ELF>@@CBAVAUATUSH@eH%(H\$8HHD$ Ht$D$HD$HD$ HD$(HD$0HD$HD$D$ us11HL$Hu^l$$Lt$(L%HHIL$MD$1HL$HHtMt HL(HD$8eH+%(H@1[]A\A]A^1HL$HHul$E11|$H@th9s=AHL(fH5OdHIL7D-fPLHHf/HHHHH5H@ff.@H=1P?S HeH%(H$1H|$IHH7H$@uM\$ E1DL$LD$u D$9BAD9s֍ fHHH$eH+%(tHĐ[ff.=ATUS x=HHu U 1ҾHHu%fHHH=11ۋ5HcH H=H9s&Hcƒ?H<Hw`H1I5HcH;Hs6HcHHJ< HHuHxÅuHÅuH>15HcH;Hʼns H=[]A\1ҋ5HcH;sPH=ff.HHHp 1@AT0USHHeH%(H$1H|$H6H$CD$CD$HHD$ HxPT$fP fT$P T$P T$P T$PT$HPHT$ PD$T$(fPfT$*PT$,PT$-PT$.PT$/HPHT$0x( Lk0HHxHtPP(T$81;P(sILHk0L9LD5HCH)H/w0HοHp0 LHT$Hw Hl$@T$Hp8T$pHxXw8H@PH=u D$p"H=u D$pH=uD$pT$HD$H HT$tsH=t Lxf.D$HƅtdSHH1A;\$(s\f=غ Hk0ID$0HHLHLA;$u*QHHX봃&tSHHwHH$eH+%(tHĐ[]A\DAU 0ATUSHHeH%(H$1H|$ Hc{(H6H$CD$H{(HHSd19rx:tkD@@rHk0H@uH@@uHHp1p rE1LH(Hp@r@pr p1p$DH4넅u"fSHHS D$Hl$Љ ЊS! ЊT$ Ѓ=D$tf.D$Hƅt\SHHLcuAD9k(rMA|$t%f!AT$ED$LHHAI4ă&tSHHH$eH+%(tHĐ[]A\A]SHHSHHs H[C tHHxHtHx0tHAUHATIU1S15HcH;Hs:HcHN, Mt"Hu LHL립HrH=tH== HH5= HHuH== (LHHuH=H=jE1E1HH 11HHXH5H=t1v15H=;HsۉkHH0C Hk(H5 ЈC H>tHx H8HH둽H[]A\A]HSH1H=H=H=H=5HcH;HÉs [xen_acpi_processor: Max ACPI ID: %u xen_acpi_processor: CPU with ACPI ID %u is unavailable xen_acpi_processor: max acpi id %u, trying to set %u xen_acpi_processor: ACPI CPU%u w/ PBLK:0x%lx xen_acpi_processor: ACPI CPU%u w/ PST:coord_type = %llu domain = %llu 4xen_acpi_processor: ACPI CPU%u missing some P-state data (%x), skipping xen_acpi_processor: ACPI CPU%u - P-states uploaded. xen_acpi_processor: %cP%d: %d MHz, %d mW, %d uS 4xen_acpi_processor: (_PXX): Hypervisor error (%d) for ACPI CPU%u xen_acpi_processor: No _Cx for ACPI CPU %u xen_acpi_processor: ACPI CPU%u - C-states uploaded. xen_acpi_processor: C%d: %s %d uS 3xen_acpi_processor: (CX): Hypervisor error (%d) for ACPI CPU%u 6xen_acpi_processor: Uploading Xen processor PM info 6xen_acpi_processor: ACPI data upload failed, error = %d xen_acpi_processor: Memory allocation error for acpi_perf_data drivers/xen/xen-acpi-processor.cMemory allocation error for acpi_perf_data ACPI CPU%u w/ PST:coord_type = %llu domain = %llu max acpi id %u, trying to set %u CPU with ACPI ID %u is unavailable %cP%d: %d MHz, %d mW, %d uS ACPI CPU%u - P-states uploaded. ACPI CPU%u - C-states uploaded. _UID_CSTACPI0007xen_acpi_processorACPI CPU%u w/ PBLK:0x%lx Max ACPI ID: %u C%d: %s %d uS No _Cx for ACPI CPU %u read_acpi_idpush_pxx_to_hypervisorpush_cxx_to_hypervisorxen_upload_processor_pm_dataget_max_acpi_idxen_acpi_processor_resume_workerxen_acpi_processor_initofflicense=GPLdescription=Xen ACPI Processor P-states (and Cx) driver which uploads PM data to Xen hypervisorauthor=Konrad Rzeszutek Wilk parmtype=off:intparm=off:Inhibit the hypercall.srcversion=72D13263BCAC849CC08564Fdepends=intree=Yname=xen_acpi_processorretpoline=Yvermagic=6.13.0-rc1-MANJARO+ SMP preempt mod_unload  (0p0( p    ((  (0( 0GNUGNU&z0y #k>c8LinuxLinux]2X;,[%$yunh9ytcxen_acpi_processorl(;+z+z2+Q+];V;b z; ; ; ; int b ,; *;Vs8nVu8Vs16Vu16+Vs32:Vu32Vs64Vu64b$ " ; +  1b 2b H I X ] ^ _ `V;; <b  I A     #}; % & *+ 4 = B f! h: l m+ nI q] } S  ]  ]  b  b } f S !V6+'^^ n6"n^cvz+W:dH  Q  ( "7 Z  (  0 i8 @  H  H  H _H  H  H  H  H8@ |4PDhQQt~ b@3Kkp b(b,~0 8}@}A}BbD HPomem@+ b( "(s0b8s@bHbLPbX`bhp G xbb bbb6s b!6"b%& 9b:?AD F }P ( Qb(T 0[2 2 ++@ 5val }+ + T  ,@ 2   +  }+`    T   {{  T   |   b+, fmtQQQbQQ$| e f+gG hQ uG v:w: keyx L Uw V } j keykV n keyoV p6 7w 8 '8N QQQQAbAbA4b key9 (/b=w 8U V modW XQY Z ([ ,\N 0Qu,v,w1xbyb w +bVP+ /1b set3 get57 8$Pv  * M p  P( P08!@" ʷH# P$ X%`&h'3p(x)V*t+,ĸ-ɸ./ 0 1 2K3 n5 9 ; ݹ>V?@ !: key":?A+BC    mod    {=1>s !!s!% !+ !-!/ /b 3     (" " ++ " ; "?2B+ # b%     0&cL&dQ&ewu&gu&i u&lu s([ b[ s+z|+?['i8-@( B#(2(b(b( s (9(( b,(!b0(( 4()#8(*bH(++P(,B#X(5 `(6 d(8 h(: l(; p(< t(=bxjse(?D@Krt(@9Fodl(AF(BF(FJIB(I6(J+(Kb(OTI(XYI(]YIB(`"0C@(d(hb(kb (l+(m (niI (onI((p0(q sX(s`(ub(x d(yHh(zp({xI(+((( (( (( ( (H((( (1B((6(B(6PKmm(+h(+p(lJx( ( ( ( (+(b( b,( b,( b,( b-( b-( b-( b-( b-( b-( b-( b-( b-( b -( b -( b -( b -("b -(+(%&Kpid( e( e(+(B#( B#(((B#((0(@(KP(KX( (">K(%+((+(+ s(- ](. ](3 ](4WA(6A(: }((=+0(>+8(A ]@(D ]H(G+P(H+X(Ky?`B(N?(TL(WL(ZL(^M(k 2(mM(pE6 (qj6((t+8(u+@Kfs(xMH({MP(~MX(M`(aQh( Qp( ?:x( ?:( ?:(=(+( (b(^(Q( (A(b(9(!>( ] ( ] (q# (  (I (*7( (B#8 (Q@ ( sH (QP (QX (Q` (URh (_Rp (+x (dR (> (b ( ] ( ] ( ] ({9 (@ ( (nR ( ( I ( I ("xR ()R (  ( R0 ( @38 ( bX (R\ (R` (@3h ( (R ( ( ( (  (!b ("b (# ($+ (& ] (' ] (( ] B()6 (3R (C6 (D+ (LR (N+ (RS (SI( (TI, (Y+0 (] 8 (^ < (_ @ (` D B(a6H (d>X (g S (i~> (lS (w (x (z+ (} (~S ( ]( ]( ( (6((( }( }(+(b(1S(;S(ES(S (b((b,(8I0orcu(60(9@( D(B#H(8P(Sx(9( s( "S( S(S(s( ( ]( ((>B(6( (!"#($"#B(.6(<SB(F`*@@)]#) )q#G# )]#* #* *"}#+8#+9#+<#+=##,<#,=b,> },:8$,;## src,A+ dst,A +=$"H$s(-(-(-/b.$(.$.$ val. I.!I ."I.#].$$ I.*%.+&9%.,#f%/9%// %0f%0GU0 :>%.'%.(q.)o$$..] .1%.2%.3.4 .5+.6+ %(.%&.%$./k%.7%8.R&.+ fn. f&%a&a&%&R&1;&9cs1=]9sl1?]9wfe1A]1E9'9ss1G]9sti1I] 1K]9nmi1M] 1P] 1S]0 1V]89lm1X]9 1]]: 1d]<1f'5cs1+5csx1]1k&1'5ss1+5ssx1]1&1g( r151m+ r141n+ r131o+ r121p+ bp1q+ bx1r+( r111u+0 r101v+8 r91w+@ r81x+H ax1y+P cx1z+X dx1{+` si1|+h di1}+p1+x ip1+9'1+ sp1+f'2BQ)2C+2D+ 2E+ 2E+(9s2E+,9dpl2E+-9p2E'+/ 2F+09avl2F+49l2F+59d2F+69g2F%+7 2F++8 3+ 3+4%)4%%])04%/i)<4' )pgd4'Q)04'"))'@5H*5I+='bPb05 }45+86;`*6<!6=! 6? b 6@ b$ 6A b( 6B b+8@@7+72sp7+es7 ds7"7$7&7+(7+07287+X7+`cr27+h7+p7+x727+7b7I7+7+7 w2jfpu7 1@+8@@5+=h@5Nl@)+W5,=f5+5 )g 5}(5,5hg0C5?g85X5rgh5%gp5+x5 f5 s5g5B5R5g5f8 -8 8 -'(9 (9 p:- cwd:I swd:I twd:I fip:I fcs:I foo:I fos:I:-:IlI-+2:*- rip:+] rdp:,]2:.*. fip:/I fcs:0I foo:1I fos:2I :)>.+-+-0:@`.:A`.:B`.Ip.+ k:$/ cwd:%+ swd:&+ twd:'+ fop:(+*.:5I:6I:9/ :</:>`.}>.I/+I"/+?:Q/ cwd:RI swd:SI twd:TI fip:UI fcs:VI foo:WI fos:XI:Z-:[l:\m:]n:^o rm:_p:`q:a/x:bI,0+]$0+@::]0:; ]:< ]:= ]0]m0+8@@:O0C:Pp.:Q$0:R0@0\+@:^1:_5-X:`p.:a"/X:bm0@:c11|+8@@:f1:hb:kb:n]:q]xfd:t]:wb:zb:b:bC:0@@:1: ]:b:b fpu@:r2:b:+:r2:r2:1 :10C:1@@1; 2; ];]V2+(2+22+2 2<>%3)3>*B>+  osq>-%3 >/6?ɉ@36?ʉ6?ˉ(@(@(@(@!(@%(@'(@,(@/(@3(@5(@9(@<(@A(@D(@H(@L(@Q(@U(@Y(A04A1BA7B osqA9%3A; A<6A6A6A6A6A(B CC n5C :5C' D5DbDbDQDQDQE5E]E]'(E 6LctEn5E& 6 5/bF@6 G`6G e6 `6H 6HI6I(I 6I I I'J 7J+J 7J 76J *7J  7JR7J7J 7' K{7FK 6K *K 7K*7/bL 7'@L'*8FL(R7L) * L*>8(L+80L,8L-9L.:L/;798987*8'@@M/8M0}M1bM2 q seqM3@M498M5{7 M6}0M7 *8C8(N9N N+N 9NI " 9 989OJ9OO }OO9 J9P k9Pk9+{9+ P8T9Q9Q } Q9R+9R,R-xS:S:Sb`S+h maxS+p+(:+ T ?: sigTk9 T(: UR USc:K: UU UV:h:qV:V V s V :V':V(V)V-;V. V/V0 :V1V5J;V6V7V8 : V<;V=V>V?V@VAVS;VT @VUsVVs VY;VZ @V[ V^<V_+V` Va VJa<VLVQ VW;V\;Vb; VE~<VFs<Vg<Vh _fdViVm<VnsVoVpb q V%5=V*:V2:5_rtV9;VBJ;Vda<Vj~<Vq<20W s=W W W W <0W =5= Ws= =W =W!W" ?: W%>W'W:W(+W.t:W0 ?: W3!> saW4= X c>X "X + lenX +X }(Y~>Y Z$>Z%)Z'Z( 0ZD>ZM#c>ZP}(ZW})8[ Q?[][][][][] [#]([,]0\)y?\*]\+{7P\8?\9?\:bH\;bLQ??+'8\D?F\E6\F@3\Gb0' ]>]@]K]Z]p]]] end]]@Vl@\+^!@^" b ^&l@^D@^D@ ^D@^E@^E@ ^E@^T A^Y@^Z q# ^[@_ (A val_ _ A_ KA val_  _ 4A(SA(U ](V ](W Gb([A0(h1B(i@(j(kAcpu(lb(m](n] (o]( (xB(+((((B(+( IW@@(0C( ]( ]( ]( I( I(+ (+((+0(b88@(D( ]( ]( ]( ]( ] ( ](( ]0( ]8( S@( ]H( ]P( SX( S`( ]h( ]p( ]x(  ](  ](  ](  ]( ]( ]( ]( ]( ]( ]( ]( ]( ]8@(*F(xBC( 6(! ]((" ]0(# ]8(%@(&P('Q((R()S(, ]X(- ]`(. ]h(/ ]p(0 Sx(1 ](3 ](6 (7*F(94F(;4F(=+javg(GB@D /F0(KF(L(M+(N+(Ob (P$(Q&(SF(9F0(]FF}FFFW(`8HC(a6(h ](i ] (j ]((k ]0(l ]8(s S@(t ]H(ubP(b(b(b(b(b(b(b(bC(7XC(7rq(^H(F(8H(F0(^EHJHB#YHFrqYH(H1(b 1(b 1(b1(b<(H(((((Ieb(Hes(I(3I(3II{( @IEI OIcHiI+! sIWlJSl4 N@ }D }H*7P+` +h)8p+x q#4 s}Ipidp`7K`9 9`:b`; q#`<) ino`=]`?x `@@`BWHLrcu`C6``DpqJK+ a>KabaWK'boLbpB uidbq (A gidbr KA bs (Abt KAbu (Abv KAbw (A bx KA$by b(bz0b{8b|@b}Hb~PbXbM`bMhbMpbMxb sbٝb5lb=bޝ=CKLkeycÒMc9cZ=cۜ semc4(cPc sX `c :5h uidc (Ap gidc KAtcfxc|c~c c+wcL M M M M MkXd^aQd_9d` }dadb dcdeW dhB#8dk=@dnXdq`dsddtB#hdwpdxbtdz6xAdbAdbdbddFd7d * itd;ddy?dKhd }dKd]ttyd`djd Ad]d ]d]d]d]d]dWAd+d+d+d'+d+ d+(d"+0d,+8d+@d+Hd"+Pd,+Xd+`d+hd>pddoddd bdd}ddd+d@3d40Mf dQdq#d9dWd fQ Q Q Q Q QXecURedBee }eg ek q#emlen1(eo0eqtU8Q ZR= iR sR fRffof{}R RR+ R R R+S+? S S9,S+ ,S 6S @S'hgySgz ]g|bg}^=]g](g80g+Xg#^`JS S S S S S2Th:Thshshh pTh!h"  h$bHh'Th(Q keyh) h*Th+s h,s(h-s0h. T8 exth/T@T:T h3' h8BU tph9BUh: sh;Ih<IpT 0: i _UdU"oUoUtU iUiBiiSU/b V+/bKOV/bWV@ XqVrtUs8 wqvVH cpuwP Vr!V^xj9Wj^j9WjIW( lenjBHjYWPjpVIW++YW+iW+k#Wk$q#k% k' iWl+Wl, l-k@mXmXmXm Fmq#@@m VHm!+m"+m#}m$8m%tUm&6 m'Y0m(+8]cpum*@]sspm+`YHBX+`m6Ym7q#m8IWm:IW(m;+Hm<YPm=Xm>\Xme`Ymfb sdamgZmh miZYfxmDZmEYmFZmH mI@3(mJq#HmK@3PmL+pmM+xmN+mO+mP+mQ+mR+mS+mT}mU+mV@3mWKmY }m\+m]+m^Vm_`YpYZ+WeY(n o3ZZZZ+sZo6.[o7Zo8Zo90oAV[oB4oCZ(pq[p 9q q"q[q[qq#qw[q[[qbqssr[r0r0r"+\r#:r$r%r'O\r(r)r+s\r,r-r!\r&[r*+\r.O\ r\[ opsr\s\ \\r2 ]r4+r6br7b /bg@5]/bgH^]gp]gq5]grgs] ]2g]g\g+g]Fg6g+gg]+]]'@g^g^]g+g+g+ g }(g,g^0Lrcug68g^H]\g^g idg^^\+g^g^ ^(s'_s sSss t _t]t& t)4 ldtt*_8t.+@t9@3Ht:sht;`pt= }xtC+|tD!~ _u `usu+ altu+u+u+ u+(uv0u8u@uHuPuXu`uhupuxuu u!_` tF'_25\ a5^ s5`b5XV[5@]@(5Xf5Y4(5\f5b+5h+5tA5w 5}$^5f5+5+h5g+fX56M5?g5d5d 5hgjrb565+cf mg wg|g8ff5g5]cid55 @@5 g5 }< 5h55+5 1S@@5k=g@5[@5+P5+X5+`5+h5+ppgd5  +x5) }55 }5?k5E+5Lb5S }5Z 5]B5_5aq#5p45r55+5+5+5+55+ 5+(5+05+85@@5q#D5+H5+P5'+X53+`5+hKbrk5+p5!+x5+5+5%+50+5k5 l@5!l5`5+h5q#p5+lx5B#55l5 f5&?l5+5+55 }5 }5^5B5tU5Il5+5+5B5 gg+ l+3^l+ l &l 0l :l Dl+]l\+6v66v96v<6vG ld}l[wSx,lx- q#x/ Nx0sl0y39my4Hy6y7y8 } xay9l  z{mz+z7zm revz+ {mzmzZn'zZnz }z }zZnzQLrbz6 nszv0zb8z<z Y>zo@ idz]`z shzopLrcuz6xm zn opszkoz!uoz zZnhzfozpz pz"pz$ pz% p z& q(z( 1q0z2 8z9}@z: 1qHz= TqPz@mqXzA q`nfo po zo5dirz9mzmz_n oo zp knzZnz fzoz sz@3 z@3@z`zhz "xz  z  }@z  }Az %gppop"ppppospspoppspospp"qosp1qp"q5JqpJqOq 6qmqp+Yqqprq/b{q0{'r{(q{) l{* r{+7r{,Ar {- 8$(qdsrv-r-r2r rdv }A? } "߄ z:τf0uQvw(xPydz{ |(Džops$~ ׅ  "ׅ z}Dž zb܅MNQOQP!wQ!wR!w T+(UI0V8W @X HY P[X\`^bh_paxcd  pmfgh} z&`&aQ busbld eQg} h-$j(k0m8n @oHp PqbXr`s!wht!wp pmvgxw  py$ DDy|0b z~Nu`23Q5!w6!w8I9 8 ; M(< 0>8@(w@AaHC {P pmEgXq"3D3Y"HH=vaDR"{Dwwf0XۉYQZ!w[I\ #^  pm`g(ۉ+sJs "BDEFGĊHlIsJ  2AOK :@+ɊN/O+PQ (+},-}.}/  0pq fr s t su v+$k(}/" #3&3'3' 8 32aq# g{l+='=a234I len4I2ό+6]18όijkWrLst lu6'R$TbU@V W)Xό YS0[X8_"$``ha+pbsxFd{mnLd_uvLL8x{S| Y}~ (A KAb ! (lJ0 s8+@=H ML P :5X :5` :5hIpItIxI|q# BI4++++ b0@H }P }T }X }\}`hB}Ip8}°H P(X`h sp.h+''@%%Hp ( 0 8 @ ۖHhPX`h8@ M+  i(!0!8@"H+P+X+`)h4p }s&#/9$HM  W  f a kb (B` sI:5:5!I"u/ z0 14 6b<@3 BQ@D"$HFטPIBXL`O dRVhSpZ5lxalblorcuc6dtUf@3k0Bnq#@@oHqq#Xr`)/b%)b>>C$ό*k>bQkM>u)")")S"ۖ)"– E"F)GHI;116;c mnt 1 );"}cm)) "#N nid&-+4+71S'RØSUXYZ bc 9 dK(Lrcue6HgsXj` idmpptqQxr)u+טטܘØB y y y" y$q#'@@y-H lruy/y0B  `2s nr`3 ns`4s@6+M\+ val] /b ݙ ݙ  6PU+ P c c'clLrcucm6cn9co }2cv˚cx+cy &cu+5xc+(cr,ct+˚c6c;cQ ,,rq cfcsc k@s{+ cMM1fcc{ keycMc6gc clc6c,c :5c :52(cwc+c+c6c;c " (cc+,^ ccc (M c֜c@+ ֜ r 9^+0B8@ uid (APBX }`$ hbb 9b gidb KA\+gbٝbrcub6r>+?8d\d d! d"+d#]d#] d$+(d$+0d'd(]d)]d0d1 d2 d3 dCԞdDdLdMB#dNԞ8dQ6dR }dSԞdTK\K+K[+ [ e9+  B#'0WF6 '` @Lrss ;08W@ }X g fn 8$ arg sw+ bg w  IeSƠeTeUgeWeXleY6'8eI' qeJ, ioceKUR=Ơ e\b0 ' 6 W val @ z val c v + %GbT++ rn/ ;. R0  4; 45b67+   (A W KA zP~b Y  F5F5(F58  fHО(:)*+ ,0-@3@. q#`/ }d0h1Ƥp2 x3+4  ] val : F/b6 BEƤ5uidF (A5gidG KAH ]DJiHj      ( 0 :58 :5@H4+ b(b, 0 8s@ 4!߫ 4@89Ѧ:Ѧ;Ѧ<Ѧ= >(?0@89Ѧ~֦ƤXDEFʧG ڧHI J(KѦ0N 8O@Q*HSP~ʧ"ڧ~ϧSߧ S ]*SxYZ[]\]]]^] _](`]0aS8cS@dHeLf]Pg]Xh]`iShjp8bbbb bbbino  B( B0b+ sbbb bbbbX?ѦXXѦ {(08@ګHXPs?!XbDvv]Ƥ/իի8 ; b 4 ;0 KHKops![ SK+j[+߫k+Mw} s" +D ] w (ۮ0 8 @ 'H 7P PXs`h p įxݯ  3ì) & f&dDlJ0}]lJ&I"mmr b flJb[&|ۮ flJbb&s6lJ6"&}'&N"7&,P<slJ&&U&x}&"&}ݯlJ&ɯ f 6" f3MbibhX6M! v"SM S " b   8@Z[<\_]}^` b(d0e8f;@h^HjPkXm`oֻhppr !xsNugvy{м}4w     (0 f #pidK6uid (A(A $  +bb bb M @3 ]h )X*6+#,0-0Ps80X  CXsi+   Ľݽ ( 0 8Ѧ@H.PX.`Qhop x  ؾ   n     %* 4 >C^ R \ f pV+V+$0}ԶԶQ]bٶ pos 0 b* fM f"p/p fQpRb u fԶ5ʷ fJq fb+Ϸ f+S f3 fV f8t f[ f y+ĸ f++++S S fpbθ fp Sb< f<[AF n fP"o fs f fbݹ f fbb b)<S)b#QZ)SZ@A};SdS})";S)Y})S)S);;S)Q^;S)Y@;S)YMc;S)S)bѻ;)ѻ;IbFrۻ!)"DSD]]I &gSSS) fbYl;S fYм;);)ռ;) 4)  cmt [ +rrS9cGbS"ĽSݽSɽS"|.G)GL 3o+"Vo)t"ؾQS~ݾ ܘ#  -2)ZiQs< o+ * : . Iff{    0ȿ ԿPQP(EFQ modG  opsH!I 5J K U<"PL5argM s5strN55arrOV0WbX"0 \ max^b_b num`; opsa!bs:r&'0(F)s6+ +/ b + /*VD+7`-.t mod/ @0tH mp1P2>KX 856s7 9 >; S <g(= w0"D>Q "S QCg X"w lGb>W8EmodF CGWPp(qsrss}tbjmtnw o ob""0 tyDUs+1(  T`YU QQ+#| /b-PȦzz @vP  idg cls $"#D3wwabb+GbGb8 a0'!l", 'Gb1mGbBGbOc d&1e2mf4g} lidh}  Vy  (-] <A(cmaP [01Q2 e3Q46X7`8h9p:x>+?se@/c0h ops1"9 dev4 z56(78 m w(6/ +V+]+]+/b4 get put    ( %0M8p@HPX`hpx3L`4QrRb idSbTrcPfghhbi0hh"h}rvrD r}%rQMrQbs*prQ RQruhrhrhhrQrQQbbwr>s3hLrb8`hQ  I "s q/b)(47566:7:8:9:!7 .[BdCD:GHI:/bPUVW .[(XXY .[8\ ]^6 qos_ 0/bcTp8mn65flro<pHkl%qT devr z@kp}m id~Q+Fz]npss]ops+ }(@30P`(     ] ]0 I0"0s0 I0. <4]<iI "<I,<IJJ 4iO<<II< II'IJR sWuIs[0oR/b[[ O+ Q+ W Y" [s \  ]0+<    <$            pad   $0( u0 I0t?uXvXwqxy z(Xm6Dqm+]m$vm+$mI6?64DREFGIHI JI KLzHOPIQIRISI TIUIV]W X!Yz"@^_`+R&+fP\U]bH(gh]i]j]k]l] o pq+rstuv]0yiz]{]|]}]~] ](bbb(0U8&`b (@]]]]] (]]]]] ++貯bbb( 08&`Ib@fߒI idII &(%x#h!m]dev z}+ px tx             ir   Q ! mbz" # / mfn1 2 3 5  reg6 BD  regE  K regM  mfnO P Q V2XY aMc    day   min  sec  ns tz   M   A AQ+(       <  m p(}MMMQQ<8t.u { | um           = }q  5cfg emem=p .} (7  u ~      cpu   '*- /now2 HSIJKL M PQRnumS0US0WregXYZ[ \$dp]"(0_ al1b 1c 1d 1e 1f ij kl!op q r s t u v 0yyz { | } ~   (0(      h_   (!y08 `Mh'l'epdc'pid  d      =  v  pxm   pxm     =   VY"""Q""" "2"""7"~"%"" "="v"""epad" cmd  u=6fD Y ]+D Y ]+Y D'b D)@3 D+6 D-6 D/6 D1! U>4 >r ]+5PR ]+_ PS ]I+ 9PTI >Xs >Ys N rN s_ +S++_ }SSbH Hc7I_\\aH%\'HAHQus[H Iuus[ W UN ;6~:N!]OQH2stNH8sNH?sNN? 3N? 3 svN~9v 82N =I~<_fQHJ }VoU bN H _ N SN,Q_s)}N_ 6DbNCtCIiEQL3  % Qs $ &, U ----,4 Ust{IiIrcm=9?))s% U T8 Q0 R ?P  ?a?)}`   $@0% U  T v:J)+J)+: Ipr$)%&'v:)'+'+( v:)( +)( +-Q3 3i 3id n3p3|J*a*R 3  Q43  -Q#3  % Qv $ &Q:3  % Qv $ &-,) T ---,H U ,` Uv--]+{5 !]wq tU `fx ` 3 f U @ Q  BoUIrcm> > Sd  p |au    %Y( T0-O U ]+  t )IiIrcmt> > :I_pr v:) + +?))s`   % U} T  Q %5' U}Q3  % Qv $ &S @T% T( Q S* < I V-TqQ^   % Qv SD 3U `vt 3 v3 J*T*7DnQ*R`   - : G T%5' Us,) T ,)# T ---, U< T Q R  X0 Y0% U  T  Q0 R0,O U % Us]+ 5IiDvf++Q3  -E !2  sib}}}}tF Flvl&IF1srvA[)HI)I>JtmpK>L>M')Nm:vPh  ?h:G)h}i h  $J@0% U  T  Qv:GPn  ?n:)n}i n  $J@0% U  T  Rv:Pu  ?u:)u}i u  $J@0% U  T  Qv R~:Py  ?]y:)y}i y  $J@0% U  T  QvSm  R0 < GS s  R0  < G,  Us T,f3 Us T0 Q0 R,fd Us T  Q0 R,7 Us T  Q0 R, Us Qv, Us-e(]+ tb ) op!Y~Iret%Ii&b)&b)&bm? )6)6b6? P9  ?0 9? )9}` 9  $@0% U  T  QsQ+(  aOPOU****S3  aOPOU****-e(E   Z_pr 2err.  &_pr:7ret7opY$_  [ D D  &7ib Y   b}Y   b}> > ] + . O &pct8O $"T . . &_pr5&dst+_ b} }}}.+&_pr*$'_7ibz b s} }}}.3 &_pr3:7op5Y; ;$ 7cx<7i=b7ok=b7ret>  @@sYc  bcc}7Yt  (btt}nYy  _byy}D D EZop0 + + + + + +YE}4!4E(syZnD!N!ZN E|.s!|D!|PNbE%b!<!}Ez0!zCN!zX+.w^f&cpuw^#Iw` vw` +w` +E}!6oUE}Zwq8V!oU! <E } ! D ! PN!  &l*! l;E x}d! x(S! xCS! xVbU &dst 86$ Jb7len b wsZp ?{! IZgfp UN    ! 0 A #Q #a #q # #wZp ${Zq ?{! R       i, #< #L #\ # #x      # # # # #w#}! #:! $! %! &! '! (p U U U U U U# U# U# U# U#  W W+ W: WI WZ W#j W#z W# W# W#w}i! :! !       + #; #K #[ # #.3!}$3<}. O!}&ptr ODv. '#s$ '0.8+$82S$8F+$9+7val<+."}:&key"J?$"Z(V :.}m&nr+$;m<.a}&nra#+$a?7U@&nr@@$@\U&nr+$6UB &vBI $BSU43&v4H $4RU&V&v&C $&M.&+t$B+.}&nr+$?m.}&nr4$Vm}.}&nr4$Vm.}0&nr'+$C}UBT&nrB+$B:.}&nr+$@m7pS+7val+.I}&nrI*+$IFK+7pL67oldM+U$&nr!+$=+7p6UU&ptr< $H$.,}}&p,; $,Kb.(}&p(: $(Jbx4L F Q ^*k^ `y  3 X UUT T x #  O ~  @# y. 3 ?  K JW c cz @  % T0 Q 4m a      n * R   - : G T4a4p444T44444% UA Q0u% 5t 6  B y%  6  B y yY   j  v J 4 a  (    n * R   - : G Tc[ "` l cv !4 c ! v   $J@0% U  T a 4 T \" R   $@0% U  T  Rsu " n OPOU****S ,# ,OK# U ,Oj# U ,# Uv-e(x+ 5' <OH~S_*kvcD$% T0 Q T %4T$R c  $@0% U  T c%4c(%)v t  $J@0% U  T uq "& n OPOU****T7%&4RT_&`R y  $@0% U  T  R|,O' U ,'' Uv-e(x ]Y(  Sr '  R d  *#, ( U ,( U ,#D( Us%L UsqH  5A : F ^  q q     Iint F ,  * +s8R+u8e+s16}+u16 +s32+u32+s64+u64P \    1F 2F Hc IP X ] ^P _ `:   <F  '   o   #SB  %{ & 4 = B h n' } 1  ;  ;  F  F   $1  XXX0xx : JKL Wx K  s \x1MH  5  G "V y  ( ;$0 t8 ]@ "H "H "H ~H "H "H "H "H$@    0  RP h  5 5 F @  E F 1/kp J  F( F, @0  E8 B@ BA BB FD  OH sP8mem T@ t   F 0 e j  t ~  ( 0 F8 @ FH FL P FX ` Fh p  x F F @$  F  F F $  F !$ "F % &r' 9F : ?0 A0 D } F  P  QF( TE$0N  ; cs =;sl ?;wfe A; Ex ss G;sti I; K;nmi M; P;  S;0 V;8lm X;9 ];: d;<  cs  csx ;    ss  ssx ;   g r15 mr14 nr13 or12 pbp q bx r(r11 u0r10 v8r9 w@r8 xHax yPcx zXdx {`si |hdi }p xip x  sp   B  C  D  E   E (s E ,dpl E -p E' / F 0avl F 4l F 5d F 6g F% 7 F+ 8  % %% )%/ 9' pgd' )'"  @H? I!_0_0 48em f g h u vwkeyx\m  U V ? j keyk n keyo ;l<=? F @ F$A F(B F+$-@ (y0FF  4( F,!F0( 4)Y.8*FH+P,(X5 `6 d8 h: l; p< t=Fx5se?@@/rt@A8dlABBBFD%I2JKFODXD]D%`"w>@d]hFkF lm nD oD(p'0q Xs`ubx dy/Dhz0p{D 0 0  /D00 x=01(%2P/mmhpEx    F F, F, F, F- F- F- F- F- F- F- F- F- F - F - F - F -"F -30/pid * *( (00((000@>FPCFX 0"{F%v(v+ - ;. ;3 ;4<6=: (=0>8A ;@D ;HGPHXK:`%N;TGWGZG^Hk -mHp0 q1(t8u@/fsxHH{HP~HXI`Lh Lp 5x 5 58 ~FL o<F\4h9 ;  ; u1 2" TD p2( (8 L@  H MP  MX M` Mh Mp x M /: F  ;  ;  ; 4 <  M 0  '  ' "M )M  0  M0  18  FX N\ N` 1h 0  N      !F "F # $ & ; ' ; ( ; %) 3*N C$ D L/N N R?N S'( T', Y0 ] 8 ^ < _ @ ` D %aH d9X gIN i9 lSN w x z } ~XN  ; ;  $  FmNwNNN F(F,vD08rcu04@ D(H4POx4  " O OO  ; >% !"-$"-%.<(O%F-@@l$@@q-spes ds"$&(0-8X`cr2hpx-F' i-5fpu ,@F(  '$@@!d@&i@ , !c c B(,Gd0&d80XQdh%`dpxb ed' Njdb !  >!val   R!! ,>!!! !!  ^! !!R! ! " \ " ?? 2"R! " "2" F, #fmt555F55$O6,# 7 8 8#5555'F'F'4Fkey9 #("F=#   8U;$V0modW;$X5Y@$ Z ([ ,\#05u$v$w$xFyF,## :$ /$1Fset3Cget5\7 .$D&;$ 5 X {  -( -08!@" ߙH# P$ X%`&/h'Hp(/x)k*+,ٚ-ޚ./ 0 .1 2`3 5 9 ϛ; >k?@=$ !'% + -/  :' !key " ?h' A Bm' Cr' h'' =' >:' '  ;{' ! $0"c("d5"e."gL"i j"lo 5('# N# Np$(cwd$'swd$'twd$'fip$' fcs$'foo$'fos$'$($'l '($*(rip$+;rdp$,;$..)fip$/'fcs$0'foo$1'fos$2' $)B)((0$@d) $Ad) $Bd) 't) :$$*cwd$% swd$& twd$' fop$( .)$5'$6'$9* $<*$>d)@B) '* '&*?$Q+cwd$R'swd$S'twd$T'fip$U' fcs$V'foo$W'fos$X'$Z($[l$\m$]n$^orm$_p$`q$a+x$b'! +@$:Q+$; ;$< ;$= Q+ ;a+$@@$O+&$Pt)$Q+$R+@ +2P@$^,$_9(-$`t)$a&*-$ba+@$c, ,E$@@$f,$hF$kF$n;$q;xfd$t;$wF$zF$F$F&$+@@$,$ ;$F$F Qfpu@$d-$F$$d-$d-$, $,0&$,@@,% -% ;%; :- - --- -&N&N&N'8.'92.'<2.'=2..(<Y. (=F (> (:.(;.7.src(A  dst(A .."F).  () /) /val) ')!' )"')#;)$ / ')*G/ )+&G/ ),#t/#*t/*uQ* L/)'/)(6)).%/).; )1/)20)3)4 )5)6 /()30 )%. )/y/ )7/8)`0)fn) t00\o0o030`0+>0+?+@+A'cpu+C'"F,0     - 1- 1  1. 01.0/ K1/ 0a1 0"0u1K1 0a11 11! 1"1 2)12*'2+2"osq2-01 2/0(3 23 3 0304P244P24P224 p24 P2424U24P2 52(5 25 5 25p2"F6 2 @6'q3(6(26)  6*3(6+406,86-96.:6/;2332q3@@7/470~71F72 6 seq73;743752 76077 83(8G48 x88 W48' R4R44G49499 94 4: 4:4 4 :84;4;  ;4<+5<,c<-cx=_5=_5=F`=hmax=p o5 > 5sig>4 >o5 ?RE ?S55 ?U ?V55A@5 @  @  @ 5@'"6@(o@){@-`6@.@/@0 5@1@56@6o@7{@8 5 @<6@=o@>{@?@@@A@S 7@T $@U@V @Y17@Z $@[ @^b7@_@` @a @J7 @L @Q @W6 @\ 7 @b17 @E7@Fb7@g7@h\_fd@i@m8@n@o@pF A @%|8 @*5 @2"6_rt@9`6 @B6 @d7 @j7 @q70A 8A A A A 80A 8|8 A8 8A  9A!0A" 5 A%N9A'5A(A.5A0 5 A3h9saA4 9 B 9B B lenB B B(C9C {D$9D% D'D( 0DD/:DM#9DPB(DWB)8E :E;E;E;E;E; E#;(E,;0F):F*;F+2PF8:F9:F:FHF;FL :;8FD;;(FEFF1FGF0 G>;GKGZGpGGGendG; :;2H!;H" F H&;HD;HD; HD;HE<HE; HE<HT L<HY<HZ u1 H[(<I o<valIZ I X<I <valI f I {<S<U ;V ;W2"6F[=    0hx=i;jk<cpulFm;n; o;( == ',@@w> ; ; ; ' ' (0F8$@@ ; ; ; ; ;  ;( ;0 ;8 1@ ;H ;P 1X 1` ;h ;p ;x  ;  ;  ;  ; ; ; ; ; ; ; ; ; ;$@qA=& 2! ;(" ;0# ;8%0@&qP'qQ(qR)qS, ;X- ;`. ;h/ ;p0 1x1 ;3 ;6 7qA9{A;{A=5avgG=@@ vA0KAL0MNOF P$Q&SA(A)]BBBBBB,`C&a2h ;i ; j ;(k ;0l ;8s 1@t ;HuFPFFFFFFFF&2X&2rqCACB)^CC(CBRrqCC;F ;F ;F;F9/DSTDBbCBs'qDqDTD? ~DD D CD'' D,EqRjS @ D Hp2P` h)px u10S DFpidpJ7>FJ9 4J:FJ; u1J<minoJ=;J?y J@]@JBSH.rcuJC`JDypE xSF K{FKFKZTSFLoGLp'uidLq o<gidLr < Ls o<Lt <Lu o<Lv <Lw o< Lx <$Ly F(Lzy0L{y8L|y@L}yHL~yPLqXLH`LHhLHpLHxL L}L iL8L}!}FGFkeyMHM4Moz!{M| semMS(M|PM X|`M huidM o<pgidM <tM{zxM|M~M M||M|G H H H H H:XN^LN_4N` NaNb Nc0NeS Nh(8Nk8@Nn]XNq`NsdNt(hNwpNxFtNzx'NF'NFNFN]N](N2N itNN4N:NƀhN N>FN\V_eNW_fFsda_gX_h"_iX WCx_DX_EW_FX_H _I1(_Ju1H_K1P_Lp_Mx_N_O_P_Q_R_S_TB_U_V1_WSF_Y _\_]_^T__NWp WXUSW`NaX a+ a+a" Ya#a$a%a'/Ya(a)a+SYa,a-a!Y a&X a* Y a./Y aYXopsaYSY YYa2Ya4a6Fa7F "FQ@Z   "FQH@Z   QpuZQqZQrQszZ uZQZQYQVQZ(QQ3QZZWZ@Q`[Q@ZQQQ Q B(Q,Q`[0.rcuQ8Q[HZYQ[QidQ j[[2Q[Q[ [(b\b2"b1b0b  c \c;c& $c)Sldtc*\8c.@c91Hc:hc;]pc= xcC |cD~ \d ]ddaltddd d(d0d\8d\@d\Hd\Pd\Xd\`d\hd\pd\xd\d \d!\\] cF\\]^ `FX^lruY0] d0 e0i>^ j  k(Rn^]hE^s (u^zpp{^|}~' ^^^_  ^3(Q0_>^n^^^7R_ F  9 k_val)R_0M_N PF*J_BlruK0x_*W_X Yk_0@GL`I_UEV  _([ 0\ 4^84@Fj`_-j 0(m`noq r s t vF 4@l`j`-z 00}Ta~     (0 a04@|a`Ta- ,Da!L`!`@!a)a, b  u1   E  q(F0F4G8w@pP rp  x#Օ$ % 'ڕ!a5cctx6c c=Cc>AS@;(X`cYS(\cbht%w }$0c4cc-*daaX Gd5rb2Cc Ld Vd[dc`cd;cid Y@@ d 9 d0 mNZ@@h!d@S@PX`hppgd  x) 5 ?hELFS Z2"]'_au1pSr0$ (08;@u1DHP'X3`h/brkp!x%0hh@h]hu1pix( ib&i  ['T!i' dod h3 [h h iQ i i 5i2#e6N#e9N#ej gGMj gHj gIii 4j9j CjHjh,jh- u1h/ h0RjgAjigK ~g:j g@~ijgNj gO gP gQ r(g+Dkg,g-Bg.Bg/ ~jj 0pkqbr rs t u v $H(Dkji"ki#ki&ki'ki' kkkj(lju1j 3jBl7jljWl!(lk3{lk4'lenk4'k2lWl k6;k1l{lk8lkil kj0 kklS[krm ksx ktk7kukRmkTFkU<kVkkWmkXl kYq0k[q8k_"q`k`uhkapkbx(kdBllkmxkn].d_ukvlmm$x{q| }~ o< <F !e u(E0 8@H L rP X ` h'p't'x'|u1^ 'Sx0o  000 \?0$@$H P T X \@e`yh%Dp08@H P(X`h pm q-q'@kqkukukvk6vkJv k^v(k nv0k nv8k v@k vHk.wPkLwXkew`-qq$@u0 q r t(!0!8@"HPX`mhSp &!#:D$SXk 0 b b l vxF (%` '!'"/ 0 14 6F<1 B5@D"qHFxPI'XL`O dRUhS]pZ ixaxbx8rcucdTf1k0%nu1@@o0Hqu1Xr0`q"Fku umFuvv vmlu1vvF51vlvJvv;v^vmOvnvmcvvmqsvvmv lEvlFmlGulHlIvvvvwm)wmntm vm mwvGwGwB)w3wmewmuQw n"wn#nidn&n-n4n7mNnRxnSxnUxnX\nYnZ Fnc 4 ndSF(.rcuneHngXnj0`idnmpnptnq5xnrmnuxxxxwjwx'0o3xo4\yo60o7o8 Bxao9Rj  o4yo 0o" \o$u1@@o-\ylruo/xo0' 4yJ2ynrJ3nsJ4y0 ]y ayy2p yvalp; py"Fq y   y r1zrr r#sNteztjzt ez M MMlz.rcuMmMn4Mo BMvzMx My MuzzxM(MrA{MtzMK{MP{M5 A{A{zA M{{ M M {U{ { M{{{H{{HF{{{M{M{keyMHMK{3M| M07M2MA| M  M (M|MMMK{MP{M  (M| MzA|0 M|M0M =z* M|MU{| | |{u}u 4u[u0u'8ux@uidu o<Pu'Xu `u$>"hL}L 4LgidL } <}23L} L]rcuL}}:@@7g~7h2"cpu7iF7jF7kF 7lF7mF7nF7oF7pF7rF7s7t7uF7{  7|3(7} 07~38(7M@@}1~"F7:M        =3@^ N9n?8NN N! \N"N#;N#; N$(N$0N'N(;N);N04N1 $N2 $N3 $NCONDNLwNM(NNwO8NQNR NSONTSF| ƀ >Fր ր  4  v)v(0wlwwwS(w `x .rssx )xq0x8xS@x Xy fny .argy  ez bz z { 'OSA OT0 OUy3OWb OXx7OY8OIqOJiocOKM!A O\F0 b | ҂val|Z || val|f |ނ} v}  }%6F}T^    "q~      . 0 $ 4"F.ۃ   45F679 * % /4`  o<  ҂  <  PF >`  rKK(K8 bHЁ()x*0+0 ,00-1@. u1`/ d0uh1bp2 rx34 { څval ÅGF  "F6(   BEbuidF o<gidG < H څD4JH ( ( ( ( (  (( (0 8 @HЇ0 F(F, (0 (8@ Ї!;$ЇGF        @89:;<=È >È(?È0@8uÈ܈u܈bȈXDEÈFG HÈIÈ JÈ(K0N щ8O@QHSPủ̉q(qڅ։q̉xYZ[;\;];^; _;(`;0a18c1@dHeLf;Pg;Xh;`i1hjp8FFFF FFFino  ( 0‹F‹ ҋ QFFF FFFFX66 Y(|08|@H6PQuGw6uF"TuTҋ;wubw ^u܈wuD8  F S 0 (H/ops!8  q( 8 H*wm}r mwk\Ǐ! : T (0 ѐ8 @ H P -XP`dh p x   ̏ba!E B:E&JJO ?bErFSYbErFFѐE~~֐B -kkPEy2dUB~~iBEؑؑbݑ bkkǏ*?MF4e]-*! &q*ޒIN  F ޒ $@Z`[[\~]^`؜ b(d0e78fZ@h}Hj7PkXmҝ`ohp"pr @xsmuvyў{}:S` j t ~  ( b 1pid>F0uid o<o< $ p FF FF r* 1 ;4 )Օ-*+., -])P^F    $0c  &c=ltΟ    ( 0 8@9HMP9XM`php x Ϡ  ) ) y  +& 05 ? INۃ ] g q { : :$)Bߘߘ5r;F pos r) Fr5brXb~oi:{b5~oi]kF bߘՙbՙڙ \bFb/qbHbߕ4kbrrMbpb ٚb$PINboi~F.boiIN~F QbQSV[ 3\brreb ϛbrbr~FrbrbrrFԛF =F$m[qmFB5ymqy`qqB؜mqmBݜmqm7qm#Zqm5<}qm_qmҝqmqmFmםGw'FQ@m~'cqc;;h EqrqmbFўqbm֞m0m05 Sm0? mt S qX6F   qΟuqӟqq u9u%Mu>fmfk RuvumϠu~ru5~rԠ q\)ux==B . LQmyt5[ "@@AA5B0CFD֪ E<(sdF90GAS8'IF'JF'KF'LF'MF *  . 'PPW     qq  ZU2_rev Z99  95.rb2ns0F8< >Y@id;` hp.rcux opsJ!T r9hEi y"$ % ɦ & ަ(( 02 ~89B@: H= P@3XA Q`E O dir d > Ukn9b 1 1@`0h x  ~  B@  BA %`dddUydn~oiɦoiަΦd~rdՙ3drQdr8"Fz  0'֧(V) ji* +, - .(z1ۧ 1"5"5" "mW "n "o&X"0"1 "2 ~"3 "4y "5 ("7 ө0"9 8"; ө@"= H"?PWW )F) LF3~jFQ)1EtbFr~~өbFr~rbFrةbF"N" l" #lF)SF)5~q`֪0 u1 X0t7u LvQw!Vx*yy z (۪7LFAN[(oot֧A`t~ttiyiC }~(E>F5modG;$opsH!I JKa ܬì\׬HLargM strNarrOVWFX \max^F_Fnum`qopsa!b$0(;();=2L t F v   :7` -  .mod /;$@ 0FHmp 1P 2{FX  8 5r 6  7  9  ; ͯ  <( = 0r5~ͯ;$5;$ү;$6F >   ,8 ELmod F;$& G6 J       _,P p q r sB tF5mtn w  1  1 F   6;"ܬy=e& o y#QNW/Q  "L Aϱ>ϱ `   A > >  AG"7>G a M b L % Kint 1u8? #W   1 <!%',/359<ADHLQUYɲʲ˲  6 9 < GK 1 :@ 1T| 1.111-  g l - - - `J 9   % V9  `/V ,4p ,   : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 ( 'I : ; 9 I8 < : ; 9 I 1B I~ : ; 9 I&I I!I/  : ;9 .?: ;9 '< : ; 9 I8 : ;9 I k : ;9 I4: ; 9 I : ; 9  I8  41B : ;9 I8  : ; 9 4: ;9 I : ; 9 I k !: ;9 I"'# $: ; 9 I%H}&: ; 9 I'  : ; 9!(4: ;9!I )4:!;9 IB*41+ I,H}-H}..: ; 9 'I />! I: ; 9!0: ;9 I1 : ;9 I k 2 : ; 9 314 15 : ; 9 I64: ; 9!I 74: ; 9 I8  : ;9!9 : ; 9 I k : U;$ > < : ;9 = I 8 >4:!;9 I? @ 1A : ; 9 I kB : ;9 I 8C : ;9 I 8 D4:!; 9 IE.: ;9 'I F : ; 9 I 8 G> !I: ;9!H.?: ;9 'I<I4:!;9 IBJ UK : ;9 I8L : ; 9 I!8 M : ;9 N.?: ; 9 '<O41P4:!;9 I Q1RBUX!YW R1RBX Y W S1RBX!YW T 1U.: ; 9 ' !V:!; 9!IW  : ;9!X : ;9 I Y4:!; 9 I Z: ;9 I[4: ; 9 I?<\!I] : ; 9 I8^ : ;9 _.?: ; 9 'I<`1RBX YW a 1Ub.?:!; 9 '<c 1Ud'Ie : ;9 If : ; 9!g !: ; 9!h  : ;9!i1RBUX YW j : ;9 I 8 k  : ; 9!l : ; 9 I!m4I4n 1o : ;9 I 8p : ; 9!q : ; 9 r4: ;9 I?<sI t.:!;9 'I@zu1RBX Y W v1RBUX Y W w.?:! ;9 'I !x.1@zy1RBUX!Y W z5I{ !: ;9!|!I/} I8~.?:! ; 9!'<.:!;9 '@z4:!;9 IH}:!;9 IB41 >! !I: ; 9! : ;9!< : ;9! !: ; 9! : ;9!.?: ;9 '<H} :!;9! 1 :!;9!4:!;9 I:!;!9 IB4I4.:! ;9!' !% U$ >  &4: ; 9 I?'  : ;9   : ;9 ( : ; 9 I 8 : ; 9   : ; 9  I   : ;9   : ;9   : ;9 (   : ; 9  I 8 : ; 9 I  : ; 9  : ; 9 .?: ;9 n'I<.?: ; 9 '<.: ;9 'U@z : ; 9 1H}.?<n: ; .?<n : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 'I : ; 9 I8 < ( : ; 9 I : ; 9 I I&I!I/  : ; 9 I8 : ;9  I8  : ;9 I k : ; 9  : ; 9 4: ;9!I '  : ; 9! : ;9 I I : ;9 I8  : ; 9 I k  : ; 9  : ; 9 I k  : ; 9 I $ > ! I 8 ">! I: ; 9 #4: ; 9!I $  : ;9!% : ;9 I 8& : ;9 I 8 ' : ; 9 I k( : ; 9 I 8 ): ;9 I* : ;9 +:!; 9!I,  : ;9!- : ;9 I . : ; 9 I!8 / : ;9 I80 : ;9 1'I2!I3 !: ; 9!4  : ;9!5 : ;9 I 8 6> !I: ;9!7 : ; 9 I!8 : ;9 I 89 : ;9 :  : ; 9!; :!;9!I k < : ; 9 I8=I >4:!; 9!I!? !: ;9!@ I8A : ; 9 B : ;9 IC : ; 9!D : ;9!E!I/F !: ; 9!G>! !I: ; 9!H% I$ > J K&L4: ; 9 I?M'N4: ; 9 I?<O : ; 9 P  : ;9 Q  : ;9 R<S : ;9 T : ; 9 U : ; 9 I 8V  : ; 9 W I X  : ;9 Y  : ;9 Z  : ;9 [  : ; 9 \ I 8] : ; 9 I ^> I: ;9 _( `4G: ; 9 a.?: ; 9 '<b.?: ; 9 'I<( 4: ;9!I $ > 4: ; 9!I &II!I/ 4:!; 9!I  : ; 9 I :!; 9!I!8 >! !I: ; 9  :!;9!I8 > !I: ;9!>! !I: ; 9! !!:!; 9! :!; 9!I8!% $ > : ; 9 I4: ; 9 I?> I: ;9  : ;9 ( HS &P&)S+0PT s $ & Q s $ &Q%,PMOQOSPT]0]{V{PVPVPVP PS!P!]S0"P15P1   0U U& U UP P 6\ Q Q      (T q $ & QT v $ & Q v $ &T v $ & Q v $ &U;UU PP( ( (#?3% (#?3%   #?3%    0kSkSV#P#XVZP0VP+] :\0P]   T v $ & Q v $ &Sv0P)HP   V)P)hVmoV  T v Q v PPP(  ( ( 80Q/PT q $ & QnUnSUS0T0TnQnQnRnRZVV P+=PyPP=0=^0^1    001    001    00&1    00]P]P ]  ] ~0P*2P0HY0S0H~0BRB[S ~ R1   0U[[ U UTTTQQ  5U5SUSU0 00PPT~0VwSw~0PwV0*Q7EQEIqPcVB0R!R!&Cq 0|q 0#|#*(q 0&*Cq 0|q 0#|#*(q 0* R!R!&Cq 0|q 0#|#*(q 0&*Cq 0|q 0#|#*(q 0* 0RR 85p5~=p=~ V`S`~RTs#8@ (((@ 8\\JSJLs1    00=1   0 ~ U~ V<U<SU\P0PVRR] P tXtPP~~00PPTPV1   01    00 ~ U~!1   0U-S-2U2]S%02@0 Q  Q 5t ] &6P66(E(($>$$  <>@ = MQ` #2 J 26KP6 22222h 2225        ; .133;O.133;O.133;O33>O "%'''''==EI]'''*19  5t]M         hVt/ X< .< X WN K =Y ; XLJX <_=}O   JEp OWfY#W<gXu YXuY|O   . 0 }..| f |<h |t<K< }<0 } | ' }A | .Z2t| f |< |f</< s K <Xz. .uX/fX/M 0.{ f |< |f<./W.3Y   [zX YJ L KY}X   & Y}t%JV YL Km<J`fP}<%}./tX/<J}}t   s}t   }    @ t~ }  }kt)<AfXY  Y.| f |<[(f<0.J  XX* zX1BX ;X0Xlut  `t<KJY<K<K<K<KJY ^<cKJY<K<K<K<KJY<q[*<K .Zt g  X |2:02, +t !~  ~J;XL  hHLuJ    |.RJ-vY[u~J <X.~~f   X  .u~O   . X Xf'.. & <\ !~ ~X0 X s0X .uJPX% .XK[ MG J>gYv;g0x. <BztLhYj<.e.fKy :  X[3:K3S5-203;5;)<5f)< N)b)xtP2J <X.}f   XQJ0fgO   '< m& <\ Z  @tY~</ / tu [g  tXu Y 3o  .wt'y.! 6Z| f |< |f</ <[Y  J} x. .  WuuY [ J vY [w K . JrJ.}  }ft }.X }f</>~t.qO h g  ~J v<  .vX. hX<  W K#y)Y{ f {< {f<./W.1X        ___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemdup__resElf64_Wordgp_seqkset_uevent_opswork_flagsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocinstrument_read_writeparametersidletimed_releasestates_d_opmce_whole_pageacpi_typestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treework_bitssi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITdata2data4performance_platform_limitreschedule_countvfsmountextable_basenoinstr_text_sizenargsdisk_infoattributes__instrument_read_write_bitopset_child_tid_overrunrestrict_linksystem_wqtmpfilercu_read_lock_nestingem_perf_statetick_dep_maskacpi_processor_throttlinglistthrottle_disksi_errnos_inode_lrubm_controlsrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionalof_noderefsmmap_compat_basetrace_eventsenv_startdev_pm_qos_req_typedma_addrcnivcswthermald_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockederr_outVTIME_GUESTregsaccess_sizeslice_maxlast_switch_countqsize_t__compiletime_assert_104__compiletime_assert_105WORK_OFFQ_DISABLE_SHIFTcolumnsacpi_lpi_statefilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrspr_backupreturn_instancearch_test_bitsoftirq_activated__param_offclass_preempt_notrace_is_conditionalret_stacknode_idstate2powerautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesdescseqcountoom_score_adjoldbitd_seqia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sum__compiletime_assert_127freeze_ucounti_ctime_nsecs_remove_countsyscall_workxenpf_set_processor_pminfohas_cstdevice_physical_location_vertical_positionpcpu_infoatomic_long_tprealloccallback_heads_vopperf_eventf_securityi_sb_listfutex_statevm_rcupgtables_bytesget_linkfmode_tdevtacpi_walk_callbackrestoredelayed_call__compiletime_assert_134__compiletime_assert_136max_nr_cid__compiletime_assert_137_statusd_sibkernel_ulong_tdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stategsindexexpires_nexti_io_listdata3f_epsrcu_barrier_seqxen_upload_processor_pm_datalinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2int16_t__kernel_timer_tclass_srcu_is_conditionalxen_platform_opDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimerduty_offsettrace_recursiondev_pm_qos_requeststart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispacpi_stringrcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerbus_master_latencys_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrget_next_child_nodecursor_xcursor_ytty_structUTASK_SSTEP_TRAPPEDyearbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleFORTIFY_FUNC_memset__compiletime_assert_164io_cqelf64_symlatch_tree_nodedestroy_workDEVICE_HORI_POS_RIGHTxenpf_core_parkingPROBE_FORCE_SYNCHRONOUSWORK_OFFQ_FLAG_SHIFTsyscore__s64dqi_bgrace__compiletime_assert_86edid__kernel_pid_tsystemstatic_call_mod__compiletime_assert_89_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredsum_block_runtimepgmapmin_perf_statedq_opconstant_test_bitrcu_tasks_nvcswwritexen_acpi_processor_inittypetabclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_pools_addr_lsb__compiletime_assert_94__compiletime_assert_95__compiletime_assert_97i_generation_sigpollmxcsrPM_QOS_MAXd_rt_spc_hardlimitnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinei_inodyndbg_infoindexpower2statedriver_datathread_headdev_pm_qosmap_typebitmap_equalf_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizedata1legacy_max_cylinderdq_sbfont_heightsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycoord_typeenable_parent_state___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblinglfb_basemnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenHRTIMER_RESTARTsym_vdso32_sigreturn_landing_padd_initkbd_shift_flagsextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimeacpi_id_cst_presentnumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchacpi_evaluate_objectshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_events_sys_private__UNIQUE_ID_offtype735init_fs_contexts_subtypeheaderfuncperf_event_contextxen_cpuidtlbflush_unmap_batchsoftPM_QOS_MINresource_order__sifieldsDEV_PM_QOS_RESUME_LATENCYrcu_read_unlock_specialread_bytesfsverity_operationsxenpf_getidletimewake_q_noderequest_key_authvirtual_dr6__guest_handle_ucharkprobes_text_sizeacpi_evaluate_integerstatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherskmalloc_cachescompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timermemcmps_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printkvm_operations_structbin_attrs_newruntime_idleiov_basesrcu_size_jiffiesxenpf_cpu_oli_statesched_classshared_cpu_mapmultiprocesspi_waitersexp_hintd_childrendirty_foliois_softread_acpi_idcntsRPM_SUSPENDEDkmemdup_noprofreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idxXEN_PV_DOMAINWORK_STRUCT_INACTIVE_BIT_head_1_head_2backquirk_idstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qbufszfileattr_setrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsqueue_work_ononlineruntime_resumedup_xol_workacpi_processor_lxinterface_supportfind_next_bittotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitxenpf_firmware_inforeported_split_lockgfp_tseccomp_filterstimeuploadkmalloc_noprofi_mmapthaw_superd_lrusignal_structWORK_STRUCT_COLOR_BITSperf_event_mutexcrcspgdval_tsetattrxenpf_microcode_updatef_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statevbeddc_infowakee_flipsget_next_variable_nameset_aclbm_rld_setpids_activedriveri_opldt_usr_semacpi_processor_pxkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__compiletime_assert_742acpi_processor_set_throttling__task_fpstatemaskcore_parkingwait_queue_headclass_rwsem_read_try_is_conditionalacpi_tsd_packagefreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_start___set_bitlegacy_sectors_per_trackkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsxenpf_settime32descsfsnotify_mark_connector_sigsyspm_qos_flags_requestxen_copy_pss_data___test_and_set_bitsymdatasrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDexpires___GFP_HARDWALL_BITacpi_processor_txnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGxenpf_efi_timethreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotpnodefalsed_weak_revalidateremoved__compiletime_assert_101show_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_dataxenpf_settime64mce_countswap_info_structsequencert_spc_warnlimitac_flagblocking_notifier_headcoredump_datatasks_pidaddress_spacemm_context_t__q_size__call_single_nodestartupseqcount_spinlock_txen_processor_performancei_wbvideo_typeuint8_tpanelclass_idmode_attrs__read_overflow2_fieldinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_prune__UNIQUE_ID_x_748printedresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errdst_cx_statesshm_clistWORK_STRUCT_PWQ_SHIFTis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descspush_cxx_to_hypervisorexec_vmrw_copy__guest_handle_uint64_tfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeupload_pm_datauser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidi_rt_spc_timelimitrseq_sighandledev_pm_domainhourlimit0limit1dqi_max_ino_limitmigrate_modepoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwlimitkobjfsyncmtd_infoi_flagsaccuracykernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapdom0_vga_console_infoalloc_dquotpm_messageremain_store_size__q_size_fieldmem_cgrouplast_update_timeacpi_io_addresssystem_levelrobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevelno_hypercalls_user_nssrcversiongreen_sizearch_flagsi_atime_nsecrcu_tasks_exit_cpuupdate_capsulehlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagescore_frequencyidle_numsshowreset_typeacpi_processor_preregister_performanceunsigned charumount_beginvdsomin_freq_test_bitmmap_legacy_basepipe_inode_infouint16_tsecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiedinterface_versionnum_kprobe_blacklistfreq_constraints___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listsrcu_barrier_completiondriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapbitmap_zerofiemapwaiterssessionidxenpf_change_freqdisk_mbr_signatureresume_latency_reqinteger_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryspace_idelemnr_retriescapsule_countsigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readarch___test_and_set_bitst_shndxfreei_wb_frn_avg_timefreqfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitymax_states_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksi_rwsemoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memcapsule_header_arraypathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerxap_syscore_opsiommu_groupdst_pctperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockis_preparedvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7transition_latencypriority_call_addrWORK_BUSY_RUNNINGloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstate__compiletime_assert_84__compiletime_assert_87__compiletime_assert_88ueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_namemin_residencyproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincounttablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqcompat_robust_list_head_tidacpi_sizelast_statuss_inode_wblist_lockend_codeqspinlocksg_list__kmalloc_large_noproflru_geninsnfilldir_t__must_check_overflowdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intacpi_handlesleep_maxmbr_signaturemmap_baseio_contextrevisiongpl_symsregister_syscore_opsseq_showswait_queue_headacpi_object_typeblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fcpumap_nr_cpusin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceeval_valueobjcgfull_namenodevm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areastatic_priocpu_addmay_skip_resumeshrinkerdl_yieldeddqi_formatexec_update_lockl1d_flush_killi_versionxen_copy_pct_dataDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keysconst_test_bitxen_pct_registerpropertywchar_addr_bndkernel_symbolsubsys_datatv_secxen_processor_csdpid_ttask_listdomain_infoftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskWORK_NR_COLORSunlinkactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writeutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimesymnumdisable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsacpi_id___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_tcontrolautaskuser_namespacevfsuid_traw_spinlocktimer_autosuspends__rcu_headmce_vaddrquota_offthrottling_platform_limitdq_inusedqi_flagsfree_cpumask_varkfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenbm_sts_skipnamelencodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtime__compiletime_assert_756sched_rt_mutexdummylocked_pendingnr_deferredfown_structfeatures_lockedresolutiontracing_graph_pauseperfpermepfncompat_robust_listktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidnr_acpi_bitsspinlockpid_namespaceget_cur_state_syscallmod_arch_specificnum_static_call_sites__compiletime_assert_760vm_mmfortify_memcpy_chkdebugfs_idguest_permdom0_consolemem_dqinfotruei_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invoking__UNIQUE_ID_y_749i_lockd_nameget_ownershipufdsexe_filexenpf_read_memtypenr_scannedpcp_listpid_linkss_sysfs_nameq_size_fieldrefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipqc_dqblkacpi_ids_donemmappedseqcount_raw_spinlockFREQ_QOS_MAXkill_sbd_opset_cur_statemiscMIGRATE_ASYNCdevice_dma_parametersWORK_OFFQ_FLAG_BITSi_write_hintfxsaveprocess_keyringlist_op_pendingblue_sizeDEVICE_VERT_POS_LOWER__stack_chk_failllist_headpm_qos_flagsbyteswait_startthermal_req__arg2__arg3__arg4__arg5f_freeptrclass_raw_spinlock_irqsave_try_is_conditionalperflib_req__ret_condshow_fdinfoxenpf_symdatafixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqrcu_syncpreempt_notifierssrcu_last_gp_ends_fsnotify_infoxen_acpi_processor_exitfreq_qos_requestmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrund_parentpayloadac_minflti_sbphys_cpuid_tmatchcommcan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openstart_prevent_timepblk_lengthreadahead_controlcontrol_register__kernel_gid32_tspfnkernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabledread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tpm_qos_constraintsdetachget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclampFREQ_QOS_MINsuper_operationsbytes_per_linexenpf_pcpuinfosplice_eofutil_avgxen_copy_psd_data___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAPM_QOS_UNITIALIZEDpt_regspipe_bufsacpi_ids_mutexKOBJ_NS_TYPE_NETcapabilitiesctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infopcpu_alloc_noprofDD_CLASS_TYPE_LEVEL_NAMES__guest_handle_voidFORTIFY_FUNC_memscannsecsvm_private_dataio_bitmap__ret_oncenum_entriesphys_iduprobe_task_statetimerkobj_typei_pagesWORK_OFFQ_POOL_BITSino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharqf_ownerunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecfreq_qos_req_typegraph_get_port_parent__restorefn_tacpi_id_presentclass_raw_spinlock_irq_try_is_conditionalthread_shstkacpi_processor_limitgetidletimeadd_memtyped_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflenbit_widthsaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_maskmax_presents_rootra_pagesTT_COMPATfwnode_handleElf64_Symquery_capsule_capabilitiesd_automountclass_cooling_dev_is_conditional__UNIQUE_ID_ddebug736__UNIQUE_ID_ddebug738parentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeWORK_STRUCT_LINKED_BIT__UNIQUE_ID_ddebug740get_named_child_nodelaunder_foliocurr_target__UNIQUE_ID_ddebug744__UNIQUE_ID_ddebug746is_suspendedacpi_processor_get_throttlingvariable__ffsburstetypeei_funcsmodule_kobjectactive_memcg__UNIQUE_ID_ddebug751__UNIQUE_ID_ddebug753__UNIQUE_ID_ddebug755def_flags__UNIQUE_ID_ddebug759base0base1base2wait_queue_head_tacpi_get_typepage_typercu_data0no_updatequery_variable_infovendorcap_bsetmutex_lockarchdata_sourcepower_statenr_perf_states__UNIQUE_ID_ddebug761stack_vm_areasaved_statebasessaved_sigmasks_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcounterskasan_check_readname_linklfb_sizecmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_typepolicyshareddismissd_real_typelookahead_bandset_variableseq_startred_posraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirsread_memtypetask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionaleffective_flagsmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailslineno__dynamic_pr_debugres_cnt_freqwidthget_inode_acl_addr_pkeysettime32migrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeinvalid_phys_cpuidis_hardfsbasecompatibleclock_listvesa_lfbattrscpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainparam_ops_int_sigchldsettime64__UNIQUE_ID_license765acpi_psd_packagereservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetenter_acpi_sleeptime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclmemset__UNIQUE_ID_author763___GFP_ZERO_BITwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsqc_statesoftirq_next_timercheck_flagsxenpf_add_memtypeswp_entry_tuint64_t_mapcountdomain_taghas_lpihang_detectedchild_ns_typeqf_fmt_idgeneric___test_and_set_bits_vfs_rename_keyeventpower_resourceset_performance_stateclass_preempt_is_conditionalconsumers_cntmodule_memoryfreqpercentagepi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tentry_methodcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2a__compiletime_assert_737dma_cleanup__compiletime_assert_739maple_treeKMALLOC_DMAdentrycpu_itimerpower_setup_donepercpuset_timerel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpblk__compiletime_assert_741xen_processor_cx__compiletime_assert_743__compiletime_assert_745acpi_processor_power__compiletime_assert_747pushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magic__compiletime_assert_750__ptr__compiletime_assert_752__compiletime_assert_754futex_exit_mutex__compiletime_assert_758plist_headkernfs_iattrs___GFP_WRITE_BITd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addr__compiletime_assert_762d_rt_spacenameu_flagsIS_ERR_OR_NULLnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITshared_pendingi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevcheck_acpi_idsself_exec_idkernfs_opsWORK_CPU_UNBOUNDMODULE_STATE_LIVEvendor_guidapic_idnr_migrationsa_opsxa_flagsfreezebin_sizeset_pminfodev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITd_spc_timerjump_entriesasync_suspendmsi_device_dataassoc_array_ptrsuper_blockFORTIFY_FUNC_UNKNOWN_typercu_tasks_holdout_listcpuset_mem_spread_rotorWORK_STRUCT_PWQ_BITassoc_arrayxen_pfn_tmnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keyarch_static_branchnum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXxen_processor_powernlinkxen_acpi_processor_resumehorizontal_positionval_aval_bpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedlegacy_max_headdquot_operationsmappingRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_file___GFP_COMP_BITs_stateuser_sizedev_pm_opsbitmap_freescheduled__UNIQUE_ID_description764class_raw_spinlock_nested_is_conditionalworker_privateis_relset_dqblk__bitmap_equalkmalloc_typeqstrma_flags___GFP_ZEROTAGS_BITchange_freqacct_timexpd__rcu_icq_cache_find_next_bitacpi_objectsizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_whenxen_processor_px__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headtsd_valid_flagschedule_workWORK_OFFQ_DISABLE_BITSrcharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDdevice_driverdl_server_has_tasks_frunnable_sumreal_credWORK_STRUCT_FLAG_BITSget_namefwnode_endpointwq_misc_constsepoll_watchesxenpf_efi_infonon_rcu__cpu_possible_maskdqb_curspaceWORK_STRUCT_STATIC_entrygp_statebitsetload_avgcstimecpuidobjectcfs_rqmax_freq_uidst_spacemm_cid_next_scanns_type__guest_handle_xen_processor_cxac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned interr_freei_mutex_dir_keyq_nodespc_warnlimitvalids_encodingqueue_work__kmalloc_noprofgpl_crcsorc_entrykeysdqb_curinodesload__s8invalidate_lock_key__UNIQUE_ID_ddebug757dma_maskprealloc_mutexnanosleep__already_donepush_pxx_to_hypervisorsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdel_memtypexenpf_mem_hotaddnum_processorsdl_periodsym___kernel_vsyscall__guest_handle_uint32_ti_fsnotify_markswakeup_pathdio_mem_alignbtime__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_position__guest_handle_xen_processor_csdstates_tssseq_stopkiocbefi_runtime_callclass_rwsem_read_intr_is_conditionalprobefsuidefi_infos_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countupdatedsig_okdelaysirq_safereadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagshared_typersvd_posfs_flagswordworkpgprotval_tkeytypefortify_memset_chksigpendingfsindexshstkset_wakeup_timesrcu_sspwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialacpi_object_listHPROBE_GONEproc_idactive_timei_sequence__guest_handle_chardqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_privatebranch_perfi_dir_seqnentkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typenotifier_fn_tf_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmovesystem_timesched_contributes_to_loadstatic_key_trueweighti_privatemaxrssdst_perfflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_buf__UNIQUE_ID___addressable_init_module766class_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagsaddressstart_boottimevm_starts_flagscpumask_var_tiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESxenpf_cpu_hotaddp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listrequest_pendinghrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listxen_ulong_tdqb_rsvspaceversionxen_start_flagsserialclass_releasealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblenr_mfnssyscall_user_dispatchzalloc_cpumask_var_nodercu_tasks_exit_listarchdataia_uidchildrenrb_subtree_lastno_pm_callbacks__guest_handle_xen_processor_pxbuild_iddevice_get_match_datavfork_done___GFP_ACCOUNT_BITrt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typecpumask_clearpointerseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timersyscore_opsquotalenf_pipei_wb_frn_historylast_wakeenextWORK_OFFQ_LEFTio_tlb_memarch_spinlock_ti_mtime_nsecperformancemmlistmin_freq_notifierssuppress_bind_attrsRPM_RESUMINGreg_offsetgsbases_quota_typesf_llistred_sizephandleacpi_processori_nlinkmce_kill_mewrite_begingroups__ret_do_oncepi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrrowspkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_supers_inode_list_lockthermal_cooling_device__UNIQUE_ID_off734sweventfreeze_holderxen_domain_type__signalfn_tquota_enablesched_avgWORK_STRUCT_INACTIVEntabdevice_typemaj_fltarch_rwlock_twake_latencyclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxmax_acpi_idnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalXEN_HVM_DOMAINbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockoverflowfile_ra_stateuser_structon_rq__p_size_fieldfs_contextacpi_processor_unregister_performanceprealloc_bufDL_DEV_DRIVER_BOUNDcpu_to_nodeprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidfile_lockcookiedst_statestargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenbitmap_zallocmnt_flagscred_guard_mutexWORK_OFFQ_POOL_SHIFTsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrplatform_quirki_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfilterblue_poscurr_ret_stackedid_transfer_timedockacpi_adr_space_typedev_links_infoloff_tthread_pidWORK_STRUCT_PWQsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevtrc_blkd_nodecallsi_default_acls_uuid_lenioc_nodegeneric___set_bitof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpaddingtarget_value__fillerFORTIFY_FUNC_memcmpd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmodule_state__write_overflow_fieldlast_used_at__compiletime_assert_473vm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimexenpf_del_memtypemigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendHYPERVISOR_platform_opFORTIFY_FUNC_memcpynsproxycan_wakeupxol_areadevdatarlockfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_databits_per_pixelDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVEmax_capsule_size__state_sizecallerthread_structcached_requested_keyenvpctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userscpu_ols_idsecsmem_adds_dentry_lrubp_offsetfolio_queuelast_task_numa_placementplatform_limitblock_startcgtimesymlinkoom_flag_originresume_latencycounterorc_unwindDEV_PM_QOS_FLAGSWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionalpreviously_onlined_rcuacpi_pct_registerlatency_tolerance_reqki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERpropertiessysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intthermal_cooling_device_opsacpi_get_phys_idnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobeacpi_processor_get_psd_Boolsleep_start__p_sizemin_fltstatus_registerHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagsacpi_walk_namespacersvd_sizetotal_numa_faultss_countdev_msi_infod_revalidatebus_groupssleep_states_opd_sbsysv_shminstrument_atomic_readdq_countutf8data_tableset_latency_tolerance__func__foliowake_entryxa_headsuidcpumap_bitmapi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_txenpf_efi_guidclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_countersdomain_flagsnotify_nextmax_perf_statebus_dma_limitbuffershort intmynodeof_device_idclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_owneracpi_processor_get_performance_infobp_regVTIME_USERsa_flagstest__kmalloc_cache_noprofDEVICE_PANEL_BACKDEV_PM_QOS_MAX_FREQUENCYi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskgbl_capslatency__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTArwsemi_private_listia_validvertical_positionWORK_OFFQ_FLAG_ENDFORTIFY_FUNC_strncati_rcu__pcpu_ptri_atime_secWORKER_DESC_LENqc_type_statekey_serial_tinstrument_writedev_ueventsetupf_lock___GFP_MOVABLE_BIT__read_overflowactivedqb_itimeWRITE_LIFE_MEDIUMfree_acpi_perf_datasrcu_idxpidsWORK_STRUCT_LINKEDgetattrDEVICE_HORI_POS_LEFTi_wb_listxarray_start__flagsp_size_fieldfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iterdpcntia_gidprocessorattribute_groupcontextposix_timersselectoracpi_processor_cxdev_releasedefault_timer_slack_nskcsan_check_accesssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_ref___GFP_NOFAIL_BITgroup_infovdso_imagefileWORK_BUSY_PENDINGof_match_table__user_state_sizeduty_widthFORTIFY_FUNC_memchr_invtext_mode_3uuid_tproperty_read_int_array___GFP_UNUSED_BITcount_objectserrorq_sizexen_psd_package_stimelatency_tolerancezone_device_dataf_wb_errdefparamstatesfred_cs__param_str_offkprojid_tptracer_credtlb_genstorekobjectaudit_ttyvariable_test_bitmce_ripvstatfshlist_bl_headnumab_stateheightremovablefeatureson_listkgid_ton_cpuWORK_OFFQ_BH_BITfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_list__fortify_sizeaudit_contextno_constraint_valuepp_ref_countsysfs_opsnotifierssequential_io__compiletime_assert_100_large_mapcount__compiletime_assert_102__compiletime_assert_103sda_is_staticxenpf_enter_acpi_sleep__compiletime_assert_106__compiletime_assert_107__compiletime_assert_108__compiletime_assert_109formatftopenclavesp_regcreateiattrWORK_STRUCT_PENDING_BITrseqnfdssigvalvma_lockperf_event_list__compiletime_assert_110__compiletime_assert_111get_reserved_spacestack_refcountinvalidate_lockbmapERR_PTRkey_payloadd_realexpiry_active__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126dqi_max_spc_limit__compiletime_assert_128__compiletime_assert_129eval_stringexception_table_entryevent_countWORK_STRUCT_COLOR_SHIFTfallocatei_spc_warnlimitbuddy_listi_ino_timelimit__compiletime_assert_130__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135monthmems_allowed__compiletime_assert_138__compiletime_assert_139tlb_flush_batched_ddebug_infounregister_syscore_opsis_noirq_suspendedactual_typetracepoints_ptrsleadertimethermal_instanceswakee_flip_decay_tss_max_linksnr_wakeups_sync__compiletime_assert_140__compiletime_assert_141kallsymsprevdma_parmsfs_structclockiduint32_targ_startblocksflags_reqset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_listdevice_dma_supportedd_ino_warnsXEN_NATIVEhiwater_vmpackagetracepointcompound_headia_vfsuidacpi_bufferacpi_processor_performance__kernel_ssize_torig_ret_vaddrDEV_PM_QOS_LATENCY_TOLERANCEpoweroff_noirqrenamevm_area_structrpm_statussb_writers__compiletime_assert_82__compiletime_assert_83ino_timelimit__compiletime_assert_85__compiletime_assert_162__compiletime_assert_163splice_write__compiletime_assert_165__compiletime_assert_166__compiletime_assert_167__compiletime_assert_168__compiletime_assert_169state_in_sysfsdstpthrottlingprocessorsqf_next__compiletime_assert_90__compiletime_assert_91__compiletime_assert_92__compiletime_assert_93__compiletime_assert_170__compiletime_assert_171__compiletime_assert_96iommu_mm__compiletime_assert_98__compiletime_assert_99cutimeem_tablepersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtget_variableirq_domaindefault_valuesigned charprioprividle_notificationsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPno_pmacpi_processor_flagsgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodeget_max_statesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datadaylightsync_stateki_posexecute_only_pkeysyncsetleasepinsfirmware_infopacct_structmust_resumelong intfile_lock_contextusagel_yessiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssproperty_present__kmalloc_indexacpi_perf_data__write_overflowget_requested_powerUSRQUOTAprintk_index_sizesymtabpblk_addressstate_countrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirtynum_srcu_structsbdi_writebackkobj_completionacpi_psd__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigval__UNIQUE_ID___addressable_cleanup_module767bvecnameidataext_lfb_basexen_processor_flagslatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobe__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structxen_power_registerpi_lock___orig_eipprobestubget_timemm_cid_activesrc1src2elemsizedirty_paused_whenmaxlensuspend_noirqacpi_get_devicesxen_acpi_processor_resume_workerclass_spinlock_irq_try_is_conditionaloom_mmmax_freq_notifiersget_reference_argssrcu_reader_flavortv_nseci_lruFORTIFY_FUNC_strcpygfp_maskpi_state_listrcu_segcblistsubvoldescriptorfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_iddev_pin_infosrcu_structrlim_curnofaultmm_countcputime_atomicdrv_groupsstackfunctionfree_percpuki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hash__real_kmemdupsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpmicrocodedl_throttledWORK_STRUCT_PENDING_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextget_wakeup_timeopc1__int128 unsignedpcountrestore_noirqki_filpbit_offsetcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_events__vpp_verifyiommuprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keypm_qos_typebm_checksrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrarch___set_bitmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTnbitsKMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_works__arg1xenpf_efi_runtime_callrb_root_cacheds_copdd_key_truekmalloc_array_noprofhres_activegreen_posbpf_raw_eventsxenpf_platform_quirkdq_dirtydl_deferbug_listdirect_complete__per_cpu_offsetxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_counttimer_broadcast_on_statekey_restrictionexit_stateget_max_acpi_idis_late_suspendedsysvsemignore_childrenrestore_earlyreferenceclock_mutexfs_superserr_unregisterdqb_bsoftlimitpendingf_task_work___GFP_NORETRY_BITiowait_countedd_paramsacpi_statusnotifier_blockdma_io_tlb_memstringread_countpdomainfutex_offsetlong long intdst_cxmax_store_sizeatomic_flagssysvshmtimer_expiresDEV_PM_QOS_MIN_FREQUENCYtrace_evalsactive_basesearly_initlpi_statessecurityxmm_spaceacpi_processor_tx_tssactivatenr_cpu_idsf_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITi_bytesdomain_datarelax_countlinelinkstart_timekernfs_nodedev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchreschedule_countvfsmountextable_basenoinstr_text_sizeattributesset_child_tid_overruntmpfilercu_read_lock_nestingtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugrefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tUTF8_NMAXfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqia_vfsgidsize_tcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workatomic_long_tpreallocclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicdelayed_callmax_nr_cid_statusd_sibbin_attributepercpu_counternuma_pages_migratedgsindexexpires_nexti_io_listf_epsrcu_barrier_seqreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tHRTIMER_BASE_BOOTTIMEclass_srcu_is_conditionalnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionHRTIMER_BASE_REALTIME_SOFTstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registers_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrstate_in_sysfstty_structUTASK_SSTEP_TRAPPEDbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollnr_wakeups_idleio_cqelf64_symlatch_tree_nodedestroy_work__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerma_external_lockuid_tflush_requiredsum_block_runtimepgmapdq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditional_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitnuma_groupdescriptionclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinei_inodyndbg_infoindexthread_headmap_typef_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenHRTIMER_RESTARTMOD_MEM_NUM_TYPESsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxcpu_basedquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_events_sys_privateUTF8_NFDIinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authHRTIMER_BASE_TAIvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherscompletionsw_reservedUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treequota_onvm_operations_structbin_attrs_newiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdatanrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupwake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlinedup_xol_worktotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramd_spc_softlimitreported_split_lockgfp_tseccomp_filterstimei_mmapthaw_superd_lrusignal_structperf_event_mutexcrcspgdval_tSB_FREEZE_WRITEsetattrf_mappingnoinstr_text_startbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activei_opldt_usr_semkobj_ns_type_operationsDQST_FREE_DQUOTSseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tis_dirty_writebacktrace_bprintk_fmt_startkstatfssitesptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutex_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupseqcount_spinlock_ti_wbclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedpagetrc_holdout_listget_inode_usagenormal_priodestroy_inoderelease_folioi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inameHRTIMER_BASE_MONOTONIC_SOFTi_mappinginblockrmidrseq_siglimit0limit1dqi_max_ino_limitmigrate_modeftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksd_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrDQST_SYNCSstack_vm_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalcg_listsrcu_barrier_completionrw_semaphoremnt_sb_ddebuginfofiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypeinit_modulemembarrier_statepage_poolinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_mempathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwrcu_syncvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstateueventlock_countrefcount_tplugsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttableslist_headtgidwrite_protect_seqcompat_robust_list_head_tids_inode_wblist_lockend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutask__UNIQUE_ID_srcversion473sched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextgpl_symsseq_showswait_queue_headblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfds_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceobjcgnodeDQST_READSvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvstatic_prioshrinkerdl_yieldeddqi_formatexec_update_lockDQF_PRIVATEDQF_SYS_FILE_Bl1d_flush_killi_versionprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symboltv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskSB_FREEZE_PAGEFAULTactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlock__rcu_headmce_vaddrquota_offdq_inusedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmod_tree_nodef_sb_errwritepagecodegtimesigactionclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listktypelockrefsrcu_struct_ptrsmm_structvlagi_uidspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesvm_mmmod_mem_typedebugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipMOD_INIT_RODATAqc_dqblkmmappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCi_write_hintfxsaveprocess_keyringlist_op_pendingllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyioveci_private_lockVTIME_IDLEstatic_keys_magicdl_overrunDQST_ALLOC_DQUOTSd_parentpayloadac_minflti_sbd_sbcommPIDTYPE_PIDatomic_write_segments_maxatomic_openreadahead_control__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupblockedi_securitystats_lockD_REAL_DATApt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colorbitsiopriocap_inheritablegp_waitlookupDD_CLASS_TYPE_LEVEL_NAMESvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vec__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATElf64_Symd_automountparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcestack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkDQST_CACHE_HITScmaxrsstimer_slack_nspolicysharedd_real_typelookahead_bandseq_startraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamerun_delaytailslinenoget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseattrscpumask_tswregs_statedqb_isoftlimitorig_axsched_rt_entitytimerqueue_nodeil_weightmem_dqblknr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pause_sigchldreservedlatency_record_countcgroupsprev_scan_seq_DQST_DQSTAT_LASTrcu_usersoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockUTF8_NFDICFcpu_bitmapstatic_call_keyutil_estucountsMOD_RODATAqc_statesoftirq_next_timercheck_flagsswp_entry_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aMOD_INVALIDmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalautogroupnr_threads__i_nlinkpushdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magicfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsMOD_INIT_DATAnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_infoshared_pendingi_gidmin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idHRTIMER_MAX_CLOCK_BASESkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsxa_flagsbin_sizegrphid_spc_timerjump_entriesassoc_array_ptrsuper_block_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_array__UNIQUE_ID_depends472mnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpref_node_fork__int128dqi_privrss_statmems_allowed_seqrefcntD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxresult_maskdquot_operationsmappinggrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizescheduledclass_raw_spinlock_nested_is_conditionalworker_privateis_relqstrma_flagsfutex_stateHRTIMER_BASE_TAI_SOFTacct_timexpd__rcu_icq_cacheDQST_WRITESsizef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tdl_server_has_tasks_frunnable_sumreal_credepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgcstimecfs_rq_uidst_spacemm_cid_next_scanac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysMOD_TEXTdqb_curinodesload__s8invalidate_lock_keyprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_marksdio_mem_alignbtime__u8is_roxlockrlim_maxruntime_deferred_listd_waitlist_lru_oneseq_stopkiocbclass_rwsem_read_intr_is_conditionalfsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeshrinker_idrootoom_reaper_listsym_VDSO32_NOTE_MASKbpf_storage__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingfsindexshstksrcu_ssp__page_1__page_2__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEi_sequencedqb_ihardlimitd_lockrefnum_bpf_raw_eventsaddr_perfi_dir_seqkqidKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typef_iocb_flagscmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagshrtimer_base_typestart_boottimevm_starts_flagsiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listhrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendings_listdqb_rsvspaceversionserialalloc_locks_dquotfolioqprev_posseqcount_spinlocks_umountis_bin_visiblesyscall_user_dispatchrcu_tasks_exit_listia_uidchildrenrb_subtree_lastbuild_idvfork_donenanosleeprt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelayquotalenf_pipei_wb_frn_historylast_wakeenextarch_spinlock_ti_mtime_nsecmmlistutf8_normalizationset_dqblkreg_offsetgsbases_quota_typesf_llisti_nlinkwrite_beginpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedHRTIMER_BASE_BOOTTIME_SOFTfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tquota_enablesched_avgntabmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextprealloc_bufprojiddrop_inodenum_trace_evalsllseeknext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeunfreeze_fsintervallast_mm_cidcookietargeta_flagstrace_overrunsession_keyringfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributerestrict_linkMOD_DATAi_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackloff_tthread_pidsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringma_locksched_delayedmodule_statelast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimemigrate_from_cpusrcu_barrier_mutexi_private_dataElf64_Halfnsproxyxol_areacleanup_modulerlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_datasignumfscrypt_keyrings_mountsuse_memdelay__state_sizethread_structcached_requested_keyenvpctimereleasesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_datasysv_semanon_vma_namefileattrDQST_DROPSlong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionali_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_ts_iflagsmce_kflagstotal_numa_faultss_countd_revalidates_opsysv_shmdq_countutf8data_tablefoliowake_entryxa_headsuidi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_lockiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_t_flagsnotify_nextshort intmynodeclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_ownerbp_regVTIME_USERsa_flagstesti_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivaltrace_event_callis_guestpoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keyGRPQUOTAi_private_listia_validi_rcuHRTIMER_BASE_REALTIMEi_atime_secqc_type_statekey_serial_tsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsi_wb_listxarray_startfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectordefault_timer_slack_nssource_listswap_readahead_info__fpstateactive_refgroup_infovdso_imagefile__user_state_sizemce_kill_meuuid_tcount_objects_stimezone_device_dataf_wb_errdefparamfred_cskprojid_tptracer_credtlb_genstorekobjectaudit_ttymce_ripvstatfsnumab_statefeatureson_listkgid_ton_cpufregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisti_mmap_rwsemwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadd_realexpiry_activedqi_max_spc_limitexception_table_entryfallocateHRTIMER_BASE_MONOTONICi_spc_warnlimitbuddy_listi_ino_timelimitSB_FREEZE_FSi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infotracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevfs_structclockiduint32_targ_startblocksset_infofileattr_getvectortimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrrenamevm_area_structsb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextiommu_mmcutimepersonalityget_statetask_sizes_inodes_addrbinfmtsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filercu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataki_posexecute_only_pkeysetleasepacct_structlong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typein_iowaitunregfuncegiddq_hashput_superMOD_INIT_TEXTpushable_dl_tasksf_flagsf_inodemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infoTT_NONEVTIME_INACTIVEcancelled_write_bytessrcu_usagebitmapmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_cold__UNIQUE_ID_name470ssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenDQST_LOOKUPSclass_spinlock_irq_try_is_conditionaloom_mmsrcu_reader_flavortv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idsrcu_structrlim_curnofaultmm_countSB_FREEZE_COMPLETEstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infodatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountki_filpcap_ambientatomic64_tanon_vmarlimread_folionr_eventsprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keysrcu_gp_startopenit_real_incrmodert_prioritymm_lock_seq__UNIQUE_ID_intree471KMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksrb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionexit_statesysvsemMOD_RO_AFTER_INITDQF_ROOT_SQUASH_Bfs_supersSB_UNFROZENdqb_bsoftlimitpendingf_task_workiowait_countstringread_countfutex_offsetlong long intatomic_flagssysvshmtrace_evalsactive_basessecurityxmm_spacef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesclass_rwsem_read_intr_is_conditionalclass_mutex_is_conditionalclass_preempt_notrace_is_conditionalMOD_INIT_RODATAMOD_TEXTclass_srcu_is_conditional_nameclass_rcu_is_conditionalclass_migrate_is_conditionallong long unsigned intNR_KMALLOC_TYPESclass_rwsem_read_is_conditionallong long intsigned charPIDTYPE_SIDclass_preempt_is_conditionalElf32_Wordorc_headerPIDTYPE_TGIDlong intclass_raw_spinlock_irq_is_conditional_descclass_local_lock_nested_bh_is_conditionalHRTIMER_BASE_MONOTONIC_SOFT__UNIQUE_ID_retpoline471class_rwsem_read_try_is_conditionalUTF8_NFDIDQST_LOOKUPSclass_spinlock_irqsave_is_conditionalclass_spinlock_try_is_conditionalclass_local_lock_is_conditionalhrtimer_base_typeMOD_RO_AFTER_INITn_descsz__u8DQST_ALLOC_DQUOTSSB_FREEZE_FSKMALLOC_NORMALDQST_WRITESunsigned int__int128class_irqsave_is_conditionalHRTIMER_BASE_REALTIMElong unsigned int__u32HRTIMER_MAX_CLOCK_BASESclass_spinlock_irqsave_try_is_conditionalclass_spinlock_is_conditionalshort unsigned intHRTIMER_BASE_TAIclass_local_lock_irqsave_is_conditionalclass_read_lock_is_conditionalelf32_noteboolDQST_DROPSclass_local_lock_irq_is_conditionalMOD_RODATAKMALLOC_CGROUPclass_rwsem_write_is_conditionalclass_spinlock_irq_try_is_conditionalclass_spinlock_irq_is_conditionalclass_write_lock_is_conditionaln_typeMOD_DATAclass_write_lock_irqsave_is_conditionalHRTIMER_BASE_BOOTTIMEn_nameszSB_FREEZE_COMPLETESB_FREEZE_WRITEclass_raw_spinlock_nested_is_conditionalMOD_MEM_NUM_TYPESDQST_SYNCSDQST_FREE_DQUOTSmod_mem_typeHRTIMER_BASE_MONOTONICclass_mutex_intr_is_conditionalclass_task_lock_is_conditionalUTF8_NMAX_nhdrPIDTYPE_PGID_Boolunsigned charKMALLOC_RECLAIMHRTIMER_BASE_BOOTTIME_SOFTcurrent_stack_pointershort int_note_18_note_19utf8_normalizationKMALLOC_RANDOM_STARTDQST_CACHE_HITSclass_irq_is_conditionalDQF_PRIVATEPIDTYPE_PIDDQST_READSMOD_INIT_DATAclass_raw_spinlock_try_is_conditionalclass_raw_spinlock_irqsave_is_conditionalPIDTYPE_MAXcharGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackSB_FREEZE_PAGEFAULTUTF8_NFDICFclass_mutex_try_is_conditional_DQST_DQSTAT_LASTclass_write_lock_irq_is_conditionalKMALLOC_RANDOM_ENDMOD_INIT_TEXTclass_raw_spinlock_irqsave_try_is_conditionalpid_typeHRTIMER_BASE_REALTIME_SOFTKMALLOC_DMAclass_read_lock_irq_is_conditionalHRTIMER_BASE_TAI_SOFTSB_UNFROZENclass_raw_spinlock_is_conditionalkmalloc_cache_typeclass_read_lock_irqsave_is_conditionalclass_rwsem_write_try_is_conditionalDQF_SYS_FILE_Bclass_raw_spinlock_irq_try_is_conditionalDQF_ROOT_SQUASH_B__UNIQUE_ID_vermagic470__int128 unsignedMOD_INVALID/home/thomas/Documents/kernels/stagingdrivers/xen/xen-acpi-processor.c/home/thomas/Documents/kernels/stagingdrivers/xen./arch/x86/include/asm/xen./arch/x86/include/asm./include/asm-generic/bitops./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/device./include/acpi./include/xen./include/xen/interfacexen-acpi-processor.cxen-acpi-processor.chypercall.hjump_label.hinstrumented-non-atomic.hbitops.hfind.hslab.hworkqueue.hfortify-string.herr.hbitmap.hcpumask.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hasm.hinit.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hstatic_call.hbug.hcpumask_types.hatomic-long.hstddef.hgfp_types.hsysfs.hpercpu.hsched.hspinlock_types.hrwlock_types.hllist.hsmp_types.hpreempt.hrestart_block.htime_types.htime32.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hprocessor.hmath_emu.hirqflags.htypes.hshstk.hthread_info.hosq_lock.hmutex_types.hmutex.hspinlock.hrwsem.hrcupdate.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.htracepoint-defs.hworkqueue_types.hrcu_segcblist.hwait.hswait.hsrcutree.hsrcu.hnotifier.hkref.hmaple_tree.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.htopology.hxarray.hlist_lru.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hdevice.hpm.hpm_wakeup.hpm_qos.hbus.hdriver.hclass.huio.huio.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hmod_devicetable.hdevice.hof.hfwnode.hcpuhplock.hthermal.hsyscore_ops.hactypes.hxen.hinterface.hxen.hacpi.hprocessor.hplatform.hrcupdate_trace.hpercpu.hacpi_bus.hacpixf.hoverflow.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.hdrivers/xen/xen-acpi-processor.mod.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingdrivers/xen./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/schedxen-acpi-processor.mod.cint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hirqflags.htypes.hshstk.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hquota.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hxen-acpi-processor.mod.c/home/thomas/Documents/kernels/stagingscripts/module-common.c/home/thomas/Documents/kernels/stagingscripts./include/uapi/asm-generic./include/linux./include/linux/sched./include/uapi/linux./arch/x86/include/asm./include/asm-genericmodule-common.cint-ll64.htypes.hirqflags.hpreempt.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hpid_types.hhrtimer_defs.hslab.hunicode.hquota.hquota.hfs.helf.hmodule.hasm.hmodule-common.cint-ll64.hGCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910x ,FLCL KBB A(A0Dp 0C(A BBBE 5$tEj!DGKA JDVK AABD GQA A(J(A ABB$]Fg E DGIH C(0v( ABB;4RAA AB    !"$&(*,./12468:;<=>(8 ..7(88O.c.(p.(p8(8(85.t" (. *`0!" Q.,(8(P8up ,(08E(8^(8]w"` p;!(8   @, ,  ,   @,$ p1 !> ,I V$&  `l6** **(* 6M(Y i | ` $PKo` ## : Pdt  ,5,!^t%0GM[r~!.9HXm2&;Ndrxen-acpi-processor.c__UNIQUE_ID_ddebug751.8acpi_psd__UNIQUE_ID_ddebug759.4acpi_id_cst_presentnr_acpi_bitsacpi_id_present__UNIQUE_ID_ddebug757.5__UNIQUE_ID_ddebug755.6__UNIQUE_ID_ddebug753.7xap_syscore_opsacpi_ids_donewq.119no_hypercall__UNIQUE_ID_ddebug744.11__UNIQUE_ID_ddebug746.10__UNIQUE_ID_ddebug736.18__UNIQUE_ID_ddebug738.17__UNIQUE_ID_ddebug740.16acpi_ids_mutexxen_acpi_processor_resume_worker.cold__UNIQUE_ID_ddebug761.0__func__.130__func__.129_entry.128_entry.127__func__.126_entry.125__func__.124_entry.123__func__.122__func__.121_entry.120__func__.118__UNIQUE_ID___addressable_cleanup_module767__UNIQUE_ID___addressable_init_module766__UNIQUE_ID_license765__UNIQUE_ID_description764__UNIQUE_ID_author763_entry_ptr.1_entry_ptr.2_entry_ptr.9_entry_ptr.12_entry_ptr.15__UNIQUE_ID_offtype735__param_off__param_str_off__UNIQUE_ID_off734__pfx_read_acpi_id__pfx_xen_acpi_processor_resume__pfx_xen_acpi_processor_resume_worker__pfx_get_max_acpi_id__pfx_xen_acpi_processor_init__pfx_free_acpi_perf_data__pfx_kmalloc_array_noprof.constprop.0__pfx_push_pxx_to_hypervisor.isra.0__pfx_push_cxx_to_hypervisor.isra.0__pfx_upload_pm_data.isra.0__pfx_xen_upload_processor_pm_data__pfx_xen_acpi_processor_exitxen-acpi-processor.mod.c__UNIQUE_ID_srcversion473__UNIQUE_ID_depends472__UNIQUE_ID_intree471__UNIQUE_ID_name470module-common.c__UNIQUE_ID_retpoline471__UNIQUE_ID_vermagic470_note_19_note_18orc_headeracpi_walk_namespace__kmalloc_noprof__this_modulequeue_work_on__stop_alloc_tagsxen_domain_typeprocessorsunregister_syscore_opskfreeacpi_get_typeacpi_processor_get_psdbitmap_free__per_cpu_offset__fentry____bitmap_equal__start_alloc_tagsacpi_get_phys_id_printk__stack_chk_fail__pfx_init_modulexen_start_flagsacpi_processor_unregister_performancemutex_lock_find_next_bit__fortify_panic__pfx_cleanup_module__cpu_possible_maskmemsetacpi_processor_preregister_performancebitmap_zalloc__x86_return_thunkkmemdup_noprofnr_cpu_idsfree_percpuacpi_get_devicespcpu_alloc_noprofmutex_unlockacpi_evaluate_object__dynamic_pr_debugacpi_evaluate_integerparam_ops_intacpi_processor_get_performance_infohypercall_pagesystem_wq{  8  /= Eep$~  p `  (  5<C Mu{$ "Qv  +$07\cs hz        <I V  [eo tz # (.<Aq}xm r}' `   P /GWqs z 0' H . 5 :U Zbz ` ` # .4> CIY y $$ $#(/ 4H Y|d k  pw$~$$ "+ (0  &+27> CJOU_ djv 4 (p08@tH@HP@HP(~ ,. wV!z Dd $( ,044t8<@DPHuLPTX\/`[d~hlptx;|HZs'wq.Fp~9Yay-Bx ' 3$X(o,048<@*D6HBLNPcTu  !%$ '$((*,,0.438< @QD`HLPT"X\`dhlptx|EP|RSTV[`w  (+?u $(,4048<B $(b048@DH PTX`dhzpftmxZ"lp* P( 08`@HP`Xp80ppxp8@HPpx&8` p(0@PX`hQ08@He@@ P  #' $' $ !g' ". #Q6Y #Ge #o #"a} #L #^b #0, # # #-d #` # #e #U # #g #}t #[!z #> #h] #q #a # #^ #C #Nv #8 #DD #<; #̀  #  #t* #Z1 #ќ6 #NB #zN #WZ #nf #9r #~ #m #k~ # # #xv #bu # # #  #ep #" #, #: #R+ #n7 #C #5O #A[ #p #{~ #ā #{ #3 #85 #l # #u+ #;x #2 #l #u7 #D #lQ # # #0 #W #d # # #| #? #" #l0 #> #L #WxZ #Sh #8v # #w: #'a #` #; # # #W #k #f #mx #j  #%+. #G< #vJ #X #DZf # #Oj #7t #6 #` #Mt #Td # #?p #]  #/) #L8 #IG #3V #Ɵe #yt # # #* #  #N #T # # # #0  # #<( #=7 #fF #U #2Yd #s #y #. #C # # #q #4 #& #i # # #-' # >6 #&E #KT #vc #r # #] #[ #K #6 # #I # # #= #0lA #5U #mj #ow #3 # #3q #% #o #"Z #t #u; # N #d # ! #jb. #r; #KH ##U #"/b #o #f} #S # #P # #+ #G #|/ #]w #l #  #<- #rM #W #Bd #x #g #4^ #Y #A #- #D # #&# #  #N# #"2 #O #6v_ #|e #k1k #Yiq #Fx #f #$ #3 #w #mI #$ # #< # #p #$ #?Q #]^ # #U/ # # #r #q # #h #t #/  #E2 #&% #p 3 # 4A #tO #D] #k #hy #z #G& #{G #jb #nD #qR #  #8 #YW #/E #< ##! #LA/ #J= #͞K #Y #9g #,| #c  #+f #|/ # #r # #l #r #4R #2 # ? #AL # Y #f #t #t  #{ #3 #t< #n # # #Ą #  #Dy #g #F #Bw #s # # # #yY #H #YF #O' # iC #[ #UEa #;g #'-m #Js #1y #3 # # #Q #և #8- #W #'W #3 # Y #( # #M #\ #9j #  # #k #\ # # #p #W #& #k, #X9 #OR #Y^ #_{ #ߟ #tl # #3x #L # # # # #  #- #T" #0 #l> #L #Z #^qh #Xv #88 ## #Y #n #p # #f #F #kE& #f5 #DD #T #Ac # <r #M #Ĕ #d # #9 #2N # #c #5 #h #w #1& #45 #XD #S #}b #q #Y #S+ #_k #n #P #e ## #u #% #t #P" #&% #C #^vR #:Xa #wp #0 # # # # # #g # #~ #=  #Vj #+ #C; #$K #7[ #k #Wz{ #2 #[7 # #- #  # #n #B5 # #% #J4 #kC #R # pa #ep # #iu #7? #Y #k #1 #-  #\ #O #V #< #8$ #ng3 #B #WQ # ` #)o #h~ #~ #o #  #Z` #x #$_ # #z #B #R #$ #ɡ3 #B #?_ #n #=} #Xy #& #& #E #)p # M # #, #/ # #" #1 #2@ #%.O #^ #m #<| #sX #j # # # #9 #m #g # #n3 #! #60 #? #N #,%] #Tl #h{ # #v #\ # #[ #Y #FQ #- #!I #% #t  #=/ #> #tM #V\ #k #fz #j # #z #>B #n #9P #Z #K #c #N #} #x. #OT= #t{L #:[ #i2k #`z #$M #{ #Q #  #` #4 #% #I #3 #r #x #. #1> #>lM #\ #x]k #[dz #, #P #ԙ #1Q #} #M # #u #!! #U! #V! #9.! #r=! #]=L! # [! #/~j! #Ky! #7! #! #.6! #.! #y! #ET! #gQ! #n" #c" #" #L." #ϋ=" #'L" #d[" #o#j" #y" #;" #R" #3" #" #" # |" #m" #!" #vV# ## #8## #T%2# # Q# #|y^# #=r# #R# # N# #E!# #@# #;x# #N4# #l# #W# #r# #" $ #.I$ #>SV$ #0c$ #p$ #-F$ #$ #$ #I$ #($$ #$ #_$ #$ # $ #0% #ZT% #ȗ% #o9,% #?% #ZL% #o9Y% #u% #2% #|/% # % #?% #e% #{x% #o9% #% #54& #F[ & #ia& #p && #n3& #l& #V& #& #eo& #t& #|/' #,' #t+' #.vZ' #V' #' #E[( #Pz( #( #)T( #%( #)L( #/L( #|/) #%C) #5LR) #^) #dj) #N!x) #N!) #Q) #d) ##) #) #X) #i* #a* #>* #^{(* #46* #D* #|/R* #&a* #zp* #{* #e* # * #O* #um* #Lx* #* #2+ #~#+ #v1+ #G?+ #M+ #]+ #k+ #y+ #B=+ #e+ #=+ #)R+ #+ #O>, #K#, #$, #`Z2, #7@, #MO, #(t], #>k, #>2y, #X2, #[, #F, #}, #, #y, #Ո, #, #tg, # - #- #h)- ##6- #"- #`- #H. #.T. #q. #. #<. #P. #`. #0. #$w#/ #O/ #`/ #'/ #ɉ/ #M/ #oL/ #./ #-/ # %0 #730 #fA0 #&8O0 #(Qn0 #}0 #ٔ0 #0 #g0 #:0 #q0 #T@0 #30 #'F1 #^ 1 #"/1 #-]=1 #\K1 #fY1 #/u1 #1 #r1 #&&1 #n1 #1 #G1 #D1 #z1 #v2 #:s2 #+2 #"92 #G2 #v=U2 #s>c2 #x2 #jH2 #$2 #-]2 #2 #G2 #2 #2 #$ 3 #&3 #233 #0lA3 #dN3 #[3 #%u3 #i3 #3 #|3 #H3 #s3 #73 #b\3 #j3 #@H3 #<3 #A4 #4 #U!4 #^4.4 #-;4 #4H4 #~U4 #1b4 #o4 #|4 #p4 #u4 #[4 #-4 #'4 #4 #%4 #i4 #<4 # 5 #7 #7 #i7 #77 # 7 #7 #$7 #8 #\8 #8 #OD8 #:Q8 #^8 #k8 #28 #I8 #m8 #8 #Q8 #8 #N8 # 8 #8 #9 ##9 #T09 #ӓ=9 #uK9 #G^9 #YF|9 #x9 #9 #-9 #c39 #dE9 #O9 #ob9 #}9 #. 9 #'9 #@: #IL: #oX: #lei: #"Hu: #5D: #j: #}: #mt: #.: #V": # `: #q5: #?: # ; ##; #V"0; # `=; #T; #V"a; # `n; # {; #I; #; #/; #~; #o`; #!; # #; #J"< #Y< #%< #pv1< #=< #K9I< #4OU< #Ffk< #< #M< #2< #>< #u< #R< #h< #= #P= #MM= #3)= # ?= #L= #Y= #Qf= #o.t= #g&= #&= #MR= # e= #= #&= #<= #1= #ł= #̝= #%<> #S"> #1k/> #<> #QV> #%nd> #nq> #H> #G> ##> #Q> #-]> #> #L> # > #~> #> #^? #E9? #Un? #n*? #7? #GD? #ڗR? #%j_? #8l? #z? # ? #M? #3d? #? #Z`? #d? #d? #=\? #`@ #@ #ew@ #4)@ #6@ #_C@ #3m@ #z@ #"@ #@@ #?@ #@ #@ #j@ #@ #"@ #@ #jbA #у)A #LA #XA #8fA #OtA #VA #jbA #<A #A #BA #A #A #A #ngA #A #\NA #B #OB #V#B #<2B #t@B #NB #N\B #NjB # xyB #B #gB #{0B #oB #W'B #SB #_B #e:B #1B #_C #iC #:E"C #DR1C #D@C #@NC #L[\C #AdjC #0xC #/C #gC #q~C #o6C #hC #{C #*C #C #.R #.;R #EvHR #|[R #jR #UVtR #'~R #Y5R #R #R #k@R #^R #R #>BR #` S #t,S #W-S #L'7S #AS #KS #DXS #eS #rS #7S #S #S #OWS #a2S #US #S #؝S #S #T%T #9T # T #4-T #X;T #iHT #XUT #bT #4qT #~T #WT #4RT #;T #T #T #T #6U #U #p(U #5U #ZrHU #TU #uU #U #4U #NU #U #GU #HU #U #YU #JU #._U # U #U #O$U #8U #U #U #3@V #]V #^V #qsV #lV #YG!V #/1V #d7V #o=V #tuCV #IV #_PV #]_`V #:gV #XnV #UtV #2zV #V #]VV #dV #AGV #hV #VV #̚V #DV #NW #W #W,W #jW #wW #jbW #DW #;LW #6W #jbW #9W #qW #[W # W #W #jb X #SX #a#X #"0X #>=X #JX #dYX #0hX #(vX #1X #c X #jbX #X #X #"X #X #[ Y #YY #C,Y #FY #&SY #ffY #sY #7Y #+Y #Y #U Y #jbY #]Y #uY #aY #"Y #Y #AZ #IZ #1Z #l)Z #6Z #1 CZ #xPZ #-]Z #kZ #hyZ #Z #dZ #3eZ # Z #AgZ #S[ #[ #l![ #2/[ #*"<[ #I[ #DW[ # d[ #[?x[ #f[ #w[ #[ #T[ #\[ #9[ #5[ #\ #'%\ #Cs\ #̜5\ # B\ #CsY\ #jmf\ #Cs}\ #?f\ #F\ #U\ #H~\ #\ #1\ #` \ #I\ #Y ] #/G] #7#] #)] #/] # 6] #F] #~L] #vR] #eX] #_] #"l] #y] #] #":] #":] #V;] #d?] #Y] #u] # ^ #"^ #%^ #2^ #I?^ #L^ #[SY^ #ls^ #;1^ #k ^ #r^ #v&^ #ky^ #ky^ # ^ #jb_ #' _ #_ #WM1_ #F>_ #K_ #e_ #r_ #jb_ #K,_ #E_ #y_ #`n_ #%_ #y_ #E_ #4_ #-]_ #] ` #` #C &` #]3` #@` #M` #tZ` #7g` #!t` #c` #z` #t` #a` #l` #/` #5 ` #i"` #9w` #$a #=0a #.?Fa #Ra #nna #[a #a #Va #<a #na # a #/a #b #+b #,b #DDb #Zb #[Lfb #Rb #Rb #9wb #b #b #Y4 c # c #[.c #Bc #RPc #X^c #i|c ##c #<c #c #Uc #8 c #{c #5c #+d #Ee d #E.d #xg #g #3g #g #g #`g #g # h #.h #Y2Pq #q #4gq #kfq #Eq #uq #q #|/q #q #q #q #r #.3r #Gr #^Tr #j[ar #Tnr #Z{r #r #r #~nr #zr #-]r #Jr #.0 s #zs #Xb$s #M1s #>s #JbKs #Xs #fes #ښrs # s #s #$Cs #ss #Ws #Ts #s #%s # s # t #-]t #t #*t #8t #CFt #hTt # Rbt #qpt #Dt #t #Wt #Nt #Jt #:t #=u # "u #,1u #‘@u #Ou #8^u #mv #{v #+v #v #:v #v #Rw #B&w #,%w #GG2w #z?w #Lw #a Yw #Rfw #@rsw #>x #_0 x #Ix #z'x #Cx #tIx #x #ux #Wx #Q3y #~$y ##m1y #>y #wKy #FXy #fy #2]y # y #y #Py #ޒy #Ly #1y #y #y #rz #f7z #B&-z #JGz #qrUz #|/qz #z #&z #z #dz #Vz #wz #Rz #[z #E{ # { #Qa { #m/{ # >{ #-M{ #\{ #k{ #/8z{ #b{ #sk{ #%{ #{ #l{ # { #MF{ #z%| #r| #m| #z-| #1<| #K| #-Z| #i| #Cy| #C| #v| #v[| #B| #V| #O| #s| #jb} #} #Y1!} #z/} #9=} #RK} #Y} #Cg} #{t} #.} #ޞ} #$N} # } #p} #4} #^R} #o} # ' ~ #S~ #RB%~ #&\3~ # A~ #PO~ #/]~ #k~ #Xy~ #[~ #\g~ # ~ #r-~ #-~ #~ #|E~ #&~ #~ # ## #! #A/ #u= #K #hY #Jg #3 # #[ #dz #]m # #A # f # #@ #rj #qQ #p #P #jb #[?* #8 #ԠF #OT #Ңc #m #F| #L #`y #?Y #= #22ƀ #]KՀ #` # #2 # #ϟ #-. #jb< #NJ #X #-f #>bv #M #k #x #e #L8Ɓ #lՁ #ѡ #d #Z #H #+ #s3) #:9 #bI #iY #i #Xy #G # # d #bd #yɂ #;ق #j #_ #j? # #5! #%/ #s= # $L #e[ #%j #Wey #c9 # #@] #W̓ #Nڃ #jb #H #AG #ѡ # #J<( #C5 #JCB #?O #\ #)i #ޢv #k #w #m #} # #o #W #m #Q3 #‰ #z #_B #@ #ŀ# #0 #@= #ŀY #He #q #M} #j #H #: #G #h{ي #' #' #(V #o0# #0 #P= #cJ #XW #Ld #i~ #%c # # #0 #ċ #ҋ #tn #Lj #;x #Mp #l& #uG #jbT #'j #X3| #= #tAÌ #Ќ #\ #W # #b( #H4 #Û@ #K|M #TZ #g #t #& #B #> # #r% #? #ύ #Vw܍ #8 #f # #/ #> #xL #tZ #=h #Xv #V& #Q #u # #B #%ʎ #E؎ # #]X #: # #v$ #2 #F+@ #mN #\ #&j #>x #ʢ #)h #G@ #Q #h #E0̏ #]ڏ #y #+ #  #" #" #Z/. #l< #K #Z #r #8 #e #> #j # #SӐ #;# #N} #t #G #-b& #b5 #FD #gi #~v # #a! #& #& #f #Pđ #ё #w#ޑ #t #N #5J #. #* #mY9 #jG #!!U #vcc #L2q #s # # #@ # #/#Œ #iӒ #6 #B #I #k # #' #/5 #mC #SQ #9_ #m #`{ #+ #9I #Nz #{e #M #jГ #wߓ # #|m #j #[p #<[+ #i: #!I #X #vg #Bv #?{ # #u #A? #Ž #|Д #ߔ # #m7 # #@: #.$* #/9 # H #+W #Q{f # # # # #)o• #ѕ #5 #p #M #E #[ # # #- #Vs #Y< #0V #T #P #̗ # Tٗ ##? # #\8 # #x  #v( #nl5 #B #[?O #|i # zv # #h> #W #. #*= #b # #e #jb! #; #eN #0 #i #%˙ #@љ #י #}ޙ # # #5 #fA #4 #s) #Y6 #cC #Q #]Y[ #g #ts #d # #s! # # #!q #tA #|/ #R #k- #JA #N #eLZ #4| #r #g› #2ܛ #d #@W #t #2 #/6 #tAC #tP #|/] #Rj #k #` #qM # aĜ #Bל #щ # #Rq #8 #l_ #G$ #E1 #ؕK #_X #re #|s #: # #%; #_ #X #"" #}f #0( #!5 #ϕB #BO #P`] #Tj # w #+ #J #O #V #(I #8Ǟ #i՞ #{ #r #l #k^ #MU #H) #"\ # f #CU # #Ih # #r #A #_ɟ #E֟ #{F #s # #x #g& #.3 #6A #' # # #` #]Ϡ #v۠ #; #  #( #-<7 #YX #l;{ #S #;i #ud #W # /š #ˡ #b%ѡ #Tס ##ݡ # #x #r? #w #w# #{) #~/ #5 #E #[S #q/_ #x$l #jy #o #5 #&{ #ˢ #|kע # #_ # #B # #hv9 #8F #5lT #Pb #xp #} # #͖ #; #4 #ʣ #jأ #a # # #  #5T #Pi, #Y; #^ #nj #RXz #B #x #f ## #qǤ #[fڤ #|/ #CP # # #_ #j) #e6 #OC #aP # {] #tk #>x #p8 #+ #;< #; #[ #Aƥ #ӥ #% #Z #Fl #R #3 #G& #: #pNH #sV #Sd #Ór #-; #Ei #3r #{ #9! #[ #% #'3 #A #_O #l] #1k #gy # #} ## #9!0 #?> #L #A6Z # h #v # #8W #.s #ޔ #&Y #ďʨ #0Vب #M #Z #W #AI # F #- #; #I #W # le #`s #mG #" #M # p #URȩ #t֩ #\ # #o #V& #6- #H; #%I #-W #Jre #Gt # # #; #o # #)Ȫ #^֪ #N #.[ #\ # #;} #S # #U # #-v #y| #V #nĬ #9Ҭ #j< #p #D # #kd #m& #Y 4 #B #xP ##^ #}l #z #IO #K #E^ # #o #fέ #%ܭ #2 #Ds #iC #!H #mU #XUm #z #ل #1 #Ͱ #$ڰ #r #~ #Lf #p #yA #Y% #F3 #A #>O #&O] #4k #;y #$ #: #{ #p #  #Dͱ #۱ # #Ņ #~ #. #s2! #>C/ #`= #K #wY #g #gu # #M #z # #$ # #6=β #Pܲ #jb #  #y" #7z1 #Dq? #M #-][ #vi #Iw #fN #j #d #ló #ѳ #m޳ # #@ #y # #- #; #I #No #E} #9% ## # #0 #,ô #qѴ #PIߴ #Ֆ # #o #I #y% #{r3 #A #O #>,] #k #Ny #! #%i #)/ # #_ #oP͵ #T۵ #a #} #& #|5 #>z? #S #'g] #O g #M&q #$D #5ڶ #6 #: #lw #> #rG #m #]J #. #}: #mpU #'r} #mo # #] #M #j$ #sq. #Tp #| #, #= #l #eW #y # ɿ #Zտ # #$ # #n: #L/ #u# #01 #JV #c #W #v= #+ # #w ## #q; #sOU #˙| #. #P # #7 # #+f #K #> #j #?" #{E #KR #B&l # #[ #v` #$4 # #+ # #= #΂ #U/} #w #X #C # # #S< #7 #iS #$ #$ #cb #-]) #7 #]E #!S #9a #u #U9 # #MZ #a #| # #݌ #7. #\Q> #TD #J # Q #/_ #Wm #|/{ #O #4 # # #y #~ #s) #@7 #zE # S #~Bb # s #U}y #r #q # # #8 # #^ #MP #Su #M #;1 #`f # # # #4( #MY2 #C #&zI #$5O #1UU #q[ #xba #g ##n #T #x # #@ #b #ͅ #r # #{ #" # #Z #:u #0f #6) #= #]\ #lf ##s #W #m #7 # #f} #} #J #eF # # #4 #J #eB< #MI #;1V #n #1x #< #c # # #X #4 #U[ #U #N0 #= #kJ #W #Dd #q #~ #3 #D_ #o # # #K #m #u #$ # H #+ #ǖ #lA' #HB? #M_L #e #bx #ߖ # # #Nf #mr #<9 #W #mI #3h #l # #E #B #8 #TD # #,w #> # #|/* #$= # J #7W #e #@r # #N #G #D #? #- #P, #6m #` #Z #-B #|/ #U!& #Z6 #]< #XB #ߡH #N #{] #U!u #l/ # #|/ #4 #;o #|/ #/ #f7 #ty #5 #LdC #jbQ #_ #7s #l #7 #/ # #a #v5 #h' #G # #c6 #6 #?u #|/& #3h? #|/M #mI[ #flt #|/ #mI #fl #|/ #' #- #!] #|/ #g. #q # ## #ʠ0 #f= #SZ #|/h #sv #% #|/ #e #d #]C #|/ #x' #C #e #' #fl( #6 #mID #flv # #{o #Џ # #p #{o #j #Y #j # #e #F #$ #b; #I # W # e #[ns #u # O # #E #z # #{M #N #m # #0+ #u& #{@4 #dB #qP #9^ #"z #\ # #O #& #" #B #} # #= #? #.% #g2 # #AJ # #` #|/ #h #S #+ #B8 #<E #S #}` #3m #oz # #;+ #O # #h # #S # #O #' #U4 #'G #NV #Qc #Gp #6} # # #a #Q| # #mI #. #{I # #(Q #h # #+( #w5 #2B #w O #N;\ #j #w # #{ #{C #~ #q #O #9 #| #d # #G #6 #& #3 #aA #:N #wS[ #wh #2u #N; # # #w ##m # # #{ #{C #~ #q #c #9 #|- #jK: #vG #hT # a #n #^{ #d #O #m #% #: #'G #bU # #; ## #w0 ##m> #֑L #<&Z #pv #5A #@ #f #wH # # #! #8. #w< ##mJ #֑X #<&f #t # #L #R #T # #9| # # #D{ #F #g #! #D{* #FD #gR #}Rl #)ky #|/ #% #x #% #? #)k #|/ # #4% #mI3 #@ # N # [ #) h # #% # # #R= #^& #ހ # #' #& 4 #[ #Wh #-]u #4 #X #-] #W #X # # #+' # #0 #." #oz/ #+F #0S #.` #5v # #T # ##e #& #M #` #yL #J #f+ #- # # @ #8 #f7E #jR #x_ #l #[y #Q #< #f7 #y6 #E #'u #~ #+f #Vf #6# #0 #WG #+fT #-]a # o #|/~ #z_ #j #L # #A. #H #mc #W # #|/ #8 #F #ZT #Zb #p # #/. # #l/ # #E #L7 # #y #. #{I) #7 #E #hT #v9b #p # #b #U #|/ #B #w #Y #0` #i! #0 #? #LN #T] #m #xZ{ #' # #O #+9 # #mI #. #{I # #(Q #h # ^% #+3 #wA #2O #w ] #N;k #z #k # #G #6 # # #a #" # #{ #{C #~' #q5 #OC #9Q #do #w| #q= #1 #|/ # E # #I # #X #:! #[/ #_> #viL #XZ #:w #a #C #{= # #  #|/ #+ #XA #< #: #W! #h/ #|/H #?OU #Pb #Ho #a| #DN #M #wt #+c #J #Q #\ #H #X # #8{ #D8 #I{% #2 #M ? #~>Z # v #, # #+, #Ro #^ #$  #* 3 #=?(H #ET`] #?i r #0H~ # #k # #1 #Q l# #G\1 O #Q] f #Whs| #! #I # #] #\ #T~ #}8 #g #L #ML # #] # # #"7 # I= #P #wY #`u #ӂ #5 ## #L #ԛ # #] #; #)3 #wJ #P #:g #5 #~q #6 # # , #1\ #O #F* #HsF #BMm q  zS ! 4 2 G Ah# /;GSz6D #nOo s p   # # #cJ #x    #y  `l, #L:ClX #pWblw #?f 2 0ll B @ Z Xph # ! #V' j+ h0 !5 #߄@ {D wK !^ b g #q=r v  # ! #V   #߄ # !. #V  ( #߄  @%/ !nD H V` !nr| ! ! ! * ( ; 9 ! L J ]" Y'9C !AX {\ ye i nc !T    x!4M*_? Ian #Z0999 9.9QQ_ # g !Fs #=~   % ! # #_ #yy @ > W U n l& ![/ 3 <yFyb f o s |  4( #B  #   " 1 C5 =: #H #_U@^ #ku ! d b # ! #V s q #߄k #x   #y  kk6 : C G P T ] a f}2 !    G #! !*u7P 3T 1] Ea Afuu [ Y r p     !! % . 2 ;  ? Dcm 5 3 ! D B !& S Q !6 b ` s# q, 0 9 = F J Smw             $1,>8K]qt 2 # ) - 7 #J #VX #߄ku !     ,E #dX # #\ #x #y #܉ #}~+ #v"8 #dqE #='S #me #sar #AA #G #J # # #% > 6 h d #       #:+ / 4 #? C H #i #_y # #bU   # ! #K #V ! #?f * ( ! <! 8* k. g3 !<HYf(w !s #K #< ! #?f   !     ! *7`H !SQ #;a_ph} #V !c #?f   !c   '  #  !cp !/( #L68?T #6>^ !Ag #?fr D v B  !A V  R    ~  !A8    '  +  4>V  Z  c  g  r{|{        {{         4OeIi # #- $  " @ ; D 5 R Y V U [ #:sf r j n o #xpz  ~   #~ ##     #>    ~ #V #K  '  #V1 F  #?fQ   U   ^ h              P  !      ! - j7 jS   W   `  !   #E%  #a  # h  #r  # %  #`1  #_= @F  #R a  #q=|  #1K   #U  #?f  #GK P  #U  #?f  #_   # &  #8C  #1Z  #CE  #  #U  #܉  #}~  #v"  #dq  #='  #m  #sa  #AA  #G  #J  #/  #' L  # hX  #rs  #]  #x  #y  #܉  #}~  #v"  #dq  #='  #m  #sa  #AA #G #J #, #$T #` #7$ # #x #y #bJ0 #pT #?f #xJ! #T* #?f= #JJX #gUa #?fp #_| #  #-y # #& #@ #@ #@ #@ #O' #'G5 #eR #-]_ #l #@z #c #-] # # # #-] # #w #\ #  #z #q= #K #VX #߄g #^y #d #` #d #; # #Gk # # #7 #Xl #ё+ #= #J #ƙW #e # .} # #܉ # #-] #i # #  #  #E' #^7 #wG #W #g #Ts #m # #-] #i # # #5 #N #g #" #2 #B #ČR #X^ #qo #~ # #4  #̍ #M  #q  # # #ގ # #U> #-]! #i. #; #H #N?U #g #$v #< # # # # # # #< #{! #e #~" #+1 #D@ #P #Պ` #p # # # #d #-] #i # # #Ȑ # 3 # #f! #!31 #93A #Q #] # j #5{ #;q #W # # # #+f #-] #Q #1Z% #?f2 #E #Y,a #+fs #9  #+f # #+f #F #+f # #-] #' #-]4 #!J #-]W #Kh #du # #+f # #+f # #F #+f #4/ #+f$ #1 #EH #+fU #9q #+f # #R #+f # # v #+f #% #ӆ= #-]I #|/V #S:q #-]~ #`M #-]` 0  ,  M  G  m  i kk!  %  +uQl  p  y  }       4  0 "k ! N  L  ]  [  ! s  m      !    %|EkZ !c  g  p  t  }         F D W U j f   j  f  ! % .CXm8B^ b k o y. !      !   !*       !*     .  !:>  ?B  =K  PO  NX  a\  _e  ri  pr H H H                        ! !J! ! ! ! (! ![5!J! !kW! [! d!n! !kz!  ~! ! :! 6! !k!!!!`! !{!! " W " U" "8" g<" eE" I" }R"]"n"P{"""" " """#"## '# -#vB#L#"a#k#3#K#p# # # # # # # # # F# :# $ y $ ! $ $$ )$I$fb$fw$f$ $ $f$f$ $ $ $ $m$$0%% !%3% !@% D% M%W% !c% g% p% Et% Ay% !%%%%H%%% f% `%'&@&U&n& r& {&&& & & & &&>&&&^''f('~:'U' Y' b' f' o'y'' ' ' ' ''' (' &' 7' 5'(`(#(`-(E([( #Q_( #^Pg( #@k( #@x( 4 }( #'( $m ( $ ( "Q( #P( #*( #( #'( #A( #( #( #( #e) #) #) #,) #8) #F) #K) #FY) #b) #) #) #n) #) #) #^* #* #* #(* #4* #s@* #ȩL* #3_* # f* # k* #Zw* #J* # * #[* #* #* #* #* #ͬ* #} * #* #S* #4+ #+ #+ #'++ #7+ #dC+ #^O+ #d+ #r+ #I+ #+ #4 + #h+ #+ #+ #+ #^+ #״+ #, #u+, #8, #E, #p, #, # , #&, #, #_ , #&, #, #_ , #- #- #J- #,- #:- #H- #ZV- #~d- #r- # - # - #z- #'- #- #- #o- #,- #- #. #. #4. #*. #98. #`F. #T. #b. #p. #=~. #/. #. #. #. #\. #>. #. #/ #T/ #/ #a./ #h=/ #L/ #=k/ #z/ #/ #;/ # / #W/ #/ #y/ #/ # / #U0 #0 #f0 #.0 #Ԥ=0 #ML0 #[0 #j0 #y0 #0 # 0 #0 #10 #0 #x0 #0 #԰0 #11 #1 #1 #-1 #<1 #˱K1 #Z1 #i1 #x1 #ݱ1 #c1 #O1 #91 #1 #1 #51 #g1 #t1 #ح2 #2 #Q2 #Ry2 #2 #82 #2 #G2 #2 # 3 #63 #RC3 # 4 ##)4 #I4 # V4 #Ƽc4 #p4 #~4 #4 #ͼ4 #5 # 5 #X5 #'5 #65 #\5 #n5 #U{5 #5 #B5 #5 #5 #5 #5 #5 #5 # 6 #a"6 #/6 #C6 #s`6 #c}6 #6 #e6 #6 #| 6 #6 #6 #6 #6 # 6 #V7 #7 # $7 #27 #@7 #N7 #Y\7 #j7 #)x7 #7 #7 #!7 # 7 #T7 #M7 #7 #{7 # !8 #)08 #?8 #O8 #f^8 #m8 #|8 #8 #z8 #68 #c8 #~8 #8 #o8 ##8 #ĸ9 #9 #"9 #*19 #e@9 #GO9 #^9 #Zm9 #3|9 #H 9 #9 #ڧ9 #̧9 #9 #9 #9 #9 #3: #z: #!: #Z0: #v?: #N: #_]: #|l: #s{: #: #: #?: #r : #b: # : #: #; # ; # !; #Y1; #A; ##Q; #ga; #cq; #; #; #; #; #; #; #; #; #< #J< #!< #0< #MN< #r]< #l< #{< #< # < #1< #6< #< #< #< #< #~= #B= # = #//= #)>= #M= #s\= #k= #5z= # = #&= #= #W= #= #E= #= # = #> #> # > #/> #>> #M> #\> #k> #} z> #)> #> #> #A> #> #> #> #? #? #R? #-? # N #2LN #&ZN #hN #vN #N #N #[N #N #N #N #N #N #N #O #T O #O #,O #dAO #NO #%[O #hO #uO #O # O #O #O #$ O #O #O #O #P #*P #g6P #CP #PP #]P #jP #wP #P #P #rP #`Q #]Q # Q #xQ #:Q # -R #e:R #GR #]TR #SaR #R #R #] S #BS #&S #3S #LS #YS #fS #S #ES #S #S #S #S #S #S #گT #ȣ.T #;T #IT #JVT #/dT #KT #6 T #T #T #T #T #T #@T # U #FU #(U #I6U #ODU #RU #qU #U #U #6 U #U #U #5U #YU #U #U #7V #SV #`V #mV #zV #^V #V #V #V #V #V #W #5&W #_,W #h2W #BW #\W #iW #:vW #W #W #?W #>W #W #W #_ W #X #X #G*X #7X #aDX #QX #^X #_ lX #X #dX #MX #CX #MX #, X # X #Y #ZY # ,Y #=Y #CY #IY #OY #1UY #\Y #aY #7nY #|Y #UY #Y #ûY #Y #~Y #<Y #Y #Y # Z #Z #"Z #~/Z #<IZ #WZ #dZ #MqZ #~Z #Z #kZ #CZ #Z #Z #Z #kZ # Z #Z #}  [ #;[ #r$[ #G2[ #?[ #M[ #^[ #Sd[ #k[ #x[ #r[ #L[ #" [ #[ #[ #8[ #[ #[ #\ #*\ #"\ #<\ #I\ #ZV\ #c\ #v\ #?\ #\ #G\ #" \ #\ #F\ # \ #\ #] #d] #U3] #?] #L] #uZ] #f] #s] # ] #] #] #] #!] #] #^ #^ # ^ #p,^ #=^ #fJ^ #V^ #tc^ #x^ #^ #X^ #^ #^ #^ #^ #^ #X^ # _ #_ #X%_ #"2_ #ϲ?_ #V_ #sc_ #Rp_ #_ #_ #_ #v_ #_ #R_ #_ #E_ #` # ` #"` #4?` #c` #p` #}` #4` #O` #!` #` #` #G` #\` # ` #a #Ga #va #8+a #=?a #ZKa #Ua #lba #4oa #}a #a #a #a # a #a #a #a #a # b #b #(b #6b #Cb #UPb #]b #kb #5xb #b #Ӭb #b #ab #b #{b #b #|b #rb #b #v c #Hc ##c #) 1c #>c # Kc #Xc #vc #c #Sc #c #c #\c #c #c # c #c #c #_$d #,1d #E?d #Kd #DXd #,fd #rd #d #,d #d #,d #d #wd #% e #Re #5e #+e #s9e #He #Ye #g_e #ee #ke #qe #xe # e #,e #e #e #e #se #e #_e # f #pf #"!f #/0f # >f #Lf #[f #if #ݽwf #f #f #]f #$f #Af #f #f #f #9f #g #jg #!g #D/g # =g #4Kg #Yg #bgg #ug #g #> g #g # g #g # g #g #g #g #h #Fh #h # +h # 9h #Gh #Uh #ch #qh #Hh #h #3h #"h #h # h #2h #Kh #4h #Ti #i #i #*i #l8i # Fi #خTi #bi #pi #~i #i #i #i #Qi #1i #i #Qi #+i #q j #j #)j #a7j #TEj #JSj #gj #j #:j #kj #9j #j #j #j #{j #j # k #k # *k #:k #Jk #Zk #)jk # zk #k #k #'k #ߺk #k #k #k #l #(l #5l #s Bl #ZOl #+gl #ul #Ll #ҳl #l ##l #l #l #)l #l #"m #,m #:m #Hm #Vm #dm #m rm #_m #m #ym #:m #m #m #m #m #m #m # n #,n #!9n #qFn #Sn #mn #|zn #n #dn #Dn #/n #sn #Rn #n #%o #2o #S ?o #MLo #Yo #=fo #Qso #Go #ao #Zo #o #o #( o #o #*o #o #o #p #Jp # p #N)p #6p #nap #np #p #&p # p #Jp #p #p #p # q #q #0q #Dq #Nq #Xq #Bbq # lq #vq #q #q #Vq #q #Sq #q #q #Oq #q #q #r #r #! r #-r #:r #Gr #ͻVr #Ger #rr # r # r #mr # r #r #r #r #&r # r #s ##s #1s #?s #sMs #[s #Jis #ws #s #5s #s #Ws #s #s #s # s #s #t #t #t # -t #;t #It #tWt #et #st #H t #͸t #6t #t #t #t #5t #t #E t #t #u #x u #-u #!:u #Gu #Zu #du #|nu #Kxu #lu #u #vu #u #cu #Zu #u #mu #\u #u #v #6v #' v #*v #8v #4Fv #Tv #hv #v #"v #v #~v #7v # v #ҽv #v #v #\w #w #w #2w #V?w #Lw #Yw #lw #vw #w # w # w #dw #~w #w #w #@w #~w #vw #w #x #x # x # -x #:x #Gx #wTx #`ax #nx #{x #Cx #x #{x #x # x #Mx #x #x #y #wy #ay #6y #Cy #lPy #N]y #jy #y #y #qy #y # y #y #ly #y #z #sz # z #+z #)8z #Ez #lz #z #z #z #z #,z #z #z #z #z #{ #{ # "{ #1/{ #[<{ #&Z{ #g{ #t{ #J{ #{ #9 { #6{ #{ #{ #{ #{ #{ #| # | #` | #D-| #@| #M| #!Z| #~t| #<| #| #| #'| #| #*| #>| #| #| #| #Y} #F!} # .} #;} #I} #/V} #Sc} #} #} # } #J} #z} #} #} #%~ #3~ #@~ #M~ #L Z~ #h~ #u~ #O~ #ͷ~ #o~ #~ #S~ #~ #o~ # #u #) #4 6 #\C #ͷP #] #j #} #  #} # #r # #r #q #\ # # # #(, #O9 #ͷF # S #u` #m #z # #- # # # #]ɀ #׀ # #S # #2 #> #zT #Fa #n #  # # #K #́ #{ف # # # #v( #5 #bB #sO #] #n #&t #ޥz #F # #ѥ #  #A # #  #t #˂ #}؂ #, #, # # #̵, #)N #[ #th #u #  # #  #[ #à #ۃ # # #L #$, #$6 #>C #P #!] #4j #Q #  # #N #„ #τ #!܄ #y # # # # #y( # 5 #O #\ #Ǥi #Ev # #n  # # #4 #xą #х #+ޅ # # #h # #G* #? #L #t #7 # # #c #ц #b  #\ # # #) #3< #lS #` #n #" # # #܇ # # #7 #b D #\ #p #~ # # #B #̈ #U # # # #  #t+ #W9 #W #p #~ # #B # #b #ω #J݉ #  # # #A #S #a #?o #S} #  # #ֶ # #Ê #ъ # ߊ # #? # # #+ #9 #G #b # # #@ # # #m‹ #ы #ߋ #B # #=  #B #0 #T> #(\ #Ԩu # #K #) #? nj #h #_ #  #"$ # = #4K #Y #{ # #l #& #z # #!ݍ #" # # #f ### #1 #? #ۨM #r [ #7i #w #' #  #< #V #ٵ #Ύ #ݎ # # #  # #w( #_7 #F #U #۪d #s #W # # # #͏ #܏ #' # #:  # #' #6 #E #~T #Nc #r #3 # # #! #m #|̐ #Lې # # # # #& #5 #j #*t # #! # # # #ʑ # # #  #k #) #6 #kR #^ #j #v # # # #h #Ò #ђ # ߒ # # #!' #B #N #Z #g #t #x #  # #e #Ó # ѓ #ߓ # #b  #+   #( #5 #^C #vP #] #u~ # #! #  #є #  # #? #6 #B #^ #j #B v #U #w # #C # #ĕ #ѕ #ɥޕ # #b # # #1 #3 #*@ #۳e #t # #~ # #, #5 #[Ȗ #֖ #I #  # # #ҭ" #b0 #> #&L # Z #?h #v # #> #O # # #ʗ #uؗ #) # #  #> #a #д, #v: #ѺH #V #d #r #g  #ʨ # #+ #Ř #KԘ #6 # # #  #0' # = #XL #[ #Lj #!y # # # #ǹř #ҙ #ߙ #{ #ӯ # #E #  #- #: #SG #_ # n #| # #C #v #b #š #К #ޚ #B # #] # #$ #2 #@ #N #0 \ #Zj #x #  #m # # # #1̛ #ڛ # # #B # ## #]2 #A #Q #Z` #o #~ # #1 # # #ɜ #؜ # # # #  # # # 2 #KA #JP #_ #en #ǫ} #w # #P #xɝ #_؝ #y # #+ # #* #; #A #< #$ #91 # > #K #nr #2 #w۟ # #m  # # #* #7 #D #Q #^ #k #x # #s # #4Š #*Ҡ #ߠ # #G" #K/ #r< #4I #V #p #} #4 # # # #ҡ #]3 #? #P #gV #\ #c #m #z # # #  # #K #Ȣ #M֢ # #@ # #B # #ٹ6 #RC #'j # w #  # # # #8ƣ #ӣ #ߣ #  #I: #b G #a #dw # # # # # Ȥ #դ # # # #" #Z0 #I #\ #f #Yu #H # # #/ # #EХ #ݥ # # #n # #D #h #v # #= # #  #cƦ #Ԧ # #ŵ #X  #  #e  #$ #i1 #> #)K #X #!v #3 # # #٩ # # # # #Y #vߧ # #_ #F #+ #  #<- #: #wH #~U #Gb #p #} # #s #  # # #ͨ #Dڨ # # # # #G #Q #k #u # #O #D #_ #1 #Y  #qΩ #ݩ # #  #  #& #, # x # # # #| #ƪ #:Ӫ #X # #" #nC #$f # # # # # #  #r #k« #ȫ #ϫ # #} #m # #k # #  #5 #( #.9 #? #uE #7L #Y #f #s #a # # #Ĭ #zڬ # #I #V #  #& #[3 #A #qO #] #q #3 # #Y # #  #ŭ #bӭ # #r # #  # #x( # K #b # h # n #u #W #Z # # #/Ʈ #rӮ #/ # #U #G #  #$( #5 #B #O #\ #ji #aw #@ # #  # #b #ů #3ү #߯ #Լ # # # #D$ #2 #Q # W #W] #wc #i #do #u #r{ # # # # # # #ΰ #ܰ # # #W #e #Ts #ƽ #! # # # #DZ #ձ #  #k #~ #3 #j #@ #: #/IJ #pҲ # #x # #  #J #& #k4 #B #P #9^ #m #2{ # #  # #W # #ϳ #N # #I # #$ #C #WQ #h_ #5m #{ #B # #' # #´ #Rд #_޴ #O # # # #"$ #2 #L@ #AN #\ #3 #A #O #Ϯ] #Ak #ö #[ж #޶ # # #- #M ; #.I #W #e #{s #k # # # # #[Ƿ #շ #A #t #e #Y  #R #T) #WV #h #LN #4 #s # #ӸǺ #  #  #  #' #4 #AA #%O #,Y #c #/r #y # #IJ # #> #Oƻ #Ի # # #C #|  # #( #ζ6 #WD #HR #` #n #@| # # #5 #> #+¼ #ۼ # # # # #?  #S #) #E #a #Mo #~ #: #Q # # #Ľ #ҽ # #] # #  #k+ #L8 #P #Bl # r #x #~ #R #  # # #K #0ľ #Ȯ # #X # # " # 0 #%> #yL #HZ #h #v # # # # #. #ʿ #ؿ #d #c # #p # #Q, #ֲ: #_H #V #y # # #x # #} # #Q #, # #U #c #& # #K #I # # # #1 #e #N # #  # ## #) #c  # #Z # #  # #& #3 #{@ #Y #f #Ru #ӫ # #B #B #w #u # # # #  # #! #^. #; #j H #fU #b #:o #7} # # # #  # # # #j # #!  #Z #$ #I # V #c #  #R #V #T #  # #Y # #   #2 #) #7 #"E # S #<a #Yo #u} # #C # # #K # #Ϋ # #o #( #5 #RC #Q #@_ #8m #4{ #e #Y #< # #h # #4 # #g #Z # #e #ܸ #A, #X 9 #lj #~ # # #  # #} #0 #Ϋ # #b  #ֶ #< #* #8 #aF #T # # # #  #{ #4 #k, #!9 #L #Y #2f #s #4 # # # #* #7 #'D #` #l # # # #M #-Z # # #q # #  #  # 2 #L #s # #h #r # # #a # # #  # / #p< #!V #o ##} # #~ #Ϋ # #  #M # #g #x #~ # #^ #1 # #r # #  # # #  # # ## # #T #i #! #/ #= #[ #i #uw # #  # # # # #/ #dE # P b~ #   #W  #  #- # S # $c $< "g #+  # #  #% #3 #G: #A #M #=[ #b #y #? # # # #A # # # # # #t # #  #2 #4 # #" #/ #4< #jI #HV #c #Zp #u} # #4 # # # #[ # # #M # #0  # #% #1 #= #[J #V #b #n #gz #t #; #V #) # #t # #v # # #( # #  # #e # #C& #:7 #= #C #TI #UO #U #X[ #b #r #x #~ #$ # # # # # # # # # # # # #  #Z # #  #G # #- #>9 #E #R #c #2i #o #Mu #{ #g #& #" # # #' #. #U #n #  #.% #U0 #nA #Mk #w , # S5YHSB J`3pClN([lk|(+(( +<M^|icp!&2!ApL Xpc(opz(p(p(p2DeatRkkkkk82$4F\ugsu~ u(( 6ETct ?iz+=HR]ly   ( 5 E W d `t `      { {  { { % P< PZ bs b P ~ ~   @  P U j1 `N `n ` k   5 O k^ kt k      GXkw..  +[@HQHbHsHHHHH !,;HXhsx"pGmfXf" ,7 FSg )8C   !0@P``pp p(  : j0BTdtS .+;HK\l||  2'7GpQ!\yo/BUchs!}`p" $H& $o* ${. $2 $6 $: $> $B $ F $ J $7N $FR $aV $wZ $^ $b $m $r $w $| $ $ $  $) $0 $7 $C $T $Z $c $m $x $ $ $ $ $ $ $ $ $ $ $ $ $ $ $+ $; $I  $] $k $q $! $& $+ $0 $5 $: $? $D $I $N $S $X $ ] $b $!g $*l $6q $Iv $Y{ $d $p $| $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $& $, $: $I $\ $l ${ $ $ $ $  $ $ $ $  $% $* $!/ $,4 $<9 $Q> $fC $mH $}M $R $W $\ $a $f $k $p $u $z $ $ $ $ $ $" $) $4 $; $H $R $c $i $p $} $ $ $ $ $ $ $ $ $ $ $ $ $ $  $  $ $ $" $,$ $5) $=. $D3 $O8 $\= $kB $uG $|L $Q $V $[ $` $e $j $o $t $y $~ $ $  $  $  $  $#  $2  $D  $M  $Z  $l  $u  $z  $  $  $  $  $  $  $  $  $  $  $  $  $  $  $  $  $/  $D  $S  $b ( R s $ w $ { $  $  $  $2  $B  $Y  $p  $  $  $  $  $  $  $  $  $  $  $  $  $!  $'  $.  $7  $C  $V  $f  $q  $~  $  $  $  $  $  $ # $ ( $ - $ 2 $ 7 $ < $+ A $9 F $? K $S P $a U $i Z $t _ $| d $ i $ n $ s $ x $ } $  $  $  $  $  $  $ $ $  $. $= $P $` $o $} $ $ $ $ $ $ $ $ $ $ $  $0 $E  $Z $a $q $ $" $' $, $1 $6 $; $@ $E $J $O $T $Y $^ $c $ h $m $"r $*w $<| $H $X $c $j $t $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $# $1 $8 $B $M $\ $k  $r ${ $ $! $& $+ $0 $5 $: $? $D $I $N $S $X $] $b $# ${ $ $ $ $ $ $ $ $- $= $H $P $[ $e $p $x $ $ $ $ $ $ $ $ $ $  $ $ $ $ $" $  ' L 'P ' ' '` '0  'T 'Xp ' '  'p$ '(!< '@.symtab.strtab.shstrtab.rela.text.rela.init.text.rela.text.unlikely.rela.exit.text.rodata.str1.8.rela__mcount_loc.rodata.str1.1.rela.rodata.modinfo.rela__param.rela.return_sites.rela.call_sites.orc_unwind.rela.orc_unwind_ip.note.gnu.property.note.gnu.build-id.note.Linux.orc_header.rela__jump_table.rela__patchable_function_entries.codetag.alloc_tags.rela.data.rela.exit.data.rela.init.data.rela__dyndbg.rela.printk_index.rela.gnu.linkonce.this_module.bss.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.rela.debug_rnglists.rela.debug_line.debug_str.debug_line_str.comment.note.GNU-stack.rela.debug_frame @@@+&@0@;46@@O J@@Z2hnaPi@@ {2}@  @h@ La(@p`@ @а@X@@P0@@@p@$0#4/@ @F`A@8 @c0(| @ w@X@"@@$@@&h@ @(8!(@8x@*!@@0@,'0'@@/ uL@@2 -@(P@44./@x@6I2'D@%@8U0O`0kp0TyY`p@p@>ЂA| ؒx