { p  { p  { p  { p {W{{׃{׃{{{Q{Q{Q{Q{ { ()qos{"0|+|,F id|-|.|/U" |0(|180|2*X|3 `|4 h|5 p|6 x|7 |8*|9*|:*|;*|<* dev|=C~,|> p,|? p߇ 8C~) {ops{]{ƒ{ {ƒ{ ҃{ ҃{C~pC~W}M׊}NF}OF}P!{}Q!{}R!{ }T(}U0}Vƒ8}W ҃@}X ҃H}Y ҃P}[ƒX}\ƒ`}^3h}_ƒp}aƒx}cƒ}d ҃ pm}f8}hpƉC~~`~aF bus~b=~d ~eF~gp ~h$~j(~k0~mƒ8~n ҃@~oƒH~p ҃P~q3X~rƒ`~s!{h~t!{p pm~v8x~w ҃ p~y܊+}3C~Q׊`23F5!{6!{89 ; (< ҃0>ƒ8@({@A2HC LP pmE8XBL\2#L||70XYFZ!{[\ ^ ҃ pm`8(Qƍ*ZƍZ Br Dr Ew F G Hq IZ |  A K :Ҏ @ƍN O* P Q (+N,-p.p/ Ҏ 0 p qf r  s M t Z u  v$(N"܏#&'' ܏ 2U" DLNa+2 348 len482a 6Q18ui j k*Ur s t܏NuRTWU@V܏WX Y$0[)8_"``ha*pbZx5dLƐmn/d_uv$x {$ | L } ~ $A  GA W    !  ( gJ0  Z8 *@̴H  @L  P  nVX  nV`  nVh 8p 8t 8x 8| U"      8 U * *   !       0 @ H  _P  _T  _X  _\T` +h- xIp 8TQH  P (5X ?` Ih  Zp9*'@AU i( y0 y8 @ H9PWXp`9$@    @  *    ( !}0 !8 @ "H *P *X *` h Up   _ Z & # Ⱥ $׺ ܺ     f    W  t(- `  Z 8 nV nV !8 " /  0  1 4  6W <5  BF@ D"H FP I#X L` O nd RXh Sp Zmx aq bqIrcu c dX f5 k0- nU"@@ oH qU"X r`"WW<WF<UFiZyn$~ EFGHI 4 mnt   RRp4>př\ "ě#  nid&-*4*7*SRSUXYZ Wc 9 dK(/rcueHgZXj` idmpptqFxru*ěu# uu u" u$U"@@u- lruu/u0# V2D nrV3 nsV4DW6Y*h2*  valQ h W"W   " #|W\* W Y YYl/rcuYmYn9Yo p YvҞYxYy Yu!xY*(Yr3Yt*ҞY=YBYF 33yL Ym YZ Y rGZ* YMM8mYY keyYMY=DY YNY6Y3 Y nV Y nV (Y~Y*Y*Y=YBY  (Y Y3: YYY /3 YݠYG ݠ y 91_*0#8@ uid $AP#X _`$ hXX 9X gidX GA2*DX XrcuXy>*?8ZcZ Z! Z"*Z#QZ#Q Z$*(Z$*0Z'Z(QZ)QZ0Z1 Z2 Z3 ZCۢZDZLZM&"ZNۢ8ZQ=ZR _ZSۢZTKcR*Jb* b l9*  &"0*U5 ` G/rss 08*U@ _X n fn =% arg Z  8[S [T [UD[W [XN[Y8[I q[J ioc[KNRz+ [\W0    - val  P val 9 <hssxin*v8_ `#a b c pd p/rcue reffs0\ * v * %&WTr** nr" ˦. 0  4˦ 4#5W6#7L33*= 8 BG s $A -  GA PP  W LQs   zV zV( zV8 fHК(ʨ)*+ ,0-5@. U"`/ _d0h1Vp2 x3*4w  val ʨ ֨"W6 BEV!uidF $A!gidG GA H Dw(JH       ( 0 nV8 nV@H}Ī* W(W, 0 8Z@ Ī!o Ī}@8H9a:a;a<a=u >u(?u0@8ɪaMufVzXDAEuFZG jHuIu Ju(Ka0N 8O@QHSPZFj_~~$o$$~xYZ[Q\Q]Q^Q _Q(`Q0aG8cG@dHeLfQPgQXhQ`iGhjp8IWWWW WWWino  ( 0tWt* WWW WWWWXϯaa  (.0L8.@jHPϯRWԯ)V)L)3eeIQHJ8 ʰ W U ʰ0 ڰH)ops! $ڰ**o*3 w }$  8 8Z)M= y   Ӳ      8( j0  8  @  H  ƳP  ߳X ` h  4p  Sx l    ´R+ ~feӲgJpgJز 3fgJW3U jfgJWWZ=gJop Ƴ߳˳gJp4NNNp9lgJXf qf´y3  ^ WE  9 3 < !<  LNL$A3  S     W  $@ Z [ \޾ ] ^ `8  b`( d~0 e8 f@ hݿH jP kX m2` oUh pp r x s u v y1 {O }r     & 0 : D(  f  x"pid J (6uid  $A $A  $ "  * W W  W W  3 G 5  QE  )9 * +$ , -*N* PZ$0      . U*g x .  L  L  C \  p(  L0  8 a@ H P X ` h p  x      /  W p      xA    ú ͺҺ    K*$* &+pSSFQWX   pos  *  Wf̻ftfFtѻ  W 0fS(Ifsu5gfW*Nf-l$ffռffڼf *Cf**** TpSftWMftSWufUŽ fϽsf/ffW\ffW4uuWz au W$WFپ$پG$$p8`$Lp=~$e$$Fݿ$L$L@2$$W PP7}R}8WovZ$QQ $$fWL1$fLO6rT w mt U *$&W $.C$3\$Hp$au n-s/ WF4kk$\u  FZ * * ) . 8\#\    ;/#G SF6(E6FF modG  opsH!I $JKY T@L!argM Z!strN!arrO VWWX \ max^W_W num` opsa!bZk0(35)3U6D* l* W n- +K*7` - .x mod / @ 0xH mp 1 P 28KX 8 5j 6w 7  9  ;  <( = 0jF F  &W >88 EDmod F . G8P p qZ rZ sp tWAmtn w    W   3UD*S  )WZW LBFF*Q& D"W~-~ || i=jwk [m ~VC~V=~C~VF`WW*&W&W8W 0!p" &W1&WB&WOced&e2f4gp lidhp e'} y Q fcma 0\1F2 3F4a6X7`8\h9\p:\x>*?Z@/0 ops1"C dev4C~56(78aa  |"W   h(-AZ@z{| Z}Z~ &"(0 irqW8W<*@*HFP dirXA #|8 iirq W6UX ~( 0yydIi6U023:# 4W@&W"W> get put   ( /0W8z@HPX`hpx$=Vj>Q|RW idSWT|PfghWi1p|\||p/|FW|FWZ4z|F \F||||F|FFWW|H Z=)V|WBj[L! "Q!ptr#ZhL busMbNOlP Qx($ ]b(D8@Ppops  Z?} C~IdevH~xx W W  g  W " "(565len7W cap8$3D $` JDKbusLbMbO Z P(QI0SW8T<U>V@WBXWDYHZI\J]SP`]XaD`c8hdlemfn gxhppiniqjrkxmRnQtvqy zW( |W- }W. ~W/ W0 W1 W2 W3 W4 W5 W6 W7 W8 W9 W: W; W<WW\ W W W}AdevH~)irqWap@ WB W B W B W B W B W B WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB W B W!B W"B W#B W$B W%B W&B W'B W(B W)B W*B W+B W,B W-B W.B W/BF _H U"LqP W@M W`M WaM Z  )vpd  WPO  T    8 W`P     p 0 2 )rom$8  @ FH  *P #X   N XJRF    ( 0 8 @ H#P!{X!{`hpb Wq*8*x*  *(  .! >"\#$ e*.b>b3Z\bWCbW%abW8;<U"=*H W8_Zasehk l o (r 0sD}_DxD8DDQDD8DZ"WpEHpN}pT pZpeH+n$nb**hp pppp'2*p pp'}:(q0qvmaq1-q2 q3 *q4*q5*  3q>q? *q@ *--*--***n$nWn-$n***A-2i-*ZFF}-n-RR-*+-*G|(;@ Z ZD ;"W02 3F*V608:=F?WE = I W(p88FFW8FFBBO7PFQFRFST /devUH~PVE@WKHXXhY\ _] _^ __ _`W\ HMXX]B@@CSDSEJhFG<HIWJWKWLWMWNWO*PWQ _RS T Us-Ws-XyZ{#]*0^ _8_*U@aWXbW\cW`dWdMdirghrcunpoxq5rs tFvhWW ZE{#{#@hE irqWW devC~ msgF4 \(V0 I8Z@ HP88 irqW<p ( Z0SJF    ( 0 8 @ H P X ` h p x     ,   f f     ! # $ &*JWs-pW,sAAF =f|1NkpZWs- cntW:#"W"J , pin-./8@08A18B4567*8 R SJ!uvTHInJK8L8M<Ns-OE P Z(00***ack*eoi* *(JP9n<88@8D %Hx!D" #Z$ S% h& } ' }((W0)W4*88+8<,8@-WD. ZH/*P0*X1p`2h3x8SZDh8ZXxx9m2*&W@ R1SWTWUWVW WX }gcY1 x@2*"W        8 Z Ps??s@sAsBq Psesfsh mapsj.sk Cslu sq(ss 0su8sv @swH?p\@ p @ .pW<CpW3pp\pWBHpWWZzpWWpppp  ?z@8A8B8C8 DFE zp2*   888 8 88( 8< (  8!8"8#8$8%8 &8  ()8*8+8,8-8.8 &H: 1&6p7888 9F> ? 8 @:B C 8 DpF G 8 H<m n8 o8qorstuvw x Wz { |ZlyoL Q!ptrZ Zo4!pci IEZ9P    !  6( T0 i8 i@ H<H 8@Wops Z <( Z0F8 Z@pW<pWpC~!pE 6E&TpC~;ipC~Yp <nNpC~pp#f|#/|01 2 C$4 cmd6  err9 <  bus=  > A B E G  I$*M cmdO  errQ T  busU  V C<X$Z  op[\(L devDC"#Z$5%7(&0'`(d)h**p+Xx op, ^WWWWL a%*CWW@hiFjk lo p 8( addr[0 gett~8CD 8Dp#[D=D~WWW`z'05 W9Y f5F i`pWHD&\i5pDj`2Zc `8Z `?Z W9 f5W9 f5P 5X9DUXTXQbus*RXX;M  ];j- zk0B f?#h h ZYh mno 1cT Q06Il 1UsT Q YnQQ5kHo 0HBcdevID0I pKL |D>|P HW\%W0><>pHj\z06\>zC >zX*\j>j8>jVS4/Sչ47S424KH]SRnew44KS9Rnew144H][jp{4jFZretlpHVoVp[ApRnewA@4B4CZretEp#4#5]%H]&qH  5A : F ^  q q     Iint F ,  * +s8R+u8e+s16}+u16 +s32+u32+s64+u64P \    1F 2F Hc IP X ] ^P _ `:   <F  '   o   #SB  %{ & 4 = B h n' } 1  ;  ;  F  F   $1  XXX0xx : JKL Wx K  s \x1MH  5  G "V y  ( ;$0 t8 ]@ "H "H "H ~H "H "H "H "H$@    0  RP h  5 5 F @  E F 1/kp J  F( F, @0  E8 B@ BA BB FD  OH sP8mem T@ t   F 0 e j  t ~  ( 0 F8 @ FH FL P FX ` Fh p  x F F @$  F  F F $  F !$ "F % &r' 9F : ?0 A0 D } F  P  QF( TE$0N  ; cs =;sl ?;wfe A; Ex ss G;sti I; K;nmi M; P;  S;0 V;8lm X;9 ];: d;<  cs  csx ;    ss  ssx ;   g r15 mr14 nr13 or12 pbp q bx r(r11 u0r10 v8r9 w@r8 xHax yPcx zXdx {`si |hdi }p xip x  sp   B  C  D  E   E (s E ,dpl E -p E' / F 0avl F 4l F 5d F 6g F% 7 F+ 8  % %% )%/ 9' pgd' )'"  @H? I!_0_0 48em f g h u vwkeyx\m  U V ? j keyk n keyo ;l<=? F @ F$A F(B F+$-@ (y0FF  4( F,!F0( 4)Y.8*FH+P,(X5 `6 d8 h: l; p< t=Fx5se?@@/rt@A8dlABBBFD%I2JKFODXD]D%`"w>@d]hFkF lm nD oD(p'0q Xs`ubx dy/Dhz0p{D 0 0  /D00 x=01(%2P/mmhpEx    F F, F, F, F- F- F- F- F- F- F- F- F- F - F - F - F -"F -30/pid * *( (00((000@>FPCFX 0"{F%v(v+ - ;. ;3 ;4<6=: (=0>8A ;@D ;HGPHXK:`%N;TGWGZG^Hk -mHp0 q1(t8u@/fsxHH{HP~HXI`Lh Lp 5x 5 58 ~FL o<F\4h9 ;  ; u1 2" TD p2( (8 L@  H MP  MX M` Mh Mp x M /: F  ;  ;  ; 4 <  M 0  '  ' "M )M  0  M0  18  FX N\ N` 1h 0  N      !F "F # $ & ; ' ; ( ; %) 3*N C$ D L/N N R?N S'( T', Y0 ] 8 ^ < _ @ ` D %aH d9X gIN i9 lSN w x z } ~XN  ; ;  $  FmNwNNN F(F,vD08rcu04@ D(H4POx4  " O OO  ; >% !"-$"-%.<(O%F-@@l$@@q-spes ds"$&(0-8X`cr2hpx-F' i-5fpu ,@F(  '$@@!d@&i@ , !c c B(,Gd0&d80XQdh%`dpxb ed' Njdb !  >!val   R!! ,>!!! !!  ^! !!R! ! " \ " ?? 2"R! " "2" F, #fmt555F55$O6,# 7 8 8#5555'F'F'4Fkey9 #("F=#   8U;$V0modW;$X5Y@$ Z ([ ,\#05u$v$w$xFyF,## :$ /$1Fset3Cget5\7 .$D&;$ 5 X {  -( -08!@" ߙH# P$ X%`&/h'Hp(/x)k*+,ٚ-ޚ./ 0 .1 2`3 5 9 ϛ; >k?@=$ !'% + -/  :' !key " ?h' A Bm' Cr' h'' =' >:' '  ;{' ! $0"c("d5"e."gL"i j"lo 5('# N# Np$(cwd$'swd$'twd$'fip$' fcs$'foo$'fos$'$($'l '($*(rip$+;rdp$,;$..)fip$/'fcs$0'foo$1'fos$2' $)B)((0$@d) $Ad) $Bd) 't) :$$*cwd$% swd$& twd$' fop$( .)$5'$6'$9* $<*$>d)@B) '* '&*?$Q+cwd$R'swd$S'twd$T'fip$U' fcs$V'foo$W'fos$X'$Z($[l$\m$]n$^orm$_p$`q$a+x$b'! +@$:Q+$; ;$< ;$= Q+ ;a+$@@$O+&$Pt)$Q+$R+@ +2P@$^,$_9(-$`t)$a&*-$ba+@$c, ,E$@@$f,$hF$kF$n;$q;xfd$t;$wF$zF$F$F&$+@@$,$ ;$F$F Qfpu@$d-$F$$d-$d-$, $,0&$,@@,% -% ;%; :- - --- -&N&N&N'8.'92.'<2.'=2..(<Y. (=F (> (:.(;.7.src(A  dst(A .."F).  () /) /val) ')!' )"')#;)$ / ')*G/ )+&G/ ),#t/#*t/*uQ* L/)'/)(6)).%/).; )1/)20)3)4 )5)6 /()30 )%. )/y/ )7/8)`0)fn) t00\o0o030`0+>0+?+@+A'cpu+C'"F,0     - 1- 1  1. 01.0/ K1/ 0a1 0"0u1K1 0a11 11! 1"1 2)12*'2+2"osq2-01 2/0(3 23 3 0304P244P24P224 p24 P2424U24P2 52(5 25 5 25p2"F6 2 @6'q3(6(26)  6*3(6+406,86-96.:6/;2332q3@@7/470~71F72 6 seq73;743752 76077 83(8G48 x88 W48' R4R44G49499 94 4: 4:4 4 :84;4;  ;4<+5<,c<-cx=_5=_5=F`=hmax=p o5 > 5sig>4 >o5 ?RE ?S55 ?U ?V55A@5 @  @  @ 5@'"6@(o@){@-`6@.@/@0 5@1@56@6o@7{@8 5 @<6@=o@>{@?@@@A@S 7@T $@U@V @Y17@Z $@[ @^b7@_@` @a @J7 @L @Q @W6 @\ 7 @b17 @E7@Fb7@g7@h\_fd@i@m8@n@o@pF A @%|8 @*5 @2"6_rt@9`6 @B6 @d7 @j7 @q70A 8A A A A 80A 8|8 A8 8A  9A!0A" 5 A%N9A'5A(A.5A0 5 A3h9saA4 9 B 9B B lenB B B(C9C {D$9D% D'D( 0DD/:DM#9DPB(DWB)8E :E;E;E;E;E; E#;(E,;0F):F*;F+2PF8:F9:F:FHF;FL :;8FD;;(FEFF1FGF0 G>;GKGZGpGGGendG; :;2H!;H" F H&;HD;HD; HD;HE<HE; HE<HT L<HY<HZ u1 H[(<I o<valIZ I X<I <valI f I {<S<U ;V ;W2"6F[=    0hx=i;jk<cpulFm;n; o;( == ',@@w> ; ; ; ' ' (0F8$@@ ; ; ; ; ;  ;( ;0 ;8 1@ ;H ;P 1X 1` ;h ;p ;x  ;  ;  ;  ; ; ; ; ; ; ; ; ; ;$@qA=& 2! ;(" ;0# ;8%0@&qP'qQ(qR)qS, ;X- ;`. ;h/ ;p0 1x1 ;3 ;6 7qA9{A;{A=5avgG=@@ vA0KAL0MNOF P$Q&SA(A)]BBBBBB,`C&a2h ;i ; j ;(k ;0l ;8s 1@t ;HuFPFFFFFFFF&2X&2rqCACB)^CC(CBRrqCC;F ;F ;F;F9/DSTDBbCBs'qDqDTD? ~DD D CD'' D,EqRjS @ D Hp2P` h)px u10S DFpidpJ7>FJ9 4J:FJ; u1J<minoJ=;J?y J@]@JBSH.rcuJC`JDypE xSF K{FKFKZTSFLoGLp'uidLq o<gidLr < Ls o<Lt <Lu o<Lv <Lw o< Lx <$Ly F(Lzy0L{y8L|y@L}yHL~yPLqXLH`LHhLHpLHxL L}L iL8L}!}FGFkeyMHM4Moz!{M| semMS(M|PM X|`M huidM o<pgidM <tM{zxM|M~M M||M|G H H H H H:XN^LN_4N` NaNb Nc0NeS Nh(8Nk8@Nn]XNq`NsdNt(hNwpNxFtNzx'NF'NFNFN]N](N2N itNN4N:NƀhN N>FN\V_eNW_fFsda_gX_h"_iX WCx_DX_EW_FX_H _I1(_Ju1H_K1P_Lp_Mx_N_O_P_Q_R_S_TB_U_V1_WSF_Y _\_]_^T__NWp WXUSW`NaX a+ a+a" Ya#a$a%a'/Ya(a)a+SYa,a-a!Y a&X a* Y a./Y aYXopsaYSY YYa2Ya4a6Fa7F "FQ@Z   "FQH@Z   QpuZQqZQrQszZ uZQZQYQVQZ(QQ3QZZWZ@Q`[Q@ZQQQ Q B(Q,Q`[0.rcuQ8Q[HZYQ[QidQ j[[2Q[Q[ [(b\b2"b1b0b  c \c;c& $c)Sldtc*\8c.@c91Hc:hc;]pc= xcC |cD~ \d ]ddaltddd d(d0d\8d\@d\Hd\Pd\Xd\`d\hd\pd\xd\d \d!\\] cF\\]^ `FX^lruY0] d0 e0i>^ j  k(Rn^]hE^s (u^zpp{^|}~' ^^^_  ^3(Q0_>^n^^^7R_ F  9 k_val)R_0M_N PF*J_BlruK0x_*W_X Yk_0@GL`I_UEV  _([ 0\ 4^84@Fj`_-j 0(m`noq r s t vF 4@l`j`-z 00}Ta~     (0 a04@|a`Ta- ,Da!L`!`@!a)a, b  u1   E  q(F0F4G8w@pP rp  x#Օ$ % 'ڕ!a5cctx6c c=Cc>AS@;(X`cYS(\cbht%w }$0c4cc-*daaX Gd5rb2Cc Ld Vd[dc`cd;cid Y@@ d 9 d0 mNZ@@h!d@S@PX`hppgd  x) 5 ?hELFS Z2"]'_au1pSr0$ (08;@u1DHP'X3`h/brkp!x%0hh@h]hu1pix( ib&i  ['T!i' dod h3 [h h iQ i i 5i2#e6N#e9N#ej gGMj gHj gIii 4j9j CjHjh,jh- u1h/ h0RjgAjigK ~g:j g@~ijgNj gO gP gQ r(g+Dkg,g-Bg.Bg/ ~jj 0pkqbr rs t u v $H(Dkji"ki#ki&ki'ki' kkkj(lju1j 3jBl7jljWl!(lk3{lk4'lenk4'k2lWl k6;k1l{lk8lkil kj0 kklS[krm ksx ktk7kukRmkTFkU<kVkkWmkXl kYq0k[q8k_"q`k`uhkapkbx(kdBllkmxkn].d_ukvlmm$x{q| }~ o< <F !e u(E0 8@H L rP X ` h'p't'x'|u1^ 'Sx0o  000 \?0$@$H P T X \@e`yh%Dp08@H P(X`h pm q-q'@kqkukukvk6vkJv k^v(k nv0k nv8k v@k vHk.wPkLwXkew`-qq$@u0 q r t(!0!8@"HPX`mhSp &!#:D$SXk 0 b b l vxF (%` '!'"/ 0 14 6F<1 B5@D"qHFxPI'XL`O dRUhS]pZ ixaxbx8rcucdTf1k0%nu1@@o0Hqu1Xr0`q"Fku umFuvv vmlu1vvF51vlvJvv;v^vmOvnvmcvvmqsvvmv lEvlFmlGulHlIvvvvwm)wmntm vm mwvGwGwB)w3wmewmuQw n"wn#nidn&n-n4n7mNnRxnSxnUxnX\nYnZ Fnc 4 ndSF(.rcuneHngXnj0`idnmpnptnq5xnrmnuxxxxwjwx'0o3xo4\yo60o7o8 Bxao9Rj  o4yo 0o" \o$u1@@o-\ylruo/xo0' 4yJ2ynrJ3nsJ4y0 ]y ayy2p yvalp; py"Fq y   y r1zrr r#sNteztjzt ez M MMlz.rcuMmMn4Mo BMvzMx My MuzzxM(MrA{MtzMK{MP{M5 A{A{zA M{{ M M {U{ { M{{{H{{HF{{{M{M{keyMHMK{3M| M07M2MA| M  M (M|MMMK{MP{M  (M| MzA|0 M|M0M =z* M|MU{| | |{u}u 4u[u0u'8ux@uidu o<Pu'Xu `u$>"hL}L 4LgidL } <}23L} L]rcuL}}:@@7g~7h2"cpu7iF7jF7kF 7lF7mF7nF7oF7pF7rF7s7t7uF7{  7|3(7} 07~38(7M@@}1~"F7:M        =3@^ N9n?8NN N! \N"N#;N#; N$(N$0N'N(;N);N04N1 $N2 $N3 $NCONDNLwNM(NNwO8NQNR NSONTSF| ƀ >Fր ր  4  v)v(0wlwwwS(w `x .rssx )xq0x8xS@x Xy fny .argy  ez bz z { 'OSA OT0 OUy3OWb OXx7OY8OIqOJiocOKM!A O\F0 b | ҂val|Z || val|f |ނ} v}  }%6F}T^    "q~      . 0 $ 4"F.ۃ   45F679 * % /4`  o<  ҂  <  PF >`  rKK(K8 bHЁ()x*0+0 ,00-1@. u1`/ d0uh1bp2 rx34 { څval ÅGF  "F6(   BEbuidF o<gidG < H څD4JH ( ( ( ( (  (( (0 8 @HЇ0 F(F, (0 (8@ Ї!;$ЇGF        @89:;<=È >È(?È0@8uÈ܈u܈bȈXDEÈFG HÈIÈ JÈ(K0N щ8O@QHSPủ̉q(qڅ։q̉xYZ[;\;];^; _;(`;0a18c1@dHeLf;Pg;Xh;`i1hjp8FFFF FFFino  ( 0‹F‹ ҋ QFFF FFFFX66 Y(|08|@H6PQuGw6uF"TuTҋ;wubw ^u܈wuD8  F S 0 (H/ops!8  q( 8 H*wm}r mwk\Ǐ! : T (0 ѐ8 @ H P -XP`dh p x   ̏ba!E B:E&JJO ?bErFSYbErFFѐE~~֐B -kkPEy2dUB~~iBEؑؑbݑ bkkǏ*?MF4e]-*! &q*ޒIN  F ޒ $@Z`[[\~]^`؜ b(d0e78fZ@h}Hj7PkXmҝ`ohp"pr @xsmuvyў{}:S` j t ~  ( b 1pid>F0uid o<o< $ p FF FF r* 1 ;4 )Օ-*+., -])P^F    $0c  &c=ltΟ    ( 0 8@9HMP9XM`php x Ϡ  ) ) y  +& 05 ? INۃ ] g q { : :$)Bߘߘ5r;F pos r) Fr5brXb~oi:{b5~oi]kF bߘՙbՙڙ \bFb/qbHbߕ4kbrrMbpb ٚb$PINboi~F.boiIN~F QbQSV[ 3\brreb ϛbrbr~FrbrbrrFԛF =F$m[qmFB5ymqy`qqB؜mqmBݜmqm7qm#Zqm5<}qm_qmҝqmqmFmםGw'FQ@m~'cqc;;h EqrqmbFўqbm֞m0m05 Sm0? mt S qX6F   qΟuqӟqq u9u%Mu>fmfk RuvumϠu~ru5~rԠ q\)ux==B . LQmyt5[ "@@AA5B0CFD֪ E<(sdF90GAS8'IF'JF'KF'LF'MF *  . 'PPW     qq  ZU2_rev Z99  95.rb2ns0F8< >Y@id;` hp.rcux opsJ!T r9hEi y"$ % ɦ & ަ(( 02 ~89B@: H= P@3XA Q`E O dir d > Ukn9b 1 1@`0h x  ~  B@  BA %`dddUydn~oiɦoiަΦd~rdՙ3drQdr8"Fz  0'֧(V) ji* +, - .(z1ۧ 1"5"5" "mW "n "o&X"0"1 "2 ~"3 "4y "5 ("7 ө0"9 8"; ө@"= H"?PWW )F) LF3~jFQ)1EtbFr~~өbFr~rbFrةbF"N" l" #lF)SF)5~q`֪0 u1 X0t7u LvQw!Vx*yy z (۪7LFAN[(oot֧A`t~ttiyiC }~(E>F5modG;$opsH!I JKa ܬì\׬HLargM strNarrOVWFX \max^F_Fnum`qopsa!b$0(;();=2L t F v   :7` -  .mod /;$@ 0FHmp 1P 2{FX  8 5r 6  7  9  ; ͯ  <( = 0r5~ͯ;$5;$ү;$6F >   ,8 ELmod F;$& G6 J       _,P p q r sB tF5mtn w  1  1 F   6;"ܬy=e& o y#QNW/Q  "L Aϱ>ϱ `   A > >  AG"7>G a M b L % Kint 1u8? #W   1 <!%',/359<ADHLQUYɲʲ˲  6 9 < GK 1 :@ 1T| 1.111-  g l - - - `J 9   % V9  `/V ,4p ,   : ; 9 I8  : ;9 I8 I !II~1B : ;9 I8( 'I  : ; 9  H} : ; 9 I8 : ; 9 I< : ;9 I kH}4:!;9 IB&II : ; 9 I4:!;9 I!I/  : ; 9 I k 41B : ;9 4: ;9 I  : ; 9 I81RBX YW 1RBUX!YW ' !1RBX YW " I8 #1RBUX YW $: ; 9 I% U& : ;9 I8 '1RBX Y W ( : ; 9 ) U* : ;9 I+: ;9 I,: ; 9 I- : ; 9 ..?: ;9 '</:!;9 IB0H}1: ;9 I2  : ; 9!3 : ;9 I k 4.: ;9 'I 54: ;9!I 6 I71RBUX Y W 8 9 1:4:!;9 I ;.: ; 9 ' !<4: ; 9 I=>! I: ; 9!>.?: ; 9 'I<?1RBUX Y W @.: ; 9 'I A : ; 9 IB : ; 9 C:!;9 IBD.?: ; 9 '<E 1F  : ;9!G41H> !I: ;9!I4: ; 9!I J4:!;9 IBK1RBX Y W L : ;9 I8M: ;9 IN4:!; 9 IBO : ; 9 I k P : ;9 Q : ; 9 I kR4:!; 9 IS.:!;9 'I@zT4I4U.?: ; 9 '<V$ > W I 8 X.?: ;9 'I<Y41Z : ;9 I 8[ : ;9 I 8 \ : ; 9 I!8 ] : ;9 ^!I_`4: ;9 Ia:!; 9 IBb : ; 9 I 8 c(d 1Ue f 1g4:!;9 Ih :!;9!i:!; 9!Ij  : ;9!k : ;9 I l : ;9 m.: ;9 ' !n4: ; 9 Io4: ; 9 I?<p.?: ;9 '<q'Ir : ;9 I 8s : ;9 I 8 t : ;9!u  : ; 9!v : ; 9!w !: ; 9!x  : ;9!y 1z :!;9!{.:!;9 'IU@z|H}} : ; 9 ~ : ; 9 I8 : ; 9 I!4I4H} :!;9  I8 : ;9 II 4:!; 9 I 1 5I>! !I: ; 9! !: ;9!4: ;9 I?<.?: ; 9 'I<.:!;9 '@z 1U.:!;9! 'U@z1:!; 9 IB.:!; 9 'I@z4:!; 9 IB !: ; 9!!I/< : ;9! !: ; 9! !: ; 9 H}H}% U$ >  &4: ; 9 I?'  : ;9   : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9   : ; 9  I 8 : ; 9 I (  : ; 9  : ; 9 I 8 : ;9 4G: ; 9 .?: ; 9 '<.?: ; 9 n'I<.?: ; 9 '< 1 : ;9 1X YW .?: ;9 'U@z.?: ;9 'I@z.?: ; 9 'I@z: ; 9 I.: ; 9 'U@z.?: ;9 'I .?: ; 9 'I .: ; 9 '  : ; 9 .1@z.?<n.?<n: ;  : ; 9 I8  : ;9 I8 I !I : ;9 I8'I(  : ; 9  : ; 9 I8 1B < : ;9 I k : ; 9 I : ; 9 I&II : ; 9 I8I~!I/  : ;9  : ; 9 I k ' I8  : ; 9  : ;9 I8  : ; 9 : ; 9 I  : ; 9!: ; 9 I4: ;9!I  : ;9 I I!41B"H}# : ; 9 $.: ; 9 'I %>! I: ; 9!& : ; 9 I': ;9 I(  : ;9!)4: ; 9!I * +4: ; 9 I,1RBX Y W - : ; 9 I k .> !I: ;9!/ : ;9 I k 0 U1.: ;9 'I 2$ > 3 : ;9 I84: ;9 I5 I 8 6 7 : ; 9 I k8 : ;9 I 89 : ;9 I 8 : : ; 9 I!8 ;1RBUX Y W < 1U=H}>!I? : ;9 @1RBUX!YW A : ; 9 I 8 BH}C1RBX!YW D1RBX YW E1RBUX YW F:!; 9!IG  : ;9!H : ;9 I I : ;9 J.?: ;9 'I<K.?: ; 9 'I<L1RBX Y W M: ;9 IN.?: ; 9 '<O4: ;9 IP4: ;9 IQ 1R.: ; 9 ' !S'IT : ;9 I 8 U  : ; 9!V : ; 9!W(X !: ; 9!Y  : ;9!Z U[4: ; 9 I\4:!; 9 I!].?:!; 9 '<^4:!; 9 I_ : ;9 I 8` : ;9!a : ;9 b : ; 9 c : ; 9 I8d : ; 9 I!ef4:!;9 IBg 1h41i 1j I8kI l.?: ;9!'<m1n 1o1RBUX!Y W p4I4q4:!; 9 IBr5Is !: ;9!t : ;9 Iu.?: ;9 '<v:!;9 IBw x4:!; 9 Iy>! !I: ; 9!z!I/{<| !: ; 9!}4: ;9 I?<~ !: ; 9 4:! ; 9 I?<:!;9 IB4I44:!;!9!I.:!;9! ' !:!; 9 IB% U$ >  &'4: ; 9 I? : ; 9   : ;9   : ;9  : ;9  : ; 9 I 8 : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 (   : ; 9  I 8 : ; 9 I  : ; 9 .: ;9 'IU@z4: ;9 IB.?: ;9 'I@z.?: ;9 'U@zH}41H}4: ;9 I .?: ; 9 '@z.: ; 9 'U@z: ; 9 IB4: ; 9 IB : ; 9  : ; 9 .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8I~'I(  : ; 9  : ; 9 I8 : ;9 I k < : ; 9 I : ; 9 I&II1B : ; 9 I8!I/ H} : ;9 ' I8  : ; 9 I k  : ; 9  : ;9 I8  : ; 9   : ; 9! 1U4: ;9!I  : ;9 I !H}" I#41B$4: ;9 I% & : ; 9 ' U(: ;9 I).?: ; 9 'I<* 1+>! I: ; 9!,: ; 9 I- : ; 9 I.41/  : ;9!04: ; 9!I 14: ; 9 I2 13 : ; 9 I k 4> !I: ;9!5 : ;9 I k 6$ > 7 : ;9 I88: ;9 I9 I 8 :.?: ;9 '<;H}< : ; 9 I k= : ;9 I 8> : ;9 I 8 ? : ; 9 I!8 @1RBUX YW A!IB : ;9 C.?: ; 9 '<D4:!;9 IE4:!;9 I!F : ; 9 I 8 G4:!; 9 I H UI:!; 9 IBJK1RBUX!Y W L.?: ; 9!'<M:!; 9!IN  : ;9!O : ;9 I P : ;9 Q1RBUX!YW R.: ;9 'I S.: ; 9 'I T4:!; 9 IU4:!;9 IBVH}W'IX : ;9 I 8 Y  : ; 9!Z : ; 9![ !: ; 9!\  : ;9!]4I4^H}_ : ;9 I 8` : ;9!a : ;9 b : ; 9 c : ; 9 I8d : ; 9 I!e(f4:!;9 Ig1h i: ; 9 Ij4: ; 9 I?<k I8lI m.?: ;9 'I<nH}o4I4p:!;9 IBq1RBUX!Y W r 1s:!;9 IBt.: ; 9 ' u.1@zv !: ;9!w!I/x : ;9 Iy4:!;9 IBz :!;9!{.: ;9 ' | :!;9!}4:!;9 I~: ;9 I4:!; 9 IB4:!; 9!I :!; 9!>! !I: ; 9!4: ;9 I?<< !: ; 9! !: ; 9 .?: ;9!'<.:!;9! '@z1RBX!Y W H}.:!;9! 'I@z41 1RBX YW  1:!; 9 IB41% U$ >  &'4: ; 9 I? : ; 9   : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 (   : ; 9  I 8 : ; 9 I  : ; 9  : ; 9 I 84G: ;9 .?: ;9 '@z.?: ;9 'I@z 1U.: ; 9 'IU@z4: ; 9 IB.: ; 9 'I@z4: ; 9 I : ; 9 .: ; 9 '@z.: ; 9 'I  : ; 9 1RBX YW .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8'I : ; 9 ( : ; 9 I8 < : ;9 I k : ; 9 I I~ : ; 9 I&II!I/ 1B : ; 9 I8 : ;9  : ; 9 I k ' I8  : ; 9  : ;9 I8  : ; 9 4: ;9 I   : ; 9! : ;9 I I:!; 9 IB 4:!;9 IB! U" : ; 9 # : ; 9 I$: ; 9 I%4:!; 9 IB&>! I: ; 9!'  : ;9!(4: ; 9!I ) *H}+ : ; 9 I k ,> !I: ;9!- : ;9 I k .$ > / : ;9 I80: ;9 I1 I 8 2 : ; 9 I k3 : ;9 I 84 : ;9 I 8 5H}6!I7 : ; 9 I!8 8 : ;9 91RB UX YW : : ; 9 I 8 ;.: ; 9 'I <.?: ;9 'I<= U>1RB UX!YW ?:!; 9 IB@: ; 9 IA: ;9 IB:! ; 9!IC  : ;9!D : ;9 I E : ;9 F 1G1RB UX!Y W H.?: ;9 '<I4:!;9 IBJ4I4KH}LH}M.?: ; 9!'<N.?:!; 9 'I@zO'IP : ;9 I 8 Q !: ; 9!R  : ;9!S.?: ; 9 'I<T:!;9 IBU.: ;9 'I !V W.:!; 9!' !X : ;9 I 8Y : ;9!Z : ;9 [  : ; 9!\ : ; 9 ] : ; 9 I8^ : ; 9 I!_(`4:!; 9 I a4:!;9!I!b 1c1RB X!Y W!d41Be1f I8gI h4: ; 9 Ii4:!; 9 Ij.?:!;9!'I@zk1RB X YW l !: ;9!m : ;9 In : ; 9!o1RB X!Y W!pH}q1RB UX!Y W!r4: ; 9 Is>! !I: ; 9!t4: ; 9 I?<u !: ; 9!v4: ;9 I?<w!I/x<y !: ; 9!z !: ; 9 {.?: ; 9!'<|}:!;9 IB~.?:!;9!'@zH}4:!; 9!IB 4:!;!9!I1X!Y W!(1X!Y!W! % U $ > &4: ; 9 I?'  : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 (   : ; 9  I 8 : ; 9 I  : ; 9  : ; 9 I 84G: ; 9 .?: ; 9 'I<.?: ;9 '<H} : ;9  : ;9  1U41 .?: ;9 '@|4: ;9 I.?: ; 9 'IU@z : ; 9 .: ; 9 'I@z4: ; 9 I H}: ;9 I4: ;9 I : ; 9 .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8'I : ; 9 ( : ; 9 I8 < : ;9 I k : ; 9 I : ; 9 I&III~!I/  : ; 9 I8 : ;9  : ; 9 I k ' I8  : ; 9 1B : ;9 I8  : ; 9   : ; 9!4: ;9!I  : ;9 I I : ; 9  : ; 9 I!H}":!; 9 IB#4: ; 9 I $H}%>! I: ; 9!&  : ;9!' : ; 9 I k (> !I: ;9!) : ;9 I k *4:!; 9 IB+ U,$ > - : ;9 I8.: ;9 I/ I 8 0 : ; 9 I k1 : ;9 I 82 : ;9 I 8 3!I4 : ; 9 I!8 5 : ;9 6.?: ;9 'I<7 : ; 9 I 8 84:!; 9 IB94:!; 9 I:: ;9 I;:!;9 I<1RBUX Y W =.: ;9 'I !>:! ; 9!I?  : ;9!@ : ;9 I A : ;9 B UC:!; 9 IBD E: ; 9 IF: ; 9 IG.: ; 9 'I !H'II : ;9 I 8 J !: ; 9!K  : ;9!L4:!;9 IM.?: ;9!'<N41BO4:!; 9!I!P.?:!; 9!'<Q 1R : ;9 I 8S : ;9!T : ;9 U  : ; 9!V : ; 9 W : ; 9 I8X : ; 9 I!Y(Z4I4[ \1RBX Y W ]1^H}_ I8`I a.:!;9! 'I@zb1RBUX YW c.:!; 9! 'IU@zd>! !I: ; 9!e !: ;9!f : ;9 Ig : ; 9!h.?:! ; 9!'I<i.?: ; 9!'<jk:!;!9 IBl:!;9 Im.:!; 9 'I@zn1RBX!Y W o4: ; 9 Ip: ;9 Iq !: ; 9!r!I/s<t !: ; 9!u !: ; 9 v.?:!;!9!'<w:!;9 IBx4:!;9!IBy :!;9!z.:!; 9! '@z{:!; 9 I| 1U}41 ~1RBX!Y!W! 1RBUX!Y W! 1RBX YW  .: ; 9 ' !% U $ > &5I4: ; 9 I?'  : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 (   : ; 9  I 8 : ; 9 I 4: ;9 I?< : ; 9 4: ; 9 I : ; 9 I 84: ; 9 I?<.?: ;9 'IU@z1RBUX YW 1UX YW 1X YW H}: ; 9 I4: ; 9 I4: ;9 I : ; 9 .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8'I : ; 9  : ; 9 I8 ( < : ;9 I k : ; 9 I : ; 9 I&II!I/  : ; 9 I8 : ;9  : ; 9 I k ' I8 I~1B : ; 9  : ;9 I8  : ; 9 4: ;9!I  : ;9 I  : ; 9! I : ; 9  : ; 9 I!>! I: ; 9!"4: ; 9 I #  : ;9!$ : ; 9 I k % : ;9 I k &$ > ' : ;9 I8(: ;9 I) I 8 *> !I: ;9!+:!; 9 IB, : ; 9 I k- : ;9 I 8. : ;9 I 8 /!I0 : ;9 1 : ; 9 I 8 2 : ; 9 I!8 34:!; 9 I4H}5: ; 9 I6:! ; 9!I7  : ;9!8 : ;9 I 9 : ;9 :41B;H}<1RB X Y W!=1RB X Y W >.:!; 9 'I@z?4:!; 9 IB@'IA : ;9 I 8 B !: ; 9!C  : ;9!D4:!;9 IE.?: ; 9 'I<F:!; 9 IBG: ; 9 IH : ;9 I 8I : ;9!J : ;9 K  : ; 9!L : ; 9 M : ; 9 I8N : ; 9 I!O(P4:!; 9 IBQ UR I8SI T.?:!;9 'I<U 1V WH}X :!; 9 Y.: ; 9 'I !Z !: ;9![ : ;9 I\ : ; 9!]1RB UX!Y W ^.?: ; 9 '<_.: ; 9!' !`4: ; 9 Ia.: ;9 'I !b: ;9 Ic !: ; 9!d!I/e<f !: ; 9!g !: ; 9 h4: ; 9 Ii1RB X!YW!j:!; 9 Ik:!; 9 Il4I4m4:!; 9 I!n Uo 1p% q r$ > s> I: ; 9 t&u4: ; 9 I?v'w  : ;9 x  : ;9 y : ;9 z : ; 9 I 8{  : ; 9 | I }  : ;9 ~  : ;9   : ;9 (   : ; 9  I 8 : ; 9 I  : ; 9  : ; 9 I 84: ; 9 I?<.?: ; 9 '<.?: ;9 'I@z1RB UX YW 1RB X YW  : ; 9 1RB UX Y W 1RB UX YW H}.?: ; 9 'I@z4: ; 9 I 1: ;9 I  : ; 9 .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8'I : ; 9 ( : ; 9 I8 < : ;9 I k : ; 9 I : ; 9 I&II : ; 9 I8!I/  : ;9  : ; 9 I k ' I8  : ; 9  : ;9 I8  : ; 9   : ; 9!4: ;9!I  : ;9 I1B I : ; 9  : ; 9 I >! I: ; 9!!4: ; 9 I "  : ;9!# : ; 9 I k $> !I: ;9!% : ;9 I k &I~'$ > ( : ;9 I8): ;9 I* I 8 + : ; 9 I k, : ;9 I 8- : ;9 I 8 .: ; 9 I/!I0 : ; 9 I!8 1 : ;9 2: ;9 I3 : ; 9 I 8 4.?: ; 9 'I<5:!; 9!I6  : ;9!7 : ;9 I 8 : ;9 94:!; 9 IB:: ; 9 I;.: ;9 'I !<'I= : ;9 I 8 > !: ; 9!?  : ;9!@4: ; 9 IAH}B.: ; 9!' !C D : ;9 I 8E : ;9!F : ;9 G  : ; 9!H : ; 9 I : ; 9 I8J : ; 9 I!K(L41BM I8NI O:!; 9 IBP1RB X Y W Q1RB UX Y W R.: ; 9 'I S !: ;9!T : ;9 IU : ; 9!V.?:!;9!'I<W :!; 9!X1RB UX Y W Y.?:!; 9!'I@zZ>! !I: ; 9![ !: ; 9!\!I/]<^ !: ; 9!_ !: ; 9 `.?:!;!9!'<a4:!; 9!I!b Uc1RB X Y W!d 1e:!; 9 IBf4:!; 9!IBg h i4:!;!(9!Ij.?:!; 9!'<k4:!; 9!Il% Um n$ > o&p4: ; 9 I?q'r  : ;9 s  : ;9 t : ;9 u : ; 9 I 8v  : ; 9 w I x  : ;9 y  : ;9 z  : ;9 {( |  : ; 9 } I 8~ : ; 9 I 4: ;9 I?< : ; 9  : ; 9 I 84: ; 9 I?<4G: ; 9 .?: ; 9 '<.?: ;9 '<.?: ; 9 'IU@z 1 1U1 1.?: ; 9 '@zH}1RB UX YW  1U41 1RB X YW  U: ; 9 I1RB X YW  : ; 9 4I4: ;9 I4: ;9 I.: ; 9 'I  : ; 9 I8  : ;9 I8 I !I : ;9 I8'I : ; 9 ( : ; 9 I8 : ;9 I k < : ; 9 I : ; 9 I&I : ; 9 I8I!I/  : ;9 ' I8  : ; 9 I k I~1B : ; 9  : ;9 I8  : ; 9   : ; 9!4: ;9!I  : ;9 I4:!; 9 IB I  : ; 9 ! : ; 9 I">! I: ; 9!#4: ; 9 I $  : ;9!%:!; 9 IB&H}' : ; 9 I k (> !I: ;9!) : ;9 I k *H}+$ > , : ;9 I8-: ;9 I. I 8 / : ;9 I 80 : ;9 I 8 1 : ; 9 I k2 : ; 9 I!8 3: ; 9 I4!I5 : ;9 6 : ; 9 I 8 7 81RB X Y W 9: ;9 I::!; 9!I;  : ;9!< : ;9 I = : ;9 >1RB X Y W ? 1@ : ; 9!A4:!; 9 IBB1RB UX Y W C: ; 9 ID E : ;9 I 8 F'IG  : ; 9!H !: ; 9!I  : ;9!J.?: ; 9 '<K UL.: ; 9 'I !M : ;9 I 8N : ;9 O : ;9!P : ; 9 Q : ; 9 I8R : ; 9 I!S(T4: ; 9 IU41BV1RB UX Y W W4:!; 9 IX.: ;9 'I !Y.:!; 9!' !Z I8[I \.:!; 9 'I@z]:!; 9 IB^.?:!; 9!'<_ !: ;9!` : ;9 Ia.?: ;9 '<b.?:!;9!'I<c d>! !I: ; 9!e!I/f !: ; 9 g<h !: ; 9!i.?:!; 9!#'I<jk.:!; 9! '@zl 1Um1RB X!Y!W! n :!; 9!oH}p Uq.:!;9!' !r:!;9 Is4:!; 9!It% Uu$ > v w&x4: ; 9 I?y'z : ; 9 {  : ;9 |  : ;9 } : ;9 ~ : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 4: ;9 I?<(   : ; 9  I 8 : ; 9 I  : ; 9  : ; 9 I 84: ; 9 I?<4G: ;9 .?: ;9 '<H} H}41 .: ; 9 'IU@z4I4 : ; 9 1H}4: ;9 I.: ; 9 '  : ; 9 I8  : ;9 I8 I !I : ;9 I8'I : ; 9 ( : ; 9 I8 < : ;9 I k : ; 9 I : ; 9 I&I : ; 9 I8I!I/  : ;9 ' I8  : ; 9 I k  : ; 9  : ;9 I8  : ; 9 1B  : ; 9!4:!; 9 IBI~4: ;9!I  : ;9 I I  : ; 9 ! : ; 9 I">! I: ; 9!#4: ; 9 I $  : ;9!% : ; 9 I k &> !I: ;9!' : ;9 I k ($ > ) : ;9 I8*: ;9 I+ I 8 , : ; 9 I k- : ;9 I 8. : ;9 I 8 / : ; 9 I!8 0:!; 9 IB1H}2!I3 : ;9 4:!; 9 I5 : ; 9 I 8 6 7:!; 9!I8  : ;9!9 : ;9 I : : ;9 ;1RB X Y W <4:!; 9 IB=H}>: ;9 I? U@'IA : ;9 I 8 B  : ; 9!C : ; 9!D !: ; 9!E  : ;9!F1RB UX Y W G1RB X Y W H I : ;9 I 8J : ;9!K : ;9 L : ; 9 M : ; 9 I8N : ; 9 I!O(P.:!; 9 'I@zQ 1R: ; 9 IS.:!; 9!' !T I8UI V4: ; 9 IW.?: ; 9 '<X:!; 9 IY1RB UX Y W Z4: ; 9 I[.: ; 9 'I !\.: ;9 'I !].?:!; 9!'<^ !: ;9!_ : ;9 I`.?:!;9!'I<a41Bb1c:!; 9 IBd>! !I: ; 9!e!I/f<g !: ; 9!h !: ; 9 i.?:!; 9!#'I<j.?:!;!9!'<k.:!; 9! '@zlH}m 1Un41 o1RB X!Y!W! pH}q.:!;9!' !r:!;9 Is% Ut$ > u v&w4: ; 9 I?x'y : ; 9 z  : ;9 {  : ;9 | : ;9 } : ; 9 I 8~  : ; 9  I   : ;9   : ;9   : ;9 (   : ; 9  I 8 : ; 9 I 4: ;9 I?< : ; 9  : ; 9 I 84: ; 9 I?<4G: ; 9 .?: ;9 '<: ; 9 I U1X Y W H}4: ; 9 IH}4: ;9 I.: ; 9 '   : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 'I : ; 9 I8 < ( : ; 9 I : ; 9 I I&I!I/  : ; 9 I8 : ;9  I8  : ;9 I k : ; 9  : ; 9 4: ;9!I '  : ; 9! : ;9 I I : ;9 I8  : ; 9 I k  : ; 9  : ; 9 I k  : ; 9 I $ > ! I 8 ">! I: ; 9 #4: ; 9!I $  : ;9!% : ;9 I 8& : ;9 I 8 ' : ; 9 I k( : ; 9 I 8 ): ;9 I* : ;9 +:!; 9!I,  : ;9!- : ;9 I . : ; 9 I!8 / : ;9 I80 : ;9 1'I2!I3 !: ; 9!4  : ;9!5 : ;9 I 8 6> !I: ;9!7 : ; 9 I!8 : ;9 I 89 : ;9 :  : ; 9!; :!;9!I k < : ; 9 I8=I >4:!; 9!I!? !: ;9!@ I8A : ; 9 B : ;9 IC : ; 9!D : ;9!E!I/F !: ; 9!G>! !I: ; 9!H% I$ > J K&L4: ; 9 I?M'N4: ; 9 I?<O : ; 9 P  : ;9 Q  : ;9 R<S : ;9 T : ; 9 U : ; 9 I 8V  : ; 9 W I X  : ;9 Y  : ;9 Z  : ;9 [  : ; 9 \ I 8] : ; 9 I ^> I: ;9 _( `4G: ; 9 a.?: ; 9 '<b.?: ; 9 'I<( 4: ;9!I $ > 4: ; 9!I &II!I/ 4:!; 9!I  : ; 9 I :!; 9!I!8 >! !I: ; 9  :!;9!I8 > !I: ;9!>! !I: ; 9! !!:!; 9! :!; 9!I8!% $ > : ; 9 I4: ; 9 I?> I: ;9  : ;9 ( mQ              Y?tiJJJ JY~J#vt YtYY<P W/  fvty"r _(u tJJJJtJwXu Z n.u J|(x4ztX<t  .x JZv tZNFt |tttv[y t .t -<x JJxt.ott(v 4ztX<t  .x JZv tXhv t[y t  -x<JJ wt.st(w3oX<t  .x JZv tXhv t[y t  -x<JJ wt.st(w6xt w.RYsJ\ FH H 9 G t <v J |JtJX3 % < 7Y K :xJ`t<)(x3oy.%Ys<  8 9M G<  .8 yJ<.{X4zfV9W.vQtXX~Y(~oJ3X<t<1X$J>Jm~= ..-vXY| t YY|[ =M u  Y<~~ <~ t..~.XXNlt << f .}%~ tXXX<w. / .. `/ $< ..w    . l= #J X|X1 {JtYhhJ {J,XJtu X<z. zt zX< {   $fzXz]J !!z]X!] ytg...yt   ;   X< XX<z]Jf!z]X {   $.z]JwJ. {X.!z]XfX{Y(~2t Z< X=YZmEz XJ  L  <J~J ...nX0'  /,- >=:= ?Z[< V[~XzJ v tyX d Yg J#v  |t  X.}Jvy<yYlI= -X   J X f ~t<J } } }< }<<} tX .X Jj  X  X  u Jv tuX fkX<v!!lSy    <} WYXu    8 X} -YX}- YXy~ X YXfwXX }$xxXXxJ#v 9xt t0 :f JJy]<iy!!lSy   ]JvxX    z~v zX.{{tX(}:<ZtJJJl}YzX(}I<|p YMg K<"~K}X{!!lSy   ]J z   J {   X t .t|~< z.X}} <} t}.X~ |.X Jv tPyytXyJ#v 9yt t0 :f JJz]< z!!lSy   J vty.y.    y   {X~ XXyytXyJ#v 9yt t0 :f JJy]< z!!lSy   J wty.y.    y   zX~ XXxxXxJ#v 9xt t0 :f JJy]< vy!!lSy   J xt      x.s.x. Vfx.   x   zX~ XX }t<J}J<$*}ftttXZX j XZX  ~X~.1X(<X J=  }L  %~.~%~ X<>zfKX=Mw!!lSy   ]J w#~ . x..t /~X ~t ~ <J ~ ~ ~< ~<<~ tX .X Jx  X  X  7 K~ WY X -YsX- Y X YX  |t<J | | |< |<<| tX .X Jj  X  X  uv Jt$pJ.u!!lSy XJ    | WY X -YsX- Y X YXXXtvX~Y XX  }t<J } } }< }<<} tX .X Jj  X  X  Kv Jp.u!!lSy     | WY X -YsX- Y X YXXXtvX~ XX X~ ~t<J ~J<~ tX .X Jj  X  X t .(yYt[<< Js<.>1X$JYXYXfX\xp Ygt K<"x=Zwt WY X -YXzyX LH~'- Y X YX w  V 0 y z{{tt{ v[y t|O    |O   g |J#v  |tz u X. .|O   KYL|O    }}  gK.0 /L<Q|O   o L.7.f v|.>y$1f ]<Y |RX,  %.~%~ y KAD|.t|t< w(}Zr< f{X|t|J~  Y {J#vf{tt w{ '  _~  r>(}X<_~|!!lSy   ]X~   X X|t|JX~ X.  Lx0Y  i u-fu~q:XE \  0 L "< <t -<[0t ;[# s / IK# <[t <[0t ;[u1 V OX K K  .0 .0 .0K .0K .0K .1K .0K .0K Wt.v(~}t ~ t t |  </ }J J } X    ~J ]<, ~J ? t,f ~   t $f "t ^xX~   5t >~Xv tyYJ~ uV*ZY(W-J--KWX 5t >~X uV& u ZX~<tK~~<v}  (.J % [<%X [JX< z .0 ; =)JK*r<O  !t. XXtg ko<t7 JuIK Wh~X Jt rZ uvz Jtzm0^~ 5t >~. uV}    uV}   ~   ~   uV}    f ~J.  ~Xtv tzxv tzjttfXrZ uv tz x<vX xt~Xt ] X u ~ XtV  xt ~ xt ~ xt ~BtQX xt ~ A } ? tf m  ~J ]<, ~X ? t,.@ }t J} ~J ]< ~J ]J JfX ~J ]< ~J ]J KufX    t $.fxXtXt ~ i}X uv tz         Y!I =<Z <Yz JY= XX~  t~Y {kt,XJY Jy<y { X {XJY1U.V: >}X"< .=}XMJ..}t      NJJ g #]tu.X}   *pXX~o]SMUJ<h:< =t..XX]Y~~X.Y Xt,XJY ttX..~X    < . t  %i X`.-Y< XD xJX7Z*X Tt\.CH XXYx~X     fJX .=IZVL[I=X~.~t       #~   ~   f--qXX CX-X X4 zX  wJt1YT9 ={X$J  g + g XJ/|t,J K$-ttu=Z{.   "% TXM.L. |<< }fX6 xXJ1YS9=}.X|   X t$  hX M UJ+O J  .{ygZeX Jt!I3J s/Y  K P         ,Y>L h<.SJY tfbfX!X!X" X . YW < t/ 3 " t .   t t X    * Vf ?XfXv.t/ .X 1Y W= ZXX$f <Jz~XJ f...7~X,K<mX< .t< L!;Y!#0X Y X0~< X~.h <J ;</ 3.N2JLN <M ~  ~fJ JJ .< ~.XJ  ~    .  t  ;.</ t  V0 ~f  JI J~f .. XzX J~f J<X  V0~X  J# ~  V0 hX(X0,  fwJY X J LXJZt L.;cJ{ 1L GwVvq&JMv{ t{}X[J<= L JYZp Mgt K<"= J> %< 0 /X t XY  t/tutX;Y.fNX3Z.:3:3g .J z<<Y  t/X..oX JfJw f[Y<X=f=XUYYM$uJ .T  /X~X =Y   g.%~y JtyX  XXy[X/P =;Y#zX wX ytuvy u| f/  u| f 6!JXY MX1X  1u4s rL*.J X U i  XM%.~%~ tzX  .XXz .< XtJXy=;h ++S.[X'iXwf t'=<.< t  f.JzX(<=(7K I/ 7G=  s. }.t }<  } . #}<<ftKu . Jf }X f #}f< u   I.fnX #}<ftu   I.. ttX tX #ttX  :X JXY          ''",JVZYM ?JXX0,lztYvz .zt cXtMX[-J)WjJZ' t",VZYM X^.) =WY #J/J XJ[ <Y(0,UYYM U>VL...zX.pt Xf    f t y=KrX 3 =#HF .J#XJu JU J.ktJ q . J.gt  5} [t Y=M   ut}[t Y=M   ut}[t Y=M   ut}[t Y=M   ut.         3v ty<tX<YK\uX.<>  tn.ttz. %.~%~y JtyX  y nJt fJ<=M=N~=Jt=[ =M u u KJF.sp X2X$' tn <.X J >;.Y J K>;Z#I L-;Z#IM!f <p <YMgt K<"<=wX .f<  &JX            >JX~ . P-.,AZJt<[$Jf^k#Z=Y;,2<t<[g u  Zyy<*Wt J...=Z=<t<Yg?p <YMgt K<"K<=YYZ@ F*mXJty<y wf X  .%~z Xz  tz  X z[X</~<J*L /J vXXJm:ZZKJ<>Kp YMgt K<"=ytJvyyy<CXy<* XY~?9yE fty<.%~ XXX<yL+/< }[! tiLmJ#vmJ#v0t+(<JXk<. ~*< \F>X.JtXZ[3Z. Z6 X J<[X Y=M  V Y WK K K<n  <  t J .^X .J z.cXO1X X[J =M  Y WK K K B          ~#v R tK <=~%/=tZJt<Y6J J#vstYtYlJ ....pXt"=tZ<\KY<XX<Yxf<_.tZ ...%jX*%JJ Xt wlJ<* XyY=.%~ ty JXy XXyZL[X =M Y = K<kJ#vlttwX ...+[...$= OZJ<J<=gp Mgt K<"~;J=~<T<`YvF@ <..*Wtx<x.JXxX<...wX  .%~y JtyX   yf< .JL. wXX6<J=NJ<t= W)<K=p YMgt K<"=ytJ@yyfXz< Xf        x ,`HALKIB D(A08^0h (A BBBE LKIB D(A0 (A BBBE LKIB D(A0 (A BBBE d6KIB B(D0A8F@KH[PEXE`P@i 8A0A(B BBBE LKIB D(C0L8V0\(A BBB<GMA DX  AABE >X4/BDD ]AB(LGDB G(A0DH0D(A BBB\GBE K(C0U (A BBBE D(D IBBl5GBB E(D0C8 0A(B BBBE ^ 0A(B BBBE \iKBB B(A0A8DX`UXx8C0A(B BBB\3GBB E(A0A8Fh 8A0A(B BBBE ppFh$OhLGEE D(A0P (A BBBE :<9GAA D0  DABE 00\KBB B(A0A8QXX`KX 8A0A(B BBBE <JD HE ~ AE pdKAD  ABE W ABE A DIE I ABE { 4OKAD  ABE n 4OKAD  ABE n 4~KDD  ABE V tLKBB B(A0A8QhgpGxGGXhcpBxBXh 8A0A(B BBBE \KBB B(A0K8GXX`KX 8A0A(B BBBE \fKBB B(A0A8QXX`KX 8A0A(B BBBE \rKBB B(A0A8Q`XhK` 8A0A(B BBBE $E`\7KBB B(A0A8Qh[pKh 8A0A(B BBBE 4KBB A(A0<0Z (D BBBE TKEE L(D0A8t 0A(B BBBE LKBL A(D0k (A BBBE dKAK  HBE ] ABE U ABE OAB x 4JFU CE v CE  |JGBB A(A0 (A BBBE 8H@JHX0A (A BBBE [8A@UHKPT0$!0,JK U AE |KBB B(A0A8D 8A0A(B BBBE  8C0A(B BBBE $h4J\ E q E O E x ,ZFEIA,vJR E A E LKGE D(D0D 0A(A BBBE \KEL I(A0KxJAHxT 0A(A BBBE dGBE E(D0C8G@[ 8C0A(B BBBE FH`@RH_@$k@TGAE DHn  AABE uPFXB`EhFpExRHlGGB B(A0A8NFPA 8A0A(B BBBE &GGB B(D0A8J 8A0A(B BBBE FPAWFPBf@f,BJ\ E I E D9KAD F(s  EDBE r  AABE N  IABE i  AABE c  ADBE D  IABE D DAB4KKK  ABE Xx ITKEE B(A0C8Dh 8D0A(B BBBE TbKBE E(D0A8DXR 8D0A(B BBBE $-X<KCA D0c  AABE TKBB B(A0A8 0A(B BBBE 4rKDA ~ ABE TKBB E(A0A8 0A(B BBBE \KBJ D(H0 (C BBBE M (A BBBE 4dJAa AE lAx &DKBA A(D8H (A ABBE $8DKJD A(D8a (A ABBE $8<KDD D0K  AABE ,6JDbA4jJPl AE O AE \&KBE E(D0C8GH  8A0A(B BBBE $!H,JPX AE DKKC t ABE O ABE ! x ,`JF E AE <KCA D@M  AABE 4JCG(` AAE  DKDD D(D8i (A ABBE lKBI I(A0D8w 0A(B BBBE R 0C(B BBBE $&Jx Vd,JPx AE $J E $x <KBA A(t  ABBE LKBE E(D0D80A(B BBBdKEA D(  DBBE j  ABBE A ABB4vKNH F ABE TKBL B(A0A8DP8A0A(B BBB\KBB B(D0A8D`W 8A0A(B BBBE D` 8A0A(B BBBE x 5TKBE E(D0A8^ 0A(B BBBE LKBB D(D0D8a 0A(A BBBE tKBB E(A0I8DH 8A0A(B BBBE D8F0A(B BBBKEB B(A0A8D@ 8D0A(B BBBE ^ 8A0A(B BBBE D 8A0A(B BBBE ,^JPw AE TKBL B(A0A8D@8A0A(B BBBdevice_attribute___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersnvec_useddev_tFREEZE_HOLDER_USERSPACEmsi_capdup_xol_addrrevmapcapture_controlnr_wakeupsstartxen_pcibk_xenbus_registerstart_brkstatic_key_modd_ino_softlimitport_namexregs_statePCI_DEV_FLAGS_ACS_ENABLED_QUIRKdemand_offlineWRITE_LIFE_LONGuclamp_sex86_msi_addr_lo__resElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotpci_load_and_free_saved_statecoherent_dma_maskis_vallocpermissive_showparametersbridged_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsxenbus_transactionswap_deactivatefunctionalblkcnt_ticq_treesi_codeinit_dev_msi_infothread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributes__list_del_entryset_child_tid_overruntmpfilercu_read_lock_nestingem_perf_statetick_dep_masklistthrottle_disksi_errnoromlens_inode_lruatomic_setconf_byte_readsrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionalof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTdevfnregsslice_maxlast_switch_countpci_set_drvdataqsize_tmsi_desc_datafilesotherend_watchdevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagepublishmodule_sect_attrsreturn_instancearch_test_bitsoftirq_activatedpdevpci_power_tclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesdescseqcountdriver_remove_fileremove_busoom_score_adjoldbitd_seqia_vfsgidsize_tdevidacpi_device_idptm_enabledprepare_to_wait_eventcap_permittedTT_NATIVEaffinity_hintclass_irqsave_is_conditionalserver_pick_taskirq_handler_state_storepgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idx__compiletime_assert_39error_statercu_tasks_holdouttarget_listno_64bit_msipasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecneeds_fresets_remove_countDEV_PROP_U64syscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopu64_dataperf_eventf_securityi_sb_listpublish_pci_root_cbvm_rcupgtables_bytesget_linkirq_shutdownfmode_tcputime_atomicpci_channel_state_tdriver_attr_irq_handler_staterestoredelayed_callmsi_instance_cookiemax_nr_cid_statusd_sibkernel_ulong_tX86_IRQ_ALLOC_TYPE_DMARdma_opsioapic_alloc_infobin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedhdr_typedl_dev_statexen_pcibk_slot_resetgsindexexpires_nexti_io_listf_ep__compiletime_assert_51pci_restore_statesrcu_barrier_seqmsi_locklinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_txen_pcibk_lateeoidpc_rp_extensionsclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodepcistub_probefile_leasedev_propsscan_objectspid_typewb_errstatus_use_accessorscputimerpcistub_idsnew_slot_storebe_watchtrace_recursionhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disp__UNIQUE_ID_hidetype735rcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerpcistub_get_pci_devdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstats__compiletime_assert_775hugetlb_usage__dummyratelimit_states_pinsdriver_gpiosattrdmar_subhandle_validget_next_child_nodeFAULT_FLAG_WRITEirq_set_irqchip_statestate_in_sysfsIRQCHIP_STATE_LINE_LEVELvm_fault_ttty_structUTASK_SSTEP_TRAPPEDfind_special_pagebacktrace_entire_mapcountsoftware_nodeforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleFORTIFY_FUNC_memsetio_cqres_attr_wcelf64_symlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUS__param_str_hidep2pdmasyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_modbus_select_token_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredpcie_flags_regsum_block_runtimepgmapmin_perf_statestrnlendq_oprcu_tasks_nvcswrefcount_warn_saturatewritetypetabirq_release_resourcesclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_pools_addr_lsbi_generation_sigpollprocentmxcsrdevtX86_IRQ_ALLOC_TYPE_AMDVId_rt_spc_hardlimitpci_error_handlershotplug_notifynuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexmsi_parent_opsdriver_datathread_headdev_pm_qospcistub_device_findmap_typedsw_presentf_oppids_active_resetconfirm_switchseqcount_tacpi_device_software_node_portnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizecommon_processpcistub_device_idsconf_dword_writeptm_granularityid_tabledq_sbarch_static_branchptm_rootnr_pendingsighand_structpcistub_device_allocflagsi_lock_key__refcount_dec_and_testkmem_cacheinodedrivers_dirdev_prop_typebug_entry___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestedpm_devmsi_translatenr_forced_migrationsnum_argsri_timerstack_canarydestid_8_31blksizesiblingmnt_rootnext_scanf_rastr_to_quirkquota_writesrcu_barrier_cpu_cnttranslateiopl_warnrmdirpcie_link_statesockPCI_DEV_FLAGS_BRIDGE_XLATE_ROOThash_lenget_policy__list_add_validHRTIMER_RESTARTpci_dev_putexternal_facingirq_nmi_setupsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimeX86_IRQ_ALLOC_TYPE_IOAPICnumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchsemaphoreshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsptm_cap_sys_privatebus_unregister_notifierinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoftresource_order__sifieldsirqs_per_chiprcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authirq_bus_sync_unlockremote_epvirtual_dr6attachkprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxirq_hw_number_tstart_stackwatcherskmalloc_cachesdown_writeredirect_hintcompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantdriver_attr_permissiveacpi_device_flagsFREEZE_HOLDER_KERNELioapiccore_nodepri_capsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_datafinish_waitirq_flow_handler_txen_pcibk_config_free_dyn_fieldspasid_featuresfieldirqstatget_dquots_raw_spin_unlock_irqrestorenum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structbin_attrs_newhwirq_maxruntime_idleconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersxen_pcibk_config_quirks_add_fieldexp_hintd_childrendirty_foliodep_unmetis_softbindcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGsoftware_node_ref_argsnrpages_refcounti_crypt_inforaw_atomic_fetch_add_relaxedsaved_cap_spacelist_emptyerror_remove_folioxen_pcibk_deviceold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepXenbusStateConnectedenvp_idxXEN_PV_DOMAIN_head_1_head_2backstate_add_uevent_sentblock_cfg_accessi_hashresulthlist_nodesprintfio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumeirq_disablewake_qpdev_idfileattr_setkzalloc_noprofrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsDOMAIN_BUS_WAKEUPonlinepci_physfnruntime_resumedup_xol_workpermissivepcistub_device_find_lockedcan_maskpercpu_enabled___GFP_WRITE_BITPCI_DEV_FLAGS_NO_D3icookieMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligninitialize_devicesDOMAIN_BUS_NEXUSdelay_worktot_countoublockacpi_device_wakeup_flagsrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockcur_bus_speedgfp_tseccomp_filterstimedestid_0_7list_add_tailevent_channelsi_mmapirq_startupthaw_superd_lrusignal_structDOMAIN_BUS_VMD_MSIperf_event_mutexpri_enabledcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeis_msixki_completevtime_statewakee_flipsset_aclrom_attr_enabledpids_activedrivermsix_ctrlget_hwirqi_opskip_bus_pmldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorePCI_DEV_FLAG_PCIE_BRIDGE_ALIAScredjump_entrylist_lru_nodemsi_post_freesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatebe_watchingmaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodegpe_numberis_dirty_writebacktrace_bprintk_fmt_startdisablehuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracePCI_ERS_RESULT_NO_AER_DRIVERquota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysenable_intx__list_addsrcu_cb_mutexstatic_call_sitexen_pcibk_error_handlerfortify_funcMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswhandle_irqMODULE_STATE_GOINGDL_DEV_UNBINDINGbus_select_maskmulti_capthreadsym_timens_pageacpi_hp_notifysriov_configures_time_minbusn_resBUS_NOTIFY_BOUND_DRIVERs_devcpus_allowed_lockget_next_idrwlock_tpci_ers_resultpgprotfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utimebus_list_dummy_pkeymsi_alloc_info_tiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitconfig_fieldac_flagwrite_msi_msgsched_rt_mutexcoredump_datatasksdriver_attr_slots_pidaddress_spacemm_context_tis_probed__call_single_nodestartupPCI_DEV_FLAGS_NO_FLR_RESETpcistub_put_pci_devis_virtualseqcount_spinlock_ti_wbswnodesuint8_tpanelclass_idinactive_timer_pkeyfilenames_export_op__mptri_flctxstashedcond_suspend_depthvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqpagetrc_holdout_listlist_nodeget_inode_usagedevice_nodepcidevnormal_priodestroy_inoderelease_foliolast_busyi_pipebasehostuaddrnum_portsactive_lows_wb_errshm_clistis_child_subreaperunicode_mapXenbusStateInitWaitgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_name__SCT__might_reschedmmu_notifier_subscriptionswait_lockoffslast_siginfoirq_managedunusedalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidrseq_sighandledev_pm_domainlimit0limit1dqi_max_ino_limitquirks_listpcistub_device_id_addmigrate_modewakeup_preparedpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwlimit__real_strnlenkobjfsyncmtd_infoi_flagsBUS_NOTIFY_BIND_DRIVERsscanfkernel_siginfopost_ejectuprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITxenbus_devicereleasedthread_fndep_mapalloc_dquotpm_messageto_pci_sysdatamay_splitmem_cgrouplast_update_timeacpi_io_addressirq_suspendsystem_levelrobust_list_headisr_oncurrent_state__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofnotifier_presents_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_headpci_load_saved_states_encoding_flagsrunnable_weightincrparsedgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_beginaffinity_notifyvdso_test_bitmmap_legacy_basepipe_inode_infouint16_tsecurebitsstate_initializedbus_notifier_eventuring_cmd_iopollcompat_uptr_tuevent_opspref_windowslicesas_ss_spnr_dirtiednum_kprobe_blacklistxen_pcibk_config_init___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITquirkclass_local_lock_is_conditionalsuspend_latewakeupcg_listlink_bwctrlsrcu_barrier_completionsaved_config_space__compiletime_assert_58driver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapxenbus_printfacpi_device_perfpcistub_device_releasewaiterssubdevicesessionidinteger_sifields_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_infopadding1llistdebugfs_entryacs_capelemnr_retriesIRQCHIP_STATE_PENDINGsigval_talimitundo_listKMALLOC_RANDOM_STARTdelivery_modeirq_datamask_cache_dev_warnacpi_device_namemissedslots_showquota_readst_shndxfreedriver_attr_new_sloti_wb_frn_avg_timefile_ref_ttypemembarrier_stateIRQ_HANDLEDgpe_devicepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wqparam_ops_charp_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typewakeup_listmtimeserver_has_tasksvm_faultxen_pcibk_config_init_devoom_score_adj_minx86_msi_datakobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memhotplug_slotpathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqhardware_idDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerxen_pcibk_error_resumeunlinkpcistub_deviceperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncproc_dir_entrydevice_classvm_opsiopollpagesizes_blocksizevm_pgoffauprobe__retnuma_workupdate_timeptrace_dr7no_d1d2priority_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_runningDEV_PROP_REFpcistub_seizesubnodes__lstatebroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenparammodule_attributepollfdnr_wakeups_remote__pci_reset_function_lockedpci_busllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awarestate_use_accessorsclass_spinlock_irqsave_is_conditionalpcistub_exitrseq_csprimarynum_ftrace_callsitesxen_pvh_setup_gsisoftirq_expires_nextatomic_fetch_add_relaxedREFCOUNT_DEC_LEAKDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnon_compliant_bars_pincountxen_acpi_get_gsi_infotablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqltr_pathcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codeqspinlockep_props__kmalloc_large_noprofirq_compose_msi_msglru_genirq_set_wakeinsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasklink_frequenciessched_entityd_spc_hardlimitlong unsigned intacpi_handlesleep_maxmmap_baseio_context__condrevisiongpl_symsseq_showswait_queue_headpcistub_init_devicecow_pagenotify_onlineacpi_object_typepcistub_device_getblocki_spc_timelimitreturn_instancesDEV_PROP_U16class_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerpci_channel_io_normalinaccessiblequick_threadstime_sliceeval_valueobjcgunmapfull_namepci_device_idarch_clear_bitnoderesetacpi_bus_addressvm_lockpci_saved_stateno_cgroup_migrationnextevts_writers_key__countirq_cntxcomp_bvcma_areastatic_priomay_skip_resumexen_reset_deviceshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockarch_set_bitl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimereg_writelerrnumstate_remove_uevent_sentlegacy_memdmar_formatspurious_thresholdia_sizein_hrtirqs_master_keysarch_msi_msg_addr_hi_tconst_test_bitpolaritypropertywchar_addr_bndkernel_symbolsubsys_datapld_crctv_secis_64DEV_PROP_U32pid_ttask_listftrace_sleeptimerun_nodema_rootallow_interrupt_control_showuring_cmdX86_IRQ_ALLOC_TYPE_HPETnr_failed_migrations_affineproperty_entryxen_acpi_register_get_gsi_funcREFCOUNT_SUB_UAFstrcmpuser_cpus_ptrpi_top_taskaddress_lopresentslotpcistub_devices_lockactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writeutil_sumreserved_0st_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthacpi_device_wakeupphysical_node_count_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmoduleXenbusStateUnknownpcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flags__compiletime_assert_749l1sssriov_set_msix_vec_countkfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queueirq_descdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenscan_dependentcodegtimepci_store_saved_statesigactionwake_activedev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimexen_pcibk_backend__kernel_timespeclocked_pendingreset_preparepcistub_removenr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listis_msi_managedktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagIRQ_GC_MASK_CACHE_PER_TYPEi_uidxen_pcibk_config_free_devparent_dataspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mm__compiletime_assert_761__compiletime_assert_765irq_domain_chip_genericdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTsp_offsetdriver_attr_quirkssrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filereserved_1nr_scannedpcp_listpid_linksdev_locks_sysfs_namerefcountvaddrrequest__compiletime_assert_771rw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipirq_nameqc_dqblkmmappedseqcount_raw_spinlockpci_save_statebroken_intx_maskingirq_pm_shutdownkill_sbd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headacpi_gpio_mappingbytesxen_pcibk_config_quirkwait_start__arg1__arg2__arg3__arg4__arg5f_freeptrclass_raw_spinlock_irqsave_try_is_conditionalu8_datashow_fdinfobacklightfixupirq_gethashBUS_NOTIFY_DRIVER_NOT_BOUNDposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifiersDOMAIN_BUS_TI_SCI_INTA_MSIsrcu_last_gp_ends_fsnotify_infoDOMAIN_BUS_PCI_DEVICE_MSIXxen_pcie_aer_opmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocsubvendord_parentconf_word_writevmd_devacpi_devicetransparentpayloadac_minflti_sbport_propskmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflineis_levelatomic_write_segments_maxacpi_hp_fixupatomic_openstart_prevent_timepblk_lengthreadahead_controlsubordinate__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesselecthost_dataread_newsignalfd_wqhmmapmodnamereg_basedomain_free_irqsasync_put_workmknodpri_reqs_allocacpi_device_dirirq_gc_flagsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapdma_alias_maskwritepagessched_statisticsirq_alloc_infohead__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampsuper_operationssplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lock__refcount_addD_REAL_DATAshow_in_uixen_pcibk_xenbus_unregisterphysical_node_lockpt_regsenablepipe_bufsKOBJ_NS_TYPE_NETctx_idarch_msi_msg_addr_lo_td_rt_spc_warnsi_verity_infomsix_entriesirq_retriggerxsavetimespec_type__rb_parent_colordevres_lockdomidbitsPCI_DEV_FLAGS_MSI_INTX_DISABLE_BUGiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoats_capDD_CLASS_TYPE_LEVEL_NAMESFORTIFY_FUNC_memscandev_flagsvm_private_dataio_bitmapxen_pcibk_config_field_freeuprobe_task_statetimerkobj_typebroken_parity_statusdeactivatei_pageshlist_bl_headino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitirq_alloc_typedoe_mbspage_fragwrite_bytesiobasechardomainunix_inflightpci_set_dev_assignedxenbus_watchholders_dir__wq_entryfpu_state_permi_fsnotify_maskbio_vecxen_pcibk_initis_addedari_enabledgraph_get_port_parent__restorefn_tclass_raw_spinlock_irq_try_is_conditionaldriver_create_filethread_shstkacpi_device_perf_stated_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsDEV_PROP_U8d_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_tmask_posrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freebridge_d3__UNIQUE_ID_ddebug738parentirq_set_affinity__dummy2atimecopy_file_rangetask_cputime_atomicuser_definednodeptrskey_type__UNIQUE_ID_ddebug740get_named_child_nodelaunder_foliocurr_target__UNIQUE_ID_ddebug744number__UNIQUE_ID_ddebug748is_suspendedPCI_ERS_RESULT_DISCONNECThotplug__keyacpi_hotplug_contextburstraw_atomic_setetypeei_funcsmodule_kobjectactive_memcg__UNIQUE_ID_ddebug750__UNIQUE_ID_ddebug752__UNIQUE_ID_ddebug754__UNIQUE_ID_ddebug756def_flags__UNIQUE_ID_ddebug758PCI_DEV_FLAGS_HAS_MSI_MASKINGd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updateIRQCHIP_STATE_ACTIVEvendorpcistub_reset_device_statecap_bsetarchdata_sourcepower_statenr_perf_statesstack_vm_area__UNIQUE_ID_ddebug764kstat_irqs__UNIQUE_ID_ddebug766__UNIQUE_ID_ddebug768saved_statekernfs_elem_attrbasespcie_mpsss_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcounters__UNIQUE_ID_ddebug770__UNIQUE_ID_ddebug772kasan_check_readname_link__UNIQUE_ID_ddebug776__UNIQUE_ID_ddebug778chipcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typesriovdriver_attr_allow_interrupt_controlpolicysharedpercpu_dev_idwait_queue_entrydismissconf_field_reset__UNIQUE_ID_ddebug780quirks_show__UNIQUE_ID_ddebug782d_real_typelookahead_bandseq_startpcistub_get_gsi_from_sbdfnum_chipsraw_lockd_dnameget_dqblkmax_hang_timeirq_nmi_teardowncpus_maskDOMAIN_BUS_ANYsubdirstask_groupinitializedstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcecmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailslineno__dynamic_pr_debugbase_pfnxenbus_stateget_inode_acl_addr_pkeymigrate_foliocustom_sliceport_nraer_capthread_keyringkparam_arrayrefcount_setutimestart_codeset_bitis_managedis_harddest_mode_logicalfsbasecompatiblesubsystem_deviceclock_listattrsdynidscpumask_tbase_offsetswregs_statedqb_isoftlimitdma_iommuorig_axpriv_flagscompletesched_rt_entitymight_reschedtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettime64_tacpi_device_software_nodesi_blocksxen_pcibk_mmio_enablednuma_faults_localityhas_child_subreaperirq_chip_regsrom_bar_overlappref_64_windowi_aclwake_enabled___GFP_ZERO_BITwrite_newlist_lockpm_domaininstrument_atomic_read_writecpu_bitmapthreads_handled_laststatic_call_keyPCI_DEV_FLAGS_NO_PM_RESETutil_estucountsraw_atomic_fetch_sub_releaseqc_statevirt_destid_8_14handledsoftirq_next_timerkobject_namecheck_flagshandlerimm_readyswp_entry_tmsi_descirq_get_irqchip_state_mapcountdomain_tagpasid_requiredarch_atomic_sethang_detectedchild_ns_typexen_pcibk_config_quirk_releaseqf_fmt_idpcistub_reg_adds_vfs_rename_keyeventIRQCHIP_STATE_MASKEDup_writepower_resourceirq_maskset_performance_statephys_addr_tclass_preempt_is_conditionalcfg_sizeconsumers_cntmodule_memoryotherend_idpi_entrydriver_attributepme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacxen_pci_sharedinfonr_to_scanwake_depthfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delay__compiletime_assert_737dma_cleanup__compiletime_assert_739maple_treekref_putXenbusStateInitialisingKMALLOC_DMAdentrycpu_itimerhonor_depspercpusriov_get_vf_total_msixpci_domain_nrrel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlink__compiletime_assert_741__compiletime_assert_743__compiletime_assert_745__compiletime_assert_747pushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setfound_devdelayed_workhiwater_rsskretprobe_instancesPCI_ERS_RESULT_NONErange__compiletime_assert_751__compiletime_assert_753__compiletime_assert_755futex_exit_mutex__compiletime_assert_757__compiletime_assert_759acpi_device_perf_flagskernfs_iattrsPCI_ERS_RESULT_RECOVEREDtrc_blkd_nodePCI_ERS_RESULT_NEED_RESETIRQ_GC_NO_MASKack_intrd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addr__compiletime_assert_763d_rt_spacename__compiletime_assert_767__compiletime_assert_769u_flagswait_for_threadsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingbus_tokenDOMAIN_BUS_IPI__compiletime_assert_773is_physfni_gid__compiletime_assert_777needs_force_resume__compiletime_assert_779min_vruntimefaults_disabled_mappingquota_typepcistub_get_pci_dev_by_slotstate_savedi_rdevirq_reroute_variantself_exec_idDOMAIN_BUS_WIRED_TO_MSIkernfs_opsfile_lockHYPERVISOR_physdev_op__compiletime_assert_781__compiletime_assert_783MODULE_STATE_LIVEclass_masknr_migrationsa_opsxa_flagspercpu_affinityfreezebin_sizemap_busclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITX86_IRQ_ALLOC_TYPE_PCI_MSIX__compiletime_assert_4irq_affinity_descd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNirq_baseset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32d_rculock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkis_virtfnpercpu_refhorizontal_positionpcistub_init_devices_latepref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAxen_pcibk_reset_deviceget_nextdqblks_fs_infoallow_interrupt_controlfutexpower_manageablewait_maxDEV_DMA_NON_COHERENTpcistub_device_id_removeresult_maskphysical_node_liststate_syncedpp_magicagaindquot_operationsmappingRPM_INVALIDgrploREFCOUNT_ADD_UAFclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightcommonvm_file___GFP_COMP_BITs_statesbdfuser_sizedev_pm_opsxsd_errorsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkkmalloc_typeqstrma_flagsno_msifutex_stateorig_pmdshpc_managedacct_timexpd__rcu_icq_cacheacpi_objectsizeem_perf_tablewakeup_sourcef_posirq_print_chipnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalen__UNIQUE_ID_description786nr_wakeups_affine_attemptsalt_lenu32_datacinblockextableexitkernel_param_opsbus_dma_regiondpc_capio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headlist_is_headconf_dword_readrcharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_t__UNIQUE_ID_ddebug736pci_namepci_devs_to_hidedevice_driverdl_server_has_tasks_flane_polaritiesrunnable_sumreal_credget_namefwnode_endpoint__intepoll_watchesprealloc_ptebus_iddqb_curspace_entrygp_statebitsetload_avgaccesscstimepcie_capcore_internal_state__do_not_mess_with_itcfg_entrycfs_rqslot_list_uidmsi_indexst_spacemm_cid_next_scanns_type__UNIQUE_ID_ddebug742msix_enabledxen_pci_opwill_handleac_majfltpasid_enabledpci_dev_getposix_cputimers_work_upperforce_resume_depthacpi_pnp_typemodule_param_attrsshort unsigned intbus_flagsno_suspend_depthi_mutex_dir_keyq_nodespc_warnlimitvalidfound_psdevs_encodinggpl_crcsorc_entrykeysorig_ptepasid_capdqb_curinodesxen_pcibk_pci_driverload__s8pci_get_drvdatainvalidate_lock_keydma_maskprealloc_mutexPCI_DEV_FLAGS_ASSIGNEDnanosleepDOMAIN_BUS_FSL_MC_MSIFORTIFY_FUNC_kmemdupu16_datadq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__UNIQUE_ID_ddebug760__u8__UNIQUE_ID_ddebug762is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionseq_stoppower_resourcespci_dev_flags_tdev_iddomain_alloc_irqskiocbclass_rwsem_read_intr_is_conditionalprobefsuidaer_statss_blocksize_bitsnuma_scan_period__UNIQUE_ID_ddebug774migration_disablediter_typeschedule_timeoutclass_device_is_conditionalshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storagepci_enable_deviceIRQ_GC_INIT_MASK_CACHEirq_flags_to_cleararch_msi_msg_data_tno_callbacks__u16timers_activewait_countsig_okhwirqdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedxen_pcibk_release_pci_devraw_spinlock_tkey_tagsysdatafs_flagsworkpgprotval_tkeytypesigpendingfsindexshstknotify_remote_via_irqnum_ctsrcu_sspwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEproc_idactive_timei_sequencepci_vpddqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendori_dir_seqirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookielist_delsrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmauclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeirq_resumedpc_rp_log_sizepci_channel_io_perm_failurenotifier_fn_tf_iocb_flagspcistub_device_id_add_listpoweroffcmaj_fltaer_opvtimeejectablemath_emu_infoxen_pcibk_cleanupiowait_sumf_pathinrush_current__u64journal_infooverride_onlyFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_trueweighti_privatemaxrssxen_pcibk_error_detectedflushruntime_suspendi_blkbitsvaluepcistub_match_onegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimepermissive_storerequired_flagsdeadlinedevice_lock_assertpinned_vmacpi_hp_uevent_head_2apsi_flagsaddressstart_boottimevm_startsrcu_gp_seq_neededIRQ_GC_BE_IOs_flagscpumask_var_tfaultmsi_domain_infoirq_mask_ackkref_initshow_statsdl_densityfreeptr_tread_dqblkpci_bus_typedq_flags__UNIQUE_ID___addressable_init_module784chip_dataatomic_fetch_sub_releaseDD_CLASS_TYPE_DISJOINT_NAMESpci_devp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_gran__refcount_inckernel_cap_tnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpdevicetypei_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionxen_start_flagsserialclass_releasealloc_locks_dquotfolioqPCI_ERS_RESULT_CAN_RECOVERprev_posseqcount_spinlockexpire_countscnprintfs_umountis_bin_visiblepgoffpending_masksyscall_user_dispatchrcu_tasks_exit_listacpi_hotplug_profileset_descarchdataia_uid__list_del_entry_valid_or_reportchildrenconfig_releaserb_subtree_lastno_pm_callbacksbuild_id__p_lendevice_get_match_datavfork_done___GFP_ACCOUNT_BITevtchn_irqpud_tacpi_bus_idrt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typemsi_enabledpointerseeksxen_pvhtask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerfindquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memarch_spinlock_ti_mtime_nsecperformanceDOMAIN_BUS_PCI_DEVICE_MSImmlist__compiletime_assert_2__compiletime_assert_3devcapsuppress_bind_attrsRPM_RESUMINGreg_offsetpublish_pci_dev_cbgsbases_quota_typesirqchip_irq_statef_llistIRQ_NONEphandleseized_devicesi_nlinkbranchwrite_begingroupserr_handlerno_vf_scanpi_blocked_onDOMAIN_BUS_DEVICE_MSIcompanions_xattrclass_local_lock_irqsave_is_conditionalon_dispatchPCI_DEV_FLAGS_NO_RELAXED_ORDERINGclass_local_lock_irq_is_conditionalsyscrunbindpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tpci_sysdatashareFORTIFY_FUNC_strscpyxen_pcibk_config_reset_devpagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superinstalleds_inode_list_lockinstance_nopower_removedsweventfreeze_holderdriver_overridexen_domain_type__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tplatform_idclock_basecdevmy_qBUS_NOTIFY_REMOVED_DEVICEgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timeracpi_device_dataclass_write_lock_is_conditionalXEN_HVM_DOMAINbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datairq_handlers_showmmap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structpci_msi_descon_rqPCI_DEV_FLAGS_VPD_REF_F0fs_contextprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfignore_parentunsafe_warnllseekfoundexplicit_getDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitXenbusStateClosedwritable_sizercu_nodeinit_nameunfreeze_fsintervalclassaddress_hilast_mm_ciduntrustedxen_pcibk_get_pcifront_devcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuportsDEV_PROP_STRINGilenmnt_flagscred_guard_mutexpci_opssigcnt__UNIQUE_ID_license787hrtimer_cpu_baseresourcescb_headcheck_quota_fileFORTIFY_FUNC_memchrdata_lanesattributerestrict_linkdev_archdatai_deviceskey_perm_tkill_domain_by_devicepi_state_cacheclass_disable_irq_is_conditionalconf_field_freeanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knchip_typessival_ptri_opflagsrobust_listconf_field_initsym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapmsi_attribacpi_device_pnpfiltercurr_ret_stackirqreturn_t__compiletime_assert_451dockdev_links_infoirq_bus_lockloff_tthread_pidsrcu_gp_seq__UNIQUE_ID_ddebug746no_command_memoryprepare_desc_archipi_send_singlest_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlencleanclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnoirq_calc_maskuintptr_tbatchasync_sizeacct_vm_mem1i_mtime_secDOMAIN_BUS_PLATFORM_MSIsh_infomatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETxen_pcibk_aer_wait_queuepadding__init_waitqueue_head__fillersaved_sigmaskd_timeentriescpu_idmsi_freefop_flags_tirq_fwspecFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_lockinit_wait_entrysched_delayedmsi_initacpi_device_classmodule_state_dev_infolast_used_atirq_chip_typevm_endlast_queuednuma_migrate_retryuser_nsirq_ack__statefirstiommu_groupmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctime__fortify_strlenDOMAIN_BUS_WIREDFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexi_private_datapci_stub_notifierElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupxol_areadev_datairq_request_resourcesirq_chip_genericrlockremove_slot_storefl_owner_t_rescls_mskeuidwaitbug_tableis_inlinedirtied_time_whensequential_io_avgcallbacknum_trace_bprintk_fmtgc_flagsvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayirq_flags_to_setRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpdev_set_drvdatareg_readlctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenreclaim_sempme_supportdqb_btime_nr_pages_mappedutf8datarevmap_treemm_usersfind_vfss_ids_dentry_lrubp_offsetmask_basefolio_queuelast_task_numa_placementpgtable_tblock_startdriver_attr_remove_slotcgtimenodenamesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionalrefcount_saturation_typeki_waitqBUS_NOTIFY_UNBIND_DRIVERtrace_eval_mapdoneacpi_device_powerpcistub_devicesfscrypt_operationsdmar_index_0_14release_workparent_irqksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexpci_stub_nbratelimitfree_foliodriver_managed_dmaMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotarefcount_incDOMAIN_BUS_DMAR__builtin_strlendl_timeri_dataDL_DEV_NO_DRIVERpropertiesparse_errorFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intXenbusStateClosingnuma_preferred_nidinstrument_atomic_write_hugetlb_cgroupis_dock_stationdentry_operationsmemcg_nr_pages_over_highd1_supportarch_uprobepcistub_device_idmsi_mask_Boolsleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatestrleni_link__outlistxattr_lowertrap_nrasync_probe_requestedX86_IRQ_ALLOC_TYPE_PCI_MSI__list_add_valid_or_reportcompat_long_trefcount_dec_and_testactive_countspurious_eventss_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagssupported_flagstotal_numa_faultss_countdev_msi_infod_revalidateerrstringbus_groupsirq_chippmd_tsleep_states_opxen_unregister_device_domain_ownersysv_shminstrument_atomic_readnodesdq_countutf8data_tableset_latency_tolerancedev_get_drvdata__func__resource_size_tfoliowake_entryBUS_NOTIFY_DEL_DEVICExa_headdevice_ids_locksuidof_compatibleirq_domain_opsi_readcountxen_find_device_domain_ownerirq_write_msi_msglocked_vmthreads_oneshotrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tprepare_countclass_rcu_is_conditionalIRQ_GC_INIT_NESTED_LOCKbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countarch_addr_hiksm_merging_pagesotherendautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriesrequest_mutexs_qcopatomic_talloc_tag_counters_flagspci_channel_io_frozennotify_nextmax_perf_statebus_dma_limitbuffershort intmynodeof_device_iddev_listXenbusStateInitialisedbridge_ctldownclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirVTIME_USERsa_flagstest__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalsupported_speedsmapcountem_pdtrace_event_callxenbus_transaction_startis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOthreads_activecurrent_may_mountarch_addr_loseqlock_tnuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozencrs_csi2_localmlock_countin_lru_faultgrpmasklatency__ret_warn_onregfuncpcistub_semstate_for_enumerationindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockmsi_msg___GFP_MOVABLE_BITpcie_bwctrl_dataactivexlatexen_pcibk_quirksdqb_itimeWRITE_LIFE_MEDIUMop_worksrcu_idxpidsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_start__flagsfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidarch_test_and_clear_bitprocessorattribute_groupcontextposix_timersdriver_exclusive_resourceselectorMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasedefault_timer_slack_nskcsan_check_accessirq_set_typesource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BITgroup_infovdso_imagefileof_match_tablepercpu_count_ptr__user_state_sizewarned_on_writedmar_subhandle__param_hidepcie_cap_lockmce_kill_meuuid_tproperty_read_int_arraynr_actions___GFP_UNUSED_BITconf_word_readcount_objectserror_stimezone_device_dataf_wb_errhandler_namephysfndefparamstatesenumeration_by_parentlast_unhandledfred_cscca_seenfault_flagresend_nodekprojid_tptracer_credtlb_genstorepage_mkwritekobjectaudit_ttyvariable_test_bitmce_ripvstatfs_dev_errenable_countats_enablednumab_stateremovablefeatureson_listphysdev_pci_devicekgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisteetlp_prefix_pathclass_groups__refcount_sub_and_testnuma_nodePCI_DEV_FLAGS_NO_BUS_RESETpcistub_device_puti_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNpcistub_initwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listrevmap_sizeaudit_contextpp_ref_countsysfs_opserror_detectedsequential_ioipi_send_maskis_busmaster_large_mapcountsda_is_staticpcistub_matchformatftopenclavemask_cache_privdefault_irqcreatewrite_msi_msg_dataiattrirq_domain_bus_tokenrseqnfdssigvalvma_lockperf_event_listconfig_fieldsget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadirqactiond_realBUS_NOTIFY_ADD_DEVICElink_stateexpiry_activeoldp__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_44__compiletime_assert_45__compiletime_assert_46__compiletime_assert_47__compiletime_assert_48__compiletime_assert_49dqi_max_spc_limiteval_stringexception_table_entryevent_countparam_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimitconf_byte_write__compiletime_assert_50DOMAIN_BUS_AMDVI__compiletime_assert_52__compiletime_assert_53__compiletime_assert_54__compiletime_assert_55__compiletime_assert_56__compiletime_assert_57i_mmap_writablemems_allowedacpi_device_wakeup_contexttlb_flush_batched_ddebug_infois_noirq_suspendedactual_typetracepoints_ptrsleaderconfig_field_entrytimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tDOMAIN_BUS_PCI_MSIblocksirq_affinity_notifyset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_listaffinityXenbusStateReconfiguringdevice_dma_supportedd_ino_warnsXEN_NATIVEbattery_presenthiwater_vmpackagexen_msix_entrytracepointcompound_headia_vfsuidirq_eoi__kernel_ssize_torig_ret_vaddrpoweroff_noirqunique_idrenamevm_area_structrpm_statussb_writersthread_maskino_timelimitpci_bus_flags_tsplice_writemsix_capi_rt_spc_timelimit_raw_spin_lock_irqsavesysfs_attrs__list_del_entry_validrom_base_regconstant_test_bitqf_nextio_window_1krangesppdeviommu_mmirq_enableats_stucutimeem_tablepersonalityget_statepci_unregister_drivertask_sizes_inodes_addrbinfmtacpi_scan_handlerirq_domainsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataarch_atomic_fetch_addsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITsyncsetleasepinspacct_structmust_resumecoherent_dmatriggerlong intfile_lock_contextusageuv_alloc_infol_yessiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ss__dynamic_dev_dbgproperty_presentmsi_domain_ops__kmalloc_indexacpi_device_power_stateUSRQUOTAprintk_index_sizesymtabpblk_addressstate_countrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncthreads_handledegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagsxdevcodetagPROBE_PREFER_ASYNCHRONOUSis_thunderboltmark_dirtythread_flagsnum_srcu_structsbdi_writebackpci_clear_dev_assignedpci_dev_datakobj_completion__kernel_clockid_tseccompiteratorBUS_NOTIFY_UNBOUND_DRIVERqc_infodev_nameTT_NONEVTIME_INACTIVEirq_common_dataf_inodevisitedcancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddynamic_statusmultifunctiondepthsnprintfwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldmultipleDOMAIN_BUS_GENERIC_MSIssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobe__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_struct__UNIQUE_ID___addressable_cleanup_module785xen_pcibk_dev_datadevice_nameeoi_flagpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqpci_dev_idclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argsirq_unmasksrcu_reader_flavorirq_safetv_nseci_lruiommu_cookied3cold_allowedFORTIFY_FUNC_strcpygfp_maskpi_state_listdel_listrcu_segcblistsubvolbase_addressbus_register_notifierspin_unlock_irqrestorefree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idpcistub_device_get_pci_devdev_pin_infojiffies_eoi_delayeddmar_reserved_0srcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTREFCOUNT_ADD_NOT_ZERO_OVFbucket_idrb_leftmostthread_infop_lensuspended_timedatastrtabtty_old_pgrp__UNIQUE_ID_alias788dl_throttledirqs_unhandledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextget_gsi_from_sbdf_tdmar_base_addressmsi_prepareopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_eventsclear_bitiommuprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxtph_enabledsplice_pipebladeeffective_affinitypasid_no_tlpspinlock_checks_lock_keyreset_done__pci_register_driversrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTdriver_attr_irq_handlersKMALLOC_RANDOM_ENDmodsslotsdevice_release_drivertqheadpsdevmsi_domain_cookies_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copXenbusStateReconfigureddd_key_truedcookiehres_activebpf_raw_eventsdq_dirtydl_deferbug_listdirect_completexa_locklist_addfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateis_late_suspendedaer_cmdsysvsemadd_busof_compatible_okignore_childrenresourcerestore_earlyreferenceclock_mutexfs_superskref_getquirks_storenotifydqb_bsoftlimitpendingf_task_work___GFP_NORETRY_BITiowait_countmatch_drivertest_and_clear_bitexplicit_setnotifier_blockpci_dev_flagsallow_interrupt_control_storedma_io_tlb_memstringread_countstr_to_slotxen_irq_lateeoifutex_offsetlong long inthwsizemmio_always_onx86_msi_addr_hiatomic_flagssysvshmbus_addresstimer_expiresirq_set_vcpu_affinitytrace_evalsactive_basesacpi_device_power_flagsearly_initrcec_eamprotectsecurityxmm_spaceactivatemsix_basef_pos_lockacpi_device_statusi_fieldmaskREFCOUNT_ADD_OVFtls_arrayowneracct_rss_mem1need_mbX86_IRQ_ALLOC_TYPE_UVvm_flags_trefcount_struct___GFP_FS_BITxenbus_transaction_enddmar_index_15i_bytesdomain_datarelax_countdevice_attribute___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersnvec_useddev_tFREEZE_HOLDER_USERSPACEmsi_capdup_xol_addrrevmapcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sex86_msi_addr_lopkruElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersbridged_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codeinit_dev_msi_infothread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributesset_child_tid_overrunrestrict_linksystem_wqtmpfilercu_read_lock_nestingem_perf_statetick_dep_maskatomic_readlistthrottle_disksi_errnoromlens_inode_lrusrcu_size_stateblk_plugof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTdevfnregsslice_maxlast_switch_countqsize_tmsi_desc_datafilesotherend_watchdevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagepublishmodule_sect_attrsreturn_instancearch_test_bitsoftirq_activatedpdevpci_power_tclass_preempt_notrace_is_conditionalret_stacknode_idautosuspend_delayunsigned intgendiskspc_timelimits_instancesdescseqcountremove_busoom_score_adjoldbitd_seqia_vfsgidsize_tdevidacpi_device_idptm_enabledcap_permittedTT_NATIVEaffinity_hintclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxerror_statercu_tasks_holdouttarget_listno_64bit_msipasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecneeds_fresets_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listpublish_pci_root_cbvm_rcupgtables_bytesget_linkirq_shutdownfmode_tdevtmsi_parent_opspci_channel_state_trestoredelayed_callmsi_instance_cookiemax_nr_cid_statusd_sibkernel_ulong_tX86_IRQ_ALLOC_TYPE_DMARdma_opsioapic_alloc_infobin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedhdr_typedl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqmsi_locklinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_txen_pcibk_lateeoidpc_rp_extensionsclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errstatus_use_accessorscputimerbe_watchtrace_recursionhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrdmar_subhandle_validget_next_child_nodeFAULT_FLAG_WRITEirq_set_irqchip_statevm_fault_ttty_structUTASK_SSTEP_TRAPPEDfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleio_cqres_attr_wcelf64_symlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSp2pdmasyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_modbus_select_token_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredpcie_flags_regsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditionaldma_pools_addr_lsbi_generation_sigpollprocentmxcsrX86_IRQ_ALLOC_TYPE_AMDVId_rt_spc_hardlimitpci_error_handlersnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexirq_affinity_descdriver_datathread_headdev_pm_qosmap_typef_oppids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizeptm_granularityid_tabledq_sbarch_static_branchptm_rootnr_pendingsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entry___GFP_NOWARN_BITcmin_fltrw_semDEV_DMA_COHERENTprev_sum_exec_runtimenestedpm_devmsi_translatenr_forced_migrationsnum_argsri_timerstack_canarydestid_8_31blksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cnttranslateiopl_warnrmdirpcie_link_statesockhash_lenget_policyHRTIMER_RESTARTexternal_facingirq_nmi_setupsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodexen_pcibk_config_readcpu_basedevice_is_availabledquotdl_runtimenumbersqstr_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchsemaphoreshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsptm_cap_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsirqs_per_chiprcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authirq_bus_sync_unlockvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxirq_hw_number_tstart_stackwatcherskmalloc_cachesredirect_hintcompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELioapiccore_nodepri_capsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_datairq_flow_handler_tpasid_featuresirqstatget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printkvm_operations_structbin_attrs_newhwirq_maxruntime_idleconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocessxen_pcibk_handle_eventpi_waitersexp_hintd_childrenIRQCHIP_STATE_LINE_LEVELis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infosaved_cap_spaceerror_remove_folioxen_pcibk_deviceold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepXenbusStateConnectedenvp_idx_head_1_head_2backstate_add_uevent_sentblock_cfg_accessi_hashresulthlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumeirq_disablewake_qfileattr_setrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsDOMAIN_BUS_WAKEUPqueue_work_ononlinepci_physfnruntime_resumedup_xol_workpermissivecan_maskpercpu_enabled___GFP_WRITE_BITicookieMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignDOMAIN_BUS_NEXUSdelay_worktot_countoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockcur_bus_speedgfp_tseccomp_filterstimedestid_0_7event_channelsi_mmapirq_startupthaw_superd_lrusignal_structDOMAIN_BUS_VMD_MSIperf_event_mutexpri_enabledcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeis_msixki_completevtime_statewakee_flipsset_aclrom_attr_enabledpids_activedrivermsix_ctrlget_hwirqi_opskip_bus_pmldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorepci_disable_msicredjump_entrylist_lru_nodemsi_post_freesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatebe_watchingmaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startdisablehuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptraceatomic_write_segments_maxquota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysenable_intxsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswhandle_irqMODULE_STATE_GOINGDL_DEV_UNBINDINGbus_select_maskmulti_capthreadsriov_configures_time_minbusn_ress_devcpus_allowed_lockget_next_idrwlock_tpgprotfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDpriv_flagscurr_ret_depthac_utimebus_list_dummy_pkeymsi_alloc_info_tiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagwrite_msi_msgcoredump_datatasks_pidaddress_spacemm_context_tis_probed__call_single_nodestartupirq_mask_ackis_virtualseqcount_spinlock_ti_wbpci_disable_msixpanelclass_idinactive_timer_pkeyfilenames_export_op__mptri_flctxstashedcond_suspend_depthvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_folioxen_pcibk_config_writelast_busyi_pipebasehostuaddractive_lows_wb_errshm_clistis_child_subreaperunicode_mapXenbusStateInitWaitgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoirq_managedunusedalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidi_rt_spc_timelimitrseq_sigdev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modewakeup_preparedpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwlimitkobjfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITxenbus_devicereleasedthread_fndep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timeirq_suspendrobust_list_headisr_oncurrent_state__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrqf_ownergraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_beginaffinity_notifyvdso_test_bitmmap_legacy_basepipe_inode_infouint16_tsecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsrequest_irqpref_windowslicesas_ss_spnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listlink_bwctrlsrcu_barrier_completionsaved_config_spacedriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssubdevicesessionidarch_atomic_read_sifields_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_infopadding1llistdebugfs_entryacs_capelemnr_retriesIRQCHIP_STATE_PENDINGsigval_talimitundo_listKMALLOC_RANDOM_STARTdelivery_modeirq_datamask_cache_dev_warnmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultrequest_threaded_irqoom_score_adj_minx86_msi_datakobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memhotplug_slotpathst_sizermtpf_llistwait_sumnum_tracepointsupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handleriommu_groupperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockis_preparedproc_dir_entryvm_opsiopollpagesizes_blocksizevm_pgoffauprobenuma_workdevice_dma_supportedptrace_dr7no_d1d2_call_addrWORK_BUSY_RUNNINGloginuidcheckexpiryoptimistic_spin_queuedl_defer_runningxen_pcibk_disable_msix__lstatebroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidunlocked_ioctlrseq_lenparamwake_depthpollfdnr_wakeups_remotepci_busllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awarestate_use_accessorsclass_spinlock_irqsave_is_conditionalrseq_csprimarynum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnon_compliant_bars_pincounttablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqltr_pathcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codeqspinlock__kmalloc_large_noprofirq_compose_msi_msglru_genirq_set_wakeinsnfilldir_t__must_check_overflowdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextrevisiongpl_symsseq_showswait_queue_headcow_pageblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgfull_namepci_device_idarch_clear_bitnoderesetvm_lockpci_saved_stateno_cgroup_migrationnextevts_writers_key__countirq_cntxcomp_bvxen_pcibk_guest_interruptcma_areastatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimereg_writelerrnumstate_remove_uevent_sentlegacy_memdmar_formatspurious_thresholdia_sizein_hrtirqs_master_keysarch_msi_msg_addr_hi_tconst_test_bitpropertywchar_addr_bndkernel_symbolsubsys_datatv_secis_64pid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdX86_IRQ_ALLOC_TYPE_HPETnr_failed_migrations_affineuser_cpus_ptrpi_top_taskWORK_NR_COLORSaddress_lounlinkslotactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writeutil_sumreserved_0st_otheri_mutex_keyksethrtimer_clock_basevruntime__compiletime_assert_738disable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmoduleXenbusStateUnknownpcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsl1sssriov_set_msix_vec_countkfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queueirq_descdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagexen_pcibk_test_op_pendingcodegtimesigactionwake_activedev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimexen_pcibk_backendsched_rt_mutexlocked_pendingreset_preparenr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listunmapktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagIRQ_GC_MASK_CACHE_PER_TYPEi_uid__wake_upparent_dataspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmirq_domain_chip_genericdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filereserved_1nr_scannedpcp_listpid_linksdev_locks_sysfs_namerefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipirq_nameqc_dqblkmmappedseqcount_raw_spinlockbroken_intx_maskingirq_pm_shutdownkill_sbd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingargv__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalget_dqblkshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqrcu_syncpreempt_notifiersDOMAIN_BUS_TI_SCI_INTA_MSIsrcu_last_gp_ends_fsnotify_infoDOMAIN_BUS_PCI_DEVICE_MSIXxen_pcie_aer_opmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocsubvendord_parenttransparentxen_pcibk_enable_msixpayloadac_minflti_sbkmalloc_noprofmatchcommcan_matchlast_timePIDTYPE_PIDeventsthreads_handled_lastis_levelthreads_oneshotatomic_openstart_prevent_timereadahead_controlsubordinate__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesselecthost_dataread_newsignalfd_wqhmmapmodnamereg_basedomain_free_irqsasync_put_workmknodpri_reqs_allocirq_gc_flagsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapdma_alias_maskwritepagessched_statisticsirq_alloc_infohead__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controlxen_pcibk_control_isruclampsuper_operations__compiletime_assert_328pci_enable_msix_rangesplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATApt_regsenablepipe_bufsKOBJ_NS_TYPE_NETctx_idarch_msi_msg_addr_lo_td_rt_spc_warnspci_write_config_wordi_verity_infomsix_entriesirq_retriggerxsavetimespec_type__rb_parent_colordevres_lockmodule_attributebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoats_capDD_CLASS_TYPE_LEVEL_NAMESdev_flagsvm_private_dataio_bitmapuprobe_task_statetimerkobj_typebroken_parity_statusdeactivatei_pageshlist_bl_headino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitirq_alloc_typedoe_mbspage_fragwrite_bytesiobasechardomainunix_inflightxenbus_watchholders_dirfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledgraph_get_port_parent__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrxen_pcibk_do_opfreeze_fsuserfaultfd_ctxsigset_tmask_posrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freebridge_d3__UNIQUE_ID_ddebug737__UNIQUE_ID_ddebug739parentirq_set_affinityatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeget_named_child_nodelaunder_foliocurr_target__UNIQUE_ID_ddebug745number__UNIQUE_ID_ddebug747is_suspendedX86_IRQ_ALLOC_TYPE_IOAPIChotplugburstpci_enable_msietypeei_funcsmodule_kobjectactive_memcgdef_flagsd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updateIRQCHIP_STATE_ACTIVEvendorcap_bsetarchdata_sourcepower_statenr_perf_statesstack_vm_areakstat_irqssaved_statekernfs_elem_attrbasespcie_mpsss_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcounterskasan_check_readname_linkchipcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typesriovpolicysharedpercpu_dev_iddismissd_real_typelookahead_bandseq_startnum_chipsraw_lockd_dnameclass_rcu_tasks_trace_is_conditionalmax_hang_timeirq_nmi_teardowncpus_maskDOMAIN_BUS_ANYsubdirstask_groupstarttimei_fieldmaskmmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcecmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailslinenobase_pfnxenbus_stateget_inode_acl_addr_pkeymigrate_foliocustom_sliceaer_capthread_keyringkparam_arrayutimestart_codeis_managedis_harddest_mode_logicalfsbasecompatiblesubsystem_deviceclock_listattrsdynidsxen_pirq_from_irqcpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axbladecompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldtest_and_set_bitreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettest_intxtime64_ti_blocksnuma_faults_localityhas_child_subreaperirq_chip_regsrom_bar_overlappref_64_windowi_aclwake_enabled___GFP_ZERO_BITwrite_newlist_lockpm_domaininstrument_atomic_read_writecpu_bitmapstatic_call_keyutil_estucountsqc_statevirt_destid_8_14handledsoftirq_next_timercheck_flagshandlerswp_entry_tmsi_descirq_get_irqchip_state_mapcountdomain_tagpasid_requiredhang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventIRQCHIP_STATE_MASKEDirq_maskset_performance_statephys_addr_tclass_preempt_is_conditionalcfg_sizeconsumers_cntmodule_memoryotherend_idpi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacxen_pci_sharedinfonr_to_scanfs_parameter_specmsix_entrydesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delay__compiletime_assert_736dma_cleanupmaple_treeXenbusStateInitialisingKMALLOC_DMAdentrycpu_itimerpercpusriov_get_vf_total_msixrel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlink__compiletime_assert_740__compiletime_assert_742__compiletime_assert_744__compiletime_assert_746__compiletime_assert_748pushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancesxen_pcibk_enable_msirangefutex_exit_mutexkernfs_iattrstrc_blkd_nodeIRQ_GC_NO_MASKack_intrd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagswait_for_threadsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingbus_tokenis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typestate_savedi_rdevirq_reroute_variantself_exec_idDOMAIN_BUS_WIRED_TO_MSIkernfs_opsWORK_CPU_UNBOUNDMODULE_STATE_LIVEclass_masknr_migrationsa_opsxa_flagspercpu_affinityfreezebin_sizemap_busclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITX86_IRQ_ALLOC_TYPE_PCI_MSIXd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITirq_baseset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbarch_test_and_set_bitsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkis_virtfnpercpu_refhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAxen_pcibk_reset_deviceget_nextdqblks_fs_infoallow_interrupt_controlfutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingofflineRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightcommonvm_files_stateuser_sizedev_pm_opsxsd_errorsscheduledFAULT_FLAG_TRIEDraw_atomic_readclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkkmalloc_typema_flagsno_msifutex_stateorig_pmdshpc_managedacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posirq_print_chipnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsbus_dma_regiondpc_capio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headschedule_workrcharfutex_pi_statekstat__kernel_uid32_tis_msi_managedDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointwq_misc_constsepoll_watchesprealloc_ptedqb_curspace_entrygp_statebitsetload_avgaccesscstimepcie_capcore_internal_state__do_not_mess_with_itcfs_rq_uidmsi_indexst_spacemm_cid_next_scanns_type__UNIQUE_ID_ddebug743msix_enabledxen_pci_opwill_handleac_majfltpasid_enabledposix_cputimers_work_upperforce_resume_depthmodule_param_attrsshort unsigned intbus_flagsno_suspend_depthi_mutex_dir_keyq_nodespc_warnlimitvalids_encodingqueue_workgpl_crcsorc_entrykeysorig_ptepasid_capdqb_curinodesload__s8pci_get_drvdatainvalidate_lock_keydma_maskprealloc_mutexnanosleepDOMAIN_BUS_FSL_MC_MSIsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlockrlim_maxDOMAIN_BUS_AMDVIruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionseq_stoppci_dev_flags_tdev_iddomain_alloc_irqskiocbclass_rwsem_read_intr_is_conditionalprobefsuidaer_statss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalsrcu_supshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageIRQ_GC_INIT_MASK_CACHEirq_flags_to_cleararch_msi_msg_data_tno_callbacks__u16timers_activewait_countsig_okhwirqdelaysirq_safereadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagsysdatafs_flagsworkpgprotval_tkeytypesigpendingfsindexshstknotify_remote_via_irqnum_ctsrcu_sspwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialpci_disable_deviceHPROBE_GONEactive_timei_sequencepci_vpdpci_read_config_worddqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendori_dir_seqirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookied_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmauclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typeirq_resumedpc_rp_log_sizeimm_readyf_iocb_flagspoweroffcmaj_fltaer_opvtimemath_emu_infoiowait_sumf_path__u64journal_infooverride_onlysched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimerequired_flagsdeadlinepinned_vm_head_2apsi_flagsaddressstart_boottimevm_startIRQ_GC_BE_IOs_flagspci_enable_msix_exactcpumask_var_tfaultmsi_domain_infoshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESpci_devmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpdevicetypei_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionxen_pcibk_get_pci_devserialclass_releasealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffpending_masksyscall_user_dispatchrcu_tasks_exit_listset_descarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_done___GFP_ACCOUNT_BITevtchn_irqpud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typemsi_enabledseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerfindquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memarch_spinlock_ti_mtime_nsecperformanceDOMAIN_BUS_PCI_DEVICE_MSImmlistdevcapsuppress_bind_attrsRPM_RESUMINGreg_offsetpublish_pci_dev_cbgsbases_quota_typesirqchip_irq_stateDOMAIN_BUS_IPIIRQ_NONEphandlei_nlinkbranchwrite_begingroupserr_handlerno_vf_scanpi_blocked_onDOMAIN_BUS_DEVICE_MSIs_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superinstalleds_inode_list_locksweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockoverflowfile_ra_stateuser_structpci_msi_descon_rqfs_contextprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vffree_irqunsafe_warnllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitXenbusStateClosedwritable_sizercu_nodeinit_nameunfreeze_fsintervalclassaddress_hilast_mm_cidfile_lockuntrustedcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutex__UNIQUE_ID_ddebug735pci_opssigcnthrtimer_cpu_baseresourcescb_headcheck_quota_filedirty_folioattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tpi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knchip_typessival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapmsi_attribfiltercurr_ret_stackirqreturn_tdockdev_links_infoirq_bus_lockloff_tthread_pidsrcu_gp_seqno_command_memoryprepare_descxen_pcibk_do_one_op_archipi_send_singlest_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnoirq_calc_maskuintptr_tbatchasync_sizeacct_vm_mem1i_mtime_secDOMAIN_BUS_PLATFORM_MSIsh_infomemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETxen_pcibk_aer_wait_queuepadding__fillersaved_sigmaskd_timeentriescpu_idmsi_freefop_flags_tirq_fwspecFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmsi_initmodule_state_dev_infolast_used_atirq_chip_typevm_endlast_queuednuma_migrate_retryuser_nsirq_ack__statefirstmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctimeDOMAIN_BUS_WIREDFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_areadev_datairq_request_resourcesirq_chip_genericrlockfl_owner_tpci_is_enabled_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgcallbacknum_trace_bprintk_fmtgc_flagsvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayirq_flags_to_setRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpreg_readlctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenreclaim_sempme_supportdqb_btime_nr_pages_mappedutf8datarevmap_treemm_userss_ids_dentry_lrubp_offsetmask_basefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimenodenamesymlinkoom_flag_originxen_pcibk_disable_msidqio_semcounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqnvectrace_eval_mapdonefscrypt_operationsdmar_index_0_14release_workparent_irqksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliodriver_managed_dmaMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaDOMAIN_BUS_DMARdl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intXenbusStateClosingnuma_preferred_nidinstrument_atomic_write_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_highd1_supportarch_uprobemsi_mask_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedX86_IRQ_ALLOC_TYPE_PCI_MSIcompat_long_tactive_countspurious_eventss_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagssupported_flagstotal_numa_faultss_countdev_msi_infod_revalidateerrstringbus_groupsirq_chippmd_ts_opd_sbsysv_shminstrument_atomic_readdq_countutf8data_tableset_latency_tolerancedev_get_drvdata__func__resource_size_tfoliowake_entryxa_headsuidirq_domain_opsi_readcountirq_write_msi_msglocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalIRQ_GC_INIT_NESTED_LOCKbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countarch_addr_hiksm_merging_pagesotherendautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriesrequest_mutexs_qcopatomic_talloc_tag_counters_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_idXenbusStateInitialisedbridge_ctldownclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirVTIME_USERsa_flagstest__kmalloc_cache_noprofDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalsupported_speedsmapcountem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOthreads_activehwsizecurrent_may_mountarch_addr_loseqlock_tnuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmask__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validvertical_positioni_rcui_atime_secWORKER_DESC_LENqc_type_statekey_serial_tdev_ueventsetupf_lockmsi_msg___GFP_MOVABLE_BITpcie_bwctrl_dataactivexlatedqb_itimeWRITE_LIFE_MEDIUMop_worksrcu_idxpidsgetattrFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_start__flagsfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidarch_test_and_clear_bitattribute_groupcontextposix_timersdriver_exclusive_resourceselectorMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasedefault_timer_slack_nskcsan_check_accessirq_set_typesource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BITgroup_infovdso_imagefileWORK_BUSY_PENDINGof_match_tablepercpu_count_ptr__user_state_sizewarned_on_writedmar_subhandlepcie_cap_lockmce_kill_meuuid_tproperty_read_int_arraynr_actions___GFP_UNUSED_BITcount_objects_stimezone_device_dataf_wb_errhandler_name___ratelimitphysfndefparamlast_unhandledfred_csfault_flagresend_nodekprojid_tptracer_credtlb_genstorepage_mkwritekobjectaudit_ttyvariable_test_bitmce_ripvstatfs_dev_errats_enablednumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisteetlp_prefix_pathclass_groupsnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexit__UNIQUE_ID_ddebug741errseq_tioctx_tableVTIME_SYSchangedwatch_listrevmap_sizeaudit_contextpp_ref_countsysfs_opserror_detectedsequential_ioipi_send_maskis_busmaster_large_mapcountsda_is_staticformatftopenclavemask_cache_privdefault_irqsp_regcreatewrite_msi_msg_dataiattrirq_domain_bus_tokenrseqnfdssigvalvma_lockperf_event_listconfig_fieldsget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadirqactiond_reallink_stateexpiry_activexen_pcibk_test_and_schedule_opdqi_max_spc_limiteval_stringexception_table_entryevent_countparam_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tDOMAIN_BUS_PCI_MSIblocksirq_affinity_notifyset_infofileattr_getvectortimer_listaffinityXenbusStateReconfiguringd_ino_warnshiwater_vmxen_msix_entrytracepointcompound_headia_vfsuidirq_eoi__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersthread_maskino_timelimitpci_bus_flags_tsplice_writemsix_capstate_in_sysfssysfs_attrsrom_base_regconstant_test_bitqf_nextio_window_1krangesiommu_mmirq_enableats_stucutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprividle_notificationsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITsyncsetleasepinspacct_structmust_resumelong intfile_lock_contextusageuv_alloc_infol_yessiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ss__dynamic_dev_dbgproperty_presentmsi_domain_ops__kmalloc_indexUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncthreads_handledegidiomapdq_hashxen_test_irq_sharedput_superfwnode_reference_argspushable_dl_tasksf_flagsxdevcodetagPROBE_PREFER_ASYNCHRONOUSis_thunderboltmark_dirtythread_flagsnum_srcu_structsbdi_writebackpci_dev_datakobj_completion__kernel_clockid_trlimseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEirq_common_dataf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idmultifunctiondepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldmultipleDOMAIN_BUS_GENERIC_MSIssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobetracepoint_funccoherent_dma_maskentryfree_cached_objectsworkqueue_structsym_timens_pagexen_pcibk_dev_dataeoi_flagpi_lock___orig_eipprobestubget_timemm_cid_activedirty_paused_whenupdate_timemaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argsirq_unmasksrcu_reader_flavortv_nseci_lruiommu_cookied3cold_allowedgfp_maskpi_state_listrcu_segcblistsubvolbase_addressfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_iddev_pin_infojiffies_eoi_delayeddmar_reserved_0srcu_structrlim_curnofaultmm_countcputime_atomicdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledirqs_unhandledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextdmar_base_addressmsi_prepareopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYelemsizeread_folionr_eventsclear_bitiommuprivateDEVICE_VERT_POS_LOWERst_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxtph_enabledsplice_pipeeffective_affinitypasid_no_tlps_lock_keyreset_donesrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsslotstqheadmsi_domain_cookies_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copXenbusStateReconfigureddd_key_truedcookiekmalloc_array_noprofhres_activeDEVICE_PANEL_FRONTbpf_raw_eventsdq_dirtydl_deferbug_listdirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemadd_busignore_childrenresourcerestore_earlyclock_mutexfs_supersnotifydqb_bsoftlimitpendingf_task_work___GFP_NORETRY_BITiowait_countmatch_drivertest_and_clear_bitdma_io_tlb_memstringread_countxen_irq_lateeoifutex_offsetlong long intmmio_always_onx86_msi_addr_hiatomic_flagssysvshmtimer_expiresirq_set_vcpu_affinitytrace_evalsactive_basesearly_initrcec_eamprotectsecurityxmm_spaceactivatemsix_basef_pos_lockchip_datatls_arrayownerirq_release_resourcesacct_rss_mem1need_mbX86_IRQ_ALLOC_TYPE_UVvm_flags_trefcount_struct___GFP_FS_BITdmar_index_15i_bytesdomain_datarelax_countdevice_attribute___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersnvec_useddev_tFREEZE_HOLDER_USERSPACEmsi_capdup_xol_addrrevmapcapture_controlnr_wakeupsstartxen_pcibk_xenbus_registerstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sex86_msi_addr_loElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersbridgexen_pcibk_release_devicesd_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsxenbus_transactionswap_deactivateblkcnt_txenbus_read_unsignedicq_treework_bitssi_codeinit_dev_msi_infothread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributesxen_pcibk_driverset_child_tid_overruntmpfilercu_read_lock_nestingem_perf_statetick_dep_masklistthrottle_disksi_errnoromlens_inode_lrusrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionalof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTdevfnregsslice_maxlast_switch_countqsize_tmsi_desc_dataWORK_OFFQ_DISABLE_SHIFTfilesotherend_watchdevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagepublishmodule_sect_attrsreturn_instancesoftirq_activatedpdevpci_power_tclass_preempt_notrace_is_conditionalret_stacknode_idautosuspend_delayunsigned intgendiskspc_timelimits_instancesdescseqcounttokenremove_busoom_score_adjxen_pcibk_pv_supportd_seqia_vfsgidsize_tdevidacpi_device_idptm_enabledcap_permittedTT_NATIVEaffinity_hintclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxerror_statercu_tasks_holdouttarget_listno_64bit_msipasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecneeds_fresets_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listpublish_pci_root_cbvm_rcupgtables_bytesget_linkirq_shutdownfmode_tdevtxenbus_switch_statepci_channel_state_trestoredelayed_callmsi_instance_cookiemax_nr_cid_statusd_sibkernel_ulong_tX86_IRQ_ALLOC_TYPE_DMARdma_opsioapic_alloc_infobin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedhdr_typedl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqmsi_locklinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tdpc_rp_extensionsclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errstatus_use_accessorscputimerbe_watchtrace_recursionhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsxenbus_device_idattrdmar_subhandle_validget_next_child_nodeFAULT_FLAG_WRITEirq_set_irqchip_statevm_fault_ttty_structUTASK_SSTEP_TRAPPEDfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleio_cqres_attr_wcelf64_symxen_register_device_domain_ownerlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSWORK_OFFQ_FLAG_SHIFTp2pdmasyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_modbus_select_token_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredpcie_flags_regsum_block_runtimepgmapmin_perf_statedq_opalloc_pdevrcu_tasks_nvcswwritetypetabsubstateirq_release_resourcesclass_read_lock_irqsave_is_conditionalxenbus_map_ring_vallocdma_pools_addr_lsbi_generation_sigpollprocentmxcsrX86_IRQ_ALLOC_TYPE_AMDVId_rt_spc_hardlimitmagicpci_error_handlersnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexmsi_parent_opsdriver_datathread_headdev_pm_qosxenbus_drivermap_typef_oppids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportxen_pcibk_frontend_changedpercpu_sizexenbus_dev_fatalptm_granularityid_tabledq_sbarch_static_branchptm_rootnr_pendingsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entry___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestedpm_devmsi_translatenr_forced_migrationsnum_argsri_timerstack_canarydestid_8_31blksizesiblingmnt_rootnext_scanf_raquota_writexenbus_unmap_ring_vfreesrcu_barrier_cpu_cnttranslateiopl_warnrmdirpcie_link_statesockhash_lenget_policyHRTIMER_RESTARTexternal_facingpublish_cbirq_nmi_setupsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbersqstr_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchsemaphoreshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsptm_cap_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsirqs_per_chiprcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authirq_bus_sync_unlockvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxirq_hw_number_tstart_stackwatcherskmalloc_cachesredirect_hintcompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELioapiccore_nodepri_capsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_datairq_flow_handler_tpasid_featuresirqstatget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structbin_attrs_newhwirq_maxruntime_idleconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocessxen_pcibk_handle_eventpi_waitersexp_hintd_childrenIRQCHIP_STATE_LINE_LEVELis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infosaved_cap_spaceerror_remove_folioxen_pcibk_deviceold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepXenbusStateConnectedenvp_idxWORK_STRUCT_INACTIVE_BIT_head_1_head_2backstate_add_uevent_sentblock_cfg_accessi_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumeirq_disablewake_qfileattr_setkzalloc_noprofrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsDOMAIN_BUS_WAKEUPonlineruntime_resumedup_xol_workreg_basepercpu_enabled___GFP_WRITE_BITicookieMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignDOMAIN_BUS_NEXUSdelay_worktot_countxen_pcibk_publish_pci_devoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitxen_pcibk_xenbus_probereported_split_lockcur_bus_speedgfp_tseccomp_filterstimedestid_0_7event_channelsi_mmapirq_startupphys_addrd_lrusignal_structDOMAIN_BUS_VMD_MSIWORK_STRUCT_COLOR_BITSperf_event_mutexpri_enabledcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeis_msixki_completevtime_statewakee_flipsset_aclrom_attr_enabledpids_activedrivermsix_ctrlget_hwirqi_opskip_bus_pmldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodemsi_post_freesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatebe_watchingmaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startdisable__UNIQUE_ID_passthroughtype735huge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswhandle_irq__compiletime_assert_756xenbus_gatherMODULE_STATE_GOINGDL_DEV_UNBINDINGbus_select_maskmulti_capthreadsriov_configures_time_minbusn_ress_devcpus_allowed_lockxenbus_dev_is_onlineget_next_idrwlock_tpgprotfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDpriv_flagscurr_ret_depthac_utimebus_list_dummy_pkeymsi_alloc_info_tiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagwrite_msi_msgcoredump_datatasks_pidaddress_spacemm_context_tis_probed__call_single_nodestartupirq_mask_ackis_virtualseqcount_spinlock_ti_wbpanelclass_idinactive_timer_pkeyfilenames_export_op__mptri_flctxstashedcond_suspend_depthvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipebasehostuaddractive_lows_wb_errshm_clistWORK_STRUCT_PWQ_SHIFTis_child_subreaperunicode_mapXenbusStateInitWaitgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffsgnt_reflast_siginfoirq_managedunusedalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidi_rt_spc_timelimitrseq_sigflush_workdev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modewakeup_preparedpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwlimitkobjfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITxenbus_devicereleasedthread_fndep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timeirq_suspendrobust_list_headcurrent_state__ubuf_iovecignored_posix_timerscount__param_str_passthroughGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_beginaffinity_notifyvdsommap_legacy_basepipe_inode_infouint16_tsecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opspref_windowslicesas_ss_spnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listlink_bwctrlsrcu_barrier_completionsaved_config_spacedriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapxenbus_printfwaiterssubdevicesessionid_sifields_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_infopadding1llistdebugfs_entryacs_capelemnr_retriesIRQCHIP_STATE_PENDINGsigval_talimitundo_listKMALLOC_RANDOM_STARTdelivery_modeirq_datamask_cachemissedxen_pcibk_be_watchquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultoom_score_adj_minx86_msi_datakobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memhotplug_slotpathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalxen_pcibk_do_attachconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handleriommu_groupperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockis_preparedproc_dir_entryvm_opsiopollpagesizes_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7no_d1d2_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstatenot_essentialbroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidunlocked_ioctlrseq_lenparammodule_attributexen_pcibk_setup_backendpollfdnr_wakeups_remotepci_busllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awarestate_use_accessorsclass_spinlock_irqsave_is_conditionalrseq_csprimarynum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnon_compliant_bars_pincounttablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqltr_pathcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codeqspinlock__kmalloc_large_noprofirq_compose_msi_msglru_genirq_set_wakeinsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextrevisiongpl_symsseq_showswait_queue_headcow_pageblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgfull_namepci_device_idnodevm_lockno_cgroup_migrationnextevts_writers_key__countirq_cntxcomp_bvcma_areastatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimereg_writelstate_remove_uevent_sentlegacy_memdmar_formatspurious_thresholddevice_unregisteria_sizein_hrtirqs_master_keysarch_msi_msg_addr_hi_tpropertywchar_addr_bndkernel_symbolsubsys_datatv_secis_64pid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdX86_IRQ_ALLOC_TYPE_HPETnr_failed_migrations_affinestrcmpuser_cpus_ptrpi_top_taskaddress_lounlinkslotactoruprobenotifier_subscriptionss_readonly_remountutil_sumreserved_0st_otheri_mutex_keyksethrtimer_clock_basevruntime__compiletime_assert_738disable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmoduleXenbusStateUnknownpcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsl1sssriov_set_msix_vec_countxenbus_read_driver_statekfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queueirq_descdqi_dirty_listfe_statemax_timemod_tree_nodef_sb_errwritepagecodegtimesigactionwake_activedev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimexen_pcibk_backendsched_rt_mutexlocked_pendingreset_preparenr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listunmapktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagIRQ_GC_MASK_CACHE_PER_TYPEi_uidparent_dataspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfn__compiletime_assert_760vm_mm__compiletime_assert_766irq_domain_chip_genericdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsxen_pcibk_idsexe_filereserved_1nr_scannedpcp_listpid_linksdev_locks_sysfs_namerefcountvaddrrequest__compiletime_assert_772rw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipxen_pcibk_add_pci_devqc_dqblkmmappedseqcount_raw_spinlockbroken_intx_maskingirq_pm_shutdownkill_sbd_opxenbus_scanfclear_retrain_linkMIGRATE_ASYNCdevice_dma_parametersWORK_OFFQ_FLAG_BITSi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failpci_opsllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqrcu_syncpreempt_notifiersDOMAIN_BUS_TI_SCI_INTA_MSIsrcu_last_gp_ends_fsnotify_infoDOMAIN_BUS_PCI_DEVICE_MSIXxen_pcie_aer_opmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocsubvendord_parenttransparentpayloadac_minflti_sbkmalloc_noprofmatchcommcan_matchlast_timePIDTYPE_PIDeventsofflineis_levelatomic_write_segments_maxatomic_openstart_prevent_timereadahead_controlbind_interdomain_evtchn_to_irqhandler_lateeoisubordinate__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesselecthost_dataread_newsignalfd_wqhmmapmodnameerrnumdomain_free_irqsasync_put_workmknodpri_reqs_allocirq_gc_flagsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapdma_alias_maskwritepagessched_statisticsirq_alloc_infohead__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampsuper_operationssplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAxen_pcibk_xenbus_unregisterpt_regsenablepipe_bufsKOBJ_NS_TYPE_NETpassthroughctx_idarch_msi_msg_addr_lo_td_rt_spc_warnsi_verity_infomsix_entriesirq_retriggerxsavetimespec_type__rb_parent_colordevres_lockbitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoats_capDD_CLASS_TYPE_LEVEL_NAMESdev_flagsvm_private_dataio_bitmapuprobe_task_statetimerkobj_typebroken_parity_statusdeactivatei_pagesWORK_OFFQ_POOL_BITSino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitirq_alloc_typedoe_mbspage_fragwrite_bytesiobasecharqf_ownerunix_inflightxenbus_watchholders_dirfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledgraph_get_port_parent__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulexen_pcibk_do_opfreeze_fsuserfaultfd_ctxsigset_tmask_posrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freebridge_d3__UNIQUE_ID_ddebug737__UNIQUE_ID_ddebug739parentirq_set_affinityatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeWORK_STRUCT_LINKED_BITget_named_child_nodelaunder_foliocurr_target__UNIQUE_ID_ddebug745number__UNIQUE_ID_ddebug747is_suspendedX86_IRQ_ALLOC_TYPE_IOAPIChotplug__keyburstetypeei_funcsmodule_kobjectactive_memcg__UNIQUE_ID_ddebug751__UNIQUE_ID_ddebug753__UNIQUE_ID_ddebug755def_flags__UNIQUE_ID_ddebug759d2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updateIRQCHIP_STATE_ACTIVEvendorcap_bsetmutex_lockarchdata_sourcepower_statenr_perf_states__UNIQUE_ID_ddebug761stack_vm_area__UNIQUE_ID_ddebug763kstat_irqs__UNIQUE_ID_ddebug767__UNIQUE_ID_ddebug769saved_statecfg_sizeroot_numbasespcie_mpsss_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcounters__UNIQUE_ID_ddebug771name_linkchipcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typesriovpolicysharedpercpu_dev_iddismissd_real_typelookahead_bandseq_startnum_chipsraw_lockd_dnameget_dqblkmax_hang_timeirq_nmi_teardowncpus_maskDOMAIN_BUS_ANYsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcecmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailslinenobase_pfnget_inode_acl_addr_pkeymigrate_foliocustom_sliceaer_capthread_keyringkparam_arrayutimestart_codeis_managedis_harddest_mode_logicalfsbasecompatiblesubsystem_deviceclock_listattrsdynidscpumask_tswregs_stateevtchn_port_tdqb_isoftlimitdma_iommuorig_axbladecompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperirq_chip_regsrom_bar_overlappref_64_windowi_aclwake_enabled___GFP_ZERO_BITwrite_newlist_lockpm_domaincpu_bitmapthreads_handled_laststatic_call_keyutil_estucountsqc_statevirt_destid_8_14softirq_next_timercheck_flagshandlerswp_entry_tmsi_descirq_get_irqchip_state_mapcountdomain_tagpasid_requiredhang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventIRQCHIP_STATE_MASKEDirq_maskset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memoryotherend_idpi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacxen_pci_sharedinfo__init_worknr_to_scanwake_depthfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stamponstackcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delaydma_cleanupmaple_treeXenbusStateInitialisingKMALLOC_DMAdentryxenbus_watch_path__xenbus_register_backendcpu_itimerpercpusriov_get_vf_total_msixrel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlink__compiletime_assert_740__compiletime_assert_742__compiletime_assert_744__compiletime_assert_746__compiletime_assert_748pushirq_domain_bus_tokenDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancesrange__compiletime_assert_750__compiletime_assert_752__compiletime_assert_754futex_exit_mutex__compiletime_assert_758kernfs_iattrstrc_blkd_nodeIRQ_GC_NO_MASKd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addr__compiletime_assert_762__compiletime_assert_764d_rt_spacename__compiletime_assert_768u_flagswait_for_threadsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pending__compiletime_assert_770bus_tokenDOMAIN_BUS_IPIis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typepcistub_get_pci_dev_by_slotstate_savedi_rdevirq_reroute_variantself_exec_idDOMAIN_BUS_WIRED_TO_MSIkernfs_opsfile_lockMODULE_STATE_LIVExenbus_statenr_migrationsa_opsxa_flagspercpu_affinityfreezebin_sizemap_busclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITX86_IRQ_ALLOC_TYPE_PCI_MSIXirq_affinity_descd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITirq_baseset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorWORK_STRUCT_PWQ_BITassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkis_virtfnpercpu_refhorizontal_positionclass_maskpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedis_readypp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightcommonvm_files_stateuser_sizedev_pm_opsxsd_errorsgrant_ref_tscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkkmalloc_typema_flagsno_msifutex_stateorig_pmdshpc_managedacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posirq_print_chipnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsbus_dma_regiondpc_capio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headWORK_OFFQ_DISABLE_BITSrcharfutex_pi_statekstat__kernel_uid32_tis_msi_managedDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credWORK_STRUCT_FLAG_BITSget_namefwnode_endpointepoll_watchesprealloc_ptedqb_curspace_entrygp_statebitsetload_avgaccesscstimepcie_capcore_internal_state__do_not_mess_with_itcfs_rq_uidmsi_indexxen_pcibk_publish_pci_rootst_spacemm_cid_next_scanns_type__UNIQUE_ID_ddebug743msix_enabledxen_pci_opwill_handleac_majflt__UNIQUE_ID_ddebug749pasid_enabledposix_cputimers_work_upperforce_resume_depthmodule_param_attrsshort unsigned intotherend_changedbus_flagsno_suspend_depthread_otherend_detailsi_mutex_dir_keyq_nodespc_warnlimitvalids_encodinggpl_crcsorc_entrykeysorig_pteparam_ops_boolpasid_capdqb_curinodesload__s8invalidate_lock_key__UNIQUE_ID_ddebug757dma_maskprealloc_mutexnanosleepDOMAIN_BUS_FSL_MC_MSIxen_pcibk_xenbus_removesrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlock__UNIQUE_ID_ddebug765rlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionpercpu_ref_func_tseq_stoppci_dev_flags_tdev_iddomain_alloc_irqskiocbclass_rwsem_read_intr_is_conditionalprobefsuidaer_statss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalsrcu_supshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageIRQ_GC_INIT_MASK_CACHEirq_flags_to_cleararch_msi_msg_data_tno_callbacks__u16timers_activewait_countsig_okhwirqdelaysirq_safereadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedxen_pcibk_release_pci_devraw_spinlock_tkey_tagINIT_LIST_HEADsysdatafs_flagsworkpgprotval_tkeytypesigpendingfsindexshstknum_ctsrcu_ssppage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequencexen_pcibk_remove_devicepci_vpddqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendori_dir_seqirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookied_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmauclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typeirq_resumedpc_rp_log_sizeimm_readyf_iocb_flagspoweroffcmaj_fltaer_opvtimemath_emu_infoiowait_sumf_path__u64journal_infooverride_onlysched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimerequired_flagsdeadlinepinned_vm_head_2apsi_flagsaddressstart_boottimevm_startIRQ_GC_BE_IOs_flagscpumask_var_tfaultmsi_domain_infoshow_statsdl_densityfreeptr_tread_dqblkdq_flagschip_dataDD_CLASS_TYPE_DISJOINT_NAMESpci_devmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpdevicetypei_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionxen_pcibk_get_pci_devserialclass_releasealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffpending_masksyscall_user_dispatchrcu_tasks_exit_listset_descarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_done___GFP_ACCOUNT_BITevtchn_irqpud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typemsi_enabledseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerfindquotalenf_pipei_wb_frn_historylast_wakeenextWORK_OFFQ_LEFTio_tlb_memarch_spinlock_ti_mtime_nsecperformanceDOMAIN_BUS_PCI_DEVICE_MSImmlist__compiletime_assert_2__compiletime_assert_3devcapsuppress_bind_attrsRPM_RESUMINGreg_offsetpublish_pci_dev_cbgsbases_quota_typesirqchip_irq_statef_llistIRQ_NONEphandlei_nlinkbranchwrite_begingroupserr_handlerno_vf_scanpi_blocked_onDOMAIN_BUS_DEVICE_MSIs_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_txen_pcibk_vpci_backendsharepagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superinstalleds_inode_list_lock__param_passthroughxen_unregister_device_domain_ownersweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabxen_pcibk_disconnectdevice_typewatchmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlocknum_devsfile_ra_stateuser_structpci_msi_descon_rqfs_contextprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfunsafe_warnllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitXenbusStateClosedwritable_sizercu_nodeinit_nameunfreeze_fsintervalclassaddress_hilast_mm_ciduntrustedcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexWORK_OFFQ_POOL_SHIFTsigcnthrtimer_cpu_baseresourcescb_headcheck_quota_filedirty_folioattributerestrict_linkdev_archdatai_deviceskey_perm_tpi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knchip_typessival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapmsi_attribfiltercurr_ret_stackirqreturn_tdockdev_links_infoirq_bus_lockloff_tthread_pidsrcu_gp_seqno_command_memoryprepare_desc_archipi_send_singlest_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnoirq_calc_maskbatchasync_sizeacct_vm_mem1i_mtime_secDOMAIN_BUS_PLATFORM_MSIsh_infomemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idmsi_freefop_flags_tirq_fwspecFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmsi_initmodule_state_dev_infolast_used_at__mutex_initirq_chip_type__compiletime_assert_473vm_endlast_queuednuma_migrate_retryuser_nsirq_ack__statefirstmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctimeDOMAIN_BUS_WIREDFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_areairq_request_resourcesirq_chip_genericrlockxen_pcibk_init_devicesfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgcallbacknr_pagesnum_trace_bprintk_fmtgc_flagsvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayirq_flags_to_setRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpdev_set_drvdatareg_readlctimereleasemax_segment_sizesched_dl_entityremote_evtchn__kernel_dev_tatomic_write_lenreclaim_sempme_supportdqb_btime_nr_pages_mappedutf8datarevmap_treemm_userss_ids_dentry_lrubp_offsetmask_basefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimenodenamesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORTstate_str__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsdmar_index_0_14release_workparent_irqksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioxenbus_unregister_driverdriver_managed_dmaMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaDOMAIN_BUS_DMARdl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intXenbusStateClosingnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_highd1_supportarch_uprobemsi_mask_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedX86_IRQ_ALLOC_TYPE_PCI_MSIcompat_long_tactive_countspurious_eventss_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagssupported_flagstotal_numa_faultss_countdev_msi_infod_revalidateerrstringbus_groupsirq_chippmd_ts_opd_sbsysv_shmdq_countutf8data_tableset_latency_tolerancedev_get_drvdata__func__resource_size_tfoliowake_entryxa_headsuidirq_domain_opsi_readcountxen_find_device_domain_ownerirq_write_msi_msglocked_vmthreads_oneshotrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalIRQ_GC_INIT_NESTED_LOCKbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countarch_addr_hiksm_merging_pagesotherendautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriesrequest_mutexs_qcopatomic_talloc_tag_countersdomain_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_idXenbusStateInitialisedbridge_ctldownclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirVTIME_USERsa_flagstest__kmalloc_cache_noprofDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalsupported_speedsmapcountem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOthreads_activefree_pdevcurrent_may_mountarch_addr_loseqlock_tnuma_scan_offset___GFP_NO_OBJ_EXT_BITreclaim_memorysched_migratedfrozenmlock_countin_lru_faultgrpmaskcan_maskregfuncindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validvertical_positionWORK_OFFQ_FLAG_ENDi_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockmsi_msg___GFP_MOVABLE_BITpcie_bwctrl_dataactivexlatedqb_itimeWRITE_LIFE_MEDIUMop_worksrcu_idxpidsgetattrFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersdriver_exclusive_resourceselectorMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasedefault_timer_slack_nsirq_set_typesource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BIT__UNIQUE_ID_passthrough736group_infovdso_imagefileof_match_tablepercpu_count_ptr__user_state_sizedmar_subhandlepcie_cap_lockmce_kill_meuuid_tproperty_read_int_arraynr_actions___GFP_UNUSED_BITcount_objects_stimezone_device_dataf_wb_errhandler_namephysfndefparamlast_unhandledfred_csfault_flagresend_nodekprojid_tptracer_credtlb_genstorepage_mkwritekobjectaudit_ttymce_ripvstatfshlist_bl_head_dev_errats_enablednumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKWORK_OFFQ_BH_BITfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisteetlp_prefix_pathclass_groupsnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexit__UNIQUE_ID_ddebug741errseq_tioctx_tableVTIME_SYSchangedwatch_listrevmap_sizexen_pcibk_publish_pci_rootsaudit_contextpp_ref_countsysfs_opserror_detectedsequential_ioipi_send_maskis_busmaster_large_mapcountsda_is_staticformatftopenclavemask_cache_privdefault_irqsp_regcreatewrite_msi_msg_dataiattrWORK_STRUCT_PENDING_BITrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadirqactiond_reallink_stateexpiry_activedqi_max_spc_limiteval_stringexception_table_entryevent_countparam_countWORK_STRUCT_COLOR_SHIFTfallocatei_spc_warnlimitbuddy_listi_ino_timelimitDOMAIN_BUS_AMDVIi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tdev_strDOMAIN_BUS_PCI_MSIblocksirq_affinity_notifyset_infofileattr_getvectortimer_listaffinityXenbusStateReconfiguringdevice_dma_supportedd_ino_warnshiwater_vmxen_msix_entrytracepointcompound_headia_vfsuidirq_eoixen_pcibk_passthrough_backend__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structxen_pcibk_reconfigurerpm_statussb_writersthread_maskino_timelimitpci_bus_flags_tsplice_writemsix_capstate_in_sysfssysfs_attrsrom_base_regqf_nextio_window_1krangesiommu_mmirq_enableats_stucutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprividle_notificationsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITsyncsetleasepinspacct_structmust_resumelong intfile_lock_contextusageuv_alloc_infol_yessiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ss__dynamic_dev_dbgproperty_presentmsi_domain_ops__kmalloc_indexUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncthreads_handledegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagsxdevcodetagPROBE_PREFER_ASYNCHRONOUSis_thunderboltmark_dirtythread_flagsnum_srcu_structsbdi_writebackpci_dev_datakobj_completion__kernel_clockid_trlimseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEirq_common_dataf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idmultifunctiondepthsnprintfcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldmultipleDOMAIN_BUS_GENERIC_MSIallow_rebindssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structsym_timens_pagepi_lock___orig_eipprobestubget_timemm_cid_activedirty_paused_whenmaxlensuspend_noirqxen_pcibk_export_deviceclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argsirq_unmasksrcu_reader_flavortv_nseci_lruiommu_cookied3cold_allowedgfp_maskpi_state_listrcu_segcblistsubvolbase_addressfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_iddev_pin_infojiffies_eoi_delayeddmar_reserved_0srcu_structrlim_curnofaultmm_countcputime_atomicdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpunbind_from_irqhandlerdl_throttledirqs_unhandledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextdmar_base_addressmsi_prepareopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYelemsizeread_folionr_eventsiommuprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxtph_enabledsplice_pipeeffective_affinitypasid_no_tlps_lock_keyreset_donesrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsslotstqheadmsi_domain_cookies_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalxen_pcibk_attachremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cachedunregister_xenbus_watchs_copXenbusStateReconfigureddd_key_truedcookiehres_activebpf_raw_eventsdq_dirtydl_deferbug_listdirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemadd_busignore_childrenresourcerestore_earlyclock_mutexfs_supersnotifydqb_bsoftlimitpendingf_task_work___GFP_NORETRY_BITiowait_countmatch_driverdma_io_tlb_memstringread_countfutex_offsetlong long inthwsizemmio_always_onx86_msi_addr_hiatomic_flagssysvshmtimer_expiresirq_set_vcpu_affinitytrace_evalsactive_basesearly_initrcec_eamprotectsecurityxmm_spaceactivatemsix_basef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbX86_IRQ_ALLOC_TYPE_UVvm_flags_trefcount_struct___GFP_FS_BITdmar_index_15i_bytesdomain_datarelax_countdevice_attribute___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersnvec_useddev_tFREEZE_HOLDER_USERSPACEmsi_capdup_xol_addrrevmapcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sex86_msi_addr_loElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersbridged_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codeinit_dev_msi_infothread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributes__list_del_entryset_child_tid_overruntmpfilercu_read_lock_nestingem_perf_statetick_dep_masklistthrottle_disksi_errnoromlens_inode_lruconf_byte_readsrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionalxen_pcibk_config_header_add_fieldsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTdevfnregsslice_maxlast_switch_countqsize_tmsi_desc_datafilesdevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedpdevpci_power_tclass_preempt_notrace_is_conditionalret_stacknode_idautosuspend_delayunsigned intgendiskspc_timelimits_instancesdescseqcountremove_busoom_score_adjd_seqia_vfsgidsize_tdevidptm_enabledcap_permittedTT_NATIVEaffinity_hintclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxerror_statercu_tasks_holdouttarget_listno_64bit_msipasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecneeds_fresets_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupci_read_config_bytepgtables_bytesget_linkirq_shutdownfmode_tdevtpci_channel_state_trestoredelayed_callmsi_instance_cookiemax_nr_cid_statusd_sibX86_IRQ_ALLOC_TYPE_DMARdma_opsioapic_alloc_infobin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedhdr_typedl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqmsi_locklinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tdpc_rp_extensionsclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errstatus_use_accessorscputimertrace_recursionhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrdmar_subhandle_validget_next_child_nodeFAULT_FLAG_WRITEirq_set_irqchip_statevm_fault_ttty_structUTASK_SSTEP_TRAPPEDfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleio_cqres_attr_wcelf64_symlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSp2pdmasyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_modbus_select_token_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredpcie_flags_regsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabirq_release_resourcesclass_read_lock_irqsave_is_conditionaldma_pools_addr_lsbi_generation_sigpollprocentmxcsrX86_IRQ_ALLOC_TYPE_AMDVId_rt_spc_hardlimitpci_error_handlersnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexmsi_parent_opsdriver_datathread_headdev_pm_qosmap_typef_oppids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizeconf_dword_write__compiletime_assert_195ptm_granularityid_tabledq_sbarch_static_branchptm_rootsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entry___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestedpm_devmsi_translatenr_forced_migrationsnum_argsri_timerstack_canarydestid_8_31blksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cnttranslateiopl_warnrmdirpcie_link_statesockhash_lenget_policy__list_add_validHRTIMER_RESTARTvalid_requestexternal_facingirq_nmi_setupsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodexen_pcibk_config_readcpu_basedevice_is_availabledquotdl_runtimenumbersqstr_softexpireskey_user_hugetlb_cgroup_rsvdfield_endfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsptm_cap_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsirqs_per_chiprcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authirq_bus_sync_unlockvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxirq_hw_number_tstart_stackwatcherskmalloc_cachesredirect_hintcompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELioapiccore_nodepri_capsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_datairq_flow_handler_txen_pcibk_config_free_dyn_fieldspasid_featuresfieldirqstatget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structbin_attrs_newhwirq_maxruntime_idleconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenIRQCHIP_STATE_LINE_LEVELis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infosaved_cap_spaceerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2backstate_add_uevent_sentblock_cfg_accessi_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumeirq_disablewake_qfileattr_setrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsDOMAIN_BUS_WAKEUPonlineruntime_resumedup_xol_workpermissivereg_basepercpu_enabled___GFP_WRITE_BITicookieMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignDOMAIN_BUS_NEXUSdelay_worktot_countoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tseccomp_filterstimedestid_0_7list_add_taili_mmapirq_startupthaw_supernew_vald_lrusignal_structDOMAIN_BUS_VMD_MSIperf_event_mutexpri_enabledcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeis_msixki_completevtime_statewakee_flipsset_aclrom_attr_enabledpids_activedrivermsix_ctrlget_hwirqi_opskip_bus_pmldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodemsi_post_freesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatemaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startdisablehuge_faultkstatfssitesxen_pcibk_read_config_dwordDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysenable_intx__list_addsrcu_cb_mutexstatic_call_sitebladeMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswhandle_irqMODULE_STATE_GOINGDL_DEV_UNBINDINGbus_select_maskmulti_capthreadsriov_configures_time_minbusn_ress_devcpus_allowed_lockget_next_idrwlock_tpgprotfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utimebus_list_dummy_pkeymsi_alloc_info_tiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitconfig_fieldac_flagwrite_msi_msgcoredump_datatasks_pidaddress_spacemm_context_tis_probed__call_single_nodestartupirq_mask_ackis_virtualseqcount_spinlock_ti_wbpanelclass_idinactive_timer_pkeyfilenames_export_op__mptri_flctxstashedcond_suspend_depthvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_folioxen_pcibk_config_writelast_busyi_pipebasehostuaddractive_lows_wb_errshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoirq_managedunusedalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidi_rt_spc_timelimitrseq_sigdev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modewakeup_preparedpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwlimitkobjfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleasedthread_fndep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timeirq_suspendrobust_list_headisr_oncurrent_state__ubuf_iovecignored_posix_timersget_maskcountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_beginaffinity_notifyvdsommap_legacy_basepipe_inode_infocur_bus_speedsecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opspref_windowslicesas_ss_spnr_dirtiedtmp_valnum_kprobe_blacklistxen_pcibk_config_init___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listlink_bwctrlsrcu_barrier_completionsaved_config_spacedriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssubdevicesessionid__param_permissive_sifields_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_infopadding1llistdebugfs_entryacs_capelemnr_retriesIRQCHIP_STATE_PENDINGsigval_talimitundo_listKMALLOC_RANDOM_STARTdelivery_modeirq_datamask_cache_dev_warnmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typeconf_byte_writemtimeserver_has_tasksvm_faultxen_pcibk_config_init_devoom_score_adj_minx86_msi_datakobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memhotplug_slotpathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handleriommu_groupperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockis_preparedproc_dir_entryvm_opsiopollpagesizes_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7no_d1d2_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstatebroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvmerge_valuemce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidunlocked_ioctlrseq_lenparammodule_attributepollfdnr_wakeups_remotepci_busllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awarestate_use_accessorsclass_spinlock_irqsave_is_conditionalrseq_csprimarynum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnon_compliant_bars_pincounttablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqltr_pathcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codeqspinlock__kmalloc_large_noprofirq_compose_msi_msglru_genirq_set_wakeinsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextrevisiongpl_symsseq_showswait_queue_headcow_pageblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgunmapxen_pcibk_config_capability_add_fieldsfull_namepci_device_idnoderesetvm_lockpci_saved_stateno_cgroup_migrationnextevts_writers_key__countirq_cntxcomp_bvcma_areastatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimereg_writelstate_remove_uevent_sentlegacy_memdmar_formatia_sizein_hrtirqs_master_keysarch_msi_msg_addr_hi_tpropertywchar_addr_bndkernel_symbolsubsys_datatv_secis_64pid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdX86_IRQ_ALLOC_TYPE_HPETnr_failed_migrations_affineIS_ERRuser_cpus_ptrpi_top_taskaddress_lounlinkslotactoruprobenotifier_subscriptionss_readonly_remountutil_sumreserved_0st_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flags__compiletime_assert_749l1sssriov_set_msix_vec_countkfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queueirq_descdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimesigactionwake_activedev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimesched_rt_mutexlocked_pendingreset_preparenr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listis_msi_managedktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagIRQ_GC_MASK_CACHE_PER_TYPEi_uidxen_pcibk_config_free_devparent_dataspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmirq_domain_chip_genericdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filereserved_1nr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipirq_nameqc_dqblkmmappedseqcount_raw_spinlockbroken_intx_maskingirq_pm_shutdownkill_sbd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqrcu_syncpreempt_notifiersDOMAIN_BUS_TI_SCI_INTA_MSIsrcu_last_gp_ends_fsnotify_infoDOMAIN_BUS_PCI_DEVICE_MSIXmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocsubvendord_parentconf_word_writetransparentpci_write_config_dwordpayloadac_minflti_sbkmalloc_noprofmatchcommcan_matchlast_timePIDTYPE_PIDofflineis_levelatomic_write_segments_maxatomic_openstart_prevent_timereadahead_controlsubordinate__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesselecthost_dataread_newsignalfd_wqhmmapmodnameerrnumdomain_free_irqsasync_put_workmknodpri_reqs_allocirq_gc_flagsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapdma_alias_maskwritepagessched_statisticsirq_alloc_infohead__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampsuper_operationssplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATApt_regsenablepipe_bufsKOBJ_NS_TYPE_NETctx_idarch_msi_msg_addr_lo_td_rt_spc_warnspci_write_config_wordi_verity_infoirq_retriggerxsavetimespec_type__rb_parent_colordevres_lockbitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoats_capDD_CLASS_TYPE_LEVEL_NAMESdev_flagsvm_private_dataio_bitmapuprobe_task_statetimerkobj_typebroken_parity_statusdeactivatei_pageshlist_bl_headino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitirq_alloc_typedoe_mbspage_fragwrite_bytesiobasecharqf_ownerunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledgraph_get_port_parent__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_tmask_posrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freebridge_d3__UNIQUE_ID_ddebug738parentirq_set_affinityatimecopy_file_rangetask_cputime_atomicuser_definedkey_type__UNIQUE_ID_ddebug740get_named_child_nodelaunder_foliocurr_target__UNIQUE_ID_ddebug744number__UNIQUE_ID_ddebug748is_suspendedX86_IRQ_ALLOC_TYPE_IOAPIChotplugburstetypeei_funcsmodule_kobjectactive_memcg__UNIQUE_ID_ddebug750def_flagsd2_supportbase0base1base2wait_queue_head_tnew_val_maskpage_typercu_data0no_updateIRQCHIP_STATE_ACTIVEvendorcap_bsetarchdata_sourcepower_statenr_perf_statesstack_vm_areakstat_irqssaved_statecfg_sizebasespcie_mpsss_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkchipcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typesriovpolicysharedpercpu_dev_iddismissxen_pcibk_config_quirks_initconf_field_resetlist_deld_real_typelookahead_bandseq_startnum_chipsraw_lockd_dnameget_dqblkmax_hang_timeirq_nmi_teardowncpus_maskDOMAIN_BUS_ANYsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcecmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailslinenobase_pfnget_inode_acl_addr_pkeymigrate_foliocustom_sliceaer_capconf_space_readthread_keyringkparam_arrayutimestart_codeis_managedis_harddest_mode_logicalfsbasecompatiblesubsystem_deviceclock_listattrsdynidscpumask_tbase_offsetswregs_statedqb_isoftlimitdma_iommuorig_axpriv_flagscompletesched_rt_entityret_valtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperirq_chip_regsrom_bar_overlappref_64_windowi_aclwake_enabled___GFP_ZERO_BITwrite_newlist_lockpm_domaincpu_bitmapthreads_handled_laststatic_call_keyutil_estucountsqc_statevirt_destid_8_14handledsoftirq_next_timercheck_flagshandlerswp_entry_tmsi_descirq_get_irqchip_state_mapcountdomain_tagpasid_requiredhang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventIRQCHIP_STATE_MASKEDirq_maskset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanwake_depthfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delay__compiletime_assert_737dma_cleanup__compiletime_assert_739maple_treeKMALLOC_DMAdentrycpu_itimerpercpusriov_get_vf_total_msixrel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlink__compiletime_assert_741__compiletime_assert_743__compiletime_assert_745__compiletime_assert_747pushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancesrange__compiletime_assert_751futex_exit_mutexkernfs_iattrstrc_blkd_nodeIRQ_GC_NO_MASKack_intrd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagswait_for_threadsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingbus_tokenDOMAIN_BUS_IPIxen_pcibk_get_interrupt_typeis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typestate_savedi_rdevirq_reroute_variantself_exec_idDOMAIN_BUS_WIRED_TO_MSIkernfs_opsfile_lockMODULE_STATE_LIVEclass_masknr_migrationsa_opsxa_flagspercpu_affinityfreezebin_sizemap_busclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITX86_IRQ_ALLOC_TYPE_PCI_MSIXirq_affinity_descd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITirq_baseset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkis_virtfnpercpu_refhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infoallow_interrupt_controlfutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightcommonvm_files_stateuser_sizedev_pm_opsxsd_errorsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkkmalloc_typema_flagsno_msifutex_stateorig_pmdshpc_managedacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posirq_print_chipnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsbus_dma_regiondpc_capio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headlist_is_headconf_dword_readrcharfutex_pi_statekstat__kernel_uid32_tconf_space_writeDEVICE_FIXEDpte_t__UNIQUE_ID_ddebug736device_driverdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointepoll_watchesprealloc_pte__UNIQUE_ID_permissivetype735dqb_curspace_entrygp_statebitsetload_avgaccesscstimepcie_capcore_internal_state__do_not_mess_with_itcfg_entrycfs_rq_uidmsi_indexst_spacemm_cid_next_scanns_type__UNIQUE_ID_ddebug742msix_enabled__UNIQUE_ID_ddebug746ac_majfltreal_timerpasid_enabledposix_cputimers_work_upperforce_resume_depthmodule_param_attrsshort unsigned intbus_flagsno_suspend_depthi_mutex_dir_keyq_nodespc_warnlimitvalids_encodinggpl_crcsorc_entrykeysorig_pteparam_ops_boolpasid_capdqb_curinodesload__s8pci_get_drvdatainvalidate_lock_keydma_maskprealloc_mutexnanosleepDOMAIN_BUS_FSL_MC_MSIsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodxen_pcibk_read_config_wordsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionpercpu_ref_func_tseq_stoppci_dev_flags_tdev_iddomain_alloc_irqskiocbclass_rwsem_read_intr_is_conditionalprobefsuidaer_statss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalsrcu_supshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageIRQ_GC_INIT_MASK_CACHEirq_flags_to_cleararch_msi_msg_data_tno_callbacks__u16timers_activewait_countsig_okhwirqdelaysirq_safereadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagINIT_LIST_HEADsysdatafs_flagsworkpgprotval_tkeytypesigpendingfsindexshstknum_ctsrcu_sspwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequencepci_vpdpci_read_config_worddqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendori_dir_seqirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookied_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmacls_mskchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typeirq_resumedpc_rp_log_sizeimm_readyf_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infooverride_onlysched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimerequired_flagsdeadlinepinned_vm_head_2apsi_flagsaddressstart_boottimevm_startIRQ_GC_BE_IOs_flagscpumask_var_tfaultmsi_domain_infoshow_statsdl_densityfreeptr_tread_dqblkdq_flagschip_dataDD_CLASS_TYPE_DISJOINT_NAMESpci_devmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_lock__param_str_permissives_dquotfolioqprev_posseqcount_spinlockexpire_countpci_write_config_bytes_umountis_bin_visiblepgoffpending_masksyscall_user_dispatchrcu_tasks_exit_listset_descarchdataia_uid__list_del_entry_valid_or_reportchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_done___GFP_ACCOUNT_BITpud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typemsi_enabledseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memarch_spinlock_ti_mtime_nsecperformanceDOMAIN_BUS_PCI_DEVICE_MSImmlistdevcapsuppress_bind_attrsRPM_RESUMINGreg_offsetgsbases_quota_typesirqchip_irq_statef_llistIRQ_NONEphandlei_nlinkbranchwrite_begingroupserr_handlerno_vf_scanpi_blocked_onDOMAIN_BUS_DEVICE_MSIs_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharexen_pcibk_config_reset_devpagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superPTR_ERRinstalleds_inode_list_locksweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsxen_pcibk_config_capability_initreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structpci_msi_descon_rqfs_contextprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfxen_pcibk_write_config_wordunsafe_warnllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclassaddress_hilast_mm_ciduntrustedcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesacpi_device_idd_ino_countlast_cpuilenmnt_flagscred_guard_mutexpci_opssigcnthrtimer_cpu_baseresourcescb_headcheck_quota_filedirty_folioattributerestrict_linkdev_archdatai_deviceskey_perm_tpi_state_cacheclass_disable_irq_is_conditionalconf_field_freeanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knchip_typessival_ptri_opflagsrobust_listconf_field_initsym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapmsi_attribfiltercurr_ret_stackirqreturn_tdockdev_links_infoirq_bus_lockloff_tthread_pidsrcu_gp_seqno_command_memoryprepare_desc_archipi_send_singlexen_pcibk_write_config_bytest_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlencleanclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnoirq_calc_maskbatchasync_sizeacct_vm_mem1i_mtime_secDOMAIN_BUS_PLATFORM_MSImemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idmsi_freefop_flags_tirq_fwspecFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmsi_initmodule_statexen_pcibios_err_to_errnolast_used_atirq_chip_type__compiletime_assert_473vm_endlast_queuednuma_migrate_retryuser_nsirq_ack__statefirstmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctimeDOMAIN_BUS_WIREDFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_areadev_datairq_request_resourcesirq_chip_genericrlockfl_owner_t_reseuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtgc_flagsvm_policyperf_rdpmc_allowedrdevkernel_ulong_tDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayirq_flags_to_setRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpreg_readlctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenpme_supportdqb_btime_nr_pages_mappedutf8datarevmap_treemm_userss_ids_dentry_lrubp_offsetmask_basefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsdmar_index_0_14release_workparent_irqksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliodriver_managed_dmaMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaDOMAIN_BUS_DMARdl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_highd1_supportarch_uprobemsi_mask_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedX86_IRQ_ALLOC_TYPE_PCI_MSI__list_add_valid_or_reportcompat_long_tactive_counts_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagsxen_pcibk_read_config_bytesupported_flagstotal_numa_faultss_countdev_msi_infod_revalidateerrstringbus_groupsirq_chippmd_ts_opd_sbsysv_shmdq_countutf8data_tableset_latency_tolerancedev_get_drvdata__func__resource_size_tfoliowake_entryxa_headsuidirq_domain_opsi_readcountirq_write_msi_msglocked_vmthreads_oneshotrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_lenxen_pcibk_config_add_field_offset__kernel_clock_tclass_rcu_is_conditionalIRQ_GC_INIT_NESTED_LOCKbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countarch_addr_hiksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriesrequest_mutexs_qcopatomic_talloc_tag_countersdomain_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_idbridge_ctlclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirVTIME_USERsa_flagstest__kmalloc_cache_noprofDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalsupported_speedsmapcountem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOthreads_activecurrent_may_mountarch_addr_loseqlock_tnuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskcan_maskregfuncindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validvertical_positioni_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockmsi_msg___GFP_MOVABLE_BITpcie_bwctrl_dataactivexlatedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsgetattrFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersdriver_exclusive_resourceselectorMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasedefault_timer_slack_nsirq_set_typesource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BITprivate_datagroup_infovdso_imagefileof_match_tablepercpu_count_ptr__user_state_sizewarned_on_writedmar_subhandlepcie_cap_lockmce_kill_meuuid_tproperty_read_int_arraynr_actions___GFP_UNUSED_BITconf_word_readcount_objects_stimezone_device_dataf_wb_errhandler_namephysfndefparamlast_unhandledfred_csfault_flagresend_nodekprojid_tptracer_credtlb_genstorepage_mkwritekobjectaudit_ttymce_ripvstatfsats_enablednumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisteetlp_prefix_pathclass_groupsnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listrevmap_sizeaudit_contextpp_ref_countsysfs_opserror_detectedsequential_ioipi_send_maskis_busmaster_large_mapcountsda_is_staticformatftopenclavemask_cache_privdefault_irqsp_regcreatewrite_msi_msg_dataiattrirq_domain_bus_tokenrseqnfdssigvalvma_lockperf_event_listconfig_fieldsget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadirqactiond_realxen_pcibk_permissivelink_stateexpiry_activedqi_max_spc_limiteval_stringexception_table_entryevent_countparam_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimitDOMAIN_BUS_AMDVIi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderconfig_field_entrytimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tDOMAIN_BUS_PCI_MSIblocksirq_affinity_notifyset_infofileattr_getvectortimer_listaffinitydevice_dma_supportedd_ino_warnshiwater_vmtracepointcompound_headia_vfsuidirq_eoi__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersthread_maskino_timelimitpci_bus_flags_tsplice_writemsix_capstate_in_sysfssysfs_attrs__list_del_entry_validrom_base_regqf_nextio_window_1krangesiommu_mmirq_enableats_stucutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charfield_startprioprividle_notificationsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabled__compiletime_assert_194fixups__compiletime_assert_196__compiletime_assert_197file_operationsKMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITsyncsetleasepinspacct_structxen_pcibk_write_config_dwordmust_resumelong intfile_lock_contextusageuv_alloc_infol_yessiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ss__dynamic_dev_dbgproperty_presentmsi_domain_ops__kmalloc_indexUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncthreads_handledegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSis_thunderboltmark_dirtythread_flagsnum_srcu_structsbdi_writebackkobj_completionpci_read_config_dword__kernel_clockid_trlimseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEirq_common_dataf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idmultifunctiondepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldmultipleDOMAIN_BUS_GENERIC_MSIssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structsym_timens_pagexen_pcibk_dev_datapi_lock___orig_eipprobestubget_timemm_cid_activedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argsirq_unmasksrcu_reader_flavortv_nseci_lruiommu_cookied3cold_allowedgfp_maskpi_state_listrcu_segcblistsubvolbase_addressfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_iddev_pin_infodmar_reserved_0srcu_structrlim_curnofaultxen_pcibk_field_is_dupmm_countcputime_atomicdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledirqs_unhandledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextdmar_base_addressmsi_prepareopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYelemsizeread_folionr_eventsiommuprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxtph_enabledsplice_pipeuclamp_reqeffective_affinitypasid_no_tlps_lock_keyreset_donesrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsslotstqheadmsi_domain_cookies_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truedcookiehres_activebpf_raw_eventsdq_dirtydl_deferbug_listdirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemadd_busignore_childrenresourcerestore_earlyclock_mutexfs_supersnotifydqb_bsoftlimitpendingf_task_work___GFP_NORETRY_BITiowait_countmatch_driverdma_io_tlb_memstringread_countfutex_offsetlong long inthwsizemmio_always_onx86_msi_addr_hiatomic_flagssysvshmtimer_expiresirq_set_vcpu_affinitytrace_evalsactive_basesearly_initrcec_eamprotectsecurityxmm_spaceactivatemsix_basef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbX86_IRQ_ALLOC_TYPE_UVvm_flags_trefcount_struct___GFP_FS_BITdmar_index_15i_bytesdomain_datarelax_countdevice_attribute___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersnvec_useddev_tFREEZE_HOLDER_USERSPACEmsi_capdup_xol_addrrevmapcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sex86_msi_addr_loElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersbridged_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codeinit_dev_msi_infothread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributespci_set_masterset_child_tid_overruntmpfilercu_read_lock_nestingem_perf_statetick_dep_maskatomic_readlistthrottle_disksi_errnoromlens_inode_lruconf_byte_readsrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionalxen_pcibk_config_header_add_fieldsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTdevfnregsslice_maxlast_switch_countqsize_tmsi_desc_datafilesdevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedpdevpci_power_tclass_preempt_notrace_is_conditionalret_stacknode_idautosuspend_delayunsigned intgendiskspc_timelimits_instancesdescseqcountremove_busoom_score_adjd_seqia_vfsgidsize_tdevidptm_enabledcap_permittedTT_NATIVEaffinity_hintclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxerror_statercu_tasks_holdouttarget_listno_64bit_msipasid_activatedpi_sePCI_ROM_RESOURCEget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecneeds_fresets_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocPCI_IOV_RESOURCE_ENDpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupci_read_config_bytepgtables_bytesget_linkirq_shutdownfmode_tdevtpci_channel_state_trestoredelayed_callmsi_instance_cookiemax_nr_cid_statusd_sibX86_IRQ_ALLOC_TYPE_DMARdma_opsioapic_alloc_infobin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedhdr_typedl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqmsi_locklinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tdpc_rp_extensionsclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errstatus_use_accessorscputimertrace_recursionhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerPCI_STD_RESOURCESdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrdmar_subhandle_validget_next_child_nodeFAULT_FLAG_WRITEirq_set_irqchip_statevm_fault_ttty_structUTASK_SSTEP_TRAPPEDfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleio_cqres_attr_wcelf64_symlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSp2pdmasyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_modbus_select_token_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredpcie_flags_regsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabirq_release_resourcesclass_read_lock_irqsave_is_conditionaldma_pools_addr_lsbi_generation_sigpollprocentmxcsrX86_IRQ_ALLOC_TYPE_AMDVId_rt_spc_hardlimitpci_error_handlersnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inoxen_pcibk_read_vendordyndbg_infoindexmsi_parent_opsdriver_datathread_headdev_pm_qosmap_typef_oppids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizeconf_dword_writeptm_granularityid_tabledq_sbarch_static_branchptm_rootsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entry___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestedpm_devmsi_translatenr_forced_migrationsnum_argsri_timerstack_canarydestid_8_31blksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cnttranslateiopl_warnrmdirpcie_link_statesockhash_lenget_policyHRTIMER_RESTARTexternal_facingirq_nmi_setupsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsptm_cap_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsirqs_per_chiprcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authirq_bus_sync_unlockvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxirq_hw_number_tstart_stackwatcherskmalloc_cachesredirect_hintcompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELioapiccore_nodepri_capsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_datairq_flow_handler_tpasid_featuresfieldirqstatget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structbin_attrs_newhwirq_maxruntime_idleconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenIRQCHIP_STATE_LINE_LEVELis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infosaved_cap_spaceerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2backstate_add_uevent_sentblock_cfg_accessi_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumeirq_disablewake_qfileattr_setkzalloc_noprofrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsDOMAIN_BUS_WAKEUPonlineruntime_resumedup_xol_workpermissivereg_basepercpu_enabled___GFP_WRITE_BITicookieMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignDOMAIN_BUS_NEXUSdelay_worktot_countoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tseccomp_filterstimedestid_0_7i_mmapirq_startupthaw_superd_lrusignal_structDOMAIN_BUS_VMD_MSIperf_event_mutexpri_enabledcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeis_msixki_completevtime_statewakee_flipsset_aclrom_attr_enabledpids_activedrivermsix_ctrlget_hwirqi_opskip_bus_pmldt_usr_sembar_writekobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodemsi_post_freesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatemaskbar_readwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startdisablehuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysenable_intxsrcu_cb_mutexstatic_call_sitebladeMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswhandle_irqMODULE_STATE_GOINGDL_DEV_UNBINDINGbus_select_maskmulti_capthreadsym_timens_pagesriov_configures_time_minbusn_ress_devcpus_allowed_lockget_next_idrwlock_tpgprotfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utimebus_list_dummy_pkeymsi_alloc_info_tiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitconfig_fieldac_flagwrite_msi_msgcoredump_datatasks_pidaddress_spacemm_context_tis_probed__call_single_nodestartupirq_mask_ackis_virtualcommand_writeseqcount_spinlock_ti_wbpanelclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedcond_suspend_depthvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipebasehostuaddractive_lows_wb_errshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoirq_managedunusedalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidi_rt_spc_timelimitrseq_sigdev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modewakeup_preparedpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwlimitkobjcommand_initfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleasedthread_fndep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timeirq_suspendrobust_list_headisr_oncurrent_state__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackPCI_BRIDGE_RESOURCESlevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_beginaffinity_notifyvdsommap_legacy_basepipe_inode_infocur_bus_speedsecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opspref_windowslicesas_ss_spnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listlink_bwctrlsrcu_barrier_completionsaved_config_spacedriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssubdevicesessionidarch_atomic_read_sifields_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_infopadding1llistdebugfs_entryacs_capelemnr_retriesIRQCHIP_STATE_PENDINGsigval_talimitundo_listKMALLOC_RANDOM_STARTdelivery_modeirq_datamask_cache_dev_warnmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typeconf_byte_writemtimeserver_has_tasksvm_faultoom_score_adj_minx86_msi_datakobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memhotplug_slotpathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkheader_1clock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handleriommu_groupperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockis_preparedproc_dir_entryvm_opsiopollpagesizes_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7no_d1d2_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstatebroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidunlocked_ioctlrseq_lenparammodule_attributepollfdnr_wakeups_remotepci_busllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awarestate_use_accessorsclass_spinlock_irqsave_is_conditionalrseq_csprimarynum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnon_compliant_bars_pincounttablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqltr_pathcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codeqspinlock__kmalloc_large_noprofirq_compose_msi_msglru_genirq_set_wakeinsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextrevisiongpl_symsseq_showswait_queue_headcow_pageblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgunmapfull_namepci_device_idnoderesetvm_lockpci_saved_stateno_cgroup_migrationnextevts_writers_key__countirq_cntxcomp_bvcma_areastatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimereg_writelstate_remove_uevent_sentlegacy_memdmar_formatia_sizein_hrtirqs_master_keysarch_msi_msg_addr_hi_tpropertywchar_addr_bndkernel_symbolsubsys_datatv_secis_64pid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdX86_IRQ_ALLOC_TYPE_HPETnr_failed_migrations_affineuser_cpus_ptrpi_top_taskaddress_lounlinkslotactoruprobenotifier_subscriptionss_readonly_remountutil_sumreserved_0st_otheri_mutex_keyksethrtimer_clock_basevruntime__compiletime_assert_738disable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusebar_resetdqi_flagsl1sssriov_set_msix_vec_countkfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queueirq_descdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimesigactionwake_activedev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimesched_rt_mutexlocked_pendingreset_preparenr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listis_msi_managedktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagIRQ_GC_MASK_CACHE_PER_TYPEi_uidpci_intxcur_valueparent_dataspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmirq_domain_chip_genericdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filereserved_1nr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipirq_nameqc_dqblkmmappedseqcount_raw_spinlockbroken_intx_maskingirq_pm_shutdownkill_sbd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqrcu_syncpreempt_notifiersDOMAIN_BUS_TI_SCI_INTA_MSIsrcu_last_gp_ends_fsnotify_infoDOMAIN_BUS_PCI_DEVICE_MSIXmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocsubvendord_parentconf_word_writetransparentpci_write_config_dwordpayloadac_minflti_sbkmalloc_noprofmatchcommcan_matchlast_timePIDTYPE_PIDofflineis_levelatomic_write_segments_maxatomic_openstart_prevent_timereadahead_controlsubordinate__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesselecthost_dataread_newsignalfd_wqhmmapmodnameerrnumdomain_free_irqsasync_put_workmknodpri_reqs_allocirq_gc_flagsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapdma_alias_maskwritepagessched_statisticsirq_alloc_infohead__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampsuper_operationssplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATApt_regswhichPCI_BRIDGE_RESOURCE_ENDpipe_bufsKOBJ_NS_TYPE_NETctx_idarch_msi_msg_addr_lo_td_rt_spc_warnspci_write_config_wordi_verity_infoirq_retriggerxsavetimespec_type__rb_parent_colordevres_lockbitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoats_capDD_CLASS_TYPE_LEVEL_NAMESdev_flagsvm_private_dataio_bitmapPCI_NUM_RESOURCESuprobe_task_statetimerkobj_typebroken_parity_statusdeactivatei_pageshlist_bl_headino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitirq_alloc_typedoe_mbspage_fragwrite_bytesiobasecharqf_ownerunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledgraph_get_port_parent__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nrfreeze_fsuserfaultfd_ctxsigset_tmask_posrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountbar_initpage_freebridge_d3__UNIQUE_ID_ddebug737__UNIQUE_ID_ddebug739parentirq_set_affinityatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeget_named_child_nodelaunder_foliocurr_target__UNIQUE_ID_ddebug745numberis_suspendedX86_IRQ_ALLOC_TYPE_IOAPIChotplugburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updateIRQCHIP_STATE_ACTIVEvendorcap_bsetarchdata_sourcepower_statenr_perf_statesstack_vm_areakstat_irqssaved_statecfg_sizebasespcie_mpsss_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcounterskasan_check_readname_linkchipcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typesriovpolicysharedpercpu_dev_iddismissconf_field_resetd_real_typelookahead_bandseq_startnum_chipsraw_lockd_dnameget_dqblkmax_hang_timeirq_nmi_teardowncpus_maskDOMAIN_BUS_ANYsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcecmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailslinenobase_pfnERR_PTRget_inode_acl_addr_pkeymigrate_foliocustom_sliceaer_capthread_keyringkparam_arrayutimestart_codeis_managedis_harddest_mode_logicalfsbasecompatiblesubsystem_deviceclock_listattrsdynidscpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axheader_commonpriv_flagscompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldreservedlatency_record_countheader_0cgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperirq_chip_regsrom_bar_overlappref_64_windowi_aclwake_enabled___GFP_ZERO_BITpci_clear_mwiwrite_newlist_lockpm_domaincpu_bitmapthreads_handled_laststatic_call_keyutil_estucountsqc_statevirt_destid_8_14handledsoftirq_next_timercheck_flagshandlerswp_entry_tmsi_descirq_get_irqchip_state_mapcountdomain_tagpasid_requiredhang_detectedchild_ns_typeqf_fmt_idinterrupt_reads_vfs_rename_keyeventIRQCHIP_STATE_MASKEDirq_maskset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanwake_depthfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delay__compiletime_assert_736dma_cleanupmaple_treeKMALLOC_DMAdentrycpu_itimerpercpusriov_get_vf_total_msixrel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlink__compiletime_assert_740__compiletime_assert_742__compiletime_assert_744__compiletime_assert_746pushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancesrangefutex_exit_mutexkernfs_iattrstrc_blkd_nodeIRQ_GC_NO_MASKack_intrd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagswait_for_threadsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingPCI_STD_RESOURCE_ENDbus_tokenDOMAIN_BUS_IPIis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typestate_savedi_rdevirq_reroute_variantself_exec_idDOMAIN_BUS_WIRED_TO_MSIkernfs_opsfile_lockMODULE_STATE_LIVEclass_masknr_migrationsa_opsxa_flagspercpu_affinityfreezebin_sizemap_busclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITX86_IRQ_ALLOC_TYPE_PCI_MSIXirq_affinity_descd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITirq_baseset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkis_virtfnpercpu_refhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infoallow_interrupt_controlfutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingresource_sizeRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightcommonvm_files_stateuser_sizedev_pm_opsxsd_errorsscheduledFAULT_FLAG_TRIEDraw_atomic_readclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkkmalloc_typeqstrma_flagsno_msifutex_stateorig_pmdxen_pcibk_config_add_fieldshpc_managedacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posirq_print_chipnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsbus_dma_regiondpc_capio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headconf_dword_readrcharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointepoll_watchesprealloc_ptedqb_curspace_entrygp_statebitsetload_avgrom_writeaccesscstimepcie_capcore_internal_state__do_not_mess_with_itcfs_rq_uidmsi_indexst_spacemm_cid_next_scanns_type__UNIQUE_ID_ddebug743msix_enabledac_majfltreal_timerpasid_enabledposix_cputimers_work_upperforce_resume_depthmodule_param_attrsshort unsigned intbus_flagsno_suspend_depthi_mutex_dir_keyq_nodespc_warnlimitvalids_encodinggpl_crcsorc_entrykeysorig_ptepasid_capdqb_curinodesload__s8pci_get_drvdatainvalidate_lock_keydma_maskprealloc_mutexnanosleepDOMAIN_BUS_FSL_MC_MSIsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionpercpu_ref_func_tseq_stoppci_dev_flags_tdev_iddomain_alloc_irqskiocbclass_rwsem_read_intr_is_conditionalprobefsuidaer_statss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKpci_set_mwibpf_storagepci_enable_deviceIRQ_GC_INIT_MASK_CACHEirq_flags_to_cleararch_msi_msg_data_tno_callbacks__u16timers_activewait_countsig_okhwirqdelaysirq_safereadaheadkmalloc_cache_typepci_bar_infomutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagsysdatafs_flagsworkpgprotval_tkeytypesigpendingfsindexshstknum_ctsrcu_sspwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialpci_disable_deviceHPROBE_GONEactive_timei_sequencepci_vpdpci_read_config_worddqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendori_dir_seqirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmacls_mskchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typeirq_resumedpc_rp_log_sizeimm_readyf_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infooverride_onlysched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimerequired_flagsdeadlinepinned_vm_head_2apsi_flagsaddressstart_boottimeenablevm_startIRQ_GC_BE_IOs_flagscpumask_var_tfaultmsi_domain_infoshow_statsdl_densityfreeptr_tread_dqblkdq_flagschip_dataDD_CLASS_TYPE_DISJOINT_NAMESpci_devmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_countpci_write_config_bytes_umountis_bin_visiblepgoffpending_masksyscall_user_dispatchrcu_tasks_exit_listset_descarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_done___GFP_ACCOUNT_BITpud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typemsi_enabledseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memarch_spinlock_ti_mtime_nsecperformanceDOMAIN_BUS_PCI_DEVICE_MSImmlistdevcapsuppress_bind_attrsRPM_RESUMINGreg_offsetgsbases_quota_typesirqchip_irq_statef_llistIRQ_NONEphandlei_nlinkbranchwrite_begingroupserr_handlerno_vf_scanpi_blocked_onDOMAIN_BUS_DEVICE_MSIs_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superinstalleds_inode_list_locksweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersxen_pcibk_config_add_fieldsint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structpci_msi_descon_rqfs_contextprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfunsafe_warnllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclassaddress_hilast_mm_ciduntrustedcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesacpi_device_idd_ino_countlast_cpuilenmnt_flagscred_guard_mutex__UNIQUE_ID_ddebug735pci_opssigcnthrtimer_cpu_baseresourcescb_headcheck_quota_filedirty_folioattributerestrict_linkdev_archdatai_deviceskey_perm_tpi_state_cacheclass_disable_irq_is_conditionalconf_field_freeanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knchip_typessival_ptri_opflagsrobust_listconf_field_initsym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapmsi_attribfiltercurr_ret_stackirqreturn_tdockbar_releasedev_links_infoirq_bus_lockloff_tthread_pidsrcu_gp_seqno_command_memoryprepare_desc_archipi_send_singlexen_pcibk_write_config_bytest_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlencleanclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnoirq_calc_maskbatchasync_sizeacct_vm_mem1i_mtime_secDOMAIN_BUS_PLATFORM_MSImemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idmsi_freefop_flags_tirq_fwspecFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmsi_initmodule_statelast_used_atirq_chip_type__compiletime_assert_473vm_endlast_queuednuma_migrate_retryuser_nsirq_ack__statefirstmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctimeDOMAIN_BUS_WIREDFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_areadev_datairq_request_resourcesirq_chip_genericrlockfl_owner_tpci_is_enabled_reseuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtgc_flagsvm_policyperf_rdpmc_allowedrdevkernel_ulong_tDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayirq_flags_to_setRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpreg_readlctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenpme_supportdqb_btime_nr_pages_mappedutf8datarevmap_treemm_userss_ids_dentry_lrubp_offsetmask_basefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsdmar_index_0_14release_workparent_irqksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliodriver_managed_dmaMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaDOMAIN_BUS_DMARdl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intpci_clear_masteranon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_highd1_supportarch_uprobemsi_mask_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedX86_IRQ_ALLOC_TYPE_PCI_MSIcompat_long_tactive_counts_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagsxen_pcibk_read_config_bytesupported_flagstotal_numa_faultss_countdev_msi_infod_revalidateerrstringbus_groupsirq_chippmd_ts_opd_sbsysv_shminstrument_atomic_readdq_countutf8data_tableset_latency_tolerancedev_get_drvdata__func__resource_size_tfoliowake_entryxa_headsuidirq_domain_opsi_readcountirq_write_msi_msglocked_vmthreads_oneshotrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_lenxen_pcibk_config_add_field_offset__kernel_clock_tclass_rcu_is_conditionalIRQ_GC_INIT_NESTED_LOCKbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countarch_addr_hiksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriesrequest_mutexs_qcopatomic_talloc_tag_countersdomain_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_idbridge_ctlclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirVTIME_USERsa_flagstest__kmalloc_cache_noprofDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalsupported_speedsmapcountem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOthreads_activecurrent_may_mountarch_addr_loseqlock_tnuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskcan_maskregfuncindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validvertical_positioni_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockmsi_msg___GFP_MOVABLE_BITpcie_bwctrl_dataactivexlatedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsgetattrFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersdriver_exclusive_resourceselectorMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasedefault_timer_slack_nskcsan_check_accessirq_set_typesource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BITprivate_datagroup_infovdso_imagefileof_match_tablepercpu_count_ptr__user_state_sizewarned_on_writedmar_subhandlepcie_cap_lockmce_kill_meuuid_tproperty_read_int_arraynr_actions___GFP_UNUSED_BITconf_word_readcount_objectserror_stimezone_device_dataf_wb_errhandler_namephysfndefparamlast_unhandledfred_csfault_flagresend_nodekprojid_tptracer_credtlb_genstorepage_mkwritekobjectaudit_ttymce_ripvstatfs_dev_errats_enablednumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisteetlp_prefix_pathclass_groupsnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexit__UNIQUE_ID_ddebug741errseq_tioctx_tableVTIME_SYSchangedwatch_listrevmap_sizeaudit_contextpp_ref_countsysfs_opserror_detectedsequential_ioipi_send_maskis_busmaster_large_mapcountsda_is_staticformatftopenclavemask_cache_privdefault_irqsp_regcreatewrite_msi_msg_dataiattrirq_domain_bus_tokenrseqpci_cmd_infonfdssigvalvma_lockperf_event_listconfig_fieldsget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadirqactiond_realxen_pcibk_permissivelink_stateexpiry_activedqi_max_spc_limiteval_stringexception_table_entryevent_countparam_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimitDOMAIN_BUS_AMDVIi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tDOMAIN_BUS_PCI_MSIblocksirq_affinity_notifyset_infofileattr_getvectortimer_listaffinitydevice_dma_supportedd_ino_warnshiwater_vmtracepointcompound_headia_vfsuidirq_eoi__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersthread_maskino_timelimitpci_bus_flags_tsplice_writemsix_capstate_in_sysfssysfs_attrsrom_base_regqf_nextio_window_1krangesiommu_mmirq_enableats_stucutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprividle_notificationsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITsyncsetleasepinstmpvalpacct_structmust_resumelong intfile_lock_contextusageuv_alloc_infol_yessiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ss__dynamic_dev_dbgproperty_presentmsi_domain_ops__kmalloc_indexUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncthreads_handledegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSis_thunderboltmark_dirtythread_flagsnum_srcu_structsbdi_writebackkobj_completionpci_read_config_dword__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEirq_common_dataf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablebist_writememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idmultifunctiondepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldmultipleDOMAIN_BUS_GENERIC_MSIssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structxen_pcibk_dev_datapi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenlen_valmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argsirq_unmasksrcu_reader_flavortv_nseci_lruiommu_cookied3cold_allowedgfp_maskpi_state_listrcu_segcblistsubvolbase_addressfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_iddev_pin_infodmar_reserved_0srcu_structrlim_curnofaultmm_countcputime_atomicdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledirqs_unhandledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextdmar_base_addressmsi_prepareopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientdma_configurexen_pcibk_read_deviceruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_eventsiommuprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxtph_enabledsplice_pipeuclamp_reqeffective_affinitypasid_no_tlps_lock_keyreset_donePCI_IOV_RESOURCESsrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsslotstqheadmsi_domain_cookies_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truedcookiehres_activebpf_raw_eventsdq_dirtydl_deferbug_listdirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemadd_busignore_childrencommand_readresourcerestore_earlyclock_mutexfs_supersnotifydqb_bsoftlimitpendingf_task_work___GFP_NORETRY_BITiowait_countmatch_driverdma_io_tlb_memstringread_countfutex_offsetlong long intDEVICE_COUNT_RESOURCEhwsizemmio_always_onx86_msi_addr_hiatomic_flagssysvshmtimer_expiresirq_set_vcpu_affinitytrace_evalsactive_basesearly_initrcec_eamprotectsecurityxmm_spaceactivatemsix_basef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbX86_IRQ_ALLOC_TYPE_UVvm_flags_trefcount_struct___GFP_FS_BITdmar_index_15i_bytesdomain_datarelax_countdevice_attributelinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersnvec_useddev_tFREEZE_HOLDER_USERSPACEmsi_capdup_xol_addrrevmapcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sex86_msi_addr_loElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersbridged_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsmsi_field_initswap_deactivateblkcnt_ticq_treesi_codeinit_dev_msi_infothread_nodenr_itemsarch_tlbflush_unmap_batchmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributesset_child_tid_overruntmpfilercu_read_lock_nestingem_perf_statetick_dep_masklistthrottle_disksi_errnoromlens_inode_lruconf_byte_readsrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionalof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTdevfnregsslice_maxlast_switch_countqsize_tmsi_desc_datafilesdevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedpdevpci_power_tclass_preempt_notrace_is_conditionalret_stacknode_idautosuspend_delayunsigned intgendiskspc_timelimits_instancesdescseqcountpm_ctrl_writeremove_busoom_score_adjd_seqia_vfsgidsize_tdevidptm_enabledcap_permittedTT_NATIVEaffinity_hintclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxerror_statercu_tasks_holdouttarget_listno_64bit_msipasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecneeds_fresets_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkirq_shutdownfmode_tdevtpci_channel_state_trestoredelayed_callmsi_instance_cookiemax_nr_cid_statusd_sibX86_IRQ_ALLOC_TYPE_DMARcaplist_msidma_opsioapic_alloc_infobin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedhdr_typedl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqmsi_locklinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tdpc_rp_extensionsclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errstatus_use_accessorscputimertrace_recursionhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrdmar_subhandle_validget_next_child_nodeFAULT_FLAG_WRITEirq_set_irqchip_statevm_fault_ttty_structUTASK_SSTEP_TRAPPEDfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleio_cqfield_configres_attr_wcelf64_symlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSp2pdmasyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_modbus_select_token_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredpcie_flags_regsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabirq_release_resourcesclass_read_lock_irqsave_is_conditionalallowed_bitsdma_pools_addr_lsbi_generation_sigpollprocentmxcsrX86_IRQ_ALLOC_TYPE_AMDVId_rt_spc_hardlimitpci_error_handlersnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexmsi_parent_opsdriver_datathread_headdev_pm_qosmap_typef_oppids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizeconf_dword_writeptm_granularityid_tabledq_sbarch_static_branchptm_rootsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrygc_flagscmin_fltrw_semdqio_semprev_sum_exec_runtimenestedpm_devmsi_translatenr_forced_migrationsnum_argsri_timerstack_canarydestid_8_31blksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cnttranslateiopl_warnrmdirpcie_link_statesockhash_lenget_policy__list_add_validHRTIMER_RESTARTexternal_facingirq_nmi_setupsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsptm_cap_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsirqs_per_chiprcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authirq_bus_sync_unlockvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxirq_hw_number_tstart_stackwatchersredirect_hintcompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELioapiccore_nodepri_capsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_datairq_flow_handler_tpasid_featuresfieldirqstatget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structbin_attrs_newhwirq_maxruntime_idleconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenIRQCHIP_STATE_LINE_LEVELis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infosaved_cap_spaceerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2backstate_add_uevent_sentblock_cfg_accessi_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumeirq_disablewake_qfileattr_setpci_busbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointersect_attrsDOMAIN_BUS_WAKEUPonlineruntime_resumedup_xol_workpermissivereg_basepercpu_enabledicookieMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignDOMAIN_BUS_NEXUSdelay_worktot_countoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tseccomp_filterstimedestid_0_7list_add_taili_mmapirq_startupthaw_superd_lrusignal_structDOMAIN_BUS_VMD_MSIperf_event_mutexpri_enabledcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeis_msixki_completevtime_statewakee_flipsset_aclrom_attr_enabledpids_activedrivermsix_ctrlget_hwirqi_opskip_bus_pmldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodemsi_post_freesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatemaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startdisablehuge_faultkstatfssitesxen_pcibk_read_config_dwordDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysenable_intx__list_addsrcu_cb_mutexstatic_call_sitebladeMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswhandle_irqMODULE_STATE_GOINGDL_DEV_UNBINDINGbus_select_maskmulti_capthreadsym_timens_pagesriov_configures_time_minbusn_ress_devcpus_allowed_lockget_next_idrwlock_tpgprotfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utimebus_list_dummy_pkeymsi_alloc_info_tiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitconfig_fieldac_flagwrite_msi_msgcoredump_datatasks_pidaddress_spacemm_context_tis_probed__call_single_nodestartupirq_mask_ackis_virtualseqcount_spinlock_ti_wbpanelclass_idinactive_timer_pkeyfilenames_export_op__mptri_flctxstashedcond_suspend_depthvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_prioxen_pcibk_config_capability_msidestroy_inoderelease_foliolast_busyi_pipebasehostuaddractive_lows_wb_errshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfocaplist_headerirq_managedunusedalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidi_rt_spc_timelimitrseq_sigdev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modewakeup_preparedpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwlimitkobjfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleasedthread_fndep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timeirq_suspendrobust_list_headisr_oncurrent_state__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_beginaffinity_notifyvdsommap_legacy_basepipe_inode_infocur_bus_speedsecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opspref_windowslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalsuspend_latewakeupcg_listlink_bwctrlsrcu_barrier_completionsaved_config_spacedriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssubdevicesessionid_sifields_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_infopadding1llistdebugfs_entryacs_capelemnr_retriesIRQCHIP_STATE_PENDINGsigval_talimitundo_listdirty_foliodelivery_modeirq_datamask_cachemissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typeconf_byte_writemtimeserver_has_tasksvm_faultoom_score_adj_minx86_msi_datakobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memhotplug_slotpathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handleriommu_groupperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockis_preparedcaplist_pmproc_dir_entryvm_opsiopollpagesizes_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7no_d1d2_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstatebroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidunlocked_ioctlrseq_lenparammodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awarestate_use_accessorsclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnon_compliant_bars_pincounttablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqltr_pathcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codeqspinlockirq_compose_msi_msglru_genirq_set_wakeinsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextrevisiongpl_symsseq_showcap_offsetswait_queue_headcow_pagexen_pcibk_config_capability_vpdblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgunmapxen_pcibk_config_capability_add_fieldsfull_namepci_device_idnoderesetvm_lockpci_saved_stateno_cgroup_migrationnextevts_writers_key__countirq_cntxcomp_bvcma_areastatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimereg_writelstate_remove_uevent_sentlegacy_memdmar_formatia_sizein_hrtirqs_master_keysarch_msi_msg_addr_hi_tpropertywchar_addr_bndkernel_symbolsubsys_datatv_secis_64pid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdX86_IRQ_ALLOC_TYPE_HPETnr_failed_migrations_affineuser_cpus_ptrpi_top_taskaddress_lounlinkslotactoruprobenotifier_subscriptionss_readonly_remountutil_sumreserved_0st_otheri_mutex_keyksethrtimer_clock_basevruntime__compiletime_assert_738disable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacemsi_msix_flags_writevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsl1sssriov_set_msix_vec_countstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queueirq_descdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimesigactionwake_activedev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimesched_rt_mutexlocked_pendingreset_preparenr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listis_msi_managedktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagIRQ_GC_MASK_CACHE_PER_TYPEi_uidparent_dataspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmirq_domain_chip_genericdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filereserved_1nr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipcap_listirq_nameqc_dqblkmmappedseqcount_raw_spinlockbroken_intx_maskingirq_pm_shutdownkill_sbd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headnew_valuewait_startxen_pcibk_config_capability_pmf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqrcu_syncpreempt_notifiersDOMAIN_BUS_TI_SCI_INTA_MSIsrcu_last_gp_ends_fsnotify_infoDOMAIN_BUS_PCI_DEVICE_MSIXmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskint_typeVTIME_IDLEstatic_keyremoves_magicdl_overrunallocsubvendord_parentconf_word_writetransparentpayloadac_minflti_sbmatchcommcan_matchlast_timePIDTYPE_PIDofflineis_levelatomic_write_segments_maxatomic_openstart_prevent_timereadahead_controlsubordinate__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesselecthost_dataread_newsignalfd_wqhmmapmodnameerrnumdomain_free_irqsasync_put_workmknodpri_reqs_allocirq_gc_flagsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapdma_alias_maskwritepagessched_statisticsirq_alloc_infohead__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATApt_regsenablepipe_bufsKOBJ_NS_TYPE_NETctx_idarch_msi_msg_addr_lo_td_rt_spc_warnspci_write_config_wordi_verity_infoirq_retriggerxsavetimespec_type__rb_parent_colordevres_lockbitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoats_capDD_CLASS_TYPE_LEVEL_NAMESdev_flagsvm_private_dataio_bitmapuprobe_task_statetimerkobj_typebroken_parity_statusdeactivatei_pageshlist_bl_headino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitirq_alloc_typedoe_mbspage_fragwrite_bytesiobasecharqf_ownerunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledgraph_get_port_parent__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nrfreeze_fsuserfaultfd_ctxsigset_tmask_posrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freebridge_d3__UNIQUE_ID_ddebug737parentirq_set_affinityatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeget_named_child_nodelaunder_foliocurr_targetnumberis_suspendedX86_IRQ_ALLOC_TYPE_IOAPIChotplugburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updateIRQCHIP_STATE_ACTIVEvendorcap_bsetarchdata_sourcepower_statenr_perf_statesstack_vm_areakstat_irqssaved_statepci_find_capabilitycfg_sizebasespcie_mpsss_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkchipmsix_field_initcmaxrssno_d3coldtimer_slack_nsbus_typesriovpolicysharedpercpu_dev_iddismissconf_field_resetd_real_typelookaheadold_value_bandseq_startnum_chipsraw_lockd_dnameget_dqblkmax_hang_timeirq_nmi_teardowncpus_maskDOMAIN_BUS_ANYsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcecmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailslinenobase_pfnERR_PTRget_inode_acl_addr_pkeymigrate_foliocustom_sliceaer_capthread_keyringkparam_arrayutimestart_codeis_managedis_harddest_mode_logicalfsbasecompatiblesubsystem_deviceclock_listattrsdynidscpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axpriv_flagscapabilitycompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperirq_chip_regsrom_bar_overlappref_64_windowi_aclwake_enabledwrite_newlist_lockpm_domaincpu_bitmapthreads_handled_lastxen_pcibk_config_capability_msixstatic_call_keyutil_estucountsqc_statevirt_destid_8_14handledsoftirq_next_timercheck_flagshandlerswp_entry_tmsi_descirq_get_irqchip_state_mapcountdomain_tagpasid_requiredhang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventIRQCHIP_STATE_MASKEDirq_maskset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanwake_depthfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcaplist_vpdcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delay__compiletime_assert_736dma_cleanupmaple_treedentrycpu_itimerpercpusriov_get_vf_total_msixrel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancesrangefutex_exit_mutextrc_blkd_nodeIRQ_GC_NO_MASKack_intrd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagswait_for_threadsnvcswwatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingbus_tokenDOMAIN_BUS_IPIxen_pcibk_get_interrupt_typeis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typestate_savedi_rdevirq_reroute_variantself_exec_idDOMAIN_BUS_WIRED_TO_MSIkernfs_opsfile_lockMODULE_STATE_LIVEclass_masknr_migrationsa_opsxa_flagspercpu_affinityfreezebin_sizemap_busclosedev_dma_attrgrphiX86_IRQ_ALLOC_TYPE_PCI_MSIXirq_affinity_descd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockirq_baseset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkis_virtfnpercpu_refvpd_address_writehorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infoallow_interrupt_controlfutexwait_maxDEV_DMA_NON_COHERENTresult_maskmsi_msix_field_configstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightcommonvm_files_stateuser_sizedev_pm_opsxsd_errorsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrqstrma_flagsno_msifutex_stateorig_pmdshpc_managedacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posirq_print_chipnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lenmsix_field_configcinblockextableexitkernel_param_opsbus_dma_regiondpc_capio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headlist_is_headconf_dword_readrcharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgaccesscstimepcie_capcore_internal_state__do_not_mess_with_itcfs_rq_uidmsi_indexst_spacemm_cid_next_scanns_typemsix_enabledac_majfltreal_timerpasid_enabledposix_cputimers_work_upperforce_resume_depthmodule_param_attrsshort unsigned intbus_flagsno_suspend_depthi_mutex_dir_keyq_nodespc_warnlimitvalids_encodinggpl_crcsorc_entrykeysorig_ptepasid_capdqb_curinodesload__s8pci_get_drvdatainvalidate_lock_keycaplist_msixdma_maskprealloc_mutexDOMAIN_BUS_FSL_MC_MSImsi_field_configsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodxen_pcibk_read_config_wordsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionpercpu_ref_func_tseq_stoppci_dev_flags_tdev_iddomain_alloc_irqskiocbclass_rwsem_read_intr_is_conditionalprobefsuidaer_statss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageIRQ_GC_INIT_MASK_CACHEirq_flags_to_cleararch_msi_msg_data_tno_callbacks__u16timers_activewait_countsig_okhwirqdelaysirq_safereadaheadmutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagsysdatafs_flagsworkpgprotval_tkeytypesigpendingfsindexshstknum_ctsrcu_sspwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequencepci_vpdpci_read_config_worddqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendori_dir_seqirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmacls_mskchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typeirq_resumedpc_rp_log_sizeimm_readyf_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infooverride_onlycapabilitiessched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimerequired_flagsdeadlinepinned_vm_head_2apsi_flagsaddressstart_boottimevm_startIRQ_GC_BE_IOs_flagscpumask_var_tfaultmsi_domain_infoshow_statsdl_densityfreeptr_tread_dqblkdq_flagschip_dataDD_CLASS_TYPE_DISJOINT_NAMESpci_devmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_basemsi_masknum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffpending_masksyscall_user_dispatchrcu_tasks_exit_listset_descarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_donenanosleeppud_trt_spc_timelimitsym_int80_landing_padpci_set_power_statetailia_atimetlb_ubcquota_format_typemsi_enabledseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memarch_spinlock_ti_mtime_nsecperformanceDOMAIN_BUS_PCI_DEVICE_MSImmlistdevcapset_dqblksuppress_bind_attrsRPM_RESUMINGreg_offsetgsbases_quota_typesirqchip_irq_statef_llistIRQ_NONEphandlei_nlinkwrite_begingroupserr_handlerno_vf_scanpi_blocked_onDOMAIN_BUS_DEVICE_MSIs_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superinstalleds_inode_list_locksweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirxen_pcibk_config_capabilitynextentsxen_pcibk_config_capability_initreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structpci_msi_descon_rqfs_contextprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfunsafe_warnllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclassaddress_hilast_mm_ciduntrustedcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesacpi_device_idd_ino_countlast_cpuilenmnt_flagscred_guard_mutex__UNIQUE_ID_ddebug735pci_opssigcntpm_caps_readhrtimer_cpu_baseresourcescb_headcheck_quota_fileprimaryattributerestrict_linkdev_archdatai_deviceskey_perm_tpi_state_cacheclass_disable_irq_is_conditionalconf_field_freeanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knchip_typessival_ptri_opflagsrobust_listconf_field_initsym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapmsi_attribfiltercurr_ret_stackirqreturn_tdockdev_links_infoirq_bus_lockloff_tthread_pidsrcu_gp_seqno_command_memoryprepare_desc_archipi_send_singlest_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlencleanclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnoirq_calc_maskbatchasync_sizeacct_vm_mem1i_mtime_secDOMAIN_BUS_PLATFORM_MSInew_statememory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idmsi_freefop_flags_tirq_fwspecFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmsi_initmodule_statelast_used_atirq_chip_typevm_endlast_queuednuma_migrate_retryuser_nsirq_ack__statefirstmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctimeDOMAIN_BUS_WIREDFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_areadev_datairq_request_resourcesirq_chip_genericrlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevkernel_ulong_tDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayirq_flags_to_setRPM_ACTIVEio_window__state_sizethread_structcached_requested_keyenvpreg_readlctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenpme_supportdqb_btime_nr_pages_mappedutf8datarevmap_treemm_userss_ids_dentry_lrubp_offsetmask_basefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsdmar_index_0_14release_workparent_irqksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliodriver_managed_dmaMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaDOMAIN_BUS_DMARdl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intenable_bitnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_highd1_supportarch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrregister_capabilityasync_probe_requestedX86_IRQ_ALLOC_TYPE_PCI_MSI__list_add_valid_or_reportcompat_long_tactive_counts_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagsxen_pcibk_read_config_bytesupported_flagstotal_numa_faultss_countdev_msi_infod_revalidateerrstringbus_groupsirq_chippmd_ts_opd_sbsysv_shmdq_countutf8data_tableset_latency_tolerancedev_get_drvdata__func__resource_size_tfoliowake_entryxa_headsuidirq_domain_opsi_readcountirq_write_msi_msglocked_vmthreads_oneshotrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_lenxen_pcibk_config_add_field_offset__kernel_clock_tclass_rcu_is_conditionalIRQ_GC_INIT_NESTED_LOCKbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countarch_addr_hiksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriesrequest_mutexs_qcopatomic_tdomain_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_idbridge_ctlclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirVTIME_USERsa_flagstestDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalsupported_speedsmapcountem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOthreads_activecurrent_may_mountarch_addr_loseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskcan_maskregfuncindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validvertical_positioni_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockmsi_msgpcie_bwctrl_dataactivexlatedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsgetattrFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersdriver_exclusive_resourceselectorMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasedefault_timer_slack_nsirq_set_typesource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_tprivate_datagroup_infovdso_imagefileof_match_tablepercpu_count_ptr__user_state_sizewarned_on_writedmar_subhandlepcie_cap_lockmce_kill_meuuid_tproperty_read_int_arraynr_actionsconf_word_readcount_objectserror_stimezone_device_dataf_wb_errhandler_namephysfndefparamlast_unhandledfred_csfault_flagresend_nodekprojid_tptracer_credtlb_genstorepage_mkwritekobjectaudit_ttymce_ripvstatfsats_enablednumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisteetlp_prefix_pathclass_groupsnuma_nodei_mmap_rwsemxen_pcibk_config_add_fields_offsetDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listrevmap_sizeaudit_contextpp_ref_countsysfs_opserror_detectedsequential_ioipi_send_maskis_busmaster_large_mapcountsda_is_staticformatftopenclavemask_cache_privdefault_irqsp_regcreatewrite_msi_msg_dataiattrirq_domain_bus_tokenrseqnfdssigvalvma_lockperf_event_listconfig_fieldsget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadirqactiond_realxen_pcibk_permissivelink_stateexpiry_activedqi_max_spc_limiteval_stringexception_table_entryevent_countparam_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimitDOMAIN_BUS_AMDVIi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tDOMAIN_BUS_PCI_MSIblocksirq_affinity_notifyset_infofileattr_getvectortimer_listaffinitydevice_dma_supportedd_ino_warnshiwater_vmtracepointcompound_headia_vfsuidirq_eoi__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersthread_maskino_timelimitpci_bus_flags_tsplice_writemsix_capstate_in_sysfssysfs_attrsrom_base_regqf_nextio_window_1krangesiommu_mmirq_enableats_stucutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprividle_notificationsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixups__compiletime_assert_196file_operationsno_pmgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITsyncsetleasepinspacct_structmust_resumelong intfile_lock_contextusageuv_alloc_infol_yessiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ss__dynamic_dev_dbgproperty_presentmsi_domain_opsUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncthreads_handledegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagsf_inodePROBE_PREFER_ASYNCHRONOUSis_thunderboltmark_dirtythread_flagsnum_srcu_structsbdi_writebackkobj_completionreal_value__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEirq_common_data__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idmultifunctiondepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldmultipleDOMAIN_BUS_GENERIC_MSIssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structxen_pcibk_dev_datapi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argsirq_unmasksrcu_reader_flavortv_nseci_lruiommu_cookied3cold_allowedgfp_maskpi_state_listrcu_segcblistsubvolbase_addressfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_iddev_pin_infodmar_reserved_0srcu_structrlim_curnofaultmm_countcputime_atomicdrv_groupsstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrppm_ctrl_initdl_throttledirqs_unhandledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextdmar_base_addressmsi_prepareopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_eventsiommuprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxtph_enabledsplice_pipeuclamp_reqeffective_affinitypasid_no_tlps_lock_keyreset_donesrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTmodsslotstqheadmsi_domain_cookies_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truedcookiehres_activebpf_raw_eventsdq_dirtydl_deferbug_listdirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemadd_busignore_childrenresourcerestore_earlyclock_mutexfs_supersnotifydqb_bsoftlimitpendingf_task_workiowait_countmatch_driverdma_io_tlb_memstringread_countfutex_offsetlong long inthwsizemmio_always_onx86_msi_addr_hiatomic_flagssysvshmtimer_expiresirq_set_vcpu_affinitytrace_evalsactive_basesearly_initrcec_eamprotectsecurityxmm_spaceactivatemsix_basef_pos_locki_fieldmasktls_arrayownerfieldsacct_rss_mem1need_mbX86_IRQ_ALLOC_TYPE_UVvm_flags_trefcount_structdmar_index_15i_bytesdomain_datarelax_countdevice_attribute___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersnvec_useddev_tFREEZE_HOLDER_USERSPACEmsi_capdup_xol_addrrevmapcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sex86_msi_addr_loElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersbridged_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codeinit_dev_msi_infothread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributes__list_del_entryset_child_tid_overruntmpfilercu_read_lock_nestingem_perf_statetick_dep_masklistthrottle_disksi_errnoromlens_inode_lruconf_byte_readsrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionalof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTdevfnregsslice_maxlast_switch_countqsize_tmsi_desc_datafilesdevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedpdevpci_power_tclass_preempt_notrace_is_conditionalret_stacknode_idautosuspend_delayunsigned intgendiskspc_timelimits_instancesdescseqcountremove_busoom_score_adjd_seqia_vfsgidsize_tdevidptm_enabledcap_permittedTT_NATIVEaffinity_hintclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxerror_statercu_tasks_holdouttarget_listno_64bit_msipasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecneeds_fresets_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkirq_shutdownfmode_tdevtpci_channel_state_trestoredelayed_callmsi_instance_cookiemax_nr_cid_statusd_sibX86_IRQ_ALLOC_TYPE_DMARdma_opsioapic_alloc_infobin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedhdr_typedl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqmsi_locklinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tdpc_rp_extensionsclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errstatus_use_accessorscputimertrace_recursionhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrdmar_subhandle_validget_next_child_nodeFAULT_FLAG_WRITEirq_set_irqchip_statevm_fault_ttty_structUTASK_SSTEP_TRAPPEDfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleio_cqres_attr_wcelf64_symlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSp2pdmasyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_modbus_select_token_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredpcie_flags_regsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabirq_release_resourcesclass_read_lock_irqsave_is_conditionaldma_pools_addr_lsbi_generation_sigpollprocentmxcsrX86_IRQ_ALLOC_TYPE_AMDVId_rt_spc_hardlimitpci_error_handlersnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexmsi_parent_opsdriver_datathread_headdev_pm_qosmap_typef_oppids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizeconf_dword_writeptm_granularityid_tabledq_sbptm_rootsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entry___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestedpm_devmsi_translatenr_forced_migrationsnum_argsri_timerstack_canarydestid_8_31blksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cnttranslateiopl_warnrmdirpcie_link_statesockhash_lenget_policy__list_add_validHRTIMER_RESTARTexternal_facingirq_nmi_setupsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsptm_cap_sys_privatexen_pcibk_find_quirkinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsirqs_per_chiprcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authirq_bus_sync_unlockvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxirq_hw_number_tstart_stackwatcherskmalloc_cachesredirect_hintcompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELioapiccore_nodepri_capsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_datairq_flow_handler_tpasid_featuresfieldirqstatget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structbin_attrs_newhwirq_maxruntime_idleconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersxen_pcibk_config_quirks_add_fieldexp_hintd_childrenIRQCHIP_STATE_LINE_LEVELis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infosaved_cap_spaceerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2backstate_add_uevent_sentblock_cfg_accessi_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumeirq_disablewake_qfileattr_setkzalloc_noprofrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsDOMAIN_BUS_WAKEUPonlineruntime_resumedup_xol_workpermissivereg_basepercpu_enabled___GFP_WRITE_BITicookieMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignDOMAIN_BUS_NEXUSdelay_worktot_countoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tseccomp_filterstimedestid_0_7list_add_taili_mmapirq_startupthaw_superd_lrusignal_structDOMAIN_BUS_VMD_MSIperf_event_mutexpri_enabledcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeis_msixki_completevtime_statewakee_flipsset_aclrom_attr_enabledpids_activedrivermsix_ctrlget_hwirqi_opskip_bus_pmldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodemsi_post_freesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatemaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startdisablehuge_faultkstatfssitesxen_pcibk_read_config_dwordDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysenable_intx__list_addsrcu_cb_mutexstatic_call_sitebladeMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswhandle_irqMODULE_STATE_GOINGDL_DEV_UNBINDINGbus_select_maskmulti_capthreadsym_timens_pagesriov_configures_time_minbusn_ress_devcpus_allowed_lockget_next_idrwlock_tpgprotfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utimebus_list_dummy_pkeymsi_alloc_info_tiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitconfig_fieldac_flagwrite_msi_msgcoredump_datatasks_pidaddress_spacemm_context_tis_probed__call_single_nodestartupirq_mask_ackis_virtualseqcount_spinlock_ti_wbpanelclass_idinactive_timer_pkeyfilenames_export_op__mptri_flctxstashedcond_suspend_depthvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipebasehostuaddractive_lows_wb_errshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoirq_managedunusedalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidi_rt_spc_timelimitrseq_sigdev_pm_domainlimit0limit1dqi_max_ino_limitquirks_listmigrate_modewakeup_preparedpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwlimitkobjfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleasedthread_fndep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timeirq_suspendrobust_list_headisr_oncurrent_state__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_beginaffinity_notifyvdsommap_legacy_basepipe_inode_infocur_bus_speedsecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opspref_windowslicesas_ss_spnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITquirkclass_local_lock_is_conditionalsuspend_latewakeupcg_listlink_bwctrlsrcu_barrier_completionsaved_config_spacedriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssubdevicesessionid_sifields_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_infopadding1llistdebugfs_entryacs_capelemnr_retriesIRQCHIP_STATE_PENDINGsigval_talimitundo_listKMALLOC_RANDOM_STARTregister_quirkdelivery_modeirq_datamask_cachemissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typeconf_byte_writemtimeserver_has_tasksvm_faultoom_score_adj_minx86_msi_datakobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memhotplug_slotpathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handleriommu_groupperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockis_preparedproc_dir_entryvm_opsiopollpagesizes_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7no_d1d2_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstatebroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidunlocked_ioctlrseq_lenparammodule_attributepollfdnr_wakeups_remotepci_busllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awarestate_use_accessorsclass_spinlock_irqsave_is_conditionalrseq_csprimarynum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnon_compliant_bars_pincounttablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqltr_pathcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codeqspinlock__kmalloc_large_noprofirq_compose_msi_msglru_genirq_set_wakeinsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextrevisiongpl_symsseq_showswait_queue_headcow_pageblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgunmapfull_namepci_device_idnoderesetvm_lockpci_saved_stateno_cgroup_migrationnextevts_writers_key__countirq_cntxcomp_bvcma_areastatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimereg_writelstate_remove_uevent_sentlegacy_memdmar_formatia_sizein_hrtirqs_master_keysarch_msi_msg_addr_hi_tpropertywchar_addr_bndkernel_symbolsubsys_datatv_secis_64pid_ttmp_quirktask_listftrace_sleeptimerun_nodema_rooturing_cmdX86_IRQ_ALLOC_TYPE_HPETnr_failed_migrations_affineuser_cpus_ptrpi_top_taskaddress_lounlinkslotactoruprobenotifier_subscriptionss_readonly_remountutil_sumreserved_0st_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsl1sssriov_set_msix_vec_countkfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queueirq_descdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimesigactionwake_activedev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimesched_rt_mutexlocked_pendingreset_preparenr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listis_msi_managedktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagIRQ_GC_MASK_CACHE_PER_TYPEi_uidparent_dataspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmirq_domain_chip_genericdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filereserved_1nr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipirq_nameqc_dqblkmmappedseqcount_raw_spinlockbroken_intx_maskingirq_pm_shutdownkill_sbd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWERllist_headbytesxen_pcibk_config_quirkwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqrcu_syncpreempt_notifiersDOMAIN_BUS_TI_SCI_INTA_MSIsrcu_last_gp_ends_fsnotify_infoDOMAIN_BUS_PCI_DEVICE_MSIXmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocsubvendord_parentconf_word_writetransparentpayloadac_minflti_sbkmalloc_noprofmatchcommcan_matchlast_timePIDTYPE_PIDofflineis_levelatomic_write_segments_maxatomic_openstart_prevent_timereadahead_controlsubordinate__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesselecthost_dataread_newsignalfd_wqhmmapmodnameerrnumdomain_free_irqsasync_put_workmknodpri_reqs_allocirq_gc_flagsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapdma_alias_maskwritepagessched_statisticsirq_alloc_infohead__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampsuper_operationssplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATApt_regsenablepipe_bufsKOBJ_NS_TYPE_NETctx_idarch_msi_msg_addr_lo_td_rt_spc_warnsi_verity_infoirq_retriggerxsavetimespec_type__rb_parent_colordevres_lockbitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoats_capDD_CLASS_TYPE_LEVEL_NAMESdev_flagsvm_private_dataio_bitmapxen_pcibk_config_field_freeuprobe_task_statetimerkobj_typebroken_parity_statusdeactivatei_pageshlist_bl_headino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitirq_alloc_typedoe_mbspage_fragwrite_bytesiobasecharqf_ownerunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledgraph_get_port_parent__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nrfreeze_fsuserfaultfd_ctxsigset_tmask_posrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freebridge_d3parentirq_set_affinityatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeget_named_child_nodelaunder_foliocurr_targetnumberis_suspendedX86_IRQ_ALLOC_TYPE_IOAPIChotplugburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updateIRQCHIP_STATE_ACTIVEvendorcap_bsetarchdata_sourcepower_statenr_perf_statesstack_vm_areakstat_irqssaved_statecfg_sizebasespcie_mpsss_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkchipcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typesriovpolicysharedpercpu_dev_iddismissxen_pcibk_config_quirks_initconf_field_resetlist_deld_real_typelookahead_bandseq_startnum_chipsraw_lockd_dnameget_dqblkmax_hang_timeirq_nmi_teardowncpus_maskDOMAIN_BUS_ANYsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcecmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailslinenobase_pfnget_inode_acl_addr_pkeymigrate_foliocustom_sliceaer_capthread_keyringkparam_arrayutimestart_codeis_managedis_harddest_mode_logicalfsbasecompatiblesubsystem_deviceclock_listattrsdynidscpumask_tbase_offsetswregs_statedqb_isoftlimitdma_iommuorig_axpriv_flagscompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperirq_chip_regsrom_bar_overlappref_64_windowi_aclwake_enabled___GFP_ZERO_BITwrite_newlist_lockpm_domaincpu_bitmapthreads_handled_laststatic_call_keyutil_estucountsqc_statevirt_destid_8_14handledsoftirq_next_timercheck_flagshandlerswp_entry_tmsi_descirq_get_irqchip_state_mapcountdomain_tagpasid_requiredhang_detectedchild_ns_typexen_pcibk_config_quirk_releaseqf_fmt_ids_vfs_rename_keyeventIRQCHIP_STATE_MASKED_dev_printkirq_maskset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tmatch_one_devicecoublockioacnr_to_scanwake_depthfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delaydma_cleanupmaple_treeKMALLOC_DMAdentrycpu_itimerpercpusriov_get_vf_total_msixrel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancesrangefutex_exit_mutexkernfs_iattrstrc_blkd_nodeIRQ_GC_NO_MASKack_intrd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagswait_for_threadsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingbus_tokenDOMAIN_BUS_IPIis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typestate_savedi_rdevirq_reroute_variantself_exec_idDOMAIN_BUS_WIRED_TO_MSIkernfs_opsfile_lockMODULE_STATE_LIVEclass_masknr_migrationsa_opsxa_flagspercpu_affinityfreezebin_sizemap_busclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITX86_IRQ_ALLOC_TYPE_PCI_MSIXirq_affinity_descd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITirq_baseset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkis_virtfnpercpu_refhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infoallow_interrupt_controlfutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightcommonvm_files_stateuser_sizedev_pm_opsxsd_errorsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkkmalloc_typeqstrma_flagsno_msifutex_stateorig_pmdxen_pcibk_config_add_fieldshpc_managedacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posirq_print_chipnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsbus_dma_regiondpc_capio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headlist_is_headconf_dword_readrcharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointepoll_watchesprealloc_ptedqb_curspace_entrygp_statebitsetload_avgaccesscstimepcie_capcore_internal_state__do_not_mess_with_itcfg_entrycfs_rq_uidmsi_indexst_spacemm_cid_next_scanns_typemsix_enabledac_majfltreal_timerpasid_enabledposix_cputimers_work_upperforce_resume_depthmodule_param_attrsshort unsigned intbus_flagsno_suspend_depthi_mutex_dir_keyq_nodespc_warnlimitvalids_encodinggpl_crcsorc_entrykeysorig_ptepasid_capdqb_curinodesload__s8pci_get_drvdatainvalidate_lock_keydma_maskprealloc_mutexnanosleepDOMAIN_BUS_FSL_MC_MSIsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodxen_pcibk_read_config_wordsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionpercpu_ref_func_tseq_stoppci_dev_flags_tdev_iddomain_alloc_irqskiocbclass_rwsem_read_intr_is_conditionalprobefsuidaer_statss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageIRQ_GC_INIT_MASK_CACHEirq_flags_to_cleararch_msi_msg_data_tno_callbacks__u16timers_activewait_countsig_okhwirqdelaysirq_safereadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagsysdatafs_flagsworkpgprotval_tkeytypesigpendingfsindexshstknum_ctsrcu_sspwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequencepci_vpddqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendori_dir_seqirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmacls_mskchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typeirq_resumedpc_rp_log_sizeimm_readyf_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infooverride_onlysched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimerequired_flagsdeadlinepinned_vm_head_2apsi_flagsaddressstart_boottimevm_startIRQ_GC_BE_IOs_flagscpumask_var_tfaultmsi_domain_infoshow_statsdl_densityfreeptr_tread_dqblkdq_flagschip_dataDD_CLASS_TYPE_DISJOINT_NAMESpci_devmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffpending_masksyscall_user_dispatchrcu_tasks_exit_listset_descarchdataia_uid__list_del_entry_valid_or_reportchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_done___GFP_ACCOUNT_BITpud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typemsi_enabledseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memarch_spinlock_ti_mtime_nsecperformanceDOMAIN_BUS_PCI_DEVICE_MSImmlistdevcapsuppress_bind_attrsRPM_RESUMINGreg_offsetgsbases_quota_typesirqchip_irq_statef_llistIRQ_NONEphandlei_nlinkbranchwrite_begingroupserr_handlerno_vf_scanpi_blocked_onDOMAIN_BUS_DEVICE_MSIs_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superinstalleds_inode_list_locksweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structpci_msi_descon_rqfs_contextprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfxen_pcibk_write_config_wordunsafe_warnllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclassaddress_hilast_mm_ciduntrustedcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesacpi_device_idd_ino_countlast_cpuilenmnt_flagscred_guard_mutexpci_opssigcnthrtimer_cpu_baseresourcescb_headcheck_quota_filedirty_folioattributerestrict_linkdev_archdatai_deviceskey_perm_tpi_state_cacheclass_disable_irq_is_conditionalconf_field_freeanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knchip_typessival_ptri_opflagsrobust_listconf_field_initsym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapmsi_attribfiltercurr_ret_stackirqreturn_tdockdev_links_infoirq_bus_lockloff_tthread_pidsrcu_gp_seqno_command_memoryprepare_desc_archipi_send_singlexen_pcibk_write_config_bytest_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlencleanclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnoirq_calc_maskbatchasync_sizeacct_vm_mem1i_mtime_secDOMAIN_BUS_PLATFORM_MSImemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idmsi_freefop_flags_tirq_fwspecFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmsi_initmodule_statelast_used_atirq_chip_type__compiletime_assert_473vm_endlast_queuednuma_migrate_retryuser_nsirq_ack__statefirstmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctimeDOMAIN_BUS_WIREDFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_areadev_datairq_request_resourcesirq_chip_genericrlockfl_owner_t_reseuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtgc_flagsvm_policyperf_rdpmc_allowedrdevkernel_ulong_tDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayirq_flags_to_setRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpreg_readlctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenpme_supportdqb_btime_nr_pages_mappedutf8datarevmap_treemm_userss_ids_dentry_lrubp_offsetmask_basefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsdmar_index_0_14release_workparent_irqksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliodriver_managed_dmaMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaDOMAIN_BUS_DMARdl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_highd1_supportarch_uprobemsi_mask_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedX86_IRQ_ALLOC_TYPE_PCI_MSI__list_add_valid_or_reportcompat_long_tactive_counts_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagsxen_pcibk_read_config_bytesupported_flagstotal_numa_faultss_countdev_msi_infod_revalidateerrstringbus_groupsirq_chippmd_ts_opd_sbsysv_shmdq_countutf8data_tableset_latency_tolerancedev_get_drvdata__func__resource_size_tfoliowake_entryxa_headsuidirq_domain_opsi_readcountirq_write_msi_msglocked_vmthreads_oneshotrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_lenxen_pcibk_config_add_field_offset__kernel_clock_tclass_rcu_is_conditionalIRQ_GC_INIT_NESTED_LOCKbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countarch_addr_hiksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriesrequest_mutexs_qcopatomic_talloc_tag_countersdomain_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_idbridge_ctlclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirVTIME_USERsa_flagstest__kmalloc_cache_noprofDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalsupported_speedsmapcountem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOthreads_activecurrent_may_mountarch_addr_loseqlock_tnuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskcan_maskregfuncindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validvertical_positioni_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockmsi_msg___GFP_MOVABLE_BITpcie_bwctrl_dataactivexlatexen_pcibk_quirksdqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsgetattrFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersdriver_exclusive_resourceselectorMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasedefault_timer_slack_nsirq_set_typesource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BITprivate_datagroup_infovdso_imagefileof_match_tablepercpu_count_ptr__user_state_sizewarned_on_writedmar_subhandlepcie_cap_lockmce_kill_meuuid_tproperty_read_int_arraynr_actions___GFP_UNUSED_BITconf_word_readcount_objects_stimezone_device_dataf_wb_errhandler_namephysfndefparamlast_unhandledfred_csfault_flagresend_nodekprojid_tptracer_credtlb_genstorepage_mkwritekobjectaudit_ttymce_ripvstatfsats_enablednumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisteetlp_prefix_pathclass_groupsnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listrevmap_sizeaudit_contextpp_ref_countsysfs_opserror_detectedsequential_ioipi_send_maskis_busmaster_large_mapcountsda_is_staticformatftopenclavemask_cache_privdefault_irqsp_regcreatewrite_msi_msg_dataiattrirq_domain_bus_tokenrseqnfdssigvalvma_lockperf_event_listconfig_fieldsget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadirqactiond_reallink_stateexpiry_activedqi_max_spc_limiteval_stringexception_table_entryevent_countparam_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimitDOMAIN_BUS_AMDVIi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderconfig_field_entrytimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tDOMAIN_BUS_PCI_MSIblocksirq_affinity_notifyset_infofileattr_getvectortimer_listaffinitydevice_dma_supportedd_ino_warnshiwater_vmtracepointcompound_headia_vfsuidirq_eoi__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersthread_maskino_timelimitpci_bus_flags_tsplice_writemsix_capstate_in_sysfssysfs_attrs__list_del_entry_validrom_base_regqf_nextio_window_1krangesiommu_mmirq_enableats_stucutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprividle_notificationsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixups__compiletime_assert_196__compiletime_assert_197file_operationsKMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITsyncsetleasepinspacct_structxen_pcibk_write_config_dwordmust_resumelong intfile_lock_contextusageuv_alloc_infosiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ssproperty_presentmsi_domain_ops__kmalloc_indexUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncthreads_handledegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSis_thunderboltmark_dirtythread_flagsnum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEirq_common_dataf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idmultifunctiondepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldmultipleDOMAIN_BUS_GENERIC_MSIssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structxen_pcibk_dev_datapi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argsirq_unmasksrcu_reader_flavortv_nseci_lruiommu_cookied3cold_allowedgfp_maskpi_state_listrcu_segcblistsubvolbase_addressfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_iddev_pin_infodmar_reserved_0srcu_structrlim_curnofaultxen_pcibk_field_is_dupmm_countcputime_atomicdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledirqs_unhandledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextdmar_base_addressmsi_prepareopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_eventsiommuprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxtph_enabledsplice_pipeuclamp_reqeffective_affinitypasid_no_tlps_lock_keyreset_donesrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsslotstqheadmsi_domain_cookies_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truedcookiehres_activebpf_raw_eventsdq_dirtydl_deferbug_listdirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemadd_busignore_childrenresourcerestore_earlyclock_mutexfs_supersnotifydqb_bsoftlimitpendingf_task_work___GFP_NORETRY_BITiowait_countmatch_driverdma_io_tlb_memstringread_countfutex_offsetlong long inthwsizemmio_always_onx86_msi_addr_hiatomic_flagssysvshmtimer_expiresirq_set_vcpu_affinitytrace_evalsactive_basesearly_initrcec_eamprotectsecurityxmm_spaceactivatemsix_basef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbX86_IRQ_ALLOC_TYPE_UVvm_flags_trefcount_struct___GFP_FS_BITdmar_index_15i_bytesdomain_datarelax_countdevice_attribute___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersnvec_useddev_tFREEZE_HOLDER_USERSPACEmsi_capdup_xol_addrrevmapcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_statedevice_lockWRITE_LIFE_LONGuclamp_sex86_msi_addr_lopkruElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersbridged_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codeinit_dev_msi_infothread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributes__list_del_entryset_child_tid_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_statetick_dep_masklistthrottle_disksi_errnoromlens_inode_lrusrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionalof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTdevfnregsslice_maxlast_switch_countqsize_tmsi_desc_datafilesotherend_watchdevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagepublishmodule_sect_attrsreturn_instancesoftirq_activatedpdevpci_power_tclass_preempt_notrace_is_conditionalret_stacknode_idautosuspend_delayunsigned intgendiskspc_timelimits_instancesdescseqcountremove_busoom_score_adjd_seqia_vfsgidsize_tdevidacpi_device_idptm_enabledcap_permittedTT_NATIVEaffinity_hintclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxerror_statercu_tasks_holdouttarget_listno_64bit_msipasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecneeds_fresets_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listpublish_pci_root_cbfutex_statevm_rcupgtables_bytesget_linkirq_shutdownfmode_tdevtpci_channel_state_trestoredelayed_callmsi_instance_cookiemax_nr_cid_statusd_sibkernel_ulong_tX86_IRQ_ALLOC_TYPE_DMARdma_opsioapic_alloc_infobin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedhdr_typedl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqmsi_locklinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tdpc_rp_extensionsclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errstatus_use_accessorscputimerbe_watchtrace_recursionhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrdmar_subhandle_validget_next_child_nodeFAULT_FLAG_WRITEirq_set_irqchip_statevm_fault_ttty_structUTASK_SSTEP_TRAPPEDfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleio_cqres_attr_wcelf64_symlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSp2pdmasyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_modbus_select_token_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredpcie_flags_regsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabirq_release_resourcesclass_read_lock_irqsave_is_conditionaldma_pools_addr_lsbi_generation_sigpollprocentmxcsrX86_IRQ_ALLOC_TYPE_AMDVId_rt_spc_hardlimitpci_error_handlersnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexmsi_parent_opsdriver_datathread_headdev_pm_qosmap_typef_oppids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizexenbus_dev_fatalptm_granularityid_tabledq_sbptm_rootnr_pendingsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entry___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestedpm_devmsi_translatenr_forced_migrationsnum_argsri_timerstack_canarydestid_8_31blksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cnttranslateiopl_warnrmdirpcie_link_statesockhash_lenget_policy__list_add_validHRTIMER_RESTARTexternal_facingpublish_cbirq_nmi_setupsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchsemaphoreshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsptm_cap_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsirqs_per_chiprcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authirq_bus_sync_unlockvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxirq_hw_number_tstart_stackwatcherskmalloc_cachesredirect_hintcompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELioapiccore_nodepri_capsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_datairq_flow_handler_tpasid_featuresirqstatget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structbin_attrs_newhwirq_maxruntime_idleconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenIRQCHIP_STATE_LINE_LEVELis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infosaved_cap_spacelist_emptyerror_remove_folioxen_pcibk_deviceold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepXenbusStateConnectedenvp_idx_head_1_head_2backstate_add_uevent_sentblock_cfg_accessi_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumeirq_disablewake_qfileattr_setrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsDOMAIN_BUS_WAKEUPonlineruntime_resumedup_xol_workreg_basepercpu_enabledicookieMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignDOMAIN_BUS_NEXUSdelay_worktot_countoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockcur_bus_speedgfp_tseccomp_filterstimedestid_0_7list_add_tailevent_channelsi_mmapirq_startupthaw_superd_lrusignal_structDOMAIN_BUS_VMD_MSIperf_event_mutexpri_enabledcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeis_msixki_completevtime_statewakee_flipsset_aclrom_attr_enabledpids_activedrivermsix_ctrlget_hwirqi_opskip_bus_pmldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodemsi_post_freesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatebe_watchingmaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startdisablehuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsys__list_addsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswhandle_irqMODULE_STATE_GOINGDL_DEV_UNBINDINGbus_select_maskmulti_capthreadsym_timens_pagesriov_configures_time_minbusn_ress_devcpus_allowed_lockget_next_idrwlock_tpgprotfalsed_weak_revalidate__xen_pcibk_init_devicesremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utimebus_list_dummy_pkeymsi_alloc_info_tiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagwrite_msi_msgcoredump_datatasks_pidaddress_spacemm_context_tis_probed__call_single_nodestartupirq_mask_ackpcistub_put_pci_devis_virtualseqcount_spinlock_ti_wbpanelclass_idinactive_timer_pkeyfilenames_export_op__mptri_flctxstashedcond_suspend_depthvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodepcidevnormal_priodestroy_inoderelease_foliolast_busyi_pipebasehostuaddractive_lows_wb_errshm_clistis_child_subreaperunicode_mapXenbusStateInitWaitgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoirq_managedunusedalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidi_rt_spc_timelimitrseq_sigdev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modewakeup_preparedpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwlimitkobjfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalxenbus_devicereleasedthread_fndep_mapalloc_dquotpm_messageto_pci_sysdatamay_splitmem_cgrouplast_update_timeirq_suspendrobust_list_headcurrent_state__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_beginaffinity_notifyvdsommap_legacy_basepipe_inode_infouint16_tsecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opspref_windowslicesas_ss_spnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listlink_bwctrlsrcu_barrier_completionsaved_config_spacedriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssubdevicesessionid_sifields_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_infopadding1llistdebugfs_entryacs_capelemnr_retriesIRQCHIP_STATE_PENDINGsigval_talimitundo_listKMALLOC_RANDOM_STARTdelivery_modeirq_datamask_cachemissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultoom_score_adj_minx86_msi_datakobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memhotplug_slotpathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handleriommu_groupperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwdevice_unlockneed_parent_lockis_preparedproc_dir_entryvm_opsiopollpagesizes_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7no_d1d2_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstatebroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidunlocked_ioctlrseq_lenparammodule_attributepollfdnr_wakeups_remotepci_busllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awarestate_use_accessorsclass_spinlock_irqsave_is_conditionalrseq_csprimarynum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnon_compliant_bars_pincounttablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqltr_pathcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codeqspinlock__kmalloc_large_noprofirq_compose_msi_msglru_genirq_set_wakeinsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextrevisiongpl_symsseq_showswait_queue_headcow_pageblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgunmapfull_namepci_device_idnodevm_lockno_cgroup_migrationnextevts_writers_key__countirq_cntxcomp_bvcma_areastatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTED__xen_pcibk_publish_pci_rootsprev_cputimedev_entryreg_writelstate_remove_uevent_sentlegacy_memdmar_formatspurious_thresholdia_sizein_hrtirqs_master_keysarch_msi_msg_addr_hi_t__xen_pcibk_release_devicespropertywchar_addr_bndkernel_symbolsubsys_datatv_secis_64match_slotpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdX86_IRQ_ALLOC_TYPE_HPETnr_failed_migrations_affineuser_cpus_ptrpi_top_taskaddress_lounlinkslotactoruprobenotifier_subscriptionss_readonly_remountutil_sumreserved_0st_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmoduleXenbusStateUnknownpcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsl1sssriov_set_msix_vec_count__xen_pcibk_get_pci_devkfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queueirq_descdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimesigactionwake_activedev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimexen_pcibk_backendsched_rt_mutexlocked_pendingreset_preparenr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listis_msi_managedktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagIRQ_GC_MASK_CACHE_PER_TYPEi_uidparent_dataspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmirq_domain_chip_genericdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filereserved_1nr_scannedpcp_listpid_linksdev_locks_sysfs_namerefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbroken_intx_maskingirq_pm_shutdownkill_sbd_opvpci_devclear_retrain_linkMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWERllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqrcu_syncpreempt_notifiersDOMAIN_BUS_TI_SCI_INTA_MSIsrcu_last_gp_ends_fsnotify_infoDOMAIN_BUS_PCI_DEVICE_MSIXxen_pcie_aer_opmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocsubvendord_parentvmd_devacpi_devicetransparentpayloadac_minflti_sbkmalloc_noprofmatchcommcan_matchlast_timePIDTYPE_PIDeventsofflineis_levelatomic_write_segments_maxatomic_openstart_prevent_timereadahead_controlsubordinate__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesselecthost_dataread_newsignalfd_wqhmmapmodnameerrnumdomain_free_irqsasync_put_workmknodpri_reqs_allocirq_gc_flagsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapdma_alias_masklist_firstwritepagessched_statisticsirq_alloc_infohead__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclamp__compiletime_assert_326super_operationssplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATApt_regsenablepipe_bufsKOBJ_NS_TYPE_NETctx_idarch_msi_msg_addr_lo_td_rt_spc_warnsi_verity_infomsix_entriesirq_retriggerxsavetimespec_type__rb_parent_colordevres_lockbitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoats_capDD_CLASS_TYPE_LEVEL_NAMESdev_flagsvm_private_dataio_bitmapuprobe_task_statetimerkobj_typebroken_parity_statusdeactivatei_pageshlist_bl_headino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitirq_alloc_typedoe_mbspage_fragwrite_bytesiobasecharqf_ownerunix_inflightxenbus_watchholders_dirfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledgraph_get_port_parent__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrfreeze_fsuserfaultfd_ctxsigset_tmask_posrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freebridge_d3parentirq_set_affinityatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeget_named_child_nodelaunder_foliocurr_targetnumberis_suspendedX86_IRQ_ALLOC_TYPE_IOAPIChotplug__keyburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updateIRQCHIP_STATE_ACTIVEvendorcap_bsetmutex_lockarchdata_sourcepower_statenr_perf_statesstack_vm_areakstat_irqssaved_statekernfs_elem_attrbasespcie_mpsss_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkchipcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typesriovpolicysharedpercpu_dev_iddismisslist_deld_real_typelookahead_bandseq_startnum_chipsraw_lockd_dnameget_dqblkmax_hang_timeirq_nmi_teardowncpus_maskDOMAIN_BUS_ANYsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcecmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailslinenobase_pfnxenbus_stateget_inode_acl_addr_pkeymigrate_foliocustom_sliceaer_capthread_keyringkparam_arrayutimestart_codeis_managedis_harddest_mode_logicalfsbasecompatiblesubsystem_deviceclock_listattrsdynidscpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axpriv_flagscompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperirq_chip_regsrom_bar_overlappref_64_windowi_aclwake_enabled___GFP_ZERO_BITwrite_newlist_lockpm_domaincpu_bitmapthreads_handled_laststatic_call_keyutil_estucountsqc_statevirt_destid_8_14softirq_next_timercheck_flagshandlerswp_entry_tmsi_descirq_get_irqchip_state_mapcountdomain_tagpasid_requiredhang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventIRQCHIP_STATE_MASKEDirq_maskset_performance_statephys_addr_tclass_preempt_is_conditionalcfg_sizeconsumers_cntmodule_memoryotherend_idpi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacxen_pci_sharedinfonr_to_scanwake_depthfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delaydma_cleanupmaple_treeXenbusStateInitialisingKMALLOC_DMA__xen_pcibk_get_pcifront_devdentrycpu_itimerpercpusriov_get_vf_total_msixpci_domain_nrrel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotma_flagsfound_devdelayed_workhiwater_rsskretprobe_instancesrangefutex_exit_mutexkernfs_iattrs___GFP_WRITE_BITIRQ_GC_NO_MASKd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagswait_for_threadsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingbus_tokenDOMAIN_BUS_IPIis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typestate_savedi_rdevirq_reroute_variantself_exec_idDOMAIN_BUS_WIRED_TO_MSIkernfs_opsfile_lockMODULE_STATE_LIVEclass_masknr_migrationsa_opsxa_flagspercpu_affinityfreezebin_sizemap_busclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITX86_IRQ_ALLOC_TYPE_PCI_MSIX__compiletime_assert_4irq_affinity_descd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITirq_baseset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkis_virtfnpercpu_refhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightcommonvm_files_stateuser_sizedev_pm_opsxsd_errorsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkkmalloc_typeqstrno_msi___GFP_ZEROTAGS_BITorig_pmdshpc_managedacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posirq_print_chipnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsbus_dma_regiondpc_capio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headlist_is_headrcharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointepoll_watchesprealloc_ptedqb_curspace_entrygp_statebitsetload_avgaccesscstimepcie_capcore_internal_state__do_not_mess_with_itcfs_rq_uidmsi_indexst_spacemm_cid_next_scanns_typemsix_enabledxen_pci_opwill_handleac_majfltpasid_enabledposix_cputimers_work_upperforce_resume_depthmodule_param_attrsshort unsigned intbus_flagsno_suspend_depthi_mutex_dir_keyq_nodespc_warnlimitvalids_encodinggpl_crcsorc_entrykeysorig_ptepasid_capdqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutexnanosleepDOMAIN_BUS_FSL_MC_MSIsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionseq_stoppci_dev_flags_tdev_iddomain_alloc_irqskiocbclass_rwsem_read_intr_is_conditionalprobefsuidaer_statss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageIRQ_GC_INIT_MASK_CACHEirq_flags_to_cleararch_msi_msg_data_tno_callbacks__u16timers_activewait_countsig_okhwirqdelaysirq_safereadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagINIT_LIST_HEADsysdatafs_flagsworkpgprotval_tkeytypesigpendingfsindexshstknum_ctsrcu_sspwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequencepci_vpddqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendori_dir_seqirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmauclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typeirq_resumedpc_rp_log_sizeimm_readyf_iocb_flagspoweroffcmaj_fltaer_opvtimemath_emu_infoiowait_sumf_path__u64journal_infooverride_onlysched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimerequired_flagsdeadlinepinned_vm_head_2apsi_flagsaddressstart_boottimevm_startIRQ_GC_BE_IOs_flagscpumask_var_tfaultmsi_domain_infoshow_statsdl_densityfreeptr_tread_dqblkdq_flagschip_dataDD_CLASS_TYPE_DISJOINT_NAMESpci_devmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpdevicetypei_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffpending_masksyscall_user_dispatchrcu_tasks_exit_listset_descarchdataia_uid__list_del_entry_valid_or_reportchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_done___GFP_ACCOUNT_BITevtchn_irqpud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typemsi_enabledseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerfindquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memvpci_dev_dataarch_spinlock_ti_mtime_nsecperformanceDOMAIN_BUS_PCI_DEVICE_MSImmlist__compiletime_assert_0__compiletime_assert_1__compiletime_assert_2__compiletime_assert_3devcapsuppress_bind_attrsRPM_RESUMINGreg_offsetpublish_pci_dev_cbgsbases_quota_typesirqchip_irq_statef_llistIRQ_NONEphandlei_nlinkbranchwrite_begingroupserr_handlerno_vf_scanpi_blocked_onDOMAIN_BUS_DEVICE_MSIcompanions_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tpci_sysdataxen_pcibk_vpci_backendsharepagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superinstalleds_inode_list_locksweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structpci_msi_descon_rqfs_contextprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfunsafe_warnllseekfoundDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitXenbusStateClosedwritable_sizercu_nodeinit_nameunfreeze_fsintervalclassaddress_hilast_mm_ciduntrustedcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexpci_opssigcnthrtimer_cpu_baseresourcescb_headcheck_quota_filedirty_folioattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tpi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knchip_typessival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapmsi_attribfiltercurr_ret_stackirqreturn_tdockdev_links_infoirq_bus_lockloff_tthread_pidsrcu_gp_seqno_command_memoryprepare_desc_archipi_send_singlest_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevtrc_blkd_nodecallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnoirq_calc_maskbatchasync_sizeacct_vm_mem1i_mtime_secDOMAIN_BUS_PLATFORM_MSIsh_infomemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idmsi_freefop_flags_tirq_fwspecFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmsi_initmodule_state_dev_infolast_used_at__mutex_initirq_chip_typevm_endlast_queuednuma_migrate_retryuser_nsirq_ack__statefirstmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctimeDOMAIN_BUS_WIREDFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_areairq_request_resourcesirq_chip_genericrlockfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgcallbacknum_trace_bprintk_fmtgc_flagsvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayirq_flags_to_setRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpreg_readlctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenreclaim_sempme_supportdqb_btime_nr_pages_mappedutf8datarevmap_treemm_userss_ids_dentry_lrubp_offsetmask_basefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimenodenamesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsdmar_index_0_14release_workparent_irqksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliodriver_managed_dmaMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaDOMAIN_BUS_DMARdl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intXenbusStateClosingnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_highd1_supportarch_uprobemsi_mask_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedX86_IRQ_ALLOC_TYPE_PCI_MSI__list_add_valid_or_reportcompat_long_tactive_countspurious_eventss_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagssupported_flagstotal_numa_faultss_countdev_msi_infod_revalidateerrstringbus_groupsirq_chippmd_ts_opd_sbsysv_shmdq_countutf8data_tableset_latency_tolerance__func__resource_size_tfoliowake_entryxa_headsuidirq_domain_opsi_readcountirq_write_msi_msglocked_vmthreads_oneshotrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalIRQ_GC_INIT_NESTED_LOCKbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countarch_addr_hiksm_merging_pagesotherendautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriesrequest_mutexs_qcopatomic_talloc_tag_countersdomain_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_iddev_listXenbusStateInitialisedbridge_ctldownclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirVTIME_USERsa_flagstest__kmalloc_cache_noprofDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalsupported_speedsmapcountem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOthreads_activecurrent_may_mountpci_dev_entryarch_addr_loseqlock_tnuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskcan_maskregfuncindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validvertical_positioni_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockmsi_msg___GFP_MOVABLE_BITpcie_bwctrl_dataactivexlatedqb_itimeWRITE_LIFE_MEDIUMop_worksrcu_idxpidsgetattrFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersdriver_exclusive_resourceselectorMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasedefault_timer_slack_nsirq_set_typesource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BITgroup_infovdso_imagefileof_match_tablepercpu_count_ptr__user_state_sizedmar_subhandlepcie_cap_lockmce_kill_meuuid_tproperty_read_int_arraynr_actions___GFP_UNUSED_BITcount_objects_stimezone_device_dataf_wb_errhandler_namephysfndefparamlast_unhandledfred_csfault_flagresend_nodekprojid_tptracer_credtlb_genstorepage_mkwritekobjectaudit_ttymce_ripvstatfsats_enablednumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisteetlp_prefix_pathclass_groupsnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listrevmap_sizeaudit_contextpp_ref_countsysfs_opserror_detectedsequential_ioipi_send_maskis_busmaster_large_mapcountsda_is_staticformatftopenclavemask_cache_privdefault_irqsp_regcreatewrite_msi_msg_dataiattrirq_domain_bus_tokenrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadirqactiond_reallink_stateexpiry_activedqi_max_spc_limiteval_stringexception_table_entryevent_countparam_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimitDOMAIN_BUS_AMDVIi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tDOMAIN_BUS_PCI_MSIblocksirq_affinity_notifyset_infofileattr_getvectortimer_listaffinityXenbusStateReconfiguringdevice_dma_supportedd_ino_warnshiwater_vmxen_msix_entrytracepointcompound_headia_vfsuidirq_eoi__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structunlockrpm_statussb_writersthread_maskino_timelimitpci_bus_flags_tsplice_writemsix_capstate_in_sysfssysfs_attrs__list_del_entry_validrom_base_regcss_setqf_nextio_window_1krangesiommu_mmirq_enableats_stucutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprividle_notificationsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITsyncsetleasepinspacct_structmust_resumelong intfile_lock_contextusageuv_alloc_infosiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ssproperty_presentmsi_domain_ops__kmalloc_indexUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncthreads_handledegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagsxdevcodetagPROBE_PREFER_ASYNCHRONOUSis_thunderboltmark_dirtythread_flagsnum_srcu_structsbdi_writebackpci_dev_datakobj_completion__kernel_clockid_tseccompiteratorqc_info__xen_pcibk_add_pci_devdev_nameTT_NONEVTIME_INACTIVEirq_common_dataf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idmultifunctiondepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldmultipleDOMAIN_BUS_GENERIC_MSIssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argsirq_unmasksrcu_reader_flavortv_nseci_lruiommu_cookied3cold_allowedgfp_maskpi_state_listrcu_segcblistsubvolbase_addressfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_iddev_pin_infojiffies_eoi_delayeddmar_reserved_0srcu_structrlim_curnofaultmm_countcputime_atomicdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NEST__xen_pcibk_release_pci_devbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledirqs_unhandledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextdmar_base_addressmsi_prepareopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_eventsiommuprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxtph_enabledsplice_pipebladeeffective_affinitypasid_no_tlps_lock_keyreset_donesrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsslotstqheadmsi_domain_cookies_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copXenbusStateReconfigureddd_key_truedcookiehres_activebpf_raw_eventsdq_dirtydl_deferbug_listdirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemadd_busignore_childrenresourcerestore_earlyclock_mutexfs_supersnotifydqb_bsoftlimitpendingf_task_work___GFP_NORETRY_BITiowait_countmatch_driverdma_io_tlb_memstringread_countfutex_offsetlong long inthwsizemmio_always_onx86_msi_addr_hiatomic_flagssysvshmtimer_expiresirq_set_vcpu_affinitytrace_evalsactive_basesearly_initrcec_eamprotectsecurityxmm_spaceactivatemsix_basef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbX86_IRQ_ALLOC_TYPE_UVvm_flags_trefcount_struct___GFP_FS_BITdmar_index_15i_bytesdomain_datarelax_countdevice_attribute___GFP_THISNODE_BITlinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersnvec_useddev_tFREEZE_HOLDER_USERSPACEmsi_capdup_xol_addrrevmapcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_statedevice_lockWRITE_LIFE_LONGuclamp_sex86_msi_addr_loElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersbridged_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codeinit_dev_msi_infothread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributes__list_del_entryset_child_tid_overruntmpfilercu_read_lock_nestingem_perf_statetick_dep_masklistthrottle_disksi_errnoromlens_inode_lrusrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionalof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTdevfnregsslice_maxlast_switch_countqsize_tmsi_desc_datafilesotherend_watchdevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagepublishmodule_sect_attrsreturn_instancesoftirq_activatedpdevpci_power_tclass_preempt_notrace_is_conditionalret_stacknode_idautosuspend_delayunsigned intgendiskspc_timelimits_instancesdescseqcountremove_busoom_score_adjd_seqia_vfsgidsize_tdevidptm_enabledcap_permittedTT_NATIVEaffinity_hintclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxerror_statercu_tasks_holdouttarget_listno_64bit_msipasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecneeds_fresets_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listpublish_pci_root_cbvm_rcupgtables_bytesget_linkirq_shutdownfmode_tdevtpci_channel_state_trestoredelayed_callmsi_instance_cookiemax_nr_cid_statusd_sibX86_IRQ_ALLOC_TYPE_DMARdma_opsioapic_alloc_infobin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedhdr_typedl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqmsi_locklinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tdpc_rp_extensionsclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errstatus_use_accessorscputimerbe_watchtrace_recursionhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrdmar_subhandle_validget_next_child_nodeFAULT_FLAG_WRITEirq_set_irqchip_statevm_fault_ttty_structUTASK_SSTEP_TRAPPEDfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleio_cqres_attr_wcelf64_symlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSp2pdmasyscore__s64dqi_bgrace__kernel_pid_tsystemstatic_call_modbus_select_token_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredpcie_flags_regsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabirq_release_resourcesclass_read_lock_irqsave_is_conditionaldma_pools_addr_lsbi_generation_sigpollprocentmxcsrX86_IRQ_ALLOC_TYPE_AMDVId_rt_spc_hardlimitpci_error_handlersnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexmsi_parent_opsdriver_datathread_headdev_pm_qosmap_typef_oppids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizeptm_granularityid_tabledq_sbptm_rootnr_pendingsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entry___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestedpm_devmsi_translatenr_forced_migrationsnum_argsri_timerstack_canarydestid_8_31blksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cnttranslateiopl_warnrmdirpcie_link_statesockhash_lenget_policy__list_add_validHRTIMER_RESTARTexternal_facingpublish_cbirq_nmi_setupsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchsemaphoreshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsptm_cap_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsirqs_per_chiprcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authirq_bus_sync_unlockvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxirq_hw_number_tstart_stackwatcherskmalloc_cachesredirect_hintcompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELioapiccore_nodepri_capsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_datairq_flow_handler_tpasid_featuresirqstatget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structbin_attrs_newhwirq_maxruntime_idleconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenIRQCHIP_STATE_LINE_LEVELis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infosaved_cap_spaceerror_remove_folioxen_pcibk_deviceold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepXenbusStateConnectedenvp_idx_head_1_head_2backstate_add_uevent_sentblock_cfg_accessi_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumeirq_disablewake_qfileattr_setrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsDOMAIN_BUS_WAKEUPonlineruntime_resumedup_xol_workreg_basepercpu_enabled___GFP_WRITE_BITicookieMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignDOMAIN_BUS_NEXUSdelay_worktot_countoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockcur_bus_speedgfp_tseccomp_filterstimedestid_0_7list_add_tailevent_channelsi_mmapirq_startupthaw_superd_lrusignal_structDOMAIN_BUS_VMD_MSIperf_event_mutexpri_enabledcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeis_msixki_completevtime_statewakee_flipsset_aclrom_attr_enabledpids_activedrivermsix_ctrlget_hwirqi_opskip_bus_pmldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodemsi_post_freesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatebe_watchingmaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startdisablehuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsys__list_addsrcu_cb_mutexstatic_call_sitebladeMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITnivcswhandle_irqMODULE_STATE_GOINGDL_DEV_UNBINDINGbus_select_maskmulti_capthreadsym_timens_pagesriov_configures_time_minbusn_ress_devcpus_allowed_lockget_next_idrwlock_tpgprotfalsed_weak_revalidate__xen_pcibk_init_devicesremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utimebus_list_dummy_pkeymsi_alloc_info_tiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagwrite_msi_msgcoredump_datatasks_pidaddress_spacemm_context_tis_probed__call_single_nodestartupirq_mask_ackpcistub_put_pci_devis_virtualseqcount_spinlock_ti_wbpanelclass_idinactive_timer_pkeyfilenames_export_op__mptri_flctxstashedcond_suspend_depthvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodepcidevnormal_priodestroy_inoderelease_foliolast_busyi_pipebasehostuaddractive_lows_wb_errshm_clistis_child_subreaperunicode_mapXenbusStateInitWaitgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoirq_managedunusedalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidi_rt_spc_timelimitrseq_sigdev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modewakeup_preparedpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwlimitkobjfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITxenbus_devicereleasedthread_fndep_mapalloc_dquotpm_messageto_pci_sysdatamay_splitmem_cgrouplast_update_timeirq_suspendrobust_list_headcurrent_state__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_beginaffinity_notifyvdsommap_legacy_basepipe_inode_infouint16_tsecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opspref_windowslicesas_ss_spnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listlink_bwctrlsrcu_barrier_completionsaved_config_spacedriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssubdevicesessionid_sifields_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_infopadding1llistdebugfs_entryacs_capelemnr_retriesIRQCHIP_STATE_PENDINGsigval_talimitundo_listKMALLOC_RANDOM_STARTdelivery_modeirq_datamask_cachemissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultoom_score_adj_minx86_msi_datakobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memhotplug_slotpathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handleriommu_groupperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwdevice_unlockneed_parent_lockis_preparedproc_dir_entryvm_opsiopollpagesizes_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7no_d1d2_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstatebroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidunlocked_ioctlrseq_lenparammodule_attributepollfdnr_wakeups_remotepci_busllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awarestate_use_accessorsclass_spinlock_irqsave_is_conditionalrseq_csprimarynum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnon_compliant_bars_pincounttablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqltr_pathcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codeqspinlock__kmalloc_large_noprofirq_compose_msi_msglru_genirq_set_wakeinsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextrevisiongpl_symsseq_showswait_queue_headcow_pageblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgunmapfull_namepci_device_idnodevm_lockno_cgroup_migrationnextevts_writers_key__countirq_cntxcomp_bvcma_areastatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTED__xen_pcibk_publish_pci_rootsprev_cputimedev_entryreg_writelstate_remove_uevent_sentlegacy_memdmar_formatspurious_thresholdia_sizein_hrtirqs_master_keysarch_msi_msg_addr_hi_t__xen_pcibk_release_devicespropertywchar_addr_bndkernel_symbolsubsys_datatv_secis_64pid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdX86_IRQ_ALLOC_TYPE_HPETnr_failed_migrations_affineuser_cpus_ptrpi_top_taskaddress_lounlinkslotactoruprobenotifier_subscriptionss_readonly_remountutil_sumreserved_0st_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmoduleXenbusStateUnknownpcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsl1sssriov_set_msix_vec_count__xen_pcibk_get_pci_devkfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queueirq_descdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimesigactionwake_activedev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimexen_pcibk_backendsched_rt_mutexlocked_pendingreset_preparenr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listis_msi_managedktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagIRQ_GC_MASK_CACHE_PER_TYPEi_uidparent_dataspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmirq_domain_chip_genericdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filereserved_1nr_scannedpcp_listpid_linksdev_locks_sysfs_namerefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipqc_dqblkmmappedseqcount_raw_spinlockbroken_intx_maskingirq_pm_shutdownkill_sbd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWERllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqrcu_syncpreempt_notifiersDOMAIN_BUS_TI_SCI_INTA_MSIsrcu_last_gp_ends_fsnotify_infoDOMAIN_BUS_PCI_DEVICE_MSIXxen_pcie_aer_opmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocsubvendord_parentvmd_devacpi_devicetransparentpayloadac_minflti_sbkmalloc_noprofmatchcommcan_matchlast_timePIDTYPE_PIDeventsofflineis_levelatomic_write_segments_maxatomic_openstart_prevent_timereadahead_controlsubordinate__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesselecthost_dataread_newsignalfd_wqhmmapmodnameerrnumdomain_free_irqsasync_put_workmknodpri_reqs_allocirq_gc_flagsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapdma_alias_maskwritepagessched_statisticsirq_alloc_infohead__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampsuper_operationssplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATApt_regsenablepipe_bufsKOBJ_NS_TYPE_NETctx_idarch_msi_msg_addr_lo_td_rt_spc_warnsi_verity_infomsix_entriesirq_retriggerxsavetimespec_type__rb_parent_colordevres_lockbitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoats_capDD_CLASS_TYPE_LEVEL_NAMESdev_flagsvm_private_dataio_bitmapuprobe_task_statetimerkobj_typebroken_parity_statusdeactivatei_pageshlist_bl_headino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitirq_alloc_typedoe_mbspage_fragwrite_bytesiobasecharqf_ownerunix_inflightxenbus_watchholders_dirfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledgraph_get_port_parent__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nrfreeze_fsuserfaultfd_ctxsigset_tmask_posrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freebridge_d3parentirq_set_affinityatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeget_named_child_nodelaunder_foliocurr_targetnumberis_suspendedX86_IRQ_ALLOC_TYPE_IOAPIChotplug__keyburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updateIRQCHIP_STATE_ACTIVEvendorcap_bsetmutex_lockarchdata_sourcepower_statenr_perf_statesstack_vm_areakstat_irqssaved_statecfg_sizebasespcie_mpsss_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkchipcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typesriovpolicysharedpercpu_dev_iddismisslist_deld_real_typelookahead_bandseq_startnum_chipsraw_lockd_dnameget_dqblkmax_hang_timeirq_nmi_teardowncpus_maskDOMAIN_BUS_ANYsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcecmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailslinenobase_pfnxenbus_stateget_inode_acl_addr_pkeymigrate_foliocustom_sliceaer_capthread_keyringkparam_arrayutimestart_codeis_managedis_harddest_mode_logicalfsbasecompatiblesubsystem_deviceclock_listattrsdynidscpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axpriv_flagscompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperirq_chip_regsrom_bar_overlappref_64_windowi_aclwake_enabled___GFP_ZERO_BITwrite_newlist_lockpm_domaincpu_bitmapthreads_handled_laststatic_call_keyutil_estucountsqc_statevirt_destid_8_14softirq_next_timercheck_flagshandlerswp_entry_tmsi_descirq_get_irqchip_state_mapcountdomain_tagpasid_requiredhang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventIRQCHIP_STATE_MASKEDirq_maskset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memoryotherend_idpi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacxen_pci_sharedinfonr_to_scanwake_depthfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delaydma_cleanupmaple_treeXenbusStateInitialisingKMALLOC_DMA__xen_pcibk_get_pcifront_devdentrycpu_itimerpercpusriov_get_vf_total_msixpci_domain_nrrel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setfound_devdelayed_workhiwater_rsskretprobe_instancesrangefutex_exit_mutexkernfs_iattrstrc_blkd_nodeIRQ_GC_NO_MASKd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagswait_for_threadsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingbus_tokenDOMAIN_BUS_IPIis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typestate_savedi_rdevirq_reroute_variantself_exec_idDOMAIN_BUS_WIRED_TO_MSIkernfs_opsfile_lockMODULE_STATE_LIVEclass_masknr_migrationsa_opsxa_flagspercpu_affinityfreezebin_sizemap_busclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITX86_IRQ_ALLOC_TYPE_PCI_MSIXirq_affinity_descd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITirq_baseset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkis_virtfnpercpu_refhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightcommonvm_files_stateuser_sizedev_pm_opsxsd_errorsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkkmalloc_typeqstrma_flagsno_msifutex_stateorig_pmdshpc_managedacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posirq_print_chipnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsbus_dma_regiondpc_capio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headlist_is_headrcharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointepoll_watchesprealloc_ptedqb_curspacegp_statebitsetload_avgaccesscstimepcie_capcore_internal_state__do_not_mess_with_itcfs_rq_uidmsi_indexst_spacemm_cid_next_scanns_typemsix_enabledxen_pci_opwill_handleac_majfltreal_timerpasid_enabledposix_cputimers_work_upperforce_resume_depthmodule_param_attrsshort unsigned intbus_flagsno_suspend_depthi_mutex_dir_keyq_nodespc_warnlimitvalids_encodinggpl_crcsorc_entrykeysorig_ptepasid_capdqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutexnanosleepDOMAIN_BUS_FSL_MC_MSIsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionpercpu_ref_func_tseq_stoppci_dev_flags_tdev_iddomain_alloc_irqskiocbclass_rwsem_read_intr_is_conditionalprobefsuidaer_statss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageIRQ_GC_INIT_MASK_CACHEirq_flags_to_cleararch_msi_msg_data_tno_callbacks__u16timers_activewait_countsig_okhwirqdelaysirq_safereadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagINIT_LIST_HEADsysdatafs_flagsworkpgprotval_tkeytypesigpendingfsindexshstknum_ctsrcu_sspwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequencepci_vpddqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendori_dir_seqirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmacls_mskchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typeirq_resumedpc_rp_log_sizeimm_readyf_iocb_flagspoweroffcmaj_fltaer_opvtimemath_emu_infoiowait_sumf_path__u64journal_infooverride_onlysched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimerequired_flagsdeadlinepinned_vm_head_2apsi_flagsaddressstart_boottimevm_startIRQ_GC_BE_IOs_flagscpumask_var_tfaultmsi_domain_infoshow_statsdl_densityfreeptr_tread_dqblkdq_flagschip_dataDD_CLASS_TYPE_DISJOINT_NAMESpci_devmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpdevicetypei_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffpending_masksyscall_user_dispatchrcu_tasks_exit_listset_descarchdataia_uid__list_del_entry_valid_or_reportchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_done___GFP_ACCOUNT_BITevtchn_irqpud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typemsi_enabledseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerfindquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memarch_spinlock_ti_mtime_nsecperformanceDOMAIN_BUS_PCI_DEVICE_MSImmlist__compiletime_assert_0__compiletime_assert_1__compiletime_assert_2__compiletime_assert_3devcapsuppress_bind_attrsRPM_RESUMINGreg_offsetpublish_pci_dev_cbgsbases_quota_typesirqchip_irq_statef_llistIRQ_NONEphandlei_nlinkbranchwrite_begingroupserr_handlerno_vf_scanpi_blocked_onDOMAIN_BUS_DEVICE_MSIcompanions_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tpci_sysdatasharepagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superinstalleds_inode_list_locksweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structpci_msi_descon_rqfs_contextprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfunsafe_warnllseekfoundDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitXenbusStateClosedwritable_sizercu_nodeinit_nameunfreeze_fsintervalclassaddress_hilast_mm_ciduntrustedcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesacpi_device_idd_ino_countlast_cpuilenmnt_flagscred_guard_mutexpci_opssigcnthrtimer_cpu_baseresourcescb_headcheck_quota_filedirty_folioattributerestrict_linkdev_archdatai_deviceskey_perm_tpi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knchip_typessival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapmsi_attribfiltercurr_ret_stackirqreturn_tdockdev_links_infoirq_bus_lockloff_tthread_pidsrcu_gp_seqno_command_memoryprepare_desc_archipi_send_singlest_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnoirq_calc_maskbatchasync_sizeacct_vm_mem1i_mtime_secDOMAIN_BUS_PLATFORM_MSIsh_infomemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idmsi_freefop_flags_tirq_fwspecFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmsi_initmodule_statelast_used_at__mutex_initirq_chip_type__compiletime_assert_473vm_endlast_queuednuma_migrate_retryuser_nsirq_ack__statefirstmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctimeDOMAIN_BUS_WIREDFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_areadev_datairq_request_resourcesirq_chip_genericrlockfl_owner_t_reseuidwaitbug_tabledirtied_time_whensequential_io_avgcallbacknum_trace_bprintk_fmtgc_flagsvm_policyperf_rdpmc_allowedrdevkernel_ulong_tDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayirq_flags_to_setRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpreg_readlctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenreclaim_sempme_supportdqb_btime_nr_pages_mappedutf8datarevmap_treemm_userss_ids_dentry_lrubp_offsetmask_basefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimenodenamesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsdmar_index_0_14release_workparent_irqksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliodriver_managed_dmaMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaDOMAIN_BUS_DMARdl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intXenbusStateClosingnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_highd1_supportarch_uprobemsi_mask_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedX86_IRQ_ALLOC_TYPE_PCI_MSI__list_add_valid_or_reportcompat_long_tactive_countspurious_eventss_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagssupported_flagstotal_numa_faultss_countdev_msi_infod_revalidateerrstringbus_groupsirq_chippmd_ts_opd_sbsysv_shmdq_countutf8data_tableset_latency_toleranceresource_size_tfoliowake_entryxa_headsuidirq_domain_opsi_readcountirq_write_msi_msglocked_vmthreads_oneshotrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalIRQ_GC_INIT_NESTED_LOCKbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countarch_addr_hiksm_merging_pagesotherendautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriesrequest_mutexs_qcopatomic_talloc_tag_countersdomain_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_iddev_listXenbusStateInitialisedbridge_ctldownclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirVTIME_USERsa_flagstest__kmalloc_cache_noprofDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalsupported_speedsmapcountem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOthreads_activecurrent_may_mountpci_dev_entryarch_addr_loseqlock_tnuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskcan_maskregfuncindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validvertical_positioni_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockmsi_msg___GFP_MOVABLE_BITpcie_bwctrl_dataactivexlatedqb_itimeWRITE_LIFE_MEDIUMop_worksrcu_idxpidsgetattrFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersdriver_exclusive_resourceselectorMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasedefault_timer_slack_nsirq_set_typesource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BITprivate_datagroup_infovdso_imagefileof_match_tablepercpu_count_ptr__user_state_sizedmar_subhandlepcie_cap_lockmce_kill_meuuid_tproperty_read_int_arraynr_actions___GFP_UNUSED_BITcount_objects_stimezone_device_dataf_wb_errhandler_namephysfndefparamlast_unhandledfred_csfault_flagresend_nodekprojid_tptracer_credtlb_genstorepage_mkwritekobjectaudit_ttymce_ripvstatfsats_enablednumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisteetlp_prefix_pathclass_groupsnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listrevmap_sizeaudit_contextpp_ref_countsysfs_opserror_detectedsequential_ioipi_send_maskis_busmaster_large_mapcountsda_is_staticformatftopenclavemask_cache_privdefault_irqsp_regcreatewrite_msi_msg_dataiattrirq_domain_bus_tokenrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadirqactiond_reallink_stateexpiry_activedqi_max_spc_limiteval_stringexception_table_entryevent_countparam_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimitDOMAIN_BUS_AMDVIi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tDOMAIN_BUS_PCI_MSIblocksirq_affinity_notifyset_infofileattr_getvectortimer_listaffinityXenbusStateReconfiguringdevice_dma_supportedd_ino_warnshiwater_vmxen_msix_entrytracepointcompound_headia_vfsuidirq_eoixen_pcibk_passthrough_backend__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersthread_maskino_timelimitpci_bus_flags_tsplice_writemsix_capstate_in_sysfssysfs_attrs__list_del_entry_validrom_base_regqf_nextio_window_1krangesiommu_mmirq_enableats_stucutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprividle_notificationsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestamppassthrough_dev_datafuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITsyncsetleasepinspacct_structmust_resumelong intfile_lock_contextusageuv_alloc_infosiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ssproperty_presentmsi_domain_ops__kmalloc_indexUSRQUOTApublish_root_cbprintk_index_sizesymtabrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncthreads_handledegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagsxdevcodetagPROBE_PREFER_ASYNCHRONOUSis_thunderboltmark_dirtythread_flagsnum_srcu_structsbdi_writebackpci_dev_datakobj_completion__kernel_clockid_tseccompiteratorqc_info__xen_pcibk_add_pci_devdev_nameTT_NONEVTIME_INACTIVEirq_common_dataf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idmultifunctiondepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldmultipleDOMAIN_BUS_GENERIC_MSIssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argsirq_unmasksrcu_reader_flavortv_nseci_lruiommu_cookied3cold_allowedgfp_maskpi_state_listrcu_segcblistsubvolbase_addressfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_iddev_pin_infojiffies_eoi_delayeddmar_reserved_0srcu_structrlim_curnofaultmm_countcputime_atomicdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NEST__xen_pcibk_release_pci_devbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledirqs_unhandledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextdmar_base_addressmsi_prepareopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_eventsiommuprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxtph_enabledsplice_pipeuclamp_reqeffective_affinitypasid_no_tlps_lock_keyreset_donesrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsslotstqheadmsi_domain_cookies_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copXenbusStateReconfigureddd_key_truedcookiehres_activebpf_raw_eventsdq_dirtydl_deferbug_listdirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemadd_busignore_childrenresourcerestore_earlyclock_mutexfs_supersnotifydqb_bsoftlimitpendingf_task_work___GFP_NORETRY_BITiowait_countmatch_driverdma_io_tlb_memstringread_countfutex_offsetlong long inthwsizemmio_always_onx86_msi_addr_hiatomic_flagssysvshmtimer_expiresirq_set_vcpu_affinitytrace_evalsactive_basesearly_initrcec_eamprotectsecurityxmm_spaceactivatemsix_basef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbX86_IRQ_ALLOC_TYPE_UVvm_flags_trefcount_struct___GFP_FS_BITdmar_index_15i_bytesdomain_datarelax_countlinelinkstart_timekernfs_nodedev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchreschedule_countvfsmountextable_basenoinstr_text_sizeattributesset_child_tid_overruntmpfilercu_read_lock_nestingtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugrefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tUTF8_NMAXfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqia_vfsgidsize_tcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workatomic_long_tpreallocclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicdelayed_callmax_nr_cid_statusd_sibbin_attributepercpu_counternuma_pages_migratedgsindexexpires_nexti_io_listf_epsrcu_barrier_seqreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tHRTIMER_BASE_BOOTTIMEclass_srcu_is_conditionalnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionHRTIMER_BASE_REALTIME_SOFTstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registers_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrstate_in_sysfstty_structUTASK_SSTEP_TRAPPEDbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollnr_wakeups_idleio_cqelf64_symlatch_tree_nodedestroy_work__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerma_external_lockuid_tflush_requiredsum_block_runtimepgmapdq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditional_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitnuma_groupdescriptionclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinei_inodyndbg_infoindexthread_headmap_typef_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenHRTIMER_RESTARTMOD_MEM_NUM_TYPESsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxcpu_basedquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_events_sys_privateUTF8_NFDIinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authHRTIMER_BASE_TAIvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherscompletionsw_reservedUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treequota_onvm_operations_structbin_attrs_newiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdatanrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupwake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlinedup_xol_worktotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramd_spc_softlimitreported_split_lockgfp_tseccomp_filterstimei_mmapthaw_superd_lrusignal_structperf_event_mutexcrcspgdval_tSB_FREEZE_WRITEsetattrf_mappingnoinstr_text_startbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activei_opldt_usr_semkobj_ns_type_operationsDQST_FREE_DQUOTSseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tis_dirty_writebacktrace_bprintk_fmt_startkstatfssitesptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutex_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupseqcount_spinlock_ti_wbclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedpagetrc_holdout_listget_inode_usagenormal_priodestroy_inoderelease_folioi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inameHRTIMER_BASE_MONOTONIC_SOFTi_mappinginblockrmidrseq_siglimit0limit1dqi_max_ino_limitmigrate_modeftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksd_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrDQST_SYNCSstack_vm_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalcg_listsrcu_barrier_completionrw_semaphoremnt_sb_ddebuginfofiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypeinit_modulemembarrier_statepage_poolinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_mempathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwrcu_syncvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstateueventlock_countrefcount_tplugsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttableslist_headtgidwrite_protect_seqcompat_robust_list_head_tids_inode_wblist_lockend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutask__UNIQUE_ID_srcversion473sched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextgpl_symsseq_showswait_queue_headblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfds_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceobjcgnodeDQST_READSvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvstatic_prioshrinkerdl_yieldeddqi_formatexec_update_lockDQF_PRIVATEDQF_SYS_FILE_Bl1d_flush_killi_versionprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symboltv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskSB_FREEZE_PAGEFAULTactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlock__rcu_headmce_vaddrquota_offdq_inusedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmod_tree_nodef_sb_errwritepagecodegtimesigactionclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listktypelockrefsrcu_struct_ptrsmm_structvlagi_uidspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesvm_mmmod_mem_typedebugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipMOD_INIT_RODATAqc_dqblkmmappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCi_write_hintfxsaveprocess_keyringlist_op_pendingllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyioveci_private_lockVTIME_IDLEstatic_keys_magicdl_overrunDQST_ALLOC_DQUOTSd_parentpayloadac_minflti_sbd_sbcommPIDTYPE_PIDatomic_write_segments_maxatomic_openreadahead_control__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupblockedi_securitystats_lockD_REAL_DATApt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colorbitsiopriocap_inheritablegp_waitlookupDD_CLASS_TYPE_LEVEL_NAMESvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vec__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATElf64_Symd_automountparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcestack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkDQST_CACHE_HITScmaxrsstimer_slack_nspolicysharedd_real_typelookahead_bandseq_startraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamerun_delaytailslinenoget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseattrscpumask_tswregs_statedqb_isoftlimitorig_axsched_rt_entitytimerqueue_nodeil_weightmem_dqblknr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pause_sigchldreservedlatency_record_countcgroupsprev_scan_seq_DQST_DQSTAT_LASTrcu_usersoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockUTF8_NFDICFcpu_bitmapstatic_call_keyutil_estucountsMOD_RODATAqc_statesoftirq_next_timercheck_flagsswp_entry_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aMOD_INVALIDmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalautogroupnr_threads__i_nlinkpushdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magicfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsMOD_INIT_DATAnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_infoshared_pendingi_gidmin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idHRTIMER_MAX_CLOCK_BASESkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsxa_flagsbin_sizegrphid_spc_timerjump_entriesassoc_array_ptrsuper_block_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_array__UNIQUE_ID_depends472mnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpref_node_fork__int128dqi_privrss_statmems_allowed_seqrefcntD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxresult_maskdquot_operationsmappinggrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizescheduledclass_raw_spinlock_nested_is_conditionalworker_privateis_relqstrma_flagsfutex_stateHRTIMER_BASE_TAI_SOFTacct_timexpd__rcu_icq_cacheDQST_WRITESsizef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tdl_server_has_tasks_frunnable_sumreal_credepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgcstimecfs_rq_uidst_spacemm_cid_next_scanac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysMOD_TEXTdqb_curinodesload__s8invalidate_lock_keyprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_marksdio_mem_alignbtime__u8is_roxlockrlim_maxruntime_deferred_listd_waitlist_lru_oneseq_stopkiocbclass_rwsem_read_intr_is_conditionalfsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeshrinker_idrootoom_reaper_listsym_VDSO32_NOTE_MASKbpf_storage__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingfsindexshstksrcu_ssp__page_1__page_2__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEi_sequencedqb_ihardlimitd_lockrefnum_bpf_raw_eventsaddr_perfi_dir_seqkqidKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typef_iocb_flagscmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagshrtimer_base_typestart_boottimevm_starts_flagsiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listhrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendings_listdqb_rsvspaceversionserialalloc_locks_dquotfolioqprev_posseqcount_spinlocks_umountis_bin_visiblesyscall_user_dispatchrcu_tasks_exit_listia_uidchildrenrb_subtree_lastbuild_idvfork_donenanosleeprt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelayquotalenf_pipei_wb_frn_historylast_wakeenextarch_spinlock_ti_mtime_nsecmmlistutf8_normalizationset_dqblkreg_offsetgsbases_quota_typesf_llisti_nlinkwrite_beginpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedHRTIMER_BASE_BOOTTIME_SOFTfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tquota_enablesched_avgntabmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextprealloc_bufprojiddrop_inodenum_trace_evalsllseeknext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeunfreeze_fsintervallast_mm_cidcookietargeta_flagstrace_overrunsession_keyringfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributerestrict_linkMOD_DATAi_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackloff_tthread_pidsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringma_locksched_delayedmodule_statelast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimemigrate_from_cpusrcu_barrier_mutexi_private_dataElf64_Halfnsproxyxol_areacleanup_modulerlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_datasignumfscrypt_keyrings_mountsuse_memdelay__state_sizethread_structcached_requested_keyenvpctimereleasesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_datasysv_semanon_vma_namefileattrDQST_DROPSlong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionali_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_ts_iflagsmce_kflagstotal_numa_faultss_countd_revalidates_opsysv_shmdq_countutf8data_tablefoliowake_entryxa_headsuidi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_lockiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_t_flagsnotify_nextshort intmynodeclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_ownerbp_regVTIME_USERsa_flagstesti_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivaltrace_event_callis_guestpoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keyGRPQUOTAi_private_listia_validi_rcuHRTIMER_BASE_REALTIMEi_atime_secqc_type_statekey_serial_tsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsi_wb_listxarray_startfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectordefault_timer_slack_nssource_listswap_readahead_info__fpstateactive_refgroup_infovdso_imagefile__user_state_sizemce_kill_meuuid_tcount_objects_stimezone_device_dataf_wb_errdefparamfred_cskprojid_tptracer_credtlb_genstorekobjectaudit_ttymce_ripvstatfsnumab_statefeatureson_listkgid_ton_cpufregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisti_mmap_rwsemwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadd_realexpiry_activedqi_max_spc_limitexception_table_entryfallocateHRTIMER_BASE_MONOTONICi_spc_warnlimitbuddy_listi_ino_timelimitSB_FREEZE_FSi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infotracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevfs_structclockiduint32_targ_startblocksset_infofileattr_getvectortimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrrenamevm_area_structsb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextiommu_mmcutimepersonalityget_statetask_sizes_inodes_addrbinfmtsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filercu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataki_posexecute_only_pkeysetleasepacct_structlong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typein_iowaitunregfuncegiddq_hashput_superMOD_INIT_TEXTpushable_dl_tasksf_flagsf_inodemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infoTT_NONEVTIME_INACTIVEcancelled_write_bytessrcu_usagebitmapmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_cold__UNIQUE_ID_name470ssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenDQST_LOOKUPSclass_spinlock_irq_try_is_conditionaloom_mmsrcu_reader_flavortv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idsrcu_structrlim_curnofaultmm_countSB_FREEZE_COMPLETEstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infodatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountki_filpcap_ambientatomic64_tanon_vmarlimread_folionr_eventsprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keysrcu_gp_startopenit_real_incrmodert_prioritymm_lock_seq__UNIQUE_ID_intree471KMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksrb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionexit_statesysvsemMOD_RO_AFTER_INITDQF_ROOT_SQUASH_Bfs_supersSB_UNFROZENdqb_bsoftlimitpendingf_task_workiowait_countstringread_countfutex_offsetlong long intatomic_flagssysvshmtrace_evalsactive_basessecurityxmm_spacef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesclass_rwsem_read_intr_is_conditionalclass_mutex_is_conditionalclass_preempt_notrace_is_conditionalMOD_INIT_RODATAMOD_TEXTclass_srcu_is_conditional_nameclass_rcu_is_conditionalclass_migrate_is_conditionallong long unsigned intNR_KMALLOC_TYPESclass_rwsem_read_is_conditionallong long intsigned charPIDTYPE_SIDclass_preempt_is_conditionalElf32_Wordorc_headerPIDTYPE_TGIDlong intclass_raw_spinlock_irq_is_conditional_descclass_local_lock_nested_bh_is_conditionalHRTIMER_BASE_MONOTONIC_SOFT__UNIQUE_ID_retpoline471class_rwsem_read_try_is_conditionalUTF8_NFDIDQST_LOOKUPSclass_spinlock_irqsave_is_conditionalclass_spinlock_try_is_conditionalclass_local_lock_is_conditionalhrtimer_base_typeMOD_RO_AFTER_INITn_descsz__u8DQST_ALLOC_DQUOTSSB_FREEZE_FSKMALLOC_NORMALDQST_WRITESunsigned int__int128class_irqsave_is_conditionalHRTIMER_BASE_REALTIMElong unsigned int__u32HRTIMER_MAX_CLOCK_BASESclass_spinlock_irqsave_try_is_conditionalclass_spinlock_is_conditionalshort unsigned intHRTIMER_BASE_TAIclass_local_lock_irqsave_is_conditionalclass_read_lock_is_conditionalelf32_noteboolDQST_DROPSclass_local_lock_irq_is_conditionalMOD_RODATAKMALLOC_CGROUPclass_rwsem_write_is_conditionalclass_spinlock_irq_try_is_conditionalclass_spinlock_irq_is_conditionalclass_write_lock_is_conditionaln_typeMOD_DATAclass_write_lock_irqsave_is_conditionalHRTIMER_BASE_BOOTTIMEn_nameszSB_FREEZE_COMPLETESB_FREEZE_WRITEclass_raw_spinlock_nested_is_conditionalMOD_MEM_NUM_TYPESDQST_SYNCSDQST_FREE_DQUOTSmod_mem_typeHRTIMER_BASE_MONOTONICclass_mutex_intr_is_conditionalclass_task_lock_is_conditionalUTF8_NMAX_nhdrPIDTYPE_PGID_Boolunsigned charKMALLOC_RECLAIMHRTIMER_BASE_BOOTTIME_SOFTcurrent_stack_pointershort int_note_18_note_19utf8_normalizationKMALLOC_RANDOM_STARTDQST_CACHE_HITSclass_irq_is_conditionalDQF_PRIVATEPIDTYPE_PIDDQST_READSMOD_INIT_DATAclass_raw_spinlock_try_is_conditionalclass_raw_spinlock_irqsave_is_conditionalPIDTYPE_MAXcharGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackSB_FREEZE_PAGEFAULTUTF8_NFDICFclass_mutex_try_is_conditional_DQST_DQSTAT_LASTclass_write_lock_irq_is_conditionalKMALLOC_RANDOM_ENDMOD_INIT_TEXTclass_raw_spinlock_irqsave_try_is_conditionalpid_typeHRTIMER_BASE_REALTIME_SOFTKMALLOC_DMAclass_read_lock_irq_is_conditionalHRTIMER_BASE_TAI_SOFTSB_UNFROZENclass_raw_spinlock_is_conditionalkmalloc_cache_typeclass_read_lock_irqsave_is_conditionalclass_rwsem_write_try_is_conditionalDQF_SYS_FILE_Bclass_raw_spinlock_irq_try_is_conditionalDQF_ROOT_SQUASH_B__UNIQUE_ID_vermagic470__int128 unsignedMOD_INVALID/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback/pci_stub.c/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback./arch/x86/include/asm./include/linux./arch/x86/include/asm/xen./include/asm-generic/bitops./include/linux/atomic./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/acpi./include/xen/interface./include/xen./include/xen/interface/iopci_stub.cpci_stub.cpci.hspinlock.hpci.hdevice.hkobject.hlist.hjump_label.hfortify-string.hslab.hhypercall.hpciback.hinstrumented-atomic.hbitops.hkernel.hinstrumented-non-atomic.hkref.hrefcount.hatomic-instrumented.hatomic-arch-fallback.hatomic.hint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hstatic_call.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.htracepoint-defs.hstat.hwait.hmutex.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hirqdomain.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hsemaphore.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.htracepoint.hmod_devicetable.hioport.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hof.hfwnode.hirqreturn.hinterrupt.hmsi_api.hacpi_bus.hirqhandler.hirqdesc.hirq.hmsi.hhw_irq.hirqdomain_defs.hproperty.hmsi.hrcupdate_trace.hcpuhplock.hphysdev.hxen.hacpi.hactypes.hxenbus.hxs_wire.hxenbus.hpciif.hconf_space.hconf_space_quirks.hsprintf.hstring.hpci.hevents.hdev_printk.hspinlock_api_smp.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback/pciback_ops.c/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback./include/linux./arch/x86/include/asm./include/linux/atomic./include/asm-generic/bitops./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/device./include/xen/interface/io./include/xenpciback_ops.cpciback_ops.cpci.hdevice.hjump_label.hinterrupt.hatomic-instrumented.hatomic-arch-fallback.hatomic.hpciback.hinstrumented-atomic.hbitops.hinstrumented-non-atomic.hslab.hworkqueue.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hstatic_call.hsched.hpreempt.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hwait.hirqreturn.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.htime64.htracepoint-defs.hrcupdate.hmutex.hkref.hworkqueue_types.hasm.hextable.hirqhandler.hirqdesc.hmaple_tree.hrwsem.hswait.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hirqdomain.hfwnode.hpercpu-refcount.hirq.hmsi.hxarray.hlist_lru.hkernfs.hkobject_ns.hstat.hkobject.hhw_irq.hirqdomain_defs.hmsi_api.huuid.hmod_devicetable.hof.hmsi.hrcupdate_trace.henergy_model.hioport.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.huio.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hsemaphore.hmigrate_mode.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hdevice.hcpuhplock.hxenbus.hxs_wire.hxenbus.hpciif.hevents.hdev_printk.hoverflow.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback/xenbus.c/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback./include/linux./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/device./include/xen/interface./include/xen/interface/io./include/xenxenbus.cxenbus.cdevice.hpciback.hjump_label.hslab.hlist.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hinit.hasm.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hstatic_call.hbug.hcodetag.hsched.hpreempt.hcpumask_types.hatomic-long.hstddef.hgfp_types.hsysfs.hllist.hsmp_types.hrestart_block.htime_types.htime32.hrange.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hprocessor.hmath_emu.hirqflags.htypes.hshstk.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.hspinlock.hrcupdate.htime64.htracepoint-defs.hworkqueue_types.hworkqueue.hmutex.hwait.hkref.hmaple_tree.hrwsem.hswait.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hirqdomain.hxarray.hlist_lru.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hioport.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.huio.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hsemaphore.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hmod_devicetable.hdevice.hof.hfwnode.hgrant_table.hxenbus.hxs_wire.hevent_channel.hxenbus.hirqreturn.hinterrupt.hirqhandler.hirqdesc.hirq.hmsi.hhw_irq.hirqdomain_defs.hmsi_api.hmsi.hrcupdate_trace.hcpuhplock.hpci.hpciif.hpci.hdev_printk.hsprintf.hevents.hstring.h/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback/conf_space.c/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback./include/linux./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/device./include/xen/interface/ioconf_space.cconf_space.cdevice.hjump_label.hpci.hlist.hslab.herr.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hasm.hinit.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hstatic_call.hbug.huuid.hmod_devicetable.hioport.hsched.hspinlock_types.hrwlock_types.hcpumask_types.hatomic-long.hstddef.hgfp_types.hsysfs.hllist.hsmp_types.hpreempt.hrestart_block.htime_types.htime32.hrange.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hprocessor.hmath_emu.hirqflags.htypes.hshstk.hthread_info.hosq_lock.hmutex_types.hmutex.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.hrcupdate.hwait.hkref.hmaple_tree.hrwsem.hswait.htime64.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hirqdomain.hxarray.hlist_lru.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.huio.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hdevice.hof.hfwnode.hirqreturn.hinterrupt.hmsi_api.hxs_wire.hirqhandler.hirqdesc.hirq.hmsi.hhw_irq.hirqdomain_defs.hmsi.hrcupdate_trace.hcpuhplock.hpciback.hconf_space.hconf_space_quirks.hdev_printk.h/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback/conf_space_header.c/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback./include/linux./include/linux/atomic./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/device./include/xen/interface/ioconf_space_header.cconf_space_header.cslab.herr.hdevice.hpci.hatomic-instrumented.hatomic-arch-fallback.hatomic.hjump_label.hioport.hconf_space.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hstatic_call.hbug.huuid.hmod_devicetable.hsched.hspinlock_types.hrwlock_types.hcpumask_types.hatomic-long.hstddef.hgfp_types.hsysfs.hllist.hsmp_types.hpreempt.hrestart_block.htime_types.htime32.hrange.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hprocessor.hmath_emu.hirqflags.htypes.hshstk.hthread_info.hosq_lock.hmutex_types.hmutex.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.hrcupdate.hwait.hkref.hmaple_tree.hrwsem.hswait.htime64.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hirqdomain.hxarray.hlist_lru.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.huio.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.herrseq.hmnt_idmapping.hpercpu-refcount.hasm.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hdevice.hof.hfwnode.hirqreturn.hinterrupt.hmsi_api.hxs_wire.hirqhandler.hirqdesc.hirq.hmsi.hhw_irq.hirqdomain_defs.hmsi.hrcupdate_trace.hcpuhplock.hpciback.hdev_printk.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback/conf_space_capability.c/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback./include/linux./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/device./include/xen/interface/ioconf_space_capability.cconf_space_capability.cpci.hdevice.herr.hjump_label.hconf_space.hlist.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hstatic_call.hbug.huuid.hmod_devicetable.hioport.hsched.hspinlock_types.hrwlock_types.hcpumask_types.hatomic-long.hsysfs.hllist.hsmp_types.hpreempt.hrestart_block.htime_types.htime32.hrange.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hprocessor.hmath_emu.hirqflags.htypes.hshstk.hthread_info.hosq_lock.hmutex_types.hmutex.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.hrcupdate.hwait.hkref.hmaple_tree.hrwsem.hswait.htime64.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hirqdomain.hxarray.hlist_lru.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.huio.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hdevice.hof.hfwnode.hirqreturn.hinterrupt.hmsi_api.hxs_wire.hirqhandler.hirqdesc.hirq.hmsi.hhw_irq.hirqdomain_defs.hmsi.hrcupdate_trace.hcpuhplock.hpciback.hasm.hstddef.h/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback/conf_space_quirks.c/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm./arch/x86/include/asm/fpu./include/linux/sched./include/linux/device./include/xen/interface/ioconf_space_quirks.cconf_space_quirks.cpci.hdevice.hconf_space.hslab.hlist.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hstatic_call.hbug.huuid.hmod_devicetable.hioport.hsched.hspinlock_types.hrwlock_types.hcpumask_types.hatomic-long.hstddef.hgfp_types.hsysfs.hllist.hsmp_types.hpreempt.hrestart_block.htime_types.htime32.hrange.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hprocessor.hmath_emu.hirqflags.htypes.hshstk.hthread_info.hosq_lock.hmutex_types.hmutex.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.hrcupdate.hwait.hkref.hmaple_tree.hrwsem.hswait.htime64.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hirqdomain.hxarray.hlist_lru.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.huio.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.herrseq.hmnt_idmapping.hpercpu-refcount.hasm.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hdevice.hof.hfwnode.hirqreturn.hinterrupt.hmsi_api.hxs_wire.hirqhandler.hirqdesc.hirq.hmsi.hhw_irq.hirqdomain_defs.hmsi.hrcupdate_trace.hcpuhplock.hpciback.hconf_space_quirks.hdev_printk.h/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback/vpci.c/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback./include/linux./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/device./include/xen/interface/io./include/xenvpci.cvpci.clist.hdevice.hslab.hpci.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hstddef.hgfp_types.hsched.hstatic_call_types.hstatic_call.hpreempt.hfs.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hwait.hosq_lock.hmutex_types.hmutex.hseqlock_types.hnodemask_types.htlbbatch.hmm_types_task.hrefcount_types.hkref.hrbtree_types.hrcupdate.hmaple_tree.hrwsem.hswait.hcompletion.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hirqdomain.hpercpu-refcount.hasm.huuid.hmod_devicetable.hioport.hxarray.hlist_lru.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.huio.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hsemaphore.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hdevice.hof.hfwnode.hirqreturn.hinterrupt.hmsi_api.hpci.hxenbus.hxs_wire.hxenbus.hirqhandler.hirqdesc.hirq.hmsi.hhw_irq.hirqdomain_defs.hmsi.hrcupdate_trace.hcpuhplock.hpciif.hpciback.hdev_printk.h/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback/passthrough.c/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback./arch/x86/include/asm./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/device./include/xen/interface/io./include/xenpassthrough.cpassthrough.cpci.hslab.hlist.hdevice.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hjump_label.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.huuid.hmod_devicetable.hioport.hsched.hspinlock_types.hrwlock_types.hstatic_call_types.hstatic_call.hcpumask_types.hatomic-long.hstddef.hgfp_types.hsysfs.hllist.hsmp_types.hpreempt.hrestart_block.htime_types.htime32.hrange.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hprocessor.hmath_emu.hirqflags.htypes.hshstk.hthread_info.hosq_lock.hmutex_types.hmutex.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.hrcupdate.hwait.hkref.hmaple_tree.hrwsem.hswait.htime64.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hirqdomain.hxarray.hlist_lru.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.huio.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hsemaphore.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.herrseq.hmnt_idmapping.hpercpu-refcount.hasm.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hdevice.hof.hfwnode.hirqreturn.hinterrupt.hmsi_api.hpci.hxenbus.hxs_wire.hxenbus.hirqhandler.hirqdesc.hirq.hmsi.hhw_irq.hirqdomain_defs.hmsi.hrcupdate_trace.hcpuhplock.hpciif.hpciback.hdrivers/xen/xen-pciback/xen-pciback.mod.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingdrivers/xen/xen-pciback./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/schedxen-pciback.mod.cint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hirqflags.htypes.hshstk.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hquota.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hxen-pciback.mod.c/home/thomas/Documents/kernels/stagingscripts/module-common.c/home/thomas/Documents/kernels/stagingscripts./include/uapi/asm-generic./include/linux./include/linux/sched./include/uapi/linux./arch/x86/include/asm./include/asm-genericmodule-common.cint-ll64.htypes.hirqflags.hpreempt.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hpid_types.hhrtimer_defs.hslab.hunicode.hquota.hquota.hfs.helf.hmodule.hasm.hmodule-common.cint-ll64.hn*PSbPSPSPS"0KZ0ZSVSS"0>KPKZ0PPPPPPSPSPSPSPSPSPSPSPP\V\`U`a|xaVPSPS#0P  ,\\\1PPQ \ TS  v Uv  TS(U(U(T(T(Q(vQ(Q(vQ(q~(VQ(Q(vQSSgV~V0,S,0qx0gS~SPWTozT[0[g1~0  PPhsP Q Qq #/  T#.TUUT\T\px|Vpx,Q,3pD0DS0P]]PPPUbP  PpPpp ] U UTSTSTSTSTgQgVQV;0;eS0S  P =UUPUUPPSSQ__R\\X^^Y>>ZXZp  Pp # pUUU  UUU UUU UUU 000 111 000 UUUPPP  1  U 1 U   U  PUUT\T\px|Vpx,Q,3pD0DS0P]]PPPUbP  PpPpp ] U UEUTSTSTSTSTSESgQgVQVEVA0AkS0S 0E0*PPP P EQQQ QSSQ__R\\X^^Y>>ZXZ p  p #PPP  PPP PPP PPP 000 111 000 PPPQQQ  1  P 1 P   P  QUU'T'\T\I0I__P@^^^KVqV$P4=P/S2GSmS^SS^ ~8~8# @ U UTSTST7Q70\000S,Q,,R,\((,X,ggkRk##,Y,bbkXk]^_IIII \ II~II]]]]0P\\P\00"P"{__P_]^^^:P:cSSPk000:P:USSP P P k111 P 1_DN_Xg_ DN Xg _DN_Xg_ _DD_Xg_ _DD_Xg_ 0DD0Xg0 1DD1Xg1 0DD0Xg0 _DD_Xg_ P:APNZP  1  _ 1 _   _  P U UTSTSTSTSTSTSTgQgVQV"P"gSSPSSSPS-\\\tY0Ys\|V0\0\ =1    00SSSSSQ_____R\\\\\X^^^^^Y>>ZXZTtSSS   SSS SSS SSS 000 111 000 SSSPPP  1  S 1 S   S  PUUT\T\pxVpx Q EpE0ES0P]]PP PP  Pp P pp ]UU!T!\TMSRoS=0=VPt]S SAKS   ] U UTSTSTSTSTBQB000  SSSQ___R\\\X^^^Y>>ZXZVVV\\\]]]^^^)S)?_?SSS)_)?P?_P_( 00 PP  SS__PP9S.SS1PPR1    00  TP U UTVTVgQgSQSQ0$P VVQ__R\\X^^Y??[X[uUuVUUVUVUVUVT\TT\T\T\T\zQzSQSSQSQSR]R]R]R]R] P _XuPux_P_00P0P0? q3$r7!?B q3$~!Bg q3$r7!gp s3$r7!p s3$}7!Q3$R7! q3$r7!Q3$}7!Q3$R7! s3$}7! q3$r7!s3$R7! q3$r7! s3$}7!60q00 P _XuPux_P_  65q55 1 1    00UVUUVUVpV P XSSSPPpS.1    00PP1P1P1PSNVSdsS NV ds SNVSdsS SNNSdsS SNNSdsS 0NN0ds0 1NN1ds1 0NN0ds0 SNNSdsS PELP[gP  1  S 1 S   S  PUVUUVVVT\TT\T\T\T\\TV\ P zSSPPVS2P2P\2P\2V2.1  001    001    00PP1P1P1PSS  SS SSS SSS 000 111 000 SSSPPP  1  S 1 S   S  PUVUVUVnV P |SSSS6P6nS5PP\5P\5n5.1  001    00PP1P1P1PSS  SS SSS SSS 000 111 000 SSSPPP  1  S 1 S   S  PUVUVUVnV P |SSSS6P6nS5PP\5P\5n5.1  001    00PP1P1P1PSS  SS SSS SSS 000 111 000 SSSPPP  1  S 1 S   S  PMUM]U]O]ITItvtTOTpQpSQSQSQS!S!OQiRi^R^O^5R5^P^^O^vvOv\\O\VVOVPEW _PP;1    00# _ _ _ _ p2% p2% 2V2V2V _,SpSP q2% 12V2V2V'U'T#v#'Q'(vv'R'(vv'X'(v1|1|2V2V00\\2| 2 | 0000|||000||| 000 |||1|1| 0ES0 \ES\2| 2 | 02V2V2V2V2VCUC\U\>\ P2P>BPddPP8PUVUUVUVUVV{v~SSUSSUS{S{0{S0SU0SUS{SP\PV\V\TV\{\1    00VPPQ41    00PRRPPpppUT    \\T  U8sUsUs 1PPQ TVSnrSryUSU nz  SnrSryUSU SnnSSU SnnSSU 0nn00 1nn11 0nn00 SnnSSU PepPP  1  S 1 S   S  PUSS)U)STTTTT0 00 )0/1Kk000100P\00),0,\1    00"0 P  "5 1mSSSRUUUU  P VTTPa0am100   U V  U 9QRR KW   TKVTPUS\lV0V P ]^P^P^P^P^0P]0]VSSPVV1  0000P8VV 8 8 66 8 1 V V 1 V 1 V 1  V  1  1    00 v Uv   ^P^PP P^ 'V^kV' ^k 'V^kV 'V^^V 'V^^V '0^^0 '1^^1 '0^^0 'V^^VPV]P 1 V1V V P v Uv Ut\t|U|}U}\U"T"qSq}T}S|T"Q"rVr}Q}VQ"R"v]v}R}]RP?PPwPPR^W^T^0^}1}0 P ? Pw P   by ^bt^txT#\# #\#S# \S 19P]U]^U2P2]P]S0P\P\P0PPVPVPVPV0\1   002P2]P]SssU   p> U  p> U 1   01   0PPNTD1   01   01   0SPsP S ssS%SS S 0 s 0UVUUVUVUVVpxSvhSvhSvhSSk0kSvhSvhSvh0SSPWTPT\\\\\PPPPPPQs0)vH)s0)vH)s0)vH)1s0)s0)       TTVVVv VVPS/7SGTS /7 GT S/7SGTS S//SGTS S//SGTS 0//0GT0 1//1GT1 0//0GT0 S//SGTSP&-P>JP  1  S 1 S   S  PU]U]"T"tVtTVT px SpxGShSv0vVP0Pf\o\P4  P  ]?]S?S0?G0GV P+:Pss19sP18P2]2S2S2S2S2S 2SP&P  1  S 1 S 1 S 1P \Uf]fms(mU]U,T,LSLT,Q,I\IQ,R,^R^,X,_X_PGShpSuS0]P0P`VmV  ]!s(!;U\d]iUP;S\dSiS0;]\d0i]PLSP psBJsPBIPUB`USB`SSB`SSB`SSB`SSB`S0B`0 1B`1 0B`0 SB`S P9EPHTP  1  S 1 S 1 S 1P VU"P":UP Pu@%"U":U@%u8%"p8%": U8%u3%Op3%O"Q":U3%Ou7p7"R":U7U:S:U#T#i\irTr\#Q#k]krQr]#R#m^mrRr^ P ,S,8P8VSP5V@^V  PS3QSPS3QSPS3QSPS3QS03Q0 13Q1 03Q0 PS3QS P*6P9EP  1 P S 1P S 1P S 1P V$U$X$T$YQZkPQz  QTT.U.VUUUV0V U VUUUV0VSS0S\\0\1    00P~PPPPOTT S sSS0s0SU'S'/UT(V(/TQ*\*/QUSTVQ\1"PZUZkUksUsU UZTZkTksTsh hZTZkTksTsh hVtOVTkV VTt#U#UUU#T#fSfkTkSTSTS#T#fSfkTkSTSTS 2t2t CSCHTHySy~T~STS *1*H0H[1s~0S0P0P0P0s0s s Qs s Qs2!2P!P2!2P!P2!2P!P1"1s"s1"1s"s1"1s"s S/>S 1/>12s 2 s 1MUMSUS \ S \ S U ShSPsUxs | s | s Ux shs%U%SUS \ S \ S U ShS ss| s | s sshs(P(e___U_ _  _ _ _ _h_0]0]]  ]  ] ] ]]h] s s |  s  |  s  s s hs 00 000P  0  P  0 0  0000h3s/s(/s,/s0Pp0P0P 0 sx 0 sxQss s s s ssQ__ _ _ _ __Qs s  s  s  s  s s PP P1    00_"s6Pss"_6P__"s 6Ps s 1    00P_0)P).R9sss9___9s s s .1    00P_s|s|sssIs/_/6U6____I_s | s | s s s Is PPP 0=CRC[r[bR0SsySsyS0FRFRP|Y|P"1   00 _ U0000I0P|Y|P8  s<  U  s< 8  s< 3$ U s< 3$ U _Y P!1    00 ___  s0P0P0P0sx0sx&s&4Ux s Ux s40 0 02sx 2 sx,0/U/kSkpUpSS=CSs=Css=Css=CskUkSUSUS!SkTkTTTTT!TVVV!VPPP=0=A|1AX p3%101    00Ssss11    00SsssUuv( ^SoUaUakUkvUKSKOUPQSQVuVeSuFSFJUQ`SSp0 U VUVTT0P0P\P\0 \S?S0SUVVVPSPSS0PSPSS              11    00SvvS0"s0Tas0"0Ta0"STaS$U$RVRXtXYUYmUmVUUVUVUVXPVUUVU$T$NSNYTYSTSTSTSTSTST7\V>aUajVTjTPS(.S.2U=FPPPV#PPS(.S.2U=FP$2$  2 1S      S  S  1 P      S  S  1 P      S  S  1 P      S  S  1 PUUU@UTTTLTQSQQSRRRVRPu\PUuUSUSTVTVPPP p $ &UVUVT\T\QS]QSS q as! N as!RRPPP]]1    00pUUpTTpQSQSpRRPUUUTTTQQQRRRUV~~UV~~UV]]]]SSS]    00]V S010P0\S0__0P0PUUUUt~$UBS0sUUUt~UbSSSS0 S b   DsS2SSS1PPQ U UUjVjts8tUV P mStyP0  P mStyP$@$ $@$ $@$ @ 1$S$S$  $  $S $V S V   1$P6U6@U@dU6T6@T@dTUUTTUVUJ0JO1OV0FU P 7P<>PPCuPUu ,U,VU0T0T0Q0^Q0R0]R0X0\XPFPFaP0R>@\~p\PpS~Pp p 2T p2Q&v8&2RPpS~PH H 1&S&\!S!_!\S_\1(PPP&U&U*T*}\}T\*Q*]Q]*R*^R^\V\dpimVPFPY]PO0O[S[iPim0PFvY]vPTT  |~g~ #/(  > ==P  )0% bbcfgnty> 7 OoOO69>[ej!     O1Yt'kz ES3Q3Q3Q3Q3Q09  *1 )1;CFNT\p   NVdsNVdsNNds{  ",8 nquznquznn  #,,;;{1n   :T::n   :T::V   :T::. $l  DNXgDNXgDDXg  *2<DGOU] )1;CFNT\E )1;CFNT\ /_&.9    #(m   KWELV   '^k'^k'^^ BckpBJB`B`B`B`B`?19    /7GT/7GT//GTT( !(((=Ch  hQ    # 0%     h    -#    ',=Hs />  !"KEFKQ`k!#!#g  gxxxddd*M**,UrUU '9E117,  @ACEFGI ,P;pP61; )A,`:`T>RP/co, , , , ,` ,@ , , *, (H,vPT48m4`8;4(8484848V`wP54p8i ;(,@,; : 3?4h8X`O  9l480048 48,(p:@4848+O{OO?408X48qnj`O48488n~4P848 48$VPLf@rBE !7X488! %p48A484H8%   , P  p ,$ ,/ ,: PG hT xa ,l ,w  , `, , ,  @, ,  , , `,  , ,$ @,/ p< ,G ,R _ ,j `,u  , , @, p  , , 0 H  `,  , , 0 ( ` ,3H_+'z.0222 P 82'2 42(A20O28]2@k2Hy2P2X2`2h2p2x2222 2 2! 2/ 2= 2K 2Y 2g 2u 2 2 2 R (  0   5P* = U*J 48! 4X8: ] !U 4 8n 4@8 48 4x8 48   ,    , ~ h  @   ` ,  (  ,1  0 <  ` ,E  Q  ,A2[ 2i 22w  } q7Z7v8 4P8 48 :: 40 8  k ; 4 8 4H 8 4 89 4 8R 4h 8'>k 48LA& 48 4p8 48 48 48 48oFB@G9 4883 48HL 4 8e ;036m ,  ~    0   P (  ,  ,  1     0 E  P   p     ,[ 2  @ 2 2( f +((? @ W0JId4@ 8}4 84 8Q -4 84` 84( 84 8.4 8  `~  "      !F 0  `,  O20Q.oP(  VV W$PW9W&~ HW XX hYzY@Z6Zj[&U 4 8 4 8 4 84X 84 8 4x 8$ !P^7 E `@N W !    ,    ,  P (  `,    ,1  #<  ,282@A2HO2P2X@`,p`,``a-b@b Xb4 8,483 @B,@ b,` ,  ,  ~  '  ` @  $    ,2`*lhhpi0j0kv1;1k4l9< ~  @V `, ,_2hl2pyn5nlo4`pPqr^1;1rp`@#4PPPq@     40IdP@0!%/@*O*k7p78::;!>FAiF0GH JVVW@W3pWBWRpXbpYtY0ZZ[@^0```` a'b:bRbfhh`i j k k.lnnfpo.Pp@qpr rL@]p@G#j s |$4 M5e!n!w" (&R@KJP N2JTfw9#eV(4?& KJ)\;0q#(J X`K+"J'& Vd=Qe@-"QK i&U;)1,d&$&0_BO`izL"P. J"&8JD@fzd'S + : E W ` i ~  g f  J ! !pK+!H!]!o!'!!!Pf!"Q%"JF"@.\"c"p"""""" g##$c:#I#Y#l###g0Nb#kP-#'V% T^$ 6#e##6 $%$2$?$X$6u$$$$$$$$c#%JA% @#g_%PKp%%%T%%Sr%%& _9&K[& @r&y&V&&T!`fd&R& '(& f!'9'N'['r''''''Vpci_stub.cpcistub_devicespcistub_devices_lockdevice_ids_lockpcistub_device_idskill_domain_by_device.colddriver_attr_new_slotxen_pcibk_pci_driverdriver_attr_remove_slotdriver_attr_slotsdriver_attr_quirksdriver_attr_permissivedriver_attr_allow_interrupt_controldriver_attr_irq_handlersdriver_attr_irq_handler_statepci_stub_nb__UNIQUE_ID_ddebug740.49__UNIQUE_ID_ddebug742.48__key.198__UNIQUE_ID_ddebug744.47__UNIQUE_ID_ddebug746.45__UNIQUE_ID_ddebug748.43__UNIQUE_ID_ddebug750.41__UNIQUE_ID_ddebug778.5pci_devs_to_hideseized_devicesinitialize_devices__UNIQUE_ID_ddebug760.26common_process.cold__UNIQUE_ID_ddebug738.53pcistub_device_release.cold__UNIQUE_ID_ddebug782.3__UNIQUE_ID_ddebug776.9pcistub_semxen_pcibk_error_resume.cold__UNIQUE_ID_ddebug756.35__UNIQUE_ID_ddebug758.34pcistub_remove.cold__UNIQUE_ID_ddebug762.24__UNIQUE_ID_ddebug764.20xen_pcibk_slot_reset.cold__UNIQUE_ID_ddebug766.19__UNIQUE_ID_ddebug768.15xen_pcibk_mmio_enabled.cold__UNIQUE_ID_ddebug770.14__UNIQUE_ID_ddebug774.10__UNIQUE_ID_ddebug772.11xen_pcibk_error_detected.coldpermissive_store.cold__UNIQUE_ID_ddebug780.4__UNIQUE_ID_ddebug754.38pcistub_probe.cold__UNIQUE_ID_ddebug736.54__UNIQUE_ID_ddebug752.39pcistub_put_pci_dev.cold__func__.205_entry.204__func__.203__func__.202_entry.201_entry.200_entry.199__func__.197__func__.196__func__.195_entry.194_entry.193__func__.192_entry.191_entry.190_entry.189_entry.188__func__.187_entry.186_entry.185__func__.184_entry.183_entry.182_entry.181__func__.180_entry.179_entry.178_entry.177__func__.176_entry.175_entry.174__func__.173_entry.172_entry.171__func__.170_entry.169_entry.168_entry.167__func__.166__func__.165_entry.164_entry.163__func__.162__func__.161_entry.160__func__.159_entry.158_entry.157__func__.156_entry.155__UNIQUE_ID_alias788__UNIQUE_ID_license787__UNIQUE_ID_description786__UNIQUE_ID___addressable_cleanup_module785__UNIQUE_ID___addressable_init_module784_entry_ptr.0_entry_ptr.1_entry_ptr.2pcistub_idsxen_pcibk_error_handler_entry_ptr.6_entry_ptr.7_entry_ptr.8_entry_ptr.12_entry_ptr.13_entry_ptr.16_entry_ptr.17_entry_ptr.18_entry_ptr.21_entry_ptr.22_entry_ptr.23_entry_ptr.25_entry_ptr.27_entry_ptr.28_entry_ptr.29_entry_ptr.30_entry_ptr.31_entry_ptr.32_entry_ptr.33_entry_ptr.36_entry_ptr.37_entry_ptr.40_entry_ptr.42_entry_ptr.44_entry_ptr.46_entry_ptr.50_entry_ptr.51_entry_ptr.52__UNIQUE_ID_hidetype735__param_hide__param_str_hide.LC88pciback_ops.cxen_pcibk_guest_interrupt.cold__UNIQUE_ID_ddebug735.22__UNIQUE_ID_ddebug737.20xen_pcibk_control_isr.cold__UNIQUE_ID_ddebug739.18__UNIQUE_ID_ddebug747.13__UNIQUE_ID_ddebug743.16__UNIQUE_ID_ddebug745.15__UNIQUE_ID_ddebug741.17__func__.2_rs.3__func__.6_rs.7xen_pcibk_do_op.cold__func__.0_entry.1__func__.4_entry.5__func__.8_entry.9__func__.10_entry.11_entry_ptr.14_entry_ptr.19.LC25xenbus.c__UNIQUE_ID_ddebug757.22__UNIQUE_ID_ddebug759.21__UNIQUE_ID_ddebug749.28xen_pcibk_export_device.cold__UNIQUE_ID_ddebug743.31__UNIQUE_ID_ddebug739.33__UNIQUE_ID_ddebug741.32__UNIQUE_ID_ddebug745.30__UNIQUE_ID_ddebug747.29__UNIQUE_ID_ddebug771.15__UNIQUE_ID_ddebug761.20__UNIQUE_ID_ddebug765.18__UNIQUE_ID_ddebug751.25__UNIQUE_ID_ddebug755.23__UNIQUE_ID_ddebug763.19__UNIQUE_ID_ddebug753.24__UNIQUE_ID_ddebug767.17__UNIQUE_ID_ddebug769.16__UNIQUE_ID_ddebug737.34__key.2xen_pcibk_driver__func__.1__func__.3_entry.6__func__.7__func__.9__func__.11__func__.12_entry.13xen_pcibk_ids_entry_ptr.26__UNIQUE_ID_passthrough736__UNIQUE_ID_passthroughtype735__param_passthrough__param_str_passthroughconf_space.c__UNIQUE_ID_ddebug736.16__UNIQUE_ID_ddebug738.15__UNIQUE_ID_ddebug740.14xen_pcibk_config_write.cold__UNIQUE_ID_ddebug742.12__UNIQUE_ID_ddebug744.11__UNIQUE_ID_ddebug746.10__UNIQUE_ID_ddebug748.9__UNIQUE_ID_ddebug750.8__func__.5__UNIQUE_ID_permissivetype735__param_permissive__param_str_permissiveconf_space_header.cbar_read.coldrom_write.coldbar_write.cold__UNIQUE_ID_ddebug737.19__UNIQUE_ID_ddebug735.20__UNIQUE_ID_ddebug745.14command_write.coldheader_commonheader_1header_0xen_pcibk_config_header_add_fields.cold_entry.3_entry.7_entry_ptr.10_entry_ptr.11_entry_ptr.15conf_space_capability.cmsi_field_configmsix_field_config__UNIQUE_ID_ddebug737.2capabilities__UNIQUE_ID_ddebug735.3caplist_headerxen_pcibk_config_capability_vpdxen_pcibk_config_capability_pmxen_pcibk_config_capability_msixen_pcibk_config_capability_msixcaplist_msixcaplist_msicaplist_vpdcaplist_pmconf_space_quirks.cxen_pcibk_config_quirk_release.coldvpci.c__key.0__xen_pcibk_add_pci_dev.cold_entry.2_entry_ptr.4_entry_ptr.5passthrough.c__pfx_pcistub_device_find_locked__pfx_pci_stub_notifier__pfx_irq_handlers_show__pfx_allow_interrupt_control_show__pfx_permissive_show__pfx_quirks_show__pfx_slots_show__pfx_kill_domain_by_device__pfx_pcistub_device_id_add_list__pfx_pcistub_device_id_add__pfx_common_process__pfx_pcistub_device_find__pfx_pcistub_get_gsi_from_sbdf__pfx_pcistub_device_release__pfx_irq_handler_state_store__pfx_xen_pcibk_error_resume__pfx_pcistub_remove__pfx_xen_pcibk_slot_reset__pfx_xen_pcibk_mmio_enabled__pfx_xen_pcibk_error_detected__pfx_quirks_store__pfx_new_slot_store__pfx_allow_interrupt_control_store__pfx_permissive_store__pfx_remove_slot_store__pfx_pcistub_probe__pfx_xen_pcibk_guest_interrupt__pfx_xen_pcibk_control_isr__pfx_xen_pcibk_disconnect__pfx_xen_pcibk_xenbus_remove__pfx_xen_pcibk_publish_pci_root__pfx_xen_pcibk_publish_pci_dev__pfx_xen_pcibk_export_device__pfx_xen_pcibk_attach.isra.0__pfx_xen_pcibk_setup_backend.isra.0__pfx_xen_pcibk_reconfigure.isra.0__pfx_xen_pcibk_be_watch__pfx_xen_pcibk_frontend_changed__pfx_xen_pcibk_xenbus_probe__pfx_conf_space_read__pfx_bar_reset__pfx_xen_pcibk_read_vendor__pfx_xen_pcibk_read_device__pfx_interrupt_read__pfx_bar_read__pfx_rom_write__pfx_bar_write__pfx_bar_release__pfx_bist_write__pfx_command_read__pfx_command_init__pfx_command_write__pfx_bar_init__pfx_msi_field_init__pfx_msix_field_init__pfx_pm_caps_read__pfx_msi_msix_flags_write__pfx_pm_ctrl_init__pfx_vpd_address_write__pfx_pm_ctrl_write__pfx___xen_pcibk_publish_pci_roots__pfx___xen_pcibk_get_pci_dev__pfx___xen_pcibk_get_pcifront_dev__pfx___xen_pcibk_release_pci_dev__pfx___xen_pcibk_init_devices__pfx___xen_pcibk_release_devices__pfx___xen_pcibk_add_pci_dev__pfx___list_add__pfx_pcistub_exit__pfx_pcistub_init_device__pfx_xen_pcibk_cleanup__pfx_xen_pcibk_initxen-pciback.mod.c__UNIQUE_ID_srcversion473__UNIQUE_ID_depends472__UNIQUE_ID_intree471__UNIQUE_ID_name470module-common.c__UNIQUE_ID_retpoline471__UNIQUE_ID_vermagic470_note_19_note_18orc_headerunbind_from_irqhandlerpci_save_statefree_irq__pfx_xen_pcibk_write_config_dword__pfx_xen_pcibk_config_writexenbus_gather__list_add_valid_or_reportbus_unregister_notifier__pfx_xen_pcibk_write_config_bytepci_enable_device__kmalloc_noprof__this_modulesnprintfqueue_work_onxen_reset_devicedriver_remove_filepci_dev_putdevice_unregisterfinish_waitxenbus_dev_fatalxenbus_read_unsignedscnprintf__pfx_pcistub_put_pci_dev__pci_register_driver__stop_alloc_tagsxen_pcibk_permissivexen_acpi_get_gsi_infoxen_domain_typepci_disable_msi__pfx_xen_pcibk_read_config_dwordkfreepci_clear_mwi__pfx_xen_pcibk_config_readxenbus_printf__pfx_xen_pcibk_xenbus_registerprepare_to_wait_eventpci_set_power_statexenbus_switch_state__pfx_xen_pcibk_reset_device__wake_up_raw_spin_lock_irqsave__dynamic_dev_dbgpci_unregister_driver__fentry__xen_pcibk_aer_wait_queue__start_alloc_tagspci_read_config_dword__x86_indirect_thunk_raxxen_pcibk_quirks___ratelimitschedule_timeoutpci_intx__stack_chk_failrefcount_warn_saturatepci_enable_msix_rangedriver_create_filexen_unregister_device_domain_ownerbus_register_notifier_dev_infoxenbus_read_driver_statepci_set_mwi__pfx_pcistub_get_pci_dev_by_slot__pfx_xen_pcibk_xenbus_unregisterpci_find_capability__pfx_xen_pcibk_config_capability_initxen_pirq_from_irq__pfx_pcistub_get_pci_dev__pfx_xen_pcibk_config_reset_devpci_clear_master__pci_reset_function_lockedinit_wait_entrypci_enable_msidown_write__pfx_init_module_dev_errup_writepci_load_saved_staterequest_threaded_irq__pfx_xen_pcibk_config_field_free__pfx_xen_pcibk_config_quirks_initxen_start_flags__pfx_xen_pcibk_read_config_bytexenbus_transaction_endmutex_lockxen_find_device_domain_ownerpci_read_config_wordxen_pvh_setup_gsixen_register_device_domain_ownerxen_irq_lateeoixenbus_unregister_driver__pfx_xen_pcibk_config_quirks_add_field__list_del_entry_valid_or_report__pfx_xen_pcibk_get_interrupt_type__pfx_xen_pcibk_read_config_word__pfx_xen_pcibk_do_opsscanf__mutex_initbind_interdomain_evtchn_to_irqhandler_lateeoipci_store_saved_state__xenbus_register_backend_raw_spin_unlock_irqrestorepci_restore_state__pfx_cleanup_module_dev_warnxen_acpi_register_get_gsi_funcpci_set_masterparam_ops_charp__x86_return_thunk__init_waitqueue_headxenbus_watch_path__pfx_xen_pcibk_config_quirk_releasenotify_remote_via_irqstrcmp__pfx_xen_pcibk_field_is_dupsprintfxen_pcibk_backendxenbus_unmap_ring_vfreemutex_unlockxenbus_scanfxenbus_transaction_start__pfx_xen_pcibk_handle_eventparam_ops_boolpci_write_config_bytepci_dev_get__dynamic_pr_debug__kmalloc_cache_noprof__warn_printk__x86_indirect_thunk_r9__pfx_xen_pcibk_config_capability_add_fieldspci_load_and_free_saved_statexen_pcibk_passthrough_backendpci_disable_msixpci_disable_devicexenbus_dev_is_online__pfx_xen_pcibk_config_free_devxen_test_irq_shared__x86_indirect_thunk_r12pci_read_config_bytedevice_release_driver__pfx_xen_pcibk_config_header_add_fields__pfx_xen_pcibk_write_config_wordxen_pcibk_vpci_backendstrlen__pfx_xen_pcibk_config_init_dev_dev_printk__pfx_xen_pcibk_config_add_field_offset__pfx_xen_pcibk_config_free_dyn_fieldspci_write_config_wordxenbus_map_ring_vallocunregister_xenbus_watch__SCT__might_reschedpci_bus_typepci_write_config_dwordkmalloc_cacheshypercall_pagexen_pvhsystem_wqflush_work__pfx_xen_pcibk_config_init;L, PK P; $7L P  P6 $;~PY $^~g; $7L P  P    2 :_ $d~t; $7L P P $< $A~Qu;~ $7L P P $ $!~1U;^ $ t7{B B ! (&L $ Q~gq B; $ 7\ ` ` :. $ 3~Ca;j ( M  U.j:?Ia;t $ 7\ ` ` $ ~*d ` d `( $ 3~Q;$+ = D pI  ;  A \7 J    h 8 ^$ >) 1F >K  } G r r >  I ; $ 7I $N ~^ k Jz J ;   ; M ] '+ = E M    *     *  8I5;I Hy uy Xy  58J Zy{ gy yJI%;6 ;`n{3 c  8 cJE;X $]7hoLy P P $~ $7u $+~FT [ `8q z   8 $~JmRK; `P]ju c  08 ( 8FJe;x }`R4p c+M hT `8s z 8J; ` -{ c  P8  8 P  85JU;i y :y Se*tJI; H2yj uzy Xy' 7yL gdyv yI; HByy uy>Q Xayv y gy y J"IE;Y Hy u yq   X y  !y!! g9!yK! c!y!J!I!;! HU"y" u"y" $ "7"\# `,# `p#u#*# X#y# $y$ $ $~Q$a$ gy$y$ $y$ $ 8$$ $ $~%I%%;<% $ A%7H%\R% `% $ %~% %%=%f% `% $ %~& & &P&= &f.& 5& :&8D&PK& $ P&~`&Pg& l&t&P&$&&i&V&=&;& $&7 '7:'~]' $b'~t'|'~'J'J';' $'7'L' P ( P(70(~<( $A(~Q(a(~(J(J(;( $(7(L( P ) P) $#)~3) 8)`@)]F)'a)di)! q)y))) )M)7)~) )c)) )c *J* *c!* $&*~1*U*;y****9 *;{+ P*+e+Y ++ + +  , , ), ;, XC, @ M, Z,8k,|, , , , , , , ,  , , ,8- - *- U-;---(-.n#.-.IU.;./Ac/l//00_1n132K2Y+3*`33 3 383 "3 x384  4 48$4 >+4 @048R4 Y4 ^484r4Y44Y4(4Y5  5 5F(5 45*r5  y5 5F5z 5I%6;[6i666 >66666 V66r7;"7k27B7T7f77;77A7*778;r8 8 88 88 8.8 8 9.%909 79 P@98u9 99 99 9 98:I%:;6: q:: :.::I:;;&;?;  :J;AT; i;~;  ; 0 ;8; 8 ;;;<k,<R9<C<*d<q<R< +< 9< << G< 9<< M<  <=  = =8I=i= Op= y={=4= H =  =8= u= h =8= f> >8> [ >  %>85> H <>H>  O>_>  f>r> x y>>I>;?k)?RG? P? Y?? ?? ?? @@ '@.E@b@ 8j@A@4@  @@@@@  @@ A A A8,A  3A;AKA  UAeA 8 lA|A ` AAIA;!Bk.BR;BhBsB zB B8B B BB BBC $C4C SCCCACMCDA8D4KD `RDiD  qDD DD DE E 8%EAGE LE.bE 8 nEE E pE8E E E8E  E E8E F  F8,F 3F JF8[F  gFF  FF  FFIF;FRGEG;GG G 8G8G4H4 H!H,H 3H _  [_ $b_  p_=__ `_ `_ d_=__ _ _ `=` E`;L` Q`u`;|` ``;`n``Ia;%a$Tauaana9aIb;?bnfbbbIb;bbb;cn3c3[cpcc c c8cIc;cc cWc @d=Bd=Ud`d wdd xd d8d;dd d @ddd @d8d dDd @e e e `e#e'e `.eX2e 9ed@e `GeNe Ue  ]ehele  sewe ~e$e  ee e eee ee ee ee;;fBfef;f Pf Uf=ff f f 0f "f;f,gg BFgBQg\gBcg Btgg;g*g;gBg Bg (h. 0hu_h*ghqh Bwh h;hAh;hk;iIiui;ik jj5j;Sjkjuj*jjjkj kk5k;LkLRkhk $1ok 2wkzkk;luFlkNlVlal*l*ll;l$m-mkm m8 n nn$n*BJ2g n (s8{ b  8 |! @&b: xA F8N]T'_i{'h% bo  83*HI\g psb}u  bu  0QM  `  pb 0b\! &b.\3A pFbK` ho w~ p A pb pb 0b% *b2\B pGbR` pkbp~ 0b b\ pbt b\ pb $ 4=q K HPbfw  Q, $7$< @ $~9\H R W8d*l*q&{ $~ $7 $~*J  H8L P  / 04 Q9 q)K x P QY *p  u bz + h  5   * F3 m/  Q p T; m&  0 b8 MH pM T;h q z N 0   0  X 0  X   [  b v_" ) '. 8 ahM W Q   A x Q  % */ 4W \s;)'IhUf$$    ! y$$  y)$$9 Qyc$$z y$$ -y$$ ;y$$ D!L4$$M T YLj q vL  L ` L @ L   L  L   L. $G7Q<W @d<qu $~L @b* $7T PL  $$~+*3 : ?NF  K`Iu;!   SD q  } @(0<'D*p'*@p'* (p0<'D*Hx'* x2* (0<5D*`hp|5*p5*5*@pHP\'d*'*p'* (0<'D*`0hp|'*p'*'$*@0HP\'d*pp'*p'* P(0<'D*`hp|'*p'*'$*@0HP\'d*5*5$*`hHp02* `   5$ *` 0h 0 p | 2 *  `   `  h  p  | m p h   m p` x h 0 p  | x p    { p  P  }   P    S  `h0p|H 0(0H<D`0hPpH|0H (0H<DpP^xVYXWP^VYXWP^V Y0W8WP^VYXWP^VY X(WPP^XV`YpXxWP^VYXWP^VYXW@P^HVPY`XhWP^VYWWXV WZY[@ZHPWPUP8PYPp@`a0p`0a80`b b(0xPPpbx0x0'$*`xh@p|BE@BEM0kkpih0jlh b(r0r8n@oHPqP`pXn t(T08`@HPP`XP`h p x  4$DdTD!$%&'(T**T-T. $6(70788@$:H:P;X>`AhFpDGxH0JJJJJ$KTKtK4NQRS$TU$VVVV$W TW(W0W8X@YHYPDZXZ`[hT^p4_xD`t``abbbcdedffgghhti4j4kkl n(n0o8dp@TqHrPr" ) ; l a 4  $4(,0c48<| @DH'Ho(L)P/T/X/\/`66dO6h60  $((@08H!PX`p$sJhq   /7I; i@$C(D,$E0CI4O8P< S@SDTHzUL)pP fsP0f B$9(,* 0 4] 8 < @DEHL*PTRX\=` dP$hs'lP(p0*tx*x*|+j,-/6667$9:h;c<@gBG HrI^J6LN*RYSSTUUMVVW2WcWW!XYZqZ ZZI\^_ _$P`(`,`0ta4b8b<Zc@TdDvdHeL:fPAfTfXsg\fh`Hidjhklkplt;nxn|cop0q_rrsz[e t :O] 9$c(,04@8t<@D HTLsPT%XP\`dh2l`ptx |>`~P H \  6   ( J        " M j y      * < L      $ (,0448<6@D4HYLPTX\`$d:halptx|D\g*_C&3Ed|4_~L   $(",40T489<@DHZLdPsTX\1`ydhl6pctx|A` !D F   !8!b!!!!!T"""o###$$x$$$$% $%@%%%% &$9&(O&,k&0&4&8&< '@'D9'Ha'L{'P'T'X'\'`(d/(h@(l`(p(t(x(|(")7)?)`)p)x)))))))) *%*T***+Y,,)-T-{----.".,.T.b///00 11222*3 _3$3(3, 40/44]484<4@4D4H4L5P35T5X5\$6`h6d6h6l6p7t!7x17|A7S777788888?99999$:p::::;;;;<+<8<B<p<<<=H=x=== =>$>;>N> e>$x>(>,>0?4(?8X?<?@?D?H@L&@P@T@X@\@`@d@h@lAp2At:AxTA|kAAAA B-B:BBBBB#CRCC7DQDpDDDDKEmEEEE FIFfFFFFFFDGGG GH H;HH H$H(_I,I0I4I8I<I@JDJH0JLJPJTJXJ\$K`TKdtKhnLlLpiMtMxM|M N4NO.PlP+QqQQQQ?RnRRRSS;SsSSS$ToTTTU1UZUUUU$VBVgVqVV VV$WTWW W$9X(YX,`X0X4beb bbbc2c oc$c(c,c0c4d8Ad<d@dDdHeL\ePeTeXdf\f`fdfhPglgpgt/hx^h|hhh:itiij4jRjjjjjj4kQkvkklElMlUl`lll m,mnn#nPnmnn n o Qo o o o dp p p$ p( p, Tq0 yq4 q8 q< q@ .rD 6rH rL rP rT rX 0s\ bs` jsd rsh }sl sp t 4x ]|         ( P      ' A I r z       % E M ^ h       2 G r    $ (  , %0 -4 E8 g< v@ D H L P T )X 1\ F` jd h l p t x |   3 O ~      8 V c k          3 O t       / 7  G  p          - $ V (  ,  0  4  8 < )@ .D H TL P T X P\ ` d h l  p Xt ux |       F p         ) > J _  &'( P-pK0NQR S$ T(U, V0V40_8c<d@eD`fHfLgPPT4@  $e(f,k0p48<@DH&LDPlTmXo\q`sdxh|lptx|IJLNPUY`{)*,.059@[dfhlms\ ]^`bd f$k(,048<@D HL;P<T>X@\B`GdPhgltputyx5|679>CPginy|!%.027@WY[`dg  ! " $ $& (( ,* 0/ 4 8 < @ D H L P T X \ ` d h l p t x |        V W Y [ ] b              ;=?ABCT  $(,048*<.@DHL P TX!\0`KdLhPlptBxC|EJ  OPklp'(*/ > @$[(],_0a4b8c<t@DHLPT+X-\/`GdHhIlJpLtNxP|RW,7<G3457 9;=B& 0$K(M,O0Q4R8S<d@DH L P T X \ ` d h!l!p!t!x!|!!!!O"Z" # #F$G$H$J$L$N$P$U$%%+%-%/%0%1%&&&&&&&&j'k'm'o'q' s'x'''' '$'(','0'4(8I(<J(@L(DN(HP(LU(P(T(X(\(`(d(h)l)p)t)x)|)))*****-*.*0*5*@*Z*`*u*x*}***********++++++8,@, J,b,c,d,f, h,$j,(o,,,0,4,8,<,@:-D@-HZ-Le-P-T-X-\1.`@.d[.h].l_.pa.tb.xc.|g.////////224444444466*66666666777d7e7j7p7 77777 7$8(8,"80'84+88/8<38@9D9H9L 9P"9T$9X)9\:`:d+:h0:l<:pE:tF:xQ:|::::::::::::::::::;\;_;`;b;d;f;h;m;s;;;;;; ; ; ; ; _< `< a< c< h<$ <( <, <0 <4 <8 << <@ >D >H >L >P >T >X >\ >` >d ?h ?l ?p ?t @x @| @ @ @ @ @ @ A A A A A A A A A ]B ^B _B aB cB eB gB lB BC HC XC YC D D D D E E )F OF F F F G  G G G$ G( "G, 0G0 KG4 LG8 PG< VG@ GD GH GL GP GT GX G\ G` Gd Gh Gl Gp Gt Gx G| H H H  H %H HH IH MH OH TH XH aH bH dH iH mH qH rH tH yH H H H H oI pI rI wI J  J yJ J J J J J J J K K 1K @K$ ^K( `K, {K0 K4 K8 K< K@ KD KH )LL -LP .LT 0LX 2L\ 4L` 6Ld ;Lh Ll Lp Nt  Nx ;N| =N BN GN KN LN PN N N N N N N N N N N Q Q Q Q Q Q &R 'R (R *R /R R R R R R R R PS QS SS US WS YS ^S }S$ S( S, S0 S4 S8 S< S@ SD TH TL +TP -TT /TX 4T\ 5T` 6Td Th Tl Tp Tt Tx T| T T  U  U U U #U U U U U U U U U U U U U V V *V +V LV MV RV ~V V V V V V V V W W 7W @W hW pW W W$ W( W, W0 W4 W8 X< X@ XD XH !XL &XP eXT pXX X\ X` Xd Xh Xl Xp Yt Yx Y| Y  Y iY pY Y Y Y Y Y Y Z Z Z Z Z 0Z JZ NZ pZ qZ vZ Z Z Z Z Z Z Z Z Z Z [ [["['[ +[.[5[?\@\ A\$C\(E\,G\0I\4N\86^<@^@Z^Dj^H^L^P^T_X _\;_`F_dI_h}_l~_p_t_x_|___!`0`U``````````aaaa#apaqaratayaabbb$bbbbbbbb bbbTcUc Vc$Xc(Zc,_c0c4c8c<c@cDcHcLcPKdTLdXNd\Pd`RddTdhYdlkdpndtpdxrd|tdvd{ddddeee f fFfPfffffrgsgxggggggfhkhhhhhhhhi i CiDiFiHiMi Qi$`i({i,}i0i4i8i<i@iDiHjLjPjTjXj\j`jd jh;jl@jpAjtEjxdj|pjjjjjjkkkk kkkkkk k;kIkQkkkkkkkkkkkkkklll lllll l$l(l,l0l4l8l<l@MmD`mH1nL2nP3nT5nX7n\9n`;nd@nhtnlnpntnxn|nnnnno oZo[o]o_oaocoholopooooooooooppp pApPpkpmpoptpup ~ppqqq q$q(q,q0q4!q8'q<(q@*qD,qH.qL0qP5qT@qX[q\`q`bqddqheqlfqpjqtqxq|rrrrrrr$rBrCrDrFrHrJrLrQrUrVrWrYr[r]r_rdrirprrrrrrrrrr s  s s sss s$s(s,s0s4s8s<@>D@HRLVPZTwXx\z`dh9l@pWt[x]|deiPTUWY[`OA[_acej% = ] ~  Q ~     <         > $(8,@0`48<@D!H"L#P'TX\h`kdlhnlpprttxy|** 6   Y$]( R048 @,D0H PTX `d/ h p t x    [ *. PJ i  Z  "p; /i  z $( 048 B@#D$H bP4%T$&X :`dEh 2ptx rM+o, ++ P0H4 J14 jH13 23 33 f8)9 z89 B;m; Z z<$<(  07=4=8 r @=D>H : P=T=X `=d=h p6?tAx BlB  CwE CE " CE zDE F$F ]GG bG%H *HwI KJM j K$xM( 2 0pN4P8 @RD^SH PSTSX `=TdTh R pUtUx  5VRV [w] J W\]  |\H] \] \] ]^ *czc c{d *p `(@08P@PH@P X ` h p x0P@0!%&'(@**@-@.67p7 8(:0:8;@>HAPFX0G`Hh JpJxJJJK@K`K NQRSTTVVVVW@WpWWpX pY(Y00Z8Z@[H@^P _X0````h`paxbbbcdePffgghh`i j kklnnpoPp @q(pr0r8@@H@PX@`h 808@PPpX@`[pPxPb0t! ( 0 %8@p @@H@PPXP``h`OH @G(78`X@xBB&<`@ (08@@`H PX@`hpx` `   `  ` `     ( 0`8 @`H PX`hp`08@pHP pxPP P (0PX`hh(08@Hhppxx (HPhX`ppxp(0p8@`hppxp^P @~H@ P X>x~  "~  ~   ~( 0 8X~` h p@ ~   q qp 8q@p HPpqx q q q  (0PqX `hq0 q0 q 0    0 q8 P @ H  h qp P x  u q P  f q P   q 0 ( [H qP 0 X `  q   ,  `      ( 0 8 @ X` h p x        0  `    0@ H P X x   H    H x   H X ( 0 H8 X ` h Hp    H      xI P<& & 0@f &'p@*= &l 7 P &D J Q F &fPV`~  &C0` &e  &h< 6 & @nf &  &Ls  ' *- +' + - ' (. *">` *BSl *v *~s *7 *t *>2 *8 * *v *r *< *Mx * *޾ *z  * *& *H *o *[ * t * *tp *EN * *o *gO *D  * * # *ʲ6 *k= *<B *\N *Z *rf *Er *\B~ *z * *v *" * *N * ** *c *5 *( *2 *$ *:+ *7 *C *!O * [ *ag *s * *2 *C *2 * *< *ҁ * *1 * * *ҁ, *T *V a *ҁn *x * *^ *F *BB *E *) *BB *E' *65 *gC *wQ *W_ *?m *?{ *-J * *ҁ *½ * *ُ *ja *n@ * *C *s *r$ *D3 *[A *O *g] *k *Tyy * *# *b1 *~S *B *D" *Uk *Ѯ *~ * *o>% *+s4 *ĊC *wR * a *p *o *o6 *X *T *: * * * * * *, % * \4 *cC *R *d"a *p *7 * *w *}G *x *{ *Pj * * *$ * *$ *W3 *B * <Q *+` *}o *W~ *% *#3 *H *i *U * *L *D *o *&l *GW# *%2 *B *FUN * * * * *06 *Ѧ *W *< *i *v *P= *]\ *| *b *Y+ * X *X *06 *`+% *X4 *@ *L *EX *I"d *w *p *@ *& *& * *Ww *, *ܓ> *Q)K *e *r *} *06 * *ҁ *# *=F *ۈ * *L * *K{0 *oM *4sZ *Hg *t * *h *06 *, *f *N * *Y * *v * *$ *, *: *"H *ʪV *ǁd * r * *I *C *@ *) * * * * *Zy. *= *aPL *y[ *Pj *wz *L *E *kZ * *]w *% */C *m[ * *v *< *. *= *9L *[ *{j *2y * * *j *z1 * * *$^ *[x *V) *f * *U- *'< *,K *i *&x *h *? *7 * *}k *  *έ *Ѹ *1{ *  *! *'1 *~A *Q *2a *>q *R@ * *_ * *L? *] *}! *  * *7 *<- *< *K *VZ *[i *x *݅ *Sx * * *?I * * * *  *n *\ *!, *BF; *VAJ *zY *h *mgw *% *: *| * * *W  *kr *7 * q *# * *M, *; *dJ *Y *Qh *I * * * *, *, *}P * *l *  *3 *6* *"9 *H *<W *9f *4u *ݲ *4 * *h *P *U *D * *=C *(  *{ *w) *x:8 *&G *T>V *e * t ** *b *~| * *i *n *4 *l *j *^  *3 *T( *6+7 *F *AGU *d *_s *f *nn *y *n~ *'" *D *L * *] *k  * *u' *6 *ΖE *wT *#cc *Ór *P *9 * *OY * **_ *  ** *; *;+  *U *:' *6 *E *|T *8d **s *F *o *$w *3 *Y^ * *^ * *Z *  * *#'' *x6 *E *lBT *c *(Gr *$  *+ *_W *? *  *= *p *ő *c  *^ *' *]v6 *E *XT *uc *r *v *,) * *1E *Ә *: * *h *V *0  *o' *e* *D9 *AI **X *G&n *} * *w *  *#] * *Ώ *D *9" *0 *> *^RL *kZ *j *x *ˤ *G *w *sT *Q *G *_ ! *5! *4HC! *)W! *5e! *qks! *:@! *rZ! *! *! *i9! *9! *m! *NR! *! *e" *" *" *9" *)F" *]" *Fj" *" *]=" *" *" *A:" *# *# **(# *9# *zF# *]S# *Bg# *Fkp# *x# *D# *3[# *w# *# *t# *# *,W# *<)# *5# *# *y$ *'b$$ *x2$ *@$ *%N$ *01\$ *x$ *[$ *K$ *A4$ *N$ *$ *($ *Ŧ$ *H\$ *($ * % *% *E#% *t8)% *}/% *R6% *yC% *5]% *:j% *ˎw% **U% *)% *`% *n% *D%% *e% *R*% *I & *o& *>& *5Q& *_& *m& * {& *ׇ& *}& *& *?& *6& *p9& *,& *& *;& *' *N' *#' *{1' *?' *,M' *R[' *ti' *~Ow' *`' *' *' *f' *7P' *' *&' *tK' *'V' *ƻ( *( *B( *24( * A( *KN( * [( *%h( *v( *%( *x( *06( *M( *$( *( *ҁ( *$ ) *_) *x,) *%<) *B) *:H) *FN) *_T) *Z) *`) *f) *l) *r) *{x) */R~) *j) *) *) *s) *o) *j) *^]) *|) * ) *KP) *D* *N3 * *K* *8* *:* *ѷ"* *\(* *_.* *f4* *_3:* *g@* *o F* *L* *iR* *X* * ^* *$Zd* *mj* *~p* *%v* *|* *ŀ* *,* ** *B* ** *g* *,* ** *i* *Q]* *e* *+ *{$+ *1+ *+ *q+ *C, *5O, *l, *Ƽ, *4, *B^, *q, *, *E- *t]- *q- *̦- *- *Z- *EX- *p5- *I4- *B!. *?/. *y=. *@K. *^j. *y. *. *q. *. *. *. *~J. *. *pQ. *o/ *,/ *n:/ *mH/ *yV/ *6r/ *%/ *a/ *+/ *0/ *B/ *S/ *O/ */ * 0 *W0 *(0 *60 *#D0 *= *^X= *f= *(s= *sT= *%S= *Q)= *^= *n= *= *X= *(= *I= *= *Yp> *B> *؃> *,> *9> */SF> *PT> *~a> *f@n> *n|> *W > *3Y> *v> *ק> *kr> *w> *Qw> *m> **? *? *? *;+? *8? *E? *:o? *|? *'? *? *I? *? *>#? *? *? *|(? *? *t@ *ܞ+@ *߼N@ *Z@ *VAh@ *\v@ *!@ *t@ *"@ *!@ *L@ *@ *w@ *0@ *z@ *@ *[@ *[ A *\A *!%A *BF4A *UBA *NPA *8\^A * lA *k{A *ӼA *[{A *7A *qA *^-A *bA *pA *CA *8A *xqB *}B *BP$B *(`3B *OBB *KPB *l^B * wlB *7zB *B *zB *|B *@>B *|B *B *B *FB *cB *GC *0C *B"C *H0C *Ce>C *sLC *ZC *hC *vC *C *>;C *C *NoC *6C *C *C *>C *ysC *}BD *@|D *vh!D *\/D *G=D *IKD * YD **dgD *\uD *7D *TD *AD *DD *GD *3D *iD *D *VD *qE *E *12E *qH *cFH *UH *[yH *jH *(H *)H *RH *H *H *$H *,H *!H *I *pI *iI *+I * 9I *LGI *UI *cI *ɐI *-I *01I *tI *(I *'I *ĎI *ÏI *J *)J *Δ6J *IJ *#VJ *v}J *6J *J *J *ܱJ *uJ *%9J *2J *QJ *hJ *TJ *X K *kK *l &K *3K *J@K *\MK *ZK *gK *tK *K *1`K *K *vK *;K *K *L *L *IP *_IP * Q *QQ *t&Q *3Q *4@Q * MQ *`Q *oQ *\eyQ *-Q *=Q *Q *ѾQ *JQ *_pQ *}Q *LQ *R *2R *g2R *S-R *+R *R *fR *9R *7dR *aR *.R *R **R *4 S *?S *m#S *0S *T=S *JS *>KWS *iS *AdvS *;S *ŵS *;S *S *8S *S *S *S *S *Nm T *T *x&T *o3T *CAT *}NT *i[T *±hT *wT *DT *gT *_T *ET *T *iT *T *=U *F!U *.U *;U *\NU *ZU *D_U *nplU *lyU *U *kU *U *U *U *U *nV *!VV * 7"V */V *|tX *tX *bBY *R$&Y *u3Y *o@Y *ִMY *x[Y *nehY *wuY *RY *Y *Y *OY *B\Y *Y *gY *7Z *܆EZ *RZ *x _Z *)lZ *tzZ *BZ *|Z *#Z *HZ *!Z *wZ *7Z *Z *K"[ * /[ *t<[ *߷I[ *oV[ *#c[ *)p[ *7m}[ *i[ *[ *[ *-[ *oy[ *f[ *@[ *01[ *Q \ *%\ *t%\ *o2\ *!?\ *|L\ *#Y\ *f\ *FLs\ *|\ *8\ *\ *\ *c \ *\ *3\ *\ *{\ *\\ *w] *w/] * <] *[zk] *Yx] *] *ҁ] *9] *=] *] **] *v] *7] * ^ *v ^ *-^ *vD^ *P^ *У\^ *di^ *O^ *l^ *8^ * ^ *8U^ *k^ *R^ *w?^ * ^ *^ *<^ * _ *_ *ݍ_ *nx_ *&_ *3_ *[@_ *M_ *|C[_ *|Cn_ *D{_ *hI_ *$ _ *_ *_ *_ *x_ *_ *` *` *a ` *ҁ:` *88R` * _` *Ԉ` *],` *,` *,` * ` *t` *-` *` *Y` *Qa *Da *#,a *9a *tFa *i2Sa *`a * ma *za *a *a *a *oa *na *ioa *va * a *oa *b *b *9!b *?.b *N&;b *zvHb *Ub *bb *;tob *|b *b *j b *(b *cb *2b *@b *6I c *c *Y5c *#mHc *_c *mxc *Ec *c *Jc *]6c *Oc *Xc *c *Oc *=% d *Δd *06&d *3d *gMd *Zd *6d *V d *1Xd *`d *`d *cd *23e *@e *;Xe *le *#mze *e *`e *e *}e *Q)e *e *e * f *lf *Y'f *<5f *2Sf *xlf *zf *f *4f *f *f *YDf *:cf *u|f *t g *xg *=g *AOg *]g * kg *<yg *"g *ug *Z"g *!g *@g *!g *izg *gNg *zg *n h *~ h *R'h *5h *FCh *4 ^h *{h *^Uh *gh *g h *gh *;h *th *4h *h *zh *"i *9i *^,i *|:i *dXi * qi *~i *:i *si *i *+i *i *ii *I-i * j *j *|&j *$4j *RBj *w9Pj *R^j *( lj *qzj *gj *jj *aj *Pj *:j *Ūj *E! k *%k *3k *qAk *dk *rk *J>k *x2k *k *k *k *56k *k *Dk *qk *]w l *E l *&(l * 6l *Dl *hYRl *`l *%nl *|l *{el *"l * l *l *\|l *4l *\*l *1l *Wm *<m * m *\/m *T=>m *L Mm *\m *zm *m *-m *,m *m *m *:m * lm *m *n *n *n *.n *=n *Ln *I[n *Cjn *yn *n *n *~n *\n *],n *on *On *n *ӛo *pDo *0o *=So *[Y]o *vmlo **vo *a'o *&o *"7o *o *>o *Q)p *@q,p *=p *Cp *Ip *~Op *Up *[p *map *ggp *k,mp *qtp *{p *p *Dp *p *3p *p *^p *ebp * p *b\p *,Hp *bp *5q *{jq *Mq *?*q *,7q *5Dq *g^q *Nkq *xq *(q *Qwq *Xvq *^$q *gq *^q *Vq *q *or *Nr *0 r *s-r *Yr *Lfr *ssr * r *r *sr * r *mTr *r *r *cr *Tr *kDs *Ss *-s *T;s *Is *iWs *zs *-s *-s */es *t7s *s *fs *vs *s *Xt *t *u-t *c;t *It *"Wt *et *ȷst *t *Rt *t *t *ҁt *t *tt *- u *b:u *iG;u *Kdu *Xqu *Ynu *gu *"u *tu *eTu *u *@ku *cu *v *v *+"v *(M/v *H{ *uL{ *<Z{ *(h{ *|v{ *{ *M{ *U{ *{ *{ *{ *6{ *V{ *={ *A| *d | * s| *1,| *T:| *VH| *FxV| *CYd| *~s| *׎| *| *| *[| *+| *gl| *}| *}&| * | *͍ } *WL} *(} *7} *͌F} *RIU} *ުd} *as} *g} *a} *^?} *} *C} *)} *6} *} *X1} * ~ *+(~ *<7~ *F~ *&U~ *߄e~ *t~ *@=~ *~ *Z~ *P~ *2l *m * *:4 *{ * k *7 *cH *3^U *o *b| *+I * *@ * * *Xˀ *X؀ * *_I *Δ *! *2 *H? *gL *+5Y *G * *@ * *LvÁ *;݁ * u * * *t *#, *? *7 *~ * *tƂ *-ӂ *.~ *+ *MJ * * * * *=( *K5 *oC *O *j\ *Xvi *w *2n * *> *w *v *'׃ * * * *K+ *068 *`E *S *aVg *t *;X *o *ۄ *& *9 *w *f$ *W: *9F *E\ *Ki *cv *06 *` * *Å *Yх *>s *aM *% * *0# *|@0 *2q= *NSJ *PW *ݰq *~ * * * *v *D *&~ * *t2 *c? *V8L *oZ *Ah *av *$ * *۹ *F5 *׻ *N[Ƈ * Ӈ *m *0< *x` *: *-G *'T *:ya *7n *2'{ *԰ *iM *Gr *c *% *1ˈ *7V؈ *\ *! *T *{ *  *( *5 *ҁH *!pU *db *{To *:( *1 *udƉ *LЉ *{ډ *o * *D9 *hq * *Q) *׉8 *V#R *_ *l *4y *> *$ ӊ *<ߊ * *r *n *،! *&E. *` *n *E} * k *D *b͋ *U *k *Ӣ *o *, *-+ *8 *E *S *2 *!} *>w *sg *5Č *:ʌ *+Ќ *c֌ *܌ * * *I * * # *E) */ *U5 * E *&lS *%6_ **l *#y *{ *< *j *ˍ *3׍ *] *o *  * *Ο *09 *AF *!T *^b *Fp * *T * *EE * *ʎ *؎ *t * *g *>  * c *C}, *k; *^ *-j *hz *L * *y *s *Ǐ *yڏ *06 *] * * *Tq *) *x6 *]C *VsP *O] *k *Hx *@ *1 *E *NE * *KƐ *ڨӐ *g+ *l *2 *Pa *: *+w& *: *[H *߉V *Vbd *r *D *+} *# * *& *m *% *#-3 *A *O *r] *_k *yy *b *Ƹ *q) *&0 *I> *`L *>Z *m!h *v * *f *K * *Dj *ʓ *7eؓ *X * *g *T *8Q *- *; *I *W *e *ss *R *' *X * *V`Ȕ *l֔ *m * * *, *>- *K; *I *0W *:e *Rt * *" *;E *d *$ *ȕ *s֕ *D[ *Yl *Bn *ڭ *ԕ *b * *8 * *I4u * *"e * × *#ї *Fߗ *й *O * *4w *% * 3 *A * O *)] *k *y *\ *V *o *p$ * *Fy͘ *ۘ *+9 * Pr *'N *y'G *T *dl *$%y * *8 *̛ *)ٛ * * *y * *K *$ *Q2 * @ *N *x\\ *<j *x *5 *8 * * * *O̜ *ڜ *R" *M * *n4 *9 *M. *< *J *"X *Sf *|t *s * *d *J% *l* * * G͝ *۝ *t *  *! *?0 *"> *L *nZ *^h *Uv *[ * *ʿ *ž *О *ǂݞ * *4K *} *ɬ *, *D$: *H *1o *&P} ** *) * *7 *Xß *џ * Uߟ * *ɮ *Ȅ *TU *!% *}3 *A *O *L2] *9k *+\y * ' * } *5 * *` * ^͠ *ܴ۠ * * *& *5 *F? *S * z] * g *,q *GO *=ڡ *= *vC * *Т * *iQ * *{ *o^ * 5+ *uN *=i * * * *x *a *$8 *hB *b *_ *g *ִ *V *CŪ *cGު *g *2 * * *uA' *՚A *YM *2Y *AGg *ҁv *f * * *%k * ** *ͫ *Cګ *5 *x *7 *U * *[( *[5 *XvP *M^Z *B8g *ڊu *E *- *o *V *gά *K۬ * * *H *4 *"YN *[ *nh *|v *i * * *x> *[ *ʭ *Guح *} *& *  * * *N, *ׇE *^d *p *} *Zf *VN * *{ *HȮ *Qw֮ *s *{a * *s *& *I, *-< *i9L *z\ *(yb * Qh *o *&#| *06 * *-% * * * *3 * *g *3 *"? *@L * Z *h *nv * *Z" *} *N * *_ʱ *ׇر *N *W& *24 *L *C * *_ * , *2г *Rݳ * *W * *#a *0 *I *d7 *Ѵ *ɒȴ *h *1U% *2 *? *gL *[:ҵ *P!ߵ *g * *^D *͆K *Y *tg *_Iu *> * *F] * * *R *X *! *]j *qG *l *V *{/ *J> *M *\ *k * 4y *t *ִ * *3 *bt * * * *: *@ * *3. *w< *kJ *TX *1f *}:t * D *y *8~ *]! *Jh * * *v *< * * E$ *4 *} B *nIP *^ *4=l *z * *) *x *` *"x *.B * *n *g *ִ% *t2 *T? *RL *3Y *f *Es *M *N * * *} * * * *o * *x0 *A: *K+V *d *wOr * * *Z *a *8Z *g * *, *  *' *4 *[:A *uN *ޯ[ *Lh *u * *M *g6 *1 * *w *c *39 *p *g/ *< *:I *aV *^c *Ģp *x} *u *ޯ *L * *g6 *1 * * *'U *2f *l *r *Åx *%,~ *& * * *K * *g *` * *+ */ *B * *mv *r *0& *I * *g * *[: */ * *^ *! *6' *_8 *їB *0bO *\ *2i *L *' * * *2 *L` *[Jn *| * *L * * * * *& *  *7A *ʥ *p *] * *^ *88 *y% *4 *B *GSP *o_ *kji *z *. *< *cd * *t * *ƺ * *$ * *J *u *Ҡ * *I *j *( *ן *k% *B *xV *W` *t *o *ׁ *) *g *؂ *? *^$ *- *~ *V *Q * *_, *o? *UL *Ls *^ *88 * * *tF *0v *y *ς *F6 * *ɋ *7 *, *`9 *puF *yZS *ҁ` *-m *G&z *L * *j *Ԭ *g *M9 *n *_ *g  *w) *7 *u *2j * $ *\ * *Q5 *OX *a *  *i *p< *l *d *\ *@# *0 *= *OJ *W *Cd *:q *q~ * * * *V * * *8* *S *1 * *K *L% *q2 * K *u^ *k *^$x * * \L *1 Y *{r *N * * W *V * , *l; *@ *V *[ * *P *R$ *2 *͉@ *&\ *wj *ox *V *< *Dc *! *g * *r *J *R *A *S) *ˇD *7N *;Z * r *?x *f~ *?z *`u *h *Q * *s *& *j# * *` *O *8 *B( * *W * *x *t> *AZK *ɣY *2c *}r *;' *9N *w *, *\C *< *dX *W? *x *5] * *f>( * 6 *\D *uR *` *[n *Z| *q * * *9Y *a *7 *O *" *s * *-& *4 *CD *AbT *H~d *et *` *D *X *9 * Z *U *` * *+ *# *#2$ *4 4 *:JD *22R *]c` *qEn *̧| *= *k *N *& *a * * *, *UM$ *4 *2D *q_T *سd *t *gn *P * *R *h *D *#r *S * *Qr *8"$ *:4 *\D *TGT *d *ht *!h *k *4 *n *P * * * J * ** *<$ *(4 *@D *T *Cd *a_t *" *DR * *" *3 * * * *J: ** * *F, *N; *J *t h *ow * */z *3 * R * * *O *` *Ls *C *& *S5 *95D *b *$q *! *] *Z *u * *Rc *g *^ *u *L *g6 *1$ *2 *m&@ *vEN *d\ *j * x * *" *W] * *# *^ *y *# *l1 *? *iM *}[ * *$ *t2 *A *[N *&_ *ee *jk *fq *Vw *hf} *$ *k *a *J * *F * *1 * *6} * * *W~ * *N * * *U * * *N * *e * * *| *ǰ* *Cs7 *zn| * *M *GS *@ *L * *^$ *AM *IM *:B * *D+ *^$, *6: *H *V *r * *3 * *o *` *( * *) **D% *4 *lC *PR *Lg * *E *0 *5 *X *% *s * *q * *b *! *% *2 *? *̱L *_Y *tf *` s *i * *Y2 * * * *\g *[ *r *( *r) * ,7 *.E *%S *a *go *!~ *0 *; *@ *4 *` *ī *X *` *h *ī( *S5 *>B *'O *\ *qu *5 * $ *w *m *Y *GS *G *u} *7 *g *! * ( *6 *8D *R *a` *|n *| *g *V *bQ *? *= * *& *- *$z *J *@ *n$ *>2 *@ *=N *\ *`j *x *A *h *~ * *\[ *q *C *X: *SJ *eP *BV *#\ *ib *m h *?n *+u * *@ *M *) *s *| *+ *R *^ *g ** *O7 *06D *Q *1^ *wk * $x * *o *S_ *P *$ * $ *06 *V *Y *B' *`6 *06E *٦T *5d *Tr *t *N *ޒ *cA *g6 *1 *j *@ *5 *_ *hF *w *( *Մ6 **D *GSR *` * *:O *v *I *G *f *| *lH * *)[ *v$ *l2 *@ *ok *{ *w[ *` *L *E * * *g *s *+L * *" * *gL * * *6 *h * *T *? *OB * *f *: *|% *@3 *A * \P *}^ *gl *Vz *- *lK * t *qo *j + *P8 *{F *BT *gb **Up *~ *06 *؂ *B *g **U *{ *ҁ * *^$ * * ;% *I2 *? *NY *?f *vs *M *5 * *R *  * *ޘ *1|' *5 *-&C *tQ * *P' * *5 *] *^ *) *M * *W7" *v7 *CE *]S *a * Io *_`} *! * *x * * *A * * *o *!Q, *9 *^G *V *Ak *ICw *Ϟ * *ƛ *o * *m *" *" *C *=& *W + *IB9 *q(G *^ *wUj *w *< * *{ *{ *;S *{ *g * *o4 *B *"P *^ *l *+z *U *! *wu *N *# *e *| * *g *. *Y< *u}J *`X *4f *t *o *j * *ܤ *< *1 *  *q * *1$ *^0 *+< *\ *o-h *4>u *> *06 *{ *06 **U *P *06 **U *P *06+ *-9 *4I *nV *06c *4p *} * *- * * *a *06 * *D+ *06 *zx$ *n2 *NK *06Y *-g *{ *  * , *.F *> * *F * *g) *& *P3 *wO@ *R,M *Z *ރg * W *^& *f| *M *W  *P *% *[:2 *K@ *տM *TC[ *i *Pw * * *^ * *ɳ * *z *l *, *[ *H *~ * - *t; *FI * W *e *cs *^ **O *ִ * *)@ *5 *  *r *h8 *' * *K *^! *. *Mq; *H *06U *'b *~ *@ *\9 *p * *Pu *z * * *i *^ *s, *L; *^K *4Y *͉g *u * *S *Ӕ *[ * *٣ *} *Cf *^  *s  *^0  *NT>  *L  *Z  *h  *Sw  *4  *[  *  *{  *٣  *,!  *s  *G1  *A  *x0  *D>  *R6L  *e$Z  *Fh  *͉v  *  *  *"  *  *x  *P  *-  *;  *8:  *  *$  *2  *p@  *=N  *\\  *#j  *xMx  *g=  *:  *^  *   *  *XV  *`,  *)i  *Jx  *k\  *D  *c  *$*  *Ӝ  *S  *  *J  *ͫ  *C  *m  *nA  *"  *m  *qS  *  *@*  *7  *;rD  *ב  *,  *~~  *  *  *b  *  *[  * *w *7# *!1 *M? *M *d[ *Ao * *5 * *ִ *0r *GS *< *^  *n *{& *I43 *UQQ *Lx *GS *< *b * *z * * *II *)  *  *## *؀0 *= *J *i *-v *T *B@ *1  *ql * *j% *- *f *p` *I  *B@ *," *|. *g *  *F *g *o6 *5 * * * *F * *Z- *9 *=h *1M *[ *Ip *x$ *B\ *i *} * *} * *} *' *^ *n * $ *o6( *#@5 *B *Z * * * *R *h] *o *J *y+ *1 *6 *p$(">+ *q7U *wa0 k *x  *  R *[ *q *GS *< **` *&$  *8& *g 3 *ʜ@ *tZ *6u *aC$ *P * $ *@ *   *%  *ds   *5-6 *CL *'Yb *!ox *  *H` *i@ *GZ  *t *L} * ' *3o5 +S *a  *  *P *? * * *>  *+ *m* *F *<f *< *HF *I *v *+7 *M  *( *_r? *(CZ *dp *1a * ** * *v *R * *w$ *j? *u4e *H * * *: *O\ *Ջ *61  *- *p=I *d *hRv * *.T * *>D *<, *X *B+ *ŶG *T *83` *s *G *E *5 * * *@ *P; *a- *WC *"U *tg *Bly *? *Q  *1 * * *z $ .9 C 3Q 8_  *Sj   ,  , c c  ,]  ,Q  ,  ,!!+! 8!B!W!z!$!!U!!!"/"-K"`";v" ""%"]"""z"""##&#;#H#`R#g#t#@~### ######$$+$+;$ ,?$ ,~H$ ,L$ ,U$ ,Y$ ,b$+l$+$ ,$ ,$p$ -$ ,$ ,$p$ -$ ,$ ,$p$ -$ ,%$ ,#% - % ,6% ,2%u0%:%R% ,MV% ,K_% ,\c% ,Zl%%N%N% ,k% ,i%N% -% ,% ,%% -& ,& ,& ,& ,&*&$?&I&f& ,j& ,t&~& -& ,& ,& ,& ,&&P&& -&& ,& ,& ,0& ,,& '$'K1'$;'S'h'@r'''$'Y'#'.'C''O( (d( *ؐ$(E( ,HI( ,DN( *sY( ,d]( ,`b( *om( ,q( ,|( ,( ,( *6( ,( ,( -( *(( ,( ,( -/( *u( ,#( ,(( -@( ,@( ,<( -@) ,_ ) ,U) ,) ,) ,#) ,,)6)S) ,W) ,a)z) ,~) ,)) ,) ,)!)!) , ) ,)3) -Q) ,** ,& * ,T* ,P*?)*$3*bD*$O*`*$l*T* ** *6* *u* ** *އ* *}* *V* *(* *( + *5+ *GSO+ *\C\+ *xi+ *1w+ *8+ *ޙ+H+ *aq+`+ **++ *;+,,%,/,D,Q,[,p,},,,,`,,,@,,- - ---7--L-Y-d-9u- - *B-- ,l- ,h- ,- ,- *u- ,- ,- *5- ,- ,- *-- ,. ,. *. ,. ,. *},. *V:.O. *(Z. ,;^. ,7d.%y. *(. ,U. ,Q... ,k. ,i... ,. ,.// ,"/ ,-/7/T/ ,X/ ,a/k// ,/ ,/// ,/ ,/6/6/ ,/ ,/ ,/ ,0E0$#080$B0 e0$u0 *v00 ,0 ,0 ,*0 ,0 *-0 ,0 ,|0 *GS0 *\C1 *x1 ,"1 ,'1 *u21 ,61 ,;1 *5F1 ,!J1 ,U1 _1 *f1s12}1 -f 1 ,;1 ,71 ,X1 ,R1 ,z1 ,t1 ,1 ,1 ,1 ,1 -f 1F1H212uT2eo2X2222g2323<3Y3 ,]3 ,f3p33 , 3 , 33 - 3 ,; 3 ,5 33 - 3 ,\ 3 ,X 3 , 3 , 33 - 4 , 4 , 4 4 - -4 , 14 , :4 , >4 , G4Q4 - ^4 , b4 , k4 ,? o4 ,9 x4 ,e |4 ,_ 4 - 4 , 4 , 444 , 4 , 4 , 4 , 444 , 4 , 5 , 5 , 5585 , <5 , E5 , I5 , R5g5 , k5 , t5555&5 */5p5 ,& 5 ," 5 ,F 5 ,> 5 *u 6 ,r 6 ,l 6 *56 , "6 , '6 *-26 , 66 , ;6 *F6 , J6 , T6 *}a6 *Vo66 *(6 , 6 , 66 *(6 , 6 , 6y6y6 ,% 6 ,# 67#7 ,= '7 ,; 07:7S7 ,L W7 ,J b7l77 ,^ 7 ,\ 777 ,m 7 ,k 777 , 7 ,} 78 8 , $8 , -8 , 18 , 68%G8$X8m8$w88$8 * |8 - 8 , 8 , 8 , 8 , 8 *-8 ,h 8 ,^ 8 *GS9 *\C'9 *xB9 , F9 , K9 *uV9 , Z9 , _9 *5j9 ,.n9 ,&y9 9 *9w 9 *ޙ9 *aq99 **99 *aq99 **9:: - : ,[": ,W+: ,x/: ,r8: ,<: ,E: ,I: ,R: ,V: ,[: - i::H: :u: ;X";!=;Y;=!t;g;g!;;T ;T ; ,; ,;T <T < ,-< ,+)<w 3< - C< ,FG< ,@P<w Z< - f< ,gj< ,cs< ,w< ,<w < -) < ,< ,<w < -) < ,< ,< ,< ,<w < -) < ,$< ,< ,J= ,D = ,p = ,j= -) = ,= ,(=w 2=w O= ,S= ,\= ,`= ,i=w s=w = ,= ,= ,= ,=w =w = ,= ,= ,= ,=w = ,= ,>!>!+>K 8>!E>Z>d>8u>> *Z>P> ,1> ,-> ,Q> ,I> *-> ,}> ,w> *> ,? ,? *y3? ,? ,? *5&? ,*? ,/? *R:? ,>? ,C? *qN? ,R? , ]?Ek? *}x? *V? -q? *(? ,+? ,)?? *(? ,:? ,8? -? *(? ,I? ,G?k@ *( @ ,X@ ,V@Y$@YA@ ,gE@ ,eO@Y@ -i@ ,m@ ,}v@@ -@ ,@ ,@E@E@ ,@ ,@ ,@ ,@U@$ @xA$ ANAXA*A(A *սAPA ,A ,A ,A ,A *-A ,$A , A *GSB *\C*B *xJB *nZB * $uB ,EyB ,;B&BB -B ,wB ,uB ,B ,B ,B ,B ,B ,B ,B ,B ,,B ,(B ,HB ,DC ,d C ,`C -C8C]C>tCC^C -C ,~C ,|C ,C ,C ,C ,C ,C ,C ,C ,C ,C ,D , D ,D -D ,/D ,%D ,})D ,s2D ,6D ,?D ,CD ,LDYD -fD ,jD ,sD ,!wD ,DD -D ,ED ,CD ,WD ,UD ,hD ,fDD -D ,zD ,xD ,D ,D -D ,D ,EE-E ,1E ,:E ,>E ,DEgEqE - E ,E ,EE - E ,E ,E ,AE ,;EE -) E ,`E ,ZEE -) E ,F ,y F , F ,F F -) -F ,1F ,:F ,>F ,GF ,KF ,PF -) YF ,#]F ,fFpFF ,>F ,<F ,NF ,LFFF ,]F ,[F ,mF ,kFFG ,| G ,zG ,G ,!G6G ,:G ,CGx`G_vGG GiGG *G0G ,G ,H , H ,H *-H ,kH ,c#H *u.H ,2H ,7H *5BH ,FH ,KH *GSkH *\C{H *xH ,&H ,HH *ޙH -H *ZH H[H *RiH -H * I ,iI ,gI[!I -.I ,{2I ,w;I ,?I ,DI -MIYI9jI wIII -I ,I ,I ,I ,I ,DI ,8I ,I ,uI ,I ,I -I JH/JJJumJJXJ^JJJgK/KKKKUKKrK ,vK ,KKKKK ,*K ,(KK -K ,@K ,:KK -1K ,cK ,]K ,K ,LL -H"L ,&L ,/L9L -HFL ,JL ,SL , WL ,`LjL -HwL ,0{L ,*L ,VL ,PL ,|L ,vL -HL ,L ,LLL ,L ,L ,L ,LLM ,M ,!M ,%M ,.M8MQM ,UM ,^M , bM , kMM ,M ,MMM;MM *MN ,=!N ,91N ,]5N ,U:N *uEN ,IN ,NN *5YN ,]N ,bN *-mN ,qN ,vN *N ,N ,N *}N *VNN *(N , N , NDN *(N ,'N ,#O O)O ,?-O ,=7OAO^O ,WbO ,UkOuOO ,fO ,dOO -aO ,xO ,vOO -aO ,O ,OO P ,P ,PY%PYBP ,FP ,OP ,SP ,XPhiP$zPP$P>PP *5PP ,P , Q , Q ,Q *Q , !Q , &Q *-1Q ,- 5Q ,) :Q *EQ ,G IQ ,C SQ *}`Q *VnQ -wQ *(Q ,] Q ,[ Q -Q *(Q ,n Q ,j QQQ , Q , Q(Q( R , R , R , R , R71R$ BRWR$ aRR:R *kR!R , R , R , R , R *-R ,E!R ,A!R *GSS *\C"S *x=S ,h!AS ,\!LS$YSE"cS -@ sS ,!wS ,!S ,!S ,!S ,!S ,!S ,&"S ,"S ,W"S ,I"S -@ SY"SHS"Tu:T#UTXwT$TT}$TgT$TU""U -c 2U ,"6U ,"?U ,"CU ,"LU ,"PU ,"YU , #]U ,#bU -c kU ,2#oU ,(#xU ,d#|U ,Z#U ,#U ,#U ,#U ,#U"U"U ,#U ,#U - U ,#U ,#U"V ,$ V , $V #/V ,($3V ,$$=Vo#GV - WV ,@$[V ,>$dVo#nVo#V ,O$V ,M$Vo#Vo#V ,^$V ,\$V ,o$V ,k$Vt#V#V# W ,$W ,$W ,$W ,$$W#\ *\CK\ *xX\ *}\ *\ *ޙ\p\ *}\ *V\ *(\ *(\ *Z\ 8] *9i] * ] *(D] *+O]Pf] *GSq] ,&u] ,&] ,2'] ,'] *\C] ,'] ,'] *x] ,'] ,'] *] ,V(] ,J(] ,(] ,(] *<] ,(] ,(] *ޙ]^ *^ ,)^ ,)#^ *.^ ,!*2^ ,*;^E^^^ ,O*b^ ,M*k^ ,`*o^ ,^*x^^ ,v*^ ,p*^^^ ,*^ ,*^ ,*^ ,*^^ -^ *Y _ p_+_ *]h5_ ->_ *I_ ,*M_ ,*V_`_ -m_ ,*q_ ,*z_ ,*~_ ,*_ -_/ _M _ p__` -`a T` *s` *GS` *\C` *x` *n` * $` *1` *` *GSa *\C"a *x/a *1>a *8Da -_Za ,$+^a ,+ca *una ,|+ra ,n+wa *ޙa -ua *Ya a)a *1ha -a *a ,+a ,+a)a -a ,+b ,+ b ,+b ,+b -b)b:b Nb^b *aqkbtb **b(b *aqbb **b b *aqb@b **bbCb - c ,,c ,,cC$cCe ,-GeQeje , .ne , .we ,.{e ,.eee ,+.e ,).e ,<.e ,:.ee ,M.e ,I.eff?+f5ffBfif~fffffpf f0f g*'g1g2IgJagpg *s{g -g ,t.g ,h.g *g ,.g ,.g *ug ,P/g ,D/g *g ,/g ,/g *ޙg -h *Yh Ph,h *vI6h -?h *Jh ,/Nh ,/Whah -nh ,0rh ,0{h ,50h ,10h -hhh Phh *aqh@h **h8i *aq ii **#i0-i -6i *YDi Mibi *hli -ui *i ,R0i ,P0ii -i ,d0i ,`0i ,0i ,0i -iii ii -j *uj j4j *V>j -Gj *Rj ,0Vj ,0_jij -vj ,0zj ,0j ,0j ,0j -jjj jPjj -j ,1j , 1jkk ,1"k ,1-k17k1Tk ,,1Xk ,*1ak ,<1ek ,:1nk1xk1k ,K1k ,I1k ,[1k ,Y1k1k1k ,j1k ,h1k ,z1k ,x1k^k -+l ,1l ,1l^l -G&l ,1*l ,13l ,17l ,1@l^Jl -cZl ,1^l ,1gl^ql -c~l ,2l , 2l ,32l ,-2l^l -cl ,Y2l ,S2l ,2l ,y2l ,2l ,2l -cl ,2l ,2l^l^m ,2m ,2m ,2 m ,2)m^3m^Lm ,3Pm ,3Ym ,3]m ,3fm^pm^m ,%3m ,#3m ,63m ,43m^m ,G3m ,C3m9m'm nn $nQLnanknnnnnpnnno/op:o *_Eo -[o ,p3_o ,b3do *uoo ,3so ,3xo *o , 4o ,3o *ޙo -(o *Xo oio *"go -=o *o ,]4o ,[4oip -=p ,o4p ,k4 p ,4$p ,4)p -=2p;>pdOp cphsp *aqpp **pPp *aqp p **pHp *aqp`p **p@q - q *Yq $q/9q *;gCq -Lq *Wq ,4[q ,4dq/nq -{q ,4q ,4q ,4q ,4q -qiqq qqq -Rq ,5q ,5r r#r ,(5'r ,&52r6s ,86ss -s ,d6s ,^6s ,6s ,6s ,6s ,6s -s ,6s ,6sst ,6t ,6!t ,7%t ,7.t8tQt ,7Ut ,7^t ,!7bt ,7ktutt ,07t ,.7t ,A7t ,?7tt ,R7t ,N7tttuu)uPu#euou9uuKupuoupuv0v-v7vLv * Wv -Imv ,{7qv ,m7vv *uv ,7v ,7v *v ,8v ,8v *ޙv -_v *tv 0v v *fv -tv *w ,h8w ,f8w w -t%w ,z8)w ,v82w ,86w ,8;w -tDwPwaw 0uww *aqww **whw *aqww **w`w *aqw@w ** xXx -x *X-x 6xKx *SHUx -^x *ix ,8mx ,8vxx -x ,8x ,8x ,9x ,9x -x x#x x(x%x -y ,$9 y ,"9y%y%5y ,399y ,19DynNynky ,B9oy ,@9xy ,R9|y ,P9ynyny ,a9y ,_9y ,q9y ,o9ynyny ,9y ,~9y ,9y ,9z z -z ,9z ,9'z1z -=z ,9Az ,9Jz ,9Nz ,9Wzaz -qz ,:uz ,9~zz -z ,&:z , :z ,I:z ,C:zz -z ,o:z ,i:z ,:z ,:z ,:z ,:z -z ,:z ,:z {&{ ,:*{ ,:3{ , ;7{ , ;@{J{c{ ,;g{ ,;p{ ,,;t{ ,*;}{{{ ,;;{ ,9;{ ,L;{ ,J;{{ ,];{ ,Y;{J{8|!$|.|H;|b|w|||+||p||p|}0#}.?}I}6^} *i} -6t} *u} ,;} ,x;} *[} ,;} ,;} *\} ,;} ,;} *} ,f<} ,\<} ,<} ,<} *z} ,<} ,<} *6} ,=} , =~ * ~ ,;=~ ,5=~ ,f=#~ ,^=(~ *ޙ6~ *aqC~L~ **Y~xc~ -\l~ *tz~ h~ ~ *:H~ -n~ *~ ,=~ ,=~ ~ -n~ ,=~ ,=~ ,=~ ,=~ -n~   h#4 -= *9H ,=L ,=QN f *_>q ,4>u ,0>~N N  ,V> ,T> ,f> ,d>N N  ,u> ,s> ,> ,>N N  ,> ,>& ,>* ,>3 -= *D M *S] *9h ,>l ,>q -z *,q-  *_> ,> ,>- - ׀ ,>ۀ ,> ,? ,?- -  ,? ,?  ,$?$ ,"?-- 7- O ,3?S ,1?\ ,C?` ,A?i- ~>  ŁO ځ> >I I /N C *aqPY **fpt ~ -L ,R? ,P? ,a? ,_? ,t? ,n? ,? ,?‚ ,?Ƃ ,?̂ " "  ,? ,?$ ,?( ,?1" ;" S ,@W ,?` ,@d ,@o) y)  ,#@ ,!@ ,3@ ,1@) ) ҃ ,B@փ ,@@߃ ,R@ ,P@;  - ,c@  ,_@ ,@ ,{@"; ,; H ,@L ,@U ,@Y ,@b; l;  ,@ ,@ ,@ ,@;  ń  ,@ ,@ Z  - ,@# ,@, ,A0 ,A9Z C -O ,AAS ,;A\ ,gA` ,aAiZ s - ,A ,A ,A ,Al l Å ,ADž ,AЅ ,Aԅ ,A݅l l  ,B ,B  ,B ,Ba % -5 ,'B9 ,#BB ,ABF ,=BOa Ya u ,WBy ,UB ,gB ,eBa a  ,yB ,wB ,B† ,Bˆa    ,B ,B 2s <s Y ,B] ,Bf ,Bj ,Bss }s  ,B ,B ,B ,Bs s ч ,BՇ ,Bއ ,B ,B ,C ,C" ,C& ,C/9Q ,'CU ,%C^ ,7Cb ,5Ci; v wpو *I߈ - *u ,NC ,DC ,C ,C" *3 * m:C *ޙQ *aq^ g **t *aq` **щ(ۉUM%<CI^h9yP *F - ,C ,C *u ,HD ,8D *sɊ ,D͊ ,DҊ *݊ , E ,D *ޙ - *W I$ *f. -17 *B ,hEF ,fEOIY -1f ,zEj ,vEs ,Ew ,E| -1Jd Ƌ *}Ӌ *Vl *( ,E ,E   *(+ ,E/ ,E5 -g> *WL Uj **ft -y} * ,E ,E -y ,F ,E ,0F ,,FŒ -yˌi׌  - *Q ,QF ,KF) *aq6 ? **L[ *aqh`q **~ *aq ** *aq̍Ս ** -$  ,uF ,qF! -$. ,F2 ,F;OEO^ ,Fb ,Fnx -9 ,F ,F ,F ,FΎl{3p=Td *}q *VUU ,F ,F -Fҏ ,F֏ ,Fߏ ,+G ,%G$$.8U ,JGY ,HGcm -} ,dG ,`G ,~G ,zGÐߐ ,G ,G ,G ,G0 ,G4 ,G= ,GA ,GJb*l -| ,G ,G ,H ,G/$/‘ -ґ ,H֑ ,Hߑ/ - ,LH ,FH ,H ,H/ -) ,H- ,H6/@ -M ,HQ ,HZ , I^ ,Ig/q -~ ,1I ,+I ,UI ,OI ,{I ,sI - ,I ,I//ޒ ,I ,I ,I ,I// ,I ,I( ,I, ,I5/?/X ,I\ ,Ie ,Ji , Jr/ , J ,Jaѓ$ۓl$ *  - 0 ,EJ4 ,;JC ,JG ,vJW ,J[ ,J` *k ,Ko ,Kt * ,TK ,FK *ޙ& -  *W )%Ք *eߔ -  * ,K ,K)%  -  ,K ,K$ ,K( ,K- - 6$&B>&S gw *aq **~& *ĕ ,Kȕ ,K͕ *ؕ ,Lܕ ,L~&~& ,L  ,L ,&L ,$L"~&7 ,8L; ,6LD~&N~&k ,HLo ,FLx ,YL| ,WL& *aq **Ȗ֖9% -"  ,mL ,gL -"  ,L ,L ,L ,L ,L  ,L)9%39%P ,!MT ,M^ -K k ,AMo ,7Mza% ,M ,Mv% -[  ,Mŗ ,MΗv%ؗv% ,M ,M%  -k  ,M ,M' ,M+ ,M0%E$ O%d$ nT&$ % ,N , NE%˜$ Ҙܘ ,N ,N ,-N  ,+N ,AN ,;N  ,sN$ ,_N- ,N1 ,N:D - T ,NX ,N] - f ,Oj ,Os -  -  ,5O ,3O - ř ,GOə ,COҙ ,vO֙ ,rOۙ - E[ #< ,O@ ,OI ,OM ,OV`x ,O| ,O ,O ,O ,O ,Oš ,Pƚ ,PϚ ,PӚ ,Pܚ ,+P ,'P% ,FP) ,DP2 ,WP6 ,UP<_i - y ,gP} ,eP -  ,vP ,tP ,P ,P - ̛ ,PЛ ,Pٛ ,Pݛ ,P -  ,P ,P  ,P  ,P  - - ,P1 ,P: ,P> ,PH`hz ,P ,P - ќ - ޜ , Q ,Q -  ,Q ,Q ,KQ ,GQ - !-> HQ`j - z ,lQ~ ,fQ ,Q ,Q @  - Н ,Qԝ ,Qݝ ,Q ,Q$ $1"; - K ,QO ,QX"b"z ,R~ ,Quu ,R ,R ,*R ,&Rƞמ$ ,@R ,>R!+ - ; ,ZR? ,VRHR -/ ^ ,rRb ,nRk ,Ro ,Rx -?  ,R ,R -?  ,R ,Rß ,Rǟ ,RПڟ -?  ,R ,R ,S ,S ,2S ,.S  -?  ,JS ,FS *G ,`SK ,^ST ,pSX ,nSak ,S ,}S ,S ,S ,SŠ ,SΠ ,SҠ ,S۠ ,S ,S 4> -O N ,SR ,S[ ,T_ ,Sd {P$=pա$ !%6@ &U_p&t~TH ۢ **: * *u */ *ޙ9hG *}T *Vg *}t *V *W H *e * *vz£` ,"T ,T *GS ,_T ,ST  ,T ,T *<  ,T$ ,T) *4 ,U8 ,T= *H ,&UL ,UQ *އ\ ,MU` ,GUj *}w *V *( ,pU ,jUĤ *(Ϥ ,UӤ ,Uݤee ,U ,U -W, ,U0 ,U9 ,U= ,UBW$ h7y$  -p , V , V ,V ,Vƥ -ҥ ,2V֥ ,0Vߥ ,AV ,?V ,PV ,NV - ,hV ,fV  ,wV$ ,uV- ,V1 ,V6 -? ,VC ,VHe`u$  *kЦ *uݦ * *ޙ *} *V0 *(C *aqP Y **fq *}~ *V *>Pħ *uϧ ,Vӧ ,Vا *5 ,V ,V ,W ,W *S  *A: ,9W> ,WC *ޙR&\ *dcl *jV  *d̨ *ר ,Wۨ ,W ,W  ,W ,W ,W!,= Q^\q *| ,W ,W * ,X , Xĩ ,9Xȩ ,7Xѩ۩ ,HX ,FX $ ,ZX( ,XX4>[ ,lX_ ,jXh ,{Xl ,yXv - ,X ,X ,X ,X ,X ,XƪЪ -ݪ ,X ,X ,X ,X   * r. `7L *dVk *v ,Xz ,X ,Y ,Y ,Y ,Y˫,ܫ `, *W$&F7>DQ$\Yq *V (Y *dY *Ǭ ,.Yˬ ,,YԬYެY ,>Y ,`̺) ,Q` ,M`* )!(6$@<)U_e)wu)})))׻)))'*<F*[e8 }0 *' *6 ,t` ,l`˼ ,`ϼ ,`Լ *u߼ ,` ,` *de , a ,a * ,7a  ,1a *}" *V0'E *(P ,UaT ,QaZ(o *(z ,sa~ ,qa'' ,a ,a(ǽ - ׽ ,a۽ ,a ,a ,a -  ,a ,a ,a ,a((6 ,b: ,bD,(N - ^ ,bb ,bk ,5bo ,1bt4(e(j(j(˾ ,KbϾ ,Ibؾ ,Zbܾ ,Xbj(j( ,ib ,gbj((j(@ ,xbD ,vbMj(Wj(o ,bs ,b|j(j( ,b ,bj(j( ,b ,b ,b ,bj(j(# ,b' ,b0 ,b4 ,b=j(Gj(_ ,bc ,bl ,bp ,byj(j( , c ,c ,c ,cj( ,+c ,'c(("(.6(86(U ,GcY ,Ecb ,_cf ,]ckE(|$'$ *h& *6 ,xc ,lc *GS ,c ,c ,c ,c *\C ,c ,c *x# ,(d' , d, *u6 ,Vd: ,Nd? *deI ,}dM ,udR *\ ,d` ,dj *}v *V&& ,d ,d' -_  ,d ,d ,e ,e -_  ,@e ,8e ,ee ,ae' -v ( ,{e, ,ye66'@ - P ,eT ,e] ,ea ,ef>'~'C' -  ,e ,e ,e ,e - C' -  ,e ,eC' -  ,f , f C'* - 6 ,(f: ,$fCC'M - Z ,@f^ , ,iB ,iK/ U -a ,je ,jn ,0jr ,,j{ ,Lj ,Fj -* ,kj ,ej/ /  ,j ,j ,j ,j/ /  ,j ,j  ,j  ,j/ / 9 ,j= ,jF ,jJ ,jS/ h ,kl ,juo ~ C C  ,k ,k ,4k ,2kR $ ($2' Z *< d{ *GS ,Ek ,Ak ,^k ,Zk *\C ,wk ,sk *x *u ,k ,k -  *( ,k ,k@  *( ,k ,k!^+^C ,kG ,kP^Z^r ,kv ,k~ * *u *> *u *4 -: *g  ,k ,k *u ,Dl ,6l ,l ,l *5 ,l  ,l *ޙ *(+ -P5 *UB K ` *ci -br *| ,l ,l  -b ,l ,l ,m ,m -b   *aq  ** * -t3 *L ,:mP ,4mZ *aqf o **{[  - ,]m ,[m[ [  ,lm ,jm  - ,{m ,ym ,m  ,m -AY`h r  ,m ,m   ,m ,m   ,m ,m / - 7 -G ,mK ,mT ,mX ,ma k -x ,m| ,m ,n ,n   ,n ,n A Q  * B Z r  0 *kX * *u *ޙ%P4 *pA O *jcY *h *t * *  *6 *L * *) *6 *GS *< *mw *6 *t& *#iS *` *Km *Kz *K *&K *-K * *6 *\S *6 *p *6 *c *6 *o! *s3 *6A *d_ *:- *  *I| *Β *o *Ι  ** *`; * ,H *`Z *ng *u *M *n * * *$ *n *X *Ջ *Ln * * *c' *g 3 *@ *̽L *g Y *}e *g r *g * * *m * *ޕ * ~- *: *PZ *s *\ *۶ *t * *} *V *x *t *k *'% *}S *E<y *7 *9` * *2W *ȯ6 *9D *af *O *} *¨ *k *9  * * *ĩ *ܩ * * * *38 *mS *_ *}k *Z *9 * * * * * * *2 *J *b% *z4 *? *L *]U *n2q *x *9 *x * *x *\ *x *_ *n! *7 *nD *Z *ng * *x *q *x * *n *x *v  *x# *@: *xG *A^ *xk *A *x * $ *m * * * *O *j# * + B -fN (qQU * */ *L *! *Q *" * * *D *$ *  * *%  *h *\` *(- *? *` * * *S *" *y * *y *6 *iP  * *w% *B1 *t= *VP *W *g[\ *h *<t *! *c/ * *B *Q *? * *] *6 *5 * *iW *0 * *O( *R4 *@ *L *X *d *^p *A| * *1= *C *1= *[ * *Y- *^O *  *9 *J( *Y-5 *c6] *pj *Y-w * * * *% * *Z *= * *, *&  *O9 *2+( *6 *VD *RR *K` *n *kR ** *4 *< *Y! *4 *$ *U@ *0 * *;1 *E @ *^ O *^ *^m *:| *UO * *H * * *P *F *k * * *O! *U0 *? *U&N *^] *l *C{ *: *p *~ * *` *1 *@ * *) * *  */ *^> *M *T\ *7k *#Iz * *& *G *  *K *{ *! * *_ *D( *,V *Aj *i- */ * * *z1 * *L0 * *g5 * *  *$) *6 *"C *2P * ] *lj *w * *' * * *I * * ** * *8 *Y-( *5 *B *3b *l *Vy *R *;( * *G^ * *v * *3Z * *M+ *: *I *f *6v *=| * *) *3 * ' * *C *Y8 *  * * *N *. *0) *~6 *h *+u * * *R * *-`V *Op *[ *I *, *Z *9 *  *-Z *S  * *% *K3 *AA *O *%O] *N-k *Cy *] *1 *Q * * *] *1/ *q *& *&5 *^D *S *B'b *Yq * *| *9 *c  *S *$ * * *  *$T *# *& *5 *3D *S * _b *Dq *{ *a *+R *  * *+ *;/ * *% * * *% *Q4 *HC *_R *aUp *6 *[ *J_ * *b\ *T\ * *Q *[ *!( *5F *( *58 **H *TX *Kh *WFx * *DF *p; * * * * *` *` *U/% *4 *kC *R * a *,p * *o0 *% *xC *5 *B * *], * *& * *\$ *3 *B *Q *'` *o *~ * * *") *? *D0 * *  *J *d * *;$ *3 *VB *g_Q *`` *o * *E *U *7: * * * *0 *7 *_ *" *|1 *@ *^O *L^ *hm *| *V *H *C * *e+ *0X * * * *y. *(! *0 *? *N *(] *[l *{ * *= *) *Xa *7 *[ *N *6 *  * *  *e / *M> *4M *\ *BYk *Z4z * *9 *' *}* *. *M * */ *F * * *#. *= *N?L *8[ *j *<y *1H * * *  *A *u * *tM *} *e *  *g. *2= *9L *WX[ *3k *,z *\ * *$ * * *eX * *V *1  *H *5 *. *(= *nL *[ *3j *y * *? *  *O * * *L *: * *4 *q/. *#= *L *q [ *Mj *`y **$ *\ *4[ * *@ * *1K * *U= * J *" *1 *@ *gP * _ *u *j * * *b! * *< *8M *D * * *}  *| * # * 1 *e * *  *l *eI * *P *#% *-* *WA6 *YD *YS *5y *$ *, *< * * *R *) *; *2aD *B%R *` *n *-| *.9 * *8 *M@ *7 *g *qW * *  *lK *y& *J%N * [ *s * *) *P *| *8 * * * *j  *4+ *[9 *G *U *hc *Wq *? * *K *XX * e *?r * * *b * 1 *16 *# * *" * *  *& */.  * * *5# *U0 *= *J *W *3Zd *r *C * *i6 *R *  *s * * *q> *P * *5 *> * *w *gA, *': *~G *,U *$b *  *Q *(E * *W * *X *3B *X7 *W! *^. *X7; *ZI *6V *|d *r * *X7 * * * *^* *| * *3Z * *v * * *x: *G *T *a *wO{ *  *YG *NX *R *O *W * *3Z *  *V * ]& *NR3 *~5A *T *r *z9~ *a *h * * *Y *" *V *f *} * O6 * B */N *%_ *k *|| *~M *1? *4 *o *N *%  * * *V * *N& *% 3 *VJ *NW *% d *Hq * ~ *bJ *q *F@ *  * * *B * *C *6' *3 *V? *K *|&a *Q~ *  *K *C *6 * *R * * *  * *L5 *vRB *+O *\ *j *~ *F *M *7% * * * *g *D *n\ *T *  *+%  *H2  *RL  *.Z  *%g  * u  *  *  *R  *x  *  *E   *  *D  *W  *  *P! *.! */ ! *K-! *:! *VH! **U! *b! *`]p! *}! * ! *$! * N! * ! *%! *$! *! *tM! *B" *8" *0" *," *29" *gc" *p" * ~" *" *" *" *E" *+" *" *" *" *"" *F# *^B# *}KN# *\# *\j# *x# *"# *# *GV# *K# *dL# *D# *# *'# *# *8# *v# *\ $ *$ *($ *Q6$ *y[D$ *R$ *DE`$ *8o$ *^}$ *K($ *+$ *)0$ *$ *"$ *W$ *$ *~$ *$ ** % *% *D'% *6% *D% *R% *$`% *n% *_|% *'% *?% *% *(% *<% *_% *% *% *% *6W& *& *0$& *2& *D@& *kN& *EO\& *Yj& *`7x& *& *Z& *& *& *& *& *& *!& *& *(' *N' *#' *R1' *1?' *8M' *o[' *+i' *w' *l ' *' *' *' *z' *' *W' * ' * ' *j0( *5&( * 0( *&>( *L( *Z( *h( *9v( *1( *uK( *( *A( *<( *W( *( *) *(") *!) *)/) *"=) *(K) *Y) *Zi) **y) *) *p) *1/) *^) *[') *) *>) ** ** *$ * */* *Y* *g* *(v* *Z* *YG* * * ** ** ** *fa* * + *j+ *Y-/+ *7+ *qF+ *-j+ *2t+ *S+ *+ *+ *M+ *9Y+ *N+ *9+ *+ *J+ *, *, *, *|*, *&8, *FF, *LT, * :t, *}, *, *", *, *H, *R8, *#9, * - *8- *=&- *:9- *F- *Sm- *Az- *rZ- *:- *U- *s#- *- *- *- *- *P - *< - *[ . *. *3#. *`0. *@=. *vJ. *`W. *Yd. *8q. *M~. *I. *S. *P+. *. *Y. *`/ *8+/ *8/ *--E/ *R/ *v_/ *x/ */ *V/ *mO/ *@/ *]/ *7:/ * / *3/ *q/ */ *+0 * 0 *+L0 * '0 *40 *}A0 *(N0 *[0 *h0 *Ru0 *0 *0 *10 *0 *0 *H0 *h0 *g30 *\0 * 1 *1 *G%1 *31 *ZA1 *O]1 *k1 *y1 *\1 *1 *vQ1 *1 *1 *<1 *1 *1 *1 * W2 *2 *?!2 *D0/2 *=2 *'K2 *EY2 *Rg2 *u2 *42 *\(2 * 2 *=2 *2 *V2 *2 *2 *K2 *(3 *=3 *3 *+3 *X93 *3G3 *V[3 *h3 *Su3 *}3 *3 *B3 *L3 *T3 *3 *W3 *3 *(3 *b3 *ZI3 *4 *"4 *"4 */4 *6<4 *=O4 *[^4 *h4 *5r4 *4 *4 *O`4 *p4 *4 *4 *4 *4 *5 *!5 * +5 *55 *Y?5 * L5 *vY5 *Wf5 *~z5 *p5 *b5 *U5 *5 *|5 *B5 *z\5 *4[5 * 5 *c6 *E6 *z 6 *Y.6 *W;6 *H6 *ZU6 *Qc6 *)p6 *zF}6 *U6 *:6 *>P6 *6 *46 *'6 *%V6 *DX6 *SS7 **7 *C7 **1P7 *Y]7 *2p7 *|7 *B7 *]7 *d=7 * 7 *37 *"7 *`7 * 7 *p^7 * 8 *8 *'8 *s58 * \B8 *NO8 *]\8 * i8 *v8 *08 *U8 *w8 *Z08 *8 *b8 *J9 *{W9 *Z"9 *W/9 *=9 *M9 *S9 *Z9 *I`9 *Vf9 *Fm9 *z9 *%9 *9 *W9 *9 *VN9 *9 *9 *Z9 *O: *M,: *9: *)#F: *q S: *Y-`: *m: *z: *: *: *U: *P: *: *: *i4: *O ; *; *%); *_7; *;u; *; *; *m; *.; *Y; * ; **; *; *; *j; *VV< *< * "< */< *B<< *I< *V< *Wc< *p< *H}< *'_< *J< *Z< * U< *< *"< *< * < *< *= *+= *,= *E*= *8= *7JF= *!T= *%b= * = *= *C= *== * *> *(> *)5> *H> *UU> *}b> * *> *=*> *> *> *H#> *i> *C> *N> *"> *? *PY ? *? *'? *A? *N? *? *N1? *.C? *? *X? *"? *K? *!? *? *@ *=@ *%@ *B.@ *D<@ *dFw@ *Q@ *"@ *SZ@ * S@ *@ *@ *@ *[@ *Y@ *G A *A *#,A *V9A *|FA *SA *G`A *`mA *"zA *A *5A *!A *A *\A *A *WA *MA *-A *LA * B *9B *#B *1B *(?B *YMB *%[B *m%B *B *B *B *B *3B *b[B *RB *3C *-C *35C *H.AC *JMC *VZC *?C *RC *<C *YC * C *kC *qC *C *C *`C *@C *C *?D *7 D *%D *$[D *W$D *v1D *G>D *=LD *=_D *lD *kD *D *GD *D *WD *D *-ZD *zPD *]E *E *Y-+E *CE *BPE *2yE *&E *J:E *J:E *E *"E *}E *E * E *:E *JF *!F **F *"7F *DF *IQF *;^F */kF *tSyF *tF *IF *ZF *xF * F *sF *<F *F *]F *G *5G *G *X,G *$9G *DBFG *4SG *2"`G *,mG *>zG *#G *aG *7G *KFG *NG *9G * H *k/&H *9H *$\PH *iH *DvH *H *LH *)H *IPH *)H *iJH *H *'H *= I *I *$I *>I *M *M *M *MM *"M *M *M *M *M *N *N *1)*N *8HN *aN *F9nN *8N *,N *[N *N *\N *HN *N *WN *`O *s)O *$O *O2O *@O *KNO *d\O *jO *xO *O *O *TO *gO * OO *ZO * ZP *#P *V1P *VTP *<bP *pP *~P *mP *P *QP * P *<P *WP *= P *$P *= Q *2Q *&Q *J\4Q * BQ *X1PQ *-^Q *]lQ *zQ *$PQ *Q *)BQ *(Q *Q *Q *hQ * Q *R *0R *bR *8.R *=R *YSLR *|jR *yR *OR * HR *R *R *R *-R *QR *HR *S *S *XLS *U *+DU *SJU *>8PU *VU *\U *4bU *9iU *XpU *GwU *>~U *KU *U *.U *.U *U *HU *U *tU *U *U *V *{V *V *Q,V *9V *SV *`V *mV *bEzV *$V *#V *VV *!V */V * V *V *&V *)W *LW *t<"W *T?W *NOW *jUW *[W *bW *< oW *W * W *W *W *W *W *G, X *#X *#X *sT0X *J=X *LJX *nWX */dX *OqX *~X * X *XX *X *dX *X *SX *UX *X *X * Y *Y * 5Y *2CY *_Y *mY *n{Y *Y *$Y *iY *y8Y *Y *kEY *SY *}Y *!Z *WZ *C,Z *;Z *cOJZ *YZ *hZ *`wZ *,Z *`Z *VZ *KZ *Z *Z */Z *2Z *[. [ *;[ *r*[ *\9[ *H[ *bKW[ *g[ * w[ *6[ *[ *[ *[[ *[ *w[ *A[ *" \ *KU\ *V%\ *2\ *] * ^ *'^ *I4^ *ZB^ *O^ *}\^ *;i^ *v^ *^ *D^ *)^ *$^ *^ *^ *B]^ *_ *2_ *R _ *7_ *4_ *A_ *VVN_ *[_ *|h_ *u_ *_ *O_ *\_ *_ *_ *O_ *Y_ *Q` *+` *FM` ** 8` *E` *_` *$l` *ay` * ` *4` * ` *(a` *NA` *` *` *` *cQ` *a *8a *?#a *1a *X?a *aPMa * [a *ia *Iwa *~a *5a *a *)a *'a *a *6a *a *\:a *Bab *bb *Bb *-b *;b *`Ib *6Wb *Leb *0sb * b *c *R>c *-Gc *I c *^d *d *A%d *42d *|?d *Ld *#Yd *sd *Cd *%d *,d *#d *d *d *4d *d *}d *YGe * e *3e *@e *Me * ]le *Qye *YMe * e *\e *xe *Ce *e *\e *;f *Ef * !f *;B/f *#=f *Kf *'<Yf *[gf *Tuf *f *f *"2f *Rf *<f *f * f *g *Ig *Rg *Q-g *$;g *!Ig *$Wg *eg *1sg *'<g *g *g *h *Eh *'h *&h *)h *U6h *-h *h *E i *i *$i *wZ1i *Kbi *vi *i *i * ]i *i *i *i *!/i *-;j *xj * ,j *9j *;Fj *s"Sj *O`j *Vmj *e"zj *j *M'j *^Yj * j *vj *j * 4j *j * ]j *k *k *!k */k *x=k *$\Kk *aYk *gk *uk *Tk *k *"2k *k * Kk *l *Wl * l *+l *Dl *Ql *&`l *Qol *~l *l *[Bm *Lm *m *J n *n *'n *4n *An *WTn *an *;nn *L{n *n *n *h2n */o *u *"u *. u *u *) u *(^u *Jju *Vvu *_u *5 u *u *u *u *2u *u *u *(u * v *$v *:7v *DEv *Sv *av *ov *Zv *8.v *Gv *v * v *(v *Y-w *w * w *8.-w *U:w *VGw *>Tw *>aw * nw *{w *w *Cw *Zw *38w *Vw *xNw *w *Aw *x *!x *.x *`G;x *{Hx *Ux * abx *ox *y *y *@y *(y *y * z *y"z *Qz *fz *Otz *z *z *z *z *#z *Iz *z *`$z * { *{ **){ *#7{ *^E{ *S{ *eYk{ *Yy{ *a{ *{ *{ *={ *D[{ *{ *A{ *y`| *| *x| *!3| * ?| *EU| *2a| *>Cw| *Z| *^| *?| *| *| *IW| *| *| *} *} *,M&} * 2} *<?} *1R} *s5f} *g]s} *(} *(} *7} *S^} *} *Z} *} *~ *~ *J6~ *TD~ *R~ *8`~ *8n~ *V[|~ *5~ *+~ *0#~ *)~ *~ *6~ *y)~ * *! *E0 * > *(aL *Z *h *Jv *Z * ǀ *Ԁ *- * *y8 * * *}0 *= *vZ *g *}Qt *b  */ *C * */3 *_ȁ *v * * *{  *  *# *6 *C *$Q * ] *k *~y * *3 * *0 *N *'͂ *ۂ * *b * * *! *_/ *X= *tK *RY *hg *Pu *[ *i( * *3׃ *P * *; *- * *; *I& */I *% **+ *>1 *?18 *F *"T *bb *p *_~ * *a *E * *V „ *?:ф * * * *Z   *N *U_+ *R: *`I *^X *Hf *"t *W *8 * *Y" *` *.,΅ *9ޅ *S * *-  *` *%) *7 * E *qS *a *q *Q *G* *r *; *[ *w_ц *t$ *$ *': * *F! *6/ *q= *TK *Y *[g *:u * *% *Z *% *n *A߇ * * *W *" * , *9 *`F *BS *` *m *Hz *@ *lN *@ *a *+ *Ո *YG *fC *v% *' *nC *vQ *_ * am *S{ *  *HƉ *T Ӊ * *6V *CA * *"Z *! *. *m#; *bSH *aU *\b *so * | *3 * *2 *[ *Ɋ * *3 * *% *2 *? *L *Y *f *s *' * *bA *8 *2 *?&ȑ *PՑ * *  *9 *4% *3 *5A *O *] *o6k *y * *; * *u *Œ *Ӓ *F * 7 *R *  *y- *' *5 *C *aQ *y(_ *Lm *l{ *i *Z *` *: *< * ϓ *ݓ *E * *=- *Y *% *G= *vL *&[ *j **y * E * B * *> *E4Ӕ *q *H" *\ *} *R(4 *?A *,AN *f[ *h *|u *& *_ *l *d *S5 * Õ *T Е *ݕ *M * *+ *,  *#. *< *\3J *TX *]Af *>t *C * *G) *@ *h *" Ȗ *+֖ *A *y] *X *. *)^ ** *~8 *C!F *$T *} b *g;p *%~ *  ** *e8 *o *.ȗ *p+ח *0 * ** * *# *q72 *A *<P *_ *}6n *U} *9O *> * *| *Ș *ט *[ * *c * *" *<1 *;P *_ *xBn *} */ *Q *$ *31 * Й *֙ *S *j *ƚ *oӚ *3 *D *h! *>p *} *9Y *U *. *V *!̛ *TJٛ *f *7 *, *  *b *=4 *2;A *Z *g *t *3 *a *"Ĝ *ќ *ޜ *" * * *z *(* *R *" *} *=* *˝ *(ѝ *#Wם *R>ޝ *] *8 *# * * *G( *O44 *%N *S[ *xr *W *{ *h1 *ƞ *Ӟ * *  *  *M *  *Z= *C3v *1_ *q */% *F *25՟ *w *&H * *>5 * *+ * B *F^ * l *l! * *vL * *1 *ˠ *ؠ *; * *LT  *)B *V& **>4 *IA *SN *` *5* *S¡ *#ϡ *&ܡ *T * *CT * *  *E+ *8 *EF * S *\` *m *l { * *Z *z *>3 *Y-â *Т *ݢ *  * *5' *A *K *(U *b *>3p *s} * *_ *  *3 *]ͣ *4`ڣ * * *h *) *OL> *(!J *h_ *6k *x * * *\Ǥ *D *  *+ *y' *7- *73 *D=9 *pG? *E *YU *Gc *o *D| *2+ *30 * *k<å *Aۥ *, *WP *PH  * *YM# *F0 *6I *V *,d *}r *9 *)? * *%U * *C̦ *^ڦ *e * " *A *k *  *. *)< *NK *}Yn *Jz *s *T *F *& */ʧ *1ק *& * *P *b *_ *, *%+9 *0&F *S *!` *P<m *fG{ * *5 *Y *s * *nɨ *8֨ *8N * *$ *,  *  *1( *J6 *>QJ *XX *3f *t *>R *h *) *[2 *R *D *' *5 *C *Q *B_ *,m *U{ *j' *M *[ * *D@ *N *Q\ *j *x * * *> *r3 *6S *̫ *Pګ * * *> *v *   *X/ *F= *K *aY *Pg *,u */! * * *O *0ʬ *Uج *G5 *p *.V *B! */ *n= *NK *RY *Ng *r2u * *kB * * *0 *ʭ *Bح *O * *z * *Q *~> * * *(= *E- *~ *= *o *ӯ * * *[ *  *4 *$' *O.5 *GC *MQ *i9_ *m *4>{ *E * *  * *] *yϰ *&ݰ * * *1 *[  *R *@._ *w * *F *a *rY׳ * *m *5@ *&  *e0 *  * / *= *K *Y *g *u *?M * *+ *< *|0 *ɴ *I״ *P *Y *G *<@ * *wX+ *<9 *G *[RU *c *q *O * *U *S *4 * *ʵ *mص *I *" *s *:, *P;; *1I *vW *xe *7s *)  *N *+ *a *6-Ͷ *_۶ *z * *  *: *P) *DF7 *<E *S *y *` * * *rY *6 *&ͷ *1۷ *  *AU *cR */ * ! */ *2= *:KK *TY *g *~u * * *) * * *Iɸ *k׸ *W *\ *_> *0 *=? *W;I *V] *u'g *Hq *{ *k *Թ * *7 *'8 *D *2A *[ *SD * *>4 *0O *O2w */ * *' *ZG * *1( *`j *@v *I * *Y- *k *: * *t * * *B\ * * *(6 *m+ *J 7 *D *|d *Tq *h&~ *  *L *T * *9= *  * * *U$ * . *; *H *U *Jb * Go *D| * *8 *% *+ *1 *8 *T *|d *r * * *" *x *V *T * *Z *Z *`? *I *b *qEq *=~ * *JN *D *) *[ *U *A *&@ *84i *6w *; * *5 * *> *@2 *1 * *O * *L *  *Z *5 *  *  *&. *T= *AK *4Y *Zh *r * *?; * * */] *|^ *D *\ *" * * *,\ *" *G *)2 *+ *E * *F  *. *5K *m&_ *Yi *x *< *^- *r * *# * * * *  *=  *! *0 *|> * L *,Z *Zh *,v *Z] *_ *3 *# * % *D *=  *8 * * * * *L *-Z *h *?v *P *  *Q * * * *! *cO *M *G *D<" *2 *W*B *@R *'b *?r *  *C *'  *j  **Y *j` * * * * *" *0 *> *L *NZ *j *\z *K *o * *_ *H *_ * *; *n" *2 *VB *LR *2b *r *+ * * *, *l  * *JK *  *? *\ *m" *2 *B *~R *+b *r *9 *N *U *2 *  * *FQ * * *n *@" *n.2 *5B *R *b *Mq * *I *5 *i *&] * * * * *  *R *a( *-F *KU *e *'t * *+ *nQ * *O * *z! *2 *Y *  *A! *QE? *4N */] *l *D *y# *` * * *b *m# *a *3 * *\ * *+ *W9 *b.G *[.U *c *q * *?> * *HG *7' *3 *o_ * *@  * *T *F *" * *  * *L' *%55 *GC *SQ *\_ *m *H; *L7K *HQ *f*W *]] *0c *j *pw *`  *9 * ^ * *SQ+ *Z *9Yh *+v *) *6T *q! *E *r *O *W *@, *< *DB *H *PN *%DT *Z *;?` *2f *Ol */^s * * *9A * *I * *| * *  *:C *Q **^ *<k *]Cx * *K *v *GD *% *8< * * *@ *Y *# */P0 *O= *WK *y r *4 * *R *x *( *~ * * *4, *: *BG *` *'o *| *U *L *{U * * *{, *D7 * *G *X *M ** *8 *F *IT *Tb *Fp *5~ *o * * *7 *- * *#+ *8 *;E *R *(-_ *l *;^ *#n *e * * *?` * *q *3 *DT *Kp *! * * *J *  *P% * *C *r *8 *-U * 2 *AK *aT *g *&7 *%I *q[ *n *z -  ,o ,n *)# ,>o ,4o ,xo ,no *S: ,o ,o *A *`  *Y* - . ,o2 ,o;Y*E - R ,oV ,o]*jT x  * 6 ,p ,o *)# ,@p ,0p *  ,p ,p# -, *lF9 -B *GM ,pQ ,pW6hVw6666 ,p ,p ,p ,p6666 ,q , q ,q ,q66C6 -' ,O6W ,r[ , rd ,rh ,rqO6{O6 ,1r ,/r ,Ar ,?rO6X6 -& ,Wr ,QrX6 -6 ,|r ,vrm69q6C -FS ,rW ,r` ,rd ,rmq6w -F ,r ,r ,r ,rq6 -F ,s ,r ,s ,sx6 -V ,5s ,1s ,Os ,Ksx6 -V ,ms ,is' ,s+ ,s4x6> -VJ ,sN ,sW ,s[ ,sg6q - ,s ,s ,s ,s66 , t , t ,t ,t66 ,/t ,-t  ,?t ,=t646>6[ ,Qt_ ,Otd6y6 *  - *Z ,ut ,_t * ,t ,tx. * ,u ,pu.  - ,u! ,u& -/ ,{v3 ,_v< ,w@ ,vI ,wM ,swV ,wZ ,wc ,+xg ,xp.z. ,x ,x ,x ,x , y , y ,y ,y /// ,,y ,*y//4 ,;y8 ,9yC/M/i ,Mym ,Kyv ,]yz ,[y// ,ly ,jy ,|y ,zy// ,y ,y ,y ,y/ /# ,y' ,y0 ,y4 ,y?0I -Y ,y] ,yf ,:zj ,,zs ,zw ,xz| - ,z ,z ,z ,z - P0 - ,z ,zP0 - ,{ , { ,>{ ,:{ -H4b4- APU0ZU0v ,[{z ,Y{U0U0 ,j{ ,h{ --5 404  $h 4s3> -GN ,{R ,z{[ ,{_ ,{h ,{l ,{q -Gz -m3 -} ,{ ,{3 -} ,| ,{ ,/| ,+| -}33 +4D ,L|H ,J|Q4[4w ,[|{ ,Y|44 ,j| ,h|440 ,| ,z|0  - ,| ,|( ,|, ,|5 ,|9 ,|> -G -T1i -v ,}z ,}1 - ,&} ,"} ,U} ,Q} -444 @>4 ,r} ,p}4)4E ,}I ,}R4\4u ,}y ,}44H1 - ,} ,} , ~ ,~ ,}~ ,m~ - ,~ ,~ , ,~ ,  , , ,, - 9H1N -[ ,_ ,hH1r -~ , , ,B ,> -34 j1j1 ,a ,]1* ,. ,u7 ,; ,D1N1f ,j ,s ,w , , ,  ,B ,@ ,R ,P ,f ,b1 -/ , , , ,1%2 -B , ,# ,ρ' ,ˁ1 -B: ,> ,C72e -Rr2 -i , ,2 -i , , ,7 ,3 -i33 x"63% -{4 ,X8 ,RA63K -{X ,\ ,zg -p5   12/385  %g/C/P0md3// , ,// , , ,ς ,͂// ,ނ  ,܂) ,- ,6/@/X ,\ ,e , i , u// , , ,, ,*// ,= ,; ,M ,K/ / -& ,f* ,\3 ,7 ,@/J/f ,̃j ,ʃs ,܃w ,ڃ// , , , ,/g4 - , , 45" *5- *G *S:` *Y *N * * * * *  *A@ # *S:3 *D B @P *=[ *H. * * *S: *C *8 *A  *V    * ) *H.< *[H *:Z *' f xt *$} *H. *`  * *= * *A' 5 *S:C *9LO ] *f *H.u * * *S: *T *A  *  * * ( 6 *? *H.d *ckP- ,$ ,- - ,J ,F- - ,b ,^- - ,  ,|- -, ,0 ,9-V-n--.'.1. *C -  ,Ƅ , * ,# , ( *S:2 ,h6 ,`F ,J ,O *Y ,…] ,j+t *A} -B *3 M+ * -T *H. , ,M+ -T ,  , ,8 ,4 -T o,,',C ,UG ,SP,Z,s ,dw ,b,, ,v ,t,, , ,,   *& / *;E -fN *t Z Xc+x * -| *H. , ,+ -| , , , , -|+1,1,  , ,1,"1,; ,? ,H1,R1,j ,&n ,$w1,1, ,8 ,6^, X@ * -2 ,J ,H* -2 ,Y" ,W-h+7h+S ,kW ,i` ,{d ,ym ,q ,z ,~ , , ,+P*.-y   * * *'X, *:+= *I *4a *n *! * *O) *8 *= *: * *z *A4 *[^Q *x^ *k *y * *x * * *T *x * *q * *  *; *b7 *C *O *h *z *% *N! *% *  * *  *  *1-  *qJ  *H.W  *Sj  *  *h&  * `  *h&  *  *h&  *\  *h&  * )  *x;  *a?Q  *x^  *pAt  *x  *  *h&  *K  *h&  *  *,Q  *h&  *WH$  *h&=  *UY  *h&r  *m  *h&  *8  *h&  *  *I  *x  *  *n-  *x:  * U  *xc  *g  *t  '~z  *  +z  +S  -  (Xh  *  *8  * h  *  *  *  *ێ  *l  *  *  *"  *n;  *G  *pU  *Z  *Ch  *  *n  *  *C  * *"  *p *% *¦1 *R= *_I *ҧU *a *Om *oly * *ο *] *o * *Mb * *9 * *%i *v *#q * *g *h( *e4 *@ *,L *:X *d *yp *dd| * *j * *Y *x * *s * * *ܗ  * *+ *F8 *F *}S *` * *fj * *w * * *s  *zw *c& *4 * B *P *^ *l *z * * * *[t *5 * * *ݝ *c *e * *u$ *&2 *@ *iN *\ *aj *x *4 *F *e *  *? *1 *7 *U *  * *w) *8 *OW *ίf *iu * * *N * *O| *~ *l *j * *s  *T *e) *8 *G *V *}e *t *f *L *M * *I */f *Tw *} * *K  * *3( *Zx7 *̂F *U *d *lxs * * * *ai * * *ʮ *S *r *ج *}) *f6 *M *Z * *L * *& * *{ *P  *ׇ *"$ *7, * 4 *HA *O *E[ *nh *u * * *i *ˑ *Ut *J *3 *w *X *b  * *kc5 *A *~M *Z *_g *nt * *b * *y *~ * *F *Q *) *a6 *C *P *] *l *؅{ *Ut *: * *& * *6 *P *b ** * * * *Ds4 *A * N *[ *h * * *Ut * * * *  * *d' *q5 *PC *aQ *_ *m *o{ *U * *\ * * * * * * * * *# *1 *m? *M *[ *.i *(w *֭ * * *k *R *@ * * *+  * *p' *A *Y *f *w *! * *E * *UtV *c *Jp * * * *T *X *t *^ *m *b( *Ut6 *fC *UtP *] *aj *w * *$ * * *k *  * *Ut * *  *o  *  *.  *<  *=J  *X  *f  *t  *  *  *  *  *{  *}y  *,! *}! *̨$! *3! *B! *cR! *a! *p! *J! *! *! *݂! *! *ر! *! *! *! *re" *w" *$" *3" *qB" *OiQ" *5i`" *%o" *~" *3" *" *" *5" *" *" */" *y" *# *V# *{## *GA# *bP# *ܼ_# *!n# *}# *8# **# *~# *# *# *d# *# *M}# *ݟ $ *$ *)$ *`9$ *(I$ *oY$ *i$ * y$ *y$ *$ *zi$ *e$ *[l$ *D$ *$ *% *u% *f#% *2% *LA% *2uP% *E_% *n% *0}% *n% * % *d% *% *Se% *n% *m% *% *& *s& *U"& *1& *e@& *O& *^& *bm& *e|& *& *& *m& *j& *x& *& *Z& *b& *' *' *>"' *Q1' *f@' *]' *gl' * }{' *' *ĉ' *' *' *a' *i' *' *' *( *y( * ( *I/( *X>( *ؐM( *\( *k( *z( *B( *( *( *t}( *F{( *( *( *I( *}) *ڕ) *{) *.) *b=) *EwL) *[) *j) *Sy) *) *) *) *) *) *ʾ) *) *) *p* *^* ** *J-* *!<* *K* *Z* *i* *ax* ** ** *M* *)* ** ** ** *~s* ** *x+ *+ *x,+ **;+ *vJ+ *Y+ *$i+ *wrx+ *+ *+ * + *k+ *3+ *d+ *v+ **+ *N+ *, *l, **,, *><, *K, *hZ, *Si, *x, *, *j, *8, *, *, *, *, *+, *, *g- *%}- *I,- *;- *1J- *mY- *=h- *w- *D- *e- *Ԙ- *}- *j- * - *Ҵ- *- *-. *Bz. *,. *p;. *J. *_Y. *Yh. **w. *|. *. *. *. *c. *. *. *. */ *{/ *!/ *0/ *F/ *S/ *g`/ *Ovm/ *z/ */ */ */ *!j/ */ *ʝ/ */ */ *0 *0 *$ 0 *F0 *r0 *0 *ɏ$0 *3*0 *f~00 *t60 *<0 *B0 *H0 *'N0 *T0 *Z0 *o`0 *af0 *l0 *ˉr0 *x0 *d0 *)0 *0 *0 *0 *Ͻ0 *s0 *ԣ0 *0 *1 *1 *߻)1 *61 *C1 *8q1 *1 *%1 *h1 *J1 *1 *Ut1 *_1 *1 *hl1 *t2 *=2 *T 2 *,-2 *@2 *(M2 *,Z2 *v2 *22 *2 *g2 *2 *82 *2 *,2 *2 *3 *.3 *3 *o'3 *43 *m3 *z3 *b3 *O3 *S3 *4 *4 *+4 *F4 *tT4 *24 *O4 *S4 *.5 *5 *Ut5 *5 *5 *\5 *b5 *,6 *l6 *h{6 *r6 * 6 *h6 *96 *6 *6 *6 *g 7 *g7 * i@7 *f7 *s7 *7 *~7 *Ut7 *{7 *7 *@7 *7 *V7 *7 *y 8 *8 *ĉ'8 *T68 *k8 *y8 *k8 *E8 *m8 *8 *Nx8 *:8 *8 **8 *j9 *m9 *u#9 *f19 *?9 *!M9 *z9 *9 *9 *9 *39 *59 *i|9 *b: *g: *Q$: *02: *@: *N: *\: *j: *Zx: *: *: *: *: *lv: *#: * : *f: *: *h ; *?s; *; *< */)< *xF< *< *,r< *S< *< *< *X< *`= *m= *z= *= *z= *= *= *= *n= *> *p> *$> *C> *bR> *+a> *wp> */v> *^c> *8> *~> *w> *> *> *? *? * ? *p.? *J? *cZ? *Aj? *z? *? *f? *m? *F? *@? *}? *A? *<@ *@ *@ *E*@ *u8@ *M@ *Z@ *g@ *@ *zj@ *j@ *@ *Ut@ *i@ * A *|A *ߣ%A *3A *LA *ذ_A *\moA *uA *{A *+A *MA *nA *ӠA *A *A *A * A *A *nA *A *B *ʠB *-B *;B *^GB *TB *aB *ׇ{B *tB *IB *B *B *~B *sB *ΩB *B *B *C *sC * C *-C *{;C *HC *bVC *gdC *HqC *C *֙C *C *uC *C *bC *vC *C *C *cC *|C *~{D *+,D *F9D *vFD *rSD *2mD *"zD *(D *!D *D *D *D *gD *D *UtD * E *E *H%E *$3E *FE *dE *pE *6}E *fE *ϕE *ŨE *E *E *E *`oE *E *(F *4F *@F *QF *]F *çnF *={F *F *F *zF *\F *F *F *aeF *F *mw G *\G *%G *J *:LJ *dYJ *gJ *tJ *~J *J *J *wJ *ίJ *)qJ *ZJ *J *oJ *J *jK *K *wK *%,K *f:K *GK *TK *6bK *moK *|K *K *K *jK *|K *K *)K *3K *rK *L *;L *UtL *g+L *NUL *@hbL *pL *ss|L *ҢL *@hL *.L *L *@hL *L *@hL *L *M *4M * @M *UNM *\M *jM *yM *M *-M *M *M *M *fM *M *@hM *M *cM *M * N *sN *(N *o6N *DN *RN *laN *oN *}N **N *N *4N *N *N *N *N *fN *FN * O *еO *!(O *6O *4DO *RO *y`O *nO *1|O *|O * O *O *O *O *GqO *O *fO *%O *P *P *X$P *t2P *b@P *NP *}\P *jP *xP *rP *sP *P *oP *iP *ژP *P *ZP *7P *ϼQ *`Q *#Q *1Q *?Q *MQ *޲[Q *iQ *wwQ *tQ *YQ *Q *Q *Q *Q *Q *Q *@Q *bR *"R *ճ0R *Zg>R *xLR * ZR *.hR *vR *R *|R *R *R *sR *vR *R *3S * S *!S */S *7=S *UtKS *[S *kS *{S *S *S *~S *S *S *RS *S *ՒT *hT *i!T *LT *cZT *iT *qxT *(T *T *T *9dT *Q{T * T *nU *xU *"U * *U *{9U *]U *ogU *auU *U *U *U *U *tU *!U *U *{U *-U *V *UtV *emV *Z+V *z9V *GV *hV *uV *V *V *V *VV *V *V *vW *x W *GW *I-W *Z:W *aW *nW *Q{W *DW *W *W *W *5W *W *hW *[W *W *W *m X *X *$X *1X *)x>X *KX *eXX *eX *ٵrX *BX *X *X *xX *eX *X *$ Y *E-Y *d:Y *kGY *cTY *UtmY *Y *Y *(Y *TY *Y *Y *Y *Y *?gY *fY * Y *sZ *Z *JZ *k)Z *"{6Z *CZ *PZ *l]Z *jZ *UtwZ *=Z *:Z *Z */Z *AZ *}Z **Z *Z *mZ *m [ *b[ *e([ *6[ *R[ *\`[ *n[ *|[ *[ *p[ *v[ *s[ *[ *U[ *[ *[ *[ *Of\ *\ *$\ *t2\ * @\ *VN\ *\\ *j\ *x\ *\ *\ *\ *\ *\ *\ *c\ *\ *\ *] *Zh] * ] *.] *Y<] * P] *Ft]] *j] *w] *O] *] *I] *] *}] *e] *{] *] *@] *] *] * ^ *d^ *$^ *I1^ *oD^ *bS^ *q]^ *Qg^ *u^ *e^ *^ *^ *u^ *w^ *)^ *wr^ *^ *#_ *) _ *:w*_ *h4_ *SA_ *cN_ *[_ *so_ *#y|_ *u_ *c_ *_ *_ *_ *_ *_ *Ut_ *͖_ *` *` *` *M1` *;` *PE` **O` *Y` *Djf` *s` *D` *s` *ͫ` * ` *` *r` *(` *Ӗ` *w` *` *a *Óa *}!a *q.a *;a *Ha *Ua *`ga *sa *Ba *,a *a *a *wa *a *a *$a *Fa *b *vb *"b *yb *b *tb *ab *B|b *#c *w&c *3c *@c *wNc *d^c *dc *|jc *pc *vc *|c *c *c *$c *tpc *.c *c *]c *fc *Xc *jc *c *c *yc *|c *d * d *m1d * =d *)Id *Vd *cd *Aqd *n}d *md *@d *5d *d *pd *d *d *cd *c e *e *2e *ׇ?e *tMe *Ye *ee *}qe *)}e *we *Ce *e *?e */e *Ae *e *,ce *f *UtBf *$Pf *]f *mjf *wf *f *pf *f *f *f *~f *|f *Af *f *5-g *:m:g *Gg *2Tg *ag *ng *]|{g *g *g *g *Yg *g *g *|g *bg * h *eh *2#h *0h *]=h *yJh *Wh *dh *qh *ݤ~h *zh *Xh *>h *h *lh *h *+h *vuh *h *di *|i *:i *lPi *\i *cgri *i *Ji *Xi *i *Ji *Oi *Ji *i *7j *j *a7j *Fj *GSj *Bn`j *ʬmj *{j *tj *j *fj *yj *:oj *fj *j * j *0j *j *j *cj *Yj *k *k *)"k *I;k *A~Ik *sblk *gyk *k *wk * k *pk *k * k *k *k *=ll */l *By *My * *߯L *[ *Yj *qy *Ք * * *, *Ē *Ӓ * *V * *  *x *( *d8 *pH *eX *}h *x *ǚ *Q *Y *| *ÿ *!ϓ *ݓ *ߕ *{ *  *~ *.+ *; *K *N[ *k *{ * *U *X *1l *Oǔ *Ք *# * *g * *< *, *; * J **i * v * * * *! *Õ *YЕ *<ݕ *D * *c *y * *6+ *v8 *E *r_ *(n * * *+s *͖ *bۖ * * * *f *̶P *;] *j *w * *k * * * *ŗ *\җ *ߗ *w *+~ *, *G *a}  *- *: *yS *Ĕ * * * ** *.͘ *Ǵژ *] * * *\ * *w( *G5 *a}B *O *kh *G̙ *ٙ * * *k *  *v *' *4 *=A *N *5[ *סۚ * * * * *v *P *J] *zj *G} *} *z *G *  *}˛ *כ * *T * * *j3 *J *pe *Dq *} * * * * *ӯ *Sc؜ *w * *g * * *, *K *X *f *s * * * *ĝ *ĕ֝ *i *B *u* *v= *Y *e * * *@ *) * *Wf *}hΞ *۞ * *С *yf *8 * *) *w6 *{C *W *Kkd *Z{ *qt * * *Ÿ *П *+ޟ *_ * * * *L$ *2 *rF *'T *b *p *~ * *& * *i *rĠ *ɡҠ *b * *q *  *{ *& *4 *XB *|P *l^ *ͅl *z * *t * *j *̡ *,ۡ *H * * * *- *< *[L *b *|q *S *| * *â *+Т *ݢ *t * * *8 *(v *c+ *a8 *E *R *l_ *l * *} *> *% * *ˣ *٣ * * *nq *l * *- *S; *I *:W *e *s *O *l *  *( *ԛ *tjǤ *,դ *Q * * *  * ** *9 */hH *tW *f *v *$ *S * *~ * *Х *Dߥ *Sz * *3  * ** *w9 *cH *͙W *if *u * *w *n * *I *eߦ *9p *0 *in  *E *+ */: * O *n_ *e *; * eH *:uU *}b *Oo * *g * *D  *& *ܷ3 * @ *N *ך[ *h *Omu * * *Ut *@ *Gé *Щ *e *j * *> * F *S *e` *dm *{ *j *d *  *_ *w" */ *< *tJ *Z *9` *f * m *ftw * * *4 * *z *ū *(ҫ *z * * * *T *) *@ *M *;ht *> *B * *W *r *Ь *ݬ * *  *D *Q *ak * *T * *g *ŭ *Bҭ *߭ * *W *r *N, *: *JS *ԥf *p *v *o * *' *F *= *Fڮ * **i * *B * *N *l * *1 *  *S *į *=ѯ *ܥޯ *< * *g *r *! *. *; *wI *~xV *d *Cvq *~ * *= *f * * */o *\ *n *# *}0 *> *K *VX *e *r * *F * *6} *Ɛ± *]б *k *( *= *I *^ *j *qw *o *Ut *Ʋ * *?  * *32 *? *lL *Z *)pg *t * *ds *{o *C * * * *  * *( * *% *}C *xP *p` *Ef *5l *r *?x *b~ *j * * *M *i´ *ϴ * *& * *E  */6 *"B *hO *\ *i *l *› * *, *; *͵ *v۵ * * * *u *w! */ *= *tK *lY *g *u *  *\ *n *ö *ɶ *f϶ *Aֶ *f * *# *1 *> *0gK *X *Be *\r *s * *q *  *5 * *η *۷ *, * *p *l * *) *׿7 *E *S *a *=o *8 * * *Q *8 *ɸ *׸ *( *Ml *RR *}` *}n *| *Zz *c *0 * *¹ *]й *޹ * *Ry * * * *> *hz *bͺ *Lۺ *5 *0 *@ * *L! *Kr/ *i= *K *Y *h *v *Ut *!h * * * *Ҫʻ *  *v *X * * *> *L *Z *+h *cv *S *c *8 *? * *#˼ *zټ * * * * * *- *; *I *W *8. *< *UtJ *tX *gf * */˾ *7پ *=}  * *d( *6 *D *R *` *n *0m| * * *׆ * *¿ *вп *<޿ * *6 *| * *Td$ *Q *x *vI * * *q * * *l *Q *" * w/ *< *J *;T *G^ *sm *{ *j *y * * * *b *՜ * *R *u * *# *B1 *g? *M *[ *.i *Ww *je *U * *{} * *i * * * * *xz * *X$ *@ *\m\ *Dj *y *a *b * * *A * * * *m  * *& *Mu3 *K *,X *g *u * *i *t * * *Ɇ *Q *5 *{  * *' *'5 *]C *.Q *_ *m *{ * * * *1y * * * * *Ru *y * *# *wF *U *_fn *L} * * x * *1n *" * *" *0 *M * *v *r *DmD * *_ * * * * *ay *Sb *a *l *v * *( *c *J * *y * *!c * *o* *7 *D *,Q *^ *k *ly *b *p *b * * *Į * *z * *$ *Ӯ1 *K *wtd *r *| *s *n * * * * *\ * m *|s *y * *Q *M *b * * * * * * *$ *{2 *@ *qT * *~g *O *0 *8 *p * *9  *Ǵ *# *n) *\p0 *> *L *Z *Lh * *h *s *< * * *a *n" */ * *G * *k *i *k *b *  * *σ *y *6 * *  *  *K *9b, *: *H *W *e *s * *g *q * *ȗ *J * * * * *i * *l * * * *  *Fp *J *҅, *: *H *Fe *y * *p * * * * * *J */ *s * *( *5 *2uB *O *b *To *P *9b * *Ut *} * * * *  * * *Y *" *|( *. *O4 *: *.A *N *i[ *y * * *T *e *b *;t *0 *| *߉+ *8 *E *R *'_ *gy *c * *| * * *% *C * * *n  * *6s* *D *XQ *^ *k *x * *G *a} * *ހ * *k *[ *Adu * * *1 *Cc *: *M * * *^ *X *  * *$ *P> *UtK *X *e * * * *} *m *| * * *.- *܁; * L *] *dc *i *o *e{v *y *# *< * *4 * * *lm * *  * *~' *4 *@A *N *[ *h *u *W~ * *h * * * * * * * *"  *8 *F *^T *|b *p *~ *b * *u *= * *x *v *~ * *_  *m *% *32 *? *L *rY *nf *'s * *o *m * *w * *: *3 * *s  * *1, */9 *1eF *j  *< *' *b4 *A *.N *[ *ti *. *Cb * * * *9 * * * *܁+ *8 *E *R *_ *l * * * * *j *] *h} * *ö * *  *9 *' *5 *C *Q *Z_ *:xm *E{ * * *| *  * *q *m * *7 *o *g *# *1 *u? *DZM *Ut * *y * * *u *  * *`k *2r * *k *b+ *49 *G *&V *c *p *Ƴ} * * *vy *2 * *Ut *h * *܁ *;h *( *26 *6D *aR *܁| * *> * *f * * * * * * *N~ *+ *b9 *GG *a}U *c *q * *e * * * *; * * *e *uK *\ *kb *yh *n *=t *}{ *R *w * * * * * *  * *D *A *c" *( *~. *4 *: *¤@ *~F *L *R *X *B^ *cd *j *Oq *$k~ * *Qk *T * *ƙ * *ΐ * * *s  *V> *J *W *d *q *~ * * */ *  *m * * *5  *] */$ *1 *> *K *X *u *s * *( *p * * *d: *݄O *] *k *3y * * *4 * * * *! *3 *x *  *. *< *DT *b *Tp *n~ * *_ *: *c *k *4 * *u * *ʜ( *> *J *` *l * *m * * *8 * *= *3 * * * *`( *{; *O *=\ *t *1 *f *R *w~ * *~ * * * *L+ *9 *3G *eU *pc *xq *t * *Ut * * * * *  * *#% *U *ea * dm * *e * *l * * *b * *L *(g *s *0 *^- *; *W *ke *s *l *C *S *y * * * *c * * *$ *: *ZD *gP *j\ *Nh *t *k * *D *0 * * *Ȅ * *k# *$r1 *ܜ? *fM *[ *ƙi *w *W * *( *k * * * *[ *' *} *kb * */ *+K *8qY *g *ހu * * *b * * *< * *z * *V  *Q *E- *= *M * ] *%m *ň} * * *m *& *ώ *l * * * * *|% *CiB *w` *^o *N~ * *ȥ *6 *| *P * * * *mi  *| *- *.= *M *] *m *} *\ *( *\ *  * *i * * *  *) *- *= *M *u] *m *@} * * *| * * * *@ * *P  *l ** *C9 *|H *W *of *v *ew *2t *h *t * *(l * *l * *% *.4 *hC *yR *a *bq *g *y *p * *L * *e * * *k! *+ *5 *aC *Q *t_ *m *{ *G *a} *w * * * * * *k *ހ *y ** *uT *^ *zh *̣v *F *Oh *ؽ *d *qd *or * *e *J *dr *n * * * * *a} * * *q * *X * *~ *Yn *x *" * *& *M * * *  *]  *04  *OA  *  *\  *  *  *  *%  *  *f  *  *#  *0  *=  *[  *  *  *f  *  *Ut  *  *1|  *  **  *a  *m  *Ё-  *:  *G  *UtT  *Qs  *Z  *j  *˟  *  *O  *  *_  *vg$  * *" *A. *˟? *XK!i *u@~ *W ( *i  *' f *  *Be#7@ *W *L` *| * *V * *1 * *k, *D *Z *ou * * * *md * *D */{_ * *q * *s *  *# *5 *=K *jf *[ * *^u * * *ï *ڞ * *͸5 *M *UPl`} *b *P *O  *bS$q5 *;7] ,ԇa ,̇f *gq ,u ,~7 - ,) ,'7 - ,? ,977 ,Z ,X77 -' ,i+ ,g4 ,{8 ,y>7W7d7{ *NH , , , , , ,ӈ *g ,C ,;kIH - ,o ,g! -* ,. ,< -P ,ډT ,Љ]Hg -r ,v , , , ,* ,( ,< ,:H - ,N ,L ,` ,^ -HH ,r ,p ,! ,'HK -XHm -%z ,~ ,H -% , , ,Պ ,ъ -%wII ,HH.C;$0J -7WIa -GqII*I -W , ,HIPI -g , , ,# ,II( -y8 ,>< ,:E ,ZI ,VR ,ZV ,V[ -d ,th ,pmIzIJdIIF J" *ґ0 *= *gJ *IhW *ge * t * *g * *ܜ *w *X *[ *  *P " */ = *WH *z *s@G *a , , *; ,k ,M *g , , *P - *? 8]G *ƻ -# *. ,D2 ,B;]GE -R ,VV ,R_ ,c ,h -qG}G 8 - *U G *z - * ,  ,G -) ,- ,6 ,: ,ߍ? -H%HT@He yIG - , ,GGGGG,HIHaTHziHyH * *g *c *X * *ܜ' *w4 *qW *d *[q *P{  *  * * *  * *  *  p  *9&  *L  *V 8m  *gx  ,|  ,  *  ,H  ,>  ,  ,u  ,  ,  *  ,! ,ڎ! *P&!9/! -8! *E! PN!f8c! *m! -v! *! , ! ,!f8! -! ,2! ,.! ,a! ,]! -!)9!D9! P!! -" *;" "8-" *7" -@" *K" ,~O" ,|X"8b" -o" ,s" ,|" ," ," -"9"9" ""8""#8(#2#8R#h#9###9##9#$:$ *S"$ *g/$ *I$ *ܜV$ *w{$ *P$0 $ *$ $ *ź$ *$ *$ $ *޺$ * % *% %% *0% *A% *_L% -W% *ga% ,e% ,ڏj% *t% ,(x% ,% ,% ,% *ܜ% ,ߐ% ,Ӑ% *w% ,$% ,% *h% ,g% ,]% ,% ,% ,% ,ّ% *P%;& -& *F& 0 '&:<& *D& -/N& *Y& ,>]& ,<f&:p& -/{& ,P& ,L& ,& ,{& -/&m;&;& 0 & & *O& & *b'(' *O"' +' *b7' F'#;P'#;k' ,o' ,x' ,|' ,' ,Œ' ,' ,ے' ,ْ'N;' :';';(8 /( J(T( l(# (4 ( (< (L ( *~( :( *g) ,) , ) *) ,) ,*) ,M.) ,E3) *f=) ,{A) ,sF) *hP) ,T) ,c) ,g) ,):)u:)):)*:* * * *g7* *C* *O* *^rb* *Pl*P z* ** * ** ** *V* * *ƹ* ** *s* h * *߹+ *,+ *=+ *gI+ *U+ *l+ *Ix+ *P+0 + *+ H + *{+ *+ *+  + *+ *, *, *g-, *4,7K, *gU, ,ғY, ,ȓ^,&7v,67,F7,X7,j7, *tq, *a, *g, *P- - * - *72- *?- M- *bV- *i- *u-$0- *- *c- *g- *-- *g- *- *g . *q. *g&. *>. *fK. *+X. *gp. *}. *. *g. *h. *u. *hh. *|. *. *@/ *}(/ *5/ *UtC/ *U/ *b/ *Utp/ *r/ */ */ *Py/ *L/ */ *Ut/ *M/ *з/ *|/ *5 0 *\0 *e+0 *40 *=0 *tZ0 *g0 *~0;0 ,0 ,0 ,Q0 ,505<0 -D0z<0 -V1 ,” 1 ,1z<1 -V*1 ,Ԕ.1 ,Д71 ,;1 ,@1 -VI1<U1=f1 s117=1 -h1 ,(1 ,1 ,W1 ,S1 ,v1 ,l1 -1 ,1 ,1 -17=2 -2 ,2 ,27='2 -22 ,62 ,?2 ,0C2 ,,H2 -Q2=]2=n2 H {2 2 -2=2 -2 ,M2 ,K2=2 -2 ,_2 ,[2 ,2 ,2 -3> 3)>3  *3[53M=X3}=x3O3@>3H 3}>3x 3 -3=3 -3 ,3 ,4=4 -4 ,4 ,&4 ,*4 ,/4 -84=D4 >U4 b4fq4 -~4=4 -#4 , 4 ,4=4 -#4 ,4 ,4 ,J4 ,F4 -#4=4=4 h 5u5#<450<A5=<Y5G<f5u<s5<5<595+5<5 5M5=6S>6 6j>;6 E6>W6>r6 ,ov6 ,e6 ,6 ,6 ,?6 ,76 -366?6 -E 7 ,e7 ,c76?#7 -E07 ,w47 ,s=7 ,A7 ,F7 -EO7A[7 Al7 y77 -W7?77?78?8 @?8O8+@o8~87A8 8YA8 8pA88 8B@8 -o9 ,Ř9 ,9 ,9 ,9n@+9869 ?N9-?[9]?u999@9@9 9@9@9@:@&: 0:AH:?A`:Au:` :A:A: ,: ,: ,I: ,5: ,ř: ,; ,S; ,K ; ,}; ,w2;7B?; -L;Ba; -n; ,r; ,{;B; -; ,; ,; ,ݚ; ,ٚ; -;lB;B; ;; -; C < -< ,< ,&< C0< -=< , A< ,J< ,;N< ,7S< -\<wEh<Ey< p<<C< -< ,`< ,V< ,< ,< ,Ǜ< ,Û< ,< ,< -< , < ,= ,6= ,.= -=C4= -A= ,ZE= ,XN=CX= -e= ,li= ,hr= ,v= ,{= -=E=E= = =C= -= ,= ,> ,ɜ> ,ǜ> ,ޜ> ,؜>CT> -a>Cv> -&> ,$> ,">C> -&> ,6> ,2> ,e> ,a> -&>E>F> >?C?C.? ,2? ,@? ,D? ,I? Di? -8v?F?F? ,? ,?F?F? ,? ,? ,ɝ? ,ǝ?$F?NF @ @?@CY@ -Hf@zD{@ -Z@ ,ٝ@ ,ם@zD@ -Z@ ,@ ,@ ,@ ,@ -Z@E@E@ @ ADA -l$A ,9(A ,52A)EEA8PA%BhA2BuA?BABAAABAABB(C4BDBWCdB|B!J */J *@=J *RgKJ *fZJ *gAiJ *V wJ * J *\J *rJ *lJ *.J *pJ *1J *MJ *?J *!$K *%`K *.K *np=K *]zLK *<[K *fjK *szyK *ujK *K *vK *vcK *5K *QK *OK *9L *L *L *o.L * =L *>"LL *[L *TTjL *ZyL *1L *A$L *` L *C7L *L *0L *CL *lL *M *?_M *5M *-M **&T *MLT *MhZT *JhT *XvT *T *T *\T *kKT *T *zT *GT *GPT *T *FU *@U *2%U *5'2U *#lVU *5bU *nU *]&{U *gU *sU *]&U *WU * U *B#V *\(V *C5V *r1BV *V *"~V *ѝV *V *TW *G*W *4GW *gdW *qW *EG~W *W *W *W *GW *W *>W *QW *S=W *HX *[4X *x!X *^.X *;X *mNX *AygX *X *lX *X *\X *5X *FUX *Y * Y *I'Y *\4Y *AY * NY *)P[Y *hY *L{Y *rY *Y *~Y *=RY *~Y *eY *Y *&Y *Y *[Z *$Z *?$Z *s2Z *%@Z *NZ *w\Z *jZ *>xZ *q*Z *JZ *tZ *Z *Z *lZ *T! [ *K[ *ϡ)[ *SK8[ *r H[ *GW[ *iBf[ *Ru[ *[ *j[ *&[ *[@[ *S[ *[ *zi[ *!;[ * [ *T \ *E8\ * )\ *8\ *iG\ *OV\ *Ce\ *_t\ *1\ *q\ *t\ *:V\ *k\ *D*\ *~\\ *\ *\ *) ] * -] *͚7] *|F] *]U] *Fd] *X7s] *] *] *"] *] *a] *m] *] *!] *9C] *up^ *v^ *֐/^ *ۋ?^ *?>O^ *ȋ_^ *<o^ *^ *H=^ *^ *o#^ *S^ *i^ *t^ *s;^ *m _ * _ *)P(_ *q7_ *F_ *:vU_ *kd_ *s_ *{_ *_E_ * _ */r_ * _ *_ *Db_ * U_ *#_ *B ` *%?` *m'` * 6` *]E` *~'T` *c` *nr` *N` *v` *` *Jf` *` *d` *G%` *` *H` *< a *ca *v'a *F 6a *ESa *n ba *K!qa *!a *R-a *0-a *Ka *wva *}a *Ƥa * 3a *'6a *f$b *<b *%b *94b *e4Cb *Rb *tab *pb *7^b *pb *b *!b *b *i@b *!tb *mb *!b *y9c * c *<$c *.3c *Bc *+Qc *Y`c *noc *$~c *|c *bc *Гc *`c *_c *Vc *3c *Oc *+d *zd *C#d *2d *zAd *_\Pd *b_d *lnd *"p}d *$d *d *Hd *Mud *Ud *`d *d *iid *e *΄e *~"e * Z1e *{@e *Oe *8_e *ne *nR}e *e *We *e *te *:e *,e *Oe *9e *xf *f *"f *72f *rAf *áPf **c_f *jnf *3}f *oVf *f *Vf *Ff *Rf *3f *Y{f *d(f *, g *d!g *?"g *x1g *C@g *Og *^g *LQmg *=|g * g *a<g *g *g *Zg *Vg *4ug *ih *h *$R"h *1h *ץ@h *iOh **^h *mh *A|h *]h *9h *Ph *c h *h *;h *(h *,\h *5 i *>i *+&i *'Ei *mRi *IDfi *%{i *Si *(i *Ni *Li *zUi *oi *; j *Kj *TAj *S3j *!j *m7'j *9-j *3j *k9j *wW?j *qEj *d3Kj *@]Qj *"Wj *]j *^cj *ij *ڤoj *Ruj *|_{j *Xpj *j'j *j *:rj *Y-j *j * j *j *\j *G-j *aqj *^j *mUk *F k *~k *P:(k *sDk *\Pk *x]k *G)jk *4k *Xk * k *k *jLk *k * k *Ok **l *l *\e"l *:/l *`Kl *57Wl *Zdl *ޛql *?~l *]l *`l *?l *]l *l *5l *b'l *2E m *ym *<%m *?2m *]@m */:Sm *a_m *~gkm *xm *tm *m *@\m *Im *n *ٙDn *u`n *nn *5|n *n **n *||n *o *ٙo *Ko *Uo *p *Y!p *&,.p *Q;p *QIp *5}p *-,p *Qp *Zp *p *Ap *&$p *kq *dBq *Nq *&(\q *&(kq *#q *jq *Mrq *q *?*q *q *u  r *or *f%r *D2r *[?r *8Mr *E[r *5ir *R-xr *r *r *&kr *r *?Ur *sr * s *s *8,s *:s *r}Hs *MVs *ds *ts * s *s *}Cs *.ks *Cs *Wt *t *D(t *)ft *Sut *Nzt *t *8t *8t *at *Mt *t *pt *ڀt *lu *u *m'u *4u *7 Gu *XnUu * cu *u *eu *uv *4v *dv *ͣv *v *XVw *e w *w *}Pw *Uw *ew *w *nw *dSw *Qx *#5x *'4x *tRx *=`x *lnx *y>|x *Vx *xx *x *x *x *x *Nwy *mFy *6 y *dL.y *cMy *\y *bjy *axy *ly *36y *0 y * y *,y *ty *7 y *Nz *Kz *oz *} *b'} *d} *(}} *c=} *D} *#} *p ~ *>~ *0&~ *3~ **@~ *V M~ *SbZ~ *g~ *%U~ *@~ *~ *u~ *~ *O~ *Ȍ~ *~ *V  * *<# *b'0 *= *` *m *Ez *f *R{ *# *L *Y *[ *  *n9 *K *3 *Rh! *F. *>; *".H *: *O *u *tk *VN *JЀ *~݀ *Ą *z *5  *) *e/ *;< * I */V *m *)z *e */ *) *e *JŁ **ҁ * *6 * *_f *(' *)> *)K *_X *~o *|{ * *? *T *7l *҂ *nS *8 *`D *{ *;+ *17 *O *V[ *Rg *s *' * *  *  *4 *,҃ *,ރ *W *k *  *R- *B *8* *_7 *D *BR *FYl *qy * *V *ut *  *NɄ *Mք *?* *V *b *!  *Q *% *&3 *@ *LdM *?Z *tg *Gut *l *M * *Dp *S> *ą *х *RRޅ *\j *   *Jf *k$ *j1 *b? *tL *0Y *}f *:s * *6  *9 * Ć *(҆ *ކ *E *  *% *#q *   *z)5 * B *MhP *s * * *%? * U *#̇ *Mhۇ *$ * *VH *d *T *%   *m * ' *S5 *V Q * U_ *#m *B| * *ʠ *T *ϊ *~È *ڣш *m߈ *6 *u *-  *Y *d& *@4 *68B *ceP *o^ *vKl *W{ *J *F * a *jj *:7‰ *Љ *mމ *B *< *n * *$ *2 *Y@ *< N *\ *8@j *vx *[ *F *> *_ * *0}̊ *6:ڊ *H *Jc *B6 * *! *g<0 *8g> *@M *n[ *]i *JTw *D *w *>~ *Z *T *b7ˋ *Oً * *A *C *3 *^ *w- *)P; *eI *5vW *1z *e *U *  *E *] *=ʌ *w، * * ! *d  *ԁ. *-= *K *"AY *gg *,u */o *nh *n * *- *>͍ *2<ݍ *{H *t *  *m *19- *+< *)X *|6f *t * *7= * *4nʎ *َ *Ȍ *kP *K *  *, *2< *a *o *s *Z * *S *xȏ *")֏ ** *`M *Β * * *k* *#8 *m F *dT *^b *p *]~ *1H *- * *Ȑ *".Ր *r1 *Mh *)  *) * ~# *= *#` *Ym *9z * *G% *e *nΑ *ßۑ * * *Hi *c8 *2 *L) * 6 *NC *QP *] *j *xw *tF *T * *ץ *Ԟ *~Œ *WҒ * *e  *p *38 *ԞE *ץX *{~ *C *r *Bc *V  *̓ *y *< * *5 *. *! *#  *y- * : *.[G *=T *a *An *P{ *x] * *:n *I * *ɔ *֔ *d ** *#W *c *΍ *.( *1f6 *8O *y] *k *y *  *  *  *$[ *K͕ * Uە *# * *se *B *! *%?/ *]= *~'K *}Y * g *Nu *v * *m *+ */# *mcɖ *Yז * n *R *Y *'C * *&+ *r 9 *FG *JnU *c * q *6 *  *ty *> * *ɗ *".֗ *J * * *E  *! *3  * ( *<5 *vEB *O *L\ *Mhi * v *4 *| *a *. * \ *-Ƙ *;Ԙ *  *( *F *Rd *( *H2 *Q *2[ *0]u *- * *]  *K *V  *w *=Ι *ۙ *d *\ *8 *Z * *& *0 *+: *^H *=V *bd *r *dN *׉ *F * *Z *`:˚ *ٚ *: *d *7 *! *P *v- * |; *aX *Qf *%s *Mh * K *Q * *vE *Λ *6~ڛ * *Z *b *@ *3' *".4 *N *x+[ *oi *Cu *% *i *T *^G *< *Mh *?͜ *Vٜ ** *? *] *' *  *( *6 *oC *P *] *el *Ey *\ *W *WB * *ǝ * *P< * *w# *[0 *xxC * O *&p *} * *< *  *\ *k *0M *V * * K *T *6 *)]C * *:w *׈ * *J *Mhğ *џ *gޟ *s% *E *# *k *7# *1 *l *2y *Mh * *l *s% *  *aǠ *^ڠ *' * *- *i! *. *>; *r1H *# U *''b *Mho *4c| *{ *g *s% * *G *ʡ *8ס *r * * *  *3 *& *qn4 *9 B *kP *;ky * *#< *  *+ *ey̢ * * *ey *s *ey+ *s7 *ՏC *[P *'w * *7 *1 *aO *_ *Mˣ *s=ѣ * ף *ݣ * *  *V *Q} *k *u  *  *V ' *4 *@B *@U *Ab *E{ *q" * *  * Ƥ * Ӥ *~ * *& *Y *s! *79 *5F *xo *,| *4 *4 * *Mh *". * ȥ *Rߥ *L *# *$ *  *Mh- *~2: *̎G *T *ta *טo *y *̎ * *b *ec *S Ǧ *Ԧ *vc * *  *z *= *g" *i/ *ˇ< *zI *gV *drc *_p * *0) *} *ϋҧ *ާ *VE *u *u *qa/ *kF *Wa_ *tBl * y * *5 *P * *̨ *J٨ *& *9 *5  * *Z]4 *A *=v * *Q *ZX */Xթ *} *ϋ *k& *[:> *R *qa` *ut *ZX *u  *o *?*Ǫ *ժ *  * *H *  *D; *29 *MkR *Ɗ` *!n *4| * *F *.A *#Z *nͫ *vh *Vk *U# *P5 *׎C *Q *_ *s$m *{ *7$ * *֛ *ߚ *lm *IϬ *m *b * */  * *B) * D *a *Ok *zy * *\ * *Mh *%  *ϭ *ݭ *$ *T8 *V *n  *~> *W *%d *9 *q * *@ *Ʈ *^Ԯ *- * *Υ *o  *J& */ ( *86 *1D *RR *le` *\n *_| * *, *9 *:ׯ *7# *[  *  *' *)J * X *<f *2t *  *f * *5 *@Ȱ *nAְ *e *j *? *' * *{* *R8 *DwF *nsT *Vb * \p *: *" * *n *f *2+ʱ *2ٱ *oQ *x; *v *U *;$ *3 *B *O` *'o *~ *l *  * *9 *`ɲ *ز *ƍ * *" *X *# *~2 *7EA *@P *_ *n *} *p *ݓ *, * *JJȳ *f׳ * *EA *y *<9 *zRC *aM *AW *]+a *(z * *6 *д *<޴ *?* *e *( *. *4 *p: *@ *}F * bL *h]R *,X *_ *f *m *Wt *| *~3 *t *Mt *aY *` *TƵ *Dӵ *Y *5 *j_ *H *= *Ȗ" */ *\I *JV *c *p *j} *i *& *] *1ʶ *)P׶ *{ *~c *c *  *4 *'5 *NC *ţQ *^_ *fs *jz *> *  *i *: *Ljη *S۷ *q *i *cV  *7 *z( *5 *".B *ȌO *)P\ *\ *)G * *E *Ǹ *Y *BO * *b *) *\^7 *E *S *<a *tSo *‡} *h *x  * *I *,ù *ѹ *%J߹ *x *[ *# *0 *p\? *-D *I] *׎j *-w * *j *og *X *  *w˺ *ٺ *E *m- *8׻ *> *:m( *rl. *K4 *1|; *%H *5U *ib *&o * | *ȟ * *μ *adۼ *>a *E *Y` * *x  *tC *j *bw *AP *v6 * *4h *͔ *bŽ *&hҽ *"߽ *m * * *  *4I! *y. *\; *ER *\$^ *Uk *y * *b *k *7$ *x  *J; *,۾ *W *x *%JB *>O *\\ *<i *)Pv *@ *C * *2 * ǿ *!ֿ *=? * * *)2 *+e *@r *  *W *, *2 *6M * * *~ *X *^x *$E *6 *7 * *  *ZO  * *R{$ *\1 *\9 *  *Hs *- *0~ *L * *b *$ *V A *VN *[ *Rh *u * * * y *S= *, *)P *x *5 *$ *-$ *2 *j@ *[N *0~] *Wl *{ * *p *fg *  * *>4 *} *w *> *  *q/ * > *&M *\ *y *L *+ *x *t * **8 *e *,4 *x *I *#I  *m|0 *Ja@ *IP *[` *Uv *y *Mh * *7 * *u? *~X *  *[" *[  *4 *% *S2 *? *vL *:Y *Xf *%v *- *X *H *a *T$ *U *5 *! *^ *` *ym, *: *3H * 4V * d *Kr *c, * *؝ *2* *6 *G * *Ѡ *n *b" *m6 *H *yaN *ZT *sZ * ` *^ g *lx *c~ * *p *V *+w *1 *Mh *vE *  * *bU * */ *L * R! *)0 *L_? *CN *8] *Pl *{ *Q * * * *3 *Mh *< *Y *3 *h  *8 *r- *= *>M *>] *rl *~z *k *` *N * 2 *~9 * A * *o *O# *] *#  *s0 *Ij@ *jP *` *Ap *  *) *E *g *; * *>  ** *k * *_k *? *> *bK *\d *<q *Mh~ *N *0M *~ *  *B * I *ZI *J *b * *  *5q *4 *ȌC *X *Dk| * *, *I *J * * *S *X% *R2 *\? *L *цY *f *ss *H *\9 *Bi *Ř *lH *} *[" *#I *5 *! *w * *lZ( *q8T *da *\{ * *9 *|s *V *܎ * *Bi *Ř *lH *} *5  *! *t$ *= *) *x *\ * * * * *p *'  *i *e# *^x0 *$E *v *\ *t *\9 * *% *!H2 *? *R *"_ *l * *N *" *7 *q *N *@A *#N *o *". *-: *[F *6R *9_ *l *iy *< *Q * *i *ߠ *И *$ *k * *t  *hM- *~; *vH *sU *?|v *Mh *". *c9 *C *)G * *+ *\. *#: *hW *Nc *o *| *Z *  *  *, *H *E *  *+ *$F * *}  *U  *k, *R9 *^ *m *d{ *z *D *] *, *dW *K| *$ *H *+ *K *c *^) *A7 *]E *|S *Oa *1o *;s} * * *E * **n *`F *W * *I *c  * *9!% *3 *)A *O *5] *rk *ez * */ *> *k *D *2p * * *) *4! *y7 *NF * hU * d *HLs *n * * *3( *, *&- *l * *L  *"*  *'{ *S' *O4 *4A *Y *p_h *pv *' *Xi *8 *6y *` * * *T *) *n *$ *sH *O, *Xq: *H *V *6d *Etr *e *? * *f *1 *O *3 *k *bR *>p *~ *s  *s, * q; *vK *`Z *oi *'x *" *A} *G *I * *Y| *iE *S * * *\  *Z=, *; *@J **Y *6h *w *1 *N *  * * *X *u * *; *w$ *XS4 *K: *` *J  ** *47 *jyD *_k *(7 *Z *IV * *Y *KE *)# *>0 *= *GJ *|W *rd *q *vE~ *9 * *  *D *\ *4 *eC *h( * 5 * B *MhP *W%j * } *S7 *o *F, * *L *X *_e *ir * *Zb *w *z *j *e *E( * *  *Tw! *)G4 *5A *dXN *\ *xPp *} *Q * *y *- *9  *k! *\- *{C *9O *e *)Gr *{ *5 *dX * * *R *g *H *v *= *|w, *i>9 *eF *MS *K` *̙z * *D * * *e *wA *o# *0 *(= *lJ *7W *s(d *Ùq *H~ *'f *Z *b' *1 *WP * U *# *O * *d * *y *s1 *d> *.[K *NX *Z) *  *$[ *~ *Jn *! *y *G *Se * *L *y! *3%; *H *u!U *S4b *<p * *O *f *b *d| *A * *& *B5 *_V *Ay *Y *h *i` * * * *". * * *Y  *S *:o_ *jp * ]v *45| *~ *+ *Z * *-" *< *E *} *}} *܂ *ߌ * *ٞ *`  *5 *+# *p0 *u= *N;` *+j * *q *^ * *  *Y *< *| *m? *r  *1V *' *; *I *W *Be *s * * *g * * * *Y *Oo *_ *˞ * ! *^1 *#7 *= *lD *X q *w~ *bl *5 *V *|  * *?e *p *k *U **g * *Ռ" *D/ *>< *I *BV *Bc *Fp *SG} *. *4, *` *r *X *9 *M *J *T *y  *RY *V) *A7 *DoE *QxS *Ea *( *`a *! *- * *  *r *" *"m0 *> *VL *U*Z *( *E * *t< *_# *- *h; *\I *PyW *e *3_s *. *[ * *, *\ *'O *#L *i * *e  *ו *Sr *f* *vM8 *(T *͔b *Mvq *W *{ *a * * *, *< * *+ * *hx *M+ *9 *7G *AU *uc *&q * * *S *` *jb * * *Y * *  *n  *'4, *!9 *[G *|!z *% *B *P *J *y *j *s *( *ޒ *H ** *ǃ" *P0 *T> *PL *cZ *&h * v *l *  *i8 *AK) *mI *( *s  *9[# *&0 *WI *8V * ** * * *Nl *0v *.G * *L * * *T *;! *?/ *= *@K *Y *Gvg *u *YJ * */$ * * *L4 *8 *NI *  *s *$ *! *+ *D *AN *SX *&b *B+l * v *qC *׎ *Mh *T * * *nw *I *b *| *O- *S; *qT *a *ry *Τ *s * *F *s * *ȋ *% * *% *ZK3 *+A *}*O *] *6k *I y *w *6O * *{ *mu *}O *# *x *Y *U *a2 *! *tT/ *M(= *$oK *|5Y *g *u *V *B *} * *  *> *# *w  *-m *  *,' *{JA *(< *D< *@ *}: *o> *g^ *< *c *4 * *v *Ex# *u4 *: *@ *ӟ *U&  *w  *Y  * "  *2.  *C<  *sK  *\W  *c  *o  *_{  *  *U+  *s  *@  *5  *|  *-7  *O  *  *>  *  *#l*  *.Q8  *iDE  *R  *E_  *т  *=Q  *,  *  *O  *yf  *:  *  *)2  *+  *  *h(  *5  *U~  *q^  *I  *'  *L'  *B  *>  *&Y  **,  *:+:  *FhH  *bf  *Ut  *>  *>   *  *2  *?  *   *.` * *** *`7 *@D *=k *V{ *0 * * * *y * * *)2 *+O *JF] *Ák *y *@H * *; *6x *w *' *p *? *( *d *V *y{ * *7 *gl *# *1 *w? *N *Z_X *i * o *U;u *[{ *k *[h * *# * *& * *F *h * *x * * *) *E *t` *t{1 *(lE * O *c *c * s *e* *\ *s *> *& *L * *)P *L *  *~ *- *O: *'Ha *n *7{ * **8 *B *i *Xl *s *5 * *h{ * * *'X( *h5 * SB *sO *v-\ *'i *'H * *# *˕ *\ *8 *z *Ԕ *  *k *& *d *!_r *% *U *s *5 *Q *X * *^ *; *)a *[ *bT * *r *, *(K9 *F *NS *9` *dm *Uuz *= * *P *, * *+ *@N *1 * *!G * H *d! *,: *hM *Z *&g *r t *TT; *+H *4na *I{ *  * Q *P *, *H: *> *)P *q *t  *  *t  *{  *EW  *$  *L! *! *-! *3-! * * *2RK* *'X* *e* *dr* *e* *w* *Y* *%#* *#* *ޏ* *:* ** *W* *Mh* *"+ *^+ * + *n2)+ *vq7+ *E+ *ZS+ *\a+ *fo+ *f}+ *)+ *ff+ *,+ *F+ *n+ *+ *\+ * , *ƛ, *:&, *>3, *4@, *;XM, *Z, *ڡh, *;X, *, *, *k, *, *(, *F, *e- *W5- *%*- *|j7- *aD- *RQ- *w^- *=Dk- *Xo~- *܆- *\- *#- *- *o- *!- *~- *X- *b)- *? . *h. *0P&. *VL4. *JB. *<P. *{^. *l. *-z. *Gm. * F. *|. *b. *F. *:. *;. *. *DX. */ */ *{"/ *ϑ0/ *Q>/ *SL/ */ *0 *0 *M0 *Q0 * @0 *Ӆ0 *_0 *X0 *0 *:1 *x1 *>*1 *+I81 **F1 *fU1 *kb1 *,o1 *F'|1 *V1 *\1 *1 *J1 *51 *1 * 1 *|j1 *%2 * 2 *'2 *7W52 *KC2 *B&Q2 *%{2 *52 *~2 *R2 *7 2 *'X2 *52 *2 *`52 *\3 *Mh3 *"3 **3 *2?83 *5F3 *!T3 *_b3 *q>p3 *`5~3 *jW3 *B3 *4k3 *k3 *u3 *+3 *w3 * 3 *zJ4 *nJ[4 * ja4 *jg4 *Dm4 *\s4 *nz4 *D4 *F4 *~S4 *"j4 *I4 *р4 *~c4 *_ 5 *S5 *5 *œ5 *!5 *}'5 * #-5 *]35 *g95 *G?5 *I"E5 *#K5 *TsQ5 *GW5 *]5 *c5 */ti5 *D^p5 *s|5 *?5 *\5 *SO5 *4n5 *s5 *}5 *&5 *n5 *:5 *s6 *H6 *I,6 *=96 *όF6 *HS6 *5`6 *m6 *UMz6 *7 *{7 *7 *n7 *w8 *'8 *:h$8 * \8 *(q8 *8 *I58 *-U8 *V8 **8 *+I8 *8 *68 *5j 9 *@9 *-U&9 *K49 *@EB9 *WP9 *#^9 *v9 *9 *y9 *9 *a?9 *Q9 *9 *9 * L9 *Y : *V: *z): *?>: *u@J: *{`: *xl: *: *: *: *3: *$: *z$: *: *': *: *? ; *o); *,1; *O=; *eJ; *w]; *G{q; *~; *4n; *M; *` ; *w; *"; *< *< *$#< *L~1< *}?< *M< *{[< *qi< *iw< *9J< *e%< *8< *o< *< *]< *C= *R= *Xo= *'X+= *49= *G= *w> *< > *} > *w> *> */>> *~"> *a> *> *'> *-> *\ ? *X$? *E2? */>S? *>z? *=? *H? *f6 @ *A *A *|A * A *'A * A *B *UB *,B *BB$`B *plBuB *o4B PB *!eB .B *VvB *!SB *=B *a C *%C *~.C *x1JC *mkC *;C *DC *qC *QBC *k5C *C *H D *2LAD *BqbD *_D *kD *D *=3DVDVD *6D V!E ,K%E ,?5E ,9E ,y>E *=IE ,ME ,RE *<dEKVmE -vE *YQE E5VE *F\E -E *sE ,ŸE ,E5VE -E ,ԟE ,ПE ,E ,E -FRV FlVF 1F@F)VIF -YF , ]F ,fF)VoF -|F ,/F ,-F7VF -F ,AF ,?F7VF;VFGVFvVGV8G *BGUdG ,ZhG ,NmG *xG ,|G ,G *UG ,ޠG ,ԠG ,G , G *=G ,bG ,\G *eG ,G ,G ,G ,G *<G -UH *QH *~H ,աH ,ˡ'H*U0H -U=H ,AH ,JH ,NH ,XH -UhH*UqH*UH ,#H ,!H ,4H ,2H6UH -hH *PH HUH *BI -x I *sI ,DI ,B!IU*I -x7I ,V;I ,RDI ,HI ,MI -xVIUbIUsI II UI -EI ,I ,I UI -EI ,I ,IUIUJ ,â J ,JUJU;J ,Ң?J ,ТHJ ,LJ ,ߢUJU^JUtJ ,xJ ,J ,J ,J ,J , JUJUJ ,J ,J ,,J ,*J ,;J ,9J ,LJ ,HJUKU*KU3KUPK ,cTK ,aZK_UrKUKUK *#DK TK ,zK ,pK *=K ,K ,K *e L ,ȣL ,£L , L ,%L *0L , 4L ,9L *<BL -KL *fWL ( `L=TuL *[L -L *sL=TL -L ,L ,L ,IL ,EL -LTLTL ( MX M -M *)M ,f#M ,d)M -52M *)=M ,uAM ,sGMT\M *)gM ,kM ,uM)T~M -M ,M ,M)TM -M ,M ,MoTM -M ,M ,MoTMoTN ,̤ N ,ʤNoTNoT5N ,ۤ9N ,٤BN ,FN ,KNtTdNTmNTN ,N ,N ,N ,NTNTNTN *uNSN ,)N ,O *=O ,SO ,OO *e#O ,k'O ,g,O *7O ,;O ,@O *<IO -RO *P^O ` gOS|O *u[O -O *sOSO -O ,O ,O ,O ,O -OSOTO ` P PS'P *)2P ,ޥ6P ,ܥV , GVpNPV -ZV ,4^V ,0gV ,ckV ,_pV -yVPV3PV V`VNV *)V ,V ,~V -V *)W , W ,W *Le!W`+W *5W0DWSNdWSNWuNW -W ,W ,W ,ëW ,W>OW -W ,٫W ,׫WYOW -W ,W ,W , X , X ,X ,X ,:X ,0&X|O/X -CX ,tGX ,pPX ,TX ,]X ,aX ,fX -oX ,߬sX ,۬|X ,X ,XOXPXxPX - X ,@X ,6X O YqP3Y0Q^YvQYQYu YY *YpKZ , Z ,qZ *VZ ,Z ,"Z *b,Z ,i0Z ,]5Z *U?Z ,CZ ,RZ ,VZ ,̮[Z *=eZ ,4iZ ,.nZ *exZ ,[|Z ,SZ *Z ,Z ,Z *ߖZ ,Z ,Z *[Z ,Z ,Z *4nZ * 3Z *<ZKZ -Z *d[ @ [K&[ *SZ.[ -7[ *sA[ ,ЯE[ ,ίN[KW[ -a[ ,e[ ,ޯn[ ,r[ , w[ -[JM[nM[ @ [[{L[ *)[ ,([ ,&[L\ *)\ ,7\ ,5\ -#\ *P0\  9\KN\ *xZV\ -'_\ *si\ ,Fm\ ,Dv\K\ -'\ ,X\ ,T\ ,\ ,\ -'\xM\M\  \0\K]K1]K:] -I] ,M] ,V] ,Z] ,d]Km] -9|] ,ܰ] ,԰]L] -P] ,] ,](M] -`] ,] ,] ,K] ,E] ,n] ,j] ,] ,]sL^LK^MX^Me^N^ *b~^ *9^ *#^ *Q^ *V^ *3^ *V_ *b_ *.#_ *b0_ *xdM_ *<Y_ *Ve_ *4n}_ *_ *T_0J_ ,_ ,_ *<_ ,ֱ_ ,̱_ *V_ ,_ ,_ *4n_ ,'_ ,!` *` ,E` ,C`yJ-` *!7`PKX` ,V\` ,Ra` *Vk` ,qo` ,mt` *4n~` ,` ,` *` ,` ,`^K` *w` K` ,²` ,` *V` ,ݲa ,ٲa *4na ,a ,a *"a ,&a ,+a1KSa *{]aJ~a ,.a ,*a *Va ,Ia ,Ea *4na ,da ,`a *a ,a ,{aKa *c&aJb ,b ,b *V%b ,)b ,.b *4n8b ,г.f *f +[*f +4*f -f (Nf *Df *f *f *M g *4g *6g *P(g *'6g *w';g *`Ig *Ng *ղgg * sg *g *Bg * g *W"h *!h *mh *'h *6,h *8h *Dh *Ph * \h *shh *k3th *0h *9h * &h *h *8h *h *>h *h *h *h *h *}h *d& i *ni * ##i *2/i *@;i *fGi *Si *V:_i *~ki *2wi *5i *i *i *i *Ji *ri *%i *7i * i *$'j * j *>"j *)/j *Bk *s?k *k *'k *k *k *rl *bl *l *,l *{:l *Hl *8Vl *dl * rl *l *l *l *l *5l *l *nl *[5l *m *"m *~m *-m *8  w *w *@%w *h2w *δ?w *Yw *hqw *9~w *)w *Cw *w *=w *̦w *w *#-x *x *x *h+x *8x *!Ex *:Rx *]_x *lx *yx * x *x *x *! x *'x *8x *x * y *{=>y *BKy *ney *8ry *y *y *y *y *Ny *y *`=y *y *y *< z *6z *&z *4z *.Bz *$%Pz *^z *:2lz *zz *&z *@z *`z *4z *$z *lz *?{ *{ *%{ * 5{ * D{ *SS{ **b{ *H?q{ *{ *{ *,{ *{ *{ * 6{ *{ *{ *{ *-| *7| *o&| *5| *֩D| *tS| *b| *Aq| *| *| *~| *5| *| *| *| *| *| * } *?} *%} *&4} *4C} * R} *a} *D8} *} *6} *A} *} * ?} *>} *} *v4} *=~ * ~ *)'~ *7~ *G~ *W~ *7g~ *.w~ *)~ *~ *)~ *~ *3~ *~ *í~ *}~ * *C *4 *3C *ѸR *Aa *p * * *  *  *& *m * * *" * *S *$ *l3 *B *}Q *` * o *~ *V *b * *  *#ɀ *؀ *  *i *- *6 *I$ *M3 *B *9Q *A` *$Co *u~ *2 * *J *ȁ *Cׁ *! *F *& * *^B" *1 *@ *^O *@^ */m *| *D *8 *=+ *& *ǂ *ւ *: * *þ * *! * 0 *? *EN *] *jl *S{ *Ӻ *k *< *  *Cƃ *Ճ *: *1 * * *  */ *> *M *w\ *Bk *<z * * * *  *Mń *Ԅ *0 * *% *W * *d. *^= *"L *"[ *zj *y *7  *Y+ * *U *Ņ *E$ԅ *t * *u0 * * *a. *= *nL *n[ *;j *z *{ * *i * *' * *", *L,: *H *W.V * o * | *: *f *|  *$ *. *+ *6Ȗ *Ԗ * *XA9 *F *S *` *Cm *q *  * *0% *o/2 *? *IX *e *r *۲ *R *  *Ϙ * * *!6  *" *̹; *K *X *f *Vs * *L *A *W *7˙ * ٙ * *U *( *m% *5 *fE *S *a *+o *, *  *26 *A *ǚ *=՚ *W *`, *L * *WU *Z *d *`=q *~ *C *6 * *m *Λ *Cۛ *\ *  *^@ *  *~* *^87 *D *Q *^ *<k *y *-' *[ * *5 *!͜ *ݜ * *K *! *  * * *-" * *V& *$3 *A *N *4[ *|(h *v * *$ * *% * *˝ *@؝ * *T= *G * *F *) *7 *#G *zM *vT *.a *o *Z| *< * *{ * * * * *$ *  *2% *Y2 **? *;L *[_ *3l *:y *F *< * *8ß *?П *>5ݟ * * *B *( * D5 *C *:O *#\ *<i *Gw *9 * *  *52 *G * *|   * *!& *03 *"? *cL *a *n * *k *ũ *9 *á *С *ݡ *9 * * * *J( *-? *L *{#Y *~p *y} * * * *G'Ţ *Ѣ *ݢ *L *" *R   *4( *L *Y *f *t *[ *5 * * * *ɣ *ߣ *f5 *' * *_ *( *4 *R> *# K *X *Cf *s * *(( *? *  *¤ *Ϥ *+ܤ *[ *h ** *g *}, *:9 *[F *WT *Aa *xn *8{ *' *: * *F * *ʥ *ץ * *b9 *o *  *'@ * ' *4 *fA *.1_ *il * z * *W *u0 * * *ɦ *֦ *e *  * *( *Y4 *wA *O *[ *7h *v *| * *B *Q)ɧ *qA *~. * *l *" *B1 *B *)9H *N *e/T *(Z *Ta * o *} *Y *{ *l *è *}Ҩ *4 *1> * *(  *n *eA' * 5 *D *R *` *!n *)| *U * * *  * © *Iѩ * *a *i *t  * *B& * 4 *#B *VP * ^ *Z l *Az *V *| *k *#: * *Ϊ *\ܪ * *c *Z2 *j< *" *0 *> *L *Z *h *w *' *H * *  *) *ͫ *5۫ *` * *C *; *%! */ *x= *K *Y *g *u *9 * * * *Ь *ڬ *7 *ի ** *k *{  *`. *v.< * P *v * * *G * * *}˭ *Z ٭ *c *  * *= *I# *3 *C *S *.Ac *7 s * *! * *Y *Aʮ *ӭٮ * * *X   *J=/ **> *:X *Ff *Ѩt *ξ *C *G *ů *ٯ * * *N *5 *, *: *H *0V *<d *1r *# * *l * * *ư *԰ * *) */ * * + *o8 *BE *_ * l *y * *R *yñ * б *D *I *6 *7%$ **=1 *?> *8K *=X */e *r *T * * *o *N> * *Ͳ * ڲ *P * *C *R< * *R( *,S *6` *t *S *R< *C *3ճ *= * * *{  *" *6 *9@ *2J *T *@^ *h *v *R * * *m * *,/Ĵ *sѴ *޴ * *^  *f *3 *5 *, *9 *H *W *d *+q *~ *P *? *α *  **ϵ *ݵ *= *.2 * *Y# *l1 *? *f4M *[ *}i *f w * *V *b *9 * *#˶ *ٶ *_ *  * *= * *3- *1 ; *JI *<W *e *>s * * *(. *n  *u  *ǬǷ *sշ *; *# *u * *6 * , *9 *]&L */V *7` *j *bt *~ *j *  *j, *G *B *̸ *ٸ *j *! *S *u * *S* *8 *BF *Z *t *.~ * *U * *˹ *չ *Ⱥ߹ * * *{ *9 *$ *1 *ȸ> * K *^ *Ph *K&r *$?| *= * * * * *ĺ *"Ѻ *'޺ *v *y *Z  *  *d;$ *b1 *1#> *GK *X *e *r * * *& * *B» *л *#ܻ * *  *' * *) *< *I *\ *i * v *C *\ *  * *ż *Ҽ *~߼ * * *B * *b  *- *p: *;H *:U *)b *{=o *4} *  *) *7 * *@3 *8ڽ *9 * *9 * ; *C68 *D *̼] *j *w *' * * *h:ľ *{=Ѿ *:޾ *) *} *  *- *:< *<I *V *c *ާ} *z *ȿ *ֿ *& *+ *; *B  *. *% *u2 *? *(L * [ *j *'x *) * *B * = *5 *u *ɿ * */! *<. **H *qU * h *x9u * *o *R *  *B * *x * *u *? *Y * * *+ */8 *dE *R *_ *m * { *^ *  *C  *߰ * *ޫ *f * *>) *w56 *M *Z *q *} *- * *" *4 * * * *; * *3 *0 *# ** *#: *##@ *"F * L *=S *:` *{m **z *$ *$ *K * * *? * *:  *) *<& *|33 *@@ *M *g *f * * * * * * *B *  * *!% *2 *.? *Y *f *Bs *{ *, * * *d6 * *, *{= *W * *x  *i *' *@4 *A *N *A[ *h *u *% * * *W * *Y *$ *y *) *1$ *: *F *b *u *> * * * */ * *K3 *h *- *Y *9 * F *S *` *z *C *A *ծ *5 * * *y) *)_ *>l * * * * * *t *  *:  *( *) */7 *E *S *a * *U  *( * *i *" *p * * *  *k6 *^ E *%i *C{ *, *c *^* *k *3 */ *, *H9 *V8 *  *B * ) *x7 *E *'S *-a *eo *_ *  *7 *6" * *8 *0 *B *$ * *8# *1 * ? *$X * f *g *  * * * *> *? *?  * *( *:6 *|CD *9 R *U` *Tn *w| *. * * *8 * *k * * *52 *E8 *<Q *_ *9m *9 */ *` * * *ͳ *4 * * * * * *8 *F *T *%b *>p *~ * *a *? * *53 * *i% *  *Ͳ * * *. *8= *3L *r[ *j *y *I6 *t *G *2 *5+ *ު * *V * *4 *+- *< *K *Y/Z *Ci *x * *+ *: *[) *d * *1 * * * *J4 *&, *; *5!J * * *  *R *A * *i *j * *$ *:N *g] *-n *Bt *ýz * *v6 * *a * * *W *; ** *" *. *] *t *@ * *)+ * *& ** *m7 *D *Q *`_ *4l *ܦy *8 * * *( * * * * * *! *. *; *bH */U *b *L * *PA * */% */ * * * *B  *& *F% *2 *M *W *pd *Nr * *  ** * *8 * * *? *4 *Z01 *K *?X *We *N's * *? *w * * *% * * * * *  * *) *B *5a *m m *z * *5 *1 *, *5 *4 * * *8 * *q *# *o3 *^C *i! *)b *^ r * x *~ * * * *2) * *ƨ */= *. *] *% *2 *?? *L *Y *f * * *W * *S *q *) *2 *9 * *) *) 6 **<C *CP *] *k *x *8 *? *T *T *߯ * *W *> */ *  * *% *3 *A * * . *8 *: * *~ *d * * *4 *  */ *%> */L *&Z * . *~ * * * * * *w */ ** *7 * D * * *: *b * *T *a *n *8{ *( * *; *, *, *s9 *G *\a *n *{ * *m4 * *n *Z' * * * * *( *>6 *R *` * n *| * *5 * * *( *6 *ů *v *C *i' *. *x2= *޵L *[ *Bj *y * * *. *R *6 * *] * *w * *>, * ; *c.J *sZ *j *>z * * *' * *Y *B *\C * * A * *, *: *iH *>U *b *@o *| *H * * *| * * *8 * *A *L" *.0 *> *L *Z *h * v *k *} * * *; *G *$B *V; *- *5 * *3 *8>, *> : *pH *l *3 * * * * *] *  *?, * * *G * *Q *B *   *޿ *2B' *5 *=DD *(N *x] *k *z * *r *N * * 2 *A *5 *iC *@A * *B *:+ *y9 *G *W *g *w * *6 *0 * *,C *  * *v *  *J  * *4* *: *]J *Z *>j *Az *S * * *w *) *~ * *7 *p *~> *m *- * < *l=K *g Z *di *$ *j *8 *: *B *v * *,C *% *N  * *# *#0 *p1= *#J *IDW *Id *l~ ** *& *L  * * *n *@ *C *6$ *2 *\o *| *8 *9 *$ *  *< * *( *7 *R6 * *  *i *% *2 *? *L *Z>Y *r *= * *8 *C * *o *2 *, *9 *7  *R6- *: *G *T *a *n *  * *] *8 *. *  *M*, *9 *F *+S *` *m * z * * *8 *! *(. *; *wo *| * *% *  * *% *a *  *9 *' * *% *4 *+ R * i * *H * *+ *o+ * *< *} * *  *F> *]6! *z/ *>= *<K *j *&w * *J * * *B *  */ *j *< *bI *\ *8x * *z *Y *= *  * * *լ *f *+ * *! *. *; *$H *U *Tb * v * *׾ *1 * *m * * * *  * *' *y5 *C *NQ *ʶe *es * *&* * *5 * *. * * * *5D *N   * *k) *7 *=E *?S *Sa *8o *U} * *l( *r * *; * ** * *   *r *]' *_(6 *K%L *[ *!k * * * *~ * *'  *" *l$ *'  *f *# * 0 *Ź= *qJ *W *d *q *~ *z *1 * * * *M * * *7 *$ *}" *'0 *> *# L *#Z *h *qv *l *W$ *@@ * *8 *@ * * * * * * * , *: *iI *X *g *v * *X *A *  * * * *j *  *  ** *+ *N2: *f!I *X *g *v *4 *B * * *  * *  *7 *]  *% *+ *\; *4J *|Y *n *~ *d *#Z *og *t * * ** * * *+ *<E *AR *_ *9m *@z *n- * * * * *  *  *, * *L *8" */ *e *r * *! *B *Y *! *( * 4 **D *J *:P *!W *&a *Z1n *{ * *{= * * * * * *@* * * *6 *9+ *t:8 *_ *l * * * *` *G *0 *? *{= */ *A< *V * l *x * * *N+ * * * * *` *) *;% *"> *gQ *w/[ *gj *Gw * *Y * * *C7 *i% *s *y! *, *6 *"9 *n *6{ * *  * *g *:7 *o *F * *F * *&  *l  *&  *4  * A  *<O  *\  *i  *|  *  *  *o  *N  *t  *  *  *n   *  *)  *#6  *C  *AP  *d]  *tl  *5  *B  *t  *2  *  *s  *P/  *  *G  *5$  *1  *!c  *q  *(  **  *a  **  *  *  *,  *{=  *M!  * .  *w;  *JH  *V  *'  *e   *  *\  *  * @  *  *  *5  *;  *\  *"  *^  *N&  * ,  **2  *8  *W<H  *V  *b  *o  *|  *  *  *  *$  *  *Y3  *x+  *۬  *Z0 **# *< *I *rW *e *=s *" *A *8 * *y& *%A * * *$ * *- *u! *z / *4> *I<a *-m *N} *7 *) *  * * *}  * *a * *OB *t *, * 9 *F *:S *` **n *b{ *T *}< *? * * * *<1 * * * *  * *) *.4= *mK *|Y *g *.5u ** *o  * * *  * *( *y6 *D *5R *` *8n *F | *0 *= *P *3 *fA *4O *4] *mk *y * * * *&6 *| *)3 *P */ *[ *- * *" *2*0 *> *L *3Z *Fh *v *4 * *2 * *Z * */ *9 *C *" *0 *1> *L *1Z *h *Sw *% *6 * * * *n& *2 * *3 * *4 *! * * *o *  *x *  *; *{ * *n *> *t *  * *( *}6 *0D *R *` *!n *)| *- *e *u *" * *  *٨ *5  *u * *J *W *o *| * * * *>< * * *j# *i  * * *r' *l5 *4C *?Q *_ *m *@0{ *ܦ * *m  * *G * *3 *' ** *q# *+ *# *1 *Ω? *K5M *[ *i *2w * *8 *6 * *& *  *  *, *B * *?$ *3 *9A *nO *W] *k *xy *c *. *C * *fB * *  *l *  *3! *)/ *= * K *hq * * *x *>< * *H * * *$8 *S5 *E  *-  *'  *H5  *;.C  *7Q  *^_  *m  *{  *A  *O   *Y  *  *  *|  *:  *! *!! *(! * 7! *A! *U! *Q _! *ui! *s! *! *! *! *! *" *# *9$ *$ *2<' * ( *D",( *G( *o( *v( *( *( *:=?) *`* *f * *Wb* *#n* *z* *B* ** *"* ** *ӧ* *D* *3* *9* *>* *i* *d+ *+ *#+ *H+ *PU+ *8|+ *=+ *o+ *+ *, *O;, *B-, *_G, *,;n, *, *=, *, *7, *> , *, *, *, *O- * *- *7- *Q- *7j- *8x- *- *- *- *&- * .- *X*- *1(- *mb. *&s. *y. *I. *t. *0. *W. *. *. *. *. *;. *W/ *9/ *7*/ *=8/ *=F/ *Z/ *V/ */ *w/ *(/ * / *Ǵ/ *N1/ *0 *2#0 *>)0 *f8/0 *@0 *[#P0 *|0 *0 *0 *&0 * .0 *1 *1 *!1 *01 *3A1 *!G1 *M1 *~S1 *Z1 *k1 *q1 */w1 *}1 *k1 *J1 *1 *f1 * 1 *61 *_$1 *@'1 *{=1 *2 *2 *2 *2 *|#2 *?)2 *P/2 *M(52 *?<2 *PM2 *nS2 *Y2 *)`2 *q2 **w2 *}2 *j2 *(2 *2 **2 *2 *92 *C 2 *<2 * 3 *)3 *33 *`@3 *8M3 *Z3 *g3 *t3 *"3 *M"3 *3 *N3 *3 *G'3 *{=3 *3 * 4 *4 *f#4 *;4 *E4 *T4 *a4 *s q4 *w4 *}4 *4 *-4 *24 *04 *4 *4 *4 *4 *g5 *5 **5 *75 *8D5 *3Q5 *8q5 *Z{5 *5 *25 *5 * 5 *HB5 *w 6 *j6 *(6 *}96 *J6 *P6 *SV6 *>\6 *c6 *"s6 *y6 *r6 *6 *6 *-6 * 6 *36 *6 *j76 **-6 *7 *@7 *-"7 */7 *.<7 *PI7 *;V7 *c7 *p7 *}7 *7 *87 *7 *7 *I7 *7 *7 *.88 *8 *8 *9 *9 *X  : *]#: *0: *=: *J: *X: *g: *u: *: *: *: *: *!@: *B: *j: *: *; *(; *; *+; *9; *G; *8U; *'d; *s; *j; *I; *; *; *; *; *; *; *٭; *?< * < *Z< *~< *< *B"< **.< *W:< *F< *3R< * `< *B< *< *-< *+< * < *p< *< *= *= *= *`+= *h9= *G= *X U= *c= *]q= *u= **= *H= *C= *tC= *= *h= *= *7= *3= * > *!4)> *G7> *eE> *S> *va> *x2o> *}> *+> *> *> *'> *y> * > *"> *> * ? *R? *+? *;;? *BK? *7[? *k? *5{? *? *? *D? *? *? *#1? *J? *f?? *.@ * @ *>@ *BM@ *+\@ *Bk@ *D{@ *!@ *@ *@ *9@ */@ *@ *@ *'@ * A *lA *+A *9;A *KA *K.[A *[kA * {A *0?A *}A *UA *'A *YA *A *A *+A *- B *8B *z+B *;B *KB *64[B *xkB *{B *1B *_B * B *B *B *B *B *B * -C *C *&C *?5C *'DC *TC *cC *sC *C *˷C *CC *uC **C *ͰC *v C *D *D *^4!D *0D *?D *OD *0^D *smD *|D *uD *D *(D *0D *D *#D *(E *CE *tCE *&E *84E *۷BE *7PE *^E *lE *zE *E *E *E *+E *E *E * E *E *E *! F *MGF **QF * kF *JyF *AF *F *F *F *lG *)zG *BG *G *G *BG */G *G *+G *G *~?G *H *+H *H *+H *6H *I@H *H *I *I *I **I *@I *I *C4I *I *<J *J * J *-7;J *'HJ * K *#K *LK *K *y$K *LK *`L *6L *89L *4(L *5L *iBL *]&OL *\L *iL *9vL *LL *3L *AL *-L *=L *8L *$L *BL *L *L *M *kM *!M *s%/M *#)=M *EKM *B-YM *gM *uM *M *M *'M **!M *CM *8M *-M *89N *NN *N **N *7N * 3DN *S?RN *lN *N * 3N *;N *4N *N *G0N *N *4N *O *!O * .O *E;O *@'HO *UO * hO *$vO *8O *O *=O *S4O *O *O *SO *VO *;O *c3P *P *P *&,,P *:P *YHP *ȻVP *dP *k rP *P *P *~P *P *P *P *W%P *P *SP *:CP * Q */Q *(Q *6Q *Q *e*R *R *fR *R *R *#R *NR *R *R *CR *ͯS *S *"S *0S *?S *6LS *YS **fS *[sS *8S *S *S *S *S *S *S *S *S *{=T *T * -T *M;T *eT *tT *@T *ET *fT *T *T *0T *=T * T *BT *U *gU *"U *0U *>U *LU * ZU *=hU *vU *U *< U *>U *RU *U *@'U *U *X4V *EV *KV *3&QV *WV *]V * dV *4rV *fV *V *,V *V *V *V *`0V *7V *FV *?:W *2 W *W *W *W *#W *>)W *W/W *5W *G;W *zAW *!GW *1MW *"SW *ZW *fW *=sW *8W *W *X W *W *W *W *|1W *W *<%W *W *X *#X **0X *=X *mJX *CWX *dX *3Y *Y *5$Y * Y *޴Y *Z */Z *FZ *[Z *2iZ *&wZ *Z *Z *Z *Z *,Z *Z *?Z *^[ *[ *k[ *,[ *c:[ *H[ *1<`[ *<n[ *'D|[ *[ *[ * ![ *=[ *ç[ *[ *C[ *\ *޸\ *&(\ *4\ *D)J\ *cV\ *&l\ *{=x\ *xA\ *#\ *\ *r\ *6:\ *\ *)\ *w\ *c] *-0] *P'] *! 4] *SG] * [] *.@h] *X ] *] *] *A] *] *{=] *{7] * ^ *^ *)^ *>7^ *E^ *S^ *a^ *o^ *g}^ *^ *? ^ *^ *^ *B^ *E^ * _ *_ *#_ *-1_ *{=a` *kn` *{` *:` *0` *` *` *K` *,` *` *` *` *ta *]a *(a *Ma *sa *a *a *4a *C b *;b *_-ob *Cb *b *b *b *b *b *1c *>c *[Kc *WXc *ec *rc *c *wc *Uc *c *1c *z0c *d *G;%d *xHd *Ud sd *dd *d`d *%d *d * e *e *3e *n"Ee *We * ie *e *X7e * e *Ve *e *"f *$Ef *NJf *uff *6(f *f *f *Pf *8f *Hg *B.&g *2g -VHg ,Lg ,[g ,?_g ,3jg_sg *%g *g g *Ѧg8gE_g -lg ,g ,yg ,g ,g -lg ,͵g ,ǵg ,g ,hj_hj_)h ,-h ,6h ,(:h ,&?ht_`h -wh -h ,7h ,5h ,Jh ,Dh_h_h ,fh ,dh ,uh ,sh_h_i ,i ,'i ,+i ,4i `>i `Vi ,Zi ,ci ,¶gi ,li`i ii *9iYi ,׶i ,϶i *[j ,j , j *X j ,)j ,#j *{=&j ,J*j ,F/j *Hj ,fLj ,bWjZ`jYj)Zj0Zj *jPWj *[j *X k *{=k *h>k WBk *[Pk *X ^k *{=mk *жwkVk *[k *X k *{=k *>kYk ,~k ,zk *[l ,l , l *{=l ,l ,lY3l *8lV^l *[kl *{=l ,ͷl ,˷l *lP^l ,l ,ڷl *[l ,l ,l ,Jl ,@l ,l ,m ,Ӹ m ,˸m -Fm *='m *:1m ,5m ,>m]^Hm -FTm ,Xm ,am ,/em ,-nm ,Arm ,?{m ,Qm ,Om]^m -Fm ,cm ,am ,sm ,qm -Fm]^m]^m ,m ,m ,m ,nv^$n^.n^On_Yn_qn ,un ,n *n -n ,n ,n *[n ,n ,n *X n ,'n ,!n *{=n ,Pn ,Jn ,yn ,sn *%o *o`o *Ѧ#o@-o Ho0ho *qo -o ,o ,o *[o ,o ,o *X o ,ao ,Wo *{=o ,o ,o ,o ,o ,?o ,+o ,"o ,p * p ,p ,p *%"p *.p 7p *ѦCpHMp*Ybp *6ppAYpbYpiYp p0p *p -q ,q ,q *[%q ,)q ,.q *X 8q ,KXq^XqeXr r0+r *n4r ->Ir ,Mr ,Rr *[\r ,O`r ,5er *X or ,ݿsr ,xr *{=r ,r ,r *r ,r , r ,Cr ,5r ,r ,r *%r -r *4r r\s *s - s **s ,.s ,7s\As -Ms ,Qs ,Zs ,H^s ,Dcs -ls]xs]s ss -s *s X s\s *s -s *s ,es ,ct\ t -t ,wt ,s$t ,(t ,-t -6t]Bt6]St X gtrt -v{t *t t[t *t -t *t ,t ,t[t -t ,t ,t ,t ,t -uw] u]u 1ux ,\Bx ,ZLxS[VxS[ox ,ksx ,i|xS[xS[x ,}x ,{xS[xS[x ,x ,xa[x -dx ,x ,ya[y -dy , y ,)ya[3y -d?y ,Cy ,Lya[Vy -dcy ,gy ,py[y[y'\yd\y\y\z]+z>]Czj][z]sz]z]z]z6^z z { *B{@Z5{ ,9{ ,>{ *[H{ ,8L{ ,4Q{ *X [{ ,U_{ ,Od{ *{=n{ ,wr{ ,q{ ,{ ,{ ,{ ,{VZ{ *{Z{ ,{ ,{ *[| ,| ,| , | ,)| ,6-| ,.2| -+;| *=H| *:R| ,^V| ,T_|Zi| -+u| ,y| ,| ,| ,| -+|Z|Z| ,| ,| ,| ,|Z|Z}Z} ,"} ,(}ZK}ZY} *bu} *} *} *} *R} *%} *+} *%} *$~ */~ *W<~ *J~ *~[~ *Wh~ *x~ *~ *7~ *W~ *޼~ *N~ *~ *~ *8~ * *r$ *N? *^ * n *|-{ * * *6 *$ *W *, *W * **, *W: *?> *?K '8P *iU +p4Y +I4]0`m (Ƣt *hw *ƈ *I *Q * *i΀ *n؀ *VN * *u * *O *" *Q0 *N5 *C * *d *ˁ *ف *ށ * *Q * * *A *& *2 *|> *J *MV *i *6p *u *Ď *; *D *ɭ *z * *JЂ *Ղ *\R *C *O *CJ *@ *j *) *5 *&ZA *FM *i_Y *mLe *Zq *} *`Y *  * * à *Rσ *dv܃ *֫ * *zm *d *H]) *֫6 *ݴ^ * Lk *֫x *RX *^Ʉ *qׄ * * *1X *E *߻ *+ *79 *֫G *U *9c *q * *jy * *eM *#Y\ *k *z * *K *( *b *΋ʼn *ԉ *T *H * *L~ *5L *v` *u * *it * \ *Ί *cg܊ * * * *| * *ף *P, *u9 *@F *‹S * f` *pm *6Uz *ȥ * *RX * *fD΋ *?m܋ *E *p *o  *֫ **a& *}3 *wS * E] *j *~ * * *ˌ *N، *o *# * *e  *5 *( *{e7 *6UT *)d *j *rp *uv *ʇ} *Υ *kD *t * *=ˍ *f؍ *KT * *b  * *g$ *V *-c *6U *p * *7 *ǎ *Վ *,F *R *v *Eq  *s *"i) *Q7 * uE *S *a *]o *'} * *h *n *u *Ï *я *gߏ * * *d  * *% *%3 *#A *O *n] *%{k *n *c *  *p *ɐ *;b֐ *Q *֫ *;b *0" *RXF *dUS *[` *lOm *fDz *6U *] *Z *y‘ *_ϑ *bxܑ * *o *I *. *(T *ʦ0 *ܱI *(Tc *v * * *p * *O * *D  * *6U# *I0 *= * VJ *] *ol *4z *\ * * * *6U *sbΓ *ܓ *ȿ *x` *Y *˫ *" *I0 *L> *L *yZ *Sfh * * *[ *Zϔ *ޔ *\] * *  *L *&F* *9 *m}H *W *+f *ǣu *b *c{ *- *3 * *vϕ *UGޕ *X *as *5  *R *J) *J8 *:G *(V *gme *jt * * * *&f *E */ZΖ *ݖ *d *h *L *Q( *7 *rF *rU *d *s *^ * * * * *]ї *=~ *s * * *! *Ny1 *A *Q * *MWK *TX *r * * * *O * *Ʒ *@cӷ * *6U * * *]* * 8 *o_K *i *зu *{ * H *t *x * *zĸ *Ѹ *P޸ *i *T- *s9 *_E *qV *@b *s * * *X *zp *d * ҹ *v߹ *DG * *$X *d * * *A *dN * [ *Lh *SZu * *iq * * *gdʺ *e *d *" * *c *S* *z6 *"B *4X *u *ٍ *!t *J * *Xλ *ڻ *R * *"  *6S *b, *9 *GF *FS *oa *hu *h *I * *G * * I * *x *4T *n * *#* *[7 *MD *ʄQ *bN^ *k *6Ux * *f *} * * *i *T *w *N *9O  *" *yG) *[7 *MS *va *o *l} *~_ * *̞ *} * *4z *̖ *Pc * *AH  * *% *wU3 *A *gO *_] *k *y *  *T *$ *+~ * *b *&F *P *] * *%J *q! *l/ *= *yQ *'U^ *k *ix * * * * *] *G *\ *w *` * * *u  *F *p% *82 *E *DT *^ *ih *vv *G *A *w * *WX * *S *Pn * *i! *W+ *I5 *B * FO *\ *xp *Y} *U * *s *8 * * * *g *K * x *ś *T *N *1* *7 *SI *BV *cuc *Fp *u} * *r *] *R * * *5 * *a *u * *( *IO5 *`G *[\ *߶h *,Ru * * *{ *qo *i *7 *cg * * ~ *a *E *~+ *t8 *wE *uR *z` *Vl *ey *z * * *RX *O * * *4 * *W *_  *& *03 *[}@ *M *Z *b *4w *Y *ͯ *U * *\ *a *R *O ** *RX8 *E *R *y * * * * *mE * *6U *" *D/ *ZO< *I *uW *d *Ơq *Qa~ * *_ * *5r * *# *N  *u *% *2 *Qa? *\L */Y *l *y * *Vi * *m *+y *?m *G *c *u *̜ *a *Ơ( *Qa5 *OB *ڂO *[\ *!si *v *' *M *P *9o *6V * *F * *8  *N! *w- *.IC *mgP *] *t * * *b * * * * * * *s$ *O1 *K> *tL *\ *xb *Hh *Yn *Pu *sH * * * * * * F * *{ *{ *| *i  *h^ *D; *SIH *U *RXb *o *| *R * *֫ *r *M *p *h  * *# *+M0 *u= *iJ *GW *,n *{ *- *` *6U *u *:n * *B *i * *W * *O" *h< *I *GV *Oc * p *4} *3I * *x *c *  *8 * * *  *V *N *e, *Q9 * a *m *@ *T *ѭ * * * *x} *8H * *!q) *j@ *RM *[ *h *b * *p *6U * *7 *i * L *,' *ŒM *d *Qr *  * *^u *6U * *T *Œ *}\ *= *!fV *d *]r * *P *q *?v *m *J *  * ] *o  *C *W' *O|@ *N *˧\ * *S *¿ *p * *O * *Q` *TT  *` *& *f4 *^B *rP *^ *r * *,L * * *} *M *2W *c *Ѽ *IO *% *3 *uB *-\P *V^ *YTl *`z *ps * * *& *AL * *t *. *]8 *H[F *]T *~b *uip *~ * *! *(b *F *s *; *K *Ş * *  *V *P; *uI *Te *_ * *G *x * *E *w *?n *H *P *8 *qF *T *||b *$p *ǣ~ *L *c *HL * * * *) * * *T  *^ * ) *8 *OG *gV *me *t *sv *; *r *v *.O *h *E *pY *  * *.H( *W7 *tF *HU *d *s *6U *^ * *7 *L *! *{ * * *T  *} * ' *h6 * PE *CT *ic *ar *f| *л *v * *] *| *Hg *d *P *q, *6U\ *wj *!f * * *_P *Z * * * * * *h * *s */ * * *n *?" * / *̓< *I *V *{c *p *p} * * *x * *kD * * *6U *0 *  * *a' *2M *UZ *g *Tt *( *k[ * * *D *Չ * *M *ӿ *$ *+y *G* *ۢ7 *uQ *4^ *Fk *x * * *r *C *{D *i * * * *? *6U+ *J *W *w *, *] *h * * *] * *w *ߍ */  *  *,F) *J7 *KE *RS *Qa *o * * * *1P * *$ * * *$ * *# *1 * ? *GM *][ *Ji *̀y *Ci *sg * *@ *o *ކ *ϴ *` *p * *b *UF  * *J *uV^ * k *Қx * *ۙ *V *+G * *U *h * *q! * . *\; *H *U *Nb *^o * | *  *rN *I *- * * * *:` *][ *M  *1P *h% *3 *`A *,FO *] *Rk *ёy * * *H * * * *{ *~, *IO9 *ynH *%W *]f *Lzu *O * *m *5 *{ *G *ۑ *h) *n< * I *V *c *Qp *} * * *r$ *1 *> *\Z *D *tE *  * *t> *kGK *X *5[e *ٶr * *6U *m *IO * F *ڐ * * *R * *6U *7 *bxF *hT *n **| *p *` *i *(T * * *ٶ * *9  *) *L8 *G *EV *e *ot * *S *y *  * *H *a * *uL  *t *g' *I6 *E *T *Fsc *r *o * *ׄ * *  * * * * *R *u. *; *rH *V *zd *r *cI *R^ * *Yp *+ * *wM * *u *s *% *ji2 * @ **L *Z *2`h *+v *+q *] *f *i * *L *o *~o *_H * *Mh * *8, *f: *-H *V *d *r *- *Y^ *u[ * *# * *U *\ *f\ * * *D * *;  *' *ZZ5 *uC *`Q *\_ *m *ŏ{ * *r * * * *ޘ *~ *s * *)  *} *) *8 *G *doU *uc *q *Y *o *B *Q * *> * *y * *  * *+& *4 *mB *tP *.|` *p * *5_ *x *f * *h * *} *| *F *M *o, *: *vH *DV *Id *fs * *@ *\ *z * *{ * * *u * *( *5 *xB *}O *\ *Si *v * * * * *S * *s *A  *@T *h2 *D@ *N *\ *j *x *D *u * * *> *:M *  *  *t  *j*  *q7  *D  *WQ  *R^^  *k  *+qx  *]  *  *6  *  *s  *5  *  *7  *t%  *A2  *&?  *L  *Y  *jf  *qs  *  *W  *+q  *]  *  *:M  *d1  *I>  *K  *X  *:Me  *r  *EW  *٩  *O  *  *5  *  *@  *M  *Z  *g  *tt  *EW  *  *7  *[  *  *^  *[  *  *$  *^0  *<  *H  *ՉT  *a|k  * z  *ƺ  *i  *i  *̕  *r  *a  *  *  * *t# *E= *?K *"Y *|g *``u * * *} *R *d *R *֫ *ݴ *u *i) *t; *~Y *? *zV * * *_ * * * *r  * *IH& *3J3 *lh@ *M *Z *kHg *gt * *] *h *]\ * *L *[ *RU *۷  *b *!' *r5 *hC *Q *_ *`m *{ *g * *T *Ǘ *<| * * * *Zm *  *gK *)S) *7 *E *=S *Sa *_o *[} * *b * *A] *M *pe * *p * *  *7L *W1 * z@ *O *^ *=m *| * *e * * * *1 *\ *2 *( *S5 *'B *dO *lh\ *ii *v *V *F *f * * *ϊ *o *& * * *c *" *s0 *ѱ> *L *XZ *Rh *v *e *  * * * *) * * *Pq * * *z *L, *: *mH * V *d *r * *I *Ŷ *I *t * *` * *Ԩ *c *^ *& *5 *D *ZS *b *Sq *m * *AX *F *ix *K *{ *f *[q **P *Em *% *GD *QS *lb *Oq *' * *v *֯ * * *n *F *V *o * *c *[r *d *q * *) *5 * *y * *N *y *i *6U *` *( *5 *GN *[ *h *>pu *i~ * *G *F *u *5a *F  *rn *z *0h */ * *< *GU *y *w *1 *O *Z *W * *#[ * *' *3 *M *Z *'dq *^~ *I *  *? *p *ϒ *S *T * *6 *O< *u *Y *5t * *s * *;t * *? *̳ *p *ϒ* *SA *<] *5k *& *ڃ * *W *3 *xy * *Ԉ *Ԇ *[  *   *J%  *3  *@  *M  *|  *  *  *d  *  *Gr  *Ud  *R! *! *J! **! *@c7! *mE! *3R! *l_! *~_l! *z! *5Y! *! * W! *! *֫! *! *! *! *Q# *6U# *}# *c# *| $ *$ *2$ *?$ *L$ *OZ$ *wQg$ *it$ *$ *kT$ *P$ *i$ *M$ *w% *6% *& % *3% *% *8E% *9.% *b<% *pH% *fU% *ʩb% *o% *Iv% *% *t% *% *x% *% *9J% *% *w & *["& *|z/& *:=& *K& *Y& *m& *jW{& *$& **}& *& *& *W& *٠& *k& *U& *\N& *]' *b' *m$' *+G' *S' *c' *i' *To' *v' *H' *~' *_' *p' *^' *H' *' *( *( *( *,( *>9( *gF( *T( *a( *yn( *_{( *}( *3}( *Q( *i( *[( *h( *?( *K( *( *t) *ˈ) *M#) *m1) *u?) *M) *M[) *|i) *Ww) *) *M) *c) * * *]* *^i* *Z** *E8* *{F* *T* *(b* *p* *~* *7f* *c+ *Ā'+ * 5+ *XwC+ *E_Q+ *[_+ *Em+ *k{+ *+ *E+ *Ř+ *H+ *ԕ+ *fS+ *J+ *+ *+ * , *, *6U$, *I2, *@, *N, *\, *`j, *d, *, *, *Q, *ճ, *, * , *!, *h- *w- *$- *g2- *@- *N- *]- *_k- *?[y- * }- *- *zb- *- *- *- *~- *7- *- *h. *. *6U. *U. *H/ *o^/ *xk/ *y/ *]/ *ha/ *}/ */ *؅/ *p/ *0 *0 *N0 * *0 *80 *fF0 *T0 *b0 *-p0 *r~0 *0 *a0 *\0 *0 *wF0 *s0 *:[1 *f2 *d03 *=3 *U3 *bb3 *{3 *5s3 * 3 *f3 *W3 *3 *K3 *ˮ3 *D3 *T 4 *4 *WL)4 *HZ74 *E4 *vS4 *la4 *kDo4 *{}4 *4 *4 *_V4 *R4 *4 * `4 *'4 *4 *o4 *t 5 *G5 *MG%5 *j35 *`A5 *]O5 * ]5 *7Kv5 *5 *5 *b5 *-g5 *[5 *u~5 *5 *u5 *N5 * 6 *z6 *%'6 *D56 *hC6 *Q6 *_6 *cm6 *6 *6 *6 *6 *6 *%V6 *6 *߸6 *7 *7 *a#7 *YK17 *UW7 *Se7 *gs7 *f7 * 7 *)r7 *Q\7 *7 * 7 *,7 *r7 *7 *Y7 *_ 8 *48 *c)8 *78 *nE8 *YS8 *ߎa8 */do8 *7}8 *p8 **V8 *Z8 *y8 *8 *W8 *I8 *QH9 *9 *'9 *X;9 *3E9 *OO9 *hY9 *ts9 * w9 *(w9 *{9 *l: *Wp; *< *N< *U"? *p? *߼@ *r-@ *U@ *Af@ *Yl@ *Dr@ *%A *3bA *RB *?HB *vTB *n`B *~nB *֫}B *B *rB *bEB *}B *]QB *@gB *B *{B *pB *B *`r C *Ŋ.C *(_;C *bC *~oC *?m|C *6UC *˶C *1C */D *_-D *TD *TpqD *gQ~D *+yD *D * D *ȋD *SD *ZD *D *(E *׋E *h7E *XUPE *^E *hE *)uuE *1PE *mE *5E *E *E *pHF *YF *_F *eF *bckF **crF *}F *+yF *F *fF *%gF *nF *hF *G *G *F\G *T,G *R@G *zyG *AIG *G *?G *G *QG *mG *xG *& H *sH *nH *Q&H *6H *bH *UDoH *1P|H *mH *5H *=H *H *MI *VI *bM'I *-I *Ѱ3I *j9I *uc@I *YQI *zWI *U]I *"cI *hjI *3xI *DI *rI *dI *I *I *I *OI *I *=RI *iI *PvJ *d J *J *J *J *b"J *K3J *]b9J *3N?J *FJ *ΡWJ *B]J *cJ *QjJ *YxJ *ueJ *J *J *.J *%J *jJ * RJ *>K *۫K *Gf&K *3K *@K *yMK *aZK *gK *tK *K *K * VK *K *OK *K *=K *DK *r L *6U!L *Fs+L *~:L *GL *UWL *]L *qcL *EjL *"vL *L *L *L *&L *L *֫L *LiL *cL *=M *6UM **M *7M *WM *saM *ײnM *M *IOM *M *M *M *N *aN *}N *0N *dp6N *JR *]MR *+y[R *iR *wR *HR *5R *R *R *cR *cR *R *R *S *S *S *`n-S *;S *&JS *ŸYS *ExS *uS *ezS *S *S *NrS *zIS *zLS *S *S *ˤT *u9T *~FT *TT *m^T *mT *^dT *xT *T *?ST *{T *HT *_T *bxT *:T *U *IU *w#U *YM1U *H?U *vMU *[U *iU *0wU *ӞU *DU *U *U *@U *qRU *ɅU *`U *V *V *i!V *v/V *[?V *OV *_V *[oV *hV *~V *V *tV *\V *V *V *cV *=hV *`W *mW *O/W *?W *nMW *[W *=}iW *BwW *vW *,W *W *JW *ԌW *W *X *X *΃X *ù/X *n?X *OX *_X * oX *"X *KX *0]X **X *ΗX *]X *=X *X *jX *_Y *_Y */Y *}?Y *~OY *tK_Y *oY *hY *Y *Y *>Y *Y *fY *VY *Y *UY *gZ *,vZ *e/Z *y?Z *ԬOZ *m_Z *oZ *`Z *Z *(NZ *CZ *QoZ *\Z *Z *QQZ *rtZ *X[ *U[ *PJ'[ *T6[ * E[ *Mc[ *Mr[ *M[ *X[ *-o[ *‡[ *}[ *Z[ *X[ *ڒ[ *4\ *|Z\ *Q \ */\ *Lp>\ *\\ *Gk\ *Oz\ *\ *\ *v\ *\ *\ *\ *T\ *j\ *] *+q] *]] *W,] *c:] *B}H] *V] *Ȭd] *r] *:M] *`] *֏] *)] *eV] *] *^ *6^ *+^ *J9^ *vG^ *,FU^ *R_ *]_ *u,_ *G;_ *H_ *ySV_ *d_ *r_ *}_ *[~_ *D_ *]_ *<x` *ŵ` *&` *` *` *l` *^` *O` *ۊ` *j` *s5a *Ba *bha *.a *a *Aa *ާa *Ea *+a *51c *>c *Kc *+Xc *4vc *c *iZc *}c *5c *pc *c *Wcc *c *Nc *ܞ d *d *4&d * _3d *O@d *Md *Zd * gd *td *ud *^d *Vd *tJd **nd *Gd *d *d *d *|d *̟ e *ee *De *hRe *`e *Żne *7|e *e * e *5e *ue *+ye *pe *e **e *e *f *D6f **Cf *Pf *4]f *djf *swf *f *pf *af *f *sf *?f *f *'f *k g *Ig *'g *_5g *`LCg *rQg *]_g *Tmg *;{g *Deg *g *g * g *@g *rg *vg *Bg *Xg *ih *Mh *#h *k1h *?h *Mh *R[h *vih *wh *h *pPh *h *h *h *Vh *h *6Ui *0j *ZUj *ej *kj */{qj *@wj *}j *Lj *MSj *Zj *Lj *+yj *$j *fj *j *j *hj *$c k *Ok *-k * ZEk *Rk *p_k *6Ulk *JJyk *k *ak *Ik *Ok *k *͆k * bk *al *pl *%l *?3l *HBl *Ql *p`l *Iol *pl *ȸl *ul *^l *l *Azl *+ql *]l *l *yl *p m *đm *}'m *15m *Cm *Qm *g_m *mm *G{m *Mm *gm **m *m *m *Sn *n *n *X#n *1n *A?n *Mn *nU[n *(n *n *7n *n *)n *n *n *^n *<n *n *n *@^n *_n *n *n *rn *n *n *n * o *zo *#o *=0o *G=o *֫Po *]o *ajo *wo *#uo *o *o *o *xo *o *o *po *o *?p *KV]q *Tkq *yq *q *Rq *cq *bq *Fq *sdq * r *pr *(r *6r *fDr *$ar *4nr *qr *Tr *{r *r *Yr **r *Zr *_r *s *ws *s *6P-s *pz;s *Is *ls *REs *s *rs *s *Us *zs *}{s *s *Os *Tt *Ot *1t *c=t *`St *X`at * ot *c}t *+t *zt *Qet *Yt *|t *t *?t *t * u *G#u *0u *H=u *Ju *^mu *Ou *u *`u *u *~u *u *u *~u *-v *2v *Ca v *UHv *'Vv *6Udv *2rv *\v *?v *kv *v *pv *v *Ox *Gx *1Fx *+x *8x *>yEx *u^Sx *ax *$ox *b}x *ix *bx *kx *x *>yx *xx *y *'y *TVy *y *qy *y *z *GOz *R\z *,Fsz *Rz *,Fz *Rz *,Fz *dz *Oz *h{ *a { *3q{ *0y'{ *4{ *#L{ *Gz{ *-{ *ئ{{ *{ *{ * { *={ *g{@| *|@9| *sE|N| *ޚ[| *%h| *Su| *l| *|| *|| *z|| *L|`| *΁|`| *w}@ } *_f}  } *-}6} *[V} *Ab{} *!} *վ} *} *K} *Ӥ~ *1~ *W~ *pu~ *~ * ~d~d~ -~ ,~ ,~d~ -~ ,~ , , ,dd. ,2 ,; ,,? ,*H ,?L ,=Ud^dz ,I~ ,G ,\ ,Z ,f ,d ,{ ,wd@ddd , ,&d/dF ,J ,S ,W ,`eie , , , , , ,eè ,Ѐ ,ـ , ݀ , , , ,( ,$e ` /=eGDePDek ,:o ,8xDeDe ,M ,K ,` ,^KeKeҁ ,sց ,q߁ , , , ,KeKe ," ,+ ,/ ,8 ,< ,E ,I ,Nae_ reee , ,ɂe҂e , , ,  , e e# , ' ,0 ,34 ,1= ,FA ,DJeSeo ,Ps ,N| ,c ,a ,m ,k , ,~eÃ҃e *|a , , *O% ,) ,. *8 ,< ,A *OK ,7O ,-^ ,cb ,ag *ύu *DQ * ,o ,k *RPaa *lĄ ,Ȅ ,̈́a?a - , ,?a -% ,) ,0XaLasa *Dp` *ODž *hFх@` *O *h b. ,2 ,7 *OA ,E ,T ,X ,] *Gqjb~nbnb , , Cbцjbb * Jb( ,', ,1 *O; ,O? ,GD *N ,R ,oW *Oa ,e ,t ,x ,} *ύ * , ,@c * - *ˇ ԇ*c *| - * ,  ,*c -& ,#* ,3 ,H7 ,D< -EzcQcb v c7cɈtcc  *E`5 ,]9 ,Y> *OH ,rL ,nQ *G[ ,_ ,d *On ,r , , , *``͉aۉ *b ,  , *O , ," *G, , 0 ,5 *O? ,,C ,&Ibr *x}c ,U ,E ,Ê ,Ȋ *wҊ ,֊ ,ۊ *Jd - *e ,  , - * % .cC *ʔL -U *fco -z ,~ , , ,  -{dd ɋxڋYd *e ,! ,cc, ,+0 ,)9 ,5= ,3F ,HJ ,FS ,TW ,P` ,kd ,ei d@dd ,Č ,͌ ,ь ,ڌ ,ތ , , ,Fd c: *R *2n *Zz *O *V *uI *܍ *ٝ *G *  *_$ *1 *bH *T *֫b *l *V * *֫ *  *ʎ * U * * *  * 'B *" +>& +=* -6 (= *^ *"j *dv *: *i *; *  * *z\ *= *:Ǐ *mߏ *> *? *w *A  *gWy * * *7 *k *7; *P *a8Ȑ *Ԑ *O *8h * * * [ *f *m/ *|46 *!s; *(G *TS *+_ *4Hk **w *g[ *S *X * *|u *zN *ˑ *Ioב *I *ag *j * * *H *+ *-7 *ZC *X *Uf *'\{ *U *xs * *DF *@gǒ *wԒ *Q * *DF *$O$ *1 *DF> *g * *  *0 *[> *Ǔ *qՓ *TV *2 *x *DF  * w *_t) *Q7 *--E *S *a *)o *:} *C: * * * *0Ŕ *9EӔ *? *Q *"D *L  *# *j' *5 *3C *?j` *Co *BM~ *+ *y: *XM *= *Xɕ *rIؕ *p7 *y  *z& * $$ *3 *vB *YSQ *7g` *ro *~ * *( *./ *0 *ɖ *ؖ *  *f *m * *]?# *u2 *3A *\P *S_ *n *} *b *x *J *E *3ȗ *Bח *} *g * * *" *l1 *DP@ *4aO *^ *x7m *4| *% *c *h *2 *+wט *x *E *F& *TF; *sHH *o * *KJ *. *I *3 * N *˙ * (ٙ *<> * *; *K  *% *& * 3 *@ *@N *-j *x *a * *+ */ *E ˚ *Pך *DF *  *  *K *( *}5 *SjI *BAf *7 *u *T *  */ *qʛ *כ *d *) *f * *oO/ *ZV5 *L ; *BA *!H *@U *o *B| *P *^$ *w * *fȜ *՜ *I * *! *}7. *U *# h *jv *x *K *J * *+ *\ʝ * ؝ * * * *m *N **, *t: *jAH *TV *ld *"r *; * *, *po *h *0ƞ *p Ԟ *k *Bf *+ *.%  *Su *#`( *f6 *K *X *p?| *E  *t * *f *DFȟ * */, * * *a+ *8 *E *h *$bt *S *T *j& * * *  *KΠ *]2۠ * *A *&L *. *S@A *\O *0] *E k *)y *}r *v *ԡ *0 * * *% *a *!( *E7 *brE *QS *&a *qo *l} * *R *wc *'Z *Wâ *gѢ *9Fߢ *[ *u *zJ  *i *% *>3 *tl *H{ *? * *? *  * ǣ *4t֣ *X  * * * *'" *"k1 *,>@ *xO *^ *D(m *Al| *< * * *  * Ǥ *nv֤ * *} *c *i *3! *d0 *D? * HN **] *>l *{ *u0 * *i * *ƥ *Xm *O *1 *v *   *s/ *s> *M *Zi\ *rl *(A| *^ *B *i *C *m̦ *cܦ *^ * *^  *T *, *< *L *4\ *Rl *w{ *&H * *@ *&Ƨ *%է *E *a *@I *> *[  *N/ *u> *'M *XE\ *k *z *6 *{) *] * *kŨ *@Ԩ * *0 *; * *)B *X. *I= *L *9\ *bk *8z * *]T * *n *vũ *wԩ *Z * * * *R- *< *K * Z *\Ii *Px *+w * *  *# *uê *jdҪ *~ *  *m *Q` *[ *2, *?D; *oJ *iY *Xh *w *JG * A * * *« *ѫ *e *S *= *_.  *B *x+ *O: *6I *fX *4g *3v * + *S  *$ * *M *Ь *p߬ *L *V0 *p6  */@ *xC* *9 *keH *W *[Hf *d*u *b4 * *< * *W *Qϭ *.ޭ *GU *m` *J  * *&* *_Y9 *x+H *W *Qef *|u * *$ *f *K *R *pϮ *d ߮ *E *(t *$7  *= ** **9 *(pH * +W *nf *M'u *a *>N *1 *@ * *Dϯ *Kޯ * * *W  *% *>) *!8 *G *dV *uSe *. *A+ *BH *>= *k *&ϰ *eް *ٹ *8 *Y * *% *7K *&>q *vE~ *`U *  * *+ĺ *BҺ *:ߺ *  *'U *e *] *E # *2 *OTA *yxv *> * *) *F *Q *qʻ *` *X *WP *" *Qo *. *!< *_cJ *X *> *# *, *nhԼ * * * *4 *m  *'/ *3M= *sK *Y *9g *5u *! *~W *Ma *S *Ic *Խ *@ *o *K *A *  *c *9 *$l- *] 9 *V *2v * ** *9ſ *Exҿ *P **p *9} *d *Kd *' *K& *  *  *s  * *>@& *4 *+S *b *7kq * *L *" *3J * * *S! *7 *\v *6! *5/ *>@= * Y *gi *]y *K *H *K *# *  *;T *a *AL *Hk *\v *k* *8 *F *aa[ *#h *wu *6 * *" *br * * *$l  * *E$ * >1 *x> *.X *8Cf *8us *U *# *rm * *) */ *q * *0\ * **O *j *#'0 *S@ *F *$L *VR *X *'4_ *hd *=Wq *  *7 *Y * *# *i *] * * *g! *5 *Z * P  *. *u; * PH *VrV *T*c *bq * *8 * P * * * *YC *b * *q *w * *-6 *  *)G *:T *a *tn *Yg *$ *_ *p *_+ *g *o * *q * *m& *t3 *"j@ *7NN *Na *! *%R *x * * *  *q *; *n *= * *gC *$O *H[ *>l *a#x * *[e *W *M *  * *r9 * * *n *{& *3 *r9@ *nW *d *r9q *I~ * *}b *  *zX *9 *R *~ * *z3 *J\( *O4 *@ *L *1)X *?n *i *' *s *v *N * *j * ** *'  *, *B *JjO */\ * i * w * * *H, *}> * * * *  *+] *t *  *-% *D2 *`? *_+Y *Gg *<t *# *" *  *_+ *6 * *z& * *\ *vo *F8 * *G  *UH- *!: *"G *`nU *Cb *o *u} * *& *= *e *9 *d> * > *5 *Qe */ *P *5, *9 *JF *fp *} * * * * * *bD * *G * *;  *T^, *KvO *pc[ *ki *{)w *] *; *K *'n *r *Ad * ] *9 *@ * *p( *  *{) *]& *5 *iC *3sQ *)_ *]m *Q| *?v *RA *d  *H *v *3. *8 *  *  *9  * C *{ % *?,4 *C *Q *4_ *=m * { *Rw *@ *X * *A *jU *dv * *. *P *o *# *I1 *0? *M *u[ *'gi *Uqw *P * *G *D7 *  * * * *: *U *A *1" *(0 *j> *zJL *#QZ *M/h *J)v *  *$ * *M *- * *h2 *n *% *k9 *;I *3 *k9= *D*K *Y *g *1u *( *zJ *hc * *8 *T * * *k *H;  *[. *B< *;J *AX *f *rv * * * *H *v *i@ * *V *o *  *&- *< *f *t *A *Lr *_ *R% *  * * *x * *@' *DF; *.C *?R *e(v *kK * *| *k" *e *p *f *7R *| *# *7  *v2 *( *\6 *MD *^R *c` *R * *+ *; * * *P *Q * *% *V2 *TSE *R *ly *:Z *,r *OS *%m *< *  *k *! * *# *q& *Ps *" *K/ *< *_)I *LV * *K *] *\r *Q~ * */ *`6 *^ *  * *x *. *8C  *7 *' *<4 *(A *zN *=[ *;h *:v *f+ * * *p *o * *}r *i *B *^ * m * * h" *0< */,I *V *nc *op *Yk * *a *I *. *]K *e * *[o& *}r3 *o@ *N *#0[ *d>h *;" *o *q *  * ) * * 1 ** *J8 *[E *R *p_ *;m *cz *; *0 * * *d> *{  *\ *^ *1! *;. * r; *kH *0U *b *_5o *2 *q *_ *B *? *vn *b *+ *Z *  *; *.7$ *N1 *;> *0K *utX *e *%r *~  *E *d * *R *g  * *A *p *d> *>! *7 *C *Y *8f *JLs *s *[j *JL *F *JL *G *b */ *W *i- *m : *0G *l$T *3b *)"r *x *~ *6 * * *"X *6P * ? *r *o * *_ * * *  *! *6/ *QQ *^ *ok *x *q *Ih *u *- *DF *  *4 *K *! *S/ *S9 *F *;S *` *m *#' * ! *c * * *; *7 *a *S *G *zk *5 *a+ *}r8 *6R *_7_ *l *y *p7 *mu * *M * * *[= *Z *M *m; *E *$ *- *B *PO *^w *\f *l *t * *] * * ! *W/ *= *wV *.d *Br *; *> *!Z *x *a *  *a_ *0 *  *. *a< *FnJ *jmX *@f *t *A *6 * *\ *b * *  * *$ *FW *, *0; *beI *;X *f *rt * *| *  *(+ *8B *{Q * *Q  *70 *ED *sN *\ *tj *2x *a *o *3x *dB * *f *$ *c *f *!9 *0 *o3  *. *+Q *f_ *g{ * *q * *n *n *A *  *< *$ *e2 *piN *J \ * Uj *x *9 *,> *> * * *s * ' *)J *F *t *00 *h! *0 *lZ? *BN *e] *l *{ *% * *iI *) *= * *_k * * *jg  *I`/ *> *@M *\ *4k *iz *` * * *5d *x *Q *M * *n *^^ * *C. *f= *L *[ *Oj *.iy *[ * *EV *{ *& *5 * * *o *. * B *r *N *  *8 *b * *X *C *k *P *5 *_1 * *kR *|p *_ *#W *~c * + *G8 *vGE *-R *=`_ *)l *y * . *#  *D3 * *  *i * *0 *  *  *] * ># *9=0 *= *~1c *p *%} *z *x7 * *^d *U *^ *# **v *|2 *2Z *OM& *b3 *@ *-=M *g *[t *]( *E *9= ** *&  *nM * * *_ *% *0' *E4 *A *t` *im *6e *M$ *t *6 *Q\ *62 *t *T *4 *' *Z# *_<1 *? *TM *][ *+i *w ** *J *j *}U * *g0 *i * *a *i *i+ * >9 *:G *>-U *c *Jq *T * */ *} * ^ *@ *? *  *O * *E  *5^ * *" *1r/ *c` *t *[8 *5 *t *34 *Y * *G *S *6 *(%* * 7 *TD *;Q *g^ *nk *;x * *[@ *q * * *9 *L *0 *t * * * *- *6; *sI *W *e *s *+ *+ *J ** *c *0 *o *% *5) *B *O *v^ *hm *| * *Z  *d  *  *c  *5  *%  *+2  *g?  *R  *A"_  *Tl  *dy  *}  *,  *CK  *:-  *H :  *oG  *rTT  *p  *e$  *  *7N  *0  *T  *a  *qFn  *{  *Q  *!  *  *6  *  *  **  *Qi  *&  *  *]\(  *5  *KM  *\  *gj  *%  *tK  *E   *  *  *  * >  */  *Q *, *]! *k? *oN *:] *Ul *l\{ *  *Eg *v * *lw *D * * *c * *y!. *= *KL *,G[ *Tj * y *s *  *Uc * *( *RO *$5 * */ ** *yL* *;D *xQ *: ^ *ul *z *, * *  *s *  *du *%( * *I *Z *r,  *+I; *VH *>-V *0b *5p *~ *;* *q  *V *2 *4 *@ * *?  *  *  *  *%& *v4 *ApB *P *i^ *l *Xhz *:s *pA *' * *}h *S5 *&T *F * *  *Q? *@a# * ) *C/ *K+5 *J< *J *;X *f *t *v *) *x *] *! *& *R *&3 * *  *% *f  *v/ *j> * xM *v\ * j *;x *o * *L  *; *7 *)E *R *k * * F *w *d>- *q4; *#I *W *e *Vu *i *BC * *1 *s *v *= *= *R * *^% *(3 *A *lO *] *jsk *Ry *f *? *nr *> * *Y *6 *0  *o *;# *#0 *;"= *wJ *ZW *d *q *_~ *Y **f *X *y *tD * *_ *[ *>! *+ *G *U *c *Oxq *k *' *n- *p' *0 *n *Y *  *q *% *2 *<? *hkL *Y *f * s *( *q  *V *J *\s *. *  *8 *0  *x- *B: *FG *6+T *aa *nn *<{ *hk * * *q  *V *,G * *F *KS *0` *cm *z *P_ * *1D *a *N= *9 *CK *:U * Ib *0o *,G| * * *T *= * *Z * * *Z- *#9 *E *nQ *RD] *#i * *.# *;U * * */ *X  *` *` *= *q+ *&8 *R *<` *Hsn *sk| *? *s *q *G *s" *Q *I *DF *$O *;( *> *P *n *E * *[6 *0 * *; *#  *r  *U  */-  *:  *G  *DT  *a  *3n  *{  *  *:  *Y  *P  *   *G?  *Q  *! *! *0R! *M-! *M;! *1I! *{W! *+e! *0Os! *! *! *! * ! *b! *1! *d! *)_! *O! *j" *W" *dF!" */" *=" *,K" *xY" *Ag" *vu" *o+" *7" *r" *7" *cS" *" *" *[" *o]" *( # *(F# *p# *-# * `D# *BS# *%?b# *q# *C# *b]# *NZ# *# *W# *L# *## *;# *5$ *7!$ *YA;$ *WH$ *YU$ *b$ *Do$ *|$ *@$ *E$ *$ *$ * N$ *($ *$$ *+ $ *e$ *J3 % *C% *'% *<5% *-C% *LQ% *l_% *Ym% *{% * \% *% *NB% *X% *% *$% *D% *qY% *u% * & *nG& *u#& *1& *?& *n:M& *[& **$i& *Sw& *>& *&& *C& *Q& *& *F& *JD& *I& *4& *C ' *' **' *&P9' *H' *UW' *|f' *>Ou' *' *g' *vV' *' *' *' *' *' *' *  ( *( *B)( *U8( *?W( *f( *Zu( *W( *H( *zi( *)( *J( *'( * ( *4) *) *i) * ) *OL) *3* * (* */w* *** *p* *d.* *a* *n* ** *ob* *F* *O* *E+ *+ *!+ *V;+ *aH+ *a+ *n+ *0{+ *l + *+ *<+ *+ *3+ *;+ * , *3 , * , *#C, *, *R, *o, *V, *, *f, *, *7, *}r, *9, *3 - *9=- *$- *46.- *C_:- *LF- *K>`- *lm- *- *go- *- *9J- *E- *E - *,- *. *_%. *e!. *A&-. *}rO. *L. *v. *. *u>. *0. *M. *. *b` / *E/ *M#/ *E 0/ *,=/ *T/ *^p/ *,'~/ *:/ */ *Sd/ */ *aJ/ */ *8/ *"/ * 0 *il0 *lZ+0 *X80 *VF0 *aS0 *l`0 *0 *0C0 *k0 *0 *?0 * 0 *@1 *`l1 *!1 *9/1 *#/<1 *I1 *W1 *>%d1 *{)q1 *]~1 *$1 *1 *q1 *`1 *K1 *DF1 *81 */1 *#1 *'.2 * 82 */R2 *}\2 *Af2 *s2 *K2 *2 *92 *v2 *!2 *L2 *2 *w2 *+2 * 3 *W3 *:3 *,dO3 *S:[3 *6p3 *IO|3 *13 *3 *3 *3 *33 *4 *<.(4 *M<D4 *C4Q4 *a^4 *}rl4 *y4 *4 *T4 *4 *X4 *\4 *B5 * >5 *15 * 5 *t%5 *w+5 */15 *j75 *T5 *a5 *q5 *rPw5 *bP}5 *U5 *_5 *5 *Bq5 *45 *: 5 *5 *"D5 *I5 *6 *T 6 *Y%6 *D16 *&hG6 *`S6 *`6 *6em6 *_z6 *O6 *6 *E6 **6 *QR6 *W6 *6 *0m6 *P7 *|[7 *u$7 *&27 *+;@7 *YN7 *f\7 *j7 *.x7 *B7 *37 *4q7 *b7 *17 *l7 *^7 *@7 *l8 *J!8 *?48 *E B8 *n*O8 *\8 *wi8 *8v8 *D8 *8?8 **8 *:8 *T8 *_8 *8 *8 *hq8 *8 *Y9 *E9 *o 9 *e-9 *:9 *4H9 *EV9 *#-d9 *0r9 *"9 *i9 *(9 *L9 *-9 *j9 *9 *B9 *6K9 *D: *c: *:5q: *: *J: *: *G: *E: *m: *x@: *e: *r: *": *; *; *i; *; *$; *; *; *0; *5L; * *Y> *q["> *g0> *(>> *4L> *D6Z> *fih> *V?? *(.M? *[? *i? *w? * ? *U? */? *2@ *G+@ *9@ *sG@ *U@ *Lc@ *>q@ * G@ *'@ *e@ *R@ *X@ *V@ *^@ *<)@ *}%@ *7@ * A *RA *?'A *5A * bA *F A *rZC *C *GC */C *C *#_C * C *)q&D *p3D *.@D *iXMD *?[D *6IeD *JoD *~D *!D *D *D *#)D *D *eD *D *D *}UD *MI E *E *^&E *gh4E *BE *_PE *pX^E * lE *TzE *SE *E */jE *cE *pE *gE *E *mE *kE *F *F *F *'F *a5F *;QF *SmF *OS{F *SF *SJF *F *6F *OF *$F *z(F *YDF *bxG *!FG *3w*G *F7G *|DG *\G *?SiG *hxG *^G *G *G *G *_ G *]G *JG *)qH *o H *H *J*H *A$8H *8mFH *7jTH *{HbH *z$pH *~H *~KH *6cH *lH *H *TH *(H *H *zBH * H * I *%I **&I *o4I *WI *VfI *I * VI *SI *,I *@I *I *rI *I *#J *1J *NJ *PJ *K *A2L *;EM *7O *J `P *TWP *IP **KP *HP *P *1P *Z *}rMZ *43WZ *hZ *SnZ *tZ */zZ *tZ *;Z *P]Z *tZ *$Z *<Z *Z *Z * <Z *_Z *KZ *Z *]Z *`Z *_[ *N4[ *YN0[ *u?D[ *sqN[ *b[ *7[ *IF[ *2[ *0[ * G[ *J[ *[ *W[ *]W[ *%[ *![ *a \ *J\\ *}r,\ *$9\ *C`\ *m\ * z\ *\ * \ *-\ *=\ *?\ *G\ *[ \ *\ *MN\ *tg ] *e] *,&] *x<3] *'@] *DFM] *8Z] *g] *C] *] *m] *h] *0] *] *M] *g] * ^ *d>^ *w%^ *Tc^ *2q^ *z^ *)^ *F^ * ^ *U&^ *D-^ *^ *2^ *o^ *5^ */^ *(_ *_ *BE_ *g+_ *- 8_ *~lE_ *+bR_ *K__ *8l_ *cHy_ *<_ *_ *h%_ *p_ *_ *_ *K#_ *_ **m_ *=_ *&` *8 ` *+9` *<L` *BmY` *f` *s` *(:b **Gb *A`b *zb *b *%b *%b *gb *b *bb *%b *Eb *b *A c *tc *v c *L.c *Jc *S>Xc *]fc *%tc *=c *.c *]c *0c *\c *(:c *|c *"c *d *6#d *J-d * 7d *Cd *Od *h<[d *hgd *0?ud *;d *y'd *bd *d *Bd *Id *e *S>e *$e *2e *E@e *j&Ne *\e *?je *)xe *Ke *"e *e *W)e *<e *+xe *(e *Fe */9e *If *hf *&"f *i>f *Lf *Zf *hf *:vf *Egf *f *+`f *Tf *-f *RCf *f *@f *Wg *&g *k g *C'0g *%@g *pPg *w`g *pg *g *g *g *?g *g *.g *cg *eg *g *Rth *ch *q5h *&Sh *vbh *`qh *_wh *h *1Th *h *+h *nh *dh *i6h *i *i *K" i *10i *E@i *9Pi *?#`i *=cpi *9i *i *ti *)i *i *i *1i *1i *94j *?Rj *6 j *m0j *K@j *Pj *`j *ipj *Jj *j * j * j *?Gj *Nj *+j *kj *!j *k * bk * ,k *B;k *tJk *Yk *ik *sxk *lk *k *Mk *Xxk *k *7k *wk *@l *[ l *!'l *Bi6l *El *dTl *,dl *:sl *l *0l *"l *z l *]l *8l *Hl *0*l *]m *<#m *+x-m *.;m *0Im *]Wm *<em *sm *q m *Vm *m *m *hm *5/m *3Gm *,Gm *m *m *) n *V"n *\n *_fn *H@n *jLn *vn *n *2n *n *+o *^o *;o *o *(o *o *do *Mo *2`o *o *jt p *Vp *`p *Pp *`p *aCq *#u q *Hq *q *G%q *$2q *Q?q *uq *q *'iq *P0r *pr *D$r *!B2r *SlPr *:]r *|6s *Xs *5s *7s *Ys *5s *t *"t *6n/t * v *,Kv *gXv *?tfv *,v *!v *gv *pv *hv *v *#ev *w9w * w *z(w *=5w *5Bw *6'Ow *C\\w *Siw *B|w *Yw *0w *w *w *7iw *]w *Qw *e-w */w *px *0hx *%$x *E!2x *'a@x *Nx *mN\x *]jx *xx *@x *"x *Ox *6x *Sx *9x *gx *ZZx *,x *y *wy *N y *d.y *} *s} *H} *V} *C\} *} *xMH~ *sY~ *|=_~ *6[e~ *2k~ *0q~ *ABx~ *~ *~ *(~ *=~ *T~ *S~ *x7~ * *" *  *jBdž *Ն *~1 *w *6'  *B *,) *= 7 *bE *}ru *s * *o *{e *u *CĈ *4҈ *a * * *0  *j,$ *2 *u= *_I *Mn *' *#M *<ω * * - *68\ *`b *KȊ *+Պ * *+ * *+ *R *_ *_+l *6y *z *y  *g *T *iOŋ * *f * * *)! *}r4 *A *N *[ * sB| *D *Y- *Ō *X *bQ *1 *9]# *P= *Z] *k *  *J̍ *R; *N *4Y< *-G -v\ ,` ,e * o ,?s ,;ehg - ,c ,Y -Î ,ǎ ,ю#hߎ - , ,gg ," ,3khH ,,L ,*S2 d'{,h - ,; ,9,h,hя ,JՏ ,Hޏ,h,h ,Y ,W ,j ,f4h1?h:?hR ,V ,_ ,c ,lChch * "g *Ð ,ǐ ,͐g *'f  , , *   ,$ ,2 ,6 , @xgI -R *r_ *JSi ,/m ,)vf - ,J ,H ,[ ,Y ,m ,k ,~ ,|fɑ -֑ ,ڑ , , , -f f( ,, ,5 ,9 ,?gbMgk -$w ,{ ,Mg -: , , , ,Mg -PȒ , ̒ ,Ւ ,"ْ ,  ,1 ,/Mg -c ,@  ,> ,O ,M" ,^& ,\, -c5 ,x9 ,t>Ug[Bkkg *c`f , , *“ ,Ɠ ,ړvfff ,  , , ,fA *qJek , o , ,( ," * S ,F ,D *a9 ,Y ,SfД *ڔ ,vޔ ,r f * , ,ee2 ,6 ,@eIeb ,f ,x *  *  * *0Õ *Z͕ە * * *9 *`= *E.f *6 * *: *  *Yϖ *} *6 * *  *6 *( *t7 *lH *6U *sc *bQj *N6{ * *HT *)8 * * Ǘ *'җ *oߗ * *o *R *@g *DF *{j# *n: * G *^ *@gj *DFw *bj *h *o *@g *DF˜ *ۘ *@g *DF 'SL  * +G +G -"$ (+ *L *(X *~b *p *du * *ȣ *b */ * *Q *˙ *י *ن *W * *=e *xk * } *^ *g *c * * * *<̚ *ؚ *̻ *̲ * * *v  *" *' *3 *q? *~yK *W *c *o * * *d *! *C *? * Û *uϛ *ۛ * *q *W *_{  *ٔ *v# */ *; *qP *k^ *s *k *" *v *w * *3̜ *tڜ * *w * *) *w6 *ca *{ *Լ * * *X *x * * * * * *Ɲ *̝ *ҝ *a؝ *-ޝ *^ * * * * * *y * * *W *{! * 0 * > *lL *Z *uh *v *) * ** * * *ʞ *l؞ * *' *W *p *[ *, *Te *t *ސ *E * * * *aϟ *ޟ * { *ĸ *  * ** *+9 *H *W *~f *u * *. *\| * *P *+Ϡ *ޠ * * *  * * ) *8 *G *V *e *t * *` * *n * * ݡ *L *. *h  *c *( *7 *$F *#U *te *@u *m * * * *{ Ţ *fբ * * *| * *m% *U5 *,E *U *e *t * * * *} *_Σ *3ݣ * * *  * *J( *7 *{F *{U */|d *s * * * * * *ͤ *|ܤ *c * *Fy  *A *' *6 *NE *U *d *s * * *( *P  * *ͥ *}ܥ *۶ *} * *& *Ξ5 *D *S *9b *Sq * *{ *\ *Õ *F *˦ *ڦ * *  *0 *0 *x% *b4 *{ C *R *a *p * *% *3 * *J *ʧ *y٧ *  * *k */ *F$ *3 *B *=Q *` *o *[~ * *` *s *p *ɨ * ب * * *> *= *# *a2 *A *=P *8_ *n *} * * *\ * *Iȩ *ש * *L * * *X# *=2 *A *QP *_ *n *} * * *} *= * Ȫ *ت * * *n * *# *2 * A *FP *Z _ *n *} * *ș *~ *Ȓ *&ȫ *׫ *ܴ * * *F *ޮ" *|1 *n@ *QO */^ *} *| * *= *  *Ȭ *A׬ * *o * * *1" *"1 *@ *P *z` *p * * * *h * */̭ *  *v *~ * *+ *Ɨ8 *E *w_ *Ɨw *j *c * *~ *Ϯ *ݮ *E *i *B *z **# *Q1 *@? *wM *[ *i *w *A *+ */ *  * *̯ *ۯ *z *| *E *\ *! */ *E= *K *QY *yg *~u *} * * * *˭Ͱ *ܰ *1 * *r  *O *' *F *U *Yd *s * * * *  * *Vͱ *ܱ * *ʉ *  *{ *N' *|6 *: E *1T *kc *r * * *J * *} *̲ *۲ * * * * *"& *5 *D *S *4b *1 q * * * * *& *.˳ *Yڳ * * *h  *w *% *2 *R *y\ *i *} *Z *! *Ĵ *,Ѵ *޴ * * * *Ξ *$ *1 *h> *nL * * *tϵ *۵ *U * * *w" *E *Q *q_ *qn * *% *Ƕ *-ٶ * *) *  * ** *6_ *m *{{ * * * * *Ϸ *jݷ * *` *  *Q *Dz% *3 *̴A *n *{ * *B *J͸ *( *ε *a *% *  *. *= * K *-Y *g *٩u * *P *T *, *i *ɹ *9 *} *  * *E *Y *n *P{ *[ *7 *(Ǻ *պ * *n * * *D  *; */% *2 *c? *"L *Y *f *)s *& * *c * *1yǻ *ջ *z * *e  *q *[% *{2 *"? *L *M[ *j *) *$ *0 *ި * *, *, *Ay׼ * * * *)  *F# *\0 *7= *J *W * * *) *Ŧ˽ *+ٽ *@ * * *{ *Ň *- *-; *I *W *&e * s * *V *( * *H *&Ǿ *оվ * * * *   *~ *#) *7 *@E *S *<a *}o *} * *H *? *W *rȿ *տ *1y *) *3 *n- *Ӏ9 *rF *ES *Þ` *m *z *& * * * *  *u * *3 *) *K  * *6 *@B *O * \ *i *W | *_ * *W  * * * *g *  * * *W + *<> *ZJ *$V *&c *p * * *y *} */ *K *XY *g * * * *} * *0 *c *) *  *  *}, *E * *> *J *g * *B * * * *B *= * * * *  * *b *y *  *) *L7 *IE *=d *zs * *\ * *z * * * * *  *$ *2 * @ *LN *hj *zz * * * *} *] *K * * * * *- * ; *I *W *@l *y *) * *  *` *  *) * * *' *t5 *]B *w^ *Jj *w * * * *~ * *D *h *( *5 *[B *O *\ *}i *v * * *m *  * * * *H * * *  * *+$ *1 *F? *zK *4X *f *s *@ * *P * * * *  */ *u * *  *x" */ * = *R * _ *m *< * * *{ * *  * * * *{  * *j# *1 *}> *}L *X *^e *s *} *Ľ * *T * *} *` * * * * *" *4/ *$B *}O *@b *Po *| *@ * *P *D *; * * * *ݭ *  * *' *4 *B *N *n[ *h *W v *  *) *M *[ *{ *" * * * *a * *) *A/ *5 *; *yA *H *M *Z *ih *r * *M *9 *p *Y *6 * * * *c * *p * *# *q0 *> *K *{X *)e *zr * */ * * *T * * * *| *  *. *_; *P H *U *{b *) *  *O * * *ߔ * *A * *Z  *ׅ * *U *a *m *~ * * * *f *\ *Y *t * * *=| *C ! *58 *tE *R *C i *tv * *ˁ * *0 *Q *c *$ * *  *h *# *: *^F *R *ڰ^ *xj * *L ** * * * * *k *! *4& *2 *1> *UT *a *|n *q{{ * *= *l * * *| *Ξ *$ ** * * * *7 *D *Q *k *Xy *  * *԰ * *2 *ƍ * *  * *# *  *N *<$ *1 *O *\ *rj *w *@ * *Ɉ *p *ի *) *~ * *7 *#C *Q *_ *m *| * *  * * * *} * *  * *z * * * *+ *9 *=G *uU *=d *r *j * * *9 *P * * *A *R *" *˼  *z *&+ *9 *`G *U *Ec *q *  * * * *7 *! * * *} *  *j  * *d' *5 *yC *Q * _ *m *C{ * * *w *C *Q *t * *7 * *!  * *~& *W4 *B *P *^ *ml *gz * */ *L *u * *  *_ * * *O *% *3 *'~A *ӶO *x] *Ȯk *Wy * *q * *a *} *w *M *t * *$ *2 *@ *)N *@^ *n *?~ * * * *z *J * *  * * *<$ *DN **z\ *k *z *| * * *G{ * *T * * *w# *+ *ސ: *^ *Dh *yv *. * *P *  *- * * * *H * *) * *n, *: *H *~h *u * * *F *n * * * * *9 *F *S * ` * m *z *n *" * *g *K * * *c * * *  * *# * 0 *\= *J *pu * *M * *  * * * *K * *z+ *)D *F|X *P b *l * v *8 * *@ *G * ~ * * */ * * * *  * *' *n4 *PA *)N *X[ *Wj *y *J * * * *B *  *N * *| *3  *) *7 *E *S *a *o *b} * *C * *c * *  *9} * * *s  * *k% *w3 *A *bO *{] *k *ky *d *Z * * { * * *[ *! * *  *. *' *4 *A *N *I[ * n *x *J  *3 *| *J * * *J * * *h{ * *3 * *y* *4 *V> *L *|Z *Jh *·| * *h *= * *  * *. * *~  *X *z% * 2 * F *S *܊` *m * * * * * */ *;  *c *' *p * * *  *, *9 *ES *j` *m * z *  * *] * * *ӊ *6 * *m0 * = *'J *P W *ce *r *r *| *j  *  *F *G *Tz * *)A *O *O\ *oi *D v * *v *D *Ж *6 *b *r *  *9 *+ *ƒ8 *E *R *_ *Жl *y * *' *5 * * *  *  * * *| *h! *. *x; *UH *DU *Жb *o *| *Đ * *% * * *k * *2 * *{ *r *8 *N *0Z *0~p *} * * *$ * *c * * *e * *5 *D *Q *ʄ^ *k *Jy *j * *x} *ێ * *k} *  * * * *4  *z * * * *޲  *8 *ՓF *yi *]~v *4  *c *u * *0 * *w * *ł *, *L9 *G *Q *7^ *k *x *| * *Z * *T *) * * *{ *s * *, *6 *{C *'P *j *w *{ * * * *5~ * * * *Z *e *| *~ *  *ԋ- *E *Z *Jg * * * * * * *z * *) *0}6 *+D * W *n *{ *7 * *0 * * *) * *@ *_3 *I *U *{ * *J * *z *h *) * *1 *? *M *k * *c *a *z * * *Q * * *l *i+ *˥9 *G *U *Yn *| *& * * * *r * * *I *Е* *O8 *F *T * b * p *~ *޺ * *5 * * *H * * *9 *( *6 *^D *ES *a *p *X~ * *T * *_ *c *P *6 *J *! *תI *<] *-g *su *( * *$ *-  * *| * *{ *ĩ * * *[ *E+ *9 *G *Ņj *x * * *R *| *%  *=  *z *# *1 *}? *M *9i *w * * * *+ * *J *Q * *q * * *` *- *< *K *:Z *i *x * *y *S * *F * *ݬ *C * *y *, *; *(J *&}Y *h *w *  *R * *) *k * *@ *\ *l *ı  *  *F+ *: *I *JX *Lg *!v *{ * *l *p * * *d *  * *ٜ *7 *I *] *) * * *! * *t * *! *# * *J  * *Z *& * # ** *1 *19 *ФF *dS *0` *m *z *T *Ƶ *= *Ŧ * *ù * *Y *Ay *E  *6 *)$ *1 *> *8K *yX *~ * *_ * * * * * *y * * *, *': *G *T *Ha *fn *| * * *  *i *s * *= *G *; * *:- *_ *k *فw * * *` *ɹ * *l * *# *2 *L *#% *8 *@F *ET *b *p *' * *y *E *) * *_ * * *D- *; *I *] *(j *w *| *, * *? * *3 *8 * * *G *Qy *, *|9 *_F *Ek *Vx *) *O *u * *+ *( * * *! *(/ *H= *ԭK *0Y *\g *^u *{ * * *Ň *& *V * * *S  *F *) *. *ͺG *T *a *uo *} * *R *| *h * * * * * * * *I *% *`2 *? *L * Y *<{f *s *Q *q * *~ *O * * *| *- *T *a *wn *{ *B * *' *v  * *@ *l *  *~ *~ *e  * *E% *O< *H *U *c *Fq * *z * *{ *@ *Ň *, * *V, *9 *EF *P S *_` *m * *^ *- * *v *5 *| *8 * *O *\ *|i *6v *! *^ * *H *8 * *) *  *Yq *ڧ~ *K  *3 *X * *[z * *E *u *r| * *` * * *) * *^ *z+ *%8 *E *R *_ *l *)y * *` *! *_ *M * *( * *# ** *=8 *G *@V *e *I * *  *z *! * * * *R *)  * *|( *y7 *F *~c *ֽr *U *l * *H *5 *t *~ * * *T  *  ** *-: */J *Y` *Nn * * *̨ * * * *m~ * *j *8 *  *_ *) *6 *C *P * *  *R *Q ** * *v * * * *- * *$ *2 *]@ *W}N *\ *ߝj *x *  * * * * * * *Ɠ *  *>2 *8 *> *VD *<J *Q *_b *h *]yn * t *z * * * * *. * * * * * *  * *) *%8 *G *V *ie *st *J * * *C * *P  * * * *ц *L *N' *[7 *gG *8V *d *rr * * * * *8 *z *Z * * *6 ! *! **! *:! *J! * Z! *j! *x! *ö! *l ! *! *! *~! *! *'! *! *! * " *(" *'5" *EN" *P [" *h" *u" *|" *" *" *" *7" *" *" *" *" *" *# *# *|-# *B# *f# *;p# *# *y# *ܻ# * # *;# *# *v$ *$ *E)$ * 6$ *{C$ *FP$ *j]$ *"j$ *uw$ *$ *$ *$ *׌$ *$ *T$ *$ *$ *$ *$ *% *>% *K% *Ee% *@r% *% *B% *q% *% *, % *% *% *% *׌% *% *& *& *F'& *_& *l& *E& *& *F& *8& *L& *T& *& *M' * ' * ' *Y' *' *E' *' *u' *L' *H( *^( *)( *<( *vI( *V( *r( *~( *v( *K ( *u( *D( *k( *|( *( * ) *u$) *P0) *<) *I) *bV) *c) *Jp) *}) *{z) *) *) * ) *ߕ) *z) *) * * ** *t%* *]2* *w?* *`* *m* ** *|* ** *V* *v* ** *E+ *:$+ *A+ *M+ *Y+ *f+ *ps+ *A}+ */+ *+ *ӹ+ *R+ *c}+ *M+ *Y+ *+ *a+ *, *U, *Ӂ#, * H, *EW, *e, *fs, *l, *, *5, * , *, *C, *, *a, *, *- *]- *F!- */- *=- *K- *Y- *g- *ru- *$- *K- *- *- *- *- *֐- *\- *- *. *. *. *+. *I9. *ʦG. *[U. *_ d. * s. *. *̯. *3. *. *. *<. *. *>. * / *!/ *l0/ *?/ *N/ *]/ *q/ */ *d/ *~/ */ */ */ */ *z/ */ *0 *M0 *?0 *ܥ+0 *{C0 *R0 *`0 *Dn0 *|0 *ͩ0 *0 *e 0 *0 *0 *0 *+0 *f0 *0 *1 * 1 *$1 *O21 *@1 *8N1 *(\1 *oj1 *x1 *1 *1 *>1 *x1 *1 *1 *L1 *1 *1 *~2 *2 *m%2 *k52 *PD2 */S2 *0b2 *+q2 *2 *2 *2 *2 *2 *2 *2 *L2 *R2 *z3 *g3 *%3 *۱43 *DC3 *CR3 *?a3 *p3 *3 *|3 *3 *3 *3 *o3 *C3 *ɬ3 *4 *4 *$$4 *24 *{5 *5 *j!5 *$.5 *9U5 *3o5 *p5 *5 * 5 *5 *5 *=  6 *w6 *"'6 *׃46 *tA6 *N6 *)[6 *h6 *6 *6 *|6 *6 *E6 *6 *7 *$7 *|7 *{,7 *:7 *T7 *{g7 *^7 *;7 *͌7 *7 *7 *P 8 *8 *z8 * %8 *,8 *98 *0F8 *HS8 *'a8 *؏n8 *-{8 *88 *N8 *8 *+8 *8 *J8 *8 *8 * 9 **9 *79 *VJ9 *W9 *d9 *r9 *9 *e9 *9 *'9 *9 *O: *'!: *7: * C: *Y: *-e: *A{: *V: *: *: *: *: *: *: * ; *; *&; *5; *>B; *9O; *\; *6i; *?v; *; *:; *; *_; *p; *; *< *H9< *NF< *IS< *`< *m< *יz< *< *< *< *w< *< *_< *< *< *< *g< *F = *[= *'= *4= *wG= *XT= *a= * n= *= *= *= *= *= *+= *= *> *B> *<> *(> *i7> *Q> *?^> *ْk> *x> *> *> *> *> *> *> *&> *S.? *)D *\D *D *<D *D *"D *zD *D *" D * E *.E *i)E *͛7E *\E *E *E *E *E *0 F *yF *&F * 4F *BF *PF *^F *XlF *azF *F *:F *F *xF *F *)F *~F *`F *F *G *¾G *81G *'?G *0NG *\G *jG *G * G **G *5G *G * G *xG *G *G *H *H *j$H *;2H *@H *NH *\H *BjH *UxH *BH *H */H *yI *EI *)I *I *}I *y J *J *C$J *WJ *eJ *sJ *_J *J *J *J *J *J *`J *J * J *iJ * K *K *)K *27K *EK *ڑSK *aK *O{oK *tK *}L *M *M *M *N * N * &N *$3N * `N *"mN *zN *RN *N *N *[N *N * N *`N *yN *jN *%N * O *AyO *(O *S6O **DO *[RO *`O *!nO *|O *O *YO *O *O *O *T|O *O *O *O *KP *B!P *K +P *p5P *=?P *IP *@SP *aP *oP *P *P * P *P *0P *yP *P *zP * Q *Q *|1Q *>Q *TVQ *dQ *qQ *!~Q *Q *Q *IQ *|Q *_Q *dQ *|R *R *#R *,R * :R *HR *|VR *dR *rR * R *R *XR *R */R *WR *R *Z R *֣R *R *0 S *S *(S *6S *&DS *ďRS *`S *V nS *׌S *S *I}S *S *S *эS *S *S *,T *T *5]T *QkT *T *U *V *V *̃W *Y *Z **Z *}Z *[ *[ *)[ *y[ *[ *\ *]\ *\ *\ *P ] *] *w(] */4] *@] *IzL] *SX] *ee] *ќr] *] *] *] *] *8] *5] *] *E ^ *^ *'^ *)^ *^ * ^ *8^ *^ * ^ *3_ *o)_ *I_ *V_ *~c_ *(q_ *~_ *Ϗ_ *_ *s_ *7_ *!_ *K_ *f  ` *>` *+ ` *F-` *:` *G` *CT` *a` *Ŧ` *a * a *a *˘a *a *9a *Ia *Wa *)ea *sa *a *a *i a *C a *qa *,a *ˇa *$b *K~.b *Gb *Vb *cb *pb *}b *Ӯb *qb *Cb * b *b *Cb * c * yc *F'c *4c *c *c *Pc *(c *}c *nc *c *c *uc *ޘc *ʎc *֯d *d *d *d *'#d *jy1d *?d *Md *\d *Wjd *xd *'d *d *Ed *d *bd *d *ud *d **d *-d *d *̗d *?d *ҷd *1e *e *e *e *#e *1e *?e *Me *"je *~e *e *(e *e *|e *ݛe *Ee *e *e *yf *f *3f *_,f *9f *Ff *Sf *'ff *'sf *df *jyf *f *)f *5f *:f *f *g *g *g *kzg *!g *Fg *qSg *`g *wmg *zg *wg *g * g *dg *)g *- g *Tg *Eh * h *h *.5h *^Ch *rQh *_h *Hh *yh *&h *h *h *Ch *h *Xh *h *i * i *ii *i *>i *]Ki *eXi *ei *dri *i *i *i *i *@i *ֈi *`i *i *& i *+i *j *j *dj * (j *N5j *GMj *Zj *ʼnsj *j * j *yj * |j *tl *l *l *l *|l *l *l *!l *Ul *m *_m *3"m *}0m *x>m *Lm *Zm *_hm *;m *am *m *m *ݫm *m *˔m *Em *mm *dn *z#n *׾2n *NAn *Qn *ln *&vn *~n *n *gn *nn *>n *n *n *^o *o *o *9o *Go *aUo *:co *qo *}o *o *`o *o * o *lo *­o *eo *o *o * p *p *;'p *i5p *yCp *Qp *Bap *}p *yp *p *(p * p *p *gp * p *p *p *jq *q */q *?q *]Oq * _q *oq *Uq *r q *lq *ϝq *Hq *q *+q *gq *q *  r *Xr *'r *7r *Gr *Wr *tr *r *r *r *r *r *r *ir *r *} s *ms */s *?s *Os *_s *dos *s *s *s *s *s *rs *s *s *s *t *Qt */t *?t *Ot *_t * ot *t *t *-t *t *t *>t *t *t *t *au *u * /u *F>u *4Mu *\u *0ku *zu *lu *Yu *du *-u *u *[u *u *u *v *"v *2v *Av * Wv *$fv * uv *Ov *v * v *v *v *ʆv *v *+v * w *|w **w *k9w *Sw *]w *gw *uw *Ew *w *w *w *w *w *׌w * w *]w *x *x *x *F+x *(9x *,Gx *t\x *ax *kx *Vx *?x *x *x * x *{y *Ňy *y *y *|y *y *ty *B z *z *&z *4z *Bz *Pz *{ *.{ *4{ *y:{ *@{ *F{ *M{ *Z{ *Kg{ *zt{ *Q{ * { *| *=| * K| *Y| *9g| *| *| *} *} *} *} * ~ *~ *t%~ *y2~ *ܹ@~ *J~ *]Z~ *`~ */f~ *vl~ *Vr~ *Cx~ *p~~ *$~ *s~ *u~ *5~ *c~ *q~ *5~ *D~ *|~ *~ *  * *Aa *՞o *| *J *~ * *} *z *x *r * *  *M * *- *eA *b *׳p * } * * * *  * *rˀ * ؀ * *m *E *n *M * & *U3 *@ *M *Z *g *u * *D * *R * *nɁ *Nׁ *+ *! * *- *@; *EI *X * e *r * * * *j * *΂ *ty *j *e  * *Q) *6 *O *\ *&v * *  * * *r *ʃ *؃ *E *# *i * *  *d, *m: *H *9 V *d *fr * * *# *6 * *JƄ *Ԅ *A *f *; * *Ӈ *( *(6 *D *R *` *n *_| *Ƌ *m *)K *P * *$ ** *R0 *6 *F< *B *HH *\O *i *v *\ *9 * * * *ȇ *Շ *E *> *7 * *)+ *F8 *E *&R *_ *'s * *8 * *&Lj *ֈ *( * *} * * *. *> *L *Z *h *8v ** * * * *A *ʉ *؉ *. * *z *e * *, *|: *Q * *{ * *Q * *YƊ *ԵԊ * *: * * *` *E *U *[ *a * g *m *s *Qy * *. *ָ * *N * * * * * * *ȋ *˰Ջ *E * * *w * *y) *6 *%D * Q *"^ */x * * *ù *Ŧ *  *ƌ *G ** *-8 *F *T *b *p *y{ * *Xˎ *َ * *= *9 *\ *- *ͧA *V *d *r * *u * * *  *%Џ *ޏ *K *Y * *+ *4z? *aK *{X *=f *u * * */ *r *_ΐ *'ڐ * * */ *ו * . *< *J *X *ښf *} * * *J * *ʑ * *! *} * *, *'S * a *9o *} *w * *s * *~Ò *jђ *–ߒ * * *)# *1 *eM *[ *i *w * *Q *'Ô *|Д *{ݔ * *X *P  *, *F *}S *` *m *z *y * *-̕ * *} *p *) *) *!6 *|Q *^ *Y k *x *  * * * * *)Ɩ * *n **H *vU *Eb *o *Ŧ| *F *C~ *H * * *M *٘  * * *ƚ) *G *P *j * * * *ϙ *։ * * *S pi1 *; ,? ,D *~N ,R ,W *a ,e ,t ,3x ,-} *} ,X ,R *P  ,} ,w *^ * , ,š *̚ ,К ,՚ i *7 , , - *7 , , i3  jR *W kn *~x ,| , * , , *^ , , -6 ,C ,3˛ ,ϛ ,xԛ k *7 , , k *7 , ,& -G9 ,= ,F lO -]_ ,c ,l lu l , , l l ,Ü ,̜ , М ,՜ l #l #l ,7 ,5 ,F ,D) 'lA BlJ -pZ ,U^ ,Sc Jl| Rl Rl ,g ,e Zl Rl؝ el el *7 ,{ ,w l$ *. hE *~O ,S ,X *b ,f ,l h * 0k *~ , , *ʞ ,Ξ ,Ӟ *^ݞ , , - *d * ,* ,$ 9k -( ,E, ,C5 ,W9 ,UB -R 9k[ 9kt ,ix ,g ,{ ,y Vk -& * $1ȟ {kߟ 2 $1 k k , ,) k> kV *[ 0jr *~| , , , , * , , * , , *^ʠ *Ԡ ,/ؠ ,! j Zj ,r ,j Zj& *70 ,4 ,: pjO *7Y ,] ,g ~jp - , , ~j ~j , , ~jġ ~j , , , , j j j0 ,4 ,= ,%A ,#J j^ jw j j ,4 ,2 j jǢ j ,F ,D Wj j j* jB  kQ * \ -g *~q ,hu ,V , , *F ,/ ,% * ,o ,e , ,ƣ *У ,ԣ ,٣ *c ,d ,Z , , *  , , *^ , ,( -n2 *< *7C  L -U *d_ ,Yc ,Sh *r ,v , m - , , , , - , ,Ĥ mͤ m , , ,& ,$ m ~m/ *79 ,:= ,4F ~mO ~mp *;| ` *6y p *;  *6y hϥ lmإ lm ,_ ,] lm m -0 ,p4 ,l= ,A ,J mS -c ,g ,p my m , , m - , ,¦ m˦ m , , m m , ,% m; [ D [ ` ,d ,m ,q ,z t - ,% ,# ,6 ,2 ,R ,L t -ϧ ,qӧ ,oܧ , ,~ , , - , ,  .  E  N  j ,n ,w ,{ ,  - , , , , , ,  ɨ -٨ ,%ݨ ,# ,4 ,2 ,C ,A - ,V ,R  6 5 I 1ma n|   n (n Unѩ  ۩ rn P [  ,  E  r  x *  *v h *~ ,o ,k *! ,% ,4 ,8 ,= *}G ,K ,P *P Z ,^ ,m ,q , v *^ ,/ ,- h *7 ,C ,=  iǫ *7ѫ ,bի ,^۫ h ?i * *F% *B *i *| *z * * *)Ƭ *լ *  * * * * *)* * 8 *ϑI *FW *bg *sx *| *F *  *P  *| *P  *`˭ *׭ *w *$ * *F *]% *1 *w> * F *V *P m *y *w * * *wǮ *RЮ *| * * 'U *H< +lQ +EQ -E ( *sc *h *tv *s@ * *O *#v *r *! *Wwʯ *u#د *ݯ *yy *fX *6^ *Rp *o~ * *s *# *p *SW *S *=˰ *cXװ *lO *ؓ * *צ *@m *, *a& *2 *0> *:J *MV *3b *lu *z *$ * *h * *N *± *@α * ڱ * *+ *  *j1 *! *e" *. **C *Q *f *t * *!I *~ * *? *Ͳ *$/ڲ *~ * * *~) *)T */ *C * *~ *:3 *Pij *τ * *5V *X *y, *hpY *5Dg *iu *v *) * *S *S *ɴ *~״ *. *j *Ŋ *e *K *&+ *N9 *CsG *rV *2Oe *s *- *i *} *Vx *ۊ *|ǵ *?յ *[ * *2 *l *D* *A|9 *@H *vJW *sf *Vu *Bv * * *p *Cж *L_߶ *\ *bG *4 *: ** *.9 *"0H *W *zaf *gu *f& */2 * *D * *Ϸ *Q޷ *w * *k *֔ *q) *$48 *G *)V **e *Ѓt *H *: *i{ ** *4 *;Aθ *PRݸ ** * * *3 *( * p7 *lmF *^U *d *%} *4 *N *7Q *+~ܹ *I *~ * *G9 *-K *]^ *9l */x *l * *O *` *v *! *#tɺ *ֺ *^ *,8 *UC *& *x *Gf4 *)B *P *^ *?l *@ * *T *B *W *ܪĻ *7ѻ *ŝ޻ *a *7 *& *;) *Y/ *E5 **{; *ZB *xO *i *Gv *ɉ *] *8 *% *¼ *4ϼ *ڂܼ *;9 *S *p( *&O *pCb *gp *~ * * * *a$ *Ľ *Cҽ *hF *K; *" *G * *W& *4 *yB *qP *:^ *C[l *#tz *zX *"e *u *¡ *i *3Yξ *ܾ * *T *] *^ *"" *M0 *@E *&R * U_ *!l *y *& * * *K *1_ο * Kۿ *`V *XB * *!k *% *y/ *4H *%b *xu *` *i *C *ib * *  * *i *&" */ *]< *'I *aZ\ *e~k *my * *_ *֪ *Ӥ *& *s4 *W * *2 *Ɵ *~ *Ɣ! */ *= *K *LY *8g * * *i- *+ *\x *8/ *]Y *? *Y *) *[U8 *FPG *Q`V *e *vt *4 *&N *` *  *Pu *H * *9* *E * *Q$ *( *|7 *F *DlU *?d *?}s * *Ic *ew *S8 *Bi *+ *Ȣ *7 *; *3 *c' *j6 *ίE *ET *c *r *0 *_ *ի *y * *p/ *(Q *H| *ܥ * * *K0 *@ *P *+` *Kp * *H1 * * *, *+I *p' *( *] *} *'' *R6 *]wE *T *oc *4Sr *8 *} * *3! *n *,b *1 *P *L *Sy * *i& *P55 *D *zS *,b *'q *  *Zr *ӛ *7q *53 *G *V * * * *\ *{S4 *C *//R *΋a *e;p *C; *yY *n *j *N *&A *D *T2 * *J *F *bB$ *3 *PB *PQ *j` *|o *ܨ~ */ *- *4N *F *y */ *=G *- *bJ *j *)# *92 *fA *zP *_ *n *>o} *j *[m *[l *c *A *\ * : * *Q * *" *#i1 *o@ *xO *{^ *1m *K| *U *m * c *&m *& *?u ** * *o *2g *=! *l0 *F@ *#%O *_^ *fm *d| * *1 *G *": *o] *G * *c * *E *9~" *31 *o@ *OvO *0A^ *~cm *| *c * *` * *, *_6 *Y *H/ *M *ބ *|Q! * 0 *? *^N *K] *2l *J{ *~ *V *(g *c *T *u *, *x_ *n *_! *u0 *8? *N *O] *Kl *YG{ *  * * * *6 * i *- *hL *9 *5& *3 *RG *3\ *`j *5v *5 *w *C * *W4 *# *~ *W4 *d *), *u\9 *UZ\ *bm *z *h *GY *O *PA *x *#E *kG * * *d *= *aA *i *z0 *& *k *~ *b *.` *l *+| *<5 *$ *}* *l;0 *w6 *g= *J *iW *Z;d *}q *`k~ *b *T * *H *~ *i *ք *57 *B? *fL *4Y *(f *)Zv *$| *  *] *8 *& *q * * *D *=g *S *M" *5 *lB *MO *k *x *C *45 *S *6 * *M * *G *m *os *" *,) *ub *io * * *A * * *C *ѝ; *-'I *3x * *A *Yy *b *& * g *9: *^ *^ *C! *@:a *^p *%| *u *O *2 *v *q * *6 *6 *P5 *v[ *}h *Vz *A8 *& *3. *O{ * s *R * * *  *C *e; *9+ *` *vn *| *bb * * ** *F * *+ *Z *V *' *#& *?4 *lQB *vo *Q *d *s *nR *7 *. *l *K *X` *1' *5 *aFC *FQ *Vn_ *Zm *}{ *L * *) *( *Yy * *M * z *" *rh *qu * *B *I+; *U *$ *gc *q *h *Y *bU *qb *̝o *+| *` *_ * C *$B *! *JK *x *K *c8 *G * V *)e *( *3 *E *BT ** *#Z *Pp * *[o *fn *x" *D> *xN *Ӗ^ *:n *%~ *M *[ *X *% *ؚ *O * * *3 *Q *R+ *`@ *Z\M *8Z *[o * *Z *m *& *0 * *F *+~ *|v *# *9= *{K *C] *ǎj *\w *R *& *a *W *ܪ *7 * *T * * *_ * * *V0 *R66 *Ϗ< *8B *lI *'RN *<[ *Ci *Zps *Ȓ *8 *\ * *y *0 *; *7Z *Fn *t * *; *Ʈ% *2 *a@ *bM *K[ *45i *pv * *K *R *&( *{ *K *) *ܪ *8 * *n *- *Hb1 *N> *(K *%X *r *g] * * *d * * *45 *ܪ *& * * *'* *%8 *p1K *UZi *u * * *2G *VY * *(t * *s" *B< *- *U]9 *܁E *AwV *"\b *TXs *; * * *C * 7 *q *cI * * *) * 7 *q* *A * 7N *q[ *vh *,u *] *C * *or *6 *7 *6 *>l * *u *$* *M6 *aB *wX *u *` *F *5R * * * * *# *c *_ *$ *4, *O9 *@F *S *lBa *:u *; *d *v *- *e; *P *E *% * *aP *Yf *)} *љ) *dC *Q *M^ *u\l *~[y *A8 *d *[o ** *L_ *$ * *{ *p *M *Ԁ *g *Q*$ *[1 *e? *|L *KY * g * t *_ *)v * *Zr *v *|v *n *1 *e% * *H *&# *c0 *GZ *g *6u *& *S * * 3 *| * *|7 * *#t *\ *n9 *PE *LS *,ba *1o *#t~ *|2 *, **V *! * *; *Sy * *a * *,b *1 *P *Ȣ- *>; *aI *W *cf *bt *y *D *  *; *f **q *N *E *q *|{ *>Y *d *X- *T; *mI *7vW *De *us *gy *  *NJ *Lz *` * *$$ *g *R * * N * *h) *I'7 *zE *S *Ga *o *G} *}% *o *"D *" * *J *9s *M *mz *~j *pa *( *6 *D *hR *a` *En *\| *' *N *Q * A *,k * *] *q *M *? *q' *b5 *C *sSQ *i_ *sKm *{ *H *. *q * *; *) *N *s *: *z& *Dt4 *mzB *&P *` *+Lp *I *OV * *+ *x *F * *7 *LD *? *& *JP *^ *ym *W| * *^ *yY * *- * *'! *p* *~% *(g- *i-< * a` *yj *7x *8 *[ *} * *Z * *1 *+. *p *:k *& *  *V. *< *؜J *j *B<w *? *#t *7 *7 *‰ * * ) *>+ * *5/ *53< *Ӥc *(p *} *0 * *u *F *@ *gZ * *\ *8_ *[ *  * *IT& *b3 *|*@ *_M */Z *g *dt * *Ӥ *| *+ */ *_ *! *Q. *~; *oH *U *&n *х * * *C * *΋ *1 * * *eh *eK *% * *L^ *3j* *u-7 *zD *WQ * ^ *k *&x *p *8 *2d *o * *-< *Ar * *  *  *֘ *) *7 *S *[ha *Yo *,b} *1 *O *q *P *l *L *i *P5 * * *, *'% *&3 *CyA *:O *1] *ok *fy *y * ` *f *Q * *4 * * *z * * *fD! *g/ *g= *WLQ *&^ *k *B<x *W *, *J * */ *l *- *bJ *TS *j *ZZ *#t  * *B% *J2 *,E *jT *h^ *<h *KIv *- * *YT *p *) *U *#% *@ *i *;! *)+ *5 *XB *O *\ *Jp *v+} *g' *vi *F *h * * * *9 * *J *n *;& *0\ ** *T7 *G%I *'hV *Hc *Ap *ZH} *B *:E */ *$ * *ć *n * *3 *#t *X *^( * 5 *TSG *Ǖ\ *h *#u *g * o *M *A *B< * *9 *{ *P *3 *t *9a+ *"U8 *JE *#tR *M` * dl *8y *M * * *) * * *Z{ *͗ * *@) *  *i& *d3 *4P@ *M *Z *A *J *+ *  *^' *k *~. *3 *` * ** *)8 *hE *vR *Zy *˨ * *X *a * *i *& *1" *o/ * !< *I *#tW *d *sq *a3~ *R *0 *v *D *Y * *^  *#t *% *2 *a3? *.L * nY *kl *y *͘ *; *hx *{ *K *? *\ *4 *#t *o *z *s( *a35 *B *UO *O-\ *Ei *~v * *; * *A *' *9z * *v *w *! *I- *C *9P *X] *'t *` *X * *X * * *zh * *ߢ *E$ *f!1 *-]> *lL *Z\ *+Kb *h *f+n *M"u *  *4 *  *xw * * * *͘ *]N *]N *~O *]S *U0 *V; *H *U *)b *֪o *N| * *f *~ *YE *a *Ȅ *:  * *# *0 *#t= *B<J *-W *_n *Y{ * *2 *& *#t *@ * * *ڀ *b *z) * *" *[o< *oI *V *I!c *pp *x} * * *9K *5 *u * * *s *~ *_( *0  *7, *a9 *a *.m *+S *% *N *m *۬ *m *QP * *X *C) *@ *6$M *d[ *Xh *4 * *C *& *j * *ů * *^' *aeM *6ed *ar * *۬ *H *& *m *% *ae *3. *O{= *A8V *d *.r * *}" *܍ *H *9@ *w * *. *vB  * *+)' *N@ *IgN *z\ *Lt *#w * *ر * *C! *i *a2 *%  *%2 *& *K4 *EB *-yP *uW^ *ryr *|o * * *u *P *6 *( *E] *E *  *i% *B3 *#tB *-P *'^ *%l *2z * F *c *z *\ * *Ҋ *G *}/ *9 *,G *U *qkc *;q * *V *z *D4 *w *oF * * *q *i *3l  * ( *a"< *GJ *f *1 * *- * * *R *XJ *@ * *" *u; *CI *W *LOe *qs *v *k *5 * * *_ *; *$ *ƭ *h *ڠ *0 *Z, *vz; *!J *E9Y *$@h *^w *0I *{ *2b *I *  *G * * + *)  *H *+ *): *NGI *RmX *g *v *& */ * * * * S *dN * *f *&  *R| *w* *:9 *!H *XW *3f *u *O *D *I *_ *9n *O *p9 *6  *7" *]D/ *&_ *Jm *A8 *hq * *" *, *{| *t * *n *#j *: *L *n * *" *^  *{A *% *|2 *tf? *<L *aY *fRf *fs *pC *l *ZV *XK * * *i *W *& * *|v *u * 4* *BjP *4'] *]j *%w * p *!- *> * *c *\ *M *@k *  *M *K *-- *u: *:HT *_a *an *}{ *u *rc *cE *l * *B< * *] *i! *T!! *&.! *M! *Z! *z! *]! *! *[o! *&! *j! *! *q! *J! *`" *|" *t" *," *:" *vH" *a$V" *"d" *Wr" *" *ѣ" *|" *!" *4i" *" *dW" *" * # *# *|v&# *`s4# *eB# *-P# *^# *l# *S|# *;# *aFj$ *$ *x$ **x$ *Y$ *$ *2$ *C$ */$ *4% *% * % *~M% *'a% *pn% *m{% *% *l% *'% *% *% *% *[o & *]& *FD$& *k1& * t>& *TK& *קX& *se& *0r& *x& *& * & *& *V& *Dž& *i& *& *J2& *-& * ' *!' *[o(' *۬6' *%2D' *R' *W`' *a$n' *d|' *' *W' *' *i' *' *] ( *N( *Q/( * <( *@K( *ءZ( *.i( *Lx( *) *e) *I@) *) *N* *-* *d* *:,* * A?* *ZL* *qY* *ef* *"s* *e* *?* *R+ *D'+ *4+ *\A+ *.]+ *&]+ *+ *%+ *i+ * GA, *N, *~[, *,h, *u, *Z, *&, *`o, * , *, *c, *V, *i_, *<$- *2- *&"- *:- * KI- *:W- *]q- *- *C- *2- *+;- *%- *|v- *h- *- *d- *. *,. *;. *WsJ. *fY. *Ah. *;Bw. *. *$. *K. *. *\}. *. * 4. *Μ. *) / *IZ/ *9*/ *9/ *(H/ *qW/ *Ef/ *լu/ *)B/ *5/ *W/ *V/ *$/ *m/ *V/ *h/ *b 0 *0 *#t10 *6>0 *wEK0 *Y0 *+Mg0 *eu0 *0 *?00 *ˬ0 *B0 *o0 *`0 *0 *0 *H0 *e0 *=(1 *;51 *eC1 *UO1 *pn]1 *B2k1 *by1 *C1 */1 *Yk1 *sm1 *:y1 *B1 *A1 *B1 *1 *nY2 *v:2 *!2 *3/2 *48=2 *K2 *GUY2 *]g2 *Eu2 *y2 *F02 *+-2 *2 *m2 *2 *2 *-2 *.2 *w 3 *?3 *3 *d|3 *c#3 *"*3 *,83 *#tF3 *TST3 *.b3 *"p3 *b~3 *3 *3 *Z3 *]_3 *֋3 *k3 *Q3 *FF3 *_^3 *4 *ٯ4 *,4 *C;4 *=J4 *AX4 *#tf4 *t4 *>+4 *A4 *s4 *m#4 *}4 *t4 *4 *L4 *~4 * 5 *v5 *5m)5 *\75 *-@E5 *BGS5 *Nc5 *s5 *{5 *(15 *kj5 *5 *5 *v5 *Vv5 *5 *O6 *ߗ6 *U!6 *cS/6 *ͥ=6 *hIK6 *uY6 *kg6 *8v6 *w6 *y6 *,w6 *M6 *6 *no6 *i6 *7 *#t7 *\7 *Z+7 *87 *œE7 *PR7 *V_7 *"Wl7 *8y7 *7 *7 *#7 *|7 *:%7 *7 *7 *w8 *%8 *+:58 *C8 *sXQ8 *r_8 *m8 *m`{8 *e8 *B`8 *i8 *8 *8 *8 *˪9 *V9 * G 9 *u-9 *P:9 *@VG9 *b)T9 *?0a9 *Vn9 *C{9 */9 *9 *g9 *yg9 *5F9 *q9 *i: *: *G(: *5: *cB: *O: *\: *ui: *Pv: *@V: *b): *C: */: *(: *: *64; *A; *iN; *[; *h; *Xu; *(; *|; *; *u; * r; *?; *RC< *P< *i]< *(j< * Gw< *(< *q< *U< *F-< *Г< */< *F-< *Г= *o\'= */3= *?= *|K= *\W= * On= *[}= *1= *B<= * <= *h= *D= *= *= *cu > *> *Q_&> *(@> *tN> *S\> *[j> *p2x> *۬> *> *> *'[> *> *> *~> * ? *#t? *B<,? *'G>? *Q\? *T? *(? *o? *i? *1? *[t? *g\? * @ *@ *g@ *)@ *6@ *:C@ *jVP@ *R]@ *j@ *9w@ *S@ *Ò@ *x@ *.@ *w@ *~@ *-@ *&A *A *A * R*A *ej8A *:FA *sdTA *bA *2pA *V~A *9A *YA *%A *jA *NA *1A *A *ţA *?B *~B *B *$,B *R:B *HB *yVB *5TdB *drB *a-B *B *CpB *DB */B *,B *7B *iB *uCB *~B * C *C * 4C *wLCC *wRC *RaC *|pC *\C *<C *7C *C *C *[C *sC *=.C *YD *y+D *ϐ8D *ED *6RD *:_D *9;lD *qxyD *(D *D *$8D *D *`D *]D *BD *D *lD *t| E *5E *.u%E *xF3E *)AE *ƥOE *]E *K$kE *yE *7E *zE *E *GVE *]E *|E *xE *%E *CE *tF *ծF *5M!F */F *r=F *?KF *\YF *gF *PwuF *_F *|F *ՉF *F *F *|F *F *mF *{F *5 G *0G *)G *U8G * GG *,VG *eG *GStG *ڟG *uG *)G *G *KG *!G *{NG *8G *CG *! H *?H *(H *PGH *+#VH *eH *!tH *H *H *tIH *H *~`H *YH *xmI *I *'I *BI *]I *lI *DJ *ggJ *XctJ *J *fJ * SJ *J *"LJ *OJ *s J *J *_~J *&K *TSK *+K *8K *-QK *R^K *ikK *BxK *TQK *otK *-K *DK *#tK *E3K *DL * EqL *{}L *X)L *#tL *B<L *{L *Y:L *TL *L *L *&L *L *IL *TM *M *c,!M *sl.M *u;M *,IM *nSM *K_M *kM *vM *ӤM *@6M *lM *M *KM *TM *C N *keN *.%%N * ^9N *FN *_RN *tN *N *N *FN *vN *giN *ن O *FO *a.O *T;O *HO *CUO *kebO *.%yO *՗O *_O *sO *VO *3O *")O *sO *KP *ZqP *[P *Y)P *4CP *ZPP *q]P *kP *xP *ӤP *UOP *{P *P *6Q *^a *yp$a *42a *Z.@a *HxNa *\a *Fa * Ya *5Wc *6c * c *phc *4c *+d *E d *Md *8Zd *s)gd *{td *xd *Hd *Td **&d *Zd * d *,d *ad *Hd *d *e *KNe *|#e *_1e *'?e *!XMe *l[e *2ie *ۘwe *e *IBe *Fe *We *e *4e *2e */e *xe *f *f *"f *4,f *U96f *,@f *`QNf *\f *#txf * f *0f *Ҍf *ef *f *[of *f *]f *ag *|g *+g *~Cg *VQg *^g *'kg *Tg * g *g *g *3g *g *'g *"Yg *9 h *8h *'h *D5h *.Ch *ŃQh *]_h *mh *<{h *h *;]h *1h *h *h *h *@h *+h *ah *H6i *zi *\C#i *'1i *O,?i *.cMi *[i *b)~i *i *i * i *ٌi *\*i *xi *U!i *:i *CX j *IJj *IXj *WNuj *k *J)l *kl *h lm *6po *Bp *Sp *p *&p *p *+q *6 q *+q *O4r *r *fr *r *@r *Qs *~s *i!s *-s *9s *lEs *#Rs *h9_s *ls *Nys *gCs *s *Ds *]s *1s *is *Qt *?t *&yt *ۉt *,t *t *bt *t *B u * #u *K6u *Cu *wPu *^^u *>Rku *Z,xu *Su *u *^u *:u *&u *Ǧu *rv *G v *!v *I@'v *4v *cAv *.Nv *pCv *v *kv *|Wv *b5w *5 w *P&w *K6w *-fDw *8Rw *M9`w *tnw *[ow *ʧw *w *-w *w *g$w *Mx *x *l4x *–Cx *Px *#]x *ڞjx *~Kx *cx *x *Zx *N#x *lx *߅x *y *!y *I@!y *uy *Ty *yy *y *Vy * y *y *y *y *u5y *U+y *Ly *y *py *cz *Lz *z *YE,z *x:z *Iz *Wz *ez *tz *k~z *#z *z * Iz *Ihz *ۭz *1tz *Jz *z *=z *]4z *z *iTz *|tz *z *z *8#{ *ܖ{ *7{ *,{ *m:{ *GW{ *wk{ *eu{ *#{ *p{ *~{ *t8{ *i{ *{ *K{ * 4{ *{ *\ | *]| *aZ&| *'3| *@| *S| *]`| *U| *| *YE| *&| *E| *P| *mu| *x| *| *C| *} *;} *33} *@} *.eM} *tZ} *_`g} *~t} *;} *5} *U} *&} *} *} *i} *RF} *~ *["~ * 0~ *v>~ *8L~ *q~ *k~ *3~ *=b~ *~ *B~ *_~ *e~ *-~ *wk~ *H~ *m~ *h *a+ *(8 *}E *R *X_ *Il *y *G *Aq *u *r% *! *)^ * *" *!9 * \ *@ * *T" *U: *JqG *a&` *bts * * 4 * *zaa *Wn *y *W *- *^ *X^Ȃ *:ւ *H *K *] *} * *Y+ *9 * G *U *5q *v * *X^ *H *Sg *\1Ń *iӃ * *r * *J[ *L. *[> *Y *Dc *(o *.{ *t * *w *#tք *K` * *N@ *G{ *w6& *GW4 *vB *$P *RN^ *Gl *1_z * K *w *tb * *mJ *΅ *b܅ *$u *N *ka * *q" *N0 *ϡ> *_N * j *$x *X *2 *Ws * *< **̆ *ƍ܆ *Pf *{ *8- *#y *, *^< *FL *`\ *]l *ө| *Ұ *f: *2 *X@ * ̇ *S܇ *g@ *lg *O * *BI$ *]4 *D *a *_ *  * * *V *̈ *A܈ *dd *ާ * *o *, * /< *ZL *j\ *S~l *r| *\ * *Lr *2 *'̉ *=b܉ *Q * *j *[j *l, * < *1oL *t\ *l *6(| *S * *9 *H *+7̊ *AL܊ *; * *Td *2 *Z+ *: *I *AX *J.g *ҭv *" *G *) *& *ċ *r&Ӌ *{ *L *.p * *y. *AD *ZS *Gb *+q *'X *ve *!s *8, *f# *v[̌ *Bی * *I *́ *b& *@ *$uJ *NT *agb *ip *&~ *u *@V *C */ *b)č *5ҍ *O *g */ *( * *2& *b4 *I *' * *x *x *Î *ю *ikߎ * *a$ * *#t *-Ώ *Zaۏ *% *o *̆ *1 *FQ! *u/ */= * *Ո *ڙ! *{' *.- *3 *0: *}!G *]T *a *ȑ *WՑ *, *i* *8 *}F *zT *r *s *(oē *ѓ *Bޓ * *K *j *լ * 4 *sV- *{V7 *aG *9OM *gS * 9Y *v_ *.e *k *Yq *w *ۮ~ *{n *W * *{n” *[ϔ *-ܔ *K *& *+r *hN *;\ *{i *sv * *;f * * *ƕ *vԕ * *1 *V * *r *M. *%,O *wP] *;j *ACw *_ *W5 *, *  *q *Ŗ *fҖ *0ߖ * * * * *d *#t- *k0: *IkG *T *@b *}p *d~ *  *i *2 *r *7ė *vr *: * *9 *( *i6 *E *;R *FH_ *Kl *By *Be * *J *Be *& * *Ʃ * *6 *# *q< *ACI *3c *Ivp *On} *` * *R * { *ř *iә *1 * *< */ * *e' *P75 *C *Q *]_ *Zm *&{ *I *[ ** *; *y *SϚ *}ݚ *o * *o$ *I *H# *Ke1 *!"? *M *[ *i *Q(w *` *&8 *pܜ *G, *g[ *l^ *M *# *k) */ *$5 *±< *V *Kc *Vq *8 *r *٤ *: *5 *d *iٝ *+ *X *C *& *% *Iv2 *3? *L *` *Fdn *Y| *<4 *3 *CÞ *5ў *`ߞ *M *.e *C *ٝ *JC+ * 9 *#tG *b0U *ac *Lq *C */ **l *K *JC *ydş *Pӟ *w *۬ * *9 * *-' *v *6X *u * *Q *Pi *z *tR *+*Ϡ *`ݠ *u * * * p2 *B *`H *;N *7T *AZ *` *0f *Ljl *ysr *mUx *-0~ *1 *  *U * *I *T *j * *vM¡ *iϡ *]ܡ *y *~ * * 4 *# *G1 *-> *VK *We *Kr * *ZV *pC *r *[ *' *% *V% *^z3 *#A *5O *t] *& *6 * *3CƤ *PbԤ *c *8 *V * *xD. *vC *NQ *Pb_ *0+m *S{ *d *1 * * *˥ *!٥ *M * *  *, *Y8 *E *cS *}'b *CMw *@N *O * * *Ǧ *uݦ * *2 *h2 *. *5) *ė7 *ME *q7S *j *^]v *' * * * *yϧ *[ܧ *v * *0 *@ *ZN *2\ *j *x * * *S} *t *X *S3̨ *;' *z *& *Bj *˰: *`H * {V *.ed *Br *~ * *u *ʪ *ת * * * r *3 *G@ *dM *[oZ *yg *$Bt *Z *U *ӫ *G *f *& *Ly *A# *-> *m.K *X *>Se *Mr *  *3 *} *͈ *& *ŘҬ * *5 *QB *iO *C\ *pCi *~v * *qv * *, *m *#t  *(ޮ *l} *]7 *.P *̑6 *C; *?U *3t *I *F8 *A_ *g nӯ *8 *# * *G n# n; ,? ,H nQ ni ,m ,u *ZMz r *# , , * , , *L ,Ű ,Ұ ,ְ ,۰ -5 *7 ," , s *7 ,1 ,/! -4 ,B8 ,>A 0sJ -Z ,X^ ,Vg 0sp -| ,g ,e 0s - ,v ,t - , , 5sر @s @s , , , , Ds+ _s4 -%D ,H ,M gsf oso os , , ws os sϲ s *7 , , s *L! o8 *#B ,F ,K *U ,*Y ,"h ,\l ,Pq *{ , , *L , , , , , , *ų ,ɳ ,γ * o *7 ,. ,, -E *7" ,?& ,;, oA *7K ,WO ,UU -U^ *7h ,hl ,dw p o oƴ /p״ *'6 r *# , ,| * , , -' *ū4 *+> ,B ,K rT -` ,d ,m ,q ,z - r r , , , ,µ r r *^ $1 r# R0 $1? rH -T ,)X ,'a rv r *; Pq *# ,: ,6Ƕ ,b˶ ,Rж *#tڶ ,޶ , * , , *L ,( , , ,v *h$ ,( ,- ~qB *7L ,P ,V qk *7u ,y , - *7 , , q - , ,Ʒ qϷ q ,& ,$ q q ,5 ,3& ,F* ,B/ qH qQ qi ,]m ,[v ,lz ,j q $r $r 3rڸ ;r - Qr ~q q' r? $rL ;ra *k `p *# , ,y , , * , , *F(Ź ,ɹ ,ι *ع ,1ܹ ,+ *L ,W ,Q * ,w ,q , , *G$ ,( ,9 -eB *ūO *+Y ,] ,f po -e{ , , , , -e p pƺ ,ʺ ,Ӻ ,!׺ ,ݺ p p p# ,1' ,/0 ,@4 ,>= pF p^ ,Ob ,Mk ,^o ,\x ,m| ,k p p ,| ,z , ,Ļ ,Ȼ ,ѻ ,ջ ,ڻ p p p -{/ ,3 ,< pE p] ,a ,h p p q *P¼ nټ *# , , * , , ,. ,& *G ,Z ,R% */ ,3 ,8 *LB ,F ,U ,Y ,^  os *7} , ,  o *7 , , 0o 0oٽ ,ݽ , 0o 0o ,) ,'  o* Vo? *h\ *; *'F * *Vľ *[oѾ *& *% *i *[o *+ *C" *n3 *&@ *2N *p_ *-l *X *u` * * * * * *~̿ *pԿ *1 *X *4 * *~# *Y+ *; *S *_ *~m *( * *~ *v *- *+ *B 'b_ *l +Z +#[ (M * *o *=* *l8 *= * K *KU *Zc * h * v *{ *Ժ * *ʻ *S * *( *6 *); *G *ۻS *_ *k * w * *E *A *  *  *x *N *L * * *P * * *  *- *4 2 *> *J *[V *b *yn *z *M *l * * * *8 *H *  *H *y * *J" *65 *B *P *] *Jj * * *J *b * *e *k * *# *k0 *= *[ *i * w * *A *J * * * *J * * * *l * *ҽ- *; *qI *X *g *_u *y *  *~ * * * * * *t * * *, *; *J *Y *8h *w *( *  * *X * *& *W * *@ * *-, *; *J *NY *h *w * *% * * * *I * *L * *2 *v  *+ *: *дI *X *vg *v *Y *8 *  * * * *F *" * * *~ *1* *`9 *zH *W *f *v * *+ * * *} *V *3 *3A *p *+ * *-q *h *̽ *R *  * * *V *Y *h *t * * * * *b * *̽ * * *V, *8 *JE *R *$_ *R * * *' * * *A * * * * ' *V5 *D *S *a *o *E} *a *D *̽ * * *1  *n * *? *f  * *% *3 * A *O *( *n * * * *0 * * * *{ * */ *> *M *h\ * k *=z *- *o * * *U * *x * *E * * *. *a= *L *J[ *xj *y *  * * * * * * * * * *- *< *K *Z *'i *Px * * *  *h * * * * *  * * ( */8 *H *GX *=h *x * *a * * *a *4 *? *e *v *{ *- *Y < *bK *Z *ói *x *6 *t *n * * *) *z *e *k *' * *9, *; *F J *PY *+h *x *= *I * *W *Z * * *n *b *= *+ *': *aI *X *g *v * * * * * *B * */ * *s * * * * 9 *H *W *f *|u *  *K * * * *g *8 * *{ *  * *0) *n8 *G *DV *e *t *i *x *, *# *^ * * * * *e * *( *7 *kF *U *d *s * * *? *f * *J * * *x * * *( *ü7 *cF * U *wd *s * * * * * *? *# *' *# * * * ( */7 *F *U *>d *s * * *g *L *= *+ *@ * *a * * * ' *6 *E *~T *Xc *Tr * *n *T * * *N *7 * * * *' *76 *E * T *wc *js *l *l * *o * *V *a * * *I *I *W *e *5s * * * * *  * * * * */ * *+ *S *` *s * * * *\ *^ * * * * *t! */ *= *K *!Y *g *u * * *z *\ *@ * *} * ** *O? *L *As *3 *w * *X *k * *S * *9 *r * *x *# *0 *6= *J *W *d *̽q * * *b * */ * * * *] *W * *g+ *98 *E *T *c *̽ * * *  * * * *4 * * * * *; ** *17 *D *1Q *N~ *e *̽ *4 *6 * * * * *U * ' *5 *C *Q *_ *m *,{ * * * *w *k *? * *U * * * *# *1 *? *KM *<[ *Li *w *  * * * *j *^ */ *̽ *e *_ *V' *i3 *@ *O *\ *b *B * *9 *  * *% * *< * * *y * *R# */ *L *Q * * * * * *Lf *s * * * * * *_ *ں * * * *9 *ŲH *W *[f * *  *_ * * *t * *{ * *1 *# *? *@O * _ *Po * *S * * *< * * * *{ *M * *z, *A *N *[ * * * * * *? * * * *J *$ *Y1 *> *| *z * * * * *̽ * * * * *$ *1 *> *Z *Eg *Vz * * * * * * * * * * * *qQ *^ *̽k *x *R *ܹ *_ *0 *U *v *- * *| * * *  * * *, *9 *M *Bb *p *| *\ * * *Y *7 * *K  *9 * * * *_ - *]: *H *U *]b *p *} * * * *] *[ * *վ *c * * *g * *_! *}. *+; *-b *o *o| *) *E * *  * *^ * * * *g *̽4 *A *#N *[ *Ei *| * * * * *\ * *4 * * *F *f *^ *j *'v * * *6 * * * * * * * *D ** **A *N *[ *r * * *g * * * *  * *U *3 * *[, * C *+O *[ *g *s *d *y * * *+ *y * *f *# */ *; *G *O] *j *w * *} * * * * *y * */ *W *  * *& *@ *4M *^Z *^t *  *س * *Y * *^ * *z *& * *  * *! *. *:; *H *U *cb *p *} * *n *+ *Q * * * * *\ *; * *- *: *QG *̽T *5a * *q * *[ * *q * *  *q * *q *$ * G *jj *v *z * * * *b * * * *  *G *e *q *J *_% *3 *A *)P *^ *^l *z *g  *t *^ * *G *A *" * *< * *i *$ *32 *@ *O *~^ *l *z * * *' *y *:  * *@ * * *' *e *X" *R0 *!> *L *SZ *:h *v * *  *e * * *, * * *b *x *g *! *R/ *w= *K *yY *g *Eu * * * *e * * *  * * *# *? * *v+ * N *X *pf *t *5 *< * * * * *& * * *~ *- *; *`I *W *#e *Rs *̽ * * *) * *n *7 * *0 *l *$, *: *ԶH *MW *6 * * * *  *p * * * * *h, *: *JN *nV *e *? *! * * * * * * * * * * *- *̽; *I *W *7 e *s *G *f * * *V * * * *+ *t8 *E *X *e *D *D  * * * * * * * * *I * *m( *@5 *oB *O *\ *i *v * * * * *D * *k * *# *`J *W *d *$q *_~ *̽ *9 * *; * * *a * * * * * */, *9 *F *bS *` *m *z *f *U *̽ * * * * *Q *Q * * *( *+6 * D *kR *` *| * * * * *I * *) *) *z *' * *)$ *2 *F @ *PN *\ *\j *x *_ *O *' * * *0 *Y * * *{ *` * *8. *z< *J *X *f *5z * *J *f * *  */ * * * *8 * *  * *' *4 *A *N *[ *n *{} *l *3 * *y *F * * *g * *ü *|& *R@ *J *T *J^ *k *_x *# * * *X * * * *  * *7 * *÷ * *E, *9 *F * S *` *ڼm *z * *d *+ *\  * * *c * * *  * *b% *2 *@ *M * Z *g *v * *  * * * * * *G *  *6- *O: *M *Y *Z^ *k *x *# *9 *n *+ *^ * * *F *! *q. *; *`H *U *b *Co * | * *v * *k *\ * * * *~ *{  * *;& *4 * F * [ *=g *t * * * *C *f * * *Y *9 *l *] *o& *2 *? *L *Z *{ * * * *b *t * *  * *  * *' *A *KN *̽ *K *7  *L * * * * * * *T * *^- * ; * v * * *y * * * * *  *( *   * *+ *8 *E *R *_ *Wl *y * *m * * * * * *= *  *r *ʸ *4 *+" *0 *-> *L *Z * *4 * * * * *G */ * * *4 *@ *"L *-Y *(  * *, * * * * *k *# * *2 * *N  *  * *' *% *_2 * ? *qM *q` *Sm *' * *n * * *b *a * * * *J* *B *۸O *Kx * *i *i * * *f *y * *P *J * *̽) *6 *fC *P *] *@j *x * * * * *G *  * *X * *ĵ * *y *+ *8 *p E *R *_ *l *y * * * *  *| * *)  *% *8 *O *h *u * *= *x * *9 * *g * * *1C *%Z *h *  * * *̽ * *) *1! *! *3! *L! *U Z! *h! *bv! *P! *! *! *6! *! *^ ! *! *" *" *" *6" *D" *eR" *+u" *" *+ " *" *" *" * " *O" *D# *# *# *6*# *.8# *OF# *T# *h# *v# *# * # *# *# *Ÿ# *\# *# *# *; $ * $ *)$ *8$ *FF$ *T$ *Ib$ *p$ *~$ *4$ *$ *m$ *$ *$ *% *n$% *.% *G% *U% *q% *g% *E% *y% *% *% *,% *% *k & *& *a(& *fD& *gR& *`& *!n& *|& *h& *\& *& * & *& *|& *U& *l& *4& *' *' *&' *U 5' *[D' *̺S' *;b' *-q' *' *' *' *"' *' * ' *' *' *_( *V( * %( *ݴ4( *C( *lR( *`a( *p( *I( *̽( *( *( *( *( *( *x( *0( * ) *f) *$) *3) *B) *Q) *`) *@o) *G ~) * ) *) *) *o) * ) *f) *a * ** *%* *1* *V* *c* *p* * * ** ** * * ** ** ** ** *B* * + *+ **+ *B8+ *IF+ *T+ *< w+ *f+ *D+ *?+ *;+ * + *)+ *+ *=+ *+, *, *W*, *e8, *F, *VT, *b, *pp, *T, *#, *, *, *J, *, *, *f- *Q- *8- *Na- *̾n- *- * - *- *:- *- *- *- *- *. *. *I. *5+. *8. *E. *R. *_. *Ul. *y. *v. *B. *o. * . *. * . *. */ *q/ *z!/ *// *=/ *K/ *PY/ *g/ * u/ */ */ */ *k / *Q/ */ */ *_/ */ *0 *0 *#0 *10 *?0 *nM0 *[0 *i0 *w0 *0 *0 *0 *0 *; 0 *90 *.0 *0 *0 * 1 *p1 *(,1 *;1 *{J1 *. Y1 *I o1 *N~1 *u1 *P1 *1 *1 *1 *f1 *2 *2 * 2 * ,2 *I92 *F2 *S2 *`2 *Um2 *z2 *%2 * 2 *32 *2 *2 *O2 *2 *2 *2 * 3 *3 *)3 * 73 *?E3 * S3 *Ba3 *o3 * }3 *3 *3 *3 * 3 *u3 *3 *3 *3 *3 * 4 *-4 *%4 *v34 *&A4 *O4 *W]4 *l4 *){4 *`4 *4 *4 *4 *4 *@4 *4 *.4 *v5 *5 *!5 *_05 *?5 *N5 *]5 *l5 *Q{5 *e5 *R5 *5 *5 *5 *5 * 5 *5 *6 *!6 *06 * ?6 *N6 *^6 *pm6 *|6 *?6 *6 *!6 *~7 *7 *~7 *P7 *7 *7 *w7 *B8 *O8 *i8 *5v8 *8 *8 *8 *8 *Ϲ8 *38 *8 *̽8 *8 *9 *9 *y,9 *o99 * F9 *S9 *9 *9 *9 *y9 *9 *9 *A9 *y9 *ϳ9 * : *&: *ϳ9: *: *L: *+: *: *?: *6: *ݽ: *5: *: *H: * ; */; *"; */; *=; *?G; * S; *Z_; *y; *D; *; *; *l; *e; *N; *V; *; < *μ< *}-< *:< * F< *h< *< *< * < *< *< *= * = *"= *N/= *<= *VI= *;V= *μm= *$ = *= *K= *>= *$= *= *= *= *S> *t> *5> *7> *U D> *Q> *!_> *l> *Dy> **> *a> *> *> *? *? *? *-? *F;? *I? * W? *d? *q? *~? *? *? * ? *n? *? *f? *x? *U? *U ? *@ *@ * @ *@ *@ *@ *F@ *S@ *`@ *m@ *pz@ *L@ *@ *F@ *@ *@ *@ *@ *\@ *@ *@ *e A *4A *@'A *34A *AA *JTA *aA *nA *{A *A *'A *A *A *A *A *B *B *vB *(B *5B * DB *^B *;kB *QxB *kB *B *OB *B *C * C *!C *-C *:C *lC *̽zC *C *C *iC *C *C *I D *-D *D *VD *#D *)D *F/D *6D *-GD *MD *SD *[YD * _D *ѲeD *uD *zD *KD *sD *7D *D *|D *%D *D *KD *D *E * E *^+E *AE *2ME *ZE *gE *F tE *#E *E *E *E *E *E *xE *E *F * F *.F *ݿ,F *:F * HF *VF *`dF *^rF *F *F *F *3F *F *RF *FF *F *F *. F *G *t-G *:G *tMG *V[G *hG *uG *G *iG *G *3G *YG *YG *G * G *G **G *H *H *H *л,H *x9H *#FH *SH *WaH *oH *b}H *H *6H *8H *WH *H *H *H *H *#H *H *"H *BH *^H * I *I *'I *25I *CI *QI *_I *I *I *I * I *fI *2J *J *> J **.J *o *Lo *4Yo *&fo *Zso *Po *o *fo *o *ho *o *o *p *Fp *R"p * /p *)  +B +F +0J +EN +`R +oV +Z +^ +b +f +q +v +{ + + + + +" +, +3 +@ +Q +X +d +n + + + + + + + + + + + + +$ +, +5 +B +G  +P +V +] +f  +r% +* +/ +4 +9 +> +C +H +M +R +W + \ +a +/f +Ak +Jp +Zu +hz +n + + + + + + + + + + + + + + + + +- +9 +E +Q +W +b +s + + + + +  + + + + +$ +) +*. +73 +@8 +N= +XB +gG +L +Q +V +[ +` +e +j +o +t +y + ~ + + +% +. +8 +J +Q +X +` +k +x + + + + + + + + + + + + + +  + +$ +*  +0 +9 +C +M +V# +^( +e- +p2 +{7 +< +A +F +K +P +U +Z +_ +d +i +n + s + x + } +.  +8  +C  +M  +U  +^  +g  +m  +v  +  +  +  +  +  +  +  +  +  +  +  +  +  +  +  +#  +/  +;  +E  +P  +]  +g  +m  +s " +| ' + , + 1 + 6 + ; + @ + E + J + O + T + Y + ^ + c + h + m +! r ++ w +4 | +:  +C  +P  +c  +r  +  +  + |>M2MQ + Q +$ Q +< Q +L Q +c Q +z Q + Q + Q + Q + Q + Q + Q + Q +4 Q +O Q +] Q +k Q +y Q + Q + Q + Q + Q + Q + R + R + R + R +R +R +!!R +-&R +8+R +C0R +Q5R +Y:R +a?R +fDR +oIR +NR +SR +XR +]R +bR +gR +lR +qR +vR +{R +R +&R +0R +<R +HR +[R +kR +vR +R +R +R +R +R +R +R +R +R +R +R +R +R +R +R + R +.R +6R +BS +SS +b S +mS +tS +S + S +%S +*S +/S +4S +9S +>S +CS +HS +MS + RS +WS +*\S +:aS +KfS +\kS +gpS +tuS +}zS +S +S +S +S +S +S +S +S +S +S +-S +3S +@S +GS +MS +VS +bS +kS +uS +~S +S +S +S +S +S +S +T +T + T +T +T +T +T +$T +")T +,.T +=3T +C8T +J=T +UBT +ZGT +gLT +sQT +|VT +[T +`T +eT +jT +oT +tT +yT +~T +T +T +T +T +T +T +T +T +.T +=T +FT +KT +WT +]T +fT +nT +tT +zT +T +T +T +T +T +T +T +U +U + U +U +U +U + U +#U +((U +1-U +A2U +K7U +Vj +Cj +Hj +Mj +Rj +Wj +\j +aj +fj +%kj ++pj +8uj +?zj +Ej +Nj +Zj +cj +mj +wj +j +j +j +j +j +j +j +j +j +j +j +j + j +j +j +%j +6j +<j +Cj +Nj +Sk +`k +l k +uk +k +k +k +$k +)k +.k +3k +8k +=k +Bk +Gk +Lk +Qk +Vk +[k +`k +ek +jk +ok +*tk +7yk +C~k +Rk +\k +ck +qk +xk +k +k +k +k +k +k +k +k +k +k +k +k + k +k +k ++k +=k +Fk +Sk +ek +nl +sl +| l +l +l +l +l +#l +(l +-l +2l +7l + dl +F il +L nl +Y sl +c xl +l l7' P + + $ +!( +!, +'!0 +B!4 +X!8 +m!< +!@ +!D +!H +!L +!W +!\ +"a +"f +"k +&"p +,"u +3"z +:" +@" +K" +V" +d" +l" +t" +y" +" +" +" +" +" +" +"ŀ +"ʀ +"π +"Ԁ +#ـ +#ހ +0# +># +D# +K# +]# +f# +n# +# +# +# +# +# +# +#$ +#) +#. +#3 +#8 +$= + $B +$G +$L +*$Q +=$V +M$[ +X$` +d$e +p$j +{$o +$t +$y +$~ +$ +$ +$ +$ +$ +$ +$ +$ +$ +% +% +)% +9% +H%ā +V%Ɂ +f%΁ +w%Ӂ +%؁ +%݁ +% +% +% +% +% +% +% + & +& +3& +:& +J& +Y& +_&# +l&( +s&- +y&2 +&7 +&< +&A +&F +&K +&P +&U +&Z +&_ +&d +&i +&n +&s +'x +'} ++' +6' +=' +G' +X' +^' +e' +p' +u' +' +' +' +' +' +'Ȃ +'͂ +'҂ +'ׂ +'܂ +' +' +' +( +( + ( +( + ( +)( +1( +8( +C( +P( +_(" +i(' +p(, +~(1 +(6 +(; +(@ +(E +(J +(O +(T +(Y +(^ +(c +)h + )m +)r +)w +")| +1) +C) +L) +Y) +b) +g) +p) +|) +) +) +) +) +) +)ƒ +)ǃ +)̃ +)у +)փ +)ۃ +) +* +* +'*0JQ p +*t +*x +*| +* +* ++ ++ +5+ +J+ +Y+ +t+ ++ ++ ++ ++ ++ ++ ++ē ++ɓ +,Γ +,ӓ +-,ؓ +6,ݓ +C, +L, +Y, +d, +o, +}, +, +, +, +, +, +, +, +,# +,( +,- + -2 +-7 +(-< +<-A +J-F +P-K +W-P +i-U +q-Z +-_ +-d +-i +-n +-s +-x +-} +- +- +- +- +. +. +. +!. +-. +@. +P. +[. +g. +s.Ô +~.Ȕ +.͔ +.Ҕ +.ה +.ܔ +. +. +. +. +. +. +. +. + / +/ +,/ + +4C +4H ++4M +:4WV~ +4 +4 +4 +4 +5 +!5 +75 +L5 +c5 +r5 +5 +5 +5# +5( +5- +62 + 67 +6< +6A +'6F +46K +;6P +F6U +Q6Z +_6_ +g6d +o6i +t6n +}6s +6x +6} +6 +6 +6 +6 +6 +6 + 7 +7 +,7 +27 +97 +K7 +T7 +\7ã +m7ȣ +|7ͣ +7ң +7ף +7ܣ +7 +7 +7 +7 +7 +7 +7 +7 +8 +8 +&8 +18 +=8 +I8" +T8' +_8, +g81 +o86 +}8; +8@ +8E +8J +8O +8T +8Y +8^ +8c +8h +8m + 9r +9w +)9| +:9 +K9 +V9 +c9 +l9 +z9 +9 +9 +9 +9 +9 +9 +9 +9¤ + :Ǥ +:̤ +":Ѥ +/:֤ +6:ۤ +<: +E: +Q: +Z: +d: +o: +z: +: +: +: +: +: +: +:! +:& +:+ +:0 +:5 +;: + ;? +;D +!;I +(;N +3;S +8;X +E;] +Q;b +Z;g +e;l +n;q +{;v +;{ +; +; +; +; +; +; +; +; +; +; +; +; +; +; +<ƥ +<˥ +"<Х +,<ե +3<ڥ +A<ߥ +H< +R< +]< +l< +{< +< +< +< +< +< +< +< +< +<% +<* +</ +<4 + =9 +=> +#=C +,=H +1=M +:=R +F=W +R=\ +\=a +f=f +s=k +}=p +=u +=z += += += += += += +=@` +2> +Y> +q> +> +> +> +>$ +>( +>, +?0 +?4 +5?8 +L?C +g?H +{?M +?R +?W +?\ +?a +?f +?k +?p +?u +?z +? +? +? +? + @ +@ +-@ +B@ +T@ +]@ +j@ +z@ +@ +@ +@ŭ +@ʭ +@ϭ +@ԭ +@٭ +@ޭ +@ +@ + A +A +!A +-A +5A +=A +IA +SA +cA +pA +yA +A$ +A) +A. +A3 +A8 +A= +AB +AG +AL +AQ +AV +B[ +B` +Be +)Bj +1Bo +;Bt +GBy +SB~ +_B +eB +sB +B +B +B +B +B +B +B +B +B + C +CĮ +#Cɮ +-Cή +D< +FDA +NDF +WDK +iDP +{DU +DZ +D_ +Dd +Di +Dn +Ds +Dx +D} +D +D +D +D +E +E +E +$E ++E +5E +DE +IE +UE +[Eï +dEȯ +lEͯ +rEү +xEׯ +Eܯ +E +E +E +E +E +E +E +E +E +E +E +E +F +F" +$F' +-F, +=F1 +OF6 +UF; +_F@ +jFE +tFJ +|FO +FT +FY +F^ +Fc +Fh +Fm +Fr +Fw +F| +F +F +F +G +G +G +%G ++G +1G +:G +KG +QG +bG +nG° +xGǰ +GѰe +G +H +H +.H +EH +`H! +vH% +H) +H- +H1 +H5 +H9 +H= +IH +"IM +)IR +0IW +7I\ +@Ia +GIf +MIk +XIp +cIu +qIz +yI +I +I +I +I +I +I +I +I +I +I +I +I +J + Jŵ ++Jʵ +7Jϵ +GJԵ +YJٵ +iJ޵ +yJ +J +J +J +J +J +J +J +J +J +J + K +K +K$ +%K) +0K. +8K3 +@K8 +NK= +VKB +bKG +sKL +KQ +KV +K[ +K` +Ke +Kj +Ko +Kt +Ky +K~ +L + L +L +#L +0L +8L +@L +ML +VL +`L +lL +xL +L +LĶ +Lɶ +Lζ +LӶ +Lض +Lݶ +L +L +M + M +M +!M +0M +NM +cM +xM +M +M +M +M# +M( +M- +M2 +M7 +M< +MA +MF +MK + NP +NU +NZ +%N_ +6Nd +RI +URM +dRQ +RU +RY +R] +Rh +Rm +Rr +Rw +R| +R +S +S +S +$S +2S +:S +BS +OS +TS +]S +oS +S +S +S +S +S +S +S +S +S +S +T + T +T +-T +AT +OT +_T +mT +vT +T +T! +T& +T+ +T0 +T5 +T: +T? +TD +TI +TN +TS +UX +U] +%Ub +1Ug + +bWC +mWH +xWM +WR +WW +W\ +Wa +Wf +Wk +Wp +Wu +Wz +W +W +W +X +X +X +&X +1X +6X +CX +OX +XX +cX +lX +yX +X +X +X +X +X +X +X +X +X +X +X +X +X +X +X +Y +Y +Y +,Y$ +6Y) +=Y. +KY3 +RY8 +\Y= +gYB +vYG +YL +YQ +YV +Y[ +Y` +Ye +Yj +Yo +Yt +Yy +Y~ +Y +Z +Z +Z +,Z +5Z +:Z +CZ +OZ +[Z +eZ +kZ +tZ +~Z +Z +Z +Z +Z +Z +Z +Z +Z +Z +Z +Zno +J[s +q[w +[{ +[ +[ +[ +[ +[ + \ +(\ +7\ +M\ +_\ +j\ +u\ +\ +\ +\ +\ +\ +\ +\ +\ +\ +\ +\ +\ +\ +] +] + ] +(] +4] +D] +V] +f] +q]$ +]) +]. +]3 +]8 +]= +]B +]G +]L +]Q +]V + ^[ +^` +^e +$^j +,^o +8^t +H^y +Q^~ +_^ +k^ +w^ +}^ +^ +^ +^ +^ +^ +^ +^ +^ +_ +_ +#_ +4_ +E_ +P_ +]_ +f_ +t_ +~_ +_ +_ +_ +_ +_ +_ +_ +` +` +` +)`# +0`( +6`- +?`2 +K`7 +T`< +^`A +i`F +{`K +`P +`U +`Z +`_ +`d +`i +`n +`s +`x +`} +` +` +a + a +a +!a +(a +5a +;a +Aa +Ja +Ta +^a +ga +oa +va +a +a +a +a +a +a +a +a +a +a +a +b +b +b +!b +(b +2b" +=b' +Gb, +Ob1 +Xb6 +`b; +jb@ +sbE +ybJ +bO +bT +bY +b^ +b + c +1c +9c +Tc +dc +zc +c +c +c +c +c +c +c +c +c +d +d +d +!d +.d +5d +Ad +Pd +Wd +ad +id +qd +vd +|d +d +d +d ) 4 )8d )h ) )pT )XP )  )`L )Pl )pP ) ) )P$ )(` )P )T )X  )` ) , )0 D )H  ) )0 ) D )Hd )h@ )O )$ )(D )H`| )8 ) ) )Pl )p ), )0 @ )  ) ! )  %L )P A ) & ) '4 )8 ( ) % ) P* )  = , ) 0 * ) ] ) P- )  P. ) ~ )  6 ) 7, ) 07\ ) `8 )  :  ) :t ) x  ) ; ) >d ) hA ) F$ ) (@G ) H )  ) PL )0P0Jd )0hJ| )0J )0J )0J )0 K )0PK )0pKL )0P0N )0Q  )0Q  )0Rd )0hS )0 T )0UT )0X V )0V )V )V ) W )PW ) W4 )8~ L )PW )  )X ) , )0YD )HY )@Z )Z )[L )P t )xP^ )0_ ) $ )(@`< )@p`T )X` )a )b )b )b\ )`c )d  )e$ )(`f< )@fl )pg )g )  )h )h< )@pi )0j )0k, )0k )l )< D )(Hn\ )(`n )(o )(`p| )(Pq )( rD )(H r[^ccpN++$pp&p7pN]lNw@h$$ P"$1Ie$?0bA`$ !*+38$F$U3m<Vlw$6$6+"<2Y2{222  < ] j  z      @ f          ' pG ps   p   & p1 $> M _ n    $  @  @R i @  6  K /_ K\yT .T Gw hw u  w w w w %w Kw qw  w w w w w w w ! 2PRP~P,;J0YnhPs$ E$ EPP%PFYx-Ie^^^^^^^0^~"FXi{ # 1 Ba$?O^n}00l0>R'&j|[ ( ([EK+KAdq    1W}->^(@K$XgyY$Y . H ^ o   $ ( $ ( ! !F!!i!"!E"!E"!E"'"E"X"E""""""" #"3#"e#"#"#"#"#$ #"$")$##A$o#P$o#_$o#p$o#$#$#$$$#$ `$ `$#$$ %$ %$ +%$E%e%%%%" &",&"N&"v&"&P3'P'P'PW((c(c)"*P*a*w****/ ** */ * *+/ %+ b+}+i+++ + ++ +  ,,C(,C7,G,V,f,u,,,,, , , ,-/-N-p------ ..,.=.N.\.u...)/Q/r////00 x0'0 x60C0S0e0p0 @z00 @00000 00 0011-11=11L11\11k11{111^1^1 1 1^1^2^42^Z2^2^2^2g2^2^3^3^&3^73^H3^V3gq3`38338 4`N48^4;p4`{4 4;4 4`4;4i4/4 4i4 4/ 5i5)585H5W5g5v55555 5 556?6e6666677"717B7S7a7|777K78Y8i8{88 X88 X888 88 8 8 99 %9%49%C9nS9nb9nr9n9n9n999 9 9:':J:p:::::;;-;<;M;^;l;; ;`; ;`; F<`g< <`< <`< <`= )=`<= R=`g= =`= = = = = = = =I 5>R W>N g>N v>N >N >N >N > >1 >- ?- ?- %?- 4?- D?- S? b? u? ? ? ?" ?" @" @" $@) 4@) C@) S@) d@; @; @; @; @; @; @ @Z AZ BAZ hAZ AZ AZ Al Al Bl Bl (Ba BBa XBa hBa zBa Ba B Bs Bs Bs Bs Bs Bs CC(C8COC`tCCCC@"DOIDwDOD@DOEgZEOiEJ{E@E EJE E@EJEsEEiF F Fi"F 1F>FiRFeFOvFFOFFOFOFFFUF$F G$G$,GKGVG$eGGGGGGG*G$H* H/MH/ZH hH xH H/H/H/I/2I/VI/|I/I8I/I/I/I/I/J/!J//J8FJ %ZJAJ %JAJ %JAK%UK %{KAK$&K %K 8K$&K 8K %K$&K~&L&L~&'L~&9L~&IL~&ZL~&nL9%LO%L`LO%L9%"M9%-M$ BMO%TM`cM`yM`Ma%Mv%Mv%M%M$ M$ M$ M%N%N.NBNtNNNO6OEHOSO 0]OEhO 0wOOEOOOOOPP,PGPXPhPwPPPPPPPPPP$ QQ(Q p2Q=Q pLQYQmQQQ@Q Q$Q$Q Q"R"RuR$+RuARLR$[RsRR R RRRRRS3SKSaSqSSSSSSSST TP#T``T`T`T`U'UNU`qUU`U`UU`U$ UU$ U$ U VV&V`3VBVQV\V`iVxVVV`VVPVW:WWWW WWX:XIX[XmX|XXXXXXXYY Y/Y]?YYJY PWYYgYvYYYYYY YY0Y,Z Z,Z/Z:Z GZWZfZuZZZZZZJZZ&Z&[&![&C[([% [([% \(d\% y\(\X)\% \e)\% ](])8]')]% ]**](]$])]$ ^$^)2^<)J^Q)Y^Q)k^)z^)^)^)^)^ ^ ^ ^)_)3_)R_)t_)_)_)_)_)`)`)!`)0`)A`)R`)``)u`'`'`' a'8a'Va'haPta(a'a$a(a(a(a*(b(b,(6b,(Lbj([bj(jbj(ybj(bj(bj(bj(bs(bj(bj(bj(bj( cj(cj(,cj(9cs(Hc6(Sc$`c6(yc&c&c&c&)d&Wd'~d&d 'd&d$d'e'Ae'fe,'|e'e6'e6'eC'eC'eC'fC')fC'AfC'YfC'sfC'fC'fC'fL'fC'fC'fC' gC'gC'*gC';gC'HgL'WgW'bg$ogW'g g g g h Th h h h h (i* Li" gi ri$i/ i/ i/ i/ i/ j/ 1j/ Mj/ lj8 j/ j/ j/ j/ j/ j/ k/ k8 kC (k$5kC Fk_kxkk)kkPkDk^k^k *lEl xll ll ll l l m m m 'm ;m Om^m[ mm[ |m m m m m m m m n n *nPLnPnnPn]n]n]n]oP*%o= ?oP*ao= yoP*o= og*o= oP*oP*p 6Ap 6p 6p6p66p66q66q66=qC6qC6qC6qG6qG6qG6qG6qG6rG6rO6 rO62rO6BrO6XrX6}rX6rq6rq6rq6rq6sq6sq66sx6Psx6nsx6sx6sx6sx6s6s6t6t60t6@t6Rt6vtP.t~ t.au~ ux.u~ u.Pv~ |v /v~ w.gw~ w.w~ w.,x.x~ x.x. y.y.-y//N/g//̓/݃///g4%P-K-c---DŽ*] *Q] i+] +] Å*o, M+ o,* 9M+Fo,V,e,w,,++ņ φ+چ ++1,1,'1,91,K*Z*lh+|h+P*h+h+h+Շ77*7@7[7j7|7HHHDWIpHHۉHHH+H=HOHaHsHHwIH wINJ ֊HwI*IPI$PI?I[IuI@Gl@G]GEGW]Gb `lGw `]GG%HG (ʍ%HՍ (G%H@G8I8888!)93f8> xH)9S xbf8o)998 @9 @8͏9: ):u : :  %:Q h: ;͑ :) ?m;Q:\ X fm;q X :m;#; :#;ƒ#;ܒ#; :  :N :| : ::ӓ7;R<Ô<Քz< < z<<)%=X7=w7=7==7=  p =" p 17=>=N>`=k 8 u> 8 =>==ɖ Ӗ=ޖ == ==' 1=< K=X=p>?@h?fAx6? A 6?AƘB@Ә88B@AJAƙATB~BlBB ĚlBϚ ޚBlBwE  C "wE- < CIwEaCCțCC C7C[EmCx E CECʜCߜC%E7CB LEW fCsECC$FF ʝFڝEzD E  zD(E:DG8W8hFFF̞FFL V V5VßRV՟5V RV 5VRV! V0 VB7V[UUߠUUc*U9UU֡9U*U*U$*U5*UEUWUb  lUw  UUUUĢUӢUUUUUU-U<UMUdU{ T=TɣUTbT T=T& P 0T; P J=TWTgUTvbTlT T ToTͤoTܤoToTTT*STSlSSS S ¥SϥSߥSSS S&R]RxRRSŦRЦ ڦ^S R^SR R1RGRVRhSwSSS*S*SҧQR Qa0NQ 0NިQ 0N*Q K0NQ ʩN,u <NPhNdQ }NQ N̪NN#P5pN@ JPU dpNqPNNuNīuNګ>OYO kOYO;YOu|O|O|O|O|OAxPdu pKpKjpKpKK5K\~LLLLѯ[MK h  h K)~L8LGxMYKd 0 nxMy 0 KxMKKݰKL (ML(Mo(M(M0Jױ0J0J(0JFDJWPKrPKPKPKò K޲ K K K/JJJeJJJJѳJJJ"J=JXJsJJJĴJ0_' @_c E_E_ _ εE_E_j_)j_8_K_g_v___ `ö `ضYY*YKYgYYYYηVP^P^K^]^Ըv^v^ ]^0]^B]^R]^d]^t]^]^]^_Wǹ~ W ~ (W4~ QW]~ zW~ X X: bX Xλ X @X #Xf YWͽ W# LW W [) P[ ޿[p [ S[) D[u S[ ]\% /]: I\V]f]x\ ] \]w][ H w] H [w]"]4W\?  I]T  cW\p]H]|\ H] |\H]^] ^ ],^<S[KS[]S[lS[~S[S[a[a[a[a[@Z9@ZV@Zx@ZVZVZZZ Z7Z_ZZZZZZ@@  3@P@m````A T gz  ':Wt* :  ( (<@g @#hL2 dgy g gBB Bg-nh<,hK,hZ,hk,h?h?hgfgf0gKf\fnffffffMgMgMgB MgB#Mg2MgAMgPMg_MgjByMg`f`fff e)eGfZfwf#feepipipi4piYpi~iiiiikkkDklkl lll l!l8#lG#lVBlhRl| lhh0k{k Vk+VkF0kX0kj0k|0kk0j0j0jWj0Hjs]j]jsj~j~j~j~jj&j5jGjil< l< 0lV< pl< l< MmD< el< ~m m< l+< Zmr< m< mmm< m'm;~mP `lmqm} m mmmmm[ [ &t 7t St rt t t t      & 5 D W phhhhhh0hDhc#innrsss#s2sC&sY0sh0sw0s0s@s@s_sos&so+o]oooooo/o@oXoiorrrrr rr*r;PqcPqPqmq)qqmqqqqq'q6qGq^qmq`p`p`p`p2pXpxppppppp"p2pApPp_pnp}ppppppnn/n[nnono #o0o*0o  0AR3brx*`(8JH&Xq2hha'7 B`M ] o ; I   Z a / / / / +/ ; FQ c uW [ [  F[ [2I` kv))C@OI2IGhz///O%/O:JU` u %`8)i>iSct888//,^=H^Yd^zf^  * = g     @  V w  w * w A !d " " o# # #  $  % A )% )%# 9%A AL E%\ v%l %          " 0 @ P ` 'w ' 6' C' C' C' C' C' ( ,( ( %  )0 ')B 0)T <)f )v ) ) ) )     P*= Y**(] 3*CM+UM+g+}+-P.~ .~ 0~ P0P0.o5=~ He0n3~3011=1~ H1H101C%2SO2j2|63 4 /g4=6C6C66'X67X6Gq6Wx6g@*r= 777f8f888: :0:Ez<Wz<i*=*=7=7======$=46?F6?X|?pB@BB C CCCCCC'C9FIzD[zDmDFIG]G]GGGHHH&H8HHHX IhPIzII7 PKKKK(K:KQLa(Ms0N~Q pNpNuNN-OYOmO!xP7u BRRRdRvRRRSSS)T=T=TGT GT6UTF UVUiUyU)V5V5V7V JQ W~ W  X! ,Z?[J U5[ea[w[[W\W\|\|\\\\\']7]G]^W0_b m;__V~ f%g;gQgdgwg g g,he i~j9k'[k7kHk^kq7ll< lm mm` `   #h.< FoVofxp|pqq;rrrrr)s)s&Ts6sFn.symtab.strtab.shstrtab.rela.text.rela.text.unlikely.rela.exit.text.rela.init.text.rela.rodata.rela__mcount_loc.rodata.str1.1.rodata.str1.8.rela.smp_locks.modinfo.rela__param.rela.retpoline_sites.rela.return_sites.rela.call_sites.rela.ibt_endbr_seal.orc_unwind.rela.orc_unwind_ip.note.gnu.property.note.gnu.build-id.note.Linux.orc_header.rela__bug_table.rela__jump_table.rela__patchable_function_entries.codetag.alloc_tags.comment.note.GNU-stack.rela.data.rela.exit.data.rela.init.data.rela.printk_index.rela__dyndbg.data..read_mostly.rela.static_call_sites.rela.gnu.linkonce.this_module.bss.rela.debug_aranges.rela.debug_info.debug_abbrev.rela.debug_line.rela.debug_frame.debug_str.debug_line_str.rela.debug_loclists.rela.debug_rnglists @s@@0pK+s> &@(uK?0`:@(KOJ@0 K_` Z@K lXg@ K y28n2'l@K<x@ KT@K@ K @FKXX@K v@{K, @?@ $Rd 0^ o j@`K# {@ HK% p@hP K'1@0@4t @PK,0@K.8@ K0 @x@8hK28@`K4(& @&;@0K7X@'@S@00K9r,1|,w@`K<`/y @HK>q fj #@q(hKA @p/)KC0(_+0,d-6@`H)KGc{Q@*X)KIBL `'XF*