ELF>_@@KJ1uuDttff.DHHHHf7Wff.fHW7fD@FfFHff.H fDHtHHt 1AVIAUAATDiU1S A9IHx0I ètA1[]A\A]A^AVAAUDiATIU1S;H@uuYPuu_HL9tTI$I$( %A9u[1]A\A]A^[@]A\A]A^[P]A\A]A^[]A\A]A^@DAU ATUHSHxeH%(HD$p1H瀽 IHuf?Hvd HHƀ%AHLDuHLÅt9HD$peH+%(uHx[]A\A]@H  vJ HfZ LHHD$ Hu HH yHff.AVL AUATUSH I9txH IHHXHiI9t^D%Hŀ{ju7AX H{@HffDchsIC1I)I)0I<7H9rA$Et$II֩@hLD\$ D\$ HIJIII֩@(E Lf`H߉ƉD$HtzLA^ 1HcHD(HTt/H< HHH9uD9^ 뽃D9r fAUATUS1Ҁ Hu*HH HH][]A\A]L` H^ HttLLA<MA8HI9uHHH  tL LHƉ1HE[L]A\A]ƈHHH ff.USHf; sFft?HHt1H=t)H0HHf`[] uHeHc[] tɺHHH1HATIUSH0HI$H%HH H H[]A\ff.AUIATAUI0S HIH HL H[]A\A]ATIUS >I$ 뉘[]A\UHSމH% ؉[]ATIUSI$ 뉘[]A\AWDAVIAUE1ATADUS^ AHH` HHA^ IAt'HcHHHH4 HHH9uDE0LHLI0Iƀ DI LI M HHDeI D[L]A\A]A^A_fAVDAUE1ATAUHS u\ADH;LAII!HHI Ā EHL+[]A\A]A^^ DAHH` HHK^ HAHcHYHHH4 HHH9u9Hŀ LHHE,$HI D+[H]A\A]A^UHHSHHx0~(HHBHHIH[]uCHt HCwHeHc[]H tHHH1HAWIAVIAUATUSH8^ HcH` HtPHH4$IL $x9AT$$tA@LL $L $fAIu AǁLL $2A^ A1L}`H`HI91Ҹ`L $fABD(E7 $-HMDHGOfAoAOIHAIǃuҋ $MALE)HDA(HHI PfA9 HH@HA L:HR9NL $D-LAHHEEAGCEAD{HCHHGWfDkSHHAHAuH$D)(HHI PfA9 HH@HA AH2HR9DNAHHDIA}fuHUH-˅$DfAoAWIHAIHGWuҹ@AWfAOI1H8[]A\A]A^A_H8[]A\A]A^A_E AA9DBCHHIx AxLPHfD]~EÉ<$LUpMIGEg!HE`A)D)D]h2E9LAE1EHl$ILL$ LEDAM/ME$HDL$LT$LT$DL$LhD`HHY$t3A)L)IAA)EHl$EADuxLHt$ IAHHHD$0LT$(DL$HL$HL$LT$(HD$0DL$HQLHHsE9LLL$ LT$HL$DD$DD$HL$ILT$H@EgLL$ HHDI@ f9s"\ f9rhf9( f9s H )HcHvH@f9X r)HH HcHvH@ft-HtH=t84 hff.@AWIAVAUATUSH^ Ht$HcH` IbD$AHD$fHu ǀH|$ŅFA Mu`$9AZ $`HAEA%LD AHHAZ IIHSsAuNj $L)͋L$ HAZ HLHD$(HHI PfA9 8HH@H!A AL2AZ HR9MDNED,$D9|nDށ0.u(1LHHAZ IƋsIHSD uɁLH1EAAB4D É0.EtD,$Eu'>LD AHHAZ IIHSsAuwLH[]A\A]A^A_D$ADށ0.HtATE11ɺ HUHSHHHHHGHHGLJHGDCHK@HHH HHHLLHHHtH,@[HL]A\fATUHSHHLHHǃHMt$HuL[L]A\[]A\fAWAVAAUDiATE1UHSVt1HH( A%=@=PAE9HHx0H Åx1[]A\A]A^A_ff.AWIAVAUAATUSHHHI( L$L$DL$%AIHx0I t ID`0AID B1 'IHx0I AƨtAI1҉P0LFAEH, H1ILH9uׅ t$LD$II( H $fL$IH01#IHx0I ŨtAII( H $1fAIP0ALiL$L$1#IHx0I AƨtAI( I9l$I1҉P0H$I@9kL8%AAII( éuAI1҉P0A D$H[]A\A]A^A_fAE=Iw Hff.fATUHSHcH0eH%(HD$(1H$D$HD$ HD$HD$D$$ HLD$ HA H$D$D$\$AąHH[HP1fPT$T$PT$PT$$fPHD$(eH+%(uH0D[]A\fAU ATUSHHheH%(HD$`1Hl$D$HD$HHD$ H 1 HH9D$D$fD$$fL$&D$. =t ^ f fD$2 fD$4 fD$6l D$8 D$LD9LD>H~HH)IHB L)ƉHH`fu&tft؃9>LL렐 )Ѕ~wATLc1UIHSff.H(HHBL9uH(1󐿬 H(HuHI9u[]A\ )~-Hc1Hf.H(HHBH9uSHHƇHx4H H @A4HHx4H [ff.SHHHx4H HA4ƃ[f@HfHfHH=tH8uHcH<11HcH<DH 1HHff.AWAVAUL ATUSH I9IIH I"HH_HhI9u?sI$HމHHHEpH}pHpI9tUHtHSpHCxHBH{jL{pLsxuA$ tsI$11t[]A\A]A^A_USHH@HtHƃH(H HHǃ u-H[]HH[]HHǃff.uSHHƃH([D^ HH` ff.DvHH` ff.@Dvh fHcHHx Hff.HcHHx HFf.tH + H1AUL ATAUSHLHP HHP H9tXHP DcHDctHHCHBHHHLHH"HC[D]A\A]HLE1Hs HHATIHUSHI$ ȃf4JHPHP@8f(H0HX[]A\DAUL ATAUSHLH HH H9tXH DcHDctHHCHBHHHLHH"HCD[]A\A]HLE1D[]A\A]fft2HF1HfVHH @f fDAWAVAUATUSHHf; DfDHHH=^ 1AHcH` (f%1HDž0Hf8HH @f(lt H A1McfB`H[]A\A]A^A_L LI( f9r&f9X HLL[]A\A]A^A_ H HH $)H HcHlmHD(H L LuLLtH $MwL}HML xH{ H 1ɺ lD EH{ H1ɺH []A\A]A^A_HP )HH HH $HcHlmHD(HH LP LuLLH $MwL}HMLP | ff.@SH@u+uPuu[BHf@HtHfH`tƃHftTƃfOHfHpf[HfDAWAVIAUATUSH8wL/G8lPAV8uAV IFH AHE1A*L<w(HHt1AԉLHA AF 9PHHIvAF I AI9HHDHH pACH:jDSE9 E; fE:DA+ I Ht xA A 1҃9t iHHI A D(A t4A8A^ A HHIDIA PHfL$<tHH`4$A1LD$|$@4$L011OLAMuAN8H81[]A\A]A^A_AA AV eA I ЉAlAN8H8D[]A\A]A^A_LDT$$DT$<HHDT$Dы4$ALDT$D$EDA+ I HD$HD$@AfD$fA7f|$`I @%@ H DA @@I H ΉA~jA~hAFhI~@IHAN8At2@fJf!~A jAH $DALD$t$$t$LD$I ЉAl6Af|$E*1DLDT$|$DT$}4$LDT$DT$cA5LDT$DT$H $f A^ D$LHI` HH@@@QfP QPID$ffA $E^ DMcM` A@<@Hdf|$EHD$P<01AΩ0E1H= D$HL$D$HHHL$HIP H@ADT$H $fGAHT$ GIX H|$Ht$H $DT$t H|$Ht$HT$ IX HHwH>AnEyZA ?A ,A fA"<u4Axf|$EOtfA"fAfAtfAfAqWfApfAofAnfAmfAjfAe fAdfAcfAbfAOfANfAMfA%fA$fA#fA!fA"fA fA wlfA fAfAfAfAfAfAfAH<3f|$EfAwfAwfAfAqwfApfAofAnfAmfAjyfAehfAdfAcfAbfAO6fANfAMfA%fA$fA#fA!fA fA fA fAfAfAfAfAfAfAHAZ I,fD$ f5f4f2f3bf1f'f0Df|$A"wIff ffffffffffUSM H` )HcHHڋBu5Ht+H uH` H|H` []1[]fD=AVAUATUHStsH L AHXI9u-WH{huPEu/HCpHXI9t,lu#fus@t׀{jtH[]A\A]A^Ls@LL{ht{LD8LD>H~HH)IHDL)HƂft"ffƂH%8>||Pff.AUE1ATIU1SH HDhHPHP HPHPHP HPdHHxH( A$ H1[]A\A]ff.SH H1҉P[@USH 1t[]HH( %=@=Pff.fAUATUSH 5Hf^ Df1HL`AfHHcH` H}HHEHHE$H),HEHhE EEE ǃ`DHH(#L f1[]A\A]fDULLE1SH> ׅuA tAAD!AA uIHM9uEu[]H@HH/H[]DAWAVAUATUSHeL,%(L$I I M II"H+HL9u8HtHHCHBHL3HL{HHEHL9uI0 M0 II"H+HL9u8HtHHCHBHL3HL{HHEHL9uI@ M@ II"H+HI9u8HtHHCHBHL3HL{HHEHL9uIP MP II"H+HL9u8HtHHCHBHL3HL{HHEHL9uI I E1HHD$I fA HD$A I fD$tsI Kt$HDI B >f I HM LcLLtM HkLsM&A ID9A( IP E1fA@ IP fD$IX tsIH Kt$HDIH B >f IH HMX LcLLtMX HkLsM&A@ ID9Ht$H|$1A fA t\I A t.A8A^ ƉHHIAx HA 9AM I LH8I HHI9tq1A HcƃHI HHAA 1fA tHQHA H9A=tApLtŅtfAuDH$eH+%(o Hİ[]A\A]A^A_HyA H<[LuL uA IA AHI HHH9tBAA IPlA=tAt HApHHH9uIHx4I IA4fAAƅ#HD$\I] HD$dHD$lHD$@A AIHT$@E1 HIHA5LfA^ D1fAAAM`AfEHcI` H} Hu HEHHE()H01HELEELD$@IHIhADž`HIDLLHHHAHD$\H|$\HD$dHD$ltIIHHT$\HPHT$dH@HD$lfD$jA<$B-AD$HL$@E1LAIfEHAƅH\$(ILHHD$tHD$|HD$(HD$0HD$8D$$ŅyAIfx<|M\HLLŅ9AuAeAAƅAƒAiA kHH|$(IvHt HH)AHM9t I@EttHHƃH H4H @A4HHx4H H ƃHE1fDL$&f>ru HHO>QfvbHT$&pD$&f%fL{ Hŋ$) ƃ  ;P HsHt4AHHD$`eH+%(u(HhD[]A\A]A^A_HAUATAUSH HH( v[%==@=PEt= u = H[]A\A] t:HH( u1[]A\A]Hs HHfDUSH@Hh HHtdHHtXƃH H4H @A4HHx4H ƃlHƃlHH[]fDAWAVAUATIUSH 11AD$HHcɉHH9r݃ fA$AƄ$ I$HA$ jA$AƄ$ AƄ$%A$ ADŽ$ @HHI$( LI$ ÅiAƄ$LLII$Hǀ@I$A$ I$ I$ I$I$0 I$I$0I$I$I$I$I$8I$@I$IDŽ$8IDŽ$IDŽ$IDŽ$IDŽ$0IDŽ$IDŽ$H[]A\A]A^A_HHuIT$I$LH@A$f=f-fwZA$AIDŽ$IDŽ$IDŽ$IDŽ$fE$IDŽ$A$ +A$ IDŽ$IDŽ$IDŽ$IDŽ$IDŽ$LIDŽ$uzA$6 H<@HI$HXA$61A$69;LktLuLQtĻA$ HI$HnI$ IDŽ$IDŽ$IDŽ$IDŽ$LrL]A$ IDŽ$IDŽ$IDŽ$IDŽ$HT$0eH+%(uH8[]A\A]f.AUIATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$fD$D$IE11HHLnuA`LHHLD$NHT$0eH+%(uH8[]A\A]f.AVIAUAATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$fD$D$IE11HHLyuELHHLD$[HT$0eH+%(uH8[]A\A]A^DAVIAUATAUHSHH8eH%(HD$01Ll$H|$HD$LHt$ HD$(H),HLD$fD$D$IE11HLLu$HtEtEHHLLD$aHT$0eH+%(uH8[]A\A]A^ff.AUIATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$D$IE11HHLuALHHLD$xHT$0eH+%(uH8[]A\A]@AUIATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$D$D$IE11HHLuALHHLD$HT$0eH+%(uH8[]A\A]ff.@AUIATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$D$D$IE11HHLuALHHLD$HT$0eH+%(uH8[]A\A]ff.@AVIAUAATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$D$D$IE11HHLuELHHLD$HT$0eH+%(uH8[]A\A]A^f.AUIATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$D$IE11HHLuALHHLD$HT$0eH+%(uH8[]A\A]@AUIATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$fD$IE11HHLuALHHLD$HT$0eH+%(uH8[]A\A]ff.@AUIATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$fD$IE11HHLuALHHLD$HT$0eH+%(uH8[]A\A]ff.@AUIATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$fD$IE11HHL#uALHHLD$HT$0eH+%(uH8[]A\A]ff.@AWIAVEAUIATUSHH8eH%(HD$01Ld$H|$HD$LHt$ HD$(H),HLD$D$D$ ID$ E11HLL%u#D ADLHLLl$D$HT$0eH+%(uH8[]A\A]A^A_fDAWIAVEAUIATUSHH8eH%(HD$01Ld$H|$HD$LHt$ HD$(H),HLD$fD$D$ ID$E11HLL u#D A0LHLLl$D$HT$0eH+%(uH8[]A\A]A^A_AWIAVEAUIATUSHH8eH%(HD$01Ld$H|$HD$LHt$ HD$(H),HLD$D$D$ ID$E11HLL%u#D A8LHLLl$D$HT$0eH+%(uH8[]A\A]A^A_fDAVIAUAATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$fD$D$ IE11HHL)uELHHLD$ HT$0eH+%(uH8[]A\A]A^DAWIAVEAUIATUSHH8eH%(HD$01Ld$H|$HD$LHt$ HD$(H),HLD$fD$D$ ID$E11HLL0u#D A$LHLLl$D$ HT$0eH+%(uH8[]A\A]A^A_AUIATUSHH`eH%(HD$X1Hl$H|$ HLd$HD$Ht$8HD$@H)HD$,HD$ HD$HD$HHD$PHLD$D$3D$"ID$0E11LHL tHT$XeH+%(uCH`[]A\A]ALHLHL$HD$ufD$uT$TAVIAUAATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$D$D$ ID$E11HHL uELHHLD$HT$0eH+%(uH8[]A\A]A^DAVIAUAATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$fD$D$ ID$ E11HHLuELHHLD$HT$0eH+%(uH8[]A\A]A^AVIAUIATUSHH8eH%(HD$01Ld$H|$HD$LHt$ HD$(H),HLD$fD$D$ ID$ E11HLL%u5LHLALD$ALHLLD$HT$0eH+%(uH8[]A\A]A^fDAWIAVEAUIATUSHH8eH%(HD$01Ld$H|$HD$LHt$ HD$(H),HLD$D$D$ ID$E11HLLu#D A<LHLLl$D$HT$0eH+%(uH8[]A\A]A^A_fDAWIAVIAUATEUHSH8eH%(HD$01Ll$H|$HD$LHt$ HD$(H),HLD$fD$D$ ID$E11HLLu0EA,LD HLLD$\$HT$0eH+%(uH8[]A\A]A^A_@AWIAVEAUIATUSHH8eH%(HD$01Ld$H|$HD$LHt$ HD$(H),HLD$D$D$ ID$E11HLLu#D A(LHLLl$D$HT$0eH+%(uH8[]A\A]A^A_fDAVIAUAATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$D$D$ ID$E11HHL u!A LHHLDl$D$HT$0eH+%(uH8[]A\A]A^ff.AVIAUAATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$fD$D$ ID$E11HHLu!ALHHLDl$D$HT$0eH+%(uH8[]A\A]A^fAWIAVEAUIATUSHH8eH%(HD$01Ld$H|$HD$LHt$ HD$(H),HLD$fD$D$IE11HLLu#D A@LHLLl$D$HT$0eH+%(uH8[]A\A]A^A_fDAVIAUATUHSHxeH%(HD$p1Ld$H|$ HD$LLl$HD$@Ht$8HD$HH)HD$P,HD$XHD$`HD$hHD$HD$ HD$HLD$D$3ID$0 E11LLLt!HT$peH+%(uSHx[]A\A]A^A(LLHL$HLD$\$4rufD$uT$lUfDAWEAVEAUIATUSHH@H$Ld$ H|$LHt$(H)eH%(HD$81,HD$ HD$0HLD$D$#D$ IE11HLLu"H $D EHLLl$$D$ HT$8eH+%(uH@[]A\A]A^A_AWIAVEAUIATUSHH8eH%(HD$01Ld$H|$HD$LHt$ HD$(H),HLD$D$ D$IE11HLLu#D AxLHLLl$D$HT$0eH+%(uH8[]A\A]A^A_ff.AUIATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$D$D$ ID$E11HHLuALHHLD$HT$0eH+%(uH8[]A\A]f.AW AVAAUAATUSHHPeL<%(L$HE1Hl$HLd$HD$HHLHD$ HD$LHHD$f%D$PH|$ HD$Ht$8HD$@D AfD#t$PELl$DELLH)fDt$P,HHD$D$3D$"HD$0E11LLH>t-H$HeH+%(HP[]A\A]A^A_AHLLHD$HLLAHD$uT$ftttff.AUIATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$fD$D$ ID$E11HHLuALHHLD$HT$0eH+%(uH8[]A\A]DAUIATIUSH`eH,%(Hl$XHD$HHD$PHD$HD$ HD$Åt%HD$XeH+%(bH`[]A\A]HT$HHt$LÅD$f% 1@t AULl$H|$ fD$P1LT$THt$8HD$H)HD$@,HLD$fD$2D$"I$D$0E11LHT$LNÅtL@HL$HHT$LLAD$ALLHL$HHT$D$ÅuD$f%A$tA$iff.AUIATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$fD$D$ ID$E11HHLuA\LHHLD$HT$0eH+%(uH8[]A\A]DAWIAVAUATUHSHeL,%(L$E1Ld$DH|$HHD$DHDŽ$LH)\LHHH$HD$HD$Aƅt0H$eH+%(HĨD[]A\A]A^A_LHHAƅD$f% AfT$LJ~&ff.fAATHH9uLl$1LHt$4HD$fD$.HD$D$,HE11LHHAƅuoA\LHLHD$LLHA\HD$Aƅu0D$f%tAH=1H|$X LfT$LHD$PHDŽ$HfAUIATIUSHH8eH%(HD$01Hl$H|$HD$HHt$ HD$(H),HLD$fD$D$ ID$E11HHLuA\LHHLD$HT$0eH+%(uH8[]A\A]DAWAVAUATIUSHHeL4%(L$E1Ll$LH|$PHD$LHDŽ$LH)\LHHHD$HD$HD$nt/H$eH+%(Hİ[]A\A]A^A_L|$LHLD$f%l@2A $fL$T~BID$HT$XItff.f.HHfJHJH9uLd$ 1LHt$I$`Lz^tHt$LI$`LH []A\A]A^A_H|$HOD9t#9uH8D9uHD$ ։pbI$`Ht$LLEff.AWIAVAUATUSH(eH%(H$ 1Lt$hH$AHD$@LHD$HHD$PHD$XHD$`HHHD$(HHD$0HD$8H$ eH+%(uH([]A\A]A^A_ff.fUSHftYf9uPfHt+PHs:ubtHhf[]H0H1H|0H|1HyHH)H)HH맋01DDff.f=SHf9t [fHPHrdH0H1H|0H|1HyHH)H)щHHHf[ut뼋01DDfDAWAVAUATIUSM D0LL LA))ЉLJL1I$E1EnHA;$sACIރtDk I$1LE$HE$[]A\A]A^A_ 5UH8SHFwfuE~[]@Hƃ H[]Hff.@SÅ[ff.@U1HHSHHHHD@EHt[]HE1HHAHDHEHu;EHAtHEHH[1H]DHHUAHHHDJ1ff.AUIATIUH1SHHtIHI}HHHt0HHtHHtH9huL9`(ù~tH[]A\A]AUIATLg USHHHeH%(H\$@Hfx@tqAHCHt,H@Ht E$HLHsfEA HsHHS0LHs{itS8CdHL$ HHD$ D$# HH$HD$HD$HD$HD$(HD$0D$8D$t>At15t,ALJ LH1[]A\A]A^A_uKfL$fAl$@A A {$u@ k%t5HV[]A\A]A^A_AI?ID$tHH8-ALA)1L H86A(빋t$H<$AI?1HU[]A\A]A^A_AD$tD$A|$t(I0HtL$@f fEщT$AIu8I?HIutttfA tL$@I8Ah LHH$fH<$ƉD$A1HIA<<u}AEEt6If  DI( HAVTIfAV(At fAF&fA uL$t$H<$AFI$@ ED$AnfAAAFD$AFH9thfufƅH{ZH{@DC@tUA2LLHXHHt@f{>tHDžXHTH8ƅ`[]A\A]A^A_HXH@<HXlȐAWAVAUATAUHSHHLntFHLv L~@DFdHZHtBH[]A\A]A^A_HH^E1E1E1Hu <<tb<uMt1L9`HLn u<t<tE1E1E1<HM?1L9M=1L9) HDH[]A\A]A^A_<tE1E1HH < <<<M{L9i<E1E1E1<<M1L9 HDML9 HDML9fD9 wML9t^H <E1MxL;t1H:<fD9u8fD;uE1<_#AVAUATUHSO>ffcKdHT HH6H0Hf=AHIHH8H@Hǀ8HHHǀ1H)HfE$ A$PPHmpt3sasI$xE>f=&f=tof=A$ AƄ$f=f= AƄ$fff=HHIHH8H@Hǀ8AHHHǀ1H)HfE$ A$PPHmpt2sasI$xE>f~f-fHAƄ$JA$HHH[L-HHLtHHLkI]HLs@Lk H%HpHHLcH%HHǃH H!HHH H!HH H H!HH(H H!HH0H H!ȹH8fH HH089:$HHHHh HHHLLHHHHHHHHHHHHHHHHHHHHHHHPHHH HhHhHpH H H( H@ H@ HH HP HP HX H0 ǃǃ ǃǃǃ@ǃ ǃǃ H0 KH8 H H H HHHH fA$I$HI$CA$ fLAƄ$HЃҺHºA$DCH8HA$A$tt A$ƃH t 1t  ADŽ$A$HLHŅLH[]A\A]A^f*fv)H??fHsf=A[]A\A]A^f-fA$ E1fE$f=f= fA$H|AƄ$IAƄ$Kef=t>f=f=M@DEBHHA$ AfE$f=}HAfE$HAƄ$HPAƄ$L}Hf=f=f=f9p(uHHxtPttUJ yH$H$HHHH9uDHH9tf9p(u1 H$H$AVAULATUHLSHIHtuHHtHHCHBHHLstH[CttQLLHHCtt9~E[]A\A]A^[L]LA\A]A^HLLH[]A\A]A^[L]A\A]A^LkAWLAVAAUEAATUHLSDHHHLIH}1HtNHHHt+HfD9hu!~uMtA|$ju~uJHH}HHHuMtI|$tAD$tt7~E[]A\A]A^A_EI1HHH[L]A\A]A^A_[]A\A]A^A_HHH9uNHH9t>f9p uHHx\P\tUJ yH$H$HHHH9uDHH9tf9p u1 H$H$HHH9uNHH9t>H9puHHx\P\tUJ yH$H$HHHH9uDHH9tH9pu1 H$H$AWAVAUL@ATUHLSHHIHC@H$C@P HLHHH[LPLLtHPL3L{IHHC(HCHCHCHC C@tXP xAH8HS@LLH[]A\A]A^A_H<$PH<$H<$H<$ff.fAUATUHSHeL$%(Ld$AHH$H<$L LHH$HHH9tH;S HH9uLH=` HH C0HHfDc(PC,H$ HC tkLIt0tHHRLLLHXHD$eH+%(uxH[]A\A]S,H}1ɾtLHHtHHCHBHHHHH"HCHLxAWAVAUATUSHL@I$@H%HIH E LLIƋH]8HHk\C\P I(K DK2HLCLHf{<LLIƋtcH]0Ht4L{tCttkP xUE I [L]LA\A]A^A_[]A\A]A^A_  H6L뜾L덾Hff.AWAVAUATAUSHHL/A\ Au%AuHHtL0MtAF t|UxD9DHNHH1DUHH@AAPPDCpCpH[]A\A]A^A_MLHAtfMn0Mt;MutAEttzH xEAEX EAEtt~;HLH$LH$ LH$H$뤾LH$H$뮾LH$H$sAWIAVAUATUSH(@t H([]A\A]A^A_= t!AH([]A\A]A^A_I DL0rDI0 Dd$L0MLDLH$IH:H@HH@HD$HsHD$H4$L@$M$ID$LD$ HD$ALD$ >fA|$8E1Ht$LLHD$fPA8LfDALDD $Hx H@HHH@,)H41HBfB@jIL01ҋ4$LILMt"I|$tAD$tMI}\AE\H([]A\A]A^A_H4$LE1H= HHbHM HfXI( LH@HtI( LuH]H+AA|$nGA9H4$LIHH$t$LHD$ H$HIH@HH@HD$HHD$Ht$ H@$IEHD$AAu^AU$tRE1fA}<zA}IE1gH(L[]A\A]A^A_L'tHt$ HA/AE$Ht$ HAhfDUH0 SH0 HH9u|H H H9u[]H Hu)HtHUHEHBHHHHEH"HE1[]H0 HulHuff.AUATUSHluRDEuEIHH߉A$0f9t7[D]A\A]A[D]A\A]H[]A\A]qAWAVAUATUSHDEt%A[D]A\A]A^A_HI= ttMH߉D8IAEfD9t[D]A\A]A^A_H:HftyDDHDHx H@HHH@$)H,1HBH AfBHH[]A\A]A^A_H= IHtHLH LH@AL@ LLfAD$tLH M4$Ml$Metff.HAWAVAUATUHSHLAl$ H[@HtHtH@AD$ u.HHDž[]A\A]A^A_L(LIƋ(I\$8HtEL{\C\P AT$uHCC\tx~~LL[LLIƋtsI\$0HtL{tCttzP xRAD$uHCCtuH낾Lp L8 L럾LL{ff.AWAVAUATUSH8HL$ H@L@MK HIHH$}1 HD$Ef%fD$ fO2HD$E D$&<@Dm CXED$'ILAF HHH$Mv8MMN\AV\hJ H<$HLL$0HC IVAN2HHHD$(fA~<LL$0}1H$H8[]A\A]A^A_L{XAtR@LHH@;H@I H?HresponseH1Hse info HqDfAAj@LH@t_HP I H?$?HH)ƒt!5@1tHvftƃHP @ HDm CXHD$EHHD$@LH@t_HPI H??HH)ƒ]t!5@1tHvftƃHP@ Hno statuHs fADXA@LHH@tYH@IH?v^?HH)ȃRt 5@2tHvftƃHQ@ HautosensB H2He failedHrDXDD$'@LH@t|HPI H?,?HH)ƒ9H=H9LM@LD9HyHH)H)΃r1AȃN N 9rƃHP@ HHH$MF0MMptAPt:J  H<$HLD$(LD$(HC HHHD$(AHfIPL$H4$H11~HLHautosensHHe valid HADX5@1HvftHstate teA HHrminatedHADXH=H9LM@LD9HyHH)H)΃)1AȃN N 9r H=H9LM@LD9HyHH)H)΃1AȃN N 9r}?HH)Ѓt5@1ƃH@ H=H:LM@LD:HzHH)H)փ1AЃN N 9rH=H9LM@LD9HyHH)H)΃Z1AȃN N 9r>52Hvt5҉1HvtK5҉1Hvtj  HD$0LLL$(LL$(HD$0LLD$0HD$(HD$(LD$0LLD$0HD$(HD$(LD$0HD$0댋5҉1Hvt51Hvt+HvftAWAVAUATUHSH_( H[@HtHtH@L@MLLIƋI\$0HtfL{tCt%P H9kID$0CtCt~-LLLHDž@[]A\A]A^A_LL(LIƋ(I\$8HtL{\C\P tH9kID$8C\4C\4H+H 9C\9C`HCL@H0LH H9u.HH9t;J,u;r0uHtHBHBHL L0LLH 9C(9C,HCL LLzLhAWIAVAUATUSAHeH%(H$1HT$`Lt$$HD$<HLHD$DHD$LHD$TD$\HD$$H LHD$,HD$4fD$2I0 DL(Ld$l$L$wLL趩D$uD$|v-H$eH+%(HĠ[]A\A]A^A_IHHD$LLHD$>Ht$H|$HD$HD$DT$Ht:I0 L*Hx\P\`QD$|t8A HT$H8Af AFEoH$AG qL(LH<$HD$IHpIHIX AV2HEHIHf$R1AvfA~<Y^A~IqAV8t AT$I~\AV\<Ht$LH\ 4$HID$11LLH<$HD$IHP(HpIHT$fPHHT$ HPPPXZ D$sIHD$LDAw AWfEHHHR1AwH11L越ItAWtHXHt$L|$H\ rHHu HHIHHHHLD11H<$HT$APt$fmAG R^H@H|$L0H|$HH0L9tfE;o(tM?L9ut0MtH<$LJHT$(eH+%(H0[]A\A]A^A_xxV D$IfCT D$@IHHHDB1AFIH<$LAGL,HHA HEAG4<It708AG5IHALEKS H\ tDDHVIqAW4 1w,f=hf-f?H=HH\H@xh1M;LIVIENHHIRH1HX`AV0MN@HIHHR1Z&wLft$HLHt$LH<$HD9H\ t&H1XD$It$H14HAH<$HT$ }Ht$LNAD$ A 1HHHEO(R1HAG5HHPAw H|<IHALEPIA>IA,H=HH  AWAVAUATUSHDEHeH%(H$1HT$LH|$PHD$4HHt$4HD$<HD$DH)HD$LDHDŽ$H HfD$BDt$hAAƀADH0 L8HD$XH$D$lL$cH4$DHdD$D$n1H߉ƉD$,HD$ HHHD$HT$ H4$HHD$Ht$H|$HD$ LT$ DL$MtqH0 L8IztABtt6~HL*u<$AAD Et'A$tLHL ǃ HLH1HP[]A\A]A^A_fAHhDƃ9Mx@H0HäI LHLL$IL$L@fAIPI$1vǃ KunfAHfAKfALAAfAM1EHEƃ"E1ɉLDL$D\$DT$ `DT$ HHAED\$DL$9HGƒtHAD$ fP8t>HLLD$8DL$0D\$(DT$ HD$LD$8DL$0D\$(DT$ HD$Hx@P@t@LD$0DL$(D\$ DT$LD$0DL$(D\$ DT$yLD$0DL$(D\$ DT$HDT$D\$ DL$(LD$0CfAE E11H߹ D Aff.H\ tU1SHHHt)HHHt Hf9htH{HHu[]@%ƃH{HHu[]ff.fU1SHHHt)HHHt Hf9htH{HHu[]@%ƃH{HHu[]ff.fAWAVAUIATUSH(fD$`Dd$hT$ L$$Dt$pD$D$xLD$D$lf1DAǩ%=@=PA1LAfAƉD$ʼnD$AALfAƉD$fEHxHIHHH@,1H)4HIHH@H@@AFfA.A^-$D$H|$Iv EMfAF0LIADžHHLt$DIit$,LHcA1LAtC<l$Dd$LT$$t$ AE=  t$LfAH([]A\A]A^A_D$AFA1Lu3 뺀t 땾LA& \$Lf9(Lff.AWIH1AVAUATUSHH H7HL6H@M8H@HLHH3HHHHA x@ DhfEQE1I(HHT$DLH$H4$H|$HHAP yE$jEXD$D$HI LLLD$L$$D$LDAPD$ PjjLD$0L$(T$ LAH A A IH31IHHMt MWtAGtHtyH}\E\^RIH1HHA ǃ H3I1IHHH D[]A\A]A^A_D$D$HL@MLAL}0MMWtAWtJ HLL$L$EoHfEH3II1HL$A 1ǃ HL$tHLH3ǃ IIH1HA LI$Hk0HCDAD$CLt HH(H{@C@t ~[]A\H[]A\[]A\ff.UHH=HS HtC@@HH8fC>Hk0t HH{H{@C@t ~[]H[][]1u0ft#t5 fAWHP AVAUATUSHHHP H9u^H@ H@ H9uH[]A\A]A^A_L@  ( LP H AH<$A)Et$El$HH IcHHR5HH<$BHHH@@fDh DpHHLtI$ID$HBHHLI$H"ID$1H[]A\A]A^A_tEl$D( = tvL LHH LD)H:HcHRHшBH߉Hx H@HHH@$)H,1HB fDjATUSHHIfA|$uHAT$HH[]A\BflAVAUIATUSHtOLHILHHHH9tL;c uL;kPt%HH9u[L]A\A]A^[]A\A]A^LHtHH[]A\A]A^fAWAVAUATUSH H@eH%(HD$1H$HD$HD$HII8ƅ LHx ~HLp HHDžp HMtLCLL0bLHH0I9hHLL+IL9upIEMLM9tYILHlLtH HCHAHL;H{\L{C\uHMLIEM9uHLHI9uFPHHL9t/HӋPuހ uHPHHp(LHHL9uLLIILM9uAHtIIFHAHH"M>LIFIHHL9uXLLHLtH8H@HBHHHH8H"H@HHD$eH+%(H []A\A]A^A_$HPHHp(LHHLLLSCHƅXHDžL3LXHCHH@@$HCHx(fAWAVLwAUATUSHHo eH%(H$HLXL@LIHCI9tBLtHSHCHBHLsH{0LsC0n.LLfC.f H f 6f ffu_t  {8uCL LHK4HHH9tf;J(HH9uLH{0C0bHDžXH$eH+%(?H[]A\A]A^A_f Qf2uf0!f1uhLuLf1 f HDŽ$Dk4HDŽ$HDŽ$lfEt(LHL9tfE;l$&XM$$I9u{6H=8 IHHPEŹHH$f$HHLVHf fpf*D{(LHD$hHD$pLHD$xHDŽ$HDŽ$HDŽ$HDŽ$HDŽ$AHH$9H4$LIMH$HHt$hHDŽ$HDŽ$HDŽ$Ƅ$HDŽ$DŽ$@fD$AD$iD$vfDL$xExI|$tAD$t*`HU8vu ltcC6<t<ALLHs@HI蝋HHtI$Htۀ~uՀ~tHI1LHHDHf5 C6<<l{,E1{<uCAUD< <ulu CHD$vLLLHHL9tfE;e($ MmL9u $fA9 H(LE1HD${<D$Lt$E1ELl$ JDT@fEt-DB$t{h u lLCLt$4D|$8fj| 1fjAALt$ Ll$(H\$0Ht$H|$LLt$ Ll$(H\$0诡 D|$8H|$HD$tHIC8<aAANL LLHHL9tfE;l$(dM$$L9uLAH$HH$H=` IH LHP AD$,H$AD$0fEl$(ID$ bAT$,H}1ɾmLLItI$ID$HBHHLI$H"ID$LLMIE E]LHD$IEPD$HD${<D${>MHT$Ht$H<MLtI$ID$HBHHI$H"ID$Laxl:$D$ALL$HHt$A͉DT$0AD$(<$ZH$1DD$(HH$H׹ HDT$0Nf$>D:$0$!HDT$PHHD$0$1HHD$8H$HD$@DT$PHHD$HHqHt$@HDT$PHISH(fA9$Ld$@T$(HDT$X$LL$PL?LL$PDT$XHt$8H|$0DT$@LL$(HT$HLHOLL$(IytAAtDT$@S2H0 AHE H$Hf$$HT$hH?BAT$DH&SDH蛻HD$Ht$HHD$Ht$LHD$LMH$HHt$LCHt$H1E LHH$f$$HT$hH7ADH褺AHãvAlj$4$H贓AMB$AGZH4$Lf9H4$LLt$Lt$Ll$ HD$ELL$HHt$ADADH۹$1HHt$hDH$IAIH1LHD|$8H|$HD$Lt$ Ll$(H\$0IA1LHHD|$8H|$HD$kHdLH4$LfA9GZH4$A$1HHt$hDH$IALaLH0 EL&AEBAEBlH|$H|$H$LHD$Ht$HHD$sIH>H fA9$$Ht$HL\$$;L\$upHt$LL\$L\$I{\AC\t=Ht$1HJHLt$ Ll$(H\$0LHt$LL\$L\$I{\AC\tGYJDT$(DT$(DT$(LDT$(L 5Ht$LHt$8H|$0DT$@LL$(*Ht$8H|$0DT$(DT$(4fDSHuFuk8 H0 1H1H.\H[酽HfHhtHfHkff.AWAVAUATUSHeH%(H$H ~6 u-H$eH+%(t H[]A\A]A^A__HC HD$HD$pH$HD$XHD$H{1HHt)HHt HHt@$H{HHuHHD$pALHD$xHDŽ$L4$:fD$~ulLLHLtHLeLmImDm&H=8 HH1HPELHtH1Ht$H$H<$HHHD$ HHH9D$P HC HD$Ht$PHD$P8QH<  H)HHD$HHD$pH$T  HD$pHD$xHDŽ$HH,HD$XHIHH4$HHfD$~ HD$XE11E1HD$ AA9IcHMAD$;t LHfI|$@AD$@H []A\A]A^A_1AHfA;fAfAfAfAuE1{$u4ff.ff.fDS$AA9Ict(ftD+<uHkfx*@0MDzAChfA2fA'fA  ){HC$1E1E1f$t%KIHD9C uBT(uBt&HHD$A+fEHD$fE9@@u $fD9tfEfDEfD,$L {l{ bsHi+QC8` AfA' $C<t<LLsLc(1HILHHIHtOH@Ht$H@HtS@%I|$tAD$tHMLL{fA4C <\E1{$uff.S$AA9}AIct(ft|*uHiՀ{hRƅhDkfEC&P<{lJDk fA9:C&<<<uH@LHHH $LHH $HM9t0AD$<0=uAD$N<u fE9l$FQM$$M9uHHStK HT$'HH9ufEt AHYf<$t 4$HyY{H E1HD$#fA9tKAHgCID9B|(uBt*BD&H IH2ftf9$uH= HHH( HT$HfDhH@Ht$HD$t H|$Ht$HD$H( HHwH>GHH9xtHH9uHf@fD9@@uf; $tfEHAH9ufADf pfA5`AFfRH@LHHH $LHH $HM9AD$<0=2uAD$N<ufE9l$Ft.M$$M9uEAD$<AD$<뽀{$E1f.C$AA9}!IcT(ft|*uH\C&E1-ff.ff.fDC$AA9dIcT(ftD+<uH[Ʉ6E1-ff.ff.fDC$AA9IcT(ft|*uHP[ fj0LLHIHH9tfD9n(t H6H9u1HLLH EL s,XH If;XsHZC&~f<$(Hf $H9{$E1*ff.ff.C$AA9}IcT(ftD+<uH/ZDkfEC&PDk fA9Lf.ATUHSHHheH%(HD$`1HT$H|$ HD$HD$XHH)DHHD$HD$ HD$lA Ht$HEET$fHL$(T$8HCHHKL$2HCKуtyu@tC tKtKtKtCtKtKtKHT$`eH+%(uHh[]A\ff.AWAVAUATUSHH T$eH%(HD$1lHD$H$LHLf@ f@HAąt>f@LHD$eH+%(3H D[]A\A]A^A_2HAfH߉ƉD$ fDBE1 IHHT$,HIHHx H@HH@$)H,H$H@AE IfAMHT$AE AU  AU (AM!LH)IIG(0H$HAGHPH@ AGIw HHfAWA(HT$IGHLB(HHǃHHHt$ H H@tH0@ftAHL$E1LHf@,Hff.AUH`ATIUHSHHH H9t.HCPHSPH9tH9HH9uHHH9tHH[]A\A]ff.@AUIATUSHG@HX@ H[@HtHtH@LLH8LHHHtIXdHPtGtt~HL[]A\A]Hһff.@AVAUIATUHSHG@HX@ H[@HtHtH@LLH8HIHHtQH@@HWtIEGtt ~#1LL[]A\A]A^ݾHIEf.AWAVAUATUSH`H_@eH,%(Hl$XH H[@HtHtH@HPLHD$,L8HD$4LHD$DHD$LD$TDpHD$$HD$<A1LIHH;`0H@LLHWH`H9HD$  H( HH$fx  fx LAąfx H<$WHT$ACI`IL\$(H|$ H|$ L\$(IIHH9u@ff.fHH9t+L;bpuHBPPL\$(T$ T$ L\$(GE1L\$8T$7T$7L\$8E1qHL\$8T$7L\$8T$7D$HD$6USH@ftYf9BuPf@Ht+PH0s:ubt@Hf@[]H0H1H|0H|1HyHH)H)HH맋01DDff.z^tmMthAUH`ATUHSHH9tHS(H9uL;CHtHH9u[]A\A]HCPLcPI9uHL9H9u[]A\A]ff.@z^tAWAVAUATUSHHH<$eH%(HD$@1HH=AIH˺` IHIEH,$IEH@PIEPIEXHD$HHHD$IL;(NHH|$LHAH<$IUƉD$4AąAMI]HE1}M}(u5zff.ff.fUAIhA9}'HUXLL;z@uH;Z`u܀z^uH<$H*ȄHD$(E1#ff.EID9KdL}XM4IE(IMI9G@uI9_`uIMXHT$LHHL$tHL$HD$M}XIIOL9H$AE f;E(rHEXB|0_DI CED9dA}E1A}H}HIHHM}PL9|$tKLt$ML<$Hl$ Hl$AIvPLAF^I^`M6L9uLt$Hl$ AuMe@*LIH$ f;E(MIELIIE IIE(IIE0IA}u!AFjI~tAFttUT$4IM(LLu`HM}8H|$LehLLHD$LLIE(HC/H<$DHHD$(HH<$HLHLIIH$ f;E(H|$(IFtHL$(HAIUHIu(H<$IH@jHD$(HAWIAVLAULIATUHSHH0H$I;(IHLc`HK`I$LL9u%ff.HHIH9HI9l$(uM9l$HutI$ID$HBHHI$H"ID$A f;C(IG HD$?{th11ff.ff.ff.HKXHH9i@u HA0HA8HA@HAHKHh9H4$LMl$PMt$PIM9H,$LDHtIIFHBHHHIH"IFIHL9HAAF^AuIvPI|$@HLLHEH4$H0L[]A\A]A^A_AA} ttIU(MU(I9tgL H\$ HLd$ILt$ILL|$(MML9sIL9tHHmL9suLMLd$H\$ Lt$L|$(IIHIH9I9tH0IHH9HI9uIEH9t3HJ H4$H0L[]A\A]A^A_Au tAAMHt$LH1IEH,$AuI|$@ff.AVAUIHATUSHHvXHDd$LDt$MH[HsZHSLH:HCt$DHHCHHC HHC(Hfs\fCX1҈D$T< w D1҃< w A1AA w EB$D1҃< w A 1AA w EB(HC`HHPAHkPH[]A\A]A^HS0LAVAUIHATUSHHvXHDd$HDt$IH[HsZHSLHHCt$JHHCHHC HHC(Hfs\fCX1҈D$W< w D1҃< w A1AA w EB$D1҃< w A 1AA w EB(HC`HHPAHkPH[]A\A]A^HS0LMAWAVAUATUSHlL$u ItH[]A\A]A^A_HHEHHD$MMHI;(M3D$H|$HL\$H@HICXL@:tLfLȋLLHHHHrt 1Ɂu 1ɁzLDBGtHH fHtH\AWAVAUATUSHH8eL$%(Ld$0IHD$(H= fHAl$ H߉AEL$tELcB; ƒ"@L4A MCRB?A9ED$pE9 A4HAfx H8fH1AH߉Ɖ$^ 1HHEfDJAD$tMk\N Et$pB ƃ Hǃ N+ Hǃ B; I9ICHID$L)HkIT$IHPIQH@IAAD$N A Mt@J A LL$HL$(D9HE1LHLL$HT$(DE1 MvLL$Aǁ JHLT$HIHJ LT$LL$HD$(E JEAD$ 1ɈEAD$LD$(DuE LE fMI1A T$HH\uHH ǃHLL\$H4$H LHL\$H8Bf%B; 1fHHT$0eH+%(H8[]A\A]A^A_t*B MCRBF E9D$pED$pED$pE9 E `=HLD$ HL\$HD$LL$ LD$ L\$HD$LL$:@AU1ATUHSHeL$%(Ld$IHT$D$LuD$t*HD$eH+%(=HH[]A\A]ƅ,H1HHt%HHHHHuHD$eH+%(HL[]A\A]ƅ,H1HHtL&(HHHHHtHHtHHtՋP uuH@0xxv<$pLx4u@L%@"z&nAW AVAUATUSHHxH$Hl$ HeL4%(Lt$pE1HD$HD$HD$LHLpE1LLft2LHT$peH+%(HxL[]A\A]A^A_ HLHHHt$PLD$f%D$$<L$XH<$HA_ff.fUHHSHeH%(H\$HHT$D$Hu(D$HD$eH+%(u0HH[]HD$eH+%(uHH[]ff.fUHHSHeH%(H\$HHT$D$HHD$eH+%(uHH[]UHHSHeH%(H\$HHT$D$HHD$eH+%(uHH[]ATUH@SHLHeH%(H\$HHt$D$u6Ht*D$AD$HD$eH+%(u4HH[]A\HD$eH+%(uHH[]A\ff.SHHHH[Hff.fHff.AVAUATIUSHHheH%(HD$`1Hl$H|$HD$HD$XHH)\HA$H|$ H1HD$HD$XHH)\HI$HtD$I$Mt$@LBHD$B>D$BBD$ B@D$$HBD$X ȉD$XJ8D$X ȈD$XJ8 ȈD$XHBHD$\A$@D$,HHLl$4sYtAT$@T$4D LHPH t HuaD$SHP IT$@HT$4ILILHL$8LH)I)փr1҉փI<6H<19r|AD-A$D4f=f-fA$u LD$H t^HP IHHH)ƒCt# AMtHIfALD$SHP A$ t LD$H HP IHH20.102.0AE0.00IED4A$0\HH߉D$0H1HT$`eH+%(Hh[]A\A]A^H48.100.0AE0.00IED4뗺HH)ƒ8t# AMtHIfALD$SHP AT$@T$4ATAThH5IuHHI|5IuHI)DL)i1AN N 9rMH5IuHHI|5IuHI)DL)>1AN N 9r"ATfAT AMHIAL AMHIALfAUATIUHSHeH%(H$1LD$H|$HD$HDŽ$LH)HLHA$D$ HHiQH&9GvnM$MtjiLHH} HLHADŽ$d1H$eH+%(u$H[]A\A]HHUHxSHĀeH%(HD$x1HHHHHHHuL$  uHT$xeH+%(uH[] AV|AUATIUSHHeH%(H$1Hl$H|$HD$HD$xHH)|HHHA$Dl$1LfL$DMIcA ƃ;L$|wA; IԈ fT$@%tfL$Ik\HHI HHT$HPHT$ HPHT$(HPHT$0HP HT$8HP(HT$@HP0HT$HHP8HT$PHP@HT$XHPHHT$`HPPHT$h@XD$xD$pK T$t T$||D$H1H$eH+%(HĈ[]A\A]A^L$|u9IԈ fL$@fL$A; tIԈ ƒ҃fT$fL$DAT(USHH0eH,%(Hl$(HHH$HD$HD$HD$HD$ HIL$ ; t; ; 1HD$ HD$H HD$H HD$(LHH1HT$(eH+%(uH0[]A\zff.fHtCt8tHrelease BH postfBoff BfDHtHHtHHHHH=u+Iff.ff.HH=t dtHAH1fAWAVIAUIATDUDHSHH@<tzvI<DC$L}XK@H@LAMH[]A\A]A^A_DC$L}XK@H@LAKL}XDKHDC@L<<w< i<<Y<I<<IHE ELLHHH$M<3<<<<<<ff.@AWAVAUATUSHĀfHeH,%(Hl$xHH$HD$XHD$`HD$($D$ $D$IH 1HHD$Ht@HfHHD$xeH+%( HD$H[]A\A]A^A_D^ LHHL$^ D$D9? 1LHLLHH{ \ DpAx H81fDHAHƉD$$^ 1HIM9LHL$fDJD$H$C<3H@HkfD$0f f9X E1H<$YMHT$`E1 LHHHD$HMtt$$1HHH HDžHC<R< '9<dƅmAE<1<)ƅmHT$0H AuHLHLD$`HH $MHT$XHt$$1H AE1H<$fDL$0HH4$HT$XE1 HIHH$H<$HD$"H4$1LH$Ht$LHM4HD$W<<<u<w fHLHMLD$`H $HT$XHt$$H$ H9HBHi,C<<HH8xjMtAL$ILl$LLLLLHD$ t?Dx L8A9LLGLH|$(LLH$twS3wnH@Hs^L$M3`D9GºAH@LHHD$Ht$LLHH|$t#HL$`HT$E1LHHMHL$XH4$E1LHHhY1fK4HAf3HH<YHLHMLD$`H $HT$XHt$$H<3QHx CHH#h Dd$$HIEDLDfA}HI EH@HH@AVHLL$hLD$HL$`HT$8HAX.t$$HHT$0HrHLHMLD$`H $HT$XHt$$HHfx<|<3AE`t$$HAE H@HxHHH@XH)H`1HDl$0HAHHMLHLD$`H $HT$X{Ht$$DHLD$`HT$XHHMLHH $Ht$$HxuC;MLxHLHMLD$`H $HT$XHt$$HL<|H $MLH.ZHt$$H H+HHHC M@ <Hf7 HHHt$$HHD$<HHHEI} HD$8\ EMIfH\$@HL|$HELd$PACHHHt[fD;zuT(AE0ff9!A@FDHfA@HtHH;t1H $MLHHD$lD$t.H<$MDZ Me I9ICHKHD$0L)I Ht$0LH|$lHL$@LD$8LD$8HL$@L9fH|$0LLZ H Ht$lL#fAU0IL|$HLd$PH\$@t$$HHD$IL|$HLd$PH\$@uEMH8L$ fD@AU@PAUPAU P x L89GLALH|$(LLHt$$Hƅm&t$$HHD$t=HLH LD$8dttyDUH?SHHeH%(H$1HHT$8H HH88HHHt$0H$D$|H|$(HT$t$xt$HL$ H|$pHt$Ht$HD$8Ht$Pt$HT$@Ht$Xt$HL$hHt$`Hs4t$xWHQt$xt$xt$xt$xRPHHH$eH+%(uHĈ[]HAVIH9AUHFATUHSHItfH= IHbv$AE1HLLtL LHLHDžHLH1HDžHH)HsNtAv DžHL[L]A\A]A^IHHHILILI)LB L)ƉH뜉؍KLLITITHAAEATfATIjAۉADAD2AAEATATzADfADITAVIH9AUHFATUHSHItfH=T IH_s!AE1HLLqL LHLHDžHLH1HDžHH)THsNtAv DžHL[L]A\A]A^IHHHILILI)LB L)ƉH뜉؍KLLITITHAAEATfATIjAۉADAD2AAEATAT}ADfADIff.TAVIH9AUHFATUHSHItfH=T IH_s!AE1HLLqL LHDL<HDž<HLH1HDžHH)THsNtA<<v Dž<HL[L]A\A]A^IHHH<ILILI)LB L)ƉH뜉؍KLLITITHAAEATfATIjAۉ<ADAD2AAEATAT}ADfADIff.AVH9AUHFATIUHSHItcH= IHمt1ƒA4At9rAE1HLLujL LH8Dž8t1҉уE D9r8HL[L]A\A]A^IIHf=AUATUSHf9Jt[]A\A]fHIHtf@H8I $HzHH It Ht H)L H)։HfHAD$tr<tn<3u.fHH[]A\A]LHH뻨NtA$|AD$ tEl$`HA9LGH@AA&Et A%AD$4El$HA9LGH@As3AE ABD(fBD*HH DHtHt HJHH)AH)AAA1҉փH<0H<1D9rHHzHH DHtHt H)H)ALHHA $ ALL* BD(BD*5 BD(BD*BD(fBD*@IHHEQABf~DѸUHSDDf#6HHiQH&i)HHLAIqAI[IkHHHACEICIǃAA9LGH1H)HAsAEt@Bf^4frf=7o f=5_ HLHAPHHALHAP0HAPtHHHA A<HA<HGHHA<:HHA<@5HHA<KHHA<HHA< HHA<HHAuHHHAA<ALHLŅ$tA` AAt?A@ADž0 1Ht$@LT$@ŅLŅAlA tAAA0t$A uAu AAHPE1 f=$5t7wf=#59f=!5Cf="5LHHLHEHtFHHA< )@tgBH=t.HfLHtH@tHt7HHLH| t{Hf=5wH(DBӀ <t^ u_ HHHlH1H9H?HcHHH HHH 1H8 9hHH HcH HHH LpH HD$IFpH9D$tNAF:HHuHIvHHELE1HT$(HH$LHLI$Ht7Hs HAHs HE1DI$LHAIvHMFpMp9~D$Ј ƃE1 A9AH HHƃH(H(ru)HHT$&L$D$& L$D=u`tWf|$uNvC= HuHLHc1AHs HAHs HAE1DL{ HHLL{ \L{ KLH7Hs HHHHHHs HHHw HHHs HHHHk HHH@HLHH( LAHD%=PuQLHHHAHHHLHLHHHHs HHtHHH HHHH(gHw HHIt$ HIt$ HH_ HHHI\$ A$ tHHH=t f9FA$ tqID$fǀA$8A$Rƒf9OfA$@ ʃ f wjHHnfwID$ffvHHf9GfADŽ$@ 5JfA$ ~0uf9Gf9GA$VA$DfA$X fA$fA$^ fA$x tA$FfBA$Z fA$ A$f9C1<$fD$A$^ t$1҃`)f1fA$ A$ )fIt$DfE$ DA)ЙAA$4DHfD9sAfD9AGfIt$A$X A$ fE$ P@fA$ efA$ A$Tf9s2fA$ @P?fA$X fA$ DEHA$ A$ HA$ AAA$=A$A$ E$ DADLLI$LAƄ$%I$HHHH=tff9Fz0uf9GjTfA$ zA$ *uDL(LA$ $A$X A+$ AA+$@ IT$fA$\ A$ tID$HHA$\ E1A$ A$@ A$ Dl I$h A$ A$^ DI$HE$p DE$^ A$X I$` Hu\A$ EHA HfA$\ A$ H<$t3A$ EHHA E$^ A$X I$` I$h A$\ A$ AAHcHL HI$ HI$8 DM$ IM$0 AAEHAHHPBD-A$\ D$ ^A$ tI$` HHA$  A$\ 9GA$ I$ HuHHA$ E1A$\ D9~h HI$ HLIHH I$ H<uHHjfA$X @L$@gA$ I$ HuHHA$\ D@fE$ A$ t$A$ I$ EHHA$@ I$H HuHHE$ E$ fE$( A$ t$A$@ I$0 EHHA$\ I$ HufADŽ$ A$P<ID$1A$ A$\ N hI$x HuHHA$ E1HI$HALI$ HA$ 1҉A$ f9GE1IfA$ A$\ D9ADA$ t8A HHA$ tA$ HHA$\ D$I$E1A$ HHI$ HuA$ E1A$ A$\ DD9LHHHHt$A9Ht$I$ I$ L<0 IIWIHHIOHA$ HHDH H 9A$ AHHA$ D)A$ HHAA$ E$ fD$A$ fD$A$\ fD$A$ ukk`I$E1HHLcLI$p HHA$ fT$AfD$A$\ fD$EDHHA$ DA A$\ bII$x M I$ ILHQHL$HL$HI$x LHHuvHHLA$%A$  I$L!I$HHHHHHID H H 9ud1A$ 9~rI$ HI$x HJ 0A$ HJ6HI$x A$ HHJD6HAHHAƄ$%IHHAƄ$% I$h I$` HHI$h HIDH H 9HA`H HHPE$\ HE1A$x E$ DI$HELI$ HYHu^A$X A$@ ȃ@9~@fA$X EA$ t HAƄ$% I$ I$ HHI$ HIDH H 9AA$ HHA$ DHH PE$x E$ HE1A$ D$LcI$LHI$ HZHu1H/A$ HI$ I$ HHI$ HIDH H 91LA$ tsDL$AHA$ I$ HA A$ t9I$ HHA$ tI$ HHA$ I$HHE1E$ ALI$ HHu(A$ HHI$ I$ HNI$ HIDH H 9I$I$H E1 fADŽ$: HI$@ HHuHHE$: I$H HHt$T$HA$: L$HT$D)L$A ID$HA$8HID$HHfA$LI$ HH A$XЃffffA$( HI$ HA$( I$ HA$X ЃffffA$8 HI$0 HA$8 fA$I$HHI$@HA$ A$x fADŽ$A$x I$ fADŽ$A$x I$HfADŽ$@I$I$0H A$x HfADŽ$I$HI$H A$x HfADŽ$I$I$H A$x HfADŽ$I$PI$H A$x `I$8I$fADŽ$HHI$@HI$I$I$0I$I$I$I$8I$@IDŽ$LIDŽ$LLLLں LͺLL賺L覺!L虺'L茺4L5LrfA$u2A$t'0LM1L@2L3LuLÅI$`I$$1H1A$AƄ$AƄ$mA$X fBA$ I$ I$ HlHw HHM~ HHLHLAƆlLHAH|$L@t|$tcL1AtHLHH[]A\A]A^A_M~ HHL>L1L調HʿM~ HH1LeL HHLM~ HLLHHHLHLAƆlLHAH|$LAƆM~ M~ HHLM~ HLIHLοM~ HLM~ HLIv HH@HH HLt+1LH$H@HH@HHPLH $L@ucHLHLLƃLHLLLLLHLHB:$LHLHLƃLD8HL`HHH=w&HHHY[]A\A]A^A_HHHH@HHfǃH@HHHHLHH{HH AljAA@uTLHHLA <$X[]A\A]A^A_HqAPuLHHLHH@HHPL@HHLƃ$^u 1҉HLHHs HH HHt 1HfǃAHs HHAHw HHHs HHHs HHHs HHLHt 1HfǃHs HHHw HHfHHHHHHHHHHHHHHHHHHAD$AL$ft$H[H]A\A]Huff.ATIHUHcS1H9t*Htu HA4HH[H]A\ATIHUHcS1H9t*Htu HA4HH[H]A\ATIHUHcS1H9t*Htu HA4HH[H]A\Hu DHHA^ HL $fAx H<$fL $MIu HHEAA^ HL $f6Ax H<$fD$0L$*Lf9GMIu EFHHA^ HL $fAx H<$fL $MIu HHEAAHu HHLIfDž$1HfADžLHIu HL$HIu HHD$8LfADžIP $AAIu HHLL$DD$DD$LL$Hu HH HHfD;u t$ HAlLI$A^ HL $fAx H<$fUD$0L$*Lf9GEFMIu HHAoHfADžLHs HHHs HHIt$ HHIt$ HHHu HHHu HHHs HHHs HHHu HHHu HHfDUHSHHHHHH9tfAZftf9BH fH[]H@t|HwsH@ tfHw]H@ tPH@tCH@t6Hw-H@t H@tH@uH@Hw Ht:wAwHtOwYt`HHHHHHHHH?876543210  HH DHHHHHHHHHHHHHH|HpHdHXHLH DHHHHHH Hs HNdHV@Hw HHN@DCdIt$(HHKkIt$(LCnHHKlIt$([H]HA\A]SlIu [H]A\A]SkHKnIu HHs IHHhDHs A IHXHu IHHHu IHHHs HHHHHHPHHHHs HHHHs HHPHs HHHs HHHs HHs HHIo HHIHD$HIH9uHHD$Hl$DD$1LHt$(Lu fD$6ttA Hl$uA( I 1D1HHt$(LsfD$6fD$I $H D$lA(LHT$@Ht$(AD$A4D$F<$H$I HHT$MHT$HL9d$t I;T$ tM$$HID$HtL@Mt|AB$HAD$6LT$ ID$L$HMD$ HHp(LLHLT$ HD$AD$(fA9Ht$HFAD$6HID$L$HMD$ HHp(LLHHD$AD$(fA9tHfEl$(HLT$ LT$ fEl$(fEjWHXH[]fAUHATUSHHHH(LXLH u tLH H!L81Lxݽ HHLH[]A\A]===========f=uH=H=f=uH=5HHHH=t HHILHHK(LCLHHA11HLS(HHL11HLAtpK(LCLHHAtHHD$@eH+%(uWHHHL1[1]A\A]Me L$HLHD$@eH+%(uHH[]A\A]KHLCILHHN LFLo HLHf{<A$HK@DC0LHHHKS LHf{<tK0HS@LH{ItSHHKILHHCHt{Yt Hx(A$K LCLHHf{<t*A$tNHK@DC0LHH{It)A$tKHLCILHHH{P[]A\A]f{<uff.fu P y SHtHHCHBH[ff.@UHSHHuHH[]LcMtfI$@Hu H@$HK S(HmHHHH"HCLLI|$([]A\A]A^HK S(Hu HHHHHH"HCL[L]A\A]A^Hs HfǃLX[]A\A]A^A_Hs HHHH߹Lfǃ@ZH1[]A\A]A^A_Hs HHiHs HHMHs H5T$AHs Hf.u ff.AWAVAUATLg UHHSHQHNV Lf{<tK0HS@LH{ItSHHKILHLE1LHHH9tHH$AHH4$H[LfDsZfDEtH{PH{\HfE9uZH[]A\A]A^A_>X[]A\A]A^A_ff.ATUHSHNHV(Hw HH11HHHIHH9tHHH{tHH[1[LH]A\fAVAULATUHLSHLs\IHH9tHHHLH[LIHHHL[L]A\A]A^AVAULATUHSL1HIHH9tHH{tLLHHS0s(HLctHHt'H{u?u6HHS0HHsHH3HLVLIHH9tHtHHLH[LHHHLLHLV[]A\A]A^HXIHHHXI HHIXHHAI?1HHHH[HH][HH]N(LE Hw HHH[]A\H H8HXHL1HHH[]A\A]LH1LuHLHHLHHHHAZD[]A\HL8DGHXHLH4$LHH4$AuHHHHHoDATUH SHHHItHHCHBHHHHH"HCL[H]A\ff.AULATUSHHLeL9t2H}u"U,H{1ɾt HH2LM$$[]A\A]ff.AWAVAUATUSHHƇP0LMt*LMtLMQu7I;AW,H{1ɾLHGufILLHLEo(HHLH{1DLHILLLEg(Mw0H$IGHIHD$RH4$L uJHtEAHLHHt#Iu'uHt$HLHLHCtIu"H H4 uHHf uHLL1HIHH9tHH}\LLHH}Le\um}YuHH HL H{U(1HH߅uH}u"uHLIHL0HƃH[]A\A]A^A_ tsHXHfǃ fLJ HXHƃ HXHHL ft+HXHƃ fǃ HXHLfǃ Hs LHHHs LHHDD$DD$Hs LHHDD$DD$HF0LIHHH8HHHHHH"HCL )A$8 t4A$HHA$HI 0LHH$I0LHHf?wHLADŽ$@HLADŽ$Hfy#LADŽ$HLHA$M@DEBHHHHHs H[]A\A]A^D9Hs DH[Hw ]HA\HA]A^Hs I HHHs I| HHHs I HHHu I7#HHHu IE#HHDEuIt$(MLHHXHK@DC0LHH{ItKHLCILHHHHIl$(K(DKfHHLCHH1L1HL?Il$(KHLCPHHHHL$T$Iw HH4$fA}<H4$E1AAM0IU@HH(H[Hw ]HA\A]A^A_H(Iw H[H]A\A]A^A_T$Iw HAUHIMIIw HAT$kIL$nIw HL$L$HL$T$Mo HLL$fA|$8L$AAL$dIT$@LHL$L$T$DIw D $E8HD $Hs ITHHAHHs AD$EL$Hs ED$HPXHs HHAUEMAHs EEHRXAHs AHAHs HHs HHHs IHHHs HHD:AHs DHHC INH$HHHD$(Lt$(DD$ HDL$ UHL$ALA$A$LE$HMU LE$ HL$&MLHT$EH|$'t>I$JH$`EHHD1DHHt$DH$jIADHt H$`DHHHHAHHL1ELHH$fT$*ftL$,HH$D$wH$LH4$H4$HILLH$H$HtHx\HNEHDH$DHH HHHHH$eH+%(tH[]A\A]A^A_[It$ ]DA\HA]HH[]A\ƃ LLLHHw t t뮸ƃ HHLLHHHHIt$ IHHDL$ D\$HDT$DT$D\$HDL$ ATT$ Iu ADD$L$HZD$Iu HPDL$DD$ ^Iu HHAL1LIu HHIu HH LLA1LIu HMIu HAOAWEGAAwLfAHE1MAu HC4HII uHDD$DIu HLLLT$$t$ AELIu HHHw HHIu HHAL1LA6HAff.@AWHAVAUATUHSHHHL(L@I8IF(I@HH$HHD$H<$HHEHHtHHt E EtDHt$HA 1HHE1HDž HA@ tqMLHD$Au H[0Ht/H{tCtu P y Ht$LHtsHp1fuA E1Dž HH<$t$t$IǸMt+AP u!AG$t AGXAE1HUAE1ATPjjH|$ AH = uA(Ht A HHt$IHHHtH{tH/MtI\HHD[]A\A]A^A_Hw HHD5AHs HHs HHHw HHD:AHs HHs IHHPDHHs D@HHHHHHK S(LHHLLIM9IK4HC8uHHu HE1C4D9BD@<VHBD<<ZHBL>FLAHFDBIHt$HHH{5K4HtHHu Hs8t HHHt$HHHT$(Hu DT$HHLL$@LL$@DT$HHPHD$XHDD$(DT$dH@Hr(HHD$PDT$dHD$PLL$XfDPfEQ($ D$$AArAAnEak$HAAmfAQ8HH9 f;P& HC><HLm HE1LK=S4Hs6DC<C<RHHu HE1K=S4Hs6DC<CHX0t HHH}@E@H$eH+%(H[]A\A]A^A_E1LHH$HD$($H9l$ H9UHmMuHt$HE1IHt$HHLHD$pH$HD$XHD$HIH$eH+%(uHH[]A\A]A^A_AL$ I$HDD$ Ht$IDD$ Ht$I|HHHD$CH\$(LDD$DHt$MHAHMLd$0Dd$ HL$ HT$HH|$ HHL$ HC H(HHHD$Ht$IHHLHD$XHD$Hf9EdL;LuEgMt_M@MI($LEHLHf}8tHM@DEdLHHM$)$$MnEk$EmfE8MTE(f;$t%H$fE(MtfAFHt$(L1LHT$0LHL$(HL$(HT$0HD$ LM9t+Iw H9t$tM?I;OPuAGHHukAG(fA9utHt$ LFHmLEI1H$fE MfAD$En1HBIG@D$zfAG8AHfEg(1AW9eHkhIWXHfDbZID$HE@AD$$ EmAD$,ElfAG$S!Hu HHHsHHu HHu HHu HHu HHu HHT$H $H $HT$SIuIIuIHuHHuHPLm HLS LHXf1HA%=@LHHAHHu Ia*HHHu I*HHHu HHT$H $H $HT$AHu HHuHHu HH=PLHHAHS!Hu HHDSHtHHCHBH[Hu HHhDHu AIHXHu IHHff.UHHS1Htu HtHHH u[H]Hs HHfǃ@AHs HHAHs HHfǃ@HEHHt$ HAfǃ@HHs HDD$HHs HL@u 1HAHk HH@tXL0AGHHfAAU*HHHHY{HK(uaA$luVkHs@H $HHLkHH $A$usLHLA$HuPDEXHHHHHEH"HEH{@kHuPE^wLHLLXHLx Lh AFLHfA~AWLHHHXHLx 1LHHXHHXHHfǃx AHXHHHXHHAH"HHt$ LAfǃx HXIHHAHXHLHI$XIHHI$XHI$XIHHI$XIHHI$XIHHI$XIHHI$XI9HHAI$XI*HHAI$XI1HHAI$X IHHAE1I$XIHHAE1I$XIHHE1AHkI$XDHATIXHHIXHE1HIXHHIE1H|$HL$@HMXHHLA%Ax IXHL\$HH|$Ax H|$1DIXHL\$HL\$Mh AL$HLHHLH6HuPDEXHHHLkXLHLtHkXLeLmImCH{@HuPE^H4$IHHH II]PI"H+H9\$;HL3LcHHmENXME(LHL$4HH4$IHHH nH4$IHHH BH4$LHHH H4$I HHH H4$IHHH E1HD$@eH+%( HHL[]A\A]A^A_LH4$HI@HH LLYH4$I8HHH LmhMuMeM,$Ht$H|$AE8C1Im(HT$8D$H$ltxH4$HHH H4$IHHH H4$IHHH i{H$HHHD$f@H$HHHs fǃ@H|$9H4$IHHH H4$IHHH H$ fǀ@HD$tH$fǀ@`H<$2fu)H$HHHs fǃ@ H<$DDE1 @IH$HT$8fBHHHD$ HHu_base_assign_fw_reported_qdmpt3sas_atto_validate_nvram_ikrmpt3sas_atto_get_sas_addrmpt3sas_atto_init_base_static_config_pages QT\dwy_base_display_fwpkg_versionc_base_send_ioc_init_base_assign_reply_queues _base_make_ioc_operational_base_allocate_reply_post_free_array#_base_allocate_reply_free_dma_pool_base_allocate_reply_pool_base_allocate_sense_dma_pool_base_allocate_chain_dma_pool_base_allocate_pcie_sgl_poolIU[mpbase_alloc_rdpq_dma_poold4FYeu  _base_allocate_memory_pools_base_get_port_facts_base_get_chain_buffer_dma_to_chain_buffer_clone_sg_entries mpt3sas_base_attach mpt3sas_base_free_resources&8@_base_send_ioc_resetmpt3sas_base_make_ioc_readympt3sas_base_lock_host_diagnostic7mpt3sas_base_unlock_and_get_host_diagnostic (_base_event_notification8;Ampt3sas_port_enableMR]mmpt3sas_base_scsi_enclosure_processor "mpt3sas_base_sas_iounit_controleimmpt3sas_wait_for_ioc39@acmpt3sas_base_update_missing_delaybase_mod64[mpt3sas_base_get_smid mpt3sas_base_unmap_resources_base_request_irqS o _base_alloc_irq_vectors0 _base_check_enable_msix  _base_enable_msixR S g _base_wait_for_doorbell_not_used_base_wait_for_doorbell_int_base_wait_for_doorbell_ack_base_spin_on_doorbell_int_base_handshake_req_reply_wait_base_wait_for_iocstate BFJM_base_get_ioc_facts_base_config_dma_addressing /3;E\mpt3sas_base_map_resources_base_dump_reg_setjlIMTbqw|_base_diag_reset  mpt3sas_base_check_for_fault_and_issue_reset_base_display_event_data"&(3_base_async_event_base_sas_log_infof_base_sas_ioc_info|_base_display_reply_infompt3sas_halt_firmwarempt3sas_base_wait_for_coredump_completionmpt3sas_base_coredump_infompt3sas_base_fault_info~_base_sync_drv_fw_timestamp/"_base_clear_outstanding_mpt_commands#'_base_fault_reset_workTmpt3sas_base_start_watchdog_scsih_set_fwfault_debug_debug_dump_mfmpt3sas_base_check_cmd_timeoutmpt3sas_fwfault_debugpoll_queuesperf_modeirqpoll_weightmax_msix_vectorssmp_affinity_enablemsix_disablemax_sgl_entriesmax_queue_depthH g mpt3sas_config_update_driver_trigger_pg4 mpt3sas_config_update_driver_trigger_pg3 , mpt3sas_config_update_driver_trigger_pg2mpt3sas_config_update_driver_trigger_pg0tmpt3sas_config_update_driver_trigger_pg1_debug_dump_config_debug_dump_reply_debug_dump_mf_config_alloc_config_dma_memory5er_config_request_config_display_some_debug_mpt3sas_exitQ2_scsih_scsi_ioc_infoPUX\dnqsv|_scsih_smart_predicted_fault_scsih_tm_tr_completeOT]d_scsih_tm_volume_tr_complete_scsih_sas_control_completescsih_get_resync scsih_get_statebscsih_qcmd_scsih_tm_display_info scsih_target_reset} scsih_host_reset scsih_slave_alloc_scsih_display_sata_capabilities| _scsih_get_volume_capabilities H O ] scsih_device_configure.&.6.<.D.scsih_scan_finishedscsih_scan_start-q/x/////00 0?0F0_scsih_probescsih_remove,+++++_scsih_ir_shutdownscsih_pci_error_detected0scsih_pci_mmio_enabled 1scsih_pci_slot_reset000scsih_pci_resume0M+U+d+k+q+_scsih_nvme_shutdownscsih_suspendo0_scsih_get_shost_and_ioc++scsih_resume00_mpt3sas_init2^djn_scsih_temp_threshold_events_scsih_sas_device_status_change_event)/_scsih_tm_tr_volume_send_scsih_set_volume_delete_flag_scsih_check_ir_config_unhide_events1_scsih_check_pcie_topo_remove_events_scsih_block_io_device#(-38IO_scsih_tm_tr_send_scsih_check_topo_delete_eventsca************mpt3sas_scsih_event_callback_scsih_mark_responding_expander'_scsih_search_responding_expanders'''_scsih_mark_responding_raid_device!'1'_scsih_search_responding_raid_devicesR'}'_scsih_mark_responding_pcie_device&&&&&'_scsih_search_responding_pcie_devices_scsih_mark_responding_sas_device%& &-&_scsih_search_responding_sas_devicesu&&P&_scsih_create_enclosure_list_after_resetKm|_scsih_update_vphys_after_reset_scsih_get_port_table_after_reset ')14?_scsih_sas_port_refresh)mpt3sas_scsih_reset_done_handler_scsih_flush_running_cmds)mpt3sas_scsih_clear_outstanding_scsi_tm_commands)mpt3sas_scsih_pre_reset_handler_scsih_issue_delayed_sas_io_unit_ctrl_scsih_issue_delayed_event_ack_scsih_pcie_check_deviceXm_scsih_pcie_topology_change_event_debugH I m _scsih_pcie_topology_change_event _scsih_pcie_enumeration_event"""_scsih_pcie_device_status_change_event_debug!!!#!_scsih_sas_ir_operation_status_event_debugu%%4%<%_scsih_sas_ir_physical_disk_event$$$_scsih_sas_ir_volume_event$$_scsih_sas_pd_add""""# #_scsih_ir_fastpath_scsih_sas_ir_config_change_event_debug)$^$_scsih_sas_enclosure_dev_status_change_event_debugq!!_scsih_sas_enclosure_dev_status_change_event_scsih_block_io_all_device!!!+"J"V"_scsih_sas_broadcast_primitive_event_scsih_sas_device_discovery_error_event""_scsih_sas_discovery_eventm"q"s"_scsih_sas_device_status_change_event_debugGLN_scsih_check_device3X1;EKR[ah|_scsih_sas_host_add_scsih_sas_topology_change_event_debug]^_scsih_sas_topology_change_event_scsih_turn_on_pfa_led_scsih_pcie_device_removeCHN_scsih_pcie_device_addv{_scsih_pcie_device_init_add_scsih_check_pcie_access_status_scsih_pcie_add_device_scsih_sas_device_remove_scsih_sas_device_add7_scsih_sas_device_init_add_scsih_check_access_status_scsih_add_device _scsih_get_sas_addressao}_scsih_determine_boot_device_scsih_raid_device_add7#E#_scsih_sas_volume_add)/:DO\_scsih_expander_addg(_scsih_refresh_expander_links_scsih_alloc_vphy_scsih_sas_host_refresh_scsih_scan_for_devices_after_reset(((((((((((((()))")&)0)B)Q)V)W)a)s)w)x)_scsih_update_device_qdepth%_scsih_del_dirty_port_entries_scsih_del_dirty_vphy_scsih_expander_node_remove)+_scsih_sas_volume_deleteq#  #_scsih_pcie_device_remove_from_sml_scsih_remove_unresponding_devices''(:(F(V(_mpt3sas_fw_work)scsih_tm_post_processing _debug_dump_mf_scsih_response_code   $ 6 T mpt3sas_scsih_issue_tm_scsih_display_enclosure_chassis_info{_scsih_turn_off_pfa_led-3_scsih_remove_devicempt3sas_get_port_by_id_scsih_set_debug_level?prtvwden~|@@logging_levelhost_tagset_enablemultipath_on_hbaenable_sdev_max_qdprot_maskdisable_discoverydiag_buffer_enablehbas_to_enumeratemax_lunmissing_delaymax_sectors  "BJRYdr_transport_get_expander_phy_error_log_transport_get_linkerrors_transport_phy_reset *19_transport_phy_enable%,8Ejrz_transport_expander_phy_control_transport_phy_speed8NU_ck_transport_smp_handlermpt3sas_transport_update_linksIOiompt3sas_transport_add_expander_phy "(mpt3sas_transport_add_host_phympt3sas_transport_port_remove_debug_dump_mfsz_transport_expander_report_manufacture_transport_set_identify 8@Lmpt3sas_transport_port_add_transport_delete_phy_transport_delete_port_transport_add_phy) _ctl_enable_diag_sbr_reload _ctl_addnl_diag_query " ' - 3 : B L Y b g o v _ctl_diag_read_buffer_ctl_diag_release #B_ctl_diag_query_ctl_diag_unregister_ctl_diag_register_ctl_btdh_mapping8AF_ctl_do_reset "_ctl_eventreport_ctl_eventenable_ctl_eventquery_debug_dump_mfv_ctl_set_task_mid ?Sgy!+7DM[_ctl_do_mpt_command; _ctl_compat_mpt_command_ctl_getiocinfog _ctl_ioctl_mainmpt3sas_ctl_initgologging_level_store] fwfault_debug_store  host_trace_buffer_size_showH O host_trace_buffer_showhost_trace_buffer_enable_store BRM_status_show\jqxmpt3sas_send_diag_release$)07=G`w}_ctl_diag_register_2mpt3sas_enable_diag_buffer$59Z_irmpt3sas_ctl_reset_done_handlermpt3sas_ctl_clear_outstanding_ioctlsmpt3sas_ctl_pre_reset_handler_ctl_display_some_debugmpt3sas_trigger_mpijmpt3sas_trigger_scsi2;Cmpt3sas_trigger_eventmpt3sas_trigger_masterKXaf_mpt3sas_raise_sigiovmpt3sas_process_trigger_datampt3sas_init_warpdrive_propertiesmpt3sas_setup_debugfsmpt3sas_init_debugfsg6mf: 6 6%08x 6 6%s: System Register set: 6%08x: %08x %s%d-mq-poll%d%s%d-msix%d%s%d3%s: failure at %s:%d/%s()! 6%s: %s 6%s: sense_pool(0x%p): free 6%s: reply_pool(0x%p): free 6setting fwfault_debug(%d) reply_post_free pool3%s: scmd is NULL 5terminated due to Host ResetTimeout3%s: Command %s poll_%s%d_status%s3%s: %s: failed (line=%d) 3%s: fault_state(0x%04x)! 6 offset:data 6%s: [0x%02x]:%08x 6%s: offset:data 3%s: %s: failed panic in %s 3%s: %s: smid not available invalid functioninvalid vpidsmp data overrunsmp request failedtarget nak receivedtarget ack nak timeouttarget iu too shorttarget too much write datatarget data offset errortarget xfer count mismatchtarget no connectiontarget no conn retryabletarget abortedtarget invalid io indexeedp app tag erroreedp ref tag erroreedp guard errorconfig can't commitconfig no defaultsconfig invalid datainternal errorconfig invalid typeconfig invalid actionop state not supportedinvalid stateinvalid fieldinsufficient powerinsufficient resourcesbusydiagnostic releasedinvalid sgltask_mgmtconfig_pagesas_iounit_ctlenclosureioc_initport_enablesmp_passthrunvme_encapsulatedunknownIOPPLIRWarpDrivestartstopPCIE Topology Change ListIR Operation StatusIR VolumeIR Physical DiskIR Configuration Change ListLog Entry AddedPCIE Device Status ChangeSAS Device Discovery ErrorCable EventTemperature ThresholdSAS Topology Change ListSAS Init Table OverflowSAS Init Device Status ChangeSAS Broadcast PrimitiveDevice Status ChangeEvent ChangeHard Reset ReceivedStatus ChangeLog Data6%s: Discovery: (%s)c discovery_status(0x%08x)c 6%s: PCIE Enumeration: (%s)cenumeration_status(0x%08x)6%s: ioc is operational 6%s: sending port enable !! 6%s: write magic sequence 6%s: sending diag reset !! 6%s: clear interrupts 6%s: diag reset: issued 6%s: re-enable the HCDW 6%s: restart the adapter 6%s: diag reset: SUCCESS 3%s: diag reset: FAILED 6%s 6%s: ioc_state(0x%08x) &x->wait3%s: %s: timeout 6%s: %s: complete MinuteHour,FAILEDSUCCESS4%s: no affinity for msi %x Intel(R) SSD 910 Series6%sNVMe6%s: Protocol=(cInitiatorc%sTargetc), Capabilities=(cRaidc%sTLRc%sMulticastc%sBIDI Targetc%sEEDPc%sSnapshot Bufferc%sDiag Trace Bufferc%sDiag Extended Bufferc%sTask Set Fullc%sNCQc) 6%s: port enable: %s 6%s: %s: ioc_state(0x%08x) enableddisabledPCI-MSI-XIO-APIC6%s: msix not supported 6%s: %d %d %d 6%s: High IOPs queues : %s 6%s: enabled: index: %d 6%s: %s enabled: IRQ %d 6%s: message unit reset: %s 3%s: 32 DMA mask failed %s PCIe SGL poolchain poolsense poolreply poolreply_free poolreply_post_free_array pool&ioc->reset_wq&ioc->base_cmds.mutex&ioc->transport_cmds.mutex&ioc->scsih_cmds.mutex&ioc->tm_cmds.mutex&ioc->config_cmds.mutex&ioc->ctl_cmds.mutex6%s: %s: enter 6%s: %s: MPT3_IOC_PRE_RESET 6%s: %s: exit 6%s: %s: %s successfailed%s_dead_ioc_%d6%s: %s: CoreDump loop %d.4%s: %s: hard reset: %s 3%s: scsih_cmd in use %s 3%s: In func: %s 3%s: %s: base_cmd in use 3%s: %s: unknown reset_type io_unitsas_expandersas_devicesas_phylogenclosureraid_configdriver_mappingsas_portext_manufacturingpcie_io_unitpcie_switchpcie_devicepcie_linksas_io_unitphysdiskmanufacturingraid_volumebiosioc6mf: 6 6%08x 6 6reply: 6config: 3%s: %s: config_cmd in use config_request&x->wait3%s: %s: command timeout config_doneinvalid frameunknownoverlapped tag attemptedinvalid lunsata capability failedsata initialization faileddevice blockedsmp error not addressableroute not addressablesata affiliation conflictPCIe device capability failednvme failure statusnvme idle timeoutnvme get feature stat failednvme eventcfg failednvme qcreation failednvme qconfig failednvme identify failednvme ready timeoutPCIe device status unknownPCIe device init fail maxPCIe device MSIx RequiredPCIe device unsupportedPCIe device blocked6chassis slot(0x%04x) 6%s: chassis slot(0x%04x) 3%s: failure at %s:%d/%s()! yn3%s: %s: scsih_cmd in use &x->wait3%s: %s: timeout 6%s: IR shutdown (sending) hidingexposing%s raid component 6%s: port enable: FAILED SUCCESSFAILED48.100.00.004device_block, handle(0x%04x) mpt3sas6%s version %s loaded 3%s: In func: %s ./include/linux/raid_class.hpdev's driver data is null shost's private data is null failed4%s: hard reset: %s success6%s: port enable: SUCCESS &ioc->reset_in_progress_mutex&ioc->hostdiag_unlock_mutex&ioc->pci_access_mutex%s_cm%dfw_event_%s%d4%s: failure at %s:%d/%s()! WarpDrivevolume response info state terminated no status autosense failed autosense valid 4%s: %s wwid(0x%016llx) SSPSATASTPRAID0RAID1ERAID1RAID10RAIDXSESEnabledDisabledNVMeTLR %s 6%s: scan devices: start 6%s: scan devices: complete 6%s: completing %d cmds TLR disabled 6%s: %s: tm_cmd busy!!! 6mf: 6 6%08x 6 device reset: %s scmd(0x%p) task abort: %s scmd(0x%p) target reset: %s scmd(0x%p) unknown statusunknown reasonstartstopenclosure addenclosure removeforeignnativeunknown elementstartedcompletedc, ASC(0x%x), ASCQ(0x%x) c 6%s: discovery event: (%s)cdiscovery_status(0x%08x)6%s: %s: giving up 6%s: %s: %d retry 6%s: failure at %s:%d/%s()! cenumeration_status(0x%08x)6%s: ignoring switch event 6%s: %s: MPT3_IOC_PRE_RESET 6%s: New Port table 6%s: Old Port table EnableDisable3 2 1 0 6%s: setting ignoring flag goodcheck conditioncondition metbusyintermediateintermediate condmetreservation conflictcommand terminatedtask set fullaca activetask abortedinvalid functioninsufficient powerscsi recovered errorscsi invalid dev handlescsi device not therescsi data overrunscsi data underrunscsi io data errorscsi protocol errorscsi task terminatedscsi residual mismatchscsi task mgmt failedscsi ioc terminatedscsi ext terminatedeedp guard erroreedp ref tag erroreedp app tag errorsmart dataunsupported device discoveredinternal device resetinternal task abortinternal task abort setinternal clear task setinternal query taskinternal async notificationinternal task abort completedevice init failurepcie hot reset failedresynconline capacity expansionconsistency checkbackground initmake data consistentphys diskhot spareaddremoveno changehideunhidevolume_createdvolume_deletedpd_createdpd_deletedsata init failuretarget addtarget removelink rate changetarget respondingdelay target removerespondingremove delay%s %s: 3Fusion MPT SAS Hostmpt2sas3%s: failure at %s:%d/%s()! 6mf: 6 6%08x 6 3failure at %s:%d/%s()! &x->wait3%s: %s: timeout 6%s: phy_control - complete 6%s: phy_control - no reply remove: sas_addr(0x%016llx) 66%s: %s - complete 6%s: %s: no reply %s %s: %d 0x%08x 0x%016llx %02d %08xh %s %03x.%02x %02d.%02d.%02d.%02d 0x%04x 6mf: 6 6%08x 6 6%s: %s 3%s: %s: ctl_cmd in use &x->wait3%s: In func: %s 3%s: %s: no reply message 6%s: %s: success %d6%s: fwfault_debug=%d %x6%s: logging_level=%08xh 6%s: %s: enter 20.102.00.0048.100.00.003failure at %s:%d/%s()! 3%s: failure at %s:%d/%s()! task_mgmtnvme_encapsulatedtoolboxsmp_passthroughdiag_releasesas_iounit_cntlsata_passioc_factsdiag_buffer_postfw_uploadfw_downloadevent_notificationport_enableport_factsraid_actionioc_init6%s: %s: %s, smid(%d) abort_taskquery_task./include/linux/thread_info.hctl_requestctl_done6%s: %s: MPT3_IOC_PRE_RESET %9spostreleaseSUCCESSFAILED6%s: Ioctl: host reset: %s mpt3sasmpt2sas&ctl_poll_waitmpt2ctlmpt3ctlsas_ncq_prio_enablesas_ncq_prio_supportedsas_device_handlesas_addressenable_sdev_max_qddrv_support_bitmapdiag_trigger_mpidiag_trigger_scsidiag_trigger_eventdiag_trigger_masterhost_trace_buffer_enablehost_trace_bufferhost_trace_buffer_sizeBRM_statusreply_queue_countioc_reset_countfwfault_debuglogging_levelhost_sas_addressfw_queue_depthdevice_delayio_delayboard_tracerboard_assemblyboard_nameversion_nvdata_defaultversion_nvdata_persistentversion_productversion_mpiversion_biosversion_fw6%s: %s: enter 6%s: %s: exit mpt3sasscsi_host%d3%s %s: 6%s: %s: successful count(%d), timeout(%d) 3%s: %s: failed due to timeout count(%d), int_status(%x)! 6%s: %d BIT PCI BUS DMA ADDRESSING SUPPORTED, total mem (%ld kB) 3%s: unable to allocate memory %zu! 3%s: unable to allocate interrupt %d! 3%s: Failed to read manufacturing page 1 3%s: Invalid ATTO NVRAM checksum 3%s: Invalid ATTO NVRAM signature 6%s: Invalid ATTO NVRAM version3%s: Invalid ATTO SAS address drivers/scsi/mpt3sas/mpt3sas_base.c3MaxWidePortQD: 0x%x MaxNarrowPortQD: 0x%x MaxSataQD: 0x%x MaxNvmeQD: 0x%x 3%s: %s: Failed to get trigger pg2, ioc_status(0x%04x) 3%s: %s: Failed to get trigger pg3, ioc_status(0x%04x) 3%s: %s: Failed to get trigger pg4, ioc_status(0x%04x) 6%s: request_pool(0x%p): free 6%s: reply_free_pool(0x%p): free 6%s: reply_post_free_pool(0x%p): free 6%s: config_page(0x%p): free 3%s: bad Replypost free pool(0x%p)reply_post_free_dma = (0x%llx) 6%s: Provided chain_buffer_dma address is not in the lookup list page boundary curr_buff: 0x%p 3%s: coredump_state(0x%04x)! 3%s fault info from func: %s 3%s: doorbell is in use (line=%d) 3%s: doorbell handshake int failed (line=%d) 3%s: doorbell handshake ack failed (line=%d) 3%s: doorbell handshake sending request failed (line=%d) 3%s: %s: failed due to timeout count(%d), doorbell_reg(%x)! 6%s: doorbell is in use (line=%d) 3%s: %s: handshake failed (r=%d) 3%s: Firmware is halted due to command timeout 3%s: %s: CoreDump timed out. (ioc_state=0x%x) 6%s: %s: CoreDump completed. (ioc_state=0x%x) 6%s: %s: clear outstanding mpt cmds SAS Enclosure Device Status Change3%s: mpi_reply not valid at %s:%d/%s()! 4%s: ioc_status: %s(0x%04x), request(0x%p),(%s) 4%s: log_info(0x%08x): originator(%s), code(0x%02x), sub_code(0x%04x) 6%s: DELAYED: EVENT ACK: event (0x%04x) 6%s: device_missing_delay: old(%d), new(%d) 6%s: ioc_missing_delay: old(%d), new(%d) 6%s: %s: waiting for operational state(count=%d) 3%s: %s: failed due to ioc not operational 3%s: %s: internal command already in use 3%s: %s: failed obtaining a smid 6%s: Stop writing magic sequence after 20 retries 6%s: wrote magic sequence: count(%d), host_diagnostic(0x%08x) 6%s: disable writes to the diagnostic register 6%s: Invalid host diagnostic register value 6%s: restart the adapter assuming the HCB Address points to good F/W 6%s: Wait for FW to go to the READY state 3%s: %s: failed going to ready state (ioc_state=0x%x) 3%s: Memory allocation for fwpkg data failed at %s:%d/%s()! 6%s: FW Package Ver(%02d.%02d.%02d.%02d) 3%s: Failed to read ATTO bios page 4 header. 3%s: Failed to allocate memory for ATTO bios page. 3%s: Failed to read ATTO bios page 4 3%s: overriding NVDATA EEDPTagMode setting 6%s: Driver-FW TimeSync interval is %d seconds. ManuPg11 TimeSync Unit is in %s 4%s: TimeSync Interval in Manuf page-11 is not enabled. Periodic Time-Sync will be disabled 6%s: %s: FWVersion(%02d.%02d.%02d.%02d), ChipRevision(0x%02x) Intel Integrated RAID Module RMS2LL080Intel Integrated RAID Module RMS2LL0406%s: Intel(R) Controller: Subsystem ID: 0x%X Intel(R) RAID Controller RS25GB008Intel(R) Integrated RAID Module RMS25JB080Intel(R) Integrated RAID Module RMS25JB040Intel(R) Integrated RAID Module RMS25KB080Intel(R) Integrated RAID Module RMS25KB040Intel(R) Integrated RAID Module RMS25LB040Intel(R) Integrated RAID Module RMS25LB080Intel(R) Integrated RAID Module RMS3JC080Intel(R) RAID Controller RS3GC008Intel(R) RAID Controller RS3FC044Intel(R) RAID Controller RS3UC0806%s: Enable interrupt coalescing only for first %d reply queues 6%s: performance mode: balanced 6%s: performance mode: latency 6%s: performance mode: iops with coalescing timeout: 0x%x 3%s: %s: Failed to get trigger pg1, ioc_status(0x%04x) 3%s: %s: failed with (ioc_status=0x%08x) 6%s: %s: host in pci error recovery 6%s: unexpected doorbell active! 6%s: %s: Skipping the diag reset here. (ioc_state=0x%x) 6%s: %s: failed going to ready state (ioc_state=0x%x) 6%s: %s: failed getting to correct state 6%s: CurrentHostPageSize is 0: Setting default host page size to 4k 6%s: CurrentHostPageSize(%d) 6%s: hba queue depth(%d), max chains per io(%d) 6%s: request frame size(%d), reply frame size(%d) 4%s: pci_enable_device_mem: failed 4%s: pci_request_selected_regions: failed 4%s: no suitable DMA mask for %s 3%s: unable to map adapter memory! or resource not found 6%s: msix is supported, vector_count(%d) 6%s: combined ReplyQueue is off, Enabling msix load balance 6%s: pci_alloc_irq_vectors failed (r=%d) !!! 6%s: High IOPs queues : disabled 6%s: pci_alloc_irq_vector(legacy) failed (r=%d) !!! 3%s: allocation for replyPostRegisterIndex failed! 6%s: iomem(%pap), mapped(0x%p), size(%d) 6%s: ioport(0x%016llx), size(%d) 6%s: MSI-X vectors supported: %d 6 no of cores: %d, max_msix_vectors: %d 6%s: sending message unit reset !! 6%s: Allocation for cpu_msix_table failed!!! 6%s: Allocation for reply_post_host_index failed!!! 4%s: sg_tablesize(%u) is bigger than kernel defined SG_CHUNK_SIZE(%u) 3%s: IOC doesn't have enough Request Credits, it has just %d number of credits 6%s: scatter gather: sge_in_main_msg(%d), sge_per_chain(%d), sge_per_io(%d), chains_per_io(%d) 6%s: scsi host: can_queue depth (%d) 3%s: request pool: dma_alloc_coherent failed: hba_depth(%d), chains_per_io(%d), frame_sz(%d), total(%d kB) 3%s: request pool: dma_alloc_coherent succeed: hba_depth(%d), chains_per_io(%d), frame_sz(%d), total(%d kb) 6%s: request pool(0x%p) - dma(0x%llx): depth(%d), frame_size(%d), pool_size(%d kB) 6%s: scsiio(0x%p): depth(%d) 3%s: chain_lookup: __get_free_pages failed 3%s: chain_lookup: kzalloc failed 3%s: hpr_lookup: kcalloc failed 6%s: hi_priority(0x%p): depth(%d), start smid(%d) 3%s: internal_lookup: kcalloc failed 6%s: internal(0x%p): depth(%d), start smid(%d) 6%s: PCIe SGL lookup: kzalloc failed 3%s: PCIe SGL pool: dma_pool_create failed 3%s: PCIe SGL pool: dma_pool_alloc failed 3%s: PCIE SGLs are not in same 4G !! pcie sgl (0x%p) dma = (0x%llx) 6%s: PCIe sgl pool depth(%d), element_size(%d), pool_size(%d kB) 6%s: Number of chains can fit in a PRP page(%d) 3%s: Chain buffers are not in same 4G !!! Chain buff (0x%p) dma = (0x%llx) 6%s: chain_lookup depth (%d), frame_size(%d), pool_size(%d kB) 6%s: chain pool depth(%d), frame_size(%d), pool_size(%d kB) 6%s: sense pool(0x%p) - dma(0x%llx): depth(%d), element_size(%d), pool_size (%d kB) 3Bad Sense Pool! sense (0x%p) sense_dma = (0x%llx) 6%s: reply pool(0x%p) - dma(0x%llx): depth(%d), frame_size(%d), pool_size(%d kB) 3Bad Reply Pool! Reply (0x%p) Reply dma = (0x%llx) 3Bad Reply Free Pool! Reply Free (0x%p) Reply Free dma = (0x%llx) 6%s: reply_free pool(0x%p): depth(%d), element_size(%d), pool_size(%d kB) 6%s: reply_free_dma (0x%llx) 3%s: config page: dma_pool_alloc failed 6%s: config page(0x%p) - dma(0x%llx): size(%d) 6%s: Allocated physical memory: size(%d kB) 6%s: Current Controller Queue Depth(%d),Max Controller Queue Depth(%d) 6%s: Scatter Gather Elements per IO(%d) 3Setting 32 bit coherent DMA mask Failed %s 3%s: %s: pci error recovery reset 6%s: Unable to allocate the memory for pd_handles of sz: %d 6%s: Unable to allocate the memory for blocking_handles of sz: %d 6%s: Unable to allocate the memory for pend_os_device_add of sz: %d 6%s: Unable to allocate the memory for device_remove_in_progress of sz: %d 6%s: Some of the parameters got changed in this new firmware image and it requires system reboot %s: Issue occurred with flashing controller firmware.Please reboot the system and ensure that the correct firmware version is running 6%s: %s: MPT3_IOC_DONE_RESET 3%s: SAS host is non-operational !!!! 3%s: %s: Running mpt3sas_dead_ioc thread success !!!! 3%s: %s: CoreDump completed. LoopCount: %d3%s: %s: CoreDump Timed out. LoopCount: %d3%s: Failed obtaining a smid %s 6%s: Io Unit Control Sync TimeStamp (sending), @time %lld ms 6%s: Io Unit Control sync timestamp (complete): ioc_status(0x%04x), loginfo(0x%08x) 3%s: %s: Running mpt3sas_dead_ioc thread failed !!!! 6%s: Dell 6Gbps HBA: Subsystem ID: 0x%X 6%s: Dell 12Gbps HBA: Subsystem ID: 0x%X 6%s: Dell HBA: Subsystem ID: 0x%X 6%s: Cisco 12Gbps SAS HBA: Subsystem ID: 0x%X 6%s: Cisco SAS HBA: Subsystem ID: 0x%X 6%s: HP 6Gbps SAS HBA: Subsystem ID: 0x%X 6%s: HP SAS HBA: Subsystem ID: 0x%X 3mpt3sas: DIVISOR is zero, in div fn drivers/scsi/mpt3sas/mpt3sas_debug.h6%s: %s: %s(%d), action(%d), form(0x%08x), smid(%d) 6%s: iocstatus(0x%04x), loginfo(0x%08x) 3%s: %s: dma_alloc_coherent failed asking for (%d) bytes!! 6%s: %s: attempting retry (%d) 3%s: %s: failed obtaining a smid %s: %s: Firmware BUG: mpi_reply mismatch: Requested PageType(0x%02x) Reply PageType(0x%02x) %s: %s: Firmware BUG: mpi_reply mismatch: Requested ExtPageType(0x%02x) Reply ExtPageType(0x%02x) 6%s: %s: retry (%d) completed!! %s: %s: Firmware BUG: config page mismatch: Requested PageType(0x%02x) Reply PageType(0x%02x) %s: %s: Firmware BUG: config page mismatch: Requested ExtPageType(0x%02x) Reply ExtPageType(0x%02x) 3%s: %s: Failed to get trigger pg0, ioc_status(0x%04x) 3%s: %s: Failed to update trigger pg0, ioc_status(0x%04x) 3%s: %s: Failed to get trigger pg1, ioc_status(0x%04x) 3%s: %s: Failed to get trigger pg2, ioc_status(0x%04x) 3%s: %s: Failed to get trigger pg3, ioc_status(0x%04x) 3%s: %s: Failed to get trigger pg4, ioc_status(0x%04x) drivers/scsi/mpt3sas/mpt3sas_config.cdrivers/scsi/mpt3sas/mpt3sas_debug.htask management request completedtask queued, however not sent to targettask management request succeededtask management request failedtask management request not supported4%s: response_code(0x%01x): %s 3%s: discovery errors(%s): sas_address(0x%016llx), handle(0x%04x) nvme device configuration unsupportedPCIe device mem space access failed6%s: Device with Access Status (%s): wwid(0x%016llx), handle(0x%04x) ll only be added to the internal list3%s: NVMe discovery error(0x%02x): wwid(0x%016llx), handle(0x%04x) 6%s: NVMe discovery error(%s): wwid(0x%016llx), handle(0x%04x) 6%s: setting delete flag: handle(0x%04x), wwid(0x%016llx) enclosure logical id (0x%016llx), slot(%d) enclosure level(0x%04x), connector name( %s) enclosure logical id(0x%016llx), slot(%d) 6%s: enclosure logical id(0x%016llx), slot(%d) 6%s: enclosure level(0x%04x), connector name( %s) drivers/scsi/mpt3sas/mpt3sas_scsih.c3%s: handle(0x%04x), ioc_status(0x%04x), failure at %s:%d/%s()! atapi(%s), ncq(%s), asyn_notify(%s), smart(%s), fua(%s), sw_preserve(%s) 3%s: %s: failed obtaining a smid 6%s: Io Unit Control shutdown (sending), Shutdown latency %d sec 6%s: Io Unit Control shutdown (complete):ioc_status(0x%04x), loginfo(0x%08x) 6%s: IR shutdown (complete): ioc_status(0x%04x), loginfo(0x%08x) 6%s: search for raid volumes: start 6%s: search for responding raid volumes: complete handle(0x%04x), wwid(0x%016llx) 6 handle changed from(0x%04x)!!! 6%s: attempting host reset! scmd(0x%p) 6%s: Blocking the host reset 6%s: host reset: %s scmd(0x%p) 6mpt3sas version %s unloading 6setting logging_level(0x%08x) device_unblock and setting to running, handle(0x%04x) device_unblock failed with return(%d) for handle(0x%04x) performing a block followed by an unblock retried device_block failed with return(%d) for handle(0x%04x) retried device_unblock failed with return(%d) for handle(0x%04x) 6%s: enclosure_processor: ioc_status (0x%04x), loginfo(0x%08x) 6%s: %s: enter: handle(0x%04x), sas_addr(0x%016llx) 6%s: removing handle(0x%04x), sas_addr(0x%016llx) 6%s: %s: exit: handle(0x%04x), sas_addr(0x%016llx) 6%s: %s: enter: handle(0x%04x), wwid(0x%016llx) 6%s: %s: enter: enclosure logical id(0x%016llx), slot(%d) 6%s: %s: enter: enclosure level(0x%04x), connector name(%s) 6%s: removing handle(0x%04x), wwid(0x%016llx) 6%s: removing : enclosure logical id(0x%016llx), slot(%d) 6%s: removing: enclosure level(0x%04x), connector name( %s) 6%s: %s: exit: handle(0x%04x), wwid(0x%016llx) 6%s: %s: exit: enclosure logical id(0x%016llx), slot(%d) 6%s: %s: exit: enclosure level(0x%04x), connector name( %s) device_running, handle(0x%04x) device_block failed with return(%d) for handle(0x%04x) 6%s: IR RAID_ACTION: turning fast path on for handle(0x%04x), phys_disk_num (0x%02x) 6%s: IR RAID_ACTION: failed: ioc_status(0x%04x), loginfo(0x%08x)!!! 6%s: IR RAID_ACTION: completed successfully 6%s: removing enclosure logical id(0x%016llx), slot(%d) 6%s: removing enclosure level(0x%04x), connector name( %s) field "mpi_request->CDB.CDB32" at drivers/scsi/mpt3sas/mpt3sas_scsih.c:5245memcpy: detected field-spanning write (size %zu) of single %s (size %zu) 6%s: PCI error: mmio enabled callback!! 6%s: PCI error: resume callback!! 6%s: %s: handle(0x%04x), wwid(0x%016llx) 6%s: pdev=0x%p, slot=%s, entering operating state 6%s: Issuing Hard Reset as part of PCI Slot Reset 6%s: PCI error: slot reset callback!! 6%s: pdev=0x%p, slot=%s, previous operating state [D%d] 6%s: Issuing Hard Reset as part of OS Resume 6%s: port enable: FAILED with timeout (timeout=300s) 3%s fault info from func: %s 6%s: port enable: aborted due to diag reset 6%s: port enable: FAILED with (ioc_status=0x%08x) 6%s: %s: req_boot_device(0x%016llx) 6%s: %s: req_alt_boot_device(0x%016llx) 6%s: %s: current_boot_device(0x%016llx) HBA with DeviceId 0x%04x, sub VendorId 0x%04x, sub DeviceId 0x%04x is InvalidHBA with DeviceId 0x%04x, sub VendorId 0x%04x, sub DeviceId 0x%04x is TamperedHBA is in Configurable Secure mode 6%s: The max_sectors value is set to %d 4%s: Invalid value %d passed for max_sectors, range is 64 to 32767. Assigning value of 64. 4%s: Invalid value %d passed for max_sectors, range is 64 to 32767.Assigning default value of 32767. Max SCSIIO MPT commands: %d shared with nr_hw_queues = %d 6%s: %s: host reset in progress! 6%s: DELAYED:tr:handle(0x%04x), (open) 6%s: tr_send:handle(0x%04x), (open), smid(%d), cb(%d) %s skip device_block for SES handle(0x%04x) %s handle(0x%04x), %s wwid(0x%016llx) handle(0x%04x), wwid(0x%016llx), port(%d) enclosure logical id(0x%016llx), slot(%d) volume handle(0x%04x), volume wwid(0x%016llx) handle(0x%04x), sas_address(0x%016llx), phy(%d) qdepth(%d), tagged(%d), scsi_level(%d), cmd_que(%d) 6%s: %s: host in pci error recovery: handle(0x%04x) 6%s: %s: host is not operational: handle(0x%04x) 6%s: setting delete flag:enclosure logical id(0x%016llx), slot(%d) 6%s: setting delete flag: enclosure level(0x%04x), connector name( %s) 6%s: setting delete flag: logical id(0x%016llx), slot(%d) 6%s: setting delete flag:, enclosure level(0x%04x), connector name( %s) 6%s: setting delete flag: handle(0x%04x), sas_addr(0x%016llx) 3%s: mpi_reply not valid at %s:%d/%s()! 3%s: spurious interrupt: handle(0x%04x:0x%04x), smid(%d)!!! 6%s: tr_complete:handle(0x%04x), (open) smid(%d), ioc_status(0x%04x), loginfo(0x%08x), completed(%d) 6%s: %s: host in pci error recovery 6%s: %s: host is not operational 6%s: DELAYED:sc:handle(0x%04x), (open) 6%s: sc_send:handle(0x%04x), (open), smid(%d), cb(%d) 6%s: enclosure logical id(0x%016llx), slot(%d) 6%s: enclosure level(0x%04x), connector name( %s) 4%s: handle(0x%04x), ioc_status(%s)(0x%04x), smid(%d) 4%s: request_len(%d), underflow(%d), resid(%d) 4%s: tag(%d), transfer_count(%d), sc->result(0x%08x) 4%s: scsi_status(%s)(0x%02x), scsi_state(%s)(0x%02x) 4%s: [sense_key,asc,ascq]: [0x%02x,0x%02x,0x%02x], count(%d) 6%s: wwid(0x%016llx), port(%d) 4%s: sas_address(0x%016llx), phy(%d) 3%s: device is not present handle(0x04%x)!!! 6%s: %s: handle (0x%04x), wwid(0x%016llx) 6%s: %s: enclosure logical id(0x%016llx), slot( %d) 6%s: %s: enclosure level(0x%04x), connector name( %s) 6%s: hba_port entry: %p, port: %d is added to hba_port list 6%s: vphy entry: %p, port id: %d, phy:%d is added to port's vphys_list 6%s: updating handles for sas_host(0x%016llx) 6%s: host_add: handle(0x%04x), sas_addr(0x%016llx), phys(%d) 6%s: expander_add: handle(0x%04x), parent(0x%04x), sas_addr(0x%016llx), phys(%d) %s : pcie_device->starget set to starget @ %d %s : sas_device->starget set to starget @ %d 6%s: expander_remove: handle(0x%04x), sas_addr(0x%016llx), port:%d %s: handle(0x%04x), wwid(0x%016llx), pd_count(%d), type(%s) Set queue's max_sector to: %u %s: handle(0x%04x), wwid(0x%016llx), port(%d) %s: enclosure logical id(0x%016llx), slot(%d) %s: enclosure level(0x%04x),connector name( %s) set ignore_delay_remove for handle(0x%04x) %s: handle(0x%04x), sas_addr(0x%016llx), phy(%d), device_name(0x%016llx) 6%s: Enclosure handle(0x%04x) doesn't match with enclosure device! 6%s: handle(0x%0x) sas_address(0x%016llx) port_type(0x%0x) 6%s: %s: handle(0x%04x), sas_addr(0x%016llx) 6%s: scan devices: expanders start 6%s: break from expander scan: ioc_status(0x%04x), loginfo(0x%08x) 6%s: BEFORE adding expander: handle (0x%04x), sas_addr(0x%016llx) 6%s: AFTER adding expander: handle (0x%04x), sas_addr(0x%016llx) 6%s: scan devices: expanders complete 6%s: scan devices: phys disk start 6%s: break from phys disk scan: ioc_status(0x%04x), loginfo(0x%08x) 6%s: break from phys disk scan ioc_status(0x%04x), loginfo(0x%08x) 6%s: BEFORE adding phys disk: handle (0x%04x), sas_addr(0x%016llx) 6%s: AFTER adding phys disk: handle (0x%04x), sas_addr(0x%016llx) 6%s: scan devices: phys disk complete 6%s: scan devices: volumes start 6%s: break from volume scan: ioc_status(0x%04x), loginfo(0x%08x) 6%s: BEFORE adding volume: handle (0x%04x) 6%s: AFTER adding volume: handle (0x%04x) 6%s: scan devices: volumes complete 6%s: scan devices: end devices start 6%s: break from end device scan: ioc_status(0x%04x), loginfo(0x%08x) 6%s: BEFORE adding end device: handle (0x%04x), sas_addr(0x%016llx) 6%s: AFTER adding end device: handle (0x%04x), sas_addr(0x%016llx) 6%s: scan devices: end devices complete 6%s: scan devices: pcie end devices start 6%s: break from pcie end device scan: ioc_status(0x%04x), loginfo(0x%08x) 6%s: AFTER adding pcie end device: handle (0x%04x), wwid(0x%016llx) 6%s: pcie devices: pcie end devices complete 6%s: PCI error: detected callback, state(%d)!! field "mpi_request->CDB.CDB32" at drivers/scsi/mpt3sas/mpt3sas_scsih.c:57436%s: unexpected doorbell active! 6%s: sending tm: handle(0x%04x), task_type(0x%02x), smid(%d), timeout(%d), tr_method(0x%x) 6%s: complete tm: ioc_status(0x%04x), loginfo(0x%08x), term_count(0x%08x) 6%s: Task abort tm failed: handle(0x%04x),timeout(%d) tr_method(0x%x) smid(%d) msix_index(%d) 6%s: Poll ReplyDescriptor queues for completion of smid(%d), task_type(0x%02x), handle(0x%04x) attempting device reset! scmd(0x%p) device been deleted! scmd(0x%p) attempting task abort!scmd(0x%p), outstanding for %u ms & timeout %u ms No reference found at driver, assuming scmd(0x%p) might have completed attempting target reset! scmd(0x%p) target been deleted! scmd(0x%p) 6%s: EVENT ACK: event(0x%04x), smid(%d), cb(%d) 6%s: %s: host has been removed 6%s: sc_complete:handle(0x%04x), (open) smid(%d), ioc_status(0x%04x), loginfo(0x%08x) 6%s: removing unresponding devices: start 6%s: removing unresponding devices: end-devices 6%s: Removing unresponding devices: pcie end-devices 6%s: removing unresponding devices: expanders 6%s: removing unresponding devices: volumes 6%s: removing unresponding devices: complete 6%s: Deleting vphy %p entry from port id: %d , Phy_mask 0x%08x 6%s: Deleting port table entry %p having Port: %d Phy_mask 0x%08x 6%s: Update devices with firmware reported queue depth 6%s: port enable: complete from worker thread 6%s: sas topology change: (%s) 6 handle(0x%04x), enclosure_handle(0x%04x) start_phy(%02d), count(%d) 6 phy(%02d), attached_handle(0x%04x): %s: link rate: new(0x%02x), old(0x%02x) 6%s: ignoring expander event handle changed from(0x%04x) to (0x%04x)!!! 3%s: device is not present handle(0x%04x), flags!!! 6%s: device status change: (%s) handle(0x%04x), sas address(0x%016llx), tag(%d)4%s: SMP command sent to the expander (handle:0x%04x, sas_address:0x%016llx, physical_port:0x%02x) has failed 4%s: SMP command sent to the expander (handle:0x%04x, sas_address:0x%016llx, physical_port:0x%02x) has timed out 6%s: %s: enter: phy number(%d), width(%d) mpt3sas_scsih_issue_tm: FAILED when sending QUERY_TASK: scmd(%p) query task: FAILED with IOCSTATUS(0x%04x), scmd(%p) 6%s: %s: ABORT_TASK: giving up mpt3sas_scsih_issue_tm: ABORT_TASK: FAILED : scmd(%p) mpt3sas_scsih_issue_tm: ABORT_TASK: RETRIES (%d): scmd(%p) 6%s: %s: loop back due to pending AEN 6%s: %s - exit, query_count = %d termination_count = %d 6%s: enclosure status change: (%s) handle(0x%04x), enclosure logical id(0x%016llx) number slots(%d) 6%s: raid config change: (%s), elements(%d) 6 (%s:%s), vol handle(0x%04x), pd handle(0x%04x), pd num(0x%02x) 6%s: %s: handle(0x%04x), old(0x%08x), new(0x%08x) 6%s: raid operational status: (%s) handle(0x%04x), percent complete(%d) 6%s: PCIE device status change: (%s) handle(0x%04x), WWID(0x%016llx), tag(%d)6%s: pcie enumeration event: (%s) Flag 0x%02x6%s: pcie topology change: (%s) 6 switch_handle(0x%04x), enclosure_handle(0x%04x)start_port(%02d), count(%d) 6 port(%02d), attached_handle(0x%04x): %s: link rate: new(0x%02x), old(0x%02x) 6%s: device is not present handle(0x%04x), flags!!! 6%s: handle(0x%04x) device not found: convert event to a device add 6%s: %s: clear outstanding scsi & tm cmds 6%s: %s: MPT3_IOC_DONE_RESET 6%s: updating ports for sas_host(0x%016llx) 6%s: Port: %d Phy_mask 0x%08x sas_addr(0x%016llx) 6%s: No Matched entry for sas_addr(0x%16llx), Port:%d 6%s: %s: hba_port entry: %p, port: %d is added to hba_port list 6%s: search for end-devices: start 6%s: search for end-devices: complete handle(0x%04x), sas_addr(0x%016llx) 6%s: break from %s: ioc_status(0x%04x), loginfo(0x%08x) handle(0x%04x), wwid(0x%016llx) 6%s: search for PCIe end-devices: complete 6%s: search for expanders: start 6%s: search for expanders: complete 6 expander present: handle(0x%04x), sas_addr(0x%016llx), port:%d 6 expander(0x%016llx): handle changed from(0x%04x) to (0x%04x)!!! 6%s: setting ignoring flag for switch event 4%s: WarpDrive Warning: IO Throttling has occurred in the WarpDrive subsystem. Check WarpDrive documentation for additional details. 4%s: WarpDrive Warning: Program/Erase Cycles for the WarpDrive subsystem in degraded range. Check WarpDrive documentation for additional details. 3%s: WarpDrive Fatal Error: There are no Program/Erase Cycles for the WarpDrive subsystem. The storage device will be in read-only mode. Check WarpDrive documentation for additional details. 3%s: WarpDrive Fatal Error: The Backup Rail Monitor has failed on the WarpDrive subsystem. Check WarpDrive documentation for additional details. 6%s: %s tm_busy flag for handle(0x%04x) 3%s: Temperature Threshold flags %s%s%s%s exceeded for Sensor: %d !!! 3%s: Current Temp In Celsius: %d 5%s: Currently an active cable with ReceptacleID %d 5cannot be powered and devices connected 5to this active cable will not be seen 5This active cable requires %d mW of power 5%s: Currently a cable with ReceptacleID %d 5is not running at optimal speed(12 Gb/s rate) internal device reset completeexpander reduced functionalityexpander reduced functionality completedrivers/scsi/mpt3sas/mpt3sas_debug.h6%s: %s: host reset in progress! drivers/scsi/mpt3sas/mpt3sas_transport.c3%s: handle(0x%04x), ioc_status(0x%04x) failure at %s:%d/%s()! 3%s: %s: transport_cmds in use 3%s: %s: failed obtaining a smid 6%s: phy_control - send to sas_addr(0x%016llx), phy(%d), opcode(%d) 6%s: phy_control - reply data transfer size(%d) 6%s: phy_control - function_result(%d) remove: sas_addr(0x%016llx), phy(%d) 6%s: phy_error_log - send to sas_addr(0x%016llx), phy(%d) 6%s: phy_error_log - complete 6%s: phy_error_log - reply data transfer size(%d) 6%s: phy_error_log - function_result(%d) 6%s: phy_error_log - no reply 6%s: phy(%d), ioc_status (0x%04x), loginfo(0x%08x) 6%s: phy(%d), ioc_status(0x%04x), loginfo(0x%08x) 3%s: discovery is active on port = %d, phy = %d: unable to enable/disable phys, try again later! 6%s: %s: sending smp request 6%s: %s: reply data transfer size(%d) add: sas_addr(0x%016llx), phy(%d) 3%s: %s: Could not find parent sas_address(0x%016llx)! add: handle(0x%04x), sas_addr(0x%016llx), phy(%d) add: handle(0x%04x), sas_addr(0x%016llx) 6%s: report_manufacture - send to sas_addr(0x%016llx) 6%s: report_manufacture - complete 6%s: report_manufacture - reply data transfer size(%d) 6%s: report_manufacture - no reply 6%s: remove vphy entry: %p of port:%p,from %d port's vphys list 6%s: remove hba_port entry: %p port: %d from hba_port list 6%s: clearing sas_address from hba_port entry: %p port: %d from hba_port list 6%s: %s: removed: sas_addr(0x%016llx) add: handle(0x%04x), sas_addr(0x%016llx) attached_handle(0x%04x), sas_addr(0x%016llx) refresh: parent sas_addr(0x%016llx), link_rate(0x%02x), phy(%d) attached_handle(0x%04x), sas_addr(0x%016llx) drivers/scsi/mpt3sas/mpt3sas_debug.h3%s: %s: host_trace_buffer is not registered 3%s: %s: failed due to ioc not operational 3%s: %s: doesn't have capability for buffer_type(0x%02x) 3%s: %s: Invalid UID(0x%08x), buffer_type(0x%02x) 3%s: %s: buffer_type(0x%02x) is already registered by application with UID(0x%08x) 6%s: %s: diag_buffer (%d) ownership changed. old-ID(0x%08x), new-ID(0x%08x) 3%s: %s: already has a registered buffer for buffer_type(0x%02x) 3%s: %s: already a buffer is allocated for buffer_type(0x%02x) of size %d bytes, so please try registering again with same size 3%s: %s: the requested_buffer_size is not 4 byte aligned 3%s: %s: failed obtaining a smid field "ioc->product_specific[buffer_type]" at drivers/scsi/mpt3sas/mpt3sas_ctl.c:1708memcpy: detected field-spanning write (size %zu) of single %s (size %zu) drivers/scsi/mpt3sas/mpt3sas_ctl.c3%s: %s: failed allocating memory for diag buffers, requested size(%d) 6%s: %s: diag_buffer(0x%p), dma(0x%llx), sz(%d) 6%s: %s: ioc_status(0x%04x) log_info(0x%08x) 3%s: %s: BRM attribute is only for warpdrive 3%s: %s: failed reading iounit_pg3 3%s: %s: iounit_pg3 failed with ioc_status(0x%04x) 3%s: %s: iounit_pg3.GPIOCount less than 25 entries, detected (%d) entries 3%s: %s: buffer_type(0x%02x) is not registered 3%s: %s: unique_id(0x%08x) is not registered 3%s: %s: doesn't have buffer for buffer_type(0x%02x) 3%s: %s: unable to write mpt3_diag_query data @ %p 3%s: %s: unique_id is(0x%08x) 3%s: %s: buffer with unique_id(0x%08x) not found 6%s: %s: buffer_type(0x%02x) is not registered 3%s: %s: buffer_type(0x%02x) is not released 3%s: %s: unable to write mpt3_addnl_diag_query data @ %p scsi_io, cmd(0x%02x), cdb_len(%d)config, type(0x%02x), ext_type(0x%02x), number(%d)raid_pass, cmd(0x%02x), cdb_len(%d)6%s: iocstatus(0x%04x), loginfo(0x%08x) 4%s: sas_address(0x%016llx), phy(%d) 4%s: enclosure_logical_id(0x%016llx), slot(%d) 4%s: WWID(0x%016llx), port(%d) 6%s: scsi_state(0x%02x), scsi_status(0x%02x) 3%s: %s: failed obtaining a memory for mpi_request 6%s: HBA doesn't support NVMe. Rejecting NVMe Encapsulated request. 6%s: handle(0x%04x): ioctl failed due to device removal in progress 6%s: handle(0x%04x) :ioctl failed due to device removal in progress 6%s: TASK_MGMT: handle(0x%04x), task_type(0x%02x) 6%s: %s: handle(0x%04x), lun(%d), no active mid!! 6%s: %s: handle(0x%04x), lun(%d), task_mid(%d) 6%s: Firmware download not supported for ATTO HBA. field "src" at drivers/scsi/mpt3sas/mpt3sas_ctl.c:9906%s: Mpi2ToolboxMemMoveRequest_t request msg 6%s: TASK_MGMT: IOCStatus(0x%04x), IOCLogInfo(0x%08x), TerminationCount(0x%08x) 6%s: Response buffer provided by application is NULL; Response data will not be returned 6%s: issue target reset: handle = (0x%04x) 6%s: %s: clear outstanding ioctl cmd 6%s: %s: MPT3_IOC_DONE_RESET 6%s: registering trace buffer support 3%s: Min Trace Buff size (%d KB) greater than Max Trace Buff size (%d KB) 3%s: Using zero Min Trace Buff Size 3%s: Cannot allocate trace buffer memory. Last memory tried = %d KB 6%s: Trace buffer memory %d KB allocated 6%s: registering snapshot buffer support 6%s: registering extended buffer support 6%s: %s: skipping due to FAULT state 6%s: %s: Releasing the trace buffer due to adapter reset.6%s: posting host trace buffers 6%s: Trace buffer %d KB allocated through sysfs 6%s: releasing host trace buffer 3%s: %s: buffer_type(0x%02x) has not been released 3%s: %s: doesn't have memory allocated for buffer_type(0x%02x) 3%s: %s: buffer_type(0x%02x) is already released 3%s: %s: buffer_type(0x%02x) was released due to host reset 3%s: %s: either the starting_offset or bytes_to_read are not 4 byte aligned 6%s: %s: diag_buffer(%p), offset(%d), sz(%d) 3%s: %s: Unable to write mpt_diag_read_buffer_t data @ %p 6%s: %s: Reregister buffer_type(0x%02x) 6%s: %s: buffer_type(0x%02x) is still registered 3%s: %s: Failed to set Diag SBR Reload Bit 6%s: %s: Successfully set the Diag SBR Reload Bit 6%s: unsupported ioctl opcode(0x%08x) 3%s can't register misc device [minor=%d] drivers/scsi/mpt3sas/mpt3sas_debug.h6%s: %s: add to driver event log 6%s: %s: clearing diag_trigger_active flag 6%s: %s: Releasing the trace buffer. Trigger_Type 0x%08x, Data[0] 0x%08x, Data[1] 0x%08x 3%s: %d - Is not a valid Trigger type 6%s: %s: enter - trigger_bitmask = 0x%08x 6%s: %s: setting diag_trigger_active flag 6%s: %s: enter - event = 0x%04x, log_entry_qualifier = 0x%04x 6%s: %s: enter - sense_key = 0x%02x, asc = 0x%02x, ascq = 0x%02x 6%s: %s: enter - ioc_status = 0x%04x, loginfo = 0x%08x drivers/scsi/mpt3sas/mpt3sas_trigger_diag.c6%s: WarpDrive : Direct IO is disabled globally as drives are exposed 6%s: WarpDrive : Direct IO is disabled globally as number of drives > 1 6%s: WarpDrive : Direct IO is disabled Failure in computing number of drives 6%s: WarpDrive : Direct IO is disabled Memory allocation failure for RVPG0 6%s: WarpDrive : Direct IO is disabled Failure in retrieving RVPG0 4%s: WarpDrive : Direct IO is disabled for the drive with handle(0x%04x): num_mem=%d, max_mem_allowed=%d 6%s: WarpDrive : Direct IO is disabled for the drive with handle(0x%04x) member handle retrieval failed for member number=%d 6%s: WarpDrive : Direct IO is disabled for the drive with handle(0x%04x) member handle (0x%04x) unsupported max lba 0x%016llx 6%s: WarpDrive : Direct IO is disabled for the drive with handle(0x%04x): type=%d, s_sz=%uK, blk_size=%u 6%s: WarpDrive : Direct IO is disabled for the drive with handle(0x%04x) invalid stripe sz %uK 6%s: WarpDrive : Direct IO is disabled for the drive with handle(0x%04x) invalid block sz %u 6%s: WarpDrive : Direct IO is Enabled for the drive with handle(0x%04x) drivers/scsi/mpt3sas/mpt3sas_warpdrive.c6mpt3sas: Cannot create debugfs root Cannot create per adapter debugfs directory Cannot create ioc_dump debugfs file drivers/scsi/mpt3sas/mpt3sas_debugfs.c$$$$$$$$$$$$$$$$$parm=poll_queues:Number of queues to be use for io_uring poll mode. This parameter is effective only if host_tagset_enable=1. & when poll_queues are enabled then & perf_mode is set to latency mode. & parmtype=poll_queues:intparm=perf_mode:Performance mode (only for Aero/Sea Generation), options: 0 - balanced: high iops mode is enabled & interrupt coalescing is enabled only on high iops queues, 1 - iops: high iops mode is disabled & interrupt coalescing is enabled on all queues, 2 - latency: high iops mode is disabled & interrupt coalescing is enabled on all queues with timeout value 0xA, default - default perf_mode is 'balanced'parmtype=perf_mode:intparm=mpt3sas_fwfault_debug: enable detection of firmware fault and halt firmware - (default=0)parm=irqpoll_weight:irq poll weight (default= one fourth of HBA queue depth)parmtype=irqpoll_weight:intparm=max_msix_vectors: max msix vectorsparmtype=max_msix_vectors:intparm=smp_affinity_enable:SMP affinity feature enable/disable Default: enable(1)parmtype=smp_affinity_enable:intparm=msix_disable: disable msix routed interrupts (default=0)parmtype=msix_disable:intparm=max_sgl_entries: max sg entries parmtype=max_sgl_entries:intparm=max_queue_depth: max controller queue depth parmtype=max_queue_depth:intparm=host_tagset_enable:Shared host tagset enable/disable Default: enable(1)parmtype=host_tagset_enable:intparm=multipath_on_hba:Multipath support to add same target device as many times as it is visible to HBA from various paths (by default: SAS 2.0 & SAS 3.0 HBA - This will be disabled, SAS 3.5 HBA - This will be enabled)parmtype=multipath_on_hba:intparm=enable_sdev_max_qd:Enable sdev max qd as can_queue, def=disabled(0)parmtype=enable_sdev_max_qd:boolparm=prot_mask: host protection capabilities mask, def=7 parmtype=prot_mask:intparm=disable_discovery: disable discovery parmtype=disable_discovery:intparm=diag_buffer_enable: post diag buffers (TRACE=1/SNAPSHOT=2/EXTENDED=4/default=0)parmtype=diag_buffer_enable:intparm=hbas_to_enumerate: 0 - enumerates both SAS 2.0 & SAS 3.0 generation HBAs 1 - enumerates only SAS 2.0 generation HBAs 2 - enumerates only SAS 3.0 generation HBAs (default=0)parmtype=hbas_to_enumerate:ushortparm=max_lun: max lun, default=16895 parmtype=max_lun:ullongparm=missing_delay: device missing delay , io missing delayparmtype=missing_delay:array of intparm=max_sectors:max sectors, range 64 to 32767 default=32767parmtype=max_sectors:ushortparm=logging_level: bits for enabling additional logging info (default=0)alias=mpt2sasversion=48.100.00.00license=GPLdescription=LSI MPT Fusion SAS 3.0 Device Driverauthor=Avago Technologies srcversion=D3BFFF5751B4DF9E07233C8alias=pci:v00001000d000000E7sv*sd*bc*sc*i*alias=pci:v00001000d000000E4sv*sd*bc*sc*i*alias=pci:v0000117Cd000000E6sv*sd*bc*sc*i*alias=pci:v00001000d000000E6sv*sd*bc*sc*i*alias=pci:v00001000d000000E5sv*sd*bc*sc*i*alias=pci:v00001000d000000B2sv*sd*bc*sc*i*alias=pci:v00001000d000000E3sv*sd*bc*sc*i*alias=pci:v00001000d000000E0sv*sd*bc*sc*i*alias=pci:v00001000d000000E2sv*sd*bc*sc*i*alias=pci:v00001000d000000E1sv*sd*bc*sc*i*alias=pci:v00001000d000000D1sv*sd*bc*sc*i*alias=pci:v00001000d000000ACsv*sd*bc*sc*i*alias=pci:v00001000d000000ABsv*sd*bc*sc*i*alias=pci:v00001000d000000AAsv*sd*bc*sc*i*alias=pci:v00001000d000000AFsv*sd*bc*sc*i*alias=pci:v00001000d000000AEsv*sd*bc*sc*i*alias=pci:v00001000d000000ADsv*sd*bc*sc*i*alias=pci:v00001000d000000C3sv*sd*bc*sc*i*alias=pci:v00001000d000000C2sv*sd*bc*sc*i*alias=pci:v00001000d000000C1sv*sd*bc*sc*i*alias=pci:v00001000d000000C0sv*sd*bc*sc*i*alias=pci:v00001000d000000C8sv*sd*bc*sc*i*alias=pci:v00001000d000000C7sv*sd*bc*sc*i*alias=pci:v00001000d000000C6sv*sd*bc*sc*i*alias=pci:v00001000d000000C5sv*sd*bc*sc*i*alias=pci:v00001000d000000C4sv*sd*bc*sc*i*alias=pci:v00001000d000000C9sv*sd*bc*sc*i*alias=pci:v00001000d00000095sv*sd*bc*sc*i*alias=pci:v00001000d00000094sv*sd*bc*sc*i*alias=pci:v00001000d00000091sv*sd*bc*sc*i*alias=pci:v00001000d00000090sv*sd*bc*sc*i*alias=pci:v00001000d00000097sv*sd*bc*sc*i*alias=pci:v00001000d00000096sv*sd*bc*sc*i*alias=pci:v00001000d0000007Esv*sd*bc*sc*i*alias=pci:v00001000d000002B1sv*sd*bc*sc*i*alias=pci:v00001000d000002B0sv*sd*bc*sc*i*alias=pci:v00001000d0000006Esv*sd*bc*sc*i*alias=pci:v00001000d00000087sv*sd*bc*sc*i*alias=pci:v00001000d00000086sv*sd*bc*sc*i*alias=pci:v00001000d00000085sv*sd*bc*sc*i*alias=pci:v00001000d00000084sv*sd*bc*sc*i*alias=pci:v00001000d00000083sv*sd*bc*sc*i*alias=pci:v00001000d00000082sv*sd*bc*sc*i*alias=pci:v00001000d00000081sv*sd*bc*sc*i*alias=pci:v00001000d00000080sv*sd*bc*sc*i*alias=pci:v00001000d00000065sv*sd*bc*sc*i*alias=pci:v00001000d00000064sv*sd*bc*sc*i*alias=pci:v00001000d00000077sv*sd*bc*sc*i*alias=pci:v00001000d00000076sv*sd*bc*sc*i*alias=pci:v00001000d00000074sv*sd*bc*sc*i*alias=pci:v00001000d00000072sv*sd*bc*sc*i*alias=pci:v00001000d00000070sv*sd*bc*sc*i*depends=scsi_transport_sas,raid_classintree=Yname=mpt3sasretpoline=Yvermagic=6.13.0-rc1-MANJARO+ SMP preempt mod_unload  (0(  (0( 0( 0( 0(  ((  (0(  H H``00 (0( 0 ( ( (  ( ( (0880(  ( ( (  (    (080(  (0( 0(  (08p80( p80( p (08H80( H    (080(  (08P80( P P P ((    (080(  ( (  ( (  (08@80( @80( @80( @ (08p80( p80( p (0( 0 ( (   (08h80( h (0(  ( ( (  (  (0880(  ((  (0880(  ( ( ( (08P80( P (X( X (08H (08@80( @ (08@80( @ (08@80( @ ( (080( (0880(  (`( ` (`( ` (0h0( h (`( ` (`( ` (`( ` (`( ` (`( ` (0h0( h (0h0( h (`( ` (`( ` (`( ` (0h0( h (`( ` (`( ` (`( ` (`( ` (08p80( p (08p80( p (08p80( p (0h0( h (08p80( p ((  (0h0( h (0h0( h (0h0( h (08p80( p (08p80( p (08p80( p (0h0( h (0h0( h (08p80( p (00(  (08x80( x (08p80( p (`( ` (0880(  (`( ` ((  (`( ` (0880(  (`( ` (0880(  (`( ` (08080( 0 (0880( pp (0( 0  ( ( ( ( ((  (0(  ( (  (08X80( X (08`80( ` (080( 8 (  (p (  (0( 0 (08@80( @80( @80( @80( @ (0x0( xx (pp( p (08P80( P80( P80( P (080(   ( (    (080( 8 (08@80( @80( @ (0( 0( 0 (0( 0( 0(  (0880(  (0( 0( 0( 0( 0 (080( 80( 80(  (08@80( @ (8( 8 (080( 80( 8 (08@HP80( @ (08`80( `80( `80( `80( ` ( ( (  (080( 80( 80( 8 (080( 88 (08p80( p (080( 88 (0880(  ( ( (0880( 80( 80(  (0880(  (0880(  (0880(  (080( 888 (08@80( @ (0( 0( 0( 0( 0 (08H80( H80(  (0880( 88 (08hpxphpxh80( hphphpxh (0880(  (0(  (  (   (0( 0( 0( 0 (   (H( H (0880(  (08`80( ` (08X`hpxX80( X (08PXP80( PX`hpP (08PX`hpP80(     (08@80( @80( @  (0( 0( 0(  (08X80( X (08080( 08@HP08@HP00 (08080( 0000000 (08X80( XXXXXXX   (08X80( X (0(  ( ( (0( 0 (0880(  (0880(  (0880(  (08h80( h (0880(  ( ((  (08 (08hhh80( h80( h (080( 8 (080( 8 (08P80( P80( P80( P     (08p80( p (8( 8( 8 (0880( ((((((( 0 0 0 (00(  ((  (00(  P P (08@80( @ (0880(  (0( 0 (0( 0 (0( 0 (0( 0 ( ( ( (0880(  (080( 8(( (00( 0(  (0880(  (( (0H0( H (08`80( ` (08`80( ` (08P80( P (0880(  ((  (0880( `` 0 (0( H`0 (08H80( 80(   8PP  ph(( (08H80( ((PXPXPXPH80( H@80( @80( @( (   00( ( (0(` ( p( p( p( (0( 0( @80( @80( @ (08@80( @80(   (0(  (0( xpP8  ( (( (  (  (08H80(  @0( 0( 88@8`80( `80( `(0(8@8p80( p(h (08P80( (   H`h`h` (08PX`hpP80( @ X0080( 080( 0X`XX0h(80( h80( 8@8@8PX`XP p(((P@80( @8(  (H`P`0GNUGNU%uLq&LinuxLinux]2X;,[%$       "# m.KKLL} 7K{JJo ,     GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910A$$$$$$$$$$$$$$$$$$$$$mpt3sas\QWA<^?|n)]Y4L)!<U<\<;<Vsi++G+XGiQi]&xi&i&i&i&int&]&,i&*ims8'lmu8'ms16'mu16'55ms32'Lmu32']ms64'mu64'{]I ,(i(+((1](2](H(I(X(](^(_(`Qii)$)&)')()))<]* ]**** <*#i*%*&**+*4 *='*B*^+*hL*m5*n]*q{*} o* {* {* {* ]* ]* {*>* **>* $*o* *X*]*]00*}****}Q+=*** ,p++ + +  + (+ 0+8+@+H+Ppad+R+X+`+h_f+l+Q+,+WL|-]H. . G. . _. "n.  . 8(. U0. [8. b@. K H. K H. K H. H. K H. K H. K H. K HO@/; /c/0//b\P/+h//G/G/^/g/ l/]/8Tkp/q /](/],/g0/ l8/@/A/B/]D/ vH/Pmem/{@//+/ ]/0///// /H(/i0/]8/i@/]H/]L/P/]X/`/]h/p/  x/]/]/Z//]//]/]//i/ ]/!/"]/%/&Q/9]/:/?0/A0/D /F /P /Q](/T_0|-U0k 00U0 0505:0 `val0 JG Jk 0 5 0, U1 11  +:1 "1 J 1 ? 5 1 1 22 3x 3 3]  4 4x 444 44]4+,5P 2fmt5G5G5G5]5G5G$ :6e "6f+"6g "6h 6u 6vL6wLkey6x  6U 6V 5U 6j2key6k 6n"2key6o 76E"77 "78=877G7G7G7G(7](7](74]key79"(A]7=87UU7V0mod7WU7XG7YZ 7Z (7[ ,7\0G7u7v7w7x]7y]E+]Q+ 8/81]set83get8587 ~4..U.,. R. u. . 0(. 00.8.! @." SH.# qP.$ qX.%`.&h.'p.(x.)߮.*.+%.,M.-R..%./ z.0 .1 .2ԯ.3 .5 .9 .; .>߮.?7.@U 9 9!Lkey9"L:9?G"9A+"9BL"9CQG9=w9>i5:;;; : : w:<; fcs<={fsl+>+>+>+>+>> pte>>">> /pmd>>"?%X?%%#?%/;?' 2pgd?'#?'"e?p 2pud?p#?p"#?=@@H@I+aGk5rk0@ 4@+8A;mA<)A=)NA? ] NA@ ]$NAA ](NAB ]+U0BB'B B B {B+B i B 5(B *O-@C 'C6C]C]C i C\;(C ],C!]0C( 4C)C48C*]HC++PC,'XC5 `C6 dC8 hC: lC; pC< tC=]xgseC?F@TrtC@GdlCAHCBHCF KPCI8CJ+CK]COKCXKC]KPC`"D@CdbCh]Ck] Cl+Cm Cn,K Co1K(Cp+0Cq iXCs`CubCx dCyJhCz0pC{;KC+CCC C0C C0C C CJC0C0C CCC0CU8(PC8PTmmC])hC])pC0LxC C C C C+C]C ],C ],C ],C ]-C ]-C ]-C ]-C ]-C ]-C ]-C ]-C ]-C ] -C ] -C ] -C ] -C"] -C+CL6TpidC C C+C'C 'C0C0C'(C00C0@CLPCLXC 0C"MC%3)C(3)C+ iC- {C. {C3 {C4CC6~CC: (C=+0C>+8CA {@CD {HCG+PCH+XCK5A`PCNzACThNCWhNCZhNC^XOCk 2CmbOCp_7 Cq7(Ct+8Cu+@TfsCxlOHC{vOPC~OXCO`C'ShC oSpC ;xC ;C ;CY?C+C 'C]CCySC BC]C:C?C { C { C7 Cx  CJ C8( C'8 CS@ C iH CSP C7TX CAT` CTh CTp C+x CT C@ C] C { C { C { C5; CB C CT C0 C ] C ] C"T C)U C 0 C 'U0 C 88 C ]X C,U\ CAU` C8h C0 CKU C C C C  C!] C"] C# C$+ C& { C' { C( { PC) C3UU CC CD+ CLZU CN+ CRjU CS]( CT], CY+0 C] 8 C^ < C_ @ C` D PCaH Cdo@X CgtU Ci:@ Cl~U Cw Cx Cz+ C} C~U C {C {C C CCCC C C+C]CUCUCWC\X C](C],CJ0rcuC0C\;@C DC'HCx:PCfXxC\;C iC "pXC zXCXCiC C {C CC>PCC C!"3C$"3PC.C<XPCF'@@:@B'Jm`padB!''+?@B'5'B&'@O@@D3)D832spD+2esD 2dsD"D$D&D+(D+0DH38D+XD+`2cr2D+hD+pD+xDg3D+D]D]D+D+D 2gfpuD /2@X)(E X)E +=)b)O@@@)a2r@@bv@ /)H@*a)p@])@ X5Hp @(@,@p0D@mp8@0X@ph@%qp@+x@9o@ i@q@+@KU@q@>oF *F F * G!!+G% G+ G-G/ A]3+     +++E ;=)+E?+=)++H $]J,     0Kc,KdGKeKgKi ſKlʿ 5(,|]|t=)||L+|L+MI-M{endM{@N @N pO-cwdO]swdO]twdO]fipO] fcsO]fooO]fosO]O-O]l]-+UO*.ripO+{rdpO,{UO.Z.fipO/]fcsO0]fooO1]fosO2] :O)n.J-J.:0O@."OA."OB.].+ pO$3/cwdO%5swdO&5twdO'5fopO(55Z.O5]O6]O93/ O<C/O>.n.]C/+]S/+?OQ00cwdOR]swdOS]twdOT]fipOU] fcsOV]fooOW]fosOX]OZ-O[lO\mO]nO^ormO_pO`qOa00xOb]*E0+{U0+@O:0O; {O< {O= 0{0+O@@OO0DOP.OQU0OR0@0]+@O^?10O_e-LO`.0OaS/LOb0@0Oc?1Q1+O@@Of1Oh]Ok]On{Oq{2xfdOt{Ow]Oz]O]O]DO0@@O/2O {O]O] fpu@O2O]O+O2O2O1 O10DOQ1@@Q1P 2P {P{Q2+Q2+? Q33Q Q! 7Q" "Q#2H3+X3X3+]3b3= R3R]R]RGRGRG@S@S@ST84T94T<4T=44:U<C4"U=]"U> U:~4U;45!4srcUA5 dstUA 54,4iA]V4>(V 5V 5valV ]V!] V"]V#{V$ 5 ]:V*15"V+&15"V,#^5W^5WZW L65>V'5V(V)455V.{> V15V26V3V4 V5+V6+X$6fdX%X&X'5:(VL6"V%4"V/c5"V758Vy6V+fnV 65666L6y6Y>6Y?+Y@+YA]cpuYC]Z6Z{Z{=(Z%7\ctZl3Z&%7 6A][Z7\z7\ 7z7] 7]0^ 7^ :_7"_] _757_7>` 8`? `"7 a)U8a*+a+x osqa-7 a/0(b 8b b 0b0=c8c+c8c88c 8c 8c9c8c8= d29Vd 8d d M9d8A]e k9=@e'9Ve(9e)  e*9(e+s:0e,8e-9e.:e/;M999k99=@@f/s:f0)f1]f2  seqf3lBf49f529 f640f7 89(g:g }g+g :g] ,::x::h;hh h ;;>i %;i%;+5;+i8;j\;j jA;k+;k,k-xl;l;l]`l+hmaxl+p+;+ >m ;sigm%;m;nRnS<<nUnV:<"<of<"o "o io ?<>o'<o(o)>o-<o.0o/o0 f<o1>o5=o6o7o8 f<> o<P=o=o>o?o@$oA$>oS=oT oUioVi> oY=oZ o[ >o^=o_+o` oa :oJ>"oL"oQ "oWP="o\="ob=> oE9>oFi5=>og]>oh_fdoi>om>oniooop]  o%>"o*r<"o2<`_rto9<"oB="od>"oj9>"oq]>U0p /?p p p p >0p C?5>p/?O?p ?p!0p" ; p%?p'<p(+p..<p0 ; p3?sap4? q @q Hq +lenq +q (r:@r =)s$o@s%s's( 0sD@sM#@sP(sW)8t  At{t{t{t{t{ t#{(t,{0u)5Au*{u+29Pu8jAu9jAu:]Hu;]L AzA+=8uDAVuEuF8uG]0= v>BvKvZvpvvvendvBQ*B]+w!EBw" ]w&*BwDlBwDEBwDQBwEBwEEBwExB>wT BwYBwZ 7w[B>x Bvalxx B>x Cvalx x BCSNCCU {CV {CWx W]C[~C0ChCCiEBCjCkNC2cpuCl]Cm{Cn{ Co{( C6DC+CCCCaDC+C ]H@@CDC {C {C {C ]C ]C+ C+(C+0C]8O@CFC {C {C {C {C { C {(C {0C {8C o@C {HC {PC oXC o`C {hC {pC {xC  {C  {C  {C  {C {C {C {C {C {C {C {C {C {O@CGC6DDC 8C! {(C" {0C# {8C%0@C&PC'QC(RC)SC, {XC- {`C. {hC/ {pC0 oxC1 {C3 {C6 C7GC9GC;GC=+gavgCGaD@FG0CKiHCL0CM+CN+CO] CP$CQ&CSiH(G#C]{HHHHHHC`IDCa8Ch {Ci { Cj {(Ck {0Cl {8Cs o@Ct {HCu]PC]C]C]C]C]C]C]C]DCk9XDCk92rqCJCnHCICH#C^J J'JHrqJCnJYC] YC] YC]YC]CJCCCCCJ}bCnJ}sC]CJCJJCKKK#J,K+++6KH.0L.*.Zy.]. @. D. H.8P.+`. +h.)p.+x. .7.0.]. i@Kpidpy7Ly9 \;y:]y; 7y<|inoy={y? y@b@yB]H\rcuyC`yDp5L}L+ M]s^L=zocNzp+uidzq Bgidzr C zs Bzt Czu Bzv Czw B zx C$zy ](zzو0z{و8z|و@z}وHz~وPzXzXO`zXOhzXOpzXOxz iz zIvzT?z%aMcNkey{XO{\;{a-{! sem{]({+P{ iX5P`{ whuid{ Bpgid{ Ct{x{|{~{ {+55{0mN]OgOqO{OOpX|^'S|_\;|` |a|b |c0|e] |h'8|kY?@|nbX|q`|sd|t'h|wp|x]t|zx(|](|]|]|b|bV|k9| it||!|5A|h| |L|utty|ȏ|ҏ| B|{| {|{|{|{|{|C|+|+|+|'+|+ |+(|"+0|,+8|+@|+H|"+P|,+X|+`|+h|@p||׏|[|| ]|||||])|8|]0Ov |oS|7|\;|]|K ,StS~S}S}c}cS@~7T~~ ~ { ~ (~*~,~-~00S\Sbecf]sdagWdhT i\dbvxDGdEbFGdH I8(J7HK8PL+pM+xN+O+P+Q+R+S+TU+V8WLY \+]+^__cpbWd+hac@:d"50"50>"d#L$%>'d()>+ e,-:!8e"&d"*d".d _e5odopsie5 e_ede2e4+6]7] A]@eA]Hep,fqers1f,fUZfne+fV+fJ6fZf=@ge+++  (,g0\rcu8MgHf8eMgid&g\g]+wg|gwg(gx o0 > \h{& $)]ldt*ah8.+@98H:ih;pip= xC5|D)~\h kii+alt+++ +(08@HPX`hpx !fhkiFgU@\i@^ i@`]:@Xi`lru@Y0Ji"@d0"@e0:@ii"@j +"@k+U(@R*j5i@h0L5i@s+ U(@utj@z+pp@{yj@|+@}+@~+ tjU@j@+U@j@Bk@ iBkwrefĕ8LHh]l+pops xi5j(@QrkJiJ*jJ~jJj@:@k"@]"@ @ k2val@+#@k@Mk@N i@P]o@Jk}lru@K0Jko@W$l0@X i0@Yk@@Gl@I+5k@U0L@V + 5k(@[ 0@\ 4@^+8@@FlJ$lL@j(@mm@n+@o+@q @r @s @t @v] @@l:mJlL@z0@}m@~+@+@ i@ i@ i @ i( @m@+@+@0@@|mJ:mJmL@H@Dnalam@am#@+nH. 4o. 0. 7.  . .0L. i .*(.]0.]4.hN8.@5tP. p.  ix.#ڨ.$ .% .'ߨa)n)n@5[o2ctx@6`o[o@=o@>T]@@B(@Xo@Y](@\p@b+@h+@t7@w @}$@)p@+@+@HpJpL@o@mp0@$n0@n @pgrb@8@+opbqc Th Tjmkq sN(t0u8w@{NH~NPX+`Dhbp{xpqeoo@q@{2cid@@ @@@ q@  @2r@0@+@ U@@@vaq@@]@@+P@+X@+`@+h@+p2pgd@  )x@) @5 @?v@E+@L]@S @Zx @]+@_@a7@p]@r0@@+@+@+@+@$@+ @+(@+0@+8@EB@@7D@+H@+P@'+X@3+`@+hTbrk@+p@!+x@+@+@%+@0+@v@%v@@:v@ui@+h@7p@Dvx@'@Iv@9o@&Sv@+@+@@ @ @\g@+@^@]v@+@+@+@ qq+%v+3g5v+5v?v [NvXv+qv]+#@ ]vp/w57w(2pmd9 )02pud; *85$@EHFP2pteL )X2ptlPY`T hW]@sw @~~~~~b6b9b<bG8x+22++ +(0xx=);x++| @%xB C~xiVxxi 'x:By"Dy"Ey"FFy"GUy"Hy"Ii~xxAy !]"]  yAyKyPy,y- 7/ 0iZyUAy5xK '::y"@VxJy:Ny"O+"P"Q (+Lz,-./ '5y5y 0.pz.q9o.r .s .t i.u .v5$5K(Lzy"z#{&{'{' {z{U0{7 L{J {=b{a0{U3{4]len4]:2{Jb{"6{1{5{8{:i{"j0"k{]r|"s}"tzu=R|T]UBVzW|X{ Y*0[/8_"``Ȅha+pbixVdL{5{m}nb\d_uv{||Ox.{*.| .}.~ B. C.] ...!i .Ȅ(.0L0. i8.+@5H. L. P. wX. w`. wh.]p.]t.]x.]|.7.... .].].+.+.}.0.s..5.5.0.0.0 B0.$@.$H. P. T. X. \i`.}hP.@Kp.08H. P.(X.`.h. ip}?+'=@"J^ r( 0 8 @ HBP`Xy`?O@.Ȅ.0. ..+.  .[(.!0.!8.@."H.+P.+X.+`.|h.]p.. .i.&.#!.+.$:.?..z. 0. . 9o. . .}.] .à(P.`. i.].w.w.!]."./ .0 .1.4 .6].<8 .BG@.D"H.FP.I+X.L`.O d.R `h.Sbp.ZIvx.aLJ.bLJrcu.c.d^.f8.k0P.n7@@.o0H.q7X.r0`A]|]|{E]GE{'^Or|c,|w,|*H|H EF|GȄHI] =mnt   |[[=G|y|̈́e "͆#nid&-+4+7U=RSUXYZ ]c \; dL(\rcueHgiXj0`idmpptqGxr|u‡+͆~+034s6078 xa9Zy  J 0" $7=@@-slru/0+ Jy2nry3nsy4Z7b+xˆ]+> وval{ˆA]   H WiHb+{P{h={l\rcu{m{n\;{o U{v{x5{y :{u'J`x{+({ro{t+5{y{~{G oo {"{i"{ i+{ˊЊXOXOt{-{key{XO{y{P"{0{8:{r"{ w"{ wU({{+{+{y{~{ H :({؋"{'Jr {{0{ io {0{J؋& \;g+0+8}@uid BP+X `$ hzz \;zgidz  C]+z "zrcuz5p@@fg)fhx cpufi]fj]fk] Nfl]Nfm]Nfn]Nfo]Nfp]fr]fsftfu]f{  f|9(f} 0f~98Vf9@@*.9@K+?[+?8|Ď| |! |"+|#{|#{ |$+(|$+0|'|({|){|0!|1 $|2 $|3 $|C<|D|Ld|M'|Nd<8|Q|R |S<|TLiĎ+LÏ+Ï͏h;+'=0Z]V =` \rss 08]@ X Ґfn ~4arg i+> bҐ ]:S1"T0"UWT"X}Y=8IqJNiocKT5a1 \]0O~N~ i~^~s~}~+ ~](~],~\;0~]4~Zy8~ĕH~K X~T X~K X~T X~)X~7`~d~Wh~^p~xTdev~(~_0~ 4~38~=@~8HTid~ h~+p~Gx~^~x:~^~ ~~0~ %;~!~"0~#8~&0~(74~)08~*_H~-Tfq~2~30~58~68~78~=0 ~>70~@4Ttd~D8P~F@~K]P~P8h~R~S0~U|~V|~W|~[8~] TX> yvalb> val<,ĕin+v^=8_Y`+aYbYNc Nd \rcue reff0> xv +%cW]T֖++ nnA >. 00 $4 4q5]6q7+:.". B". y:.". C". P.\.]. 55 . ..(.8. 9oHaб()}*0+0 ,00-8@. 7`/ d0Ȅh1p2 x3+4ƙ> ;val $A]6kB:E`uidF B`gidG C"H ;Dƙ5wJGHI k k k k k  k( k0 w8 w@H̚0+ ](], k0 k8i@ !U̚@89:;<=ě >ě(?ě0@8Ȅě\ݛȄݛɛXDEěFG HěIě Jě(K0N Ҝ8O@Q HSP\Ȅ,\͜͜*k*;ל *͜xYZ[{\{]{^{ _{(`{0ao8co@dHeLf{Pg{Xh{`iohjp8]]]] ]]]2ino  ( 0Þ]ÞӞ+ R]]] ]]]]X77 Z(}08}@H7PRȄ[7Ȅ]#UȄUӞ<xȄx_ȄݛxȄ8  ] ] 0 +HTops!; *++I;+K+o.wp0.}u0. p8iz,z.ʢ.. .$. =. W .(.0. ԣ8. @. H. P. 0X.S`.gh. p. x... .Ϣ9om$0L=0L),MMRB9o0L]]\9o0L]]iԣ0L,''٣, 80zzS0L5gX''l,0Lۤۤ9o¤,9ozzʢo.B0.d0.].i0.bL.o.0.!0. ,*o.0.tU0.0. H0. ]O@.Zd.[s.\.].^ұ.` .b(.d60.eO8.fr@.hH.jOP.kX.m`.o h.p:p.r Xx.s.u.vƳ.y.{.}*.R.k.dnx(..9o. 82pid.L.*72uid. B.B .$ .t. +.].] .].]. o .0.80. { .)ڨL.*0.+40.,0.-xb]+#.PiO0.I.. . D.IZ[+.۪.. . . . .((. 0. 88.@.QH.eP.QX.e`.h.p. 8x..... . .(. A. A. 8`۪ &05<p)* + ,W-N. /+(0 09 4:0L8< @=7D> iH? iP@XA8`BC^E F8H+IK iVQDQ+Q¬+$#.ϬԬG{].,. ¬2pos. #. ]R9o98u9oH'GxW89oG'Gxzz] ~~~~  9o&9o&+%S&Z' q9o]+X9o)v*9o9o߮9o9o9o +M9o++++*Y8ztU9oGx']W89oGxtU']ů9oů]ʯϯ9oٯ,  9oxQbufQHQ 'Q 'Q 'Q ' Q (Q 0Q88opQRXQ`QRhQip89o9o']9o9o]--]2U-]<|s*|]ZG|*x]*ұ*|Hױ]*|6|*|O*|;r]*|GT]*|w]*|]*|*|]²]|5][5]][8X|H'?{*{{{]*Ƴ*|9o]]*9o˳]|*]| H]|HM/k|HW. 2mt. ]. +*pW].״*Ȅ״,**(*,8Ȅ-QȄ=eȄV~|~jȄ3)H |8ȄH'ĵ8ȄG'##*\AȄ-UUZFdi|[GisK +@#@Y#AG#B0#C^#D2 #E(sd#F0#GT]8(#I](#J](#K](#L](#M]hbio֡c W0 VN 5o48 i@H<P{X` hpr  t x* L. ]ָbָ +8rev+չ=  G\rb8ns0]8< >5@id{` ihp\rcuxչ ٺops! h¼ Ҽ"$ % " & 7(( Z02 '89@: ZH= sP@XA `ٺ: `dirn""kn9o  i8 8@`0h Hx  '  @  A %q,ҼǼ i׼i Gxi" iGx ,7 i'8ZH'<s&_)xA]ӽ0'/() x* :+X,c - ~4(ӽi4NNS?]KKGK :Km"KnR"Ko&\XK0MK1hK2 'K3 iK4տ K5 (K7 /0K9 8K; /@K= WHK?zPWfMa^hk^a'ſ^a0LϿ89o^WH'ڿ8/9o^aH'W9o^a4z9o^a)\KK K 8^H8^G'`#2#0# 7## X0#t#u #v#w!#x*#y #z (7,^,/Y,LxQxv #}[#~[#k#ubuf#{# Hk+H{+?Q+####G  5G5(8E8FGmod8GUops8H!x8I A8J8K5 :!H5:8L`arg8M i`str8N`arr8Os8V8W]8XH 8\nmax8^]8_]num8`ops8a!x8binn8&=0(V)8+ + ] 3)  Q++7`/-y/.mod//U@/0^Hmp/1~P/2MXy8/5/6h/7 /9 %/; : /<N(/= ^08H+8%G',:UG*NU?,^USW]/>H8/E2mod/FUD/GHP/p/qi/ri/s/t]gmtn/w /X/ X/]/H/Hb]bX:+*ZcZ +(,i--.. //01  idҐclsnȼ @Q+Q +X0+ XE+$5XZ+J@""end""G"+"+ "("0"&8__Q+/(C+++++ =0z\rcu12T]3z]+ HIJK LM+Nbv CO@2pHGP8X2bus`uh ip ix84D, Tmsi{(8@{H{PX `0hx zO Tid]70 !!# Z$Y%c'#h) + `, a- b. c/ d9 e< f:;<6J  Z!J"J#J $J(%J0&J8'J@(JH)JP*JX+J`,Jh-Jp.Jx/J0J1J2J3J4J5JJ;,ZOWUW]lHx"y 7z]|]}8~00'@"O8fY  Y !Y "Y #Y $Y %Y &Y 'Y (Y )]7 0L {@ @ A B C D EDk9P{^]  ]                ]__{{{{  (Tqos0+{,Gid-.0/7 0(1x:02+X3 `4 h5 p6 x7 8+9+:+;+<+dev=(> (? f,L2opsJ /J Z ZH,/H]4M^NGOGP!Q!R! T(U0VJ8W Z@X ZHY ZP[JX\J`^h_JpaJxcJd ZpmfhMww~`~aGbusbdUeGg h=$ja(kf0mJ8n Z@oJHp ZPqXrJ`s!ht!ppmvxw Zpyp|c 6^`2r3G5!6!89 ; (< Z0>J8@(@AHC PpmEXHw,r,LxQx0X3YGZ![\ ^ Z pm`(3A]-ak|HLxQx]]+W] W]48{000 0!x"W]1W]BW]O4cd&e2f4g 2lidh {cma@/J0Oops1"dev45060(78T^4@A] { hib 0 $J %] &] '] (J  ) o  * i(]Z+,jj]ZA]ągetĆKputć [Ĉ oĉċ o č(Ď 0Đ8ĕ@ĘHęPĚ(XĜA`ğZhġpĦAxĩ(īKĬĮįİQR]idS]TJPf<gOh]iE0OKO<,[OPo`ttGG]i'GZ'GO(OAO-OZGFGG]]_iO]OhLDbusMN0OP Q(O 000(80@P0p_2ops i 4devWW] ] D]`   ]""(5y682len7] 2cap8$o00O` JK02busLMO i P(Q0S]8T<U>V@WBX]DYHZI\5J]P`Xa`c]hdlemfngxhp2piniqj5rkxmn{tvyz](|]-}].~]/]0]1]2]3]4]5]6]7]8]9]:];]<]]5]]]gdevTirq]_@]B] B] B] B] B] B]B]B]B]B]B]B]B]B]B]B]B]B]B]B]B]B]B] B]!B]"B]#B]$B]%B]&B]'B](B])B]*B]+B],B]-B].B]/B(F H 7LPb(( ]@M5 ]`M]aM i x Tvpd@ 5 ]PO = y 5  5 ] ]`P 5  5 G Zy 50 2 Trom8  '@ GH  +P #LX GH a C z  ( C0 8 @ H#P!X!`|h]_+](+W8+8B\+( ! "#0$X \+,i]0] 5 X]]5;<7=0#H ]8_ae3h3k Cl C o C(r C0 3$,C8iaHMzf]A]EN*T :ZNeq,:/qvN~v?qBk++SUv!-]+:"!-J{*(02vma1)2 3 +4+5+ o>I0? 0@ /,T)Im)+Y)r)+++qv~v]qv~v+++))+iG+)D)KU0KUb)+I{)+g   + ]]  ]]'sgl()]*] @GA]N=MN P]R] T],c ~C~D ~I ~N~Se~A+~B~C'%`W{]:" c"] y}n}o}p]}u#t}w c}x c`}z c}{ c}~]8}7<}S@}^P} `p}}x y]+#2ii,iiHY 7 ]iY ^(]0o@jklenlwpmnopqrs t(+(+=@_!+V&+@@+x H 48]=]B]G mapLT_(=@@]a]@mUsbq_w] | $wsɁU(Ɇ 0Ɍ]4ɒ 8ɗ <A~m~t~u~vZ~w~x~y~z~} ]~~ ?~]~v~ ~ ~(~0~ 8~@~H~ P~ X~;`~ Th~rp~Ux~~  $H~u~~ @~]D~&JH.#~  ]#~] ]~h~iz~j~k+~l+~n]~o]~p] ~q]$~r](~s],~t]0~u]4~v]8~w]<~x]@~y]D~z]H~{]L~|]P~}]T~~]X~]\~]`~]d~]h~]l~]p~]t~]x~]|~]~]~]~~~~]~]~]~]~#~  ]iyP~J~~ @~ HY]+Y,n0iA: yAB AJAO A T A(XA0]A8b B@g BHn;BPr PBX{sB` Bh Bp Bx B Bcnxpf)qgNh}i@@k Wl=tagn o$q](t],u 0biowc8xc@5=HX{`{h{pxz|~J@=ref +5=a>elv$>X>{|>i.8B]]]P2rqsBB0 7L2opss2map A]8 ]< ]@ ]D ]H L]P]T iXA`h8p0c~~)~)W]~?]c]DvWb,W{]+]W],+;W]iHTW@rW*Yw|W,,,bjdmU8( mU16)[mU32*gU64+v         0 4 8 <@ HL l p t x |    + + + +  + + &~Hˀˁ˂˃#˄˗˘˙˚˛˜#˝Uˣ ˤ˥˦˧˨#˩˯n˰˱˲˳˴#˵˻˼˽˾˿#{# # p0"H0(0" 0&n0%0&0-LF#}  #^   #! ) *+,-.#/k 50 6789:;#< B CDEFGH#I= R STUV #W #^ #e k 0l 0m ^ 0n( 0o-0 0p. 0q1 0r, 0t LuFx  %; &'()*+,- . #0 6 789:;<=> ? @ AB #DH HS 2DevIJKL#M O 0PS 0Q #R` f g h #j H l m DnFp t-0u LvH rXs guw Fx-0˖ L˗H ˑ˒˓˔gu˘eF˙bc d #eHhlDij k lmFnq0rLslFty#~ Fˁ l˃0˄L˅FˆHˌZDˍˎ ˏ ːˑF˒F˔#˕g˨L˩lL˪ZF˫LXLLLF=Hy       $V(V0V8V@HD   F     # %-&'()*+,- . #0D3y456789:; < = >? @ABCDEF G  H$I&J(K*L,M.N0O2P4Q6R7S8T:U<V>W?X@YAZB[C#]: ̡̢̞̟̠̣̤̥̦ ̧ #̴̩̬̭̮̯̰̱̲̳ ̵ ̶ ̷̸ ̹̺̻̼̽#̿    #*    #,     $& (#        ]+#+[\]^_` #c̮d̯̰̱̲̳ #̶7(89:;<=>? @ A BC #EqH0& !"#$%&'( ) *  + , - . gSGL/ F15456789:;<= > ? @A B #D3H,̶J ̷̸̹̺̻̼̽̾̿    D   $ (F!    #W p!    # )!!+! #!!"+H,#     p! DF"#    p!# '#L_j$`p!aj$bcj$dj$,ej$<z$+#h$p$qp!2VPDr$$+#u$H͡%͢p!Dͣͤ  ͥ Fͨ$ͯR%Ͱp!ͱ #ʹ'%͡%ͣͥ͢ "ͦ  ͧ ͨ #ͩ_%ͷ@&͸p!͹ ͺ ͻ ͼ ͽ;@&%O&]+#%]&^p!_ ` a b cde f #i\&'p!   #&@(A B C D  E F #G'HLe(DM2LUNNO P FQ(HV(DWX Y  Z[\ F]r(Hb-)Dc2LUNde f Fg(l)0m"(Ln"e(Lo"(Lp"-)Fq:)Hpv*wp!x y z  { | } ~̀D́) ͂8̓9̈́:Dͅ)<͆T͇U͈VD͉)XF͋)͛*͜ ͝ ͞ #͟*Hͥ9+Dͦ ͧ ͨ  Fͩ*H`ͭ+ͮp!ͯ Ͱ ͱ+ Ͳ Dͳ+ *++9+++FͶF+H,DDF+Hl,p!gPhyl,,},]+F,,+ ; -Ϳ  #,-&!  - --]+#--+H(ͥ .ͦ #!ͧ  Dͨ  ͩ ͪ ͫ ͬ ͭ ͮ ͯ Ͱ  ͱ !Ͳ "ͳ  $FͶ - F$/GHIJK L #M.[/\#!]^ _ `abce/$//]+#h1/ L)0CDBM-N sOPQ R/Vg0"W,"X)0SGEYXZ50=p^ 2_`abcdef g h  ijklmnop q r  s$t&u (v ,w0x2LUNy4z <\CDB{g0@\SGL΁`΄t0J2",")0SGEl2=p4          $ & ( * ,022LUN4  ?  V@ABC D}! G08v h;! " # $  % & ' ( ) *"+$,&- (. ,/ 00 41 82 <3 @4 D5 H6 L7 P8 T9 X: \; `< d=,h> ?,@ A,B C D E F G H I J K L M O9Ѡ;ѡ Ѣ ѣt;vѩ#=Ѫ ѫ Ѭ ѭ  Ѯ ѯ Ѱ ѱ Ѳ  ѳ $Ѵ (ѵ ,Ѷ 0ѷ 4CrcѸ 8ѹ<Ѻ=ѻ>Ѽ @ѽ DѾ Hѿ L P T X#=\ |3=;3=+ C=+;A]m=y=O==)0A]Z=:z="{0"|):>"}"4$>8" y>H>icqS H>iX>+>|>seq]|>m=O@6@@am@@L_@N+SX[+a ieN2fqgm is_y}]@ 7(r\0 X`h]p]t x}}||0>E@W]&m@@@7@97A0F+}@]] W] A@A+!KA2rq")#!A0dA@@dAKAPA,yA@@nA,AA~AANA,ANA,A)AA)AO@A)A B@@A,B)B;B@@i]"B,PB@@]@BsB)]]UB,B)]xBBNB,BB,B )B)]B~A]&BC A]BC =aC\rcublencdp(gJh OiNl0m0 o_0p Pr Ts 7Xt0`upvrwtxvy+xz+}+id]]lun{] ]iQQ8OGGrevGOOOOO O(O0O8VP@BH]P( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ppr ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ( ] ]\` d%;h%;p0x^]    P P  ^`P i ' i]]jP8B' bv(O8 O&0'0)0 +70,Y8.8@00`10p2'3M5]6#X7"&X9T]:L<> @]B]D]GH+Q]R]S{\]eghijkl]m]n]o]p+q+z ]{ ]| ]҂ ]҉ ]Ҍ ]ҏ ]Ғ ]ҕ ]Ҙ ]қ ]Ҟ ]ҡ ]ң ]Ҩ `ҭ `Ҳ]ҵ]Ҷҹ+ Һ+(һ0Ҽ1Tirqҽ]4W8P@P0i (0Pbv8JCOHOVPPPQ0R0gdevS(TT]U]TidV] X] Y]!\]"^]#`]$d (e ,k]0l]4o Q8poP<q i@rbvHO[PePW]BPCP ]ADPp(JqRKPL0M_\rcuOpQSZ+\]_`abPde$gvRsdbjPkRm ]p ]u ]v ]wO}~+]O PR+P334oA]$Rvh*U3]W Va %VcUdG m9V(tWV0WV8҃V@҄VHҘ kVPҙ kVXҚ kV`қ kVhҜ kVpҸ Vx V V V V V  V V" W* V4 ,W; @WE cWN VW|WXWaWg WqWyGҀ҉ҏ Ґ"ҕ]$Қ](Ҝ],Ң+0Ҥ+8ҷ@ҺDҿ ]@  ]A  ]C  ]D  ]E  ]F  ]G ]L!P!X{`R V O VPU,%V O5VG9V O*VWVP]i>VkV V\VVPpVVPVV,VPVVVPV,VVPVV O+V,V OVWPV,W O]W@W)1WcWP3)EW|W  OhWW OHWRW VWW VWW OWW]XU!XA]LsX A]ZXX+ A]1Y      4Y5+X6sX7sX8{9pX?B1YEXFXGX HX$IX(L],M]0N]4O]8R0@U iPp0`Z\devab1Yc0uqdN e](QZ+aZYZZ,Z9o{&[[[[([[ 0 +  [[ ZU{[V h`[a \b \Tp[q hr[{[[+\րASCցւփT֑E\֒ h֓E\[U\+֞\֟ \֠ \֡ h֯\ְ hֱ\U\\+v]#! ]  ]+<(\%<]& '!]*]+#!,- .$] <]]+/'H]2]345]\8^9*!:; <'^ ],^+=']@z^A ASCB C D E8^\H^I#!JK L(^ z^^+M'^P_Q R S T^Wg_X#!YZ [/g_ _w_+\'%_(__   _+hq`p!       q`  `+\ap! g    a 5,./ a0LMNO5P5RTU5V gXga+ga+8:Gb;0<{=]> ?@] A0(a`qcr0sVPt{u5 v]$2idw(x,y50z2{3|4}]8~5<{@H,UI*PXY5ZT]\LbXc8L i@ iH 5P 5Rdih d 0 1Y1Y02phyZPX5Z5\^_Gb`x)e*0+,-{ .5(/{00581{@2H3I4GbP2phy5eX60`7ZpdH8?e@0gpg0A.W]IeSeTiU^'f_i` cRfdRfe e@pfq5r Vstuev0(w 58g50:g055eg0 5g0  Uh2ioc w] w  8]<[@ h i j0pO2 w304 O2id567 8{@92X:;%{<=>?@ADE `F_I `8J 7@K0HL{XM`PdQhR5jSlTmV8pW8X 7Y[\]^_`ab5de5f*g5h{i]j{k]lm]n]o$p $qr5stu]v]w] x$y%z{(}0~123456789:c@cccHcccPRwywww55wwx{] i{5555 "x$x`{z$#_#`\P*P+('P%R%&cccd00 700 70070 7  5    i  i 5(  i0 58 5:  i@  H  iP 5X 5Z 5\ 5^ *`  h ]p {x  7  ] { | ] | 0 |  D 5 5 5 ] 5 5 5 *   5  | 0 5(  *0   8  5@   |H  0P *`  h |p 5x *   ] ] | 5  |    | !] $5 %| & ' ( )| *| +| ,  - .0 0 1 2 4{ 60 700 80@ 90P :` ;8h > | ?0| @ @| A B0| CP| D0| E] F] G<{ H I J K L M N 7 O P Qx Rx( S `[0 T [4 U\ V\ WX iY5Z[\|]|^Ax_Ax`Axahxbxde0Uh Mw  Mwg#_wdw,ywi]#www w V5c#ww,w wi''#ww,x wi#xx, VGM1Ȋ w.| w5-.y w5.>5 w*QZV]i. q O.])M<MB ŋŋʋʋB [B ]B [[[Q @]+Gi.k]]]j.{.{.Ɍ.]]]M Q "{Q ={.TQio+M?.G.$.s֍+MBB=]M@M!. A B]8)Q `#X]Q s]iMB ]B [B [B Ύ].]Q 5# ]]]8.2i/'.8iP'.?il'. w]. w]Mˏ w5]. V w5B [B +B + 8W8UB;O'':BG]lG. w5 G5B?++]MB Ԑ `MT  ` .a _.N 3 `+.+JdBE ffGs^QJ^833B=''<B ϑ5]Qk+M+B 5]Bv MM! wM 4 wMG.C ^'Q 'WiG. `G]Q ʒH+GBܒ:BF::]G.8 G5.8 :H5Q5RG"U+ioc"9 w'"e*r" "+ "] " ")Z w3#xout)# N"P "U  "P "U   "+ "+ Ҕ#P #U  *#P *#U  $ ,#+ ,#+ V;#P ;#U "&/EhU~D"ǕDMD"[DhDDU|~#$o ZU~U~:U TQ ) E#6  C  >@gK@W@ #  !jU~ U~U~Z#4l$ y     9ڢY ߢ ҃T}Q 9, 1 K "K#K0KC? D Q҃T}Q 9t  K "K#K0K9  ҃T}Q 9 3K"K#K0K-=K-LK-[K-jK-yKCK-K-K-K-K-KU?9 S  ҃T}Q 9[ `3K"K#K0K-=K-LK-[K-jK-yKCK-K-K-K-K-KU?Qs9n o |   c/ mI"IIIIII:U TQs :U TQs : U TQs:U TQs'#$ }U~U~:U TQ  X"X+X 8X CXMD.#[DhD DjU|DU| U@ EU| ȟU~ ; U~ U~Ts &U~ .U~ :mU TQ R  EU| U@ Q U~ ӠU~T1 :U TQ  "U~T2 :TU TQ  :U TQ  :U T :U TQ R  EU| U@ Q 3U~U T~ P %" ioc"7 w "5 "i "i "i "$i " )X   " "i ,"P "U  ? "' _ " "i "P "U   "' ģ " "i "P "U   "' ) " "i ["P "U  n "'! "3 "3 "3 "3 "3! "  " " "! "! "x6l"iocl"? w n"]! }" ^ }"!q}" }"~\ }"! }"! }"<]" ioc]"> w) !a"P a"U <R" iocR"F w,"~+ioc,"> w)E  ."P ."U  RUs Us RЦUs Us RUs RUs6UU# OUs:U Ts Q < " ۧioc "= w) !$"P $"U X+ۧ".+ioc"- w)n  ["P "U ?  "ۨ ?-? 7A cEARA Us  Us g#Us ~l;Ussssssssssssssss:U Ts Q  +ioc - w*r *i *rc  )n w!  P  U $  i3A AA3PB  bBoBUs T  P  U ;ܬ  i B 5BB(B5B BB3PB bBoBT  P  U ; 3! 3!i B3!5BB(B5B BB3PB bBoBT ;SM!K U|T Q $ Y! Y!iAT ; _! _!iAT $4 q! q!iAT ${ z! z!iAT $ʯ!K xU|T Q ; ! !iAT $d !  ! iAT $ ! !iAT $!K xU|T Q ;M ! !iAT $!K xU|T Q ; ! !iAT $>!K xU|T Q ; ! !iAT $!K xU|T Q ;3 ! !iAT $ ! !iAU`T $ϳ!K xU|T Q $ !3 !3 !3 !3 !3 !  ! ! !  !! ! mI!IIIIIIKE  GT 1H QI 1bI#N 14N@NLNى? !` ?-? 7A cEARA? ȶ ?-?37AcEARAPXC! bX$ oX |X X X X X X X X X X X Y Y $Y /Y 4?3Ah A Av ACZ ߹ Z ZCZ Z Z>V>>>>`T} Q|R X09g\ l\ y\9\ \ \AT 9\8 \ \AUvT C+]0] =]`THQ C]Ȼ] ]`THQ C3^8^ E^`T2Q 9S^M X^ e^AT e.ee$½ e e e9Lf Qf ^f-kfigY({g1g&/g RU Q}X0 :}U TsRv :U TsT Q# :U Ts : U Ts:U Tsdne e$L #e .e 9eig ܾ{gg& g U R@X0 $T Q:U TsQv:U TsYdkdxd$Aig{gg& g $U Q~R4X0T Q| :lU TsY`:U > ?3Ah A Av Accc$ig{gg& g U QR4X0 T Q|:U Ts:U >>>>`T Q|R X0 :U TsQ  :U Ts : U TsQv R 2`>U|T} gVU| nU| :U Ts 2`U|T} :U TsY}:% :U Ts :(U Ts g@U| gXU| pU| :U :U Ts :U Ts :U Ts :(U TsY}:% :MU Ts :rU Ts :U Ts :U Ts :U Ts :U Ts :+U Ts :VU TsR} :{U Ts :U Ts :U Ts :U Ts:U Tsn!f|&/)ZU|TFn !|/)ZU|TGn !&|/)ZU|TLn !|/)ZU|T?n !|/)ZU|TMn !G|/)ZU|T n !|/)ZU|TNn !|/)ZU|TOn !g|/)ZU|TDn !|/)ZU|T!n !)|/)ZU|T'n !|/)ZU|T4n !|/)ZU|T5n !L|/)ZU|T0n !|/)ZU|T1n !|/)ZU|T2 ^&U| >U| gVU|ssssssssssssss &$U| AU|T1 40_U|Ts wU| 40U|Tss U| &U| :U T| :U T| :NU TsQ  fU| ~U|U| +ioc 5 w)   P  U ) = x6  C  >@gK@1W@ Uv UsT1 UsUU#:U Ts Q +ioc4 w*r*i  *rc + ] 5        .  Mw w) wX w| P U ;  i$!  i;K  i;u i$ i; i;  i$  i;/  i;Y  i$w  i;  i   +  +;  D i; D i; ? n i;i n iN jNGN NO O OBUsGN OO-ON kNGN NO O OBUsGN OO-ON lNGN NO O OBUsGN OO-ON mNGN NO O OBUsGN OO-OD D6P CP-OP-]P(O# 5OAO^tO OOOyO PPP& )PU|T~Qv-O6P( :CP-OP-]P(O- 85OAO^tO OOOyO !PPP& )PU|T~Qv-OMD1 [DhDDU~T~7.9 ?777 7 7 >@K@W@U t>@k K@W@>@t K@W@x - ~  &   >@xK@W@ )$ ˈ ؈ Z~    $Z1~ > K Xx>Y>>>>`T Q~R X01j CPDr*D_4DJU}T Q 9H M KlK#K0KC Z Ċ K~K#K0KCҊ!J ׊    c  mIIIIIIIh>v>>>> ވT Q|X0 ވT Q|X0ވT Q|X0 LU}[EU}Tv Q0R0Y [_U}T ϑ~U~T  :U TsQ  \;UvT< U} \;T6 :.U TsQ  :`U TsQ :U TsQ R \X  :U TsQ  :U TsQ :U Ts]n on$BZ|nZn~ nZn~ nboto$ o oZo~ o oZo/o/oro92p 7p Dp3A AA3PB  bBoBUT pU}T  U}T|Q0R0 5U}T|Q~R _U}T|Q~R swU~ :U T} :U T} sU~:U T} A$ Z ,9L{ Q ^ k xKKK& K L L-[L-iL-wL-L-LCL-L-L-L-L-L {U~T@U2T@QC`  --_  ̈́ ڄ  CX  mIIIIIIIzsUT~Q :U TQ  :U T :2U TQ  :WU T :U TQ  :U T :U TQ  :U TQ  :DU TQ  :vU TQ  :U TQ  :U TQ  : U TQ  :>U TQ  :pU TQ  :U T :U TQ :U TQ  :U T :GU T  :fU  :U  :U  :U  :U  :U  : U  :?U  :^U  :}U :U  :U T :U  :U :U yv] ov&Zv~ vww w$ZwZw~ w wU}T~Q:U TQ  v)U}T~ xAU} L{YU}yU}|W|$UZ }~Z}~ &}9E} J} W} d} q} ~}c} } mIIIIIII ZU}T|Q~ 4U}T|Qs :U T 44U}T|Qs4U}T|Qs :zU T :U TQ8:U T]vn{kv لU}T}Q1 K6U}T}Q1 %ZU}T}Q1U}T}Q1 U}TsQ} qU}TsQ| U}TsQ} tU} ه&U}TsQ} KU}TsQ} oU}TsQ| lU}TsQ %U}TsQ} U}TsQ} KU}TsQ| F&U}TsQ|vU}T~ :gU T} :U T} :U T} >@p K@W@? &      % 2 ?r_ 9gD lK 0K#K0KpsT0KE 3GT 1H3QI 1bI9z  -`A rAB 5C@ @@!TsQ19 C 9k M <M1MMNUsD:U TsE 1E^M 1MM9  9v $// ZE kE1uE^#N 14N@NLNىC= >ΎT  ,$ 9 F S ^ k1 C1P9) . K K#K0KDJ*D_4DJU}T Q  :oU T :U TQ  LU} :U TQ [U}T| ϑ&U~T _ :XU TQ  \;uUsT3:U T:U TQ ssss EU~ ",U} DU} "\U}s :U TsQ \U}g:gegX+ +ioc5 w'Je ]rcP ) w P U  P U  P U  2P U  dP U  P U  XX+X 8X CXGO v fOsOYO$ O O OO>@K@W@ X-X+X& 8X CXD.+DMD6[DhDDU|MD>[DhDDU| QUsT? E U| F.UsT}  wSUsT  EkU| :U TvQ  WUsT@H$Q?:U TvQ  : U Tv :G U TvQ :U TvQ >  >U  X X+X 8X CX 6 UU :h U Ts Q  : U Ts Q  F UsTv  w UsT  : U Ts Q Rv :K U Ts Q  :} U Ts Q   UsTv :U Ts Br+iocB* wD] E] F] G]) out IP IU  MP MU  TP TU  / bP bU  a pP pU  wP wU  |P |U  P U  )P U  [P U  P U >@UK@W@>@uK@W@>@xSK@W@>@}K@W@ :U Tv :U Tv U~ L#UsT :HU Tv `U2 :U Tv >VUs U  :U Tv :U Tv :%U Tv r=Us UU~ :zU Tv WUsT@H$QD :U TvQ  >VUs֍ :U Tv֍ :LU Tv dU~s57+ioc5; wjG 7P 7U >@8K@W@:U Ts XG+!7Y+iocE w' 5 ]ji P U   P  U  ='P 'U >@sK@W@>@K@W@>@K@W@>@K@W@>@KK@W@>@K@W@>@K@W@ Ud :U Ts :U Ts Qv :DU Ts >VUsXi++Yl\+ioc: w'D 5*i*j ] ]  +Uv \CUsdUU#zi+ioc2 w "i 5*r*i  )  +P U  ]P U  P U $ ' KK#K0K *P U  \P U 1C1PD*D_4DJUsT Q  LUs[UsT| ϑ=U}T (# :oU Ts Q  :U Ts Q  :U Ts Q  \;UvT; :"U Ts Q  :TU Ts Q Us<ioc- w65 ]%ZiocZ; ws3+ioc3- w 5 65)n  g8P 8U  ;P ;U  AP AU $4 I' KIK#K0K1GbC1P :U Tv :U TvQ  LUs :U TvQ Us%ioc0 w  6r 5 5) xout& P U  P U  )P U  <  ' nP U   P  U !(P (U s" "+ioc2 w';5'D']  " 5$! 33333  !    1! !  mIIIIIII(!:G !UUUU# zZ&+iocZ- w\y]~*i^*r^ _  `5 a])n  #cP cU ; v# e' KeK#K0K$# ' KK#K0K$$*mfp |*i @$P U  r$P U  :$U T}:U T}Q|2$ $P U  %%P U nZ%qC%kU0C%CGC CC A0&UsTHQvRDX~YNs :o&U Ts Q  :&U Ts Q :U Ts Q R y.+ioc- w-~y    *r$)n  'P U  'P U $N( ' KK#K0K ( P  U ;3( ' KK#K0K ')BP BU  Y)EP EU  )IP IU  )LP LU y. -..$+ . .r. X~*X+X 8X CXWs+1W1W1W& W/W W(>W+5>A>U T Q2 XOX+X 8X CX +UsUsTv  :+U TvQ  :,U Ts Q Rv :9,U Ts :q,U Ts Q Rv :,U Ts Q  :,U Ts Q :U Ts Q Rv A?-UsT<Q~RDX}Y5s :~-U TvQ  :-U T| :-U T| :-U T| :.U Ts :D.U Ts Q :U Ts Q R %40ioc1 w: ]6rc) q /P U  =/P U  o/P U  /P U  /P U  0P U !P U z2+ioc. w'7 {  *r$)2  %1P U $1 ' KK#K0K 1P U ; 52 ' KK#K0K Aj2UvT<QRLXY5s :2U Tv Q R :U Tv Q X2+2Ej:+iocE? w'Fj:'F/o: H5 I*rcJ Ki)~ outwz 3MP MU  +4RP RU  ]4]P ]U $4 f'Kf4K#K0KpsT0;"86 g3 g3 g3 g3 g3 g 5 g g g 5 g! g mIgIIIIII j6mP mU ;&7 s3 s3 s3 s3 s3 s /7 s s s Q7 s! s mIsIIIIII$.8 v' KvK#K0K1d d8CPDh8*D_4DJUsT Q  8U~ M8UsT: 9U~ L+9Us[E9UsT ϑe9U@T :9U Ts Q  :9U Ts Q  4:9UsQ|R8 R :UsT0 :;:U Ts Q :U Ts Q #65wA+ioc9 w'wA'!|A 5 *rc i)Z out4w/ z;P U  ;P U  ; P  U $-= 3 3 3 3 3  <    < !  mI IIIIII _="P "U ;> (3 (3 (3 (3 (3 ( $> ( ( ( F> (! ( mI(IIIIII;/? +' K+K#K0K1 e?CPD/?*D_4DJUsT Q  ?U~ M@UsT:  @U~ L8@Us[R@UsT ϑr@U@T :@U Ts Q  4:@UsQvR; R@UsT0 :AU Ts Q  :HAU Ts Q :U Ts Q #8Q7}M+ioc}8 w'}A'~ 5'~'~&{'~1  "*i *mfp |jM BP U  BP U  BP U  .CP U  `CP U  CP U  CP U  CP U  (DP U  ZDP U >@DK@W@>@DK@W@TETT$E T T T3N>[> U :EU T Q RvX5:U TQ R 'X~>@;FK@W@>@}FK@W@>@FK@W@wUGUU$lG U U U3(>5>A>U T Q2 :GU T Q RsX5:U TQ R Xv>@HK@W@wU+I1U1U$H/U U U3(>5>A>U T Q2 :HU T Q RsX5:U TQ R X~>@mIK@W@PJQ Q$&J #Q 0Q =Q3(>5>A>U T Q2 :cJU T Q R|X5:U TQ R Xs>@JK@W@ QKUT5 QKUT5 wU>KUT wU[KUT5 :KU T Q  :KU T Q  :KU  :LU TQs2$ :/LU TQ  :[LU TQ  :LU TQ  :LU T Q  :LU T Q :U TQ XM+MPGO+iocP. w'P7 R S])2  MeP eU  MiP iU  ,NmP mU  XVNX+X& 8X CX>dN>U  :NU TXQ R| :%OU Q :U Ts % Pioc . w 6 F ]6r +)2 xout+ OP U  $PP U  VP&P &U  vP .+ .+ P8P 8U  P ;+ ;+!@P @U %Qioc: wC ]  ] ])  QP U !P U T+ioc5 w'> ]  ] ] ]) out RP U  RP U  SP U  8SP U (>S5>A>U T Q2 :SU Tv Q  SUvT  :!TU Tv Q R|X~ :_TU Tv Q R}Xs :TU Tv Q FUvT %wUioc4 w= ]  ] ])  HUP U !P U %{>Vioc{5 w{> }] } ] ~])  VP U !P U keAW+ioce, w*ig]szg]6regh 5jW VjP jU  WlP lU d@ lLWu@ @ :tWU TU# :U Tv|XW+W%G XiocG0 wG9]GH I] I ] J]{5]PXioc53 w5<6s7]6sc7 ]%2`ioc5 w   5 56sz]  ] ] (] ] ] ] 5 5  56i6ret6rc) qxout(q YP U  Y   Y   ZP U  7Z   iZP U  Z 5 5 Z 5 5 Z 5 5 Z  5  5 [ 5 5 ;[P U  m[4P 4U  [EP EU  [YP YU  \eP eU  5\uP uU  g\~P ~U  \ ] ] \  i \P U  \ * *i +]P U  K]  i }]P U  ]P U  ]  i ^P U  3^P U  S^  i s^  i ^P U  ^P U  _P U  ;_ P  U  m_P U  _P U  _P U  `P U ! P  U 4Sb+ioc42 w+sz4;*i6 7] 8 :j;1a@< <i`U~ $ &T@Q cacP cU iga a{gg&/g;?SbL?X?d?T Qv 1bU QvR@X0:U Ts %bioc> w])E !#P #U %cioc< wszE])c  1cP U  Dc ' vcP U !P U Xc+"c%Ydioc3 wsz<])  *dP U !P U %dioc7 wsz@])X  dP U !P U %eioc7 wsz@]6i6j 6ctrRf)X  eP U !P U %@iv>>>>ވX0h>`jv>>>>ވX0sssssss :kU T| :kU T| :kU T| :lU T| :*lU T| :OlU T| :U T| Q l~Xn+ioc~5 w Xn *Xn$l i;m i;Im iNJnNGN NO mO OBUsGN OO-Ose%boioc3 w O& # ] 6rc)  oP U  3oP U ! P  U %pioc+ w6sz  #6r6ix  }  }  })p xout 2pP U  Rp    i pP U !P U Xp+pzr+ioc3 w'Pr$}#} r*r  j qP U r{r1r1r$q/s s s/(s 4s :rU Ts :4rU Ts :YrU Ts :U Ts φrUsT}Q}s:U Ts  }|%MtiocM5 wnNr6rP6s1Qr6lenR]6pbS* T)  s_P _U  siP iU  skP kU !rP rU z ]v+ioc@ w#-/L 5*rcout=)  t$P $U  !u6P 6U  Su>P >U  ~uUsTQRD uUsTQLRDs :uU  :vU Ts Q R $X :U Ts Q R 6X <yvioc9 w%vioc1 w 6rww+ioc? w'I 5]}*r#} 5 qiwUUT}Q}s%` xioc`8 w b] c#6rd e5)M !oP oU z*y+ioc*5 w,w_~ -y .0y/#~*r0*i0 15 25)  y<P <U $?y E 5 E 5 eyUvT~Q~s:U Tv Q U\_zB{+ioc6 w^ B{ )G{#~*r*i 5 5)}  zP U $z  5  5 …{UvT~Qs:U Tv Q [z^z|+ioc7 w,^  | (|#~*r*i 5 5)X  O|P U $|  5  5 |UvT~Qs:U Tv Q {[]%w~iocwE w y& z#6rc{)i  } 3 3 3 3 3!  }   ! !  ~P U  J~P U  |~P U !P U !+ioc!; w'"5'"*dmd$5 $ 5 $5 %*sz&5 '(#) *5)G outj$y 1 1i3A1AA3PB  bBoBUT 3P 3U  ݀9P 9U  @P @U  AaP aU  scP cU %M07MDM& QML0L M& M $UvT NUvT~Q}R ȊrUvT~Q} sU} ȊUvT~Q}s :U Tv Q R 3X  :GU Tv Q R @X  :U Tv Q R 9X  :ƒU TsQ R~:U TsQR|<ioc8 w6i Z ])M  ] 3 3 3 3  ' '!8 8! 3 3 3 3 3!  <   ! !  P U  P U  P U  %P U  WP U  P U  P U  P U  P U  QP U  P U  P U  P U  P U  K P  U  }P U !P U %DiocD5 w F G H I6rJ J K] Li M  N5 N 5 O ') xout QP QU  TP TU  \P \U  HdP dU  [ l' wP wU  yP yU  Ҋ ~' s 3 3 3 3 3!  S   ! ! !P U h;C=&<HiocH5 w)  SP SU  CWP WU  u[P [U  _P _U  ٌgP gU  kP kU  =oP oU  osP sU  wP wU  Ӎ{P {U  P U  7P U  iP U  P U  ͎P U  P U  1P U  cP U  P U  ǏP U  P U  +P U  ]P U  P U  P U  P U  %P U  WP U  P U  P U  P U  P U  QP U  P U  P U  P U  P U  KP U  }P U  P U   P  U  $P $U  E(P (U  w,P ,U !2P 2U k7@u+ioc77 w'7@5 9! : 5>@@UK@W@U|TT k!*0ioc!; wU'!D5'"5 $! % 5 >@+K@W@k @+ioc 9 w' B5' 5 !  5>@K@W@U|TT k9+ioc7 w'@5'5 !  5>@֗K@W@UvTT k)+ioc0 w'95 p i $*mfp |1ʘCP_7km7z77& 7 7 >@K@W@_-UvTsQ~ϥڥ ?? @~& (DD@ؚ%@1@@%@1@MDh[DhDdDUU#EUvUvT~lN+ioc: w'C5 p ϥڥ ?? @U|TT k+ioc4 w'=5'5 p i $9*mfp |1CP3_7m7z77& 7 7 >@K@W@1ϥڥ ?1? @31& (D3D@u%@1@@%@1@MD[DhDdDUU#EU|kuXJ+iocu2 w'u;5'v5 xp y*ϥڥ ?? @U}TT k_Tq+ioc_0 w'_95'_C5 ap bjQϥڥ ?? @U|TT kB+iocB7 w'C5'C5 Ep F Gi*mfpH |1HPCP_7,Mm7z77 7 7 >@K@W@TD1& (Dd1D@%@1@@%@1@MD.1[DhDdDUU#EU~ _-hU~TsQU~T%-ioc-6 w-?56st/Wf<b.ŋ@Y<Rb5ŋY +! + +lO+ioc0 w'95 +*i$*st  i$m 'KYK#K0KpsT07& 9 _ R= c=ˏUsT|1 mCPO\i9uͨ v_ FFFGGDGG /I'r V t u5*tagv] v ]p=x=^= ==y==>6P6CP-OP-]PqUs}sR5+iocR/ w'R7 T+ U | V5),   X+ X+ 7[P [U ;a _ iD XDgNYȳyN-NNcN^N NyO bO& OBUsGN OO-OMDd[DhDDU}TvMDZV[DhDDU}Tv EnU}:U Ts Q %8ʵioc88 w9 V%(ioc. w V 6tag$]! *! *{ iUioc : w C]{ioc7 w@5{iioc3 w<5sgioc; wUD5Tsi!1ioc7 wU@5T{i^ioc4 w=5$+ioc$4 w & '] (]*i)*r) *rc) *{+ ,Mw -) w /P /U  ͸3P 3U  ;P ;U  1EP EU  c\P \U ;M ! !i B!5BB(B5B BB3PB bBoBT P U ; i ۺP U  P U ; 7 i iP U  P U AVȻ1A) =bH6  C  >@gK@W@Yp9k$9 x    rO +$` 8ZE %TA >Q:U T:U T94 9 FC  `U ~ $ &T@Q  &Z KE Ѿ GT 1H QI 1bIkTBQC!  C U  C   E&  Z   :U TX~@Q~R~X~k1 x k$ xs ɌT1Q1R1 MUsT0 M$UsT~Us :^U T :}U  :U T :U T :U T :U TQ~:U TAP f1AFvFF^GDGG3/IE?3A h A Av A 6U|T  NU| mU|Qs oU| UsT|T &Us Us Us &Uss 5UsΎ :gU T~ :U TQX} :U TQ~Rv =U| : U Ts :.U Ts :SU T :xU T~ :U Ts :U Ts :U TQ {iocF w ]6rc)  nP U   P  U   P  U !P U X+, Y+ioc 6 w )}   P  U k( x k xs? ? F4 FGG! H QI bI Uss:U Ts Q %@ ioc@ + w6rB 6iC  C D  E q )p  R P R U  4S P S U  T W  W  g P g U   }  } i                8 P  U  j P  U   P  U ! P  U % kioc 1 w6i!  ! "  # j ( ) !0 P 0 U  ioc 3 w< ioc A w   5  5< Mioc 3 w6cpu ]  ]  ]  &]6irq 1]  Mw    8)) q  z  '   %  %!8 %   i   ,K! P  U    i   i =6i ]  ]!  iK +iocK + w'K 3 M  N Mw*rO *qidO jpoutt ;S@Q  Q iAUT S P S U  o P o U F Z tFFGG DGG /I      FdFGG! H QI bI eFjsF GG I$I[U~ aUs[U~ aUs[U~ aUs[(U~ a@Us[TU~aUs 2%r cmdr 8 V<i ioci 7 wi Bi k <T !T iT *T 4T F]U  W !l%- ioc- 5 w. . )5. A V/ c 1 xoutF % ioc . w c 6 V @  ]  < ioc , w  V  5       !  .!          ]  ]    ]    ]!  ]  ]<7ioc. w75" Mw$3 i;] iΎ Us U~ U~%ioc: wk;+ioc- w Mw (Mw$ i$ i$ igNyN-N -UsQ ΎyC'y ['y- {Mw |$ ~ i U}  U} ы!UsU}%dirqdd i fMw6iocg wsHj'H+ O'H?]*iocJ w LMw M*qidNFPFGG! H QI bIFQ$F/F:F3F FGG3G  1G@K@W@>@eK@W@KFYF GQG H I>@:>K@W@KF=YF GQG H Ij1x&   ( z:G1CP &  $ 1 >C^n c :U T} R@X\;UT 2% F1#0&/ :U T} QX ^U}:U T} Q R |X >@6K@W@>@&K@W@KF YF GQG H I>@ K@W@KF"YF GQG H I>@K@W@ W U}Tv[U}TvQ|R0 W ?U}T[jU}TQ|R0 RU}T RU}Tv W U}T[U}TQ|R  U~ R3 U}TRU}T% ] {)] ])   P U ! h hX +  r) iocr8 w t]`Q ioc`6 w b]lOO; iocO8 wU Q*qidS3FVFF^GDGG3/I C [> U FA FGG! H QI bI+ioc* w'35*i 5 &*st3 & 9b _R= c=ˏUUTT %5ioc+ w456cmd V  ! ! ! %ioc+ w3C]   $ 5 xout)p    i P U ! '(sj+ioc+ w'45'=']  "$ 3 3 3 3 3  h     !  mIIIIIII(4:G PUU#dlTT <siocs2 ws;5sDt] v " w5 x]) !|P |U << ioc<, w<5]>f0?]}dwEf@YA]YB]YC]YD] G= HH)W !fP fU <ioc2 w  H 5)     P U  P U !P U    $ H"P "U  z&P &U !(P (U !3P 3U d<ioc, wE " 5 H 5 H)W  q !P U ; #wioc/ w ]),  P U  HP U !P U {1iocC wG  )A  P U !P U XA+)1l+ioc4 w'=5j P U d:U TU# QT l|+ioc|1 w'|:5j v~P ~U d:U TU# QT lfn+iocf4 w h+*wqi `  k+ k+;\*_wqq `ԐU|D kDMDn[DhDDUv EUv UsC+iocC5 w E+) $ MK 36PMCP-OP-]P TP TU   W+ W+DWIDCY!C-C:C U @QsR ,MD\[DhDdDUU# ܒ'UsQ@A$R0X0 XUvTDQ Rs U T Q1Rv EU|d:U TU# Q R TR+',^*ioc w + ]*rc*p'w4) $ i  + + P U   + +$*__k'}MiM ^U T}Q R Xs~G P U   P U $"  i P U   + + P U    +  +MD%![DhDDU|!  !q!U} !U}U} :!U T~Q  F!U}Tv  E "U| ) ""U} ; :"U} :l"U T~Q EU| "P U  "P U  #P U  I##P #U  {#'P 'U  # 3+ 3+D#DC65$!C-C:C U @QsR ,MD9$[DhDdDUU#MD$[DhDDU|Tv X )%X+X& 8X CXR+1(`+$m( m+ z+ + + + +r+r+1%CPCB,'j& G, KK#K0KqC&kU0D&*D_4DJUsT Q CU'C^C CC m'U L'U}['U}T~ ϑ'UsT 'U 4:'U}QvR; R(U}T0 :J(U Ts~Q :U Ts~ :(U Ts~Q  :(U Ts~Q@:U Ts~Q  X!S)X+X& 8X CX Ek)U| E)U| R)U}T0 :)U Tv E)U| ; )U}[ *U}: :I*U T~Q  :{*U T~Q  *U}Tv  :*U T~Q  F*U}Tv  :#+U T~Q :U T~Q <u ,iocuA w w, x, y5 z  {{ |) xoutq ,P U  B,P U  U, ' ,P U  ,P U !P U J !` 0_-+arg`/i*iocb w c4  5+ioc7 w' i'5   ] ] *i5 i  i  5 5    V  jpqP$'/ $E/  w/P U $/ & $/ & 6061'6& 46 A636p1666& 6 6 750515& 5 55 e1,595& F5 S5 ^5:s7- 27,797 F7 Q7 >@)K@W@6t26166& 6 6 7O62a61n6{6& 6 6 67"}37,797& F7 Q7 >@)K@W@q?!"4?? 3?3? ?4= 54E=7S47,7197& F7 Q7 >@)K@W@a ˏ4UsTsi5+%i5iocD w 56j 56ctRf)5 !P U X5+*5%6ioc4 w=5 5 %liO6iocl/ wl85 n5 pi%R6iocR. wR75S U U V5%8i7ioc8) w8259 ;i ;i <5<#_7#&isrc#7i#@]6i% & 5<7"isrc3i<]6i  5K77ioc6 w4?]4] 5 i] f8!UGd@ u@ @]"8+Ui] ]Gd@ u@ @]9&Ui] ]Gd@ u@ @E4:7val&G7kpF5trettioc w)  :?P ?U  %:Ri!RiS<;ioc8 wisz%jM :?P ?U  :!;U TU# \;UsTv%\;']W=isz'imfp |j€ <?P ?U  9<?P ?U  k<?P ?U  <?P ?U  :<U  :<U  :<U d:U E]4=7cmd7 VE#R=7cmdA VEip=7cmd5 VE)=4@ V%=8P%)=pdu8i% 5= 0]%5>0]Ke(>4e(]KKN>7minK/+7maxKB+K8h>482+< >dev 5 A'  i % i>dev 7 C' gfp !%fG?f:<a;?a4a@iE4iq?446|44B45%i?sg1E?7sg8%i?E?%2?22Kb@7valb{4bŋKG>@7valG]4GŋKCd@7valC]4CŋE;]@4;@tret;]̋% [@irq [(]m [C8)% L@irq L']m LB8)E 7A7irq ]4 -4 D+4 G7dev i<`Adev3>i%Adev.%pGAdevp9%"Ares"DE#WGA4#W>% %i B ;' G%(iPBnD'N'Z  '%|.iB|D'|P! ]%%]B<'!8%z0BzCzX+E F%8)C4 F9%HCwq@ ` +< qC 4^ >UEoC7kt-EoC7kt-7div5o!R!R%&+CmJd%+DmBdKTMD7xT7M!?WK < D @Y T+! + +< D 5Y< ]D ]3Y% D(XD DCYB+EX+B'EXQ +)EXB;EX R%]E]E7n488)E%]E4I8)E%]E7cpu@]KE7cpu<]4N]%o Fiov( F$%FFvFFa$u+<NeFvNFF<FvFFKAF7vAFF7iAEF7vF% oFi ov , F% Gv !FFa (u /%u ^Gvu 'FFau .uu 56cz %OGvO"FFoldO*3)newO3<GvFF<GvFF<GvFFi!% Hv!FE MoAH7i M9o7v MH F!R O oEiH7vi?FF7oldiG3)7newiP!Rk Rk 3)Rk Rk HRk H HRk H HRk H!Rk H#FiK:I7v:7FFK3/I7v37FFKQI7v7FF7i>EmI7v=F{#K#:$3%3&3'3( I8U I8U I8U J8U J8U jJ -J8US =J8US MJ8US ]J8US!8US yJ8W J8W J8W J8W J8W! J8WS J8WS J8WS J8WS!8WS{K:33 LK8 [K8 jK8 yK8 K8! K8S K8S K8S K8S!8S"L7pAL4TR3R3tret ' [Lt__pHR'R3!R' iLh wLh Lh Lh Lh! LhS LhS LhS LhS!hS%#'%M3'C'  '% #'_M 3' C'   'E3!}M43<E%A!M7ptr%A<E!+M4!3Y4!G+!tval!+E!U+#N4!U6Y4!VY4!V-+4!W+!tval!Z+E!8+gN4!82Y4!8F+4!9+!tval!<+% sN s6N!8 u X% jN j8N jVNK N4 /]K N4 7]K (O4 2]4 K]!h K NO7new 4]4 K]K tO7new /]4 F]K O7new 1]4 ]4 ]!h E jO4 jF]tret l!R o]R p]E A6P7new A@]4 B]4 C]tret EK #hP4 #5] ]Ph %!h &$GK^P7v^O@4^Y'KPP7vPJ@4PT'KBP7vBI@4BS'E&+P4B+K,Q7ptr<@4H'4E,TQ7p,;@4,K]E(|Q7p(:@4(J]X'Q}UTTF$Q X%ReUeT@ o  wUSUU U U U(>)S5>A>U T Q2 :gSU T~ Q R|Xs:U T~ Q RvX}WTWWW W W W(>WcT5>A>U T Q2 XOX+X 8X CXXA DUAA3PB  bBoBdUUTT !X<VJWdq~/<yVJWdq~& [SVU|TREJ$!QQvVT YF$!QXUT  X)ZeU(5eBXeOY/\ kY(5BO& \ X&  X&  X& 3 &     o  Xn*`Ze|UeT 9[99 9/99O[99/9 9D [1D)EC:F[ :C%:m[ &:yD[1DE:U UUTTXʵb^ܵ9 #\ E \EF3F FF3 H H(Hc2H 3HQ  M]c p & } _    ʵܵc p=$ ^=G= ==& F^>qUT X`%2?LYfs//////////// )3%2?LYfs&/            /){` UgtX BbaB(B5B/BB5B PB  1bBoBdUUTT X3d 2sb& 9b _ R= Rbc=ˏUsTT -!d&/3ʵ 5 ܵ9 b E cEF3F FF3 H H(Hc2H 3H3Q  c p & } _   UsXEh=Ad=E!8e ECEF F FF H  H(Hc2H 3H3ʵG ܵ9  f ʵgܵc p=$ f=G= ==& g>qUv}E gEF3F FF3 H H(Hc2H 3H3Q  c p & } _   i >@hK@W@ :hU Ts Q  iUsTv  :JiU Q  FliUsTv  :iU U T wj/ w_j//:U Ts QvR0 W~jUsT@J$:U Ts QvR|j/Eh) RFk6  C  >@gK@1W@ >k    >@xK@1W@XkeUXk;?lx3k xsX1$ileCUePTX%leUXU&legUtX()le:UGXOJne\UeiT9uMm v_ FFFGGDGG /IhP}"Kr1CKrr Pc^r_Zg t9s/Cr  [rUvrU}T|Q2 8sU|T0>U}T|ZsI++G+SILIXpIIIIintX,I*IKs8dKu8w Ks16Ku16'Ks328Ku32Ks64Ku64{X&  I +  1X 2X H I X ] ^ _ `LII $ & ( <X  I j    #I % & 4 = B ^+ h8 m' nI } U a a a X X a w-   -  U        E  E E JEL_+0   _+W8          !\+H * G   "   Ű( %0 8 @ h#H h#H h#H #H h#H h#H h#H h#H:@H YPhoGG X5=kp X(X,0 8@ABXD HPcmem@X+ X '(0X8@XHXL!PXX&`Xh+p xXX%5XDXX% X!%"X%&(9X:N?AD &F P X QX(T%0 ;~ Ecs=aEsl?aEwfeAa E EssGaEstiIa8KaEnmiMa8Pa 8Sa08Va8ElmXa98]a:8da<+C Fcs'FcsxaH +p Fss'Fssxa~ gv r15m+ r14n+ r13o+ r12p+ bpq+ bxr+( r11u+0 r10v+8 r9w+@ r8x+H axy+P cxz+X dx{+` si|+h di}+p+x ip+& + sp+&C B. C'D'8E' 8E'(EsE',EdplE'-EpE''/8F'0EavlF'4ElF'5EdF'6EgF%'78F+'8+++++- pte. "j - pmd: " % %%^ %/ d' "pgd'R '" dp "pudpF p"380@H{I+A.g&Wg0 4+8+ef+gh uv8w8 keyx UV &{j+"keyknH"keyo ;<=8? X 8@ X$8A X(8B X+:-@ d04XX  8( X,!X0( 4)18*XH++P,dX5 `6 d8 h: l; p< t=XxMse?.D@=rt@EcdlA-FB(FFH;I&6J+KXOHXH]H;`"B@dhXkX l+m nH oH(p)0q Xs`ubx dyIHhzp{H+      IH A5(;&6P=mm h pIx    +X  X,  X,  X,  X-  X-  X-  X-  X-  X-  X-  X-  X-  X -  X -  X -  X - "X -+3=pid  +d dd(0@XJP]JX "J% ( + - a. a3 a4@6A: (=+0>+8A a@D aHG+PH+XK>`;N?TKWKZK^Lk p0mLp4 q 5(t+8u+@=fsxLH{MP~MXM`Ph Qp 9x 9 9<+ X Q @Xj8v= a  a 5 # mH |6( d8 Q@  H DQP QX Q` MRh WRp +x \R => X  a  a  a 8 ,@  fR   I  I "pR )R    R0  58  XX R\ R` 5h  R       !X "X # $+ & a ' a ( a ;)_ 3R C% D+ LR N+ RR SI( TI, Y+0 ] 8 ^ < _ @ ` D ;a_H d>X gS i= lS w x z+ } ~S  a a  %  +X)S3SwUU X(X,H0crcu_08@ DdH8PUx8  "V  VV  a    >;_ !"1$"1;._<V;Fy@@ y+?:@@ 0"sp+"es "ds"$&+(+008+X+`"cr2+h+p+x1+ XI++ H0Mfpu /@X (   w) :@@ !An@@r@   !!2-"A l  &(l (,vl0,Ml8Xlh%ymp+xk ~m)Rmk?V"  ?z"''+"Fval 72"7V" "&z","?" " "++ # 7"  *#&"" #   c#  c#p rr  #"x# $# X+, k$"fmt G G G X G G$$!6$!7!8+08!%!G!G!G!G!X!X!4X key!9p$(6X!=9% 8!U%!V mod!W%!XG!Y% !Z (![ ,!\%0*G !u%!v%!w%!xX!yX$9%+L &+ "/O&"1X set"3& get"5?"7 2 &e3(% ߨ  %  ( 08!@" H# P$ X%`&0h'Ip(0x)l*+,ڪ-ߪ./ 0 /1 2a3 5 G9 t; >l?Ĭ@T& #!z(#% #+ #-#/ $ ($!8 key$"8+$?($A+$B($C((z( $=)$>&(6X3w)     +)+ ; )?) )+% {X'h*      0(c*(dG(e(g.(i L(lQ &(h* )*)a end)a* *  p++ cwd+I swd+I twd+I fip+I fcs+I foo+I fos+I+++IlI++?+*+ rip++a rdp+,a?+.+ fip+/I fcs+0I foo+1I fos+2I ++),7+7++0+@1,+A1,+B1,IA,+ N+$, cwd+%' swd+&' twd+'' fop+('&++5I+6I+9, +<,+>1,l,I,+I,+? +Q- cwd+RI swd+SI twd+TI fip+UI fcs+VI foo+WI fos+XI+Z++[ l+\ m+] n+^ o rm+_ p+` q+a-x+bI;# -+a-+@+:..+; a+< a+= ..a>.+:@@+O{.,+PA,+Q-+R{.@ .>+@+^.)+_+<+`A,)+a,<+b>.@)+c. .|+:@@+f/+hX+kX+na+qa"xfd+ta +wX +zX +X +X,+.@@+/+ a+X+X fpu@+C0+X+++C0+C0+/ +/0,+.@@. , p0, a,aL0+L0+? -0- -! -" -#u0v 0+00+010 .[1.X.X.G.G.G/// 081091 0<10=11+1<11=X1>  1:21;1&1 src1A' dst1A '"2-26X2P2-(2222 val2 I2!I 2"I2#a2$2 I+2*22+&22,#2 323X3 82-2'832(2)-2&22.a- 2132232324 25+26+ 4$3 fd4%4&4'3+(232%P22/32783 8242+ fn2 +4&3&4&434 5>r45?+5@+5AI cpu5CI 646a6a0(64Bct6 16&4 r46X74 858 55 9 ;59 : V5: +;l5;x# ;5&V5;l5-< 5<*#<"5 =)5=*)=+# osq=-;5 =/ (> &6> > >0?\6?+?\6?\6&6 ? |6? \6 ?6?a6?\60 @6G@ &6@ / @ 6@|66XA 70@A'~7GA(6A) / A*7(A+80A, 8A- 9A. :A/ ;6777~70@@B/8B0B1XB2  seqB3@B47B56 B6ˉ0B7 /87 (CU8C C+C e8CI `8`88U8 D8DD D88-E 8E8+8+E88 F8F F8 G++9G,G- xHm9Hm9HX`H+h maxH+p+}9+ -I 9 sigI8I}9JRJS99JU+JV99sK:K K K 9-K'0:K(K)-K-n:K.K/K0 :K1-K5:K6K7K8 :- K<:K=K>K?K@KA-KS;KT %KUKV- KY?;KZ %K[ -K^p;K_+K` Ka +KJ;KLKQ KW:K\;Kb?;- KE;KF&p;-Kg;Kh _fdKi-Km(<KnKoKpX s K%<K* :K20:F_rtK9n:KB:Kd;Kj;Kq;?0L <L L L L (< 0L <&<L<< L =L!L" 9 L%\=L'9L(+L.9L0 9 L3v= saL4= M =M 'M + lenM +M  (N=N  O$>O%3O'O( 0OD=>OM#=OP(OW) 8P >PaPaPaPaPa P#a(P,a0 Q)>Q*aQ+6 PQ8?Q9?Q:XHQ;XL>?+08QDJ?GQE_QF5QGX00 R>?RKRZRpRRR endR?L?>+ S!?S" XS&? SD@SD?SD? SE,@SE?SE@-ST \@SY,@SZ 5S[8@-T @ valTT h@-T @ valT T @S@U aV aW#@X[A0hAi?jk@"cpulXmana oa( A+A+ I2@@B a a a I I+ +(+0X8:@.D a a a a a  a( a0 a8 U@ aH aP UX U` ah ap ax  a  a  a  a a a a a a a a a a:@EA, &6! a(" a0# a8%@&P'Q(R)S, aX- a`. ah/ ap0 Ux1 a3 a6 7E9E;E=+MavgGA@.DE0KFLM+N+OX P$Q&SF(E]FF(F(F-F2`G,a&6h ai a j a(k a0l a8s U@t aHuXP X X X X X X X X,7X,7"rqGFG(F^GGdG(F}rqGHHX HX HXHXdIH    tmHubHusIHHmHrHHHGH+))H2I{ui[ _@ D H|6P+` +h)p+x 5i[ HvpidpU7XJU9 8U:XU; 5U<x inoU=aU?U U@@UBZHBrcuUC_`UDepImJ+ JX[mJ0VoKVp) uidVq @ gidVr @ Vs @Vt @Vu @Vv @Vw @ Vx @$Vy X(Vz0V{8V|@V}HV~PVXVL`VLhVLpVLxV VV'rV<VAJKvkeyWLW8W8AȆW semWi[(WćPW X&`W h uidW @p gidW @tWDxW|W~W W+&V&WɇKLLM MMNXX^PX_8X` XaXb XcXeZ Xhd8Xk<@XnXXq`XsdXtdhXwpXxXtXz4xXXXXXXXXGX7X / itX9XX>XIhX XXJXQttyX^XhX \@XaX aXaXaXaXaX@X+X+X+X'+X+ X+(X"+0X,+8X+@X+HX"+PX,+XX+`X+hX=>pXXmXXX XXXXXX X5Xi[0 MX XQX5X8XZX PQQYDQYYQ@ZQZoZ oZ a Z (Z*Z,Z-Z0IQQ X[cMR[d)[e [g [k 5[mu[n([o0[qB\8QRR<aRkR \R\E\-\9uRR R+RRR+R+J?S S+9$S+$S.SX0ZwUZZZZ/ Z,Z.Zu0Z @Z({HZPZXZL`ZZ+Z5Z XQbdiZ Z3(ZhZpZZ QevZZXZXZXZ%ZXZ5ZZmZZB\Z\QcdiZZQbbZZp#ZaZ _ Z((8S0h]yU]za]|X]}cAjb]b(]80]+X]#c`|UUUVVV^^^^!^%^'^,^/5^3^5^9^<^A^D^H^L^Q^U^YBW _wW___ _ W_!_" &8_$X H_'#X_(G key_)+_*#X_+ _,(_-0_. (X8 ext_/-X@(BWwW_30 _8X tp_9X_: _;I_<IW38 `Y`I` `X` # `a`a ino`)a dev`* v(`+ v, uid`, @0 gid`- @4`. 8`/@`0P`1``2p`3a`4a`5I`6I`7a`8a`9I`:I`;IY+a !Z (aGZaXa aGZa aSZXZvZvZXZ a#Za$5a%a' {ZCb5CbCb cZc 8d~e e"[+e6[e5e[ ed[&[eXe (f0[f1)f7) osqf9;5f;#f<CfCfCfCfCf g+!\g,#g-h -\2\=\=\B\ hw\h)hh!\ Xiq\irB\is8 wqiv\H cpuiwP\ xj#]jj#]j3]( lenj)HjC]Pj p\3]++C]+S]+N@k.^k.^k.^k Gk5@@k \Hk!+k"+k#k$8k%B\k&_ k'^0k(+8Qcpuk*@Qsspk+^H)>^+ `k6^k75k83]k:3](k;+Hk<^Pk=Xk>\>^ ke^kfX sdakgB`khp#kiG`^XxkD2`kE^kF2`kH kI5(kJ5HkK5PkL+pkM+xkN+kO+kP+kQ+kR+kS+kTkU+kV5kWmJkY k\+k]+k^w\k_^p^B`+S]^l+m|`m-m--m"`m#8m$ m% -m'`m( m) -m+`m, m- +m!#am&|`m*`m.` mJa&Z` opsmTa&`JaOa m2am4+m6Xm7X 6X]@a6X]Ha ]pb]qa]r]sbb?]Cb]Ya]+]jbG]_]+Y]b7bCb0@]c]a]+]+]+ ] (],]c0Brcu]_8]4cHb#a ]4c] id] cCc>+ ]^c]cc^c (ncn#nUnn -o Cdoao& o)i[ ldto*Hd8o.+@o95Ho:ho;Wepo= xoC'|oD~Cd p Repp+ altp+p+p+ p+(p0p8p@pHpPpXp`phpppxpp p!MdReoFc?\e^ `X+XeFlruY7hede+iej +k+?(Rf&ehI&es+ ?(u[fz+ pp{`f|+}+~) [f?|f+?f)g  q)gqs refqW8qmJHqhqXlq+p opsq xqq&fY(QWg7e7f7ef7|f]_+ygX d g"val+ygTMgN PXLJgulruK7gLWh)X )YgT@GshI+&gUIV + &g([ 0\ 4^+8^@Fh7h<j8T(mhn+o+q r s t vX ^@li7h<z8T0}{i~++     (T i++^@|i7i7{i<82DiAshAh@Ai+i2 k ’ 5 k  I  {(X0X4K8ȁ@&P p  x#h$ % 'mA( j j5Z@?(XkYi[(\kb+h+t7w }$T l++^(l7k<_LMl)j)i vlMrb&6+qk{lrbtmrc erh erj~rkrq rs`(rt0ru8rw@r{`Hr~`Pr(Xr<`rUhrsprxltmFkkma"cid @@ m d n+ )S@@qAm@6[@+P+X+`+h+p"pgd  !x) 5 ?qE+LXS Z#])_a5pi[r+++++ +(+0+8?@5D+H+P'+X3+`+h=brk+p!+x++%+0+qr@r\e+h5p"rxd'rk&1r++  Cc)B\;r++) mm+r+3hcr+rrX,r6r+Or>+ Xarpr/r&0r7r("pmdr9 !0"pudr; -"8&5@rE3HrF3P"pterL !X"ptlrPV`rT &h@XQs @fffffCs6Cs9Cs<CsG 8qsq+q2q2q+q+ q+(q0s\s@@ t9tttt uftuu >t+uBtuDtuEtuFuuGuuHNuuI9tft vtv 3v!Xv"X ttu uw,Nuw- 5w/ _w0u?uApu&ktuK +u:uu@t7Su+uNuuO+uP uQ  (u+vu, u-u.u/ &pu&u 0ppvqkr s .t u v'$&ۜ(vu x"vx#v x&vx'vx' vvv?yvy5y Yyw]y7v0ywAv?z3?wz4I lenz4I+z2Zw7wz6a z1{w&?wz8Zw+ziwzjzkwZzrwzsztv]zu_0zRxzTXzU,@zVvzWxzXZw zY{0z[{8z_"|`z`|hza+pzbxGzdw&wzmznBd_uzvwww:x{{| }~ @ @X ! |(I0 8+@&H vL P X ` hIpItIxI|5 v GIi[++'' Ҡ0@H P T X \l` h;Hp8l2H P(X `*h px{+'0@z|zzzՀzz z%(z 50z 58z J@z hHzPzXz,`{|:@| v+  (!m0!r8w@"H+P+X+`xhi[p &#$Ǧ̦zv    k   X T(;` I!I"*/ /0 1 4 ?6X<5 BG@D"|HFePI)XL`O dR\hSpZ'rxaybycrcuc_dB\f5k0;n5@@oHq5Xr`|6XzxXˀˀЀxZwˀXG{wڀˀ%x5x*Jx{:'hx'O {E{Fx{G|{H{IÁmȁ | mnt| | xȁx,x }"}#_ nid}&}-+}4+}7)S0}RQ}So}Uo}X}Y}Z X}c 8 }dmJ(Brcu}e_H}gX}j` id}mp}pt}qGx}rx}ut+eej1Q) 0~3ǃ~4%~6~7~8  xa~9u ~~ ~" ~$50@@~-% lru~/ǃ~0)  U2P nrU3 nsU4P4e+*t>+- valat6X   C .3+.W W#0WlBrcuWm_Wn8Wo ?WvWx'Wy O+WuÅ7FxW+ (Wr Wt+&WWWG   Ps WEWW JZ+WfkLLE WȆWZ keyWLWYWW]W&6+W W W ?(WVW+W+WWW ' +(WqWÅ7 T WWW L W)W7q Q 8hc+0)8@ uid @P)X `$#h VV 8V gidV @>+YVVrcuV_·QN@@BgBh# cpuBiXBjXBkX 8BlX8BmX8BnX8BoX8BpXBrXBsBtBuXB{ / B|7(B} /0B~78GBЉ@@ˆ\/Ɖ_7@+\=+? 8XZX X! X"+X#aX#a X$+(X$+0 X'X(aX)a X0X1 X2 X3  XCҊXD XLXMdXNҊ 8XQ4XR XSҊXTmJZI+XJY+Yc9}+} d00ZG_ 0` @Brss  08Z@ X  g fn 2 arg ww+- bgw I+[Sƌ[T[UY[W[X][Y_08[I( q[J ioc[KMR&Aƌ [\X0:ZZ ZZZZ+ ZX(ZX,Z80ZX4Zu8ZWHZh#XZp#XZh#XZp#XZXZ5`ZdZwUhZpZx=devZ(Zw0Z 4Z8Z@Z5H=idZ hZ+pZxZZ8ZB\Z ZXZZ 8Z!.Z"Z#5Z&0Z(54Z)8Z*w\HZ-b=fqZ2lZ3Z55Z65Z75Z= Z>50Z@4=tdZDv8;ZF_@ZKZPZP5hZRjZSZUxZVxZWxZ[5Z] (- val- / val<GRRW in+v08_`)ab8c 8d Brcue_ reffR0;- v +%@XTRh++ nR6 -. ’0 4 45X67,+"'+S @ +u @ / PX &1&S  (8 kHБ()*+ ,0-5@. 5`/ d0|h16p2 x3+4W- ͔ val 6X6B+E6FuidF @FgidG @H ͔ DW&Jٔ Hڕ      ( 0 8 @ H]+ X(X, 0 8@ !O%]@8(9A:A;A<A=U >U(?U0@s8A|-UFn|n6ZXD!EUF:G JHUIU JU(KA0N c8O@QHSsPx:|&J?^^{O|{|͔h{^xYZ[a\a]a^a _a(`a0aU8cU@dHeLfaPgaXha`iUhjp8)XXXX XXX"ino  G( G0TXTd+ XXX XXXXXAțțA (0,8@JHțP|ț|X|d͛ |6 ,|n E|E)1(e8  X i[ 0 H=ops!˜ {+ڕ˜+Oۜ+Lw)})  .pvZ} ͞ (K0 d8 ~@ H P X`h p 4xMz 3s3sx_kiIs͞IݞݞҞkIXd[KkIXX;dI;P~i_pvuvIş///MI9kkkup;RkpvuvZLҠ)_)X^)<_L)!) -3(-{"Lq)S)v) ') Xq{:@Z[\#]A^_`} b(dí0eܭ8f@h"HjܭPkJXmw`ohpǮpr xsu+vSyv{}߯;%(k 5"pidXJ4"uid @@ $  +XX XX L ()5) a^ )h<*_)+1),)- />+P:0פ  ,פ_+-hs - -  ( -0 Ű8A@ްHPްX`h3p ŰxLLLL t  α α Űh!|¦ΒN) * ;+ ;,wU-.@ /+(0 09 v4:I8< @=5D> H? P@XA5`BCE F5HIK GQѦ%L?+LO+$\aGaX O"pos  Xߨkƨk't%kGtCpvCXH ZZoZZ b*k^k %&OC' ^kX+k!0{kIk5lkNkqk+ڪk++++3WSktX/ktSX RkRd[W\4kfk x-G buf-'- - - -  - (- 0-58 op-2;X-`-7;h-ptkkXLkkXyXCXɬx{xXGx{@A{(_{F}x'd{xíx{xܭ{xȭ{xG"{xJ{xv'w{x{xXOxu|®®IXXx'̮{aa +{S{xkX0v{kXx{xկxկگxկ '"mt 6[ +66{'@Xd{s|d{x{s{Ű|ް|@ʰ| x 3| 'Lx8t|'Q|Gy{α|jӱxGh#3+ @@AGBCD E( sdF0GZ8IXJXKXLXMX33vbio-  v G &4$8 @.HPaX8` Bhpr  t Gx* 8. I\b\9 znb <+a6A rev+< a0  GBrb&6 ns0X8< >&<@ ida` hopBrcu_xa c ops-!7 h(L \"u$ % & (( 02 89@: H= P@XA 4`c(2+ jFdirF!j 8 knk 5 5@`h 'x    @  A %ymGGt8\GQuatztG'Ƹ^GG!4G6X\ 0'(9) s* ¹+, - 2(\\ֹֹ۹ǹ\ ((G( +(m9(nٺ(o&X(0Ժ(1(2 (3 (4[ (5 ((7 0(9 8(; @(= ݻH(?P9޺9Ժ  .L3 \IVk޺'`k'ݻkk!(0( N( qN '5q GS ` 53 Xv 0tu .v3w!8x*[yo z (.#0=*QQVBoV`Vt ttX }~Qbuf '+'+?L|+ G`y[VL[GtVetV~GG! ("E!"FG mod"G% ops"H!"I 3"J"K &D ?'++"LrFarg"M Fstr"NFarr"O "V"WX"X'r "\ max"^X"_X num"`  ops"a!"bO&00(G)_&60+  X+  X   HL+7 `-.3 mod/%@0H mp1P2JX 85V67 y9 ; <(= 0oot'VotG~%G%%@X>28E1"modF%,G2PpqrstXMmtnw  X''DĄ_1+8( 2X^>X:0I?S$0 @ endG++ (0&8]6XqE qN<qT LqZ`qeL3AOr`\rQ)g++e~q?qqq*>++qq*7<T(r00"vmar1!r2 _r3 +r4+r5+ Lr>Z)r? )r@ e!Z~!+j!!+++Or\rXOr\r+++!(!+G<!-U!RARs!+%Z3!+x6X0vMvN ;vPXvRX vTXL +/ (\+++++ 00Brcu1_2Z3 >+ HIJK LM+N@r \:3@"p8HGPQX"bus`h p x5,E=BL =msi%([8`@aHaPoX t`h~x $ v=idI5 !!8# r$% '#) + ` , a - b . c / d 9 e < f :;<Nb  r!b"b#b $b(%b0&b8'b@(bH)bP*bX+b`,bh-bp.bx/b0b1b2b3b4b5bbSrg@U@XlHx;y 5zX|X}5~0@@;:8H  H !H "H #H $H %H &H 'H (H )I5 mJ @  @  A  B  C  D  E,7PaB\Z   X                           Xwwaaaa  (=qos0 +,G id-./5 0(1802+X3 /`4 /h5 /p6 /x7 /8+9+:+;+<+ dev=> ? 88"opsb Hb r raH8aXM MwNGOGP!8Q!8R!8 T(U0Vb8W r@X rHY rP[bX\b`^h_bpabxcbd r pmfhf `aG busbd%eGg hV$j(k0mb8n r@obHp rPqXrb`s!8ht!8p pmvxw r py|Nw `23G5!86!889 ; (< r0>b8@(Q@AHC P pmEX't t 0XLYGZ!8[\ L^ r pm`(L6X-yȦ// @y  idgt cls 'Lt t.XX+@X@X8% 0P!s"UP@X1@XB@XOc3d&Ze2f4g "lidh 3GQVaejQ}cmay @/0 ops1" dev456(7 80;; ZCZD .ZI >ZNRZSRE eZAZB?ZCi%`  aX+$ X$)3=teYnYoYpXYu#Yw Yx `Yz Y{ Y~X8Y5<YQ@YB\PY\pYxLt,>+8L_Xh H 5 d[ (Z0,Lh @jk lenl wpmnwowpwqwrs t(w+w+0@!+G&+@@+#H 4@8X=XBXG mapL@T 0@@]aaZ @m sbqwX | $ ws( 0X4 8 <E6Zm Zt_ZuZvZwZxZyZzZ} XZvZ ZZZ Z( Z((ZA0Z 8Zd@Z}HZ PZ XZ`Z hZpZ%xZZ kvhHZZ3Z @ZXDZ&HZ  XZ] XZh`ZiZjZk+Zl+ZnXZoXZpX ZqX$ZrX(ZsX,ZtX0ZuX4ZvX8ZwX<ZxX@ZyXDZzXHZ{XLZ|XPZ}XTZ~XXZX\ZX`ZXdZXhZXlZXpZXtZXxZX|ZXZXZXZZZZXZXZXZXZZmrXPZZ3Z ;@Z ;H>+,0*: *B *J*O * T *(X+0]+8b/+@g ?+Hn]+Pr r+X{+` +h ?+p +x + +Nf qghi)k l& tagn o$qX(tX,u ;0 biow8x@& 'H Xa`ahapxz|~8)& ref +&.'AP' elvq''a'XXXXaaP"rqs++ 5]gqj"ops"map.*X8 X< X@ XD XH LXPXT X>*`Xh5p^{ZZZ@XZ0CXwU_wU( _X+ XAwUX-Z Z_F} i +wU;X`'wUwU6#wUu. > 3R CbCWCj_+ (,--.. //0t1 L +L+S++S@+0EC6X  get2 put B Vo V ( 08@HPX(`Ahsp(x2 QRX idSXT Pf#ghXi-2#B7VGo[\tGGXG%G(AG-nGGXXnFxX hL+ busMNOP Q3(: (8@RPp]"opsM J cdev޺޺ X X + X""(565"len7X "cap8 $LA)F)A:` JK"busLMO  PJ(Q0SX8T<U>V@WBXXDY HZ I\'J]P`Xa`cIhd le mf n g xh p"pini qj'rk%xmnatQvy  zX( |X- }X. ~X/ X0 X1 X2 X3 X4 X5 X6 X7 X8 X9 X: X; X<XX' X X XMdev=irqX]@ XB X B X B X B X B X B XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB X B X!B X"B X#B X$B X%B X&B X'B X(B X)B X*B X+B X,B X-B X.B X/BF H 5LP X@M' X`M XaM   # =vpd ' XPO   l '   ' I X`P '  '  u '0  2 =romw8  @ GH  +P #X KeG     %( 0 >8 >@ RH#WP!8X!8`h]+I+޺+ +(M q! "#$ b+qbvXX2XI;<5=H X8_aehk l o (r 0,%>*IRC  + XX  SXX ' sgl()X*X \GKU8( KU16):KU32*FU64+RX 048<@HLlptx|++++ ++ 1E   !R)*+, - . /5k678 9:; <BCDEFG H IxR/STU VW^e/gk)l E)m )n()o-k)p.)q1/)r,<)tI<u#4xV67 89: ;<=> ? @ A BDH"DevIJKLMtO')P)QRtX)u<v#2 rsMuw44xX)<#2  Mu4b3cde2h,i#jk lm4n@gq)r3<s4t~ 34 g)<4gp<<<<4*2,# 4 }+     9+  !9 +2,      ,p4       L_ `a bc d ,e <& +h ep_ q"VPDr_ o +u3 # $% &'( ) * +| $[ \"]"^"_" `" a" b"!c" "d" $  >+g 2 ,#' '4 $  P    +#1             >+ ]-^_`a b cdefi        :@SABCD EFG2L,M#"LUNNOP4Q`2V,W#XY Z [ \4]2bq,c#"LUNdef4g(gl)m"S<n"<o"<p"q4q~2pvwxyz {|}~ , 89 :,<TU V,X43   2{, #   4@2` , 3+_{+42I,#,#42 MPhy_I>+4VW 2(q W ,#   ! "$% &!'"q(>+4%d2@_`a b cd  ,e#0f8g<+4judv wxy+< )+q2x"" """d" ""L"P"Q"R"S"T,"#X,"#`,"#h" p" r"t4uvwxyz{ | } ~&&& & & & >+   1&    1@>+2<X Z \ ^  `  ,b # d f  h  j  l  n  p !r  "t  $v  &x  (z  *,| #,~  4  6 8 9 : ;4 M,          "Phy                 ! " # $ ( )  * 2D R     , #             " #,! #$# ,% -' .) /+ 0- @40 20b d f ,h # j l  n  p +4s _                       @         2( "! # , #                !  " $4 M  !         /!0% H"& &' &( & ) & * & + & , &- &(. &,/ &-0 & .1 &H"0!W">+4 ! F"GHIJKLMd"[a#\#] ^ _ ` abc ea#"p#>+h"28$#  ,#    $%&'() *),044}#$ %#            %!%+$0$5&6 789 :;<= > ? G@#A B CD) G%6X&&&&6XZ '+z.'{|+P'1Yq']&6t-' icq ''+-' seqX'&:@6)A)@Lw\@N)SX[+a e"fqglm syX) 5(Y0 XX`XhXpXt x3xx')@X&)@@7)95AF+.* XX )>*+X!m*"rq"#C**)*m*r**)***o*******+*)++/+)C+?+4+]+)XD+r+)Xb++jXXw++jX++++j+++6X&E, 0a{,Brcub_ lencdrN(g3h7ilm o0p Pr Ts 5Xt`upvrwtxvy+xz+}+ idXX lunaX XLL57GG revG77777 7(70789@+HXP X  X  X  X  X  X  X  X  X  X  X  X  X  X ppr X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X  X X\` d8h8pxB\X    ; ;  B\9   XX95+d @r(:87&') +50,V8.5@0`1p2d3J5Z6#@7"@9Z:mJ<{> @XBXDXGH+QXRXSa\XeghijklXmXnXoXp+q+z X{ X | X  X  X  X  X  X  X  X  X  X  X  X\\XX+ +(01=irqX4@8;@;0 (0;@r83E,:HO9PM9QRMdevS(TZUX=idVX  XX  YX! \X" ^X# `X$d (e ,kX0lX4o L8p9<q @r@rH7 99@XBM9{, z9 X6D9N(J;KM9LMw\BrcuO_pQSZ+\]_`abz9deg; sdbjR9k-;m Xp Xu Xv Xw7}~+X7 -;+R90k6X$_;Xh*>3XW >a >c%dG m>(t>0>8>@>H ?P ?X ?` ?h ?p %?x C? %? S? g? w?  ? ?" ?* ?4 ?; ?E @N S?W"@X@@aT@g h@q@yG "X$X(X,+0+8@D  X@  XA  XC  XD  XE  XF  XG XL!8P!8Xa`_;>7>9>>7'>G>7>>M9X>?>?%?M9?>?M9>?*?S?M9H?g?9X?w?9l??7+|??7??M9??7X??? @M9 ; ?"@7@@@7''@<;T@>E@h@>Y@@7m@@X@>@6XLA 6XZYA6XA      4B5@6A7A8a9 NX?BAEYAFYAGYA HYA$IYA(LI,MI0NI4OI8R@U PN0`ECBdevabAcQqd eI(BB[C`CuCkwCCCC (C  +  C uC UCV # `$Da b  TpLDq #rLDC\D+ D ASC TD #D\DD+  E   # 3E #3EDCE+XE#  E E+<(CE %E&'E * F+#, - .$ F EF+/'E 2OF3 4 5'F \8F9*: ; <'F OFF+='[F @FA ASCB C D EF \HIGI#J K L(IG FYG+M'G PGQ R S TeG WGX#Y Z [/G GG+\'GhH  H H+\I F        I ', . / J0 L M N O'P'R T U'V FXFJ+FJ+8:J;<a=I> ? @I A(J`qKrs9tau' vI$"idw(x,y'0z 2{ 3| 4}I8~'<a@ HRI6#P X Y'ZZ\JX$L5mJ @ H 'P 'ROLh L  AA0"phyJCP X'Z'\ ^ _J`x)M*+, -a .'(/a00'81a@2 H3 I4JP"phy5MX6`7ECpOL@XIMS NTUS^6N_` ScaNdaNe  NN' VO"ioc ^ I ^ / 8I<C@ h i jp:2 ^347"id5 67/ 8b@90X:;%b<w=>? @A D E\Fw\I\8J 5@KHLbXM `PdQ hR'jS lT mV5pW5X 5Y [ \ ] ^ _ ` a b'd e'f6#g'hbiIjbkIl mInIop qr's t uIvIwI x$y%zb(} 0~ 1 2 3 4 5 6 7 8 9 :K@KKKHKKKPS^z^^^''^^_bI b  ''''  "_$_`b& #H#H\;;(; $ -$L$L$LL 5 55 5   '       '(  0 '8 ':  @  SH  P 'X 'Z '\ '^ 6#`  Sh Ip bx  5  Z b c I c  c   ' ' ' I ' ' ' 6#  S '  c  '(  6#0   S8  '@   cH  P 6#`  Sh cp 'x 6#  S I I c '  c  S  c !I $' %c &  '  (  )c *c +c , S -  . 0  1  2  4b 6 70 8@ 9P : ` ;5h >c ?/c @ ?c A" B/c COc D/c EI FI G;b H  I  J  K  L  M  N 5 O  P  Q_ R_( S C0 T $D4 UD V E W X Y'Z [ \x]x^B__B_`B_ai_b_d eVON^  N^N`^e^z^IS^^^ ^>'K^^^ ^SS^^_ ^__=_ ^'=_SS&O_T_i_ ^''v_{__ ^'__I___ _ ^>t_)) I<a''   '' I     ''I_' '"'$'&'( '* ', '. '0  2 3'4'6'8 :b    ';b^SRbS'T'UIVbIb+vbbb ^Lb+bb^Ib+aM'b6NfNFb6#/c+I?c+SOc+Iec++ Pc szQ'R SS/O2c_O8c_O?c_ dUv3dS+UgE OdOdGTd[h#wtdd_+SOd ^Od ^M dGxd ^'O  e ^ wk+'eJ+O'Ce ^ O_e ^Ub qeZUb eZw eGxOe ^'/W8e/UU;eU=f:Isz>'@#rA(outS'ډC, =C M Z g$U}T *U}T|QsR0X0? gU}T|QsRX~ ?%*J5ioc7 ^@' 6# ~   ~#r5'(out+', = M Z g$U~T U~T|Q}R0X0? 'U~T|Q}RX(?%*ioc< ^n4EII#r(out'N, = M Z g$iUT UT|QsR0X0? ՍUT|QsR}X@?%*ioc4 ^n!2I#r(out', = M Z g$U~T =U~TvQsR0X0? sU~TvQsR|XL?%@ * ioc4 ^n! 2I#r(out', = M Z g$U~T ېU~TvQsR0X0? U~TvQsR|X ?%*jӒiocj: ^knk'Ӓk8IkBIm#rn(out'>p, =p M Z g$YUT UT|QsR0X0? ŒUT|QsR}X(?%"!*?ioc?9 ^@n@#@4IA'C#rD(outZ'F, =F M Z g$ UT AUT}QvR0X0? xUT}QvR~X,?% *9ioc9 ^n#94I>I#r(out/', = M Z g$UT UT|QsR0X0? +UT|QsR}X<?%*ioc; ^n6sz'#r(out'B, = M Z g$]U~T U~T|QsR0X0? ɗU~T|QsR}Xv? U~T|QsR}Xv?%@*ioc; ^n6sz'#r(out', = M Z g$2U~T gU~TvQsR0X0? U~TvQsR|X} ?%*Mioc; ^n6Msz'#r(out', = M Z g$ϚU~T U~TvQsR0X0? ?U~TvQsR|X} ?% *i ioci< ^iE6#k#rl5m'n ~o @(out'br, =r M Z g$}U}T U}TvQ|R0X0? U}TvQ|R@X@?%*CiocC< ^DnD8EIEIG#rH(out\'J, =J M Z g$*UT _UT|QsR0X0? UT|QsR}X$?%%*Fioc< ^n8Fsz'!#r"(out3'$, =$ M Z g$ȟU~T U~TvQsR0X0? 8U~TvQsR|X} ?%p#*ioc< ^n8II#r(out'd, = M Z g$UT UT|QsR0X0? UT|QsR}X8?%$*ioc; ^n6II#r(out', = M Z g$2UT gUT|QsR0X0? UT|QsR}X0?%*_ioc; ^n6_II#r(out'ʤ, = M Z g$UT UT|QsR0X0? QUT|QsR}XD?%R*}ioc}4 ^~n~0#r(out'U, = M Z g$oU}T@ U}TvQsR0X0? ڦU}TvQsR|XH?%-*YqiocY4 ^ZnZ0\#r](outo'ާ_, =_ M Z g$U}T@ -U}TvQsR0X0? cU}TvQsR|XH?%*6ioc64 ^7n709#r:(outL'b<, =< M Z g$|U}T@ U}TvQsR0X0? U}TvQsR|XH?%*~ioc7 ^n3~#r(out(', = M Z g$U}T@ :U}TvQsR0X0? pU}TvQsR|X@?% * ioc7 ^n3 szD'#r(out', = M Z g$U~T ׬U~TvQsR0X0? U~TvQsR|X} ?% *ioc7 ^n3#r(out', = M Z g$0U}T@ eU}TvQsR0X0? U}TvQsR|X8?%$ *2ioc7 ^n3#r(out', = M Z g$U}T@ U}TvQsR0X0? $U}TvQsR|X8?%*ioc7 ^n3#r(out'#, = M Z g$=U}T@ rU}TvQsR0X0? U}TvQsR|XD?% *UYiocU5 ^VnV1YWY#rZ(outt'\, =\ M Z g$۲U~T U~T}QsR0X0? KU~T}QsRvX| ?%*,ioc,5 ^-n-1Y.0#r1(outF'c3, =3 M Z g$~U~T U~TvQsR0X0? U~TvQsR|X} ?%*ioc5 ^n #r (out' , =  M Z g$U}T@ <U}TvQsR0X0? sU}TvQsR|X`?%* ioc5 ^n1 #r(out'w, = M Z g$U}T@ ƷU}TvQsR0X0? U}TvQsR|Xp?%*ioc? ^n$#r(out', = M Z g$U}T@ PU}TvQsR0X0? U}TvQsR|X\?%H*ioc? ^n$#r(out', = M Z g$U}T@ ںU}TvQsR0X0? U}TvQsR|X\?%*siocs? ^tnu$w#rx(out'z, =z M Z g$*U}T@ _U}TvQsR0X0? U}TvQsR|Xh?%H*NFiocN> ^OnO:FszP'R#rS(oute'U, =U M Z g$ȽU~T U~TvQsR0X0? 8U~TvQsR|X} ?% *)ѿioc)> ^*n*:ѿ,#r-(out?'</, =/ M Z g$VU}T@ U}TvQsR0X0? ÿU}TvQsR|X ?%o *[ioc> ^n:[#r (out' , =  M Z g$U}T@ U}TvQsR0X0? MU}TvQsR|XL?%& P(Rioc() ^.).)#n.)2.*.*','-Vr./ / Vmem0ec1IZ+ aout_s5k$ 5)n ;GUUUUUU'U'3U'UUU3U3UZX[3['['ek$ e)n rk$ r)n y}}}}}3}}}}3}3}k$ )n t3T33k$ )n 3Vp6#''''3S''333 jioc- ^S6'S? SIy'5 5 5 5 5      3          CfUsTR fUs9UsTv Q kioc8 ^kmemeckioc9 ^kmemrZ@ 31k$ 1)n bjiocb4 ^Sb='Sc'Sc3yeyf'o Y1k$ 1)n 1k$ 1)n  eUsTv eU TsQ}peU TU# S +zYSjsz+bibmfp co1k$ 1)n 1k$ 1)n 1k$ 1)n F1k$ 1)n  eeU  eU  eU peU S+zYSjsz*bibmfp cov1k$ 1)n 1k$ 1)n 1k$ 1)n  1k$ 1)n  e+U  eJU  eiU peU S+zYKSjsz'bibmfp co[<1k$ 1)n n1k$ 1)n 1k$ 1)n 1k$ 1)n  eU  eU  e/U peU S[+KRdev5.A. .SPRdev7.C.dRgfp!_P|.'.|D.|P_3XP%X^.<.3/Pz0.zC_.zX+TkxT7J31Wh# #=.#:.$.%.&.'.((/U6/UD/UR/U`/Ut/UD/UD/UD/UD3/UD/W/W/W/W/W3/WD/WD!/WD0/WD3/WD.:../////3/D/D/D/D3/D` r    !!!!!`! [*1[9Js8!x =; M Z giK 0 <n!H   9YdQR X09eU T} Q W?!!!!!J!!W*q  U      9TsJ! =y M Z gW,!!!!,!9FqG }      h0 93dUvT Q i  ` o |  9 dT| X0W!!!!! q       J|!W!!!! !!&J3!8!EWSqT        9UsT~Qv J!!J!!! TU}TQ R0 U}TQ R0 Uv U~ U~ dU T} Q  Uv 5U~ MU~9dU T} Q WG!Lh=X M Z g9UsT0Q  WZ&!_Jle!m!zh=[ M Z g9T0 qeU$UvT|F$!Q~ Ce"UvT? 'e:Uv e[UvT$xUvT eUT  _eU dU} UvTQ R0$"UvT|F$!Q~ _e:U mU}TQ R0 _eU _eU dU}T0 _eU _eU% *UvTQ R0 ]U}TQ R0 _euU eU Tv Q R~ Uv U~ dU T} Q  )Uv CU~ duU T} Q  eU Tv Q  _eU eU T} Q  _e U _e!U e\U T} Q R~ eU Tv Q  dUvQsR; dUvT9_eUJt#++2+S+d#St#]t#i$"t$"t#$"t$"t$"int#$"i$",t$"* tzs8#uzu8##zs16#zu16##8zs32##Izu32#zs64#zu64#iC 4$$t$$+$$$$1i$$2i$$H$$I +$$X$$]$$^$$_$$`]#Itt$%$$%&$%'$%($%<i$& Z$&$&$&$& =$&##t$&%$&&$&*+$&4 $&=#!$&B$&\$&]i$&^+$&hI$&m8$&nZ$&qr$&} f$& r$& r$& r$& i$& i$& r$&J& &$&# J& 1&f$&&e&j&j#==&&&&&]+E&&& 4++WI$'(g(( ' ' 3'H) ) S) ) 7) "F) i ) () .&0) 38) o@) #H) #H) #H) nH) #H) #H) #H) #H^@* *m*=*%*ZP*5h**S*S*6*q* v*i *>6`kp*{  *i( *i, *q0 * v8 *@ *A *B *iD * H *Pmem*@ * *+ * i *= * * * * *  *I( * 0 *i8 * @ *iH *iL *P *iX *` *ih *p * bx *i *i *3& * *i * *i *i *& *  * i *!& *"i *% *&f) *9i *: *?= *A= *D  *F  *P  *Qi( *T8&0,-; qcs-=rqsl-?rqwfe-Ar-E qss-Grqsti-Ir]-Krqnmi-Mr]-Pr ]-Sr0]-Vr8qlm-Xr9]-]r:]-dr<H- lcs-8lcsx-r+- H- lss-8lssx-r+- -g r15-m+r14-n+r13-o+r12-p+bp-q+ bx-r+(r11-u+0r10-v+8r9-w+@r8-x+Hax-y+Pcx-z+Xdx-{+`si-|+hdi-}+p-+xip-+@ -+sp-+@ .B .C8.D8].E8 ].E8(qs.E8,qdpl.E8-qp.E'8/].F80qavl.F84ql.F85qd.F86qg.F%87].F+88$/+$/+$/+$/+$/+J/ pte/ $/" J/ &pmd/ $/"0%O0%% /0%/20' v8pgd0' /0'"\0p 8pud0p /0p"/0E@1H1I+m'i@Ri01 41+8H2e-+2f++2gb+2hl2ub2vI2wIkey2x-"g2U2V @2j8key2kq2n8key2oq3;,3<,3=,]3? i ]3@ i$]3A i(]3B i+^-@4 444i4i4  49(4 i,4!i04( 44)q284*iH4++P4,X45 `46 d48 h4: l4; p4< t4=ix{se4?D@`rt4@"Fdl4AF 4BF 4F8I_4I6 4J+ 4Ki 4OBI 4XGI 4]GI_4`"C@ 4do 4hi 4ki  4l+ 4m  4nWI  4o\I( 4p*0 4q X 4s` 4ub 4x d 4yHh 4z=p 4{fI 4+ 4 4 4  4= 4  4= 4  4  4H 4= 4= 4  4B 4= 46(_46P`mm4h!h 4h!p 4[Jx 4  4  4  4  4+ 4i4 i,4 i,4 i,4 i-4 i-4 i-4 i-4 i-4 i-4 i-4 i-4 i-4 i -4 i -4 i -4 i -4"i - 4+ 4y4`pid4  4  4+ 4 4  4= 4= 4( 4=0 4=@ 4JP 4JX 4 = 4"-K 4%H! 4(H! 4+  4- r 4. r 43 r 44?A 46A 4: ( 4=+0 4>+8 4A r@ 4D rH 4G+P 4H+X 4K_?`_4N? 4TL 4WL 4ZL 4^M 4k 0 4mM 4p5  4q5( 4t+8 4u+@`fs4xMH 4{MP 4~MX 4M` 4QQh 4 Qp 4 #:x 4 #: 4 #: 4= 4+ 4 ! 4i 4 4Q 4 A 4i 48 4> 4 r 4 r 46 4 $ 4I 4 7( 48 4Q@ 4 H 4QP 4bRX 4lR` 4Rh 4Rp 4+x 4R 4> 4i 4 r 4 r 4 r 4_9 4@ 4 4S 4= 4 Z 4 Z 4" S 4)HS 4 = 4 RS0 4 >68 4 iX 4WS\ 4lS` 4>6h 4= 4vS 4 4 4 4  4!i 4"i 4# 4$+ 4& r 4' r 4( r _4) 43S 4C& 4D+ 4LS 4N+ 4RS 4SZ( 4TZ, 4Y+0 4] 8 4^ < 4_ @ 4` D _4aH 4d>X 4gS 4id> 4lS 4w 4x 4z+ 4} 4~S 4 r 4 r 4  4  4& 4  4  4  4  4+ 4i 4S 4S 4V 4V  4i( 4i, 4%I0rcu40 49@ 4 D 4H 48P 4Vx 49 4  4 "V 4 V 4V 4  4  4 r4 44>_4 4  4!"2 4$"2_4. 4<V_4F@@,+?^@@5C!5f18sp5+8es5 8ds5"5$5&5+(5+05v185+X5+`8cr25+h5+p5+x515+5i5Z5+5+5 0{fpu5 ]0@i(6 h!6 *m!^@@1!mp@ 1It@v&!L1"mn1h!1 O@/n 1(1,1}n0D1Tn81=X1nh1%op1+x1m1 1o1@*1vS1o1$mb7"77b7#7878H7 #lval7 Z"Z"74#@#$7, #b8d#88d#t#+H8#+8 Z@#8 #@t#84#$8# #9 #9 9 # :: ; $;4#$;$ <$< $<<< <<i<+,=$8fmt=S=S=S=i=S=S$#$>6%+>7+>8E8>%>S>S>S>S3>i3>i3>4ikey>9$(Mi>=%8>U.&>V=mod>W.&>XS>Y3& >Z (>[ ,>\%0S>uz&>vz&>w&>xi>yi%%+]&+ ?/&?1iset?3wget?5?7 2#&)().&)) *) M) p ) () 0)̫8)!@)" +H)# IP)$ IX)%b`)&{h)'p)({x)))*լ)+),%)-*).)/ R)0 z)1 Ң)2)3 ϭ)5 )9 ); )>)? )@-#& @!)@% @+ @-@/ A .)A!IkeyA"IHA?\)+AA++ABa)+ACf)"\))A=)A> @.)Mi3*     +*+$6 ;M!#*$6?0*M!@*+$B 1iD*     0EcJ+EdSEe^Eg|Ei El @e(#*Fw+FrendFrRG RG pH,cwdHZswdHZtwdHZfipHZ fcsHZfooHZfosHZH,HZlZ&,+bH*J,ripH+rrdpH,rbH.,fipH/ZfcsH0ZfooH1ZfosH2Z HH),Z&,ZJ,H0H@,+HA,+HB,Z,+ |H$a-cwdH%8swdH&8twdH'8fopH(8@,H5ZH6ZH9a- H<q-&H>,,Zq-+Z-+?HQ^.cwdHRZswdHSZtwdHTZfipHUZ fcsHVZfooHWZfosHXZHZ,H[lH\mH]nH^ormH_pH`qHa^.xHbZ#s.+r.+@H:.H; rH< rH= .r.+^@@HO /DHP, HQ. HR /@/c+@H^m/AH_+kH`,AHa-kHb.@AHcm//+^@@Hf$0HhiHkiHnrHqr8xfdHtrHwiHziHiHiDH/@@H]0H rHiHi fpu@H0HiH+H0H0H$0 H$00DH/@@/I 0I rIr]1+]1+? Ja1J ںJ! J" J##1 v1+11+1""1E K1KiKiKSKSKSRLRLRLM8/2M9J2M<J2M=J2/2HN<q2+N=i+N> N:2N;/2@O2srcNA8 dstNA 8242 MiO2J(O73O73valO ZO!Z O"ZO#rO$73 ZHO*^3+O+&^3+O,#3?P3P*YP Ic3JO'3O(O)2@<3O.rJ O14O2F4O3O4 O5+O6+Q$F4fdQ%Q&Q'4H(Oy4+O%2+O/3+O738O4O+fnO 4@K444y44R>5R?+R@+RAZcpuRCZS)5SrSrE(SQ5fctS1S&Q5 5MiT5"U5U 5"5V 5V=W 5W HX5+X$X6@5$X5JY 26Y#$Y"6 Z)6Z*@*Z+ $osqZ-5 Z/=([ 6[ [ =[=E\6\+\6\66\  7\ 6\37\6\6E ]]7a] 6] ] x7] 7Mi^ 7E@^' 8a^(37^)  ^*!8(^+80^,8^-9^.:^/;x7887 8E@@_/8_0֋_1i_2  seq_3@_48_5]7 _60_7 8&8(`8` `+` 8`Z 48888a.9aa a39".9Jb O9bO9+_9+$b889c9c $ck9d+9d,d-xe9e9ei`e+hmaxe+p+ :+ Jf #:sigfO9$f :$gR$gSG:/:$gU$gVd:L:h:+h +h  $h i:Jh':h(h)Jh-:h.1h/h0 :h1Jh5/;h6h7h8 :J h<z;h=h>h?h@%hA%JhS;hT &hU hV J hY;hZ &h[ Jh^<h_+h` ha HhJF<+hL+hQ +hWz;+h\;+hb;J hEc<hF @<Jhg<hh_fdhiJhm<hn hohpi  h%=+h*:+h2:l_rth9:+hB/;+hdF<+hjc<+hq<b0i Y=i i i i <0i m=@=$iY="y=i =i!=i" #: i%=i';:i(+i.X:i0 #: i3>sai4= j I>j Ij +lenj +j (kd>k M!l$>l%l'l( 0lD>lM#I>lP(lW)8m 7?mrmrmrmrmr m#r(m,r0n)_?n*rn+]7Pn8?n9?n:iHn;iL7??+E8nD?anEnF>6nGi0E o>E@oKoZopoooendoE@]T@c+p!o@p" i$p&T@pD@pDo@$pD{@pE@pEo@$pE@JpT @pY@pZ 6$p[@Jq Avalq$q @Jq 3Avalq $q A4SxA4U r4V r4W $[i4[A04hB4io@4j 4kxA8cpu4li4mr4nr 4or( 4`B4+4 4 4 4B4+4 ZL@@4C4 r4 r4 r4 Z4 Z4+ 4+(4+04i8^@4D4 r4 r4 r4 r4 r 4 r(4 r04 r84 f@4 rH4 rP4 fX4 f`4 rh4 rp4 rx4  r4  r4  r4  r4 r4 r4 r4 r4 r4 r4 r4 r4 r^@4F4`BD4 64! r(4" r04# r84%=@4&P4'Q4(R4)S4, rX4- r`4. rh4/ rp40 fx41 r43 r46 47F49F4;F4=+{avg4GB@D"F04KF4L=4M+4N+4Oi 4P$4Q&4SF("F/4]FFFFFL4`"HD4a64h r4i r 4j r(4k r04l r84s f@4t rH4uiP4i4i4i4i4i4i4i4iD47XD478rq4HH4F4"H4F/4^/H4HCHFrqCH4Hr4i r4i r4ir4i4H44444Ib4Hs4Z4 I4 II4"#.I3I"=IMHWI+**"aIL)[J)})w)>\) @) D) H) 7P)+`) +h))p)+x) )6)=)>\) kIpidpr7Jr9 9r:ir; 6r<zinor=rr?e r@o@rBH[HfrcurC`rDup`JK+ -Ki\KEsoLsp@*uidsq Agidsr 3A ss Ast 3Asu Asv 3Asw A sx 3A$sy i(sz0s{8s|@s}Hs~PsXsM`sMhsMpsMxs s͊s0ts~=sҊm#2KLkeytÂMt9tHmوtΉ semt>\(t؉Pt X@`t 3huidt Apgidt 3AttTxt|t~t t+@i@t݉L"M"M"M"M"M|Xu^QQu_9u` uaub uc=ueH[ uh8uk=@unoXuq`usduthuwpuxituzKx3ui3uiuiuouoau7u ituP&uΌ&u_?&u`h&u &uJ&uttyuu&u&u @&ur&u r&ur&ur&ur&ur&u?A&u+&u+&u+&u'+&u+ &u+(&u"+0&u,+8&u+@&u+H&u"+P&u,+X&u+`&u+h&u>p&u &u&u&u&u i&u&u&u&u&uh!&u>6&u>\0M uQu6u9uH[u VQ"Q"QvQv;v;Q@bR% % r  (*,-=0Q"gRXwcRwd@*we wg wk 6wmwwn(woo0wq%]8qR"Rm="R"S xHSxxyxS"MSgS+"gS"qS"{S+S+?"S"S9S+"S"S0Vz ,.w0W@(,HP X`&&+&>6& ibdia &~(&6h&=p&6& ev@&i&i&i&&&i&6&E&&=&%]&G^cdiO&bbY&#&r&  &((SEhyyVyzcy|iy}dmbdyd(y80y+Xy#e`V"V"V"V"V"VR $RRR!R%R'R,R/6R3R5R9R<RARDRHRLRQRURY2WzXz z zz RXz!z" ]z$iHz'Xz(Skeyz)z*Xz+  z, (z- 0z. X8extz/X@k)WX$z3E z8%Ytpz9%Yz: z;Zz<ZRX$PI"{Z{Z{ {i{ z {r{rino{)r dev{* ({+ ,uid{, A0gid{- 3A4{. 8{/g@{0gP{1g`{2gp{3r{4r{5Z{6Z{7r{8r{9Z{:Z{;ZZ+$| !Z(|Z|i| |Z| =$|ZZ[[i Z|#H[|$6|%=$|' [n}>6n}n}Mi l[[ 9R~ $"[H \+6+[9\@[i  (0\1@*7@*osq95; $<=nnnnn+\, $-=VL7@$ ]]4 ] ]%] Z]@*=]Mi]+MiW^g@ XqB^r%]s8 wqvG^HcpuwP"B^[iq^ @gx__*_(len@*H:_Pp^*_++:_+J_+|@%`%`%` a6@@ ^H!+"+#$8&%%]& &'`0&(+8cpu*@ssp+`H@*5`+`6`768*_:*_(;+H<`P=X>\5`e`fisdag:bh#i?b`xD*bE`F*bH I>6(J6HK>6PL+pM+xN+O+P+Q+R+S+TU+V>6WK&Y &\+&]+&^^&_`p`:b+J_`RHtb+c.+c.J"b#I$%J'b()J+b,-H!c+&tb+*b+.b Bc@RbopsLc@b"#BcGc2c4+6i7i Miy@cMiyHcyp dyqcyrysd" dby;dyQcy+ybdayy+yxdZd;dE@ydycy+y+y+ y (y,yd0frcuy8y-eHxdcy-eyidye\ldt*Af8.+@9>6H: h;Pgp= xC8|D,~"[1@E@(1Xm1Y>\(1\m1b+1h+1tC1w 1}$1n1+1+1/nZmk1}1TnA1 lA1k 1}n{rb161+vm"nb{oc h jk(qK s(td0u8w@{H~PX`h p"x#n{oKmm1o1r8cid11 @@1 o1  1p1=1+1 S@@1smo@1 \@1+P1+X1+`1+h1+p8pgd1  !x1) 15 1?s1E+1Li1S 1Z $1]@*1_1a61p>\1r=11+ 1+ 1+ 1+ 11 1+  1+( 1+0 1+8 1o@@ 16D 1+H 1+P 1'+X 13+` 1+h`brk1+p 1!+x 1+ 1+ 1%+ 10+ 1s 1 t@ 1!t 1Ug 1+h 16p 1+tx 1 10t 1m 1&:t 1+ 1+ 1 1  1  1\)+)+))=)K))8)8 )= )= )= 0 )1@ )1H ) P ) T ) X ) \A` )Uh_)kIp )=8{H ) P )(_X )i` )sh ) pz~+'E@~‚‚ ! 5( E0 E8 Z@ xHP#X<`#~~^@))=) ))+)  )3()!0)!8)¨@)"ѨH)+P)+X)+`)zh)>\p)) ) )&)#))$)))x) =) W) m ) a ) k ) )i  )(_)ئ` )  )Z )3 )3 )!Z )"u )/ z )0  )1 )4  )6i )<>6  )BS@ )D"~H )FuP )I@*X )L` )O d )RG^h )Sop )Z0tx )a )brcu)c )d%] )f>6 )k0_)n6@@ )o=H )q6X )r=`~Mi‚ziۂۂzfyǂۂiSy!ۂ5z&4Ez:4Zz}JIxzI_ EFzGHI9΃΃Ӄ}؃mnt ΃ z#؃ z<z( "#nid&-+4+7SERaSUXYZ ic 9 dK(frcueHg Xj=`idmpptqSxrzu+uuzAa@*03ׅ456=78 xa9w    =" $6E@@-5lru/ׅ0@*  r2`nrr3nsr4`5ou+:c+J valr$Mi ʆ"ʆ   n>C+">$tb$tzEtlfrcutmtn9to btvtx8ty HtuӇZlxt+(trtt+@t%t*tS "#` tV+t +t [#/ k+$tw|MM VtوtkkeytMt%t+t=t6Ht+t 3+t 3b(tit+t+t%t*t I H(t+tӇZ tt=t } tɉAt/Z"ɉ"Ӊe 9ae+0@*8@uid AP@*X `$,$hss 9sgids 3Ac+s͊+srcuse|@@_g֋_h $cpu_ii_ji_ki ]_li]_mi]_ni]_oi]_pi_ri_s_t_ui_{  _|8(_} 0_~88a_@@׊ۋ&8@+=+?8uqu u! u"+u#ru#r u$+(u$+0u'u(ru)ru0Όu1 1u2 1u3 1uCuDuLuMuN8uQKuR uSuTKq`+Jp+"p"z9+""ÍE0H[a E` Wfrss ÍC!08H[@ X ~fn 2arg  +J b~$$ ZHwSݎ+wT=+wUφwW+wXwYE8wIAqwJiocwKR@mݎ w\i0^ + i(i,90i4w8H#X#X#X#X^X6`dVh6px`dev( 0  4 h8 r@ >6H`id h +p |x 6 8 %]    =  O9 ! "= #>6 &0 (64 )=8 *^H -`fq2" 3= 5>6 6>6 7>6 ==  >60 @4`tdD,8_F@ KH[P P>6h R  S= Uz Vz Wz [>6 ] #AAi4"4J Uval$>J xval$a$<4iȓn+v9E8_4`@*a4b4]c ]d frcue reff0ȓJ Sv +$%>[iTφ++ wnM J. 0 1$4 4K5i6K7t[[+e"#`"#joH)+) A+) UH)+) 3A+) xP)6)i) @y@ ) )g)g()g8) mH;Ъ()*=+= ,=0->6@. 6`/ d0h1~p2 x3+4$J val $Mi6D$BHE~luidF AlgidG 3A+H D@PJ!H" D D D D D  D( D0 38 3@H=+ i(i, D0 D8 @ !.&@8p9:;<= >(?0@8#u6~XDiEFG HI J(K0N 8Oɚ@QHSP#6n46}DĚ}Ě}ΚxY֛Z[r\r]r^r _r(`r0af8cf@dHeLfrPgrXhr`ifhjp8qiiii iii8ino   ( 0i֛+ +iii iiiiXԝ 3(V0t8V@HP#+ٝi..Q~Q8tQ[qyp8  i >\ 0 H`ops! }+"+#+})wHA)}MA) a"H2a R4vzxf))Š))) ) / )a()0) 8) ơ@) ߡH) P) X)+`)?h) ]p) |x))¢) Ң)#{"ޠmޠkʠ[J[Jޠ4%%*"\m[Ji\9\ޠ4m[Jiiޠ f[J4ơޠ!!ߡޠˡ4ޠ2zxx+[Jޠޠ ?ޠ0]ޠ!!D4wޠwwb[Jޠm"4ҢmǢzxxע})A)pA)i)AA)ok)})fA)!fA) v(4v}k})A)SA)A) IA) i""ģ^@)Z<)[K)\n)])^)`ȯ )b()d0)e'8)fJ@)hmH)j'P)kX)m°`)oh)pp)r 0x)s])uv)v)y){߱)})*)C)#Σ<"F"P"Z"d"n())m) 268pid)J)V58uid) A)A )$ )L) +)i)i )i)i) } )qA)>6A) r ))k)*A)+/2A),A)-Sxo˦c+/)P ^0)!)) ) D)!3+))) v) v) Ӳ) )() v0) 8)@))H)=P))X)=`)`h)~p) x))))) ) )) ) ) #8iԝ"#Ǩ̨"#֨ۨ#"#""# |)W* + ,V-. /+(0 09 4:[J8< @=6D> H? P@0XA>6`BC6E F>6H]IK aQ"\"f"p]+]+$/)ԪԪSri٪)) 8pos) /) i*m2MmI! v/2pmS! vRzxi ̫% umԪѫm%+&a' Imi+0bm!N{}mgm˦mլmm"ڬ+%m++++W2RSm v!i/2zm vS!iWm9\"ϭm4mxJbufJIJ !J !J !J ! J (J 0J>68opJVXJ`JVhJ pԭ2mm!immiĮi "-izK}zi2Siz}iWP9}sɣ}ȯzI9}zͯz}z'}zJ9}zS,m9}zO9}zr°9}z}zi9zǰ 9 Zi;Y20zI!S}SrrX"5v}b}zmi{9}mɣ߱9zƱ9zɣ 9z %"Cz /) r8mt)  \) +}Hr[i)}4Ӳ}ò}ز}4)=.VzV["B~H!Iez2I!2S!ij}6z--2""#<Azi3S K#~+@@1ASB=C6D Em(sdFh0G[83Ii3Ji3Ki3Li3Mi#~~@bioy;W b aP @48 @HnPrX` hpr  t x$* I$. Zxx$$$$:ƶҶ$޶ +6rev+"hEh  hSfrb6ns 0i8< >@@idr` hpfrcux opsy! hht "$ ں% & (( 002 !89@: 0H= IP@bXA `#t"~H ldirF++m"knhm >6 >6@`=h Ix  !  @  A %o4  ں vƺ   vߺ4  20I!I5b!NgMi0'() v* +-,8 - 2(#   ##(" 2EeESE HEm+En'+Eo&1XE0"E1=E2 !E3 E4 E5 ׽(E7 0E9 ׽8E; @E= ,HE?OP#,;"#6Y6Y=@|66c!66Y[J2׽m6,I!2m66I!ܽ,m66 Om66!1EE E #T26YI26YS!`= 6~ Xž0thu }vw!x*y z ؿ(# h4}6rJ+1 4ؿvvÿ }1~1A&bufQ& IA+IQ+?]c+#c#S#ݿ# S r(?Er?FSmod?G.&ops?H!N?I D?J?K@ #I |H?Llarg?M lstr?Nlarr?OI?V?Wi?XI# ?\Dmax?^i?_inum?`C!ops?a!N?b #D&w?&&w?&&w?&&w?&&w?O&&E0(a)6+ +  i H!  ]5+7`*-*.~mod*/.&@*06Hmp*1P*2-KX"8*5*6=*7 *9 /*; D *<X(*= h02I52/S!4D.&S4X.&I4h.&][i*>L8*E8mod*F.&D*GLP*p*q *r *s*ti{mtn*w *b* b*i*I*I:"#glUԆ+(""X`X""$@gendS++ g(g0&g8MiENT Ze#4Xtet"i++bEEO+Tc+Ho+O+Z!(08vma1!2 3 +4+5+ #t}>A? A@ &4!!+(!K!+++-XtdetiPXtet++i+!!+ S!!vSvS !+&"!+MiPEMN PiRi Ti]+/(+++++ E0(frcu12[3(7c+ HIJK LM+NIt ^g~@8pHSPtX8bus`Bh p x>6|Dh    `msi( 8 @ rH rP  X  ` =h x  ' G 1    `idZ 6 =   !! #  $ % '# )R+ `, a- b. c/ d9 e< f#E(6=get put 4 %& '=([:;$<q  !"# $(%0&8'@(H)P*X+`,h-p.x/012345# v4[U[ilHx^y 6zi|i}>6~=0c@"^^8r  r !r "r #r $r %r &r 'r (r )Z6 =K @ @ A B C D ED7Pr%]H[  i                i r r r r    (`qos0+,Sid-.=/6 0(1802+X3 `4 h5 p6 x7 8+9+:+;+<+dev=3> 3? "4I"[8ops  k  4k[ipMNSOSP!Q!R! T(U0V8W @X HY P[X\`^h_paxcd pmfh#`aSbusbd.&eSg hy$j(k30m8n @oHp PqXr`s!ht!ppmvxw py=#gq`23S5!6!89 ; (< 0>8@(@AHC PpmEX#I4 4vv0XoYSZ![\ o^ pm`(#oMi-Ⱦzz @ # .id~*cls#."8IovvQ ij=k m 2It2S!(ii+[iR[i|8=== (0!u""[i14[iBX[iO|cd&e24f4Xg 8lidh "7""#r"#cma""",@/0ops1"dev45=6=(78#66""|R$4;" C+D I NS#+eA]BC%5$`r$$iH+ +i"""vvnvoφvpivu#vw vx `vz v{ v~i8 v6< vQ@ v%]P vG^p vxvc+/2$  $4  H 6 9\  (H[0$"@j9klenlwpmnopqr9s tI(I+Y+E@!+a&+@@+ $H 48i=iBiG mapLTC!#YE@@]aH[@msbqwi | $wsÁ(Æ 0Ìi4Ò 8× <Mmtuvwxyz$} i' t  (0 8@3H P HXp` hp.&x #'"1";"J"TH~ @iD&zH^/  i/] ihijk+l+nioipi qi$ri(si,ti0ui4vi8wi<xi@yiDziH{iL|iP}iT~iXi\i`idihilipitixi|iiiiiii/#<<i Pz~ @ HAc+",0E: EB 3EJGEO \E T qE(XE0]E8bE@g EHnEPr EX{F` 2Fh Ep FFx VF kF#"|fYqghiCk l3Atagn o$qi(ti,u 0biow;8x;@@bAHWXr`rhrpxz|~C?Aref +@AmAelvAAr!B& #"c"m"wiiiP8rqspFpF= 6"""' 8ops8mapDi8 i< i@ iD iH LiPiT XD`h>6p=`1P^^[it;iyV4VWi+iViW"3W4HW+8pVi MIVuV#P"#V4W4WW4 njp$+(,--.. //0*1 #6+]+]+d+#d+$#d+# " n4BB[7Mioget"put 2 F_ F s( 08@HPX`1hcpx"#oQRiidSiTPfghiis."42'F7 _KLsdSxSi !S3&!S1S^SSii^6||h ihLbusMN=OP Q~(^ ===(8=@mP=p8opsc %    dev , ,i i "$$ ii$"$"(5,6>68len7i 8cap8$}QAVA"Q^` JK=8busLMO  P%(Q0Si8T<U>V@WBXiDYHZI\8J]P`Xa`cZhdlemfngxhp8piniqj8rk&xmnrtvyzi(|i-}i.~i/i0i1i2i3i4i5i6i7i8i9i:i;i<ii8iii{dev `irqi   @iBi Bi Bi Bi Bi BiBiBiBiBiBiBiBiBiBiBiBiBiBiBiBiBiBi Bi!Bi"Bi#Bi$Bi%Bi&Bi'Bi(Bi)Bi*Bi+Bi,Bi-Bi.Bi/B F  H  6L P o   i@M 8 i`MiaM     $ `vpd 8 iPO   , 8  8 Z i`P  8  8  w 80 2 `rom8  !@ SH  +P #X #[[""S0 I + b  v( +0 8 @ H#P!X!`h "+Z+,+""+(c ! "#$  g}+}4 ii73 iZ;:<6==/H i[iJ}8_aehk +l + o +(r +0#}:: 4+ I05bNvg{Z   + ii  ii'>sgl(>)i*i RGE`=al8grp @HP+XQEh8 fac9Q: `Eh )a   k   MiMi    +B,=-./k0zU8( zU16)azU32*mU64+YYYY YYYY0Y4Y8Y<@YHLYlYpYtYxY|YYY%Y+Y+Y+Y+ Y%+Y5+ $sBBMY/ABBM Y/!)>*B+B,M-M.M//56B7B8M9B:B;M/<KBCBDBEBFBGMHM/IRrSBTBUMVY/W+/^>/erk Al Am An(>Ao-Ap.Aq1rAr,AtkueNx6 7M8B9B:M;B<B=B>B ?M @M AMBY/D+ H6 8DevIBJBKBLB/M Ol AP6 AQY/RC t AuYkveL r sY{uwy Nx Lh0 DiejYkM lBmBNn LɌ DɍeɎYɏM ɐBɑBNɒ= ɨ kɩ0 kɪ Nɫ L DeYY N     MBBMBBBB M M MYMMY Y c+/! L0N DOePYQM RMSBTBUMV B +NY, i;jMkBlBmMnMoYpY /s ʡʢYʣBʤBʥM/ʬHL+MBB8ASCBBMYDe 8LUN+B;+N MMBBMY/H  MBBY Y/ MBBMMMM Y Y/ / 0M1M2B3B4M/5/6IJBKBLBMBNYP c+/S#[\B]B^B_B`Y/cʅKʆBʇBʈBʉB/ʌMBB/X 9MMBBMBB B B 8PHY9 Hc+/L  MBBDeM MYNUL&:'M(B)B*D+e ,N/LʎʏMʐBʑB8ASCʒBʓBʔMʕYDʖe 8LUNʗ+NʚGʮ8ʯBʰBʱBʲBʳY/ʶMBBBBBB/E ^MMBBMBB B B ^ mc+/718M9B:B;M<B=B>B?B @M AM BMCY/EzL,ʶuʷBʸBʹBʺBʻMʼBʽBʾBʿB M M BBYBBMDeY Y$Y(N>GBBBBMBBBB M M MY/ B B B B/ TB+)BBBBMB B/! BBBBMBBBB M M MY/ 6L_y`ayb+cydy,ey<B+/hLˡˢDˣeˤl  ˥l N˨˯˰˱Y/˴]^_Y`YaB bB cBdBeYfY/i$gBBMMM M MMMY/@AYBYCYDY EYFY/GtLL-DMe8LUNN+OYPYNQNSLVDWeXYYY ZM[M\YN]GN_GLbDce8LUNd+eYfYNgNiloAm"kn"-ko"kp"Nq)Ns)Lpv wxYyYzY {Y|Y}Y~BBˀMDˁo ˂B8˃B9˄M:D˅o<ˆBTˇBUˈMVDˉoXNˋ˛ ˜ B˝ B˞ M/˟ L˥4!D˦ e˧ Y˨ Y N˩ L`˭!ˮ˯Y˰Y˱! ˲YD˳!  !+4!!+N˶A!"BBBB/!b"MBB/)"L(|#MBBYb" DeYMMB B!M"B$B% B&!B'"|#("#c+N%o"L@_$`aMbMc$dy Dee0fY8gY<B)$+Nj#uo$vMwBxB/y6$<ˀ$ˁ+˂y˃˄$B$+/˅|$Lxˊ%ˋ"ˌ"Mˍ"Bˎ"Bˏ"o$ː"Y ˑ"$˒"YL˓"BP˔"BQ˕"BR˖"BS˗"YTD˘"eXD˙"e`D˚"eh˛"Mp˜"Mr˝"YtNˠ$u&vBwBxByBzY{M|M }Y ~Y/ &ˉ'ˊ&)ˋ&Yˌ&B ˍ&B ˎ&Mˏ&'&'c+/˒& ˾'˿BBBBYMM /#'<(&)MM M MBBBB<('K(c+/'L<X )Z )\ B^ B ` M Db e d Yf Mh Mj Ml Mn B p B!r M"t M$v M&x M(z M*D| e,~ M4ˀ M6˂ B8˄ B9ˆ B:ˈ B;Nˋ X(,˵ +˷ )˹ B˻ B ˽ M ˿ B 8Phy B  M B B M Y Y M B B B  B! B" B# Y$ B( B) M*/ )LD ], ) M M D e  M B B M B B Y M  B" B#D! e$# B,% B-' B.) B/+ 0- Y@N0 %+Bz,+  [-ˁ )˃ M˅ M ˇ M ˉ Bˋ Bˍ Yˏ Bˑ B˓ B˕ B˗ Y˙ B˛ B˝ M/ˠ z,L(˥ =.˦ #)˧ YD˨ e ˩ M˪ M˫ Mˬ M˭ Bˮ B˯ M˰ B ˱ B!˲ M"˳ Y$N˶ h-L8˼/˽#)˾M˿M De MBBMBBYY B$B%B&B'B(B)M*,Y0Y4NJ.$ o0#)MB B Y YM M M M M M B  o0!B0+// L0CDBMj,N yOMPMQY$R0 1+$+0SGE0 0Ep2MBBMBBBB M Y BBBBBBBBYY Y  M$ M& M( M*Y,M0M28LUN+4Y<{CDB1@{SGL `N*14\N4]M^B_B`MaBbBcBdB eM fB gB hMiYjYkYlYmM nM"oY$qY(sM,uM.wY0/y24̢.5̣M̤B̥B̦B̧B̨B̩B̪B̫B ̬M 8LUṊ+ ̮.5̯M0̰M2Y>5+/̳[4,6MBBBBBBBB M M MYYY/K5 (7MBBBBBB B B  M  Y  YYYMM/96 ,28-M.B/B0B1B2B3B4B5B 6M 7M 8M9Y:Y;Y<M=M/?57Ct8DBEBFM$G?8O8PBQBRM$S8b8cBdBeM$f8u79vBwBxM$y9}x9~BB̀M$́C9͋9+͌Y+͍t8+͎'8+͏&8+͐79+͑"x9$͒9E ͖:͗B͘B͙B͚B͛M͜B͝B͞B͟B ͠M ͡Y ͢9aͣ ͥ9L:DeDeYYN:'u;(B)B*M+Y,Y-Y .Y//;D;AE;kF:AGMAHBAIBAJ(u;Y;+NK;L,R<SBTBUBVBWMXBYBZB[B \M ]M ^M_YD`;Nb;E,>BBBBMBBBB M M BBYBBMaeY Y$Y(<>B B!B"B#M$B%B&B'B (M )M *M+Y/. >E$5?6M7B8B9M:B;B<B=B >M ?Y a@eAMBMCYD G>Mi@"(0@/@Mi,@     Mi`@g g g g g g g g g MiA$A@3A^b$MiZbAHzA+{=+|^HA++/2A6+vJAicq A A+J!Bseqi!BA^@6CmD@L^@N$*SX[+a e8fqg"m s y i   ID  6( Z0  X ` h ip it  x   ~ z z =&B"C[i&D@@7ID96A=F+DC!ii [iDNDD+!D8rq"^##Db EC EDD4ECE4.E.E%#EGE8E4\ELE4qE^aEE^vECE^EECE4E^EEC iE4ECiEF ^iiE42F ^iFFF7F4VF KF4kF^[F^iFg$Mi&F MiB9G EaoGfrcublencd|(gNhRil=m= o0p Pr Ts 6Xt=`upvrwtxvy+xz+}+idiilunri i ]]>6RSSrevS&R&R&R&R&R &R(&R0&R8&S@&FH&iP3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i ppr i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i 3 i &i\&`& d&O9h&O9p&=x&%] i        _ _   %] T    !   i i T  >6 F   It(#oG^8 R &= '= )=  +60 ,4W8 .>6@ 0=` 1=p 2 3-K 5H[ 6#'\ 7"1\ 9[ :K <1 >  @i Bi Di G H+ Qi Ri Sr \i e g h i j k li mi ni oi p+ q+ z i { i | i  i  i  i  i  i  i  i  i  i  i  i G^ G^ i i  +  +( 0 1`irq i4 [8_ @_ 0    ( 0_ It8N9G^HOSPFTQ=R={devS( T[ Ui`idVi Xi Yi!\i"^i#`i$ d ( e , ki0 li4 o ]8 pT< q @ rItHR"T" T[iBFToGsT  iMDT|(JVKFTL=M^frcuOpQSZ+\]_`absTde'gVsdbjKTk&Vm ip iu iv iwR&}&~+&i&R& &V+KTMifV[iVa1mMi $Vh *Y 3i W Z a 0Z c.& dS  mDZ( tbZ0 bZ8 Z@ ZH vZP vZX vZ` vZh vZp Zx Z Z Z Z  Z  Z  [ " [ * [ 4 7[ ; K[ E n[ N Z W[ X[ a[ g [ q[ yS     " i$ i( i, +0 +8 @ D  i@   iA   iC   iD   iE   iF   iG iL !P !X r`#VZRZTZ40ZR8 ZSDZR5ZbZFTi IZvZZgZZFT{ZZFTZZ4ZFTZZSZ4ZSZZR+Z4[RZ[FT [7[Ri#[K[^<[n[FTWH!P[[Rs[[RI[V[Z[[Z[[R[[i '\Y",\[i ;r\ @[i \MiL\ MiZ](]+-]h]dev ["i % & (i )i$4](5]87H8iL;^P<;X> `&^i>Mi^      4^5\6\7\8r9|X<_fdev=&>&?&B^&E&^&F&^&G&^ &H&^$&I&^(&LZ,&MZ0&NZ4&OZ8&R=@&U P|0``fdeva&b^&c=qd &eZ(|HՓ`fdevՔ&Ֆ&՗3ՙi&՜`&՞>6&՟=(&ՠ=8_ը`թ&^ժ&^HծAaկUaհnaձaղaճa մUa(յ a0նa8շ a@PaPa^Aana`Zaa`saaPaa4aPaaaPaa`a4a(]R`a$aa4bmy$b.b.b3b(ub = +  ub bUbV z`ba nb nTpbq zrbbb+7c׀BASCׁBׂB׃BTב_cג zד_cboc+מcן nנ nס zׯcװ zױcocc+׻d+׼!zb+׽ b+׾blmpi׿oc ׹ ?@Z A=(h,j-=.S/r0r 18(2r03884r@58H6rP7ZX8id8\9`:8d8phy;f<g=h>i?j@kAlBmC]nD[tExFhG`h`qGkr=sStru8 vZ$8idw(x,y80z2{3|4}Z8~8<r@HWSI#PXY8Z[\j kk8luniZ +JfXAl>6K  @  H 8P 8R8Ql+|l `l=^`8l@hH=P`h m = ^^08phyPaPX8Z8\^_h`x)`n*=+,-r .8(/r00881r@2H3I4hP8phy5`nX6=`7`plL8?n@={pg0A=.[iInSnT U^o_ ` c1od1oe n@poq8rZstunv=(w 88o8=p=88Dp= 8}p= M Y4q8iocZ  z 8Z<3b@ h i j=p^23=4R8id567z 8Մ@91X:;%<=>?@ADEG^F^ IG^8 J 6@ K=H L|X M` Pd Qh R8j Sl Tm V>6p W>6 X 6 Y [ \ ] ^ _ ` a b8 d e8 f# g8 h iZ j kZ l mZ nZ o1 p 1 q r8 s t uZ vZ wZ  x$ y% z( }0 ~1 2 3 4 5 6 7 8 9 : k@ k k kH k k kP 1 X   8 8     Z      8 8 8 8  " ف$ ف`   #6h >҅ ? @  Ad# B C D EZ FZ Ga H I J K L M N 6 O P Qi Ri( S zb0 T b4 U7c Vc W X  Y8 Z [ \z ]z ^  _  `  aG b d e=4q ,  ,}p/>C4X Z/ejZ8Gk/4 !!/ˀЀ4 /48!!?/-24G88/TY4i8/v{Z /ZفA6 A Z<8888 Z 88Z8 8"8$8&8( 8* 8, 8. 80 23848688:8 (a)=*r+Z,RS8T8UZVZ+/vńʄ4Մ]+5EH|=%]ioc088:;<8>[@a E@DZ+n8"oom #+Z++Z++/r%*H8Zw=w6nw&bw&bw(1\w%`HS UU dԆ+=#ĆKWԆ d+0#KX d(+ #KY( dR+#BKZR d|+ #lK[| C^  C_  C`  Ca  Cb  Cc  Cd  Ce  Cf Cg Ci  Cj  Ck  Cn Z dڈ+I#ʈKoڈ Cs> Ct( Ktr dE+#5KtE do+>#_Kuo Cx  CyD Cy| Kyr d+##Ky d+;# Kz C~ r dZ+#JCZ Kr d+#K dĊ+%#KĊ C> d+#C Kr dD+!#4KD dn+#^Kn C d+#C Kr K d+T#K C C Kr dn+#^Kn d+*#K C d،+ #ȌC، Kr d+#K dB+9#2KB C  C Kr d+ #K d׍+H#ǍK׍ C d+#C Kr dW+#GKW d+#qK C C Kr K d+L#K C1  C1 asc F&  F| Fr [i. ~.(Y  .&)  .(Y  .&) ^+4#N 1#^ 1^ 1"}  1q  1  [2   \2  ?1VO"1?5USM!{IS!? 5 FTF?֑5 8VFT528Z5<X8Z5~8Z58Z5ʒ8Z55  R?,Z h,25mM858nZ? Z?5صi25Éi֓֓V ZxiFTVFTxE05Q8#xgFT5 ~5S5?ɔ?ܔܔNDVܔ5Ri?,?  ?R5V5m5G^SiV}Y a[S#V8ʕSx IS5 R'\5?  2R?E?XVս jR?}??5n5 ?B G^5t?'?:?M? + `R?sV2S? * R5?ɗ>5*.&S?>V 1\xN1%%)x1\@@`x!+`W+?}885 Z? h?Ę?`nrhm? `nVZV 1Z?II6o5] e ]Vv w-K?85J G^ ]5Ǚ? S 4FT 585865aaZZ=.5y8K(5>#?5hZZ05 RJJr5785]`n+58rh|l5Z8+5ޛ`n[-5Z[-5n//8'5e__ZZ/5ZZ)$5ĜĜZZ8#5ZZ%?%r8h5_PPZZ],5ZZ)? V=i?ǝ8?ߝߝd1W1UV; !!:V@](SV} :a[V} La[?_?rVE S\?Z?Þ5 xk+-K+V3 r@58<?T8?l85n5Z5 FT5 ܟ8? V) SS5\$FT5]@FTF?.dSdSSN5FTRFT8'--V=!!<528(7? rrhx`##jV t::[9x5#_jjj152 !58 φ!5? !x=١S5? S 5? I hO24ѢW| k Q2$  Q2Ѣ U T U 0oh$i2h2W| F 2$  2Ѣ K92 0ʒU ʒU 0ʒ0ʒ0ʒʒU 0ʒ0ʒʒ7U ʒVU ʒuU 0U T Q 0*U U 00ɗMU Q 00hh1K0"0"0"0"0"0"0"0"0"0"0"000o1d1:5'1(1R5`/!`/İ  q/$  q/Ѣ   x/$  x/Ѣ  R /$  /Ѣ , /#  UsT Q > /#  UsT Q >W /#  UsT Q   /$  /Ѣ   /$  /Ѣ   /$  /Ѣ   0$  0Ѣ  Q 0$  0Ѣ   0$  0Ѣ   ?0$  ?0Ѣ   F0$  F0Ѣ %/d_/ Evd?/ zv/ͻż/Ƭ 3U 3/4 ܻ,B\my ?UsT}Q  /x U /ý!ż/!ż*/Y!ż>/!żR/!żf/:!żz/!ż/п!ż/!ż/f!ż/!ż/!ż/Oż/ż/ ż 0C D0 U|TvQv S0Ƭ 3U ,T049 FUsU0x U U T UvTU T ʕ U}T Q~m@U T Q1R~VXUs,pU|UssUvT ?Us U T}Q R F0X E$Us0IU|hT U T}Q R 0X U T}Q R 0X U T}DU T}QiU T}U T}sUvT  UvT 2.8.2hU. 'U.0R! -U|T }-u!}!}.}.}.~}-}!}.}}~0s-)! -U|T s-w! -U|T UsTvT2R00DUs DUs Us\-&'-$R, 4T1R0 yUsTv),Bioc,3 ,Z ,  ,j , h ,Gk ,8 ,r ,r ,+7rc,7tid, ,h % ,+ ,+ ,+ ,+\J,'J, L,Rt , , ,   ,$  ,Ѣ > , >, ,6, ,T, >~ , , , , , >0, ,0, >,0, e+Fw+ ݨ^ d+ vsUU#T  sUU#T Ԭ+oW+er Uss,Ӫ91@CO E alz 3 c  ku     T #T3%A0ܟ,1FSBf)5 Us F!S `my ż$,!ÉЉ.݉. (U|,2,9 FSBB)5 U~ F!S `my ?,Ƭ 3U ,@,69 F!SB)5 U| F!S `myA,z U UUU|UsU}U|j U|X#Uv;AU|Ts0ܟEfU|2~U|UvSU|U|TQvU|U|0ܟ0J0PU T yU|2++*+ioc+5-   +$  +Ѣ  +$  +Ѣ R\+<6ioc+,+<+A+8- uout+  +$  +Ѣ   +$  +Ѣ > z+!+İ  +$  +Ѣ   +$  +Ѣ   +$  +Ѣ ڹ+N++T rUsT Q :U|Us UsT}v$UsT}CUvT U(_UU#U Ts U Ts Q U Ts Q  U Ts U Ts Q :<\@+S6ioc@+.B+SC+XD+8-R uoutv+  M+$  M+Ѣ  / U+$  U+Ѣ ,]+!]+İ  d+$  d+Ѣ   k+$  k+Ѣ  . q+$  q+Ѣ ڹG+xa+T rUsT Q :U| Us(UsT}vBUsT}gU TvU~U(UU#U Ts Q U Tv$U TvQ  U Ts Q uGh +U6ioc +5' + + +#+++WE,+ >F+ >p+   )+$  )+Ѣ   /++ /++S+_ly..S_lyԬ w?wwwww~w;xx(xxWerU@ U@U@ ]U~T}+GÉЉ.݉. (U~Ԭ/+p,0+9%FS9 )5 Uv F!S `myW1+er U~TsU~U T~oXs2U~0ܟSܟUTQ*6iocQ*6'Q*>'R*ZT*|U* V*8*-*-*-*-*-> *  * * * A * * * -:GT JU|TsQ}* ƠҠ;ޠߠ%; MZ  ̩ hU}T $ 5BL  }ĭέ L DZeî  Юڮ*9 -.: UvT|*c%Ӫ!91@)CO E alz 3 c  u     (  #T3%-A: ܟU|* !!ØИݘԬU ;|;*b™`=!! UvԬCxD xxxxIx;xv x(xxW G er UT|M   ۸V (.xI 0E_O7 !! Uv(O Uvi U U Uv Uv U Tv B*P],{jw&  4ALQ'/ ^i E*R]*Ҕ^ה;+MZ  ̩(٩ک  @ T QH-ż/%ܻ9\ my ?UT@Q &4ALXUvT}37UvT| 3\UvT   (UvT}  U Tv Q}  %* '4 XUv*^,"rUvT0TUvT|  <UvT| U T}U T}/U T}Q  U T}Q 7*ER,_lyIԬlСEޡӪV91@ CO E alz 3 c  u     (  #T3%A ܟU|Wer UT}UUvQ0 UvT| U Tv *o!!ǗԗWer0Ԭ;F-K*T2G!@!MZer Uv2[!@!MZer Uv(2UvLU U Tv }UvTQ`UvT~ Q0U Tv U U 7U }U Tv Q R a*X U Tv Q R *X U Tv U d+# K \;*';** ]=*|,=*# @*,9,IF)zԬ HڹFSBC)5 U~ F!S `my ż%Ӫ!91@CO E alz 3 c  u     T #T3%-A: ܟU~W der U}T| U}# *!1>KerԬ% bz% tzzzzIz;z z(zzW%!er U|%u!,S! U Tv U|.*#%Ӫ!91@{#CO E alz 3 c  d#u     (  #T3%-A: ܟU~&*B$,$&$U Tv U {*)F~$x(!d%6xCxPx]x~hx*px@%ux(xx*&;!MZ  ̩(٩ک  u& T Q8!& ܻU|Qv,3!(9 FSB')5 U| F!S `my_!(mz U Tv R} 6(UvT~Q|R@H$X} ܟ(U| U Tv Q R !X [a)-iava,{-Fa~Fa~aIag*yԬ W*WYX*er U}T}p*U} ʎUvT ;a*aİС-ޡӪV91@,CO E alz 3 c  u     ( %A ܟU|8-UvT~Q~ U Tv Q R X  U Tv *3&3,S3@MZgFt~F~F~С-%y0ޡӪV91@=0CO E alz 3 c  &0u     (  #T3%A ܟU}v)%0 jwg/+% 2yԬW1WY1er UT}1U ʎUvT}%?2UvT~Q|R@I$X}ޙ^2UvQ~/2UvT}Y:0YG12UvQ02UvQ}X83U Tv Q R <%X  U Tv Q R 4%X  U Tv Q R Y} )3 U ) 4'#*08 -:GITԬA!4sS!6Ӫ91@6CO E alz 3 c  6u     (  #T3%A0ܟWU!V7er U}T|~8!8,77U Tv 7U  U 8U} Uvb*>p},= %2=J~jIsI{IOz!@:]jwi9T0q9U|i9T| @U T|Q0R X Ԭ!i:W ":er U}T}WR");er U}T}:A;U}u;U T~Q ;U}t;UvT~  ;UvTQ0R0X} Y7  <UvTY1@J<U T|Q0R Xs(b<U}@<U T|Q0R X}Ys<U}a<Uv<U}@.=U T|Q0R XsH=U}@=U T|Q0R Ys U}=U T~Q >U T~Q >>U T~Q R>U T~Q R}X~ U T~Q  *D?!?U Tv U Tv Y)*Vgt,+V.J} HX}e}r}}}}Ԭ@ڹ@XBFBSBA)5 U F!S `my żs!oDӪ91 @)DCO E alz 3 c  Du     T #U}T3 A ܟUW&E!er0DU|T}DU|T} EU|T}0s)RGӪ91@GCO E alz 3 c  Fu     (  #U}T3%A ܟU~h2GH~~ ;:G?;MGNW2Her0 U|_HU|HUvT  ;UvTi ]QwF~F~wHyI(wԬLIW|I!er U|T}s}KӪ91@KCO E alz 3 c  Ku     T #T3%A ܟU}WwGL!er U|T}sxVNӪ91@NCO E alz 3 c  Mu     T #U}#\T3%A ܟU}W PN!er U|T}W o Oer U|T}spXO -U}#\T *k @Pp}(.b -:GT4vPUvT~Q~R@I$X}PU|PUvT}GPUvT}Q}PUvT}Q0*QU Tv Q} U Q X}Ԭ QW Qer U|T}s #TӪ91@SCO E alz 3 c  Su      ( #U}#\T3%A ܟU}̶ Tݶ T ep%} . U %2UU T}UU  U UU| VUvT} UvT}YVU Tv Q}~VU Tv U T} *W,JW {"5W U  %UvoWU Tv WU  U *d "/.$X<IV#"/.<.I Uv7$^ER_lFy~F~F~v#Y jwg8#ZyԬ W[ZWYZer U}T}ZU} ʎUvT}С#]ޡӪV91@\CO E alz 3 c  \u     (  #T3%A!0ܟ&]UvT}%R]UvT~R@I$X}ޙq]UvQ~]UvT}/]UvT}Y:0YG1]UvQ0]UvQ}X8A^U Tv Q R $X  U Tv Q R $X $`,9FS`Ԭ #)_Q#_^i E*R]W#(`!er_T} `T} U}T}С#`ޡӪV`U}ʎ`UvT}  ǙU}T0Q d$cr.F~F~Ԭ#av#8b jwW#berbT}bT} U}T}bUvT}Q~bU}ʎcUvT};cUvT}ǙgcU}T1Q  UvQ~Gy$AdUbo|$dU Tv U YdUvqdUv UvY|*q,q)6CP]jwԬexLfxxxxIx;x'fx(xxWferfU Ug"/.<.I Uv%n!@g3M!ZFt~F~~6w" hHwԬ%IhWbher U~T~С fejޡӪ V%1@CO E alz 3 c  u     TСlQkޡӪV1@&k!COE!a!lz3!!!. #T3% A!0ܟWjk!erkU~T~ U~T~;qlv(.< -:GT$xGHm6xCxPx]xIhx*px#mux(xx%~mUvT~Q~R@I$X}mU~mUvQ0mUvT~Q~AnUvT|Q}*nUvT|Q~XnU Tv Q} U Q X}̶ Foݶ T ep%} .^ KXerF~F~Ԭ'}y;dyi*wy|(Oz :zż FUsС(zޡ -T *z;z* z*#{W(u{er UT}*{* {(S| >|ż FUС(|ޡ -T *|Ԭ(|(:}ż;aU}f*t|}y%( ~ }ż FUss&(P~ -T *w~;~* ~*~W0(2er UT}*Y* 4( ż FUs5(T -T *{*>C*QɀV*diԬG(H(lż***WP(3er U|T}*Z**(-͂U TU T} U7$T| BUvTiU T}U7T|;UvTσUvU T}U|7&T}]>UveU T} aUv U T}C)iCCCCC,<9 FU|*CcC*DD*~DD*D؅D*&D+D*kD&pDܟ>U| U T}Q|B)B,oBC;#Cφ(C, 9 FU}*6C3;C*{CZ|C ܟU} U T}Q}J)sXer.U T}iET0l]U| iT|ǝUvTs4UvUvPوUv ~Uv U Tv 0J))ioc)*)E|Xout-*-  )$  )Ѣ )6ioc):-   )$  )Ѣ <)oiaT00iC)Q^Fk~x,^& ܻ%B\ыmy ?UvT}Q| *;N&MZ  ̩(٩ک   T Q80Us6cUsT~QvR0X} ܟ{Uv U T}Q R P&X k)yF~F~Iڹw&~ &:(,5BO\ivIԬ%@$x%6xCxPx]xIhx*pxȏux(xx;*:/;;g ly(.& -:GTW 7&a!er U}T}~UsQ0 U}U T}U T~Q U T~Q  U 6w& oHwU T}%ϒUsT}Q~R0X }  U T~)@)n7@,ՙD@Q@^@k@x@@@@@@F@~;xA|}AAhz ̩ hT 7G#IGVG,HcGoG|GGFG~GGFG~GGGIH 2?L;H> HH; MZ  ̩ hUvT  UsT}Q~RvޙӖUsQ}ܟU~ܟU~ U T}Q R X  U T}Q R X ;AB*BϗB*TB YB*BBF< ɘ!FFFFFFFG;G.GT"G#GUsT~DU~T}Q}R}X}DVU~T}Q}R}X}}U T}U T}Q  U T}U T}#U T}JU T} U T}H)PHHHHFH~HHFH~H IFI~#I0I=IJIWIdIII*II*II;I՛I*II;II*I>I H2?L;I.JJ;IMZ  ̩ hUvT Hw;JJ*JJ*eKfK*JJ;J"J*KRKK;MZ  ̩(٩ک  3 T Q8*RKyWK؟ż!F%* SB)5 Uv F!S `my+ûϻ%ܻ9\my ?UvT}Q~ ʒגԬ *W-er U~TU~ UsT~Q} | ܻU}Q~ UsT}Q~Rvޛ֣UsT}Q}R|ܟU~ޙ UsQ~5U}T~Q1}U T}Q R mX ŤU T}Q R KX  U T}Q R |X  U T}Q R}X~p)~,vF~F~Iz&x,IԬ &o;;f(.& -:GTW &!er U}T}*[ \ U}*U T|Q \U T|Q  U ڹ&¨w& (wU T}4TUsT}Q~R0X~  U T~ U T}Q ),rF~F~Iڹ'u',Ҭ I$$x''ӫ6xCxPx]x~hx*pxux(xxԬ'*_#d*JW '!er U~T}UsQ0 U~ U R| U T~UPUsT}Q}R0Xv U Tv U T})+* $ƠҠ*ޠ9ߠ ;  MZ   ̩(٩ک  T QH%$%5BL% }ĭέ%L DZeî Юڮ/ -.: UsTv0%Ӫ!91@|CO E alz 3 c  Tu      (U#kT30J%-A:oܟ0JU Ts Q  Us)K6ioc)J-  q )$  )Ѣ >)!)İ JT0>)!)uİ JT0UsUUUwҴUseUswUseUs U Ts Q )6ioc)>-   )$  )Ѣ SU TU# Q hx((6iocx(= z()| {(],~ |(/} }()$} ~(#| (%~ ({ ( {(((8(8(8 (r{(j(Gk( ( h ((+W$) ַ ($  (Ѣ   ($  (Ѣ  : ($  (Ѣ  Z (+ (+  ($  (Ѣ   ($  (Ѣ   ($  (Ѣ  " ($  (Ѣ  T ($  (Ѣ   ($  (Ѣ   ($  (Ѣ   ($  (Ѣ   ($  (Ѣ  N ($  (Ѣ   ($  (Ѣ   )+ )+ Һ )$  )Ѣ ,;)!)İ m )$  )Ѣ   )$  )Ѣ  ѻ ")$  ")Ѣ   &)$  &)Ѣ  5 0)$  0)Ѣ  g B)$  B)Ѣ   Q)$  Q)Ѣ  ˼ V)$  V)Ѣ   W)$  W)Ѣ  / a)$  a)Ѣ  a s)$  s)Ѣ   w)$  w)Ѣ  Ž x)$  x)Ѣ Ԭ(W(@er UT{(;!F{F{׾UsT{Q{R|XU TvQ R g(X  UsR|С(ޡ -T v(  jw (T U Ԭ)}y)zzz,zI7z;?zDz(RzSzW)`!er U~6w 5) HwС=)ޡ -T  O)/ U 8i)2JWdqԬmWoer UT}U UsT{wf) [(wsl) -U{#\T U Tv3UsU TvULUsT{Q|R0X} qU TvUUsQ0wUsU TvQ|UsT|2U TvQ|WU Tv|U TvɜUsT}Q~R0XU TvgUsT|%$UsT}Q~R@I$X|IU TvޙhUsQ{U TvQ|UsQ0UsQ|X8/UsT|YG1#U TvQ|HU TvmU TvdUsT}Q}R0X| U~UsT}Q|R@H$X| Y(U Tv?U Tv`UsY{U TvU TvU Tv%UsT~Q~R0X} (U TvKUsT|Q0cUsޙUsQ{U TvQUsT|Q0UsQX8/UsTYG0CU TvQhU TvU Tv4UsT~Q}R0X| U Tv UsT}/U TvQ}TU TvyU Tv0J)](#ioc](7^(^(&8 `(+ a( 7ib(-W  g($  g(Ѣ )'jioc'< 'j '#j ' '# ' h '% h 'Gk '%Gk '= '+ '=-z   '$  'Ѣ  D '$  'Ѣ  d '+ '+ w (   (   (    (    (    (   (   (   (  A ($  (Ѣ  a (+ (+ t #(   #(   #(   )(   )(   )(   2(   2(   2(  > :($  :(Ѣ  Q ;(  d ;(  w ;(   F($  F(Ѣ   G(+ G(+  I(   I(   I(   Q(  ( Q(  ; Q(  V($  V(Ѣ dz+"#j)'ioc'< ') '  '8 'r '8 '-z Xout' 5 '$  'Ѣ  g '$  'Ѣ  '$  'Ѣ )'ioc'9' ' '+7i' ' '8 '8 'r 'hXout'-  _ '+ '+ r '   '$  'Ѣ  ' en\E'-6iocE'? G')$~ H'#} I'%~ J' }K'8L'8M'WĊuout|'  R'$  R'Ѣ >2o'!o'İ JT0 d }'$  }'Ѣ ڹT'vy'- jw-h'C;HUbo|Ԭ ';*`aW :'a!er UvW 'erUv UvW 6'!er UvT}1UvfU Q R}UT|UvU Q R}UT|Uv&U  U 0JuU TvU TvdUT}Q~R0X}ɜUT}QsR0 UT}Q}R@H$X}Y()'pioc'<'Er'8 'k 'S ' h '+-z   '+ '+  '   !'$  !'Ѣ  . +'+ +'+ ` 1'$  1'Ѣ  ' )&zioc&? &/ &  &8 &8 &Z-Ċ Xout'  &$  &Ѣ  K &$  &Ѣ  '$  'Ѣ )&kioc&<&_ &k &S &Gk &+-z Xout&  &+ &+ $ &  V &$  &Ѣ   &$  &Ѣ  ) &- &- &- &- &- &  & & & & & [ &$  &Ѣ  & )m&Ciocm&> o&], p&  q&8 r&8 s&Z- Xout&  u&$  u&Ѣ  &$  &Ѣ )@&ioc@&B B& C&  D&87rcE&-   N& N&  P&$  P&Ѣ d+(#)5)%Jioc%;%P %k %S %j % %+ %h-D Xout6&  %$  %Ѣ   %+ %+  %  5 &$  &Ѣ  g &$  &Ѣ   &- &- &- &- &- &  & & & & & : -&$  -&Ѣ  % )%ioc%5 % %k %j %FT %8-E  %$  %Ѣ Lk)%#ioc%1 % %FT)%ioc%>%| %$ % h %+ %8 %+ %+)[%ioc[%D\%$ ^%I-  u%$  u%Ѣ )%[ioc%;%| %8 %8 %Z  %j  %   %],  %Z  %![ %r-D   %$  %Ѣ  , 4%$  4%Ѣ  <%$  <%Ѣ )$ioc$4$| $r $+ $ h $8 $Z7rc$ $-  ' $$  $Ѣ  G $+ $+ y $$  $Ѣ   $ $  $$  $Ѣ  d+#)m$=iocm$;n$| p$=7iq$ r$ s$%B)$"ioc$A $%B "$= #$7i$$ %$I %$I-2   )$$  )$Ѣ  ^$$  ^$Ѣ d2+'#")#.ioc#+#= #j #8 #  #], #Z #r #8-   $$  $Ѣ  $$  $Ѣ )#dioc#.#= #8)#ioc#,#= #j #S #k #+ #8 #8 #r #+ #+)#ioc#.#= #j #S #k #+ #8 #+ #+\b#6iocb#2'b#;8d# he#+f#kg#SW > i#+ i#+ p q#$  q#Ѣ Ԭ i#bzj#:tzzzzIz;zz(zzWv#erUUU#U}T~SUU#,s#9FUs FUs/U}TU Tv ܟlUsoU Tv ܟUs),#ioc,#/-#= /# h 0#+ 1#r 2#87rc3#-  ` 7#$  7#Ѣ   <#+ <#+  C# C#   E#$  E#Ѣ  U#+ U#+d+#h#r '#(FT'#4 ,"#>"# ץ "# Us @U TsQ0R 2"ioc","58"@ "< "A "8 "7rc" "8 "Z- Xout #  "$  "Ѣ   "$  "Ѣ  / "! a "$  "Ѣ   "$  "Ѣ   #$  #Ѣ  #$  #Ѣ )"ioc"7"| "#-W  n "$  "Ѣ   "$  "Ѣ  "$  "Ѣ 8)"}ioc"A"| "+}-2  N "$  "Ѣ  "$  "Ѣ :)f"]iocf"4g"| i"]-   m"$  m"Ѣ  . q"$  q"Ѣ  s"$  s"Ѣ )!vioc!>!| !Z !FT7st!I !8 ! 87lun!Z ! !Z !Z !!v !( !8 !+7r! ! !- !XoutQ"("S"  !$  !Ѣ   !+ !+  !$  !Ѣ  C !$  !Ѣ  c "+ "+  "+ "+  $"+ $"+  *"$  *"Ѣ   -"+ -"+  E"+ E"+ G I"$  I"Ѣ  U"$  U"Ѣ ,6)!Eioc!F!| !  ! !)E7rc! !8-Z   ! !  !$  !Ѣ dZ+,#J)`!ioc`!La!)E c!I-  q!$  q!Ѣ d+2#).!yioc.!@/!| 1!k 2!Gk 3!r 4!+ 5!*yXoutQ! A!+ A!+) Yioc F *y  I-Z   !$  !Ѣ  * !!$  !!Ѣ  #!$  #!Ѣ )| ioc| ;} |7i   8  8      +7rc   *  Gk-D  8 $  Ѣ  j $  Ѣ    +  + $  Ѣ m), ioc, A- *7i/  0 8 1 8 2  3 I 4  4 -2   H $  H Ѣ   I $  I Ѣ  m $  m Ѣ 2iioc098 / 0   Gk  Z r-   $  Ѣ   $  Ѣ   $  Ѣ  G $  Ѣ  y $  Ѣ       $  Ѣ  - - - - -  H     )2;ioc222;8 4  5/ 6Z 7Gk 8r 9+ :S ;k <Z-  9 L+ L+ k X$  XѢ   b- b- b- b- b- b  b b b b b m$  mѢ \G6ioc<'Gkk-z   $  Ѣ   $  Ѣ  3 $  Ѣ  e $  Ѣ   $  Ѣ   $  Ѣ   $  Ѣ  - $  Ѣ  _ "$  "Ѣ |U|Q0U T}Q XsU T}Q U T}Q >U T}cU T}U T}Rs0U T}Q U T}Q 9U T}Q Xsoܟd76ioc9'Br'8', ;MZ  ̩(٩ک   T Qx ^ $  Ѣ   )$  )Ѣ   /$  /Ѣ >77 h7z  ̩ hT  :$  :Ѣ   D$  DѢ  B O$  OѢ  t \$  \Ѣ Ԭw0Uwwwww~w*x1x(xxW erU}T~ U}T~Ԭw,wwwww~w*xx(xxWerU}T~ U}T~@qż$xe 6xCxPx]xIhx*pxux(xxVwl!dwqw~wd  ܻU~QsWe!er U}Tv U}UR!UsT~QR@I$X~ޙz!UsT~Q~!U}!UsT~Q0!UsT~!U}"UsT~Q0="UsT~Q00J"U Ts Q R X "U TvQ~R~ܟ"U~%#U Ts Q R X k#U Ts Q R X #U Ts Q R X #U TvQ R :X =$U Ts Q R )X ]d$UsT~Q|$U TvQ R DX $UvT~Q~R|X~%%U T}Q R OX C%UsQ|i%UvT~Q07%UvTs U T}Q R \X \ 36ioc -,  ; MZ  ̩(٩ک  {, T Q8 , $  Ѣ  , $  Ѣ  0- $  Ѣ  By-2?LB- X .2?LXT.. ܻU~Q.UT~ .UT~Q}Rsf/UT~Q~RsA/UT|Q0Y/Uޛ/UT~Q~Rs/UT|Q0;/UT|Qsܟ/U~ܟ0U}%.0UT~Q~R@I$0Jn0U T Q~R|0U T Q R X 0U T Q R |X @1U T Q R hX 1U T Q R aX 1U T Q R [X 2U T Q R RX X2U T Q R KX 2U T Q R EX 2U T Q R ;X *3U T Q R 1X p3U T Q R X 3U T 6UT~Q~R@H$\;6ioc17  ; MZ  ̩(٩ک  6 T Q8 F7 $  Ѣ  x7 $  Ѣ  7 $  Ѣ  7 $  Ѣ  %82?Ln88 ܻQs 8UsTQRv 9UsT~Q0>9UsQ~ RX~a9UsT~Q0ܟy9Uޛ9UsTQ~R};9UsT~Qޛ9UsTQ~R}:UsE:UsQ0R|X1Y00J:U Ts Q~R~:U Ts Q R X ;U Ts Q R X 9;U Ts ;U Ts Q R X  U Ts Q R X io$@6$@6ioco+'o3'o?q$@rhW>=Rz z ;z MZ  ̩(٩ک  a= T Q = $  Ѣ x r>"!/<IV*c2>h;vM>{(>ż?%ܻ9\?my ?UsTQ| ?UvTTQ0 U Tv QsX~)Bioc1 Z h h h7i7j  7ret  r  -  A $  Ѣ  FA $  Ѣ  xA $  Ѣ  A    A '$  'Ѣ  A )$  )Ѣ  B .  "B .  TB 1$  1Ѣ  gB 3  B 4$  4Ѣ  B 3  ?$  ?Ѣ )Cioc7 h h-W  6C   IC   {C $  Ѣ   )Dioc/ h h $@ $@-  D   D   &D   9D   kD $  Ѣ  ~D    hD F6iocC'h'4h''ZZ FQE!.F;F!HF!UFbF.oF|FF U|TĘFU|TXs U|T)Fioc<h 7iZ  Z2BƏ2GiocB@ChD2GD-H! Fh F&h GƏ H "G K  K h2Hioc;h7sz8  87i7j   / 8 r    -D Xout) (H    ZH $  Ѣ  $  Ѣ )*uKioc*97sz,8 , 87i- .  // 08 1r 2 2 3[- 4h 4h 4&h 5$@ 5$@ 6j- Xout I ;  I ;  I ?  I ?  I ?  I ;  J I I  PJ K$  KѢ  J m$  mѢ  J |$  |Ѣ  J   J   J   K   K    RK $  Ѣ  eK    d@B_6ioc@('@18'@:'@JZB,CB_DZMo U T}Q R o -:GT JUTsQ},\L G8 |)[aioc1j 28 (7-  ` ! ,a $  Ѣ  $  Ѣ )9bioc098 28 (7 j- Xout a ! b $  Ѣ  $  Ѣ \6ioc.'EZ'B_'$8Z#8IIIZjGkSkIWR c P$  PѢ  #d U$  UѢ  Ud X$  XѢ  d \$  \Ѣ  d d$  dѢ  d n$  nѢ  e q$  qѢ  Oe s$  sѢ  e v$  vѢ ,\fzL e |$  |Ѣ {8f!.!. U TnS2jԬfїiEgV ٭ 9  q  !   ġ %-˫׫ % (B i # 5@  (  #UWjer U UkCXn}GQmYdo|Ҵ r lVdr*hlʵٵ5lUT@ U2T@s +Ҵ .˱ڱ*=n )9 U;T@kG~r}GwqYdo|Ҵ r pVdr*pʵٵ5pUT@ U2T@s +Ҵ .˱ڱ*cr )9 U;T@kEv}GuYdo|Ҵ r tVdr*tʵٵ5tUT@ U2T@s +Ҵ .˱ڱ*v )9 U;T@kIz}GyYdo|Ҵ r yVdr*xʵٵ5xUT@ U2T@s +Ҵ .˱ڱ*z )9 U;T@kK~}G}Ydo|Ҵ r 9}Vdr*}ʵٵ5}UT@ U2T@s +Ҵ .˱ڱ*~ )9 U;T@ b*7DԬ mnEzV ٭ 9  q  !   !L %-˫׫ % (B D # 5@  ( #aU~T1 #U~T2WerтU U UСjVޡ -U~T q*] qns_ -T ۓ(U|OU TvU T UsTQ0R0τU TQU T~RX  Y  ;U T~`U T~U T~QRXY}UUUU T U TR~)<I?<Ld'R'7ZG} U TvQ R } -:GT JU|Qvd 'vN`mN  !m`̶EOݶ T ep  $øθh T y4B[ӋFBSB`B͐hӍې i ͤߤ&4 7B9 *8%   *B*l̨ O/ a"]sn  U?Q1YҒۓWUnUT0Q6R)X7 UwUTDݎQ0YҒ0M UQ,UTD1NUTDfT~4vUTQDvUTDQB vяUT~vUTD UTR~v3UTDfU T}Q  Q0YҒd+ #)͐.Z88 )ioc+BZ, 8 ,\6ioc3Z%B =7i 8 87a87b 8 !-   + +  0$  0Ѣ o)X%8a2b:\6ioc7'@8 hk+WW  + + * $  Ѣ Ԭ SbztzzzzIz*zۖz(zzWNerSUU#fU~ U Ts Qv )wiocw>x* z| {* |+7i} } ~8 ~8-  F + + Y    $  Ѣ   )&љioc&9'(Y  )| *(Y  +8 , -+7i. . /8-  \ C+ C+ | U+ U+  V   b$  bѢ  V it6ioc5'>8!>Y > ڹڹ  ,39 FSB)5 Uv F!S `my,9 FS )5 Uvw UsTT ($Usܟ<Uvw_UsTT  3Us!6iocA'J8!&, , ڹUڹ+)9FS,a`mzԬGWer U;İvUsTv.UsT1FU UsTvU Ts Q ŠU Ts Q U Ts Q  U Ts Q} Rv!ʥץ,Ԭ!W er U@*n~oİU@ UsTv U Ts Q} Rv, 9 FSB)5 U| F!S `my ܟU|pDp)ioc? 88 ! Z7i +-Ċ  פ $  Ѣ   $  Ѣ  ; $  Ѣ  [ + +  $  Ѣ  !>)v~iocv8vA8vKMw Y y~7iz {+-n  < + + n $  Ѣ  !1dE.6iocE6'E?8'F'FZH8I#.J!v-  l N$  NѢ   T$  TѢ  Ч \$  \Ѣ   c$  cѢ }!UsTR?UsTvUљcUUTT U Ts Q R TX ԨU Ts XvU Ts Rv U Ts Q >5\&6ioc2';8#.8!-   $  Ѣ >("" ;"MZ  ̩(٩ک   T QH Z ($  (Ѣ   .$  .Ѣ ,2!2İ%Hż'F%ܻ9\/my ?U|T}Q~  ^Us|UsT|UUQ0UU TU# U Ts Qv R|SU TU# Q dI6ioc5'>8''ZI-E   $  Ѣ   $  Ѣ Q^i E*R]}UsTRUtۯUUTT !U Ts Q R X  U Ts Rv>p {iocAZds(6iocs/'s88'sA'tZv8w#.x!vz!{8|Z}!-   $  Ѣ   $  Ѣ   $  Ѣ  J $  Ѣ  | $  Ѣ > ;MZ  ̩(٩ک   T QH  $  Ѣ   $  Ѣ ,!İմżӵ%ܻ9\my ?U|T}Q~ }UsTRUsT1-UsTvJUsT4bUsUsT|vUsT|UљUUU Ts Q RvU Ts Q XvLU Ts Q ~U Ts Q ķU Ts Q R X U Ts Q  U Ts Q R|\26ioc+'48#.8jGkkr+!Zh- uout[  $  Ѣ  ƹ $  Ѣ   + +  + + 8 "$  "Ѣ  j '$  'Ѣ   ,$  ,Ѣ  κ 2$  2Ѣ   7$  7Ѣ >9BB ;BMZ  ̩(٩ک   T QH k H$  HѢ   N$  NѢ ,R!Rİ̶ݶ T ep%} .Q@^i E*R]Ԭ uWerʾU}TU}T U}TvW jwС]ޡӪV91@CO E alz 3 c  hu     (  #T3%A ܟU|s_Ӫ91@CO E alz 3 c  u     ( S#T3%AoܟE8żG6%ܻ9\ my ?UvTsQ~ Ԭ kWerUT@UT@ UT@S )e@T1XU}ʎvUT|UT UUTvUTQ0UT8(UIUTU TQRU TUU TU# Q RT UU TU# Q KU T QwU T R}U T R|U T}QRU T} U T QR)iocL+7i 8 8)iocG(Y 7i 8 8hpB6iocpD'qstjuv+,{   + +,{ > > Ԭ?v jwСޡӪV91@CO E alz 3 c  pu     T #T3%A0ܟW !er UT~w!wwwww~w*xx(xxUU| U|hGO6iocG0'G98IJFTKj- gMyԬWWYaer UTsyU ʎUvT~СcޡӪV91@CO E alz 3 c  wu     ( S#T3%AoܟiT0qUsiTs @U TsQ0R X Y~)*ioc*4 , -FT- hxa6ioc1'r'$hFTi4T0iLTs =Ush=6ioc5FTiT0=UsTvi Ts @U TsQ0R )q4FT7r)2FT7r)`ioc`7 b|2E|7iocEL G+ H| ' J+ J+ L 86ioc86:|< ƠҠ;ޠߠ%; MZ   ̩T٩ک  T QH%$%5BL% }ĭέ%L DZeî ЮڮA -.: UvTsB%Ӫ!91@CO E alz 3 c  u     ( S#T3%-A:oܟ)&9ioc&> (|6ioc9'&ߝ|sz8 ,-----  [    }   -:GT EƠҠ;ޠߠ%; MZ   ̩T٩ک  T QT $ 5BL  }ĭέ L DZeî  Юڮ -.: UvTs%Ӫ!91@CO E alz 3 c  uu     ( S#T3%-A:oܟ) ioc 7 |  +  +  +) wioc - H|  + g  +  +  #i p' $Z% ! İ  $ $  $ Ѣ   5 $  5 Ѣ  P T $  T Ѣ  T rU}T Q |] 3,6xU}T@QDRvXsY|_U}U}T1LU} 6U}T@QDRvXsY| U T} Q|RsX-=  F:Q[U U U U  U =U}T0 UU}vU}TUT~ MU}Tv vU}TQ|UT , $ &#U}T0DU}TlaU}T0~U}T4U}TsU T} QRXYs3U T} Qv RsX  YeU T} Q TU}T lU}T0U T} Q U T} Q Þ+U}Q~R=lHU}T0mU T} U T} U}U T} Q U T} Q @U T} Q <bU}T  lU}T02 6ioc 2 ;8 Jid Jlun J & 087rc -  $  Ѣ iy i6iocy 1'y ;J6idz J6lunz J'z 'z "8cv 5!uv!v!v!vvv tUsT~ vF !v!v!vvw tUsT} X sM6iocX 5'X >8Z [ FT\ i2T00i0i< s6ioc< 3'< <8> ? FT@ iT00i0ii! 6ioc! ('! 18'! :'! JZ# N,, -, -, -, -, - ,  C ,  ,  ,  e ,  , ,  -:GT}UsTR eUsh 6ioc .' 6 IWR   $   Ѣ SU TU# QTi e  &FTU' AW'  H!R    V,  z z z> zd 4' ,FT6lim GZ R40UT@0U TsQ0R 1UT@a1U TsQ0R X @1U TsQ0R X }B1UT}Qs1UQ@*2U TsQ0R X @a2U TsQ0R 0J2U TvQ R H X 2U TvQ R X C3U TvQ R ] X 3U TvQ R X 3U TvQ R O X  U TvQ R X ) >4ioc + DFTdo 86ioco 8'p  hr Ĝ s %~ t ],~ u  }5  ; MZ  ̩ hU~T /6 $  Ѣ  a6 $  Ѣ   62?L 607UsQ}P7UsT}QR@H$Y~ܟh7Uɜ7UsT}Q|R@H$ܟ7U%7UsT}Q}R@I$0J+8U Ts Q R X q8U Ts Q R | X  U Ts Q R X )E 8iocE *F FTF  H \ p=6dev  FT< Ts5 <. Ts<U|=UvTQR@H$X} Y(0J U TvQ R  X \A6dev!FT   > + + > $  Ѣ d >vҧ?ߧ BݨK? TsԬ?zz@zz{{{I){;1{U@6{(D{E{W@er@U} U}ҧQAߧ.  TsiAU}AUvTQR@H$X~ Y(0J U TvQ R X 24Bdev FT  2}Bdev FT7ioc  \zD6iocz:'{8'{"FT }  ~],Z8Z-  nC $  Ѣ  C $  Ѣ %CUvTQR@I$XT @DU TsQ0R 0JbDU Tv Q R X  U Tv Q R X )CXEC)FT Ek FS GR7iocH Ij JGk K+ ;E X+ X+ d+ d+iO''FTRdRWW ;WMZ  ̩(٩ک d T Q@ d b+ b+ d s+ s+ e + +>3e 5NeG*TeU gUsdO evԬf̶fݶ%T ep } .W ger U~TvԬs;gtj̃كIE{2hV%٭9 %q !   *Yh*h~jġ %-˫׫ % (B Nj # 5@  ( #ejT1 #T2*j(()W &ker UT~Ԭ b[kzc lzz{{{I){;1{k6{(D{E{W m_ler UvwlU~lUslU Uv9l96FT9@ ;R7ioc<it'.FT'8 R7iockj+# m + +Ԭ%n!nq!E o!V ٭ 9 ! q  ! !  !!L %-˫׫ % (B p # 5@  ( #pU~T1 #U~T2СKsޡӪV91@sCO E alz 3 c  ru     (  #U~T3%A ܟU}W!s!er UsUsTv|v $| $,(@tU TsQ0R  UZcv6ioc7'@8ZGk @+-  | B$  BѢ  | G$  GѢ  -} M$  MѢ  R+ R+)}ioc=F8 Gk +   + +)~ioc3Gk +  -  W~ $  Ѣ  ~ $  Ѣ  ~ $  Ѣ  + +)]ioc> Gk + 8 : + + M    pGkioc4=8 Gk + + +iGk6ioc6'?8Gk>Y > > >׀ EV ٭9  q !    ġ %-˫׫ % (B g # 5@  ( #Up#\T1 #T22vGk8iocv9idvBw yGk  }   }  (    2hGkioch2h;r jGk k+ m+ m+iGGk|6iocG4'G=rIGkW>4M >^M >Q >Q EKxV ٭9  q !    Xġ %-˫׫ % (B B # 5@  ( #bUp#\T1 #T2)1ioc142j 4+-   6$  6Ѣ  >+ >+)ioc/j +-   $  Ѣ   +  +ioc>r$h j + + +)sioc8A8 j + + +) ioc2j +-   $  Ѣ  + +\fg6iocf?'gj'g6FT'hSWĊ  {$  {Ѣ  ܋ $  Ѣ   $  Ѣ  @ $  Ѣ  r $  Ѣ   $  Ѣ U@܌U TQQ0R @U TvQ0R Ys@QU TvQ0R vU T} U T|(Q U T|(Q XsUU TR#(Q U>U TU# U T} RspRjʎiocR4R=8 Tj U+ W+ W+i3j6ioc36'3?85jC>c9 >9 >= >= E7V ٭9  q !    D!L %-˫׫ % (B q # 5@  ( #Up#tT1 #T2p$jioc$2%r%$h 'j (+ *+ *+j6ioc4'r'$hj, >ד >  >+  EV ٭9  q !    !L %-˫׫ % (B  # 5@  ( #ҖT1 #T2pjnioc4` j 8   K   ^    2Gkїioc6k7retGk + + +2Gk ioc8k7retGk2jnioc6k7retj + + +2jioc8k7retj)3ޙioc363A 4Z 6j 7Gk 8 h 9r :r ;r <8-  } `$  `Ѣ   n$  nѢ  |$  |Ѣ d6ioc0'98' ],  ~Z-   $  Ѣ  ܚ $  Ѣ %UsT~QR@I$X}0JbU Ts Q R X  U Ts Q}X Y 2 r,rr 8) 7rc|p$@ioc1hphyZ $@ $@ v       he6ioc0''hhW,< ,Z ,x >  ; MZ  ̩(٩ک   T Q8  $  Ѣ 4 ܻUsQ} U T| QsRv2nn rn:8o!2_џ_"r`џ2QQ"rR:27val7$Skp7D 7ret97ioc:-   ?$  ?Ѣ   A  A P|:len6e|e e Q =5|Q -=5|Q S:r-Be 2s'Z)p9Gk)r2B  )Сp9Gk)TsT7j)OrO1B Q )J-sJ7jQ ?=  :sz 'ji jmfp Å-O  C $ C Ѣ  ޢC $ C Ѣ  C $ C Ѣ C $ C Ѣ dO+#?P!Z=FR:tagjreq^jhwq8)  :R O) K K9R KMi2   @Rdev 2 5 ;R2 !Rddev =  2   2R)XcmdX4ZX>]27iͤ7AZ20Z07Z7rq2^2  @ZPi7:cmd=ZQ]:cmd5Z=GiPi{:cmd7ZP :cmd5ZP^=@Z2ץ8FT26 6HFT2w#S&wCFT y P(ZO:rq(2^e*i2nrq9nY2 rq6^2^pdu8 2.Ѧrq.:^2) ?Arq)@^1+ 2 8 0Z28;0Z2 ^h Dtag iP:req=^QLͧ:rL1:devL=LkeLjrdLͧQK:rK1:devK=KeKjrdKͧQJ`:rJ1:devJ=JeJjrdJͧ2fSf:h2\ \5Qe=e(i2iبqMب2 dev:2pSdevp9PWS;=W>2 % h ;! G2( nD!N!Z  !2|. |D!|P i2%i!QTӪ:xT7-KCW# P>=>)B=>6GQ+=+*BQ1=+B2 C!Or CC:2 1!zr 1E: 1MH!2 i "r 1: 9H!7old ) ׫r -:Q :r /:= 7H!Q 5:i :r (:= 0H!jold Q {W:r {-::n {4)@4WT+ + +)54W)]Ԭ]34W2D(VDC4WV+ V+V'Vx +3VVEVP3c=3D#2 i v + P :i :v +Q A٭:v A:i AP :v 2 #i "v /2 Li "v /) qv i !2 v !P[î:i[6:v[Ce] Q:v7:i>P:v=p##:$-%-&-'-(' p1U 1U 1U 1U 1U  1UG ѯ1UG 1UG 1UG1UG 1W 1W +1W :1W I1W Z1WG j1WG z1WG 1WG1WGpk:-- 1 1 1 1 1 -1G =1G M1G ]1G1GpIGpNq.S - - 1 ˱1 ڱ1 1 1 1G 1G )1G 91G1Gpg!pg!Nqg;XgE! i- j- k ! k! l ! l! ٲ1| 1| 1| 1| 1| g *1|G :1|G J1|G Z1|G1|G v1 1 1 1 1 ó1G ӳ1G 1G 1G1GpҴp9X -7ret G1 V1 e1 t1 1 1G 1G 1G Ĵ1G1G":pAX=Te-e-jret ! Vj__pIe!e-e! ds rs s s s sG sG ʵsG ٵsGsG2#! 3!C!  !2 #!Z 3! C!   !P3!x=3<P!+=!3W=!G+jval!+P̶:nZP:nr+=;=PR#:nrR5=RQ#7PDQ:nrD3=DO#Q'v:nr',='H#Q:nr*=F#Q^:v^O=^Y!QP:vPJ=PT!QB :vBI=BS!fls i6x i-i7r kP &+T= B+P }:nr += ?P :nr 4= Ve P ۸:nr 4= VP :nr = :#jc P E:nr = 8#jc Q Hj:nr H= H1#Q 4:nr 4= 4/#Pڹ:nr+=@jpWe+jval+2ss61u e2j7j8jVh3'35j'4j7ҺSܻUUQT FUs)((0j(Hj),4jQF=/jQ`=7jQ=2j=KjsQ:new4j=KjQܻ:new/j=FjQ:new1j=j=jsPj\=jFjjretleojepjPA:newA@j=Bj=CjjretEQ#м=#5j żs%s&Q:ptr<=H!=P,*:p,;=,KiP(R:p(:=(JiO~Yo~~ Ԭ ʽ;:?*M NWZerSUU# UvO4B,yFBUSB`BOܻ/B\imy ?UsTvQ| O *οSܟUUtO O*6SܟUU\'3.@O7'.3@ @$Ƭ 3U *K*rC U  U  ١UUTTO=KXe=WKXe@U TsQ0R X  Us$UsT2U@"U TUQ0R  @U TsQ0R @U TsQ0R  $UsT2O-(B  # 5@  ( U#UUT2S#T1Oqnq!.S@U TUQ0R X @U TsQ0R  UsOF!SBz)5 Us F!S `my )6CP]jwI* !"İ+"tT rUsT Q :U~UsUsTvUsTU|T U(UU#U(3UU#U(OUU#tU Ts U(UU#U Ts Q ÞUsQvR8(U~UlUUT0MU Ts Q U Ts Q U Ts U Ts QD R|O:-yߒQҒQ^i E*R](} 9D H !,(8.9OӪ$91@CO E alz 3 c  u     (S#T3TUUO}}}}}~Ԭڹx cż FUsWer Us -UsT >U T|cU T|U T|RsU0ܟS~UUOs~ Ԭ5ڹ ż FUsСZޡ -UsT WerSUU#U Tv  UvnTsQ0R0 UvO`<zn.{4-VԬ-ڹ-*4 5 -! L %-˫׫  UsY1Y0W -@!er U}T| U}s F-!. UvTsСG-!ޡ -U|T ZK-!!ڹ-- ż FUsС-W!ޡ -U|T  -=!!L!  -˫׫  U|Y1Y0!- ܻUsQvW #-er U}T~ U}СL-M!ޡ -U|T ]eUv Uv\yyjywyyԬ %ܻ9\my ?UvT}Q W2erSUU#JU~ U Ts Q O yduy%y2yԬ ,9%FS9~)5 Us F!S `myWHerSUU#`Uv ܟUsOK.ڹd<`qO^%Ӫ!91@$CO E alz 3 c  u     T #T3%-A: ܟUsԬ JڹK*'(NF0SB)5 Us F!S `my żWQerU}T| U}T| U}5%Ӫ!91@CO E alz 3 c  u      ( #UsT3%-A: ܟUs NUsØИݘ+wʛ!כ֟ ! !ße w!![9ʛכ֟ ! ßewiYʛכ֟!(!ßew!!U Ts Q R}U Ts Q R} U Ts Q R}O"/<IԬvFS9)5 Us F!S `my żСޡӪV91@CO E alz 3 c  u     T #U~T3 A ܟUsWerHU}T|UdUU# U}T|СޡӪV91@xCO E alz 3 c  au     ( S#T3%AoܟU}ʎUvTs  UvTsO3 -:Ԭ k v % %-˫׫ % (B 8 # 5@  ( #VU@T1 #U@T2 ż %ܻ9\my ?UsTQ~ *g"< ż G %  % -˫׫ % (B  # 5@  ( #'U@T1 #U@T2N `l U @QsW erSUU# U}FHԬ<#y=#7zzz,zI7z;?zDz(RzSzW>#erU} U}*;C#MZ  ̩(٩ک   T Q`V#TØИ.ݘ......+ KUvTsQ1W W#er U}T| yRS#y%y2y,9%FS9)5 Us F!S `myW per U}TvU} ܟUsUvT|QHU}zUvTsU}+T1R00J~U Tv Q R 7#X  U Tv Q R E#X OD D.D.D.D.D.D.E.EDCDDDDDDEEP  T5T @G*T+U gUsԬXuїYEV ٭ 9  q  !   ġ %-˫׫ % (B L # 5@  ( #iUT1 #UT2s_Ӫ 1@CO E alz  3 c  u     ( СkޡӪV91@CO E alz 3 c  u     (  #UT3% A! ܟUsWl%!er U}T~Ԭ dZneo Eg V ٭ 9  q  !   !L %-˫׫ % (B 1  # 5@  ( #N UT1 #UT20ܟ U} U}$FF~F+~8ER_v  jww (w88 JWdqԬmh Wo er U~T~ U~ UT|Qp^i E*R]sӪ91@CCO E alz 3 c  "u     T #U~#\T3%A ܟU~Se;y~;MZ  ̩T٩ک   T Q`n!$%5!BL% }!ĭέ%L D!Zeî !Юڮ$x6xCxPx]xIhx;pxux(xxS DeT{ Ub{o{,|{ġ %-˫׫ % (B ] # 5@  ( #zUsT1 #UsT2 ܻ%B\my ?U}T|Q~ %:ØИ.ݘ......+ KUT}Q2W er U~Tv U~U TsQ RvX|U TsQ  U T Q X}s Ӫ91@TCO E alz 3 c  7u     (  #UsT3%A ܟU};RT . -:GTO| !]|j|,@!w|Sġ %-˫׫ % (B k # 5@  ( #UsT1 #UsT2T ܻ%B\my ?U}T|Q~ W Uer U~TvQ d^i E *R]Q Y ^i E *R]Q a ^i E *R]}] !}}.}}~ UT}'!U~ T2R0y!U T Q X}!U TsQ RvX| U TsQ 4"UT~QR@I$XvG<"UT|Qvn"UT~Q~R@I$Xv0J"U T Q R X #U T Q R X 2#U T Qvx#U T Q R X #U T Q R X  U T Q R X OQ$"/<IV*c$h;v${(O( E%V ٭9  q !    ;%%**8 &= *Kw&P*^&_!L %-˫׫ % (B h( # 5@  ( #(T1 #T2O/ÉЉ݉Ԭ )*F:*S9))5 Us F!S `my żС,ޡӪV91@Y,CO E alz 3 c  <,u     T #U~T3 A ܟUsW)-er,U}T|U-UU# U}T|СU/ޡӪV91@"/CO E alz 3 c  /u     ( S#T3%Aoܟm/U}/UvTsQ~ UvTsA -FT~Fa~n{IG:6w0Hwv1 jw>A2ʒגԬ*1W-2er U~T~2U~ UsT~Q~Q2^i E*R]С4ޡӪV91@4CO E alz 3 c  r4u     T #T3%A ܟU~$xr56xCxPx]xIhx*pxM5ux(xx;r6;MZ  ̩T٩ک  S6 T Q`7$%5BL% }ĭέ%L DZeî Юڮ;U<8Zgt(. -:GT|:,:?M9!L %-˫׫  UvY1Y0@9 ܻUQsA/:ØИ.ݘ......+ KUsTQ0W B:er U~T|:U~ UsTQ0R0 U T~Q СG;ޡ -UvT ?!.,>; X<!L %-˫׫  UvY1Y0 < ܻUQsW  =er U~T|Q =^i E *R]Q %>^i E *R]s"d>. UsT|>U~ >UsTQ0R0]>Us Us U T~Q %5?UsT~Q~R@I$X|A[?UsT~Q|?UsT~Q00Jޙ?UsQ0?UsT~Q0@U T~Q R X b@U T~Q R X @U Ts Q R X @U Ts Q|AU Ts Q R X FAU T~Q|AU T~Q R X  U T~OXBʒגԬ *7BW-Ber U~TvBU~ UsT|Q}OgMCyԬ W8CWYCer U}T|CU} ʎUvTs ODÉЉ.݉.o(O]MEo|Ԭ DWDer U}T|DU} UvTs Obz1EtzyzTzz*zEz(zzOx14FxyxTxx*xFx(xxOw<FwywTywQww*xFx(xxOl ,GllllolOK 8H] j w    y y y y  :GUv #HUsT  QDR@XY (UvONNHy`UymTN !m`OSJ_ly..S_lyԬ jIwJwwwww~w;xIx(xxWvJerUaJUU# U~JU~S]UUJ W++G+XGWQW]uWWWWint],W*W[s8i[u8|[s16[u16,[s32=[u32[s64[u64]0 W+1]2]HIX]^_`QWW$%&'(<] N !#W%&4=B^+h=m,nN} Z f f f ] ] f) ) Z    @h hhm@hQ+* +W=    E JkTH S G  K "Z }  $( %0 G8 %@ #H #H #H H #H #H #H #H:@q = ZPhGGJA F]5@kpK ](],A0 F8@AB]D PHEPrmemU@+ ]fku -(0]8@]H]LP]X`]hp x]]%]]]#& ]!#&"]%&)9]:?AD OF P Q](T%0 ; Qcs=fQsl?fQwfeAf E? QssGfQstiIf7KfQnmiMf7Pf 7Sf07Vf8QlmXf97]f:7df<(l Rcs,Rcsxfq ( Rss,Rssxf g r15m+ r14n+ r13o+ r12p+ bpq+ bxr+( r11u+0 r10v+8 r9w+@ r8x+H axy+P cxz+X dx{+` si|+h di}+p+x ip+$? + sp+$l BW C,D,7E, 7E,(QsE,,QdplE,-QpE',/7F,0QavlF,4QlF,5QdF,6QgF%,77F+,8+++++) pteW " ) pmdc " % %% %/ s' !pgd'{ '"sp B!pudpo p")\a*@HI+Mg$g0 4+8(ef+gh uv=w= keyx  U7V $jT!keyknq!keyo  ; <  = 7 ? ] 7 @ ]$7 A ](7 B ]+:-@! !W4!]!]!  !9(! ],!!]0!( 4!) 28!*]H!++P!,X!5 `!6 d!8 h!: l!; p!< t!=]xdse!?XD@@rt!@Erdl!AWF!BRF!FH;!IN6!J+!K]!OH!XH!]H;!`"B@!d%!h]!k] !l+!m !nH !oH(!p)0!q X!s`!ub!x d!ytHh!zp!{H!+!!! !! !! ! !tH!!! !A!!6(;!N6P@mm! !h! !p!Ix! ! ! ! !+!]! ],! ],! ],! ]-! ]-! ]-! ]-! ]-! ]-! ]-! ]-! ]-! ] -! ] -! ] -! ] -!"] -!+!4@pid! ! !+!! !!!(!0!@!JP!JX! !"J!% !( !+ !- f!. f!3 f!4@!6AA!: (!=+0!>+8!A f@!D fH!G+P!H+X!K>`;!N=?!T+L!W+L!Z+L!^M!k 0!m%M!p#5 !qH5(!t+8!u+@@fs!x/MH!{9MP!~CMX!MM`!Ph! 2Qp! 9x! 9! 9!=!+! !]!! !] ! f ! f ! f !8 !V@ ! !R ! ! N ! N !"R !)R !  ! R0 ! 58 ! ]X !R\ !S` !5h ! !S ! ! ! !  !!] !"] !# !$+ !& f !' f !( f ;!) !3S !C#& !D+ !LS !N+ !R-S !SN( !TN, !Y+0 !] 8 !^ < !_ @ !` D ;!aH !d2>X !g7S !i= !lAS !w !x !z+ !} !~FS ! f! f! ! !#&!!! ! !+!]![S!eS!U!V !](!],!H0rrcu!0!9@! D!H!;8P!)Vx!9! ! "3V! =V!GV!! ! f! !!>;!! !!"1!$"1;!.!<QV;!F@@+?:@@" "1!sp"+!es" !ds"""$"&"+("+0"18"+X"+`!cr2"+h"+p"+x"01"+"]"N"+"+" r0dfpu" /@] (#  !# )!:@@6!Men@r@  J!AV"M^l ! $|l (,l03l8Xlh%mp+xnk m)SmskBD$"$$D$"$,$,($"Rval$ 5["5" $"$"$,"D%#%%##+(%2#% 5" % S#$#%"%2# & #& & # ''  (#("(# )3$)#))) ))])+,*$!fmt*G*G*G*]*G*G$3$+6$+77+8T*8+;%+G+G+G+G+]+]+4] key+9$(0]+=d% 8+U%+V mod+W%+XG+Y% +Z (+[ ,+\;%0SG +u&+v&+w&+x]+y]$d%+Q8&+ ,/z&,1] set,3 get,5,7 D28&z](% > a  ( 08!@" ?H# ]P$ ]X%v`&h'p(x)˪*+,9->./ f0 1 23 5 9 Ӭ; >˪?#@A& -!(-% -+ ---/ . (.!= key."=(.?(.A+.B(.C)(( .=*).>$(0]3)     +)+# ; )#?) )+/ ]1*      02c*2dG2er2g2i 2l $y(* 3+3f end3f/4 /4  p5+ cwd5N swd5N twd5N fip5N fcs5N foo5N fos5N5+5NlN++D5*+ rip5+f rdp5,fD5.$, fip5/N fcs50N foo51N fos52N (5)8,5+5+(05@Z,5AZ,5BZ,Nj,+ Z5$, cwd5%, swd5&, twd5', fop5(,$$,55N56N59, 5< -5>Z,{8,N -+N-+? 5Q- cwd5RN swd5SN twd5TN fip5UN fcs5VN foo5WN fos5XN5Z+5[l5\m5]n5^o rm5_p5`q5a-x5bNd#.+f.+@5:W.5; f5< f5= W.fg.+:@@5O.35Pj,5Q.5R.@.X+@5^/&5_/+K5`j,&5a-K5bg.@&5c//+:@@5f/5h]5k]5nf5qf!xfd5tf5w]5z]5]5]35.@@5/5 f5]5] fpu@5m05]5+5m05m05/ 5/035/@@/ 6 06 f6fQ0+Q0+? 707 7! #7" 7#׸0 1+!1!1+&1+1* 818]8]8G8G8G/9/9/9 :81:91 :<1:=11(;< 2;=];>  ;:D2;;1$1 src;A, dst;A ,I2T20]<w2)(<2<2 val< N$3 fd>%>&>'3((<4<%w24<+ fn< R4$3 M4M44>4 ?>4??+?@+?AN cpu?CN @4@f@f*(@4Gct@51@&4 40]A5 B>5B C5>5 C c5C D ~5D (E5E# E5$~5E5)F 5FS#F"5 G)6G*)G+# osqG-c5 G/ (H N6H H H*I6I+I6I6N6 I 6I 6 I6I6I6* J6HJ N6J M J 7J60]K .7*@K'7HK(6K) M K*7(K+680K,8K-9K.:K/; 777.77*@@L/68L0L1]L2  seqL3/@L47L56 L6)0L7 M87 (M}8M @M+M 8MN 88;8}8 N8NN N88)O 8O8+8+O88 P9P P9 Q+S9Q,Q- xR9R9R]`R+h maxR+p+9+ )S 9 sigS8S9TRTS99TUTTV99U):U U U :)U'Y:U(U))U-:U.U/U0 ):U1)U5:U6U7U8 ):) U<;U=U>U?U@ UA )USD;UT (&UUUV) UYh;UZ (&U[ )U^;U_+U` Ua (UJ;ULUQ UW;U\D;Ubh;) UE;UF$;)Ug <Uh _fdUi)UmQ<UnUoUp]  U%<U*5:U2Y:R_rtU9:UB:Ud;Uj;Uq <D0V <V V V V Q< 0V =$<V<= V D=V!V" 9 V%=V'9V(+V.9V0 9 V3= saV4D= W =W -W + lenW +W  (X=X  Y$2>Y%\Y'Y( 0YDg>YM#=YP(YW) 8Z >ZfZfZfZfZf Z#f(Z,f0 [)>[*f[+6 P[8-?[9-?[:]H[;]L>=?+*8[Dt?H[E[F5[G]0* \>?\K\Z\p\\\ end\?Q?X+ ]!@]" ]]&? ]D/@]D@]D@ ]EV@]E@]E;@)]T @]YV@]Z 5][b@)^ @ val^^ @)^ @ val^ ^ @!SA!U f!V f!W#E]![AA0!hA!i@!j!kA!cpu!l]!mf!nf !of( !A!+!!!!$B!+! NA@@!B! f! f! f! N! N!+ !+(!+0!]8:@!XD! f! f! f! f! f ! f(! f0! f8! Z@! fH! fP! ZX! Z`! fh! fp! fx!  f!  f!  f!  f! f! f! f! f! f! f! f! f! f:@!E!A3! N6!! f(!" f0!# f8!%@!&P!'Q!(R!)S!, fX!- f`!. fh!/ fp!0 Zx!1 f!3 f!6 !7E!9E!;E!=+davg!G$B@XDE0!K,F!L!M+!N+!O] !P$!Q&!S,F(E!]>FCF RFRFWFA!`G3!aN6!h f!i f !j f(!k f0!l f8!s Z@!t fH!u]P!]!]!]!]!]!]!]!]3!.7X3!.7!rq!G!1F!G!RF!^GG GRFrqG!1HS!] S!] S!]S!]s!tH!!!!!Hb!1Hs!N!H!HH!HHHGH+))HAI:|ou[ }@ D H6P+` +h)p+x 5[ Ipidp_7J_9 9_:]_; 5_<y ino_=f_? _@%@_BZHGrcu_C`_DpI@J+ J]L\J*`o&L`p) uid`q @ gid`r @ `s @`t @`u @`v @`w @ `x @$`y ](`z0`{8`|@`}H`~P`X`M``Mh`Mp`Mx` ``|r`=`MJ&LkeyaMa9aM&a sema[(a"Pa X$G`a h uida @p gida @taxa|a~a a+$$a'0L M*M4M>MHMZXb^Pb_9b` babb bcbeZ bh8bk=@bn%Xbq`bsdbthbwpbx]tbzxb]b]b]b%b%Hb.7b M itbbb>bhb bJbattybbƋb @bfb fbfbfbfbfb@b+b+b+b'+b+ b+(b"+0b,+8b+@b+Hb"+Pb,+Xb+`b+hbg>pbbˋbObb ]bbbbb !b5b[0RMl b2Qb5b9bZb? P7QAQcvQcOcOKQ@dQdd d f d (d*d,d-d0{QQ XecRed)ee eg ek 5emouenE(eo%0eq\8 RR=RR fRfffRRR+R SS+-S+t?2S\^ seA_sf] sdasg`sh#si`^lxsD`sE^sF`sH sI5(sJ5HsK5PsL+psM+xsN+sO+sP+sQ+sR+sS+sTsU+sV5sWJsY s\+s]+s^\s_A_p^`+]F_/t(u`u-u-)u"`u#=u$u%)u'#au(u))u+Gau,u-(u!uau&`u*`u.#a ua$` opsua$Gaaa u2au4+u6]u7] 0]g@ b0]gH2b gpgbgq bgrgslbgbDgbgag+gbHgg+hgb5qbb*@gVcg2bg+g+g+ g (g,gVc0Grcug8gcHbua gcg idg`ccX+ gcgcc (vcv#vZvv )w dwfw& w)[ ldtw*d8w.+@w95Hw:hw;epw= xwC,|wD ~d x exx+ altx+x+x+ x+(x0x8x@xHxPxXx`xhxpxxxx x!dewFcD\e^ `](XfRlruY5ede(i4fj +k+D(Rdf$ehI$fs+ D(ufz+ pp{f|+}+~) fDf+Df|g  y|gys refy8yJHyghy]ly+p opsy jxyy$Ofh(Qg54f5df5f5fm(g] s g!val+geMhN P]\J7hlruK5g\W\h&X &Yge@GhI+$hUIV + $7h([ 0\ 4^+8n@Fh5\hKjae(mRin+o+q r s t v] n@lpi5hKzae0}i~++     (e j++n@|'j5pi5iKaADLjMhMRi@Mj+LjA ik " 5   |I  :|(]0]4+L8#@$bP p  x#Ǥ$ % '̤M^j^j5k!ctx6kk=k>.[@?(XkY[(\7lb+h+t7w }$e^l++n|l57lK\l&Yj&Lj ldrbN6+klzbmzc zh zjzk"zqE zs(zt^0zu|8zw@z{Hz~PzXz`zhzpzxlmkknf!cid @@ 0n s en+ [S@@CrMn@[@+P+X+`+h+p!pgd  6!x) 5 ?CrE+L]S Z#])_a5p[r+++++ +(+0+8@@5D+H+P'+X3+`+h@brk+p!+x++%+0+HrXr@mre+h5pwrx|rnk&r++  c)\r++) 0nm+Xr+3chr+hrrrXrr+rX+ ]rpz/As$z7As(!pmdz9 @!0!pudz; V"8$@zE\HzF\P!ptezL ;!X!ptlzPV`zT OhE]s @tttttN{6N{9N{<N{G 8yCty+y2y2y+y+ y+(y0CtkMt@@ |t||kt }t}} t(}Bu}Du}Eu}F}Gju}Hu}Itt ~Vu~ \~!]~"] !uVu`ueu,u- 5/ }0ouD}Au$t}K (}:u}@kt5u(}Nv}O+}P}Q  (}+av},}-}.}/ $u$u 0pvqnkr s t u v,$$:(avv "v#w &w'w' wvwDEw5 h_wm5!w*uwMEwD3w4N len4N(2w5uw6f 1w$w8w(iwjkwZr1xs@tvmu*R yT]UV@VvWyXw Y:|0[?|8_" }``׀ha+pbxHd_w$wm@n%Gd_uvx1x1x:x{:|| }~ @ @] ߡߡ!W ׀(I0 8+@$ H L P X ` hNpNtNxN|5֒ eN[++@a,, 10@H P T X \{W`kh;Ip8{H P(uX`h pyO|+'*@}  0Xl ( 0 8 @ ÁHPPnX`O|}:@׀ +  G(!̦0!Ѧ8֦@"H+P+X+`yh[p &# $&+v  k nk u @] (;` N!N"/ 0 14 6]<5 BG@D" }HFPI)XL`O dR]hS%pZ|rxaՃbՃrrcucd\f5k0;n5@@oHq5Xr`}0] y] &&+ yw S&]GSw5 l&] yqyy:| -Áy- E FyG׀HIO ȁ# K mnt  y# iiKU yy܀s "ۂ#} nid&-+4+7[S*RS˃U˃XYZ ]c 9 dJ(GrcueHgXj` idmpptqGxryuЃ +ƃۂ) 03#4678  xa9ou X " $5*@@- lru/#0) X _2 nr_3 ns_45%+ЄX+) valfЄ0]  U N +a)aA*alGrcuaman9ao Davax,ay r(au 5Rxa+ (arhat+$arawaG hh aaa |+aĆɆ MMm a&a keyaMarhaGamaN6(aia a D(aa+a+arawa - ((aχa 5ie aaa b\ a&a|5χ  9c+0)8@@ uid @P)X `$#h `` 9` gid` @X+h``rcu`,Z@@LgLh# cpuLi]Lj]Lk] 7Ll]7Lm]7Ln]7Lo]7Lp]Lr]LsLtLu]L{ M L|7(L} M0L~78HL.@@ kM$u7@?+=O+? 8bb b! b"+b#fb#f b$+(b$+0 b'b(fb)f b0b1 b2 b3  bC0bD bLXbMbNX0 8bQbR bS0bTJ]+J++9ۋ+ۋ  *0NZH *` Grss   08Z@ X  ƌ fn D2 arg |֌+) bƌ֌ N(eS%eTeUheWFeX@meY*8eI qeJ@ ioceKR$M% e\]0:d@d ddd$d+ d](d],d90d]4dou8dHd#Xd#Xd#Xd#XdXd5`dddUhdJpd;x@devd(d!0d 4d8d@d5H@idd hd+pdxdJd;8d\d ddd 8d!Jd"d#5d&0d(54d)8d*\Hd-@fqd2d3d55d65d75d= d>50d@4@tddD8;dF@dKZPdP5hdRdSdUydVydWyd[5d] FJ) k valT) valw< iޑn+vP*8_K`)aKbK7c 7d Grcue reff0ޑ) j v +%UE]TȒ++ n0 ). "0 4 4c5]6c7ss+}x( @ k(Փ @ PN] $$  (8 nkHSЙ( )@*+ ,0-5@. 5`/ d0׀h1p2 x3+4) - val 0]6\B(ERuidF @RgidG @H - D$hJ9 H: \ \ \ \ \  \( \0 8 @ H+ ](], \0 \8@ !%@89:;<= >(?0@ӗ8 ׀ N Η׀ΗXDEFG HI J(K0N Ø8O@QHSӗPؗ N׀N :|\ ܘ:|ܘ-Ș :|xYZ[f\f]f^f _f(`f0aZ8cZ@dHeLffPgfXhf`iZhjp8]]]] ]]]!ino  e( e0]Ě+ C]]] ]]]]X(( K(n08n@H(PC ׀i (׀] F׀FĚ- i׀iP ׀Ηis ׀z8   ] [  0 H@ops!* :|+:*+:+\w_&}d& x_ xiv}ܞ , F x(0 ß8 ݟ@ H P XB`Vh tp x٠  Ҟ\Ҟמ nk'j IҞ ,I<<A1 snkI]s[K nkI]]} YßIYݟȟ } vv BI$ VG t[y I ʠʠnkԠϠYnkޠ vv\1&d&]nW&%K\|&!|& ](:|\С&7S&ա& -& ]Сڡ:@ZR[_\]^`ܭ b(d"0e;8f^@hHj;PkXm֮`ohp&pr Dxsquvyկ{}>WR\fpz(nk 5!pidJ4!uid @@ $ b +]] ]] \ &5& fn )ǤK*&+1&,&-j%X+P:06  36uNG+VǦҰ    ( 0 $8@=HQP=XQ`thp $x ӱ  - - $LǦۦ!.Z)k* Y+ Y,U-@.\ /+(0 09 4:I8< @=5D> H? P@XA5`BCJE F5HIK HQ0pzQ+Q+$ Gf] !pos  ] >nk% ank-\tC nkG\tf v] dddd  nk |nk %?&x:' | ]nk]+D vnkE!b :|nk{ nk ˪nk nkЪ nk  +9nk++++WW f7Snk\t]C nk\t7S]k nk[ nkūnk x7 buf7-7 7 7 7  7 (7 0758 op7X7`7h7p Ӭnknk] nknk]ج ] A]( y_:|y]F G}y:|}d O:| ߡ:| ܭy-í O:|y "y:|y ;:|y' ^O:|yG@ O:|yc O:|y ֮O:|y:|y] OyՓۮ !Oi!N]X Dy-+ g:|gfflI :|v :|ynk] կO:|nk ߡOyگ Oyߡ 4Oy49 Wy4C !mt [ + :|\E]ð :|Ұ׀ð:|װ :|Ҟ :|$׀ =׀) Q׀B jyjoV ׀ -y y ӱ׀- ׀Gر :|N -׀ƃ AAF2PU y}GG_#+ @@EAGBCJD E( sdF~0G.[8I]J]K]L]M]Tbio֍Ok ֒ H $4@8 @JHPfXT` ^hpr  t cx38* =. Nf´f Nڴδ´ +6 rev+ ~*~  ~GGrbN6 ns0]8< >$@ idf` hѷpGrcux Ŷ ops! ~h "׸$ %  & #(( F02 89@: FH= _P@xXA `Ŷ( ̷RdirZ̷  kn~nk 5 5@`h -x    @  A %m ַ ׸ø \tܸ \t# F-( |_K xE!d }0] 0'() Rt* $+B,L - D2(k 88=)kG 2y2G2 (2m2n;2o&EX20621Q22 23 24 25 (27 029 82; @2= ?H2?bP@O6J mJmQT JJw JJmkI nkJ@-» nkJJ- ?nkJJ bnkJJE!D22 2 Ӽg Jm- ӼJmG ` 5 Xؼ 0t{u vw!x*yѽ z ({J* E ѽ½atftֽl }C~CSabufc -S+-c+?Qu+ þܾu  G׾Ⱦ׾  G (,E,FG mod,G% ops,H!`,I 8,J,K$ " -(,LտRarg,M Rstr,NRarr,O[ ,V,W],X-տ ,\V max,^],_] num,`  ops,a!`,bVz&*0(H)uN6+  +  ]   qQ+7 `-S. mod/%@0JH mp1XP2JXS 856Q7 9 ;  <((= 80 -] G%G (%8%-E]>gA8E!modF%3GeAPpqrst]dmtnwg 2 2]--N7<I" uf+b(pzVXA_bX3$Njd+ (,O--.. //01   idƌ clsTȦ @Q+Q+Q+X&+ @ endG++ (0&8+Q+/ (+++++ *0<Grcu12.[3<KX+ HIJK LM+Nr :{@!pPHGPX!bus`7h p x53UZd @msi=(s8x@fHfPX `hx < @idN5 c!!# $%%'#*)+ `, a- b. c/ d9 e< f :;<   ! " # $ (% 0& 8' @( H) P* X+ `, h- p. x/ 0 1 2 3 4 5  EURE]lHxy 5z]|]}5~0@:8)S  S !S "S #S $S %S &S 'S (S )N5 J >@ @ A B C D E3.7Pf\ZH  ]                ]R!!ffffM  b(@qosl0 +>,G id-./5 0H(1;802+X3 M`4 Mh5 Mp6 Mx7 M8+9+:+;+<+ dev=> ? )Cb=Rg!ops       ] M!NGOGP!Q!R! TF(Ud0V 8W @X HY P[ X\ `^}h_ pa xc d  pmfh ::A `AaG busbd%eGg h$j#(k(0m 8n @o Hp Pq}Xr `s!ht!p pmvxw  py2?& __{K }i! `253G5!6!8d9 S ; h(< 0> 8@(@A|HC P pmEX -N_N:cc5X |_m_atft 0XYGZ![d\ d^  pm`(0]-#-? -d_NatftF]]+E]E]8= 0h!Ht"mhE]1E]BE]OcKd&re2f4g !lidh KqK_inf}icma @/ 0 ops1" dev456(78 /<N^^.[S0]  get> put N b{ b ( 08@HPX4`Mhp4x> QR] idS]T Pf/gh]i. >/NC bS {_g h G G] G% G  4 MG9 zGG]]zR   ]  hL7 busMNOP Q(: (8@]Pp+!opsX A rdev@@] ] 7 ]""(5(65!len7] !cap8$\M&R&M:` JK!busLMO  PA(Q0S]8T<U>V@WBX]DYHZI\,J]P`Xa`cNhdlemfngxhp!piniqj,rk#&xmnftivyz](|]-}].~]/]0]1]2]3]4]5]6]7]8]9]:];]<]],]]]ddev@irq]+@]B] B] B] B] B] B]B]B]B]B]B]B]B]B]B]B]B]B]B]B]B]B]B] B]!B]"B]#B]$B]%B]&B]'B](B])B]*B]+B],B]-B].B]/BF H 5LP% ]@M, ]`M]aM  # @vpd , ]PO  {( ,  , N ]`P ,  ,  ou ,0 2 @rom8  @ GH  +P #X WzG     0( 0 I8 I@ ]H#bP!X!`?h++N+@++(X |! "#$ m+ |m ] ]2 ]N;*<5=H ]8_aehk l o (r 07 * *O   0! I5 N]N0]yE yNyT yZye\ rr |g++yDy@yy@*OX+(yjy*5e(z0!vmaz1E!z2 }z3 +z4+z5+ o\z>&z? &z@ E! E!+ "E! EE!+++' r^r]J r|r++c +E! E!+ GE! E!S SE!+#& \E!+ } + ]]  q]] ' sgl()]*] !/G0]+*~M@~N Y~P]~R] ~T]LWOW dCdD VdI fdNzdSza edAdBdC%` f](@ ]@EOY!uzcn3cocp]cu#!cw cx `cz c{ c~]8c5<cKQ@c\Pc]pc@xh!uGX+2` t} H 5 [  (Z0Tt @jk lenl wpmn|o|p|q|rs t(|+|+*@ !+H&+@@+#H 4h8]=]B]G mapLhT *@@]aZ @m sbq w] | $ ws( 0]4 8 <m0dm+ dtdudvdwdxdydzd} ]dd ddd -dP dP(di0d -8d@dHd -Pd Xd`d hdpd%xd(d AHddd @d]Dd&Hd  ]d] ]dhdi!dj.dk+dl+dn]do]dp] dq]$dr](ds],dt]0du]4dv]8dw]<dx]@dy]Ddz]Hd{]Ld|]Pd}]Td~]Xd]\d]`d]dd]hd]ld]pd]td]xd]|d]d]d]dddd]d]d]d]d+d ]&Pddd Y@d YHX+,0: B JO  T (X0]08bI@g YHnwPr X{` h Yp x   Zf qg@h$i|k l tagn o$q](t],u Y0 biowO8xO@$HkXf`fhfpxz|~T ref +$M? elv`f)]]]P!rqs 5!ops!mapH]8 ]< ]@ ]D ]H L]P]T XX`h5pA_dddE]dL O] U -U" Pk]+2 ]iU]U kn kk+ UY] -UN U_## AUԠ-VkFfk[ zkk0] 0]Z(z{|(?@1h`mN6!u) icqE +) seq]:@6|M@L\@N)SX[+a e@!fqgm s y$] 5(Z0 X`h]p]t x@@yyE]&@@795AF+$ ]] E]HX+!!rq"#] || @@   0! I|5YN w|]^|]| ]]] @0]&_ 0]B *aGrcub lencdѤZ(g h&i@lm o 0p Pr Ts 5Xt`upvrwtxvy+xz+}+ id]] lunf] ]QQ5+GG revG00000 0(0008r@ H]P ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ] ppr ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ] ]\` d8h8px\]    ; ;  \|   ]]5 r(:8&&') +50,V8.5@0`1p23J5Z6#17";9.[:J<> @]B]D]GH+Q]R]Sf\]eghijkl]m]n]o]p+q+z ]{ ]| ] ] ] ] ] ] ] ] ] ] ] ]]]]]+ +(01@irq]48;@;0 (0;r8 :HOrPQRddevS(T.[U]@idV] X] Y]!\]"^]#`]$d (e ,k]0l]4o Q8p<q @rrH5wE]B } ]0D Z(JKLM\GrcuOpQSZ+\]_`abdeg sdbjkm ]p ]u ]v ]w+}~+]+ +0ik0]$lh*3]W %a :c%dG mN(tl0l8%@%H P X ` h p x        " (* 4 A; UE xN WXag qyG "]$](],+0+8@D ]@  ]A  ]C  ]D  ]E  ]F  ]G ]L!P!Xf` &   :&,* GN&? l]S  q  ; rr &+& ( A&]- UF xkY Z &} &-     &E]160]L 0]Z+ h dev .["] %&(] )]$4(587H8]L;P<OX>` ]0]A      45@678f9ZX?BAEFG H$I(LN,MN0NN4ON8R@U PZ0`GdevabAcaqd@ eN(Zh~I    I Y" ' ,0 2Hq8QY+Qi+ZHGdev]5(8q  H ( 0!8 ;@  x   ;&&[U8( [U16)@[U32*XU64+pl WWWW WWW W0W4W8W< @WH LWlWpWtWxW|!!WWW"!W +W +W!+W!+ W"!+W2!+ q!@@KW>!!@@K W!!);"*@+@,K-K.K/!5"6@7@8K9@:@;K<H"B#C@D@E@F@GKHKI"Ro#S@T@UKVWW(#^;"eo#|k$&l !&m !&n(;"&o-"&p.#&q1o#&r,|#&t#KucOx#6$7K8@9@:K;@<@=@>@ ?K @K AKBWD'$H2%!DevI@J@K@L@M$Oh%&P2%&QWR?%t%&uWKvcA r%sWduwu%Ox%b&cWdWe%Ahd&3icjWkK l@m@On &|q&&r&Ksd&Otq&|&K%K&O&A'3cWW O &@6'+}' @ @ @ @ 6'@'+ (@@@@K@ @!'(@@@@K@@@@ K K KW}' (L_[)`}'a[)b&'c[)d[),e[)<@k)+h(A)}'3ch% h%Ox))}'W)]*^}'_W`Wa@ b@ c@d@eWfWi*I+}'@@KKK K KKKW*@+AWBWCWDW EWFWGV+AL,3Mc!LUNN&'OWPWOQ+AV,3WcXWYW ZK[K\WO],Ab,3cc!LUNd&'eWfWOg,|l)-&m"+Kn",Ko",Kp",Oq,ApvS.w}'xWyWzW {W|W}W~@@K3)- @8@9K:3)-<@T@UKV3)-XO6-. @ @ K`.A.3 c W W O.A`S/}'WWS/ W3c/ .c/+u.t/+O.u0v@w@x@y@zW{K|K }W ~W/~0& (&W&@ &@ &K&~000X+0  1@@@@WKK 01& (KK K K@@@@1 11X+1,  3  ( @ @  K  @ !Phy @  K @ @ K W W K @ @ @  @! @" @# W$ @( @) K* 1AD e4  ( K K 3 c  K @ @ K @ @ W K  @" @#3! c$# @,% @-' @.) @/+ !0- W@O0 -3  S5  ( K K  K  @ @ W @ @ @ @ W @ @ K r4 5  ( W W  W W W `5*0h6i@j@k@l@mKn@o@p@q@ rK sW HtcuWvWGSGLw& y5 7‚@ƒ@„@…@†K‡@ˆ@‰@Š@ ‹K Œ@ @ ŽKWW‘'“6*,8@@@@K@@@@ K K @@W@@KHcW W$W(79@ @!@"@#K$@%@&@'@ (K )K *K+W.8*$5l:6K7@8@9K:@;@<@=@ >K ?W H@cAKBKCWD' G9:::nkw: ::: (;  +  ; : U%;V A `M;a 5b 5 Tpu;q Aru;%;;+ ;ŀ@ ASCŁ@ł@Ń@ Tő;Œ Aœ;;;+ Ş4<ş 5Š 5š A ů\<Ű Aű\<;l<+h = }' @ @ K W W  W W W W = W%=+\ Z> }'  X         Z>  ,, . /  j>0 L M N O ,P ,R T U ,V  XXXj>+Xz>+8 :> ; <f =N >  ? @N  A(z> ,x@ - .r /f 0f  1,( 2f0 3,8 4f@ 5,H 6fP 7NX!id 8\ 9` :,d!phy ;f <g =h >i ?j @k Al Bm Cn D.[t Ex F> G>` qA r sr tf u,  vN$!id w( x, y,0 z2 {3 |4 }N8 ~,< f@ H RI _#P X Y ,Z .[\}@X B 5 J  @ H ,P ,R DB  ` B   A 8 B@ >H Pih UC  A A0!phy P X ,Z ,\ ^ _ >`x )(D * + , -f  .,( /f0 0,8 1f@ 2H 3I 4>P!phy 5(DX 6` 7pBE] IKD SvD T Uq ^D _ ` q cD dD e vD  E ,   E!ioc vT  N  {T    8 N< :@  h  i  j p: 2vT 3 4&!id 5 6 7  8bY@ 90X : ;%rY < = > ? @ A D E] F\ I]8 J 5@ KH L|YX M` Pd Qh R,j Sl Tm V5p W5 X 5 Y [ \ ] ^ _ ` a b, d e, f_# g, hY iN jEY kN l mN nN o p  q r, s t uN vN wN  x$ y% zY( }0 ~1 2 3 4 5 6 7 8 9 : A@ A A AH A A AP T T U KU , , U KU mU Y N   Y   , , , ,  " fV$ fV` Y k) #l< #%=\; S.; t/( I+; ) ) * B B B UC    5    5   5   5    ,            ,(   0  ,8  ,:   @   qH   P  ,X  ,Z  ,\  ,^  _#`   qh  Np  Yx   5    Z  Y  Y  N  Y    Y     ,  ,  ,  N  ,  ,  ,  _#   q  ,  Y    ,(  _#0   q8  ,@  YH  P  _#`   qh  Yp  ,x  _#   q  N  N  Y  ,   Y   q  Y  !N  $,  %Y  &  '  (  )Y  *Y  +Y  , q  -  .  0  1  2  4Y  6  70  8@  9P  :`  ;5h  >Y  ?Y  @ Y  A#  BY  CZ  DY  EN  FN  GX  H  I  J  K  L  M  N 5  O  P  QU  RU(  S ;0  T M;4  U;  V4<  W X  Y, Z [ \y ]y ^U _U `U aU bV d eE$ T     T E TTTNq TT UvT ,A "U'UKUvTqq XU]UmUvT zUUUvT,Uqql: UUUvT,, UUUvT, VV NV $V)V =VvT  fV& 2%&  N< 'X , ,    , ,  N      , , N =V ,  ," ,$ ,& ,( ,* ,, ,. ,0 2 3 ,4 ,6 ,8 : |X     , X {T q (X ) *f +N , R5Y S, T, UN V5YNEY+ vRYWYbYvTQrY+2!wYYTNY+'XKD,YDDX|X'_#Y+NY+qZ+NZ++ (; %:{Z;<=><Bj[CDEFG,HIJ# K L-MR$N(O,0P2Q3R4 [  \ L#   d  d d d(W],#  W] f !g]"g]+ w]+]&Z Z! 8  ^vT ^^N(58 5^vT5^:^988 ne^vT ^e^,08^_8 ^vT ^^NS58 |^vT ^^,18 y^vT ^^,8 >_vTBkD_+8 6x@`_vTPi]_+BA_]8_]Pk_ZP _B `P%`BvK`q+k`GBoE ``G`L\#Pt``}+qBk `Z8 `vT-D%%%%Pk+-aJ+} DavT,8 `avT,8 ,|avT8 avTBk aZB taaZ98 _avT ^aNNe48 #bbvTf>UC%82Ab}88bb}8?~b}}bBbBB8b_G~BbP bPbB@PcBP)cBPB?c8 &x@`cvTf>8 8ccvT>NXP*cG~P`#c BcB} cvTf>} dvTf>P5#"d   B9dBB)VdG_G~%W8|d  %UB;dB=d:uI~ outww+w+Fx~2i{2  %bUT x $   v y $   v Ly $   v ~y $   v .k Nz@'M+'z4zj^U|2 awvzsxzaU{{*17<+~\{*17UT}{ '{''|'Z|1'|' |U ^|UT~Q0 ^}UT}Q~R ^-}UT}Q~R nJ}UsT0 ^q}UT}Q ~b}U~ }UTsQ1<7  c~U T|Q R X  cI~U T|Q R X  c~U T|Q R X cU T|Q R X X~+~4xYYphy'-09iocvT^e^ (,9sz,9rc+9i >Ii outYU++F~2i{2  %bU}T E $   v w $   v  $   v ہ $   v L (~(.i (1{.   1%bT ق *$  * v   1$  1 v = 9$  9 v . @'M+4уj^U|2 a5saUDŽ*17<+*17UT}c '''1 'T'1'T 3U ^[UT~Q0 ?^UTQR} ^UTQ~R ^߆UTQ~ ~bU~ ~bU 5UTsQv ^\UTQ~ nyUsT0<7  c͇U T|Q R 9X  cU T|Q R *X  c[U T|Q R 1X  cU T|Q R X  cU T|Q R X  c0U T|Q R X cU T|R}Xi+YxYphy&-/9iocvT 9  8>+I~ N++F. $   v  $   v . ۋ1@'M+4j^U|2 a sYaU}*7<+*7U~T~ U~ ^7U}TvQ0 eU}TsQ ~1)# ^U}TQ<7  cލU T|Q R X cU T|x֖Yioc9vTYphy-uu֖ۖ9rc,  ! q9sz"NI& out} %$  % v  ,$  , v  8$  8 v  E$  E v L'M.MFZ.Z# i$  i v U r$  r v  z$  z v  $   v  $   v  $   v "B 4AN[`T,QR X\ޒ'+7+mLCiMk`UsT Q %`T,Q}X0 aғU~ |aUsT: `U~ `aUs Da@UsTfeUsT R(Y4fUsT aUvT <7  cU Ts Q  cU Ts Q  cDU Ts Q  cU T Q ER  -aUsT c֕U Ts X cU Ts Q  @(U< `EUsT0 cjU Tv cU Tv cU TvcU Tv\w]=-09iocvTx@+9rc++ U' +.4j^Us2 +as'52f V1wb @z2 E 2 3 '+  c.  .   o* +aT3wA AO<~b+  *7U|Tv !U|D_UsT}-6-Ax9iocvTx@+9rc++ Ɯ' +4j^Us2 +as'52f V1wb @2 E 2 3 '+  Ԟ.  .   o* +aT3wA AO<~b+ z*7U~T| U~D_UsTvxکYphy+9iocvT+ ( 5>I z++ $   v ޠ $   v . @'M+4rj^Us2 a֡s,aU}f*17<+*17UT| F(5BO[huê" 4AN[`T(QR X0]k.*]Ѥ.24'+70ECiMk`UsT Q z%`T(QX0 aU~ |a,U}T: `FU~ `a^U} DaU}T~fU}T~ R<YLfU}T~ aU~T cU T} @&U~< `CU}T0 cvU TsQ  -aU}T~cU T} cާU T} cU T} c6U TsQ  c\U Ts cU TsQ  c¨U TsQ cU T Q "R  U ^=U}T~Q0 ]cU}TQ<7  cU TsQ R X cU TsX+ک=,ioc?vT,phyuu qrc, qqszNI outwt $   v / $   v a $   v  "$  " v *2 A$  A v  J$  J v O R$  R v  X$  X v  c$  c v # q$  q v j[[X+%=. &=[,phy&fYioc8vT-f-,-"-1->+b(D>v_++LLL (.Z $   v as aU~TsQ}/*7Uj'*7yU ϰU $U~Tv Q0 ["U~T@QX}9dU Q RsX|YXv+f?zYioc?9iyz+{{#|b}~(D~!(D>#>ccoutI  ++LJFhLLFڻ  $   v F*LTFr $   v ּ $   v LL u.LLɽ $   v FK $   v ass վaUTsQ}+0߿gp`q}cU|g"0*7U~T+2:gp`q}cUvg"*7yUU#T*7yUU#T"U^Us vU~<c cU TQ}<b cU TQ ~bU c9U TQsR ~bQUs 9d}U Q  cU TQ Rv~bDBX+BYioc4vT-=,-f-$>(D!(D+bx@9iBcIR vbv_q $   v F~2i{2  i+  iAbT Q` $   v ++  $   v > $   v p $   v  $   v  $   v  $   v 8 $   v j $   v L $   v L" 8$  8 v T @$  @ v  L$  L v Q+Q+\FcFcLcq"" as""  OaUT|Qs+ *7UTWer'.TTTUTv+5 g%11=IpdUTQ"U'I52f V1wb @2 E 2 3 '+  }.  .   o* +aT3wA AO~bU~R w%1=Ib'dU}T|Q~"UeUs+Sg*7UTZFu &3?LYfs" 4AN[`U#T@QR X0]PC0.+7-CiMk`U#T Q 0%`T@QsX0];4@]<'K`U~T84HC""i^^ C C'44T5.9IVcp}A U|TsQv]2C C'^"#"1"?"M"[4i"j"y""" _dU2T8QvK`U~T842C""o!"^/^<CI CV4cTd.9IVcp}A U|T~Qv]CC'^"#"1"?"M"[4i"j"y""" K`U~T@_dU2T@Qv4(C""i^^C+C84ETF.9IVcp}A U|TsQv]CC'^"#"1"?"M"[4i"j"y""" K`U~T4_dU2T4Qv4C""o^"^/C<CI4VTW.9IVcp}A U|T~QvcU Tv aNU `hU |aUT: `aU DaUT~ -aUsT~fUT| R4Y<fU~ a9UvT @YU|<`UT0 cU T# Q  cU Ts Q  cU Ts Q  cOU T Q R  c~U T# Qv cU T Q  cU TvcU Tv U $:UTQ}<)c c_U| "dwU| bU| bU bUT Q U `cUTsQ| b-U| ?cGU cU T# Q R X  9dU T|Q R cU T# Q R X  c`U T# Q R X  cU T# Q R| cU T# Q R X  c0U T# Q R X  ~bHU} cU T# Q R @X  bU bU| c U T# Q R 8X  cVU T# Q R X  cU T# Q R X  cU T# Q R X  c4U T# Q R X <7 XR+Bc,ioc1vT Hb f $>qib[,iocbIvT cb c/(Dee#f(Dk%k8mKm#k< ,ioc<GvT =b =/(D >f >$>@A(DIPP#Ic$,ioc$,vT $C %(D'fI # )$  ) v X+c(,ioc/vT  3(DfIi # $   v c,ioc0vT f>@Iv # $   v =a,ioca@vT bf b/ b8dueufgqrchi,jklm qn qo p I out s$  s v . z$  z v ` $   v  $   v  $   v   $   v ; $   v qtmp_# $   v     #%%#     #o##    #%%#     ###    #%%#     ####    #%!%#     #### $   v {Z4ZX+&$Yioc$0vT-$9,-$B-%N'F0 0 0 0 0 0T000v0#0.90IVcp} d UsTRdUs$ioc1vT:,Je4J(~NNI J$ J v 7J$ J v iJ$ J v Fg aUvT~QR@I$X|<7  cBU Tv Q  cU Tv Q|X YcU Tv Q RX AX+_6%jrc_nUiocn8vT6o>qb>rx@>s+>t|>{+>{+>|>|#>+>+_\bUioc\AvT6]f6]$>_F'UphyF3>H>I>c TA,s T7x@c Oj,r O1^# Q`{6Usz'jijmfp YI J$ J v J$ J v LJ$ J v #J$ J v X+{=!&,dev=# = 2&c",dev5 A   q=i,dev7 C `,gfp!}= %  ;  G}=|. |D |P}#]=%]  < #%=z0v7 zC} zX+`TfUxT7J#JW# _ >6 >)^6 >6c= C!,r CCa= 1!,r 1Ea 1M = ,i ",r 1a 9 qold ca @V T+#++=D(cV DCVB+cV+P +cV= ,i ,v += ,i ",v /_[9Ui[6Uv[C#>] # #: $  %  &  '  (%U%U%U%U%U4%U?%U?%U?'%U?#%U?C%WR%Wa%Wp%W%W#%W?%W?%W?%W?#%W? :    %#%2%A%P%#a%?q%?%?%?#%?"UpAL6T> > jret #j__p->> #>1V?VMV[ViV#yV?V?V?V?#V?=# 3 C = #'  3  C  _3!E63<`^hUv^Oh6^Y=j j8 jV`6/ `67 `62 6K #V`%Unew4 6K ``Unew1 6 6 #V_j6jF jretl#>o >p _AUnewA@ 6B 6C jretE`#6#5  V%#V&`HUptrHR 6(o0c8o@cHcLWPcX\`chap  xccrkczcco c!"c%&h9c:?%A%D "F P Qc(Tw0 &L!u !!L! !5!52! Yval! >Q >u ! + !, L" ""  +2"( " > " I + " "( ## $ $ $g  % % %%% %%c%+W + ,&j $fmt&M&M&M&c&M&M$ 2'e 'f+'g 'h 'u 'vF'wFkey'x  'U 'V +o 'j $key'k 'n< $key'o (6^ (7 (8 48( (M(M(M(M"(c"(c"(4ckey(9< (8c(=   8(Um(V%mod(Wm(XM(Yr (Z (([ ,(\ 0&M(u(v(w(xc(yc^ +cW+ )/)1cset)3\get)5u)7 2m  4 W  ( 08!̪@" H# 0P$ 0X%I`&bh'{p(bx)*+, -./ 90 a1 R23 5 y9 ; ӭ>?@$* 0*!Fkey*"F2*?^*A+*Bc*Ch^*=*>o+0+,,, + + +-; Ucs-=oUsl-?oUwfe-Ao-EUss-GoUsti-Io?-KoUnmi-Mo?-Po ?-So0?-Vo8Ulm-Xo9?-]o:?-do<2-Ycs-5Ycsx-o-2-Yss-5Yssx-o- -gr15-m+r14-n+r13-o+r12-p+bp-q+ bx-r+(r11-u+0r10-v+8r9-w+@r8-x+Hax-y+Pcx-z+Xdx-{+`si-|+hdi-}+p-+xip-++-+sp-++.B.C5.D5?.E5 ?.E5(Us.E5,Udpl.E5-Up.E'5/?.F50Uavl.F54Ul.F55Ud.F56Ug.F%57?.F+58/+/+/+/+/+3/ #pte//" 3/ Fpmd//"/0%o0%%(0%/R|0' $pgd0'(0'"||0p $pud0p(0p"(04@1H1I+Vg+h01 41+82;}2<)2=)?2? c ?2@ c$?2A c(?2B c+B-@3 9&343c3c3 o 3q9(3 c,3!c03( 43)[283*cH3++P3,9&X35 `36 d38 h3: l3; p3< t3=cxfse3?D@Irt3@ F{dl3AF3BF3F"IC3I63J+3Kc3O,I3X1I3]1IC3`"C@3dW3hc3kc 3l+3m 3nAI 3oFI(3p)03q oX3s`3ub3x d3yHh3z%p3{PI3+333 3%3 3%3 3 3H3%3%3 3B3%3k6(C36PImm3'h3'p3EJx3 3 3 3 3+3c3 c,3 c,3 c,3 c-3 c-3 c-3 c-3 c-3 c-3 c-3 c-3 c-3 c -3 c -3 c -3 c -3"c -3+3c4Ipid3 3 3+39&3 9&3%3%39&(3%03%@3JP3JX3 %3"K3%'3('3+ o3- o3. o33 o34*A36A3: (3=+03>+83A o@3D oH3G+P3H+X3KJ?`C3N?3T}L3W}L3Z}L3^mM3k 03mwM3pu5 3q5(3t+83u+@Ifs3xMH3{MP3~MX3M`3 3c 3 o 3 o 3 o 3J9 3@ 3 3R 3% 3 W 3 W 3"R 3)2S 3 % 3 X 3gS 3iO> 3lS 3w 3x 3z+ 3} 3~S 3 o3 o3 3 3333 3 3+3c3S3S3U3qV 3c(3c,3I0{rcu303q9@3 D39&H38P3{Vx3q93 o3 "V3 V3V3o3 3 o3 33>C33 3!"13$"1C3.3<VC3FN&@@}N&+?B@@4'4P1$sp4+$es4 $ds4"4$4&4+(4+04`184+X4+`$cr24+h4+p4+x414+4c4W4+4+4 0ffpu4 G0@(5 '5 )'B@@1'Vn@1s@#F'@1(Vl1'1 o+l 1(1,16m091 m81%X1@mh1%9np1+x1k1 o1>n1**1`S1Cn1k6 /)6 6 /) 7!v)7% 7+ 7-7/ 8c3)           +)+5 ;')5?*'**+8 c:*                    0;c4+;dM;eE;gc;i ;l +L(*<a+<oend<o0= 0= p>,cwd>Wswd>Wtwd>Wfip>W fcs>Wfoo>Wfos>W>,>WlW,+L>*4,rip>+ordp>,oL>.r,fip>/Wfcs>0Wfoo>1Wfos>2W 2>),>,>4,20>@,>A,>B,W,+ c>$K-cwd>%5swd>&5twd>'5fop>(5+r,>5W>6W>9K- ><[->>,,W[-+Wk-+?>QH.cwd>RWswd>SWtwd>TWfip>UW fcs>VWfoo>WWfos>XW>Z,>[l>\m>]n>^orm>_p>`q>aH.x>bW)].+om.+@>:.>; o>< o>= .o.+B@@>O.9>P,>Qm.>R.@/^+@>^W/,>_}+A>`,,>ak-A>b.@,>cW/i/+B@@>f0>hc>kc>no>qo$xfd>to>wc>zc>c>c9>/@@>G0> o>c>c fpu@>0>c>+>0>0>0 >009>i/@@i/? 0? o?oW0+W 1+? @K1@ ù@! @" @# 1`1+p1p1+u1z14 A1AcAcAMAMAM0B0B0BC82C942C<42C=4222D<[2D=cD> D:2D;2+92srcDA5 dstDA 52%2o8cE2  3(E!3E!3valE WE!W E"WE#oE$!3 W2E*H3E+&H3E,#u3Fu3FYF FM33E'3E(E)2+&3E.o3 E13E204E3E4 E5+E6+G$04fdG%G&G'32(Ec4E%2E/z3E738E4E+fnE 4+5444c44H>4H?+H@+HAWcpuHCWI5IoIo4(I<5JctI1I&<5 48cJp5    K5K 55L 5L%M 5M 2N5Ng N5+5N53O 6OI O"6 P)k6P***P+ osqP-5 P/%(Q 6Q Q %Q%4R6R+R6R66R 6R 6R7R6R64 SH7PS 6S S c7S68cT 7 4@T'7PT(7T)  T* 8(T+80T,8T-9T.:T/;c788774@@U/8U0U1cU2  seqU3@U48U5H7 U60U7 88(V8V rV+V 8VW %8888W9WW W993X :9X:9+J9+X8#9Yq9Y YV9Z+9Z,Z-x[9[9[c`[+hmax[+p+9+ 3\ :sig\:9\9]R]S2::]U']VO:7:^{:^ ^ o^ T:3^':^(^)3^-:^.^/^0 {:^13^5;^6^7^8 {:3 ^<e;^=^>^?^@^A3^S;^T ^Uo^Vo3 ^Y;^Z ^[ 3^^;^_+^` ^a 2^J1<^L^Q ^We;^\;^b;3 ^EN<^Fo+;3^gr<^h_fd^i3^m<^no^o^pc  ^%=^*:^2:Y_rt^9:^B;^d1<^jN<^qr<L0_ D=_ _ _ _ <0_ X=+=_D=d=_ =_!%_" : _%=_'&:_(+_.C:_0 : _3=sa_4= ` 4>` 6` +len` +` (aO>a 'b$>b%b'b( 0bD>bM#4>bP(bW)8c "?cococococo c#o(c,o0d)J?d*od+H7Pd8?d9?d:cHd;cL"??+48dD?PdEdF)6dGc04 e>0@eKeZepeeeende0@W?@^+f!Z@f" cf&?@fD@fDZ@fDf@fE@fEZ@fE@3fT @fY@fZ 5f[@3g @valgg @3g Avalg g A3ScA3U o3V o3W Mc3[A    03hB3iZ@3j3kcA$cpu3lc3mo3no 3oo( 3KB3+3333vB3+3 W@@@3C3 o3 o3 o3 W3 W3+ 3+(3+03c8B@3D3 o3 o3 o3 o3 o 3 o(3 o03 o83 c@3 oH3 oP3 cX3 c`3 oh3 op3 ox3  o3  o3  o3  o3 o3 o3 o3 o3 o3 o3 o3 o3 oB@3E3KB93 63! o(3" o03# o83%%@3&P3'Q3(R3)S3, oX3- o`3. oh3/ op30 cx31 o33 o36 37E39F3;F3=+favg3GvB@DF03K~F3L%3M+3N+3Oc 3P$3Q&3S~F( F(3]FFFFF@3` H93a63h o3i o 3j o(3k o03l o83s c@3t oH3ucP3c3c3c3c3c3c3c3c937X937$rq33H3F3 H3F(3^HH9&.HFrq.H3HZ3c Z3c Z3cZ3c|3H33333Hb3Hs3W3 I3 IH3II'I8HAI+ *)KI@EJ|u'\ @ D H6P+` +h)pp+x `5%'\ oUIpidph7Jh9 q9h:ch; 5h<wyinoh=oh? h@W@hB1[HJrcuhC`hD*pJJrJ+ Kc\J4ioxLip**uidiq @gidir A is @it Aiu @iv Aiw @ ix A$iy c(izP0i{P8i|P@i}PHi~PPiXimM`imMhimMpimMxi oiirii=iV\KxLkeyjmMjq9jVj semj'\(jPj oX+`j huidj @pgidj Atj xj|j~j j+++_jLrM|MMMMcXk^pkk4kkIk ckSkkkk'k)6k'\0Mq kQk5kq9k1[k AQQQlQl"l"Q@mLRm m  m o m (m*m,m-m%0QQRXncRnd**ne ng nk 5nmunn(noW0nq]8[RRX=RR 2Sx`lR7SQS+QS[SeS+S+?SS9S+SSq0mUmmmma m,m.mu0m>@m(HmPmoXm`mm+m)6m cgbdimH me(mhm%pm m gevmmcmcmcmmcm5mm5m%m]m{]gcdim#mgbbm-m^ mom  m(y(S4hoyqVozLbo|co}cV(cob(o80o+Xo#c`VvVVVVV0 000!0%0'0,0/50305090<0A0D0H0L0Q0U0Y2WpXpopopp ;Xp!p" "?p$cHp'Xp(Mkeyp) p*Xp+o p,o(p-o0p. X8extp/X@mWXp34 p8Ytpp9Yp: op;Wp<W;XFFqwZqWq qcq s qoqoinoq)o devq* (q+ ,uidq, @0gidq- A4q. 8q/@q0Pq1`q2pq3oq4oq5Wq6Wq7oq8oq9Wq:Wq;WZ+r !Z(rZrcr orZr %rZZ[[coZr#1[r$5r%%r' [Ws)6WsWs8cl[     [  q90tu u"[2u[u5u[u"\+[ucuoo(v0v\v1**v7**osqv95v; v<%WvWvWvWvWvw+\w, w-%x \\%\\] x5]x**x%x\Xyqv]yr]ys8 wqyv{]HcpuywPv]xz]zz]z](lenz**Hz^Pzp]]++^+^+c@{^{^{^{ P{5@@{ ]H{!+{"+{#{$8{%]{& {'e_0{(+8gcpu{*@gssp{+_H**^+`{6e_{75{8]{:]({;+H{<e_P{=X{>\^{e_{fcsda{ga{h^ {iaj_qx{D`{Ee_{F`{H {I)6({J5H{K)6P{L+p{M+x{N+{O+{P+{Q+{R+{S+{T{U+{V)6{WJ{Y {\+{]+{^5]{__pe_a+^_0|2}:a}M.}M.3}"ka}#F}$}%3}'a}(})3}+a},}-2}!a}&:a}*ka}.a }b+aops}b+ab b}2Lb}4+}6c}7c 8co@ub   8coHb   opboquborosbbLocobo+o(cPoo+lo=c>bc4@ocobo+o+o+ o (o,oc0Jrcuo8ocH=caocoidocd^+odo"dd(~id~ ~c~%~ 3 eo& )'\ldt*e8.+@9)6H:oh;fp= xC5|D)~e fo+alt+++ +(08@HPX`hpx ! efFidL1\Kf1^ o1`c21X~fYlru1Y%>'f1d%1e%21if1j +1k+L(1Rf+Kf1hEJ+~f1s+ L(1ug1z+pp1{g1|+1}+1~** gL1;g1+L1_g1g1 ogFtref8JHhcl+pops xo+_gl(1Qh>f>f>$g>;gr1218h1c1 |1 Qh$val1+(18hk1Mh1N o1Pca1Jhlru1K%>^ha1Wh,1X o,1YQhk@1G3i1I++h1UEJ1V + +h(1[ 01\ 41^+8s@1FQi>hA1jk(1mi1n+1o+1q 1r 1s 1t 1vc s@1li>QiA1zk01};j1~+1+1 o1 o1 o 1 o(k 1pj1+1+1%s@1|j>i>;jA1@1DjV3iVi@Vpj(1+j@ k  5   EJ o |(c0c4}L8@+ˤP p  ox#0$ `% `'5Vjj15k$ctx16lk1=1l1>[1@0@(1XNl1Y'\(1\l1b+1h+1t=1w 1}$k1l1+1+s1l>lA1a1 m,1j,1j 16mfrb161+1l;mb4nc Sh Sjlkq sM(t0u8w@{MH~MPX*`ChapzxEm4nlNl1n1o$cid11 @@1 n1 | 1n1%1+1 S@@1rVn@1[@1+P1+X1+`1+h1+p$pgd1  'x1) 15 1?r1E+1Lc1S 1Z 1]**1_1a51p'\1r%11+1+1+1+11+ 1+(1+01+81Z@@15D1+H1+P1'+X13+`1+hIbrk1+p1!+x1+1+1%+10+1r1r@1r1f1+h15p1rx19&1r1k1&r1+1+11 1 1d1**1]1r1+1+1**1 nHn+r+3'dr+rrYrr+s^+(1 c"sp/s+7s($pmd9 '0$pud; (8+#@EHFP$pteL 'X$ptlPW`T hMc1t      @ }}}}}W6W9W<WG8t+22++ +(0tpt@Atot'uo t2B~uD~uEuFuGuHvIot'uu !c"c uuuu,v- 5/ 0ouLA1v+,uK 2:Lv@t>v2NzvO+PQ (+v,-./ +1v+Lv 0p1wqkr s t ou v5$+(vzv"Vw#~w&~w'~w' wVw~wLw5 lwr>w4wVwL3x4Wlen4W22x>w6o1 W'\++r%ʣ55%%% 0@H P T X \`ԣhCUIp%8H P(ޣX`h op|y|+'4@p}vvՁ ( 0 8 @ ,HPׂX`|p}B@@% +  (!0!8@"H+P+X+`wyh'\p o&ǧ#$;w % > k H Rrc (C` oW!W"\/ a0 T14 q6c<)6 BM@D"u}HF*PI**XL`O `dR{]hSWpZrxa>b>{rcucd]f)6k0Cn5@@o%Hq5Xr%`z}8cb vwycbryx{cMLYxj+(jrцjt++pjۆjjM цц j joj o!+j-2PmMPUmMֆ jj!keyjmMjۆljưj%rj62j҇j j L(jj+j+jۆjj 6 2(j8j>҇k j_j%j ˅a j|,j>8|Z q9'd+0**8r@uid @P**X `$ hiMi q9igidi MA\^+liircuic@@UgUh cpuUicUjcUkc ?Ulc?Umc?Unc?Uoc?UpcUrcUsUtUucU{  U|8(U} 0U~88PU@@p~8@+=+?8k!k k! k"+k#ok#o k$+(k$+0k'Ik(ok)ok0~k1 k2 k3 kCkDIkLkM9&kN8kQkR kSkTJƋ!+J + *}9D+DNs9&401[P 4` Jrss s0X81[@ X /fn 2arg o?+3 Tb/? W2nSnT%nUlnWnXrrnY48nIqnJiocnKR+lV n\c0Bmm ombmwmm+ mc(mc,mq90mc4mu8mHmU Xm^ XmU Xm^ Xm-Xm5`mdmUhmpmxIdevm(m0m 4m78mA@m)6HIidm hm+pmKxmm8m]m mm%m :9m!m"%m#)6m&0m(54m)%8m*5]Hm-Ifqm2m3%m5)6m6)6m7)6m=% m>50m@4ItdmD8CmF@mK1[PmP)6hmR mS%mUwymVwymWwym[)6m] 3 ԑval3 val<%iGn+v48_`**ab?c ?d Jrcue reff0G3 Ӓv +%McT    1++ n8 s     3. 0 4s 4˓5c6˓7ۓۓ+2 @ ԑ2= A Pc ++  (8 kHР(r)r*%+% ,%0-)6@. 5`/ d0@h1p2 x3+43 val r~8c6ĕ  B2EYuidF @YgidG AH D+ЕJH ĕ ĕ ĕ ĕ ĕ  ĕ( ĕ0 8 @H%l%+ c(c, ĕ0 ĕ8o@ l!ml%@89 : ; < = >(?0@;8q @6@6"XDEFG HI J(K 0N +8OI@QbHS;P@@%&&|ĕD|D0b|&NxYVZ[o\o]o^o _o(`o0ac8cc@dHeLfoPgoXho`ichjp8cccc ccc$ino  ( 0cV,+ ccc ccccXTw  (֜08֜@HPw@҂Y@c|@,ќ@ќg@6ќۜ @ 8 s c '\ s0 HIops! |+++awȝ,}͝, ȝoҝ%1w"Ec|  (0 ,8 F@ _H oP X`h ݠp xB Rk;;@'^k^jJ|EJ;hEJ^%ܟkEJcܟ"\^kEJcc^o,EJ%F^1_^K%o^d1w6wtEJ^^\^ݠ^Ġ%^EJ^33k=8%RkGk1w6wW"a,j,cs,WAa,!, %|a9,S,>, 6, c9CB@Z[2\U]s^` b׮(d0e8f1@hTHjPk|Xm`o̯hppr xsDu]vy{ư}*mMţϣ٣(hk 6$pidJA5$uid @@ $ ˤ +cc cc a ,)6, os )0A*,+2,,h,-ӒWI^+(Po@0xy 6z{ |}k9~ VB0   9 ~+)   ӱ ( 0 8 @H$PX$`Ghep x~~~~  β   Tѧ§̧֧ۧc)>* + ,U-. /+(0 09 4:EJ8< @=5D> oH? oP@ XA)6`BCE F)6H6IK oPQCMWWq+W+$(Moc $pos ( ck4k6tWkMt9u1wucz mm mm "\̪k~k % & ' ~Ѫ0kc+Ik'5b|kN{kIgkkګkګ߫+ k++++W9SktcaktSc>k"\fk%ˬˬkЬx@ybuf@6@ @ @ @  @ (@ 0@)68op@7X@`@8h@opkkc~ӭkkccحucwy2|wycMPwy|P7s|ZH|xwy6׮|wywy|wyܮ|wy1|wyMT|wy6||wyY|wy|wycǯwyǯ=҂Wc$Yѯwy6:|:oo?]|I|wykcb|kHưwywyH˰wy *wy Y$mt [ +hh|/YMc   |@%|ӱ|;|ر%@@r$@=wy=B)e@'6L~ˬwyj@6β@M|Ӳ@/#(wyPMo2U e+@@AMB%CD ES(sdFQ0G[8"Ic"Jc"Kc"Lc"Mcee'bio`"> b>; PY +z48 o@HGPoX` hpr  t x* F. Wl!ŵ o+6trev+oQ4Q  QMJrb6ns0c8< >+q@ido` ohpJrcux opsb!l Qh] "$ ù% & (( 02 89@: H= 2P@KXA i`]g2 Ydir-yVmknQkˬ o)6 )6@`%h 6x    @  A %9n||m%|ˬooùˬtoˬotȹ%ˬo|6~2|K|'7i|P8c  0'(n) t* +, - 2(po  p;L;M; 2;mn;n;o&X;0 ;1$;2 ;3 o;4 ;5 (;7 0;9 8;; @;= H;?5Pnn" @@$'cJh@pEJk6k6¼k5k';e; ; :@6j@M`% 5e ׿X0tNu cvhw!mx*y z (N%cXer4+w%ttq }~&gbuf6 6&+66+?WH+}ҿHMȿȿþͿ}MW()EW)FMmod)Gmops)H!3)I A)J)K+z ܿu6a2)LYarg)M oYstr)NYarr)O.)V)Wc)X6 )\)max)^c)_cnum)`ops)a!3)bo)40(UP)U~6f+ + c ' W+7`-&.emod/m@0Hmp1+P2KX&856$7 9 ; <(= 060M%mMm% mMc>:   @8Eg$modFm9G8@Ppqorostcfmtnw:  c66! R~g9+4)CMX_Xpfu f+(,--.. //01  [id/clsp+ȫaa @pW+W+^+^+$@|endM++ |(|0&|8W+/(+++++ 40Jrcu12[3&^+ HIJK LM+Ns BVe@$pHMPX$busb`h op ox)6L9 Imsi(8@oHoPX `%hx g IidW5% >!!m# $q%{'#)"+ `, a- b. c/ d9 e< f:v;<[  !"# $(%0&8'@(H)P*X+`,h-p.x/012345%MU-   Mcl]    Hxy 5zc|c})6~%0@B8vZ  Z !Z "Z #Z $Z %Z &Z 'Z (Z )W5 %J @ @ A B C D E97Po]1[#  c                c-oooo(  =(IqosG0+,Mid-.%/5 0#(1802+X3 `4 h5 p6 x7 8+9+:+;+<+dev="> "? ]%=F-B$ops   %cMNMOMP!mQ!mR!m T!(U?0V8W @X HY P[X\`^Xh_paxcd pmf]h`aMbusbbdmeMg h$j(k0m8n @oHp PqXXr`s!mht!mppmv]xw py ::ȿV&XvD`23M5!m6!m8?9 . ; C(< 0>8@(@AWHC qPpmE]Xg6):)%>>3W:H%q:tt\0XYMZ!m[?\ ?^ pm`](v8c-  [6?:)tt! iyj$k m 6DyMcc+Mc"   McL   8%%% 0!t"Mc1      McB(  McOL  cd&e2f4(g $lidh L&ocma@/b0gops1"dev45%6%(78lvL0W%[8c  getput   ( 0'8J@^H^PrX`hpxr &:QLRcidScTLbPfgghci].gg%gLL:LLM'LMcoJLMr,M^LOgrLcgLgwgLMLMMccQLo g&Lc:g+hLbusM N%OP Qe(B % %%(8%@P%p$ops o ?{devc c  c""(56)6$len7c $cap8$a,,B` JK%$busL M O o P(Q0Sc8T<U>V@WBXcDYHZI\5J]P`Xa`cWhdlemfngxhp$piniqj5rkxmnotvyzc(|c-}c.~c/c0c1c2c3c4c5c6c7c8c9c:c;c<cc5ccc'fdevIirqc @cBc Bc Bc Bc Bc BcBcBcBcBcBcBcBcBcBcBcBcBcBcBcBcBcBc Bc!Bc"Bc#Bc$Bc%Bc&Bc'Bc(Bc)Bc*Bc+Bc,Bc-Bc.Bc/B3F H 5LPW-- c@M5 c`McaM o  IvpdK 5 cPO B  5  5 W c`P 5  5 L u 50 2 Irom8  @ MH  +P #QX ?MH a C z  ( C0 8 @ H#P!mX!m`h] +W-+=+=Ga+( ! "#0$X a|+ % o c0 c!3 X cW5;<5=%(H c8_ae3h3k Cl C o C(r C0' 3$%C8aHMzvfW8cE     N)T 9ZMep%9.sMs>pg++RLu9+^+29+>z)k(0$vma1'2 3 +4+5+ a>H,? #,@ F%S'Hl'+X'q'+++sscss+++''+oM*'C'`S/`Sa'+Hz'+f  + cc  cc'sgl()c*c 0G(      o  o  8c   Wjj %kcx (`U8( `U16)N`U32*ZU64+rq 048<@HLlptx|++++ ++ "6( (!C)*+,-.(/5\6789:;(<BCDEFGH(IiR STUV(W(^(e tk,l 6,m ,n(,o-\,p.,q1 ,r,-,t:AuDxG %e&'()*+,- . (06)789:;<=> ? @ AB(DrH}$DevIJKL(M6O,P},Q(R@ lm9nDpt,uAv@ rIsfuwDxz,A@ fuVDzbcd(e@h]9ijk lmDntq,rAs]Dtj(~ D ]t,ADtAIADtmAIAAAD'@9 D z     ^+(+$    ( A+@,@    $9mDA    $( ML_`$abcd,e<+(h-@$9 D.$(P$+#(;]:^$_`a b cdef(i$  (G@`ABCD EF(G@L9M$LUNNOPDQm@V(9WXY Z[\D]@b~9c$LUNdefDg5tl,m"`An"Ao"(Ap"~Dq@pvw$xyz {|}~9 89:9<TUV9XD@   (@9    DM@`$ 9  @ +~+D8+H+ LCDBM8N fOPQRH VW(XSGEYIuZ4p^|_`abcdef g h ijklmnopqr s$t&u(v,w0x2LUNy4z ? P@ABCD1 uG\0]^_`abcd e f ghijmlY`4MN PcRc Tc%" mCmD "mI "mN"mS"emA6mBqmC>&%`boc2 nculnlolpclu#~lw mlx m`lz ml{ ml~c8l5<lQ@l]Pl{]plrxu^+(2oo%ooHc 5 "\oc h(1[0y@jklenlwpmnopqrs t"("+2+4@i!+P&+@@+ H 48c=cBcG mapLT24@@]a1[@mZsbqiwc | $wsƁZ(Ɔ 0ƌc4ƒ 8Ɨ <8mm   mtmumv_mwmxmymzm} cmm C!ma!mz!m !m! m!(m!0m !8m!@m"Hm !Pm "Xm?"`m X"hmv"pmmxm"m "(Hmymem @mcDm&NH2(m  c(m] cmhmi~mjmk+ml+mncmocmpc mqc$mrc(msc,mtc0muc4mvc8mwc<mxc@mycDmzcHm{cLm|cPm}cTm~cXmc\mc`mcdmchmclmcpmctmcxmc|mcmcmcmmmmcmcmcmcm(mcoPmNmem @m H]^+],r0': 'B ''J;'O P' T e'(Xy'0]'8b'@g 'Hn'Pr 'X{ (`ǀ &(hLJ 'pnj :(xǒ J(Ǚ _(gr|cf-qghi%k bl)#tagn o$qc(tc,u 0biow"8x"@+X#H>Xǂo`DžohLJopNJxǑzǗ|ǘ~Ǜǜ%ǟ5#refǠ Ǣ++z#V#elv##o$o2<FcccP$rqsd(d(% 5P $opsw$map&c8 c< c@ cD cH LcPcT oX&`h)6p%_ m!m-m-McmC!   a!"ucH!z!Uf!%!U!!>c+!c!Uc!!>!!!">!%">+"?"Uco"6X"U)D"v"U)!]"{"""U="%">"%">"">"%"u"8c # #")#-;8cZX#  2zz#{%|-2ǫ#Ǭrǭ2lǶ#rǷ6Ǹu3ǿ#icq #o#+3$seqc$ #B@6%V&@L5]@N*SX[+a oe$fqgm osiycǂDŽdž=& lj5(ǎZ0ǔ Xǚ`Ǡhǣcpǥctǫ xǮrǰrDzeǹwyǻwy%$%Mc&& @@7=&95A%F+{&cc Mc&   B&&+!&$rq"-#&;&%&&&%'%'%"'"' ';','%P'@'%e'-U'y'-j'%'-~''%u'%'-''%oc'%'%c' ( -cc'%&( -c(:(+(%J( ?(%_(ˬ-O(-8c&(         8cB)           4aF)Jrcublencd:c(gi0h4il%m% oi0p Pr Ts 5Xt%`upvrwtxvy+xz+}+idcclunȀoȁcȃ cȅoȆȇWȈWȉ)6Ȋȋ4ȌMȍMrevȎMȑ4Ȓ4ȓ4Ȕ4ȕ4 Ȗ4(ȗ40Ș48Ț5@Ȝi(HȠcP"ȧ c "ȭ c "ȳ c "ȹ c "Ȼ c "ȼ c "Ƚ c "Ⱦ c "ȿ c " c " c " c " c " c ppr c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c c\` d:9h:9p%x]c    C C  ]5 o  occ5)6u(9& s(B84&%'%)% +50,W8.)6@0%`1%p29&3K51[6#=7"=9[:J< > @cBcDcGH+QcRcSo\ceghijklcmcncocp+q+z c{ c| c c c c c c c c c c c c{]{]cc+ +(01Iirqc4R=8C@C0o (0Cs8i0)BHO5P6Q%R%fdevS(T[UcIidVc Xc Yc!\c"^c#`c$d (e ,kc0lc4o W8p5<q o@rsH455McB6     F)E6 c8Dh6  c(J7K6L%M5]JrcuOpQSZ+\]_`abE6deg7sdbj6k7m cp cu cv cw4}~+ɀcɇ4ɏ 7+6K1k8c$+8  qh*d;3cW ;a ;cmdM m;(t;0;8;@;H ;P ;X ;` ;h ;p ;x < ; < 3< C<  \< l<" <* l<4 <; <E <N <W<X =a =g 4=qM=yM "c$c(c,+0+8@D c@  cA  cC  cD  cE  cF  cG cL!mP!mXo`+8};4};h6i;%;45;M;4;;6co;;};;;6; <6 <;%<6<3<5$<%C<58<\<4+H<%l<4a<<6q<<4c<<-<<6>'<<ˬ4< =46<8 =};=4=};%=M=49=Mc=       d;=8cL=        8cZ%>       5>+8c>          4>5=6=7=8o9cX?B>E5>F5>G5> H5>$I5>(LW,MW0NW4OW8R%@U oPc0`#@Jdevab>c%gqd eW(?>9@M@M@R@(@ % +  @ -@U@V s`@a gb gTpAq srA@A+VÀASĆ͂̓T͑~A͒ s͓~AAA+͞A͟ g͠ g͡ sͯAͰ sͱAAA+hB$ B B+\C$ Z    C 5,./ C0LMNO5P5RTU5V ZXZC+Z D+@D5oE5W $%@F(G0I8`E%56o 5(5*$id,0456789:o@WHWLJPD8:@F;%<o=W> ?@W A%(E,G-%.5/o0o 15(2o03584o@55H6oP7WX$id8\9`:5d$phy;f<g=h>i?j@kAlBmC%>nD[tExF@FG#@EF`qIr%s5tou5 vW$$idw(x,y50z2{3|4}W8~5<o@HASI)PXY5Z[\G II$luncW + DXJ)6J o@ oH 5P 5R5J+;Joh J % >>0$phy(@PX5Z5\^_@F`x)K*%+,-o .5(/o00581o@2H3I4@FP$phy5KX6%`7#@p;JMcIK SKToU^"L_o` cMLdMLe K@pLq5r};stuKv%(w 58L5%M$ioch\W m\ a 8W<R@@ h i j%pB2h\3%44$id567a 8 a@90X:;%a<=>?@ADE{]F5]I{]8J 5@K%HL'aXM`PdQhR5jSlTmV)6pW)6X 5Y[\]^_`ab5de5f)g5h,aiWj`kWlmWnWop qr5stuWvWwW x$y%z6a(}0~123456789:I@IIIHIIIP\\]=]55]=]_];aW o;a5555 "X^$X^`Ka#A#B\CC(C.:JJJJ%% 5%% 5%%5% 5  5    o  o 5(  o0 58 5:  o@  H  oP 5X 5Z 5\ 5^ )`  h Wp Pax  5  1[ Ua _a W da % _a  C 5 5 5 W 5 5 5 )   5 ia % 5(  )0   8  5@  iaH  %P )`  h _ap 5x )   W W _a 5  na    _a !W $5 %sa & ' ( )_a *_a +xa ,  - .% 0 1 2 4,a 6% 7%0 8%@ 9%P :` ;)6h >}a ?a @ a A Ba Ca Da EW FW G` H I J K L M N 5 O P Q] R]( S @0 T @4 UVA VA WX oY5Z[\wy]wy^]_]`]a]b ^de%M\  \L(\\%\oW(\\]h\};5I(]]%=]h\o(J]O]%_]h\o(l]q]%]h\5]`(]]%]h\55(]]%]h\5(]]W ^(^^/^h\};X^,}, W<`5555 W 55W/^5 5"5$5&5( 5* 5, 5. 50 23545658:n`5`m\R`S5T5UWV`W`+(v`a% ah\Wa+"a1ar\WKa+`K5Za"LLZn`)a+Wa+a+Wa++%5ra&a&aPObPQMR S%T(U0V!m8WM@X H vbw sx sy s πbhdrρb3ώ c?Ϗ s?ϐ sUbusϑ sύ,cϒbϓ sόRcuϔ cϕ s\ϵ#dhdr϶bϷ s ϸ sϹ sϺ sϻ sϼ s Ͻ s$Ͼ s(Ͽ s, #d0 [P [Q gR,cT[3d+ udhdrb g  g udsd+dhdrb ud d s s d[d+ehdrbe d*e+H e$hdr b  s ooo o( s0 s4 s8 s< s@$mf eD[e+8f$hdrb s  s s  s! s" s # s$$ s(% s,& s0$mf' e49f$hdr:b$id; s $bus< s= g> gx]yg$hdr^b_ [ ` [ a gb sc ygd spe stsg+pg$hdrqbr s |υAh$hdrφbχ [ ψ [ ω gϊ sϋ ygό spύ stώ sxϚlh$hdrϛbϜ s  Ϭh$hdrϭbϮ [ ϯ [ ϰ gϱ sϲ sϳ sϴ hsh+(ϾBi$hdrϿb s ` Bi sRi+=@ =A [ 8cLi E D ^ D r D  D  D  D  D  D  D  D  D ' D > D a D  D  D  D  D  k Z Z    Z  Z Z0 D l D  D 4D D D D ,D D @nl+^l %4+ rl+al D D D $D @(m+&m .%4+ a2l 8% C% Mb Sb Q\ mmbbmh\:nh\!3b nh\!3:}; ppMp [U O[ pm:;p6MOp6ObpMOҠ qMMO'qMM:Hqh\Hq@:nqh\nq@:qh\qVA:2oq:8oq:?oq:rh\rAQs 3rJ[:sYrh\Yr^r5 Qs urJ[rMb4r6:3Erh\5:Ȟ6r46OHsMc'Qv+so+QwE GsGsMp\Otovsvs+:sh\K:sh\oOk+sK+:5sh\:Wth\b(th\5b Et_pOrjtpcoQttti[q9bt:.Ith\5:,Gth\5O&tMO  u6+M:o'uh\5W8Mu$UQ;muQ=u:<Qv uK:ouh\5Q7]uM:ouh\WCv+ mEvU mevU RmU zn8w iocz-h\&i|U)wbo|sX0t^x^+vx wgj gx  woj ox !!xrU RdpU T Q  p@xU  p_xU  txU T QtU T Q^x+xj 17z dev* bufM 6 7zW!y oԌ" y*ERUQ pzUsTW p)zUv6 I12{ dev)  buf +6  6  7z z  otUQT Q 13{ dev,! buf-6 6!{ o p{UU pUsT 18| dev'E buf6 6 7z p| otUQT Q 18`} dev!? buf6 6 7z 6} otUQT Q 1NN)O bufO-MO9 Q4&iocRh\ S7z TIwvalUL V6 WE X ~ QoR ~Ԍ *ERUQ r(U|T0QL r?T0 rWUs roTs rT0 rUs rTs rU}61818(9 buf9'6 ;4&ioc<h\ v ;otUQT Q 1$0d$(% buf%'6 '4&ioc(h\ : 'otUQT Q 15' buf-M9 4&ioch\ r +&sz &set c o!0+ FG  5  o'o '  m .  Ճ/<qT Q!G     F      ӄ # '܇ - g  +  +!х  'q !$     F       # '܇ - M.E W.˄ ؇؄eU} qUvT} tU} 'U}6t51v݊& buf'6 4&ioch\ +rc   o  + +G;I0___0F      Չ # '܇  -ErW.˄ Ȋ؄eU|U|1( buf-M9 4&ioch\  q +&sz &set ܋ o!$0+T FGm  5  o'o '  m .  N/<qT QT!     F  *    L # '܇ -  + +!J 'q!     F      ) # '܇ - Ɛ.EW.˄ Q؄eU} sqpUvT} tU} U}6t19' buf'6 4&ioch\ +rc T j o  + +!0T___0TF      = # '܇  -EړW˄$؄eU|U|1Y Y)Z bufZ-MZ9 ]4&ioc^h\ _!nq `+&sza &setb 8 ]o!0d+T dFdGɖ f5 fo'of'  m .  /<qT QT! k k k k kF k  k k k  k# k'܇k - < v+ v+! x'qx! z z z z zF z c z z z  z# z'܇z -^ ".EvWW.˄ }؄eU} Mq̚UvT} tU} U}6t1@@(A bufA'6 C4&iocDh\ E+rcF T ƛ Co  H+ H+! 0JT_J_J_J0JTF J w J J J  J# J'܇ J -EH6W˄K؄eU|U|1 q * buf-M9 4&ioch\ !Hq +&rc &set  o!ܞ0+ FG$ 5 o'o'  m .  /<qT Q4G          F            #  '܇  -  ++ ++!  ,'q,!` . . . . .F . ʢ . . .  .# .'܇. - .E+W.˄ 1؄eU} 'q3UvT} tKU} cU}6t1 D )  buf '6  4&ioc h\  +rc  -  o M  +  +G 0 _ _ _ 0 F            #  '܇   -E W˄ ؄eU|U|[   /  buf -M 9  4&ioc h\wstr   f~ ~out v   oG c0 x'q   j  x  Ǩ j  x   j  x  "Ԍ x*ERUQU ۩bo|sX0 qUsT Q~ p+U~T  pPU~T 6 tU T} U|T0Q~ t̪U T~ U|TvtU T~^+ 5| )| .)} /buf} '6  4Kioc h\#  o1_ Ь_ (_ G buf` M`  b 4&iocc h\wvald \ A b oԌj *ERUQ q¬UsT Q\6[? ? '? F buf@ 6 B 4&iocC h\ D o E W;   B o ͭH j H x  O j O x !R Z  Z  Z  Z  Z F Z   Z  Z  Z  ޮ Z # Z '܇ Z  -tU TU#Q ^+[ " ,  buf '6  4&ioc h\  W  ";7  e  o  j  x  ɰ j  x  tT Q tU TU#Q 'k^7+'[ $  ? buf 6  4&ioc h\ ~  ~  5  5&sz &rc ; out  ^  o  j  x !  'q  , j  x  ^ j  x   j  x . ų crݳU} !rU} 3r UT~QvRP tNU~T Q 6 tU TsQ  tU TsQ  tU TsQ tU TsQ 1 E '  buf '6    4&ioc h\ ӵ  otT Q 1 - % D buf 6  4&ioc h\   otUQT Q [v bv $v C bufw Mw  y 4&iocz h\wval{ \vr t y o  j  x Ԍ *EUQ6 q2UsT Q\6tU Tv^r+b1m -;m #m B bufn 6 p 4&iocq h\  p otUQT Q [R R $R C bufS MS  U 4&iocV h\wvalW \vr  U o '] j ] x Ԍ_ *EyUQ6 qUsT Q\6tU Tv1I 0I #I B bufJ 6 L 4&iocM h\ } L otUQT Q 14 1k4 &4 E buf5 6 8 4&ioc9 h\ A 8 otUQT Q 1 ./ $ C buf 6 " 4&ioc# h\  " otUQT Q 1 . " A buf 6  4&ioc h\ ɽ  otUQT Q 1 .  = buf 6  4&ioc h\   otUQT Q 1 . " A buf 6  4&ioc h\ Q  otUQT@Q RU#1 .O $ C buf 6  4&ioc h\   otUQT@Q RU#1 .  ? buf 6  4&ioc h\   otUQT@Q RU#1 0 ,  buf 6  4&ioc h\   otUQT Q 1 0 /  buf '6  4&ioc h\ y  otUQT Q 1} .o} %} D buf~ 6  4&ioc h\ =  otUQT@Q RU#1i 63i !i @ bufj 6 l 4&iocm h\  l otUQT Q 1P H P "P A bufQ 6 S 4&iocT h\ V W  S otUQT Q 19 H9 9 ? buf: 6 < 4&ioc= h\  < otUQT Q 1& l& %k cmd& 4c arg& G+Kret( R@UUTTQQR1X 1  k cmd /c arg B+Kret R@UUTTQQR1X 1  k cmd 1c arg D+Kret R@UUTTQQR0X 1 @ k cmd ,c arg ?+Kret R@UUTTQQR0X \ \ k cmd\ 1c arg\ Co] ] 5&ioc_ h\` b~ a ~i&retb ;   ag j g x !  % *e~  j  x . 1ăσۃboU~TvQH UUsT|Qv ;sUsTvtU T Q R   j  x e EăσۃboU~TvQ<pl ppp*ppxp*d76Npp\p#p. ]d6|' d6| Z(5!hB~OKăσۃboU|TvQH@!R!_!*l!y!!x!Xʎ׎.E[,WN!S!\!n!˄k؄ eU} eU}eU}U}.loUvT|QH   *   x |ʎ׎.EMWN!t"!\0!1!˄ ؄ eU} eU}eU}U}X   *- : G xS ʎ׎.EWN{ # \ > .˄؄eU}U} tU Ts Q  tU T Q R tU T Q R  !ih~8ăσۃboU~TvQ@*Ubo|sX0 UsT~ t:U Ts Q R~tU Ts Q  tU Ts Q Rv tU Ts Q Rv tU Ts Q R~ tIU Ts Q R~ tU Ts Q R~tU T Q R ! #!!!h "~"7uăσۃboU~TvQ< {sUsT0tU Tv tU T Q 8R tU TvQ  !h~(5BO\hsxx  ăσۃboU~TvQ % *W &n ƅ҅ޅ*\iX; HT^oU|T~Q1oUvT|Q~\pu.q} T0\&.q  U}T0 i+sUsT Q  UsT} sUs uUsT|HUsT| sUvT tMU Ts Q R| tU TvQ R} tU Ts Q R| tU Ts Q  t-U Ts Q R~ t_U Ts Q  tU Ts Q  tU Ts Q  sUsQ}R {sUsT0 t3U Ts Q  tkU TvQ R} tU Ts Q R} tU T Q  R  tU Ts Q  tGU Ts Q  tyU Ts Q tU Ts Q j |!h~h~ăσۃboU~TvQ@* UsTv UsTvQ~ {s+UsT0 t]U Ts Q  tU Ts Q RvtU Ts Q Rv tU Ts Q R| tBU T Q R  tzU Ts Q Rv tU Ts Q Rv tU Ts Q R|tU Ts Q RvQ( c(p(! h}(~ăσۃboU|TvQ ,oUvT|Q i))) )-):)mG)H)'܇ - t?U Ts Q  tU T Q R tU T Q R & &&!\h&~făσۃboU~TvQL\a'Bf's''''m'E''܇ -\(@((XƂƂ*ӂX i EqU @T nUsTs tU T Q R  tU Ts Q tU T Q R   *h#~." /; sUsT1 #pUv mUsT~ m Us !r!Uv !r9Uv tkU Ts Q tU Ts Q  crU #pU~ !rU6 p UsTv !r*U~ )HUsTv fUsTv UsTv "UsTv6 tU T Q g R tU Ts Q|*e[.  ioc. 1h\ cmd. ?c arg/ o1 e~ 2 &3 *e;  ; j ; x !T @ 'q@ .: ăσۃboU~TsQ8OJ aO K aOL ?aOM ha ;UvTs46tU T Q ; R e^+5 /ioc 5h\/arg Go  W  W;7  u j  x # j  x [  ioc /h\ arg Ao h  W; out  ^ j  x   j  x   j  x   j  x !^  'q   j  x   j  x !          *   {         #  '܇  - C j  x  ăσۃboUTvQ( dd*. FoUvT|Q(6 tU Ts Q Rv tU Ts Q  tU Ts Q  t&U Ts Q R0 tXU Ts Q  tU Ts Q R X tU Ts Q ^+5 [/ioc /h\/arg Ao  lh  '[  o  o  `  eKrc Ki    +  +  5  5  ; oout    j  x  J" j " x  |' j ' x  - j - x  3 j 3 x  : j : x  DB j B x  vK j K x  Y j Y x  a j a x  f j f x  >o j o x  pv j v x   }      j  x   j  x  , j  x # j  x lh  5/ioc+h\/arg=o Ah oKrc  ;  j x  Mj x  j x  j x  j x  j x  Gj x  yj x #j x ^+Q iocQ3h\Q;R) T U V5 W5 XW&rcY Z; out \j \x  +ij ix  ]qj qx  xj xx ! ~.q~T0! .q}U|T0 j x  j x  -j x  _j x i+sUsT Q  sUsT1 sUs uUsTH.UsT sMU}T tU Ts Q  tU Ts Q  tU Ts Q  tU Ts Q  tGU Ts Q  tyU Ts Q  sUsQ|R3 tU Ts Q tU Ts Q  s^+[ ioc)h\ arg;og~ o&i ;  j x  j x  P j  x  j x  j x  #j #x  Bj Bx {ăσۃboUvTsQ|AoUsTvQ| U|T}6 tAU T| Q R} tyU T| Q R} tU T| Q R} tU T| Q Rs tU T| Q  t[U T Q R tU T| Q 5 /ioc.h\/arg@o g o   W ;   < j x  n j x  j x  j x   j x  6 j x  h j x #j x ^ + [!  ioc,h\ arg>of~&rc;1   S j x  ăσۃboU~TTQx  UvT~6tU T Q R ^1 +!  ioc4h\<f~ W W W Wv!B 0!x'q! t $j $x  5j 5x  9j 9x  Zj Zx  <_j _x  nij ix  rj rx 6 tU T| U|Tv tU T| 3U|Tv tXU T~ t}U T~ tU T~ U|Tv tU T~tU T~^+[ ioc.h\&rc&i o  W ` e  5  5 !W ";  oout $j $x  )j )x  0j 0x  @7j 7x  r=j =x  Gj Gx  `j `x  wj wx  :}j }x  lj x  j x  j x !Q .q=T0! .qUvT0!B 'q!     * !   ! Ga uU TGQ X܇ - )j x  [j x  j x  j x  j x  #j x Ubo|sX0ÁЁLsT~ QR X0ei+sUsT Q Ubo|sT~ X0 sUsT1 UsTv s'Us uHUsTHeUsT sU|T 6 tU Ts Q RvX MCRB tU Ts Q  t<U Ts Q Rv tnU Ts Q  tU Ts Q Rv tU Ts Q R0Xv tU Ts Q Rv tMU Ts Q  tU Ts Q  tU Ts Q  tU Ts Q  tU Ts Q R~ t<UsT t|U Ts Q RY~ tU Ts Q  sUsQvR {sUsT0 t!U Ts Q  tSU Ts Q tU Ts Q Rvf5/ioc0h\)9W 1Nioc.h\U6Trc5 /ioc+h\/arg=o !fKrc;  j x  j x #j x 5 /ioc6h\)"  E +Krcoout {  + +  o# of5u@!/iocu6h\)v"  xI y+Krczoout ! + + 0! o# o5Q!/iocQ5h\)R"  TG U+KrcVooutj ! [+ [+ ! \o# \o52"/ioc2'h\/arg29o 4b 5;"  h"8j 8x  "Aj Ax #Fj Fx ^"+ "[& ioc*h\ argj x G> 5 o'o'  qUT (?j x  Z?j x  ?j x ! @ .q?T0!@ .qz@U}T0!B     !B  IA    kA # X܇  -׈N"B#3CSc0uU@T Q|"U}TsQ| 0Cj x  bCj x  C j  x  Cj x Gj >x !F KiG,E P'qP 4ERj Rx .QE%0Ǐҏ*Eޏ oFUvT~H6FUvT|R~Y~HYFUvT~Q}HvFUvT~tU Tv Q}!K c$i Ffj fx  Gxj xx .wG%0Ǐҏ*EޏioJiii!]Jiii jj&j3j?jLj\ljHqj}j nUvT|\jIjjJn Iƅ҅ޅ*X; HT^oU}T|Q1oU~T}Q| k/iocB+h\)BK)C#i E F5 G5 H}; I7z J!iKszKWKlunLW M6;  jKstZ>k [ N juj ux  j W W kj x #j x RL1&~m&k&+m&ioc(h\Gk .oGk .o.%*kl>2JUUT QT.* -ld76. 0ld6|' 4d6|1m fd"k-R9pUUTTQQR Wn ioc=h\&i;  (nj x tU Ts Q (o iocCh\;  nj x  tnUsunUU#tU Ts Q zp ioc q) Kioch\ oout p o# oh\/q ioc4h\<W  q uqUsTQqUsVu iocV6h\W q Yu Z5&i[&sz\W \ W ]!r mW mW!s n'qn!pt o o o o oF o s o o o s o# o'܇o -udt1u>u*KuVu EttU T1Q1R0R(tU TMQ1d5Adu/iocA/h\)A85KiC5 DW{ ioc*h\35<W i { %{ &sz W!w     F  v    w # '܇ -!w  W  W!y     F  x    x # '܇ -!Ly ) W ) W!z , , , , ,F , z , , , +z ,# ,'܇, -{08{{{{{*E{|pUsTv Q R| uW{UsTR up{Us u{UsTv uUsTv 0j]}?7 >)7 >65C!]/rCCt51!/r1Et)1M'5˄/i"/r1t)9'Koldy)@W)T+# + +y*)5Wy]E)]3W5D(Ve)DCWQ+|V+Q'VO +VQVT 7 7 *7 6sz # # j ;7 &7 :+j kH ? @ !8 key"8?A*BC =>c C  k ;7cs=a7sl?a7wfeAaE97ssGa7stiIa(Ka7nmiMa(Pa (Sa0(Va87lmXa9(]a:(da<f2cs'2csxak2ss'2ssxag r15m* r14n* r13o* r12p* bpq* bxr*( r11u*0 r10v*8 r9w*@ r8x*H axy*P cxz*X dx{*` si|*h di}*p*x ip*9* sp*fBQC'D'(E' (E'(7sE',7dplE'-7pE''/(F'07avlF'47lF'57dF'67gF%'7(F+'8 * * * * *  pteQ "  pmd] "%%%%/Q' pgd'u'"Qp <pudpip"#V[ @HI*3 g4g0 4*8;<=(? W (@ W$(A W((B W+*-@ %"4WW c 8( W,!W0( 4)18*WH+*P,%X5 `6 d8 h: l; p< t=WxFse? D@.rt@EPdlAFBFFH+I6J*KWOHXH]H+`"zB@dhWkW l*m nH oH(p~)0q cXs`ubx dy;Hhzp{H*      ;H zA5(+6P.mm3'h3'pIx    *W  W,  W,  W,  W-  W-  W-  W-  W-  W-  W-  W-  W-  W -  W -  W -  W - "W -*3.pid  *% %%(0@JJPOJX "J%'('+ c- a. a3 a4@6 A: (=*0>*8A a@D aHG*PH*XK>`+N?TKWKZK^Lk e0mLp4 q5(t*8u*@.fsxLH{LP~MX M`Ph Pp 9x 9 9<* WP q@W\8h= a  a r5   _H n6( %8 Q@  cH 6QP QX Q` ?Rh IRp *x NR /> W  a  a  a 8 @  XR   I  I "bR )R    R0  58  WX R\ R` 5h  R       !W "W # $* & a ' a ( a +)_ 3R CE D* LR N* RR SI( TI, Y*0 ] 8 ^ < _ @ ` D +a_H d=X gR i= lS w x z* } ~S  a a  E  *WS%SiUU W(W,H0Prcu_08@ D%H8PUx8 c "U UVc  a    >+_ !"w1$"w1+._<V+F%@@ %*?*@@'0sp*es ds"$&*(*008*X*`cr2*h*p*x0* WI** =0Ffpu /@( 3' n)8'*@@^'3m@r@r'0~(3k3' l (,Sl0)*l8X]lh%Vmp*xj c[m)R`mj< ! (! ! ( "!("% "+ "-"/ #W3n)     *~)* ;'~) ?)')* # lW%_*     0&c*&dF&e&g &i (&l- (_*'*'a end'a"( "( p)~+ cwd)I swd)I twd)I fip)I fcs)I foo)I fos)I)~+)IlI+*/)*+ rip)+a rdp),a/).+ fip)/I fcs)0I foo)1I fos)2I )),$+$+0)@&,)A&,)B&,I6,* A)$, cwd)%' swd)&' twd)'' fop)('+)5I)6I)9, )<,)>&,Y,I,*I,*?)Q- cwd)RI swd)SI twd)TI fip)UI fcs)VI foo)WI fos)XI)Z~+)[ l)\ m)] n)^ o rm)_ p)` q)a-x)bI( -*a-*@):#.); a)< a)= #.a3.**@@)Op.))P6,)Q-)Rp.@ .<*@)^.)_*=)`6,)a,=)b3.@)c. .n**@@)f/)hW)kW)na)qaxfd)ta )wW )zW )W )W)).@@)/) a)W)W fpu@)80)W)*)80)80)/ )/0)).@@.* e0* a*aKu0*K0*? +0+ j+! +" +#Q00*00*0 0 ,P1,W,W,F,F,F"-"-"-.81.91.<1.=11/<1/=W/> /:2/;11 src/A' dst/A '22c#W0B2(0202 val0 I0!I 0"I0#a0$2 I0*20+&20,#2121iX1 820'*30(0)220.a 01u30230304 05*06*2$3 fd2%2&2'u3(030%B20/207*380 40* fn0 43443 43>d43?*3@*3AI cpu3CI444a4a (444ct414&4 d4#W54 656  5 57 -578 H58 9^59 9r5H5 9^5: 5: :"~5 ;)5;*);+  osq;--5 ;/(< 6< < < =N6=*=N6=N66= n6= N6=6=S6=N6 >68> 6> /> 6>n6#W? 6 @?'p78?(6?) / ?*7(?+80?, 8?- 9?. :?/ ;6776p7 @@@/8@0@1W@2  seq@3?@47@56 @60@7 /87(AG8A A*A W8AI R8R88G8B8BB B8 8C 8C8*8* C88D8D  D8E+9E,E-xF_9F_9FW`F*h maxF*p*o9* G 9 sigG8 Go9 HR HS99 HU HV99`I9I I c I 9I'":I(I)I-`:I.I/I0 9I1I5:I6I7I8 9 I<:I=I>I?I@IAIS ;IT OIUcIVc IY1;IZ OI[ I^b;I_*I` Ia IJ;ILIQ IW:I\ ;Ib1; IE;IFcb;Ig;Ih _fdIiIm<IncIoIpW ` I%|<I*9I2":2_rtI9`:IB:Id;Ij;Iq;/0J <J J J J <0J <|< J< <J  =J!J" 9 J%N=J'9J(*J.9J0 9 J3h= saJ4 = K =K 'K * lenK *K (L=L 'M$=M%VM'M( 0MD/>MM#=MP(MW)8N >NaNaNaNaNa N#a(N,a0O)>O*aO+6PO8>O9>O:WHO;WL>?* 8OD?PKPZPpPPP endP?K?<*Q!?Q" W Q&?QD?QD? QD?QE@QE? QE@QT N@QY@QZ r5 Q[*@R q@ valR R Z@R @ valR  R }@S@U aV aW 1W[ A0hzAi?jk@cpulWmana oa( A*A* I0@@zB a a a I I* *(*0W8*@ D a a a a a  a( a0 a8 U@ aH aP UX U` ah ap ax  a  a  a  a a a a a a a a a a*@tEA) 6! a(" a0# a8%@&P'Q(R)S, aX- a`. ah/ ap0 Ux1 a3 a6 7tE9~E;~E=*FavgGA@ D yE0KELM*N*OW P$Q&SE(E]F FFFF0`G)a6h ai a j a(k a0l a8s U@t aHuWP W W W W W W W W)6X)6rqGEGF^GG%GForqGG9W 9W 9W9WQ;H    a_HbbGbsI|H|H_H_ HH HGH*)~) H0 I { t G[  _@  D  H n6P *`  *h )p *x  u r5  G[  cHcpidpS7JJS9 8S:WS; r5S<x inoS=aS?2 S@@SBZH4rcuSC_`SDBpI_J* TJTWT[_J UoKUp) uidUq q@ gidUr @ Us q@Ut @Uu q@Uv @Uw q@ Ux @$Uy W(Uzh0U{h8U|h@U}hHU~hPUXUL`ULhULpULxU cUUrU<U3rJKckeyVLV8V3V semVG[(VPV cXƆ`V h uidV q@p gidV @tV!xV|V~V V*3uVK L L L L MAXW^PW_8W` WaWb WcWeZ Wh%8Wk<@WnXWq`WsdWt%hWwpWxWtWzxWWWWWWWW8W6W / itWWW>W&hW WJJWCttyW;WEW N@WaW aWaWaWaWaW@W*W*W*W'*W* W*(W"*0W,*8W*@W*HW"*PW,*XW*`W*hW/>pWWJWΉW_W WWiWWWW3'W5WG[0MJ WPWr5W8WZW P P QX6QX̲X̲ Q@YQY} Y } Y a Y (Y*Y,Y-Y0;Q QXZc?RZd)Ze Zg Zk r5ZmtZnÐ(Zo0Zq \8Q DR< SR ]R [R[![ [gR R R* R R R*R*\^ie^ifW sdaig `ih ii%`^JxiD`iE^iF`iH iI5(iJr5HiK5PiL*piM*xiN*iO*iP*iQ*iR*iS*iTiU*iV5iW_JiY i\*i]*i^U\i_^p^ `*1]^"jkY`k-k-k"`k#8k$ k% k'`k( k) k+`k, k- k!ak&Y`k*`k.` k'a7` opsk1a` 'a,ak2kak4*k6Wk7W #W\@a#W\Ha\pa\qa\r\sa a/\ b\6a\*\Gb8\_\*G\\b$a b @\b\a\*\*\* \ (\,\b04rcu\_8\cH\ba\c\ id\b c<*\;c\@c ;c(lcl lUll m dmam& m)G[ ldtm*%d8m.*@m95Hm:chm;4epm= xmC'|mD~  dn /encn* altn*n*n* n*(n0n8n@nHnPnXn`nhnpnxnn n!*d/e mFc/\ie^ c`WXe2lruY$Eedeiej *k*/(ReiehIes* /(u8fz* pp{=f|*}*~) 8f/Yf*/}fg cogobs refo48o_JHohoWlo*p opso xoco~}fG(Q4g$e$e$Bf$YfK_VgW Q ogval*VgEMgN cPW@JgblruK$|g@WgX cYogE@GPhI*gUIV * g([ 0\ 4^*8L@Fnh$g=j[E(mhn*o*q r s t vW L@lh$nh=z[E0}Xi~** c c c  c(E i**L@|i$h$Xi=[0Di3Ph3h@3i*i0 j  r5  k    I  c  {( W0 W4 K8 @ߣP  p  cx #D $ u % u 'I3ii5kctx6k k=Nk>Z@?(XkkYG[(\kb*h*t6w }$Ek**Ll$k=_@*lii SlFrb6*Nk XlpbQmpc $ph $pj=pkQpqt ps(pt0pu8pw@p{Hp~PpXp`php2ppKxblQm#kkkmacid q@@ m Q m* S@@q3m@[@*P*X*`*h*ppgd  ^'x) 5 ?qE*LWS Z ])_ar5pG[r***** *(*0*8?@r5D*H*P'*X3*`*h.brk*p!*x**%*0*qq@q9e*hr5pqx%rj&r**   c) \r**) mem*q*3Ecq* q quX  r r*,r<* W>rpp/rp7r(pmdp9 h'0pudp; ~(8@pEVHpFVPptepL c'XptlpPV`pT Ih1W.s @RRRRR5q65q95q<5qG8oso*o1o1o*o* o*(o0 sIsq@@rtrcrssCtscs tsBtsDtsEtsFtsGtsH+usIctCtttt Vt!Wt"W tt ttu,+uu- r5u/ _u0ct/sAMuHtsK s:hus@s$0usNusO*sP sQ (s+us, s-s.s/ Muhu 0 pMv qj r  s  t c u  v'$(uuv"rvv#vv&vv'vv' vrvv/wvwr5w GwvKw$v wv3v/x3wx4I lenx4Ix27w$vx6ax1Xwwx87wxiwxjxkwZxrwxsxtrvKxu_ xRxxTWxU@xVrvxWxxX7w xY{0x[{8x_"|`x`Yhxa*pxbcx8xdv]wxmxn4d_uxvwww*x {{ |  } ~ q@  @ W  \ \ !Ԣ  Y( I0  c8 *@H  vL  P  X  `  h Ip It Ix I| r5    S  G I G[ * *   ޢ  ' '    0 @ H  P  T  X  \YԠ` h+ Hp 8YH  P (X ` h  cpx{*' @x|xxxxڀx x(x 0x 8x '@x EHxҁPxXx `{|*@ Y   v  *    Ĥ( !I0 !N8 S@ "bH *P *X *` xh G[p    c &q #  $   Wv   j    W  1(+ j`  c I   !I " /  0 i 1  4  6W <5  BF@ D"|H FBP I)X L` O ud R\h Sp Zrx aV bVPrcu c_ d \ f5 k0+ nr5@@ oH qr5X r`|#Wx{xW{x7wՀWFՀXw߀xx'x{'Ex', yEyFxyGYyHyI͐Jź mntz z xׁ́x x^ {"]{#_ nid{&{-*{4*{7S {R.{SL{UL{X{Y{Z W{c 8 {d_J(4rcu{e_H{gcX{j` id{mp{pt{qFx{rx{uQ*BBG].)0|3|4|6|7|8  xa|9t  |ك| |" |$r5 @@|- lru|/|0) كS2- nrS3 nsS4-4B*Q<*} h val}a }Q#W~   ք 5 *  V  V# Vlc4rcuVm_Vn8Vo /VvVx'Vy OVu$c2xV*(VrVt*VVVF -` V"VcV 'c7* VCHfLfkL"VV7 keyVLVGVƆVKV6VV V /(V3V*V*VVV ' (VNV$E VuVV @ VV$N  p. 8Ec*0)8@ uid q@P)X `$! hUcU 8U gidU c@r<*GUUrcuU_.A@@@g@h cpu@iW@jW@kW (@lW(@mW(@nW(@oW(@pW@rW@s@t@uW@{ / @|7(@} /0@~788@@@I/S7@*N=Ή*?8W7W W! W"*W#aW#a W$*(W$*0W'_W(aW)aW0W1 W2 W3 WCWD_WL׊WM%WN׊8WQWR WSWT_J܊7&*JJ6* 6 @8Z* Z d% 0͋Z8_ ` 4rss J0n8Z@ X D fn 2 arg cxT* i bD T  IZSZTZUGZWČZXKZY_ 8ZI qZJ iocZK?R3 Z\W0*YY cYYY Y* YW(YW,Y80YW4Yt8Y4HY XY XY XY XYXYr5`YdYiUhYDzpY!x.devY(Yg0Y 4Y8Y@Y5H.idY hY*pYxYDzY8Y \Y Yf YY 8Y!=Y"Y#5Y&0Y(r54Y)8Y*U\HY-p .fqY2z Y3Y55Y65Y75Y= Y>r50Y@4.tdYD 8+YF_@YKZPYP5hYRx YSYUxYVxYWxY[5Y] Č Ȑ val Ґ val  <$//4i\n*v͑ 8_ȑ`)aȑbȑ(c (d 4rcue_ reff/0\ v * %ґ1WT/E** n/# . 0  4 45W67 *   0 q@  R @ P ˓ W 0   C C( C8 jHГЏ()*+ ,0-5@. r5`/ d0Yh1p2 x3*44  val #W6ٔ BE2uidF q@2gidG @H D4JH ٔ ٔ ٔ ٔ ٔ  ٔ( ٔ0 8 @H:* W(W, ٔ0 ٔ8c@ !, :@89:;<=2 >2(?20@P8Y 2˓#KYK7XDE2FG 'H2I2 J2(K0N @8O^@QwHSPPU˓Y'˓;;{ٔ,Y{YEw{;cxYkZ[a\a]a^a _a(`a0aU8cU@dHeLfaPgaXha`iUhjp8WWWW WWWino  G( G01W1kA* WWW WWWWXi ț(0 8@'HPYnYWÛYÛAY|͛ YK"Y"X8  W G[ 0 H.ops! {**,*@ wܜ }  ܜc Mv 6 Y w     Þ  ( '0  @8  Z@  sH  P  X ` ӟh  p  x ) V  f OVOT ;rjri^IO|Ir jIWB[rȞ'jIWWrc;@I;,ZrEsr__rxMvRvIrrtӟrğr؟ r  )IrGGjQL ;.fj[MvRvk6@  ^ WL Ԡ = _@  !   {@ M R R  '  W M W*@ ZϢ [ܬ \ ] ^; `Y  b( d0 e8 fۭ@ hH jP k&X mS` ovh pp r x s u v/ yR {p }  ԯ aϢ ٢    ( | j  5pid JJ 4uid  q@ q@  $ ߣ  * W W  W W  @  5  aL  )D= *_ +1 ,| - ]<* Pc*0      ) S͋Ĥ* D O      d }  (  0  8 @ H ΰP X ΰ` h p  x ( ( ( (  P  x       ɤDi X] g{lv   A)* ;+ ;,iU-.O /*(0 09 v4:I8< @=r5D> cH? cP@XA5`BCDzE F5HIK c8Q   K*K+*$ 8=eeFaWj   +pos    Wjިj'sjFsMvW$ Y]Y} YY p vjeb^j%&)' ^{کjW*jm'ߩ {j%j]Hj*fjMj k*j****WRjsW jsRW.j.B[38 `jBuujzx+# buf+'+ + + +  + (+ 0+58 op+!X+`+ !h+cpePjjW(}jjWUW Wxܬ{xWìFx{͐{\;{"Yx'@͐{x^x{x{xۭ͐{xF͐{x&͐{xvS͐{x{xW+q͐xqRX͐IWzX{x'{aa Ʈ{/{xjW R͐{j4\p͐xW͐x\u͐x ԯx mt [ *{ٯ1W @{OY@d{T}{Oi{YYΰYx ӰY''(uxPY'-xYFU{˓}YGñ  ͱұxĤFcܱ *@@²AFBCDzD E( sdF0GZ8IWJWKWLWMWѲcbio ̲ S 8 438 c@=HPaXG` Qhpr  t Vx&+ * 8 . I[>[    ʴVJ>b n *S6 rev* =   F4rb6 ns0W8< >@ ida` chKp4rcu_x= ? ops ! h( 8"Q$ j% & (( 02 89@: H= ٸP@XA `?  F2dirִ" F knju c5 5@`h 'x    @  A %Vm##P8#-Quc=cjusVcucsouc#'^ٸ#Ÿ#m'޸##W80'() s* +,ƹ - 2(8Ic I&&F& &m&n&o&X&0&1˹&2 &3 c&47 &5 d(&7 0&9 d8&; @&= H&?ܻPɺĺDz˹κ Dzĺ(DzĺII2djDz'<jDzĺ'ijDzĺܻjDzĺm'& & *& M*Dz'MDzF/` r5 }XR0tu vw!x*7yK z e( Dz *--2²K2<e2ssPJ }~ͽCbufݽ 'ͽ*'ݽ*?Kn*#<Ux72(7FP2APn2njZs#F(EFF modG  opsH!ٿI 3JK  'LN2argM c2strN{2arrOԿVvWWX'Nv \Ͽ max^W_W num`J opsa!ٿbcϿ 0(8)S6 * 4*i W ' iK~*7` - . mod / @ 0DzH mp 1P 2JX 8 52 6˹ 7 U 9 x ;  <( = 0KKP'~2xKPFZ F}  1W >08 E mod F ) G޿0P pd qc rc s tWFmtn w    W ' 'ʴ DS *(d  X^"X  %/  *(,--.. //091 E  idD9 clsțM  R@Kb*Kr*@ endF** (0&8rK*/(L***** 04rcu1_2Z3<* HIJK LM*Nr L*@pHFPAXbus`}h cp cx5<)5 .msi(8@aHaPX `hx V v.idIr5 !!# b$`%j'#o) + ` , a - b . c / d 9 e < f:; <>R  b!R"R#R $R(%R0&R8'R@(RH)RP*RX+R`,Rh-Rp.Rx/R0R1R2R3R4R5RRCbW1U1WlHx+y r5zW|W}5~00@ +*8o9  9 !9 "9 #9 $9 %9 &9 '9 (9 )Ir5 _J @  @  A  B  C  D  E)6Pa \Z   W                           Wggaaaa  (.qos0+,F id-./r5 0(1802*X3 /`4 /h5 /p6 /x7 /8*9*:*;*<* dev=> ? o 8 (opsR 8R b bQ8(QW=MgNFOFP!Q!R! T(U0VR8W b@X bHY bP[RX\R`^h_RpaRxcRd b pmfhV`aF busbd eFg hF$ji(kn0mR8n b@oRHp bPqXrR`s!ht!p pmvxw b pyxln>g`2{3F5!6!89 ; (< b0>R8@(-@AHC P pmEX'{ss0X<YFZ![\ ^ b pm`(<#W-iM s'ssWW*1W1W<8 0!s" 1W11WB1WO<cd&e2f4g lidh   a ocma  @/Q0V ops1" dev456(7 8 [ e<" 5#W getn put ~  ( 08#@7H7PKXd`}hpdxKnQ%RW idSWT%QPf_gVhWi-VnV_~Vs%%%%F%FWc#%F F7%(VK%<Vd%VPV}%Fi%FFWW*%cV%WVhLg busMNOP Q(* (8@Pprops c Pdev W W g   W " "(5X65len7W cap8 $@} }*` JKbusLMO c P(Q0SW8T<U>V@WBXWDY HZ I\'J]P`Xa`cIhd le mf n g xh ppini qj'rkExmnatvy  zW( |W- }W. ~W/ W0 W1 W2 W3 W4 W5 W6 W7 W8 W9 W: W; W<WW' W W WFdev.irqWr@ WB W B W B W B W B W B WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB W B W!B W"B W#B W$B W%B W&B W'B W(B W)B W*B W+B W,B W-B W.B W/BF H r5LP W@M' W`M WaM  c  .vpd ' WPO   YX '   ' I W`P '  '  t '0  2 .romw8  @ FH  *P ##X   XF 3  L  `( 0 y8 y@ H#P!X!`h/ r*I**   3*( ! "#$* 3*cWW2*WI;Z<r5=H W8_aehk l  o (r 0gZZ 3L8`QyeI~#WoEoNoT oZoeB V,r9rBg**$po/oooGoo*~<*oo*$KE(p0vmap1m'p2 _p3 *p4*p5* @p>p? p@ $m'=m'*)Qm'Btm'***V,r9rWy,r9r***m'm'*cFm'm'RR2m'*EVKm'*7  * WW  SWW' sgl()W*W P"G#W5j^ 5:Ojw?U8( ?U16):?U32*FU64+RJffff ffff0f4f8f<@fHLflfpftfxf|!fff1f*f*f*f!* f1*fA* OOZfMOOZ f!)J*O+O,Z-Z.Z/56O7O8Z9O:O;Z<WB*CODOEOFOGZHZIR~SOTOUZVfW7^Je~rk)l m n(Jo-p.*q1~r,t=urBxH}DevIOJOKOLOM6aOP}QfR0)rff B   ZOOZOOOO Z Z ZfZZff<*O"*i O O O O "O*L_`iabcd,e<O*h0Oi)r Bif\]!^i_f`faO bO cOdOefffiiOOZZZ Z ZZZf.@GAfBfCfDf EfFfG0L)MrLUNNOfPfBQT0V)WrXfYf ZZ[Z\fB]0be)crLUNdefffBgrlm"G=n"=o"=p"eBqr0pvwixfyfzf {f|f}f~OOZ) O8O9Z:)<OTOUZV)XB' O O Z0o) r f f B40`iff f) '*So*B| $56Z7O8O9Z:O;O<O=O >Z ?f 8@rAZBZCfDv G tM3tN ;tPWtRW tTW ?J̲ J YCYD < YI L YN` YS` TeYAYBYC%% ` a  W3 W3 8 B LtXXn&XoXpWXu#Xw Xx `Xz X{ X~W8Xr5<X Q@X \PX\pXx[t:<* FcZ_c fvccH r5 B[c (Z0:Z v @jk lenl wpmnxoxpxqxrs t(x*x* @!*8&*@@+ H 4N8W=WBWG mapLNTJ @@]oaZ@m sbqwW | $ ws( 0W4 8 <S#YmYtmYuYvYwYxYyYz Y} WYY Y Y Y  Y6  Y6 (YO 0Y  8Yr @Y HY  PY XY `Y hY pY xY Y ' y  v  HYYY @YWDY&HY  WY] WYhnYiYjYk*Yl*YnWYoWYpW YqW$YrW(YsW,YtW0YuW4YvW8YwW<YxW@YyWDYzWHY{WLY|WPY}WTY~WXYW\YW`YWdYWhYWlYWpYWtYWxYW|YWYWYWYYYYWYWYWYWYY{Wc PYYY ;@Y ;H<* ,0`: pB JO  T (X0]8b@g Hn2Pr GX{j` h p x   Af qgh ibk l  tagn o$qW(tW,u ;0 biow̲8x̲@ HXa`ahapxz|~Gl  ref * 3%  elvF z a c   f WWWooPrqs r5 k  u   x opsmapW8 W< W@ WD WH LWPWT cX`f h5p^ Y YY1WY ? ̲W  iUm  iU 6 mW* WO iUW; h h m  T  w  *  iU;Wnc ' iU  iU(     ' iUQ < , L A ` Q p e #W   u   #WZ z {|% 1GF K6tj  icqÐ j cz *  seqW  *@6b3@LU\@N)SX[*a cefqgz m csy W r5(Y0 Xf `f hWpWt xxx  g1W&q@@79r5AF* JWW *f !Brq"#[b[BGpbe} uqb 2bcWGbW7jx WWLx Wox u #W& aP4rcub_ lencdNA(gshilm o0p Pr Ts r5Xt`upvrwtxvy*xz*}* idWW lunaW WcKK5FF revF (08@HWP W  W  W  W  W  W  W  W  W  W  W  W  W  W ppr W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W W\` d8h8px \W    + +   \ c  cWW5% r(*8&') +r50,V8.5@0`1p2%3J5Z6#&7"&9Z:_J< > @WBWDWGH*QWRWSa\WeghijklWmWnWoWp*q*z W{ W | W  W  W  W  W  W  W  W  W  W  W  W\\WW* *(01.irqW4[&8+@+0c (0+r8s*HOP"QRFdevS(TZUW.idVW  XW  YW! \W" ^W# `W$d (e ,kW0lW4o K8p<q c@rrH  1WB"PO W#DrA(J K"LMU\4rcuO_pQSZ*\]_`abOdeg  sdbj'k!m Wp Wu Wv Ww}~*W !*'0j#W$4!Jh*m$3WW $a $c dF m$(t$0$8$@$H $P $X $` $h $p $x % $ (% <% L%  e% u%" %* u%4 %; %E %N (%W%X&a)&g =&qV&yF "W$W(W,*0*8@D  W@  WA  WC  WD  WE  WF  WG WL!P!Xa`4!$$rr$$'$F$$$"Wc$$$$$"$%"%!$(%"%<%-%L%A%e%*Q%u%j%%"z%%W%%%%";'%%u%&'%!)&$&=&$.&V&B&1W&m$ &#WL& #WZ.'#W'      4'5&6&7&8a9 AX<(4dev=>?B'E.'F.'G.' H.'$I.'(LI,MI0NI4OI8R@U cPA0`)4devab'cCqd eI((' 0)D)D)I)()  *  ) $)U)V #`)a b Tp)q #r)) **M*O ASCOOOTu* #u* ****   #* #****m++!) ) *2mpi* Q+ # u*h+iOOZff ffff+ f ,*\?-i F        ?- ', . / O-0 L M N O'P'R T U'V FXFO-*F_-*8:-;<a=I> ? @I A(_-`q /rstau' vI$idw(x,y'0z 2{ 3| 4}I8~'<a@ HRI(P X Y'ZZ\-Xq/5_J c@ cH 'P 'R/ch 70  ''0phy)P X'Z'\ ^ _-`x) 1*+, -a .'(/a00'81a@2 H3 I4-Pphy5 1X6`7)p/S:1TcUS^e1_c` Sc1d1e :11' 2ioc:A I ?A  8I<I)@ h i jp*2:A34id5 67 8E@9u0X:;%E<w=>? @A DbE\FU\I\8J r5@KHLEXM `PdQ hR'jS lT mV5pW5X r5Y [ \ ] ^ _ ` a b'd e'f(g'hEiIjEkIl mInIop qr's t uIvIwI x$y%zF(} 0~ 1 2 3 4 5 6 7 8 9 :/@///H///PAAAB''AB1B FI c F  ''''  ")C$)C`F#Q+# ,\++(+O!q/q/q/70 r5 r5r5 r5   '    c  c '(  c0 '8 ':  c@  SH  cP 'X 'Z '\ '^ (`  Sh Ip !Fx  r5  Z &F 0F I 5F  0F   ' ' ' I ' ' ' (  S ' :F  '(  (0   S8  '@  :FH  P (`  Sh 0Fp 'x (  S I I 0F '  ?F  S  0F !I $' %DF &  '  (  )0F *0F +IF , S -  . 0  1  2  4E 6 70 8@ 9P : ` ;5h >NF ?^F @ nF A B^F C~F D^F EI FI GjE H  I  J  K  L  M  N r5 O  P  QB RB( S )0 T )4 UM* V* W X cY'Z [ \x]x^qB_qB`qBaBbBd e2)}A  }A1AAAcISAAA:A$' /AAB:AcSSB!B1B:Ac>BCBlB:A'lBSS~BBB:A''BBB:A'BBIBBB C:A$a)C} I<D''   '' I     ''IC' '"'$'&'( '* ', '. '0  2 3'4'6'8 :?E    'jE?ASRES'T'UIVEIE*vEEE:AKE*A EFDAIF*D1' +Fe11F?E(^F*InF*S~F*IF**dF:AF++Z2cF_Z8cF_Z?cG_d#Gd:G:A:GW8dGU[;G[=Gs:s<["]GFtZG:A (uGFte L\ioc-:AM6'MFI'%++> Lfi>*> NL goutHD*D*I' '#L AI' '#L TI>]fgggI' '#L O)e J:eOdlJddHeQJ U T~,He U T~Hd Jdd,He U T~Hd "Kdd,He U T~_e:K UFYK Us TUgGK U  Ts Q  R}  XvGK U  Ts Q ,G U  Ts Q *RL*L ePGP\iocP.:AMP6 \ascPD MQ 'S%++>TGPfiU>V*>W N\P gout(MDY*DY*ZM'i 'i#L M' '#L TM>]fggg&N' '#L O)e YLN:eOdNddHeN U,He UHd ^Odd,He UHd eUOdd,He U_emO UFO Us TUgGO U  Ts Q  R~ X} Y|GP U  Ts Q ,G U  Ts Q  *R\P*LPeT\ioc/:AM8'M''%++> Tfi>*> NT goutBMQD *D *Q' '#L Q'1 '1#L Q': ':#L TKR>=]f=ggg}R'C 'C#L O)e R:eOd5SddHeR UHeS U,He UHd oSdd,He UHd Sdd,He U_eS UFS Us TUgGNT U  Ts Q  R}  X~ GT U  Ts Q GT U  Ts Q ,G U  Ts Q )RT*TvXhioc0:Ai9I%%++&*& NY woutU!*!*U% %#L V% %#L TyV&VfgggV% %#L x)e V:exdVWddHeW U} T|He;W U} T|,He U} T|^d Wdd,He U} T|^d Xdd,He U} T|_e X U}g^8X UsFPX UsUgGX U  Ts Q  RvGX U  Ts Q ,G U  Ts Q RY*XvpR^hiocp6:Aiq&F%s _&t2Nb^ Y%v %v#L Y% %#L j [&&&&&k!Z!!!Z!:!Vueeeeeeej a\&&&&&k![!!![!:!Vueeeeeee\!!!!!:!\!!!:!:!]% %#L L]% %#L g^j] Us TvUgG] U  Ts Q G] Us T0 Q_G] U  Ts Q G0^ U  Ts Q ,G U  Ts Rb^*R^DdhiocD.:AiE&F&G :GszH'&H '&I*N\P wout\>_%K %K#L j`&Od&OcVdO+d8d+d8d]Fd  WdddqdrdHd  n`dd,F T Q,Ta&U&U&U&U&Uk!U8a!U!U!UVa!U:!UVueUeeeeeea%W %W#L b!_*!_*Cb%` %`#L sb%f %f#L ^)e_b:e^d dbdd,He U| Tv#Gc Us TvG4c Uv_eLc U|G~c U  Ts Q Gc U  TU# Q Gc U  Ts Q ,G U  Ts Q 4W %cFd- ;- G_W|.cd-|D-|P_:DWW%Wd-<-:Wz0d-zC_-zX*)e-@V-T*:D*D*WD(#VHe-DCV[+_e#V*u *ue#Vy#f-#:-$-%-&-'-(eUeUeU fUfUef,fU6;fU6JfU6YfU6:U6sfWfWfWfWfW:fW6fW6fW6fW6:W6yg-:--9gGgUgcgqg:g6g6g6g6:6Obp7**F*R7K7Wq q7 7 7 7 rint W ,7 *79s8 e9u8 x9s16 9u16 "9s32 39u32 9s64 9u64 cW(  7 *  1W 2W H I X ] ^ _ `K77 $ & ' ( ) <W  D }    #7 % & 4 = B ^* h3 m" nD q\ } P \ \ \ W W \      P     7 _ _ _ d7_Ky*   yst*W3FuH  F  Z "i   3(  0 V8 @  H  H  H H  H  H  H  H%@ HtYPhFFYL QWC5(kpV W(W,L0 Q8@ABWD [HPLmem`@ƿ* Wqv "(c0W8c@WHWLPWX`Whp o xWWWWW`c W!`"W%&9W:?AD F P QW(T0)$   )H ""h 1val  $ | H ,h )     *      |   XX / |    /  W*, fmtFFFWFF$ e: f*go hy uo v3w3 keyx: t U V  j keyk~ n keyo~ v6 7 8 8x FFFFWW4W key9 (!W= 8U V modW XFY Z ([ ,\x 0FuVvVw[xWyW  *WKz* /1W set3 get57 1zR ' M p  .( .08!@" NH# lP$ lX%`&h'p(x)ک*+ ,H-M. / u0 1 2Ϫ3 5 9 ; >ک?2@P !3 key"3?A*BC =*>c ^   *;2cs=\2sl?\2wfeA\ET2ssG\2stiI\$K\2nmiM\$P\ $S\0$V\82lmX\9$]\:$d\<1cs"1csx\1ss"1ssx\g r15m* r14n* r13o* r12p* bpq* bxr*( r11u*0 r10v*8 r9w*@ r8x*H axy*P cxz*X dx{*` si|*h di}*p*x ip*T* sp*BlC"D"$E" $E"(2sE",2dplE"-2pE'"/$F"02avlF"42lF"52dF"62gF%"7$F+"8 * * * * *  ptel "  pmdx "% %%%/M' 1pgd''"Mp Wpudpp">qv@ H I*.ff0 4 *8!;!<!=$!? W $!@ W$$!A W($!B W+%-@" %"3"W"W" c "8(" W,"!W0"( 4")v18"*WH"+*P",%X"5 `"6 d"8 h": l"; p"< t"=Wx=se"?C@(rt"@%ELdl"AE"BE"F5H&"I5"J*"KW"O?H"XDH"]DH&"`"B@"d"hW"kW "l*"m "nTH "oYH("p")0"q cX"s`"ub"x d"yGh"zp"{cH"*" " " "" "" " "G""" "A""5(&"5P(mm"N'h"N'p"XIx" " " " "*"W " W, " W, " W, " W- " W- " W- " W- " W- " W- " W- " W- " W- " W - " W - " W - " W - ""W -"*"~3(pid" " "*"%" %"""%("0"@"IP"IX" "")J"%.'"(.'"+ c"- \". \"3 \"4B@"6@": ("=*0">*8"A \@"D \H"G*P"H*X"Kb>`&"N>"TK"WK"ZK"^}L"k 0"mL"p4 "q4("t*8"u*@(fs"xLH"{LP"~LX"L`"LPh" Pp" (9x" (9" (9"<"*" "W""P" @"W"7" =" \ " \ "5 "/  "H "6( "%8 "P@ " cH "PP "\QX "fQ` "Qh "Qp "*x "Q "= "W " \ " \ " \ "d8 "? " "Q " " D " D ""R ")BR "  " LR0 " C58 " WX "QR\ "fR` "C5h " "pR " "  " "  "!W ""W "# "$* "& \ "' \ "( \ &")y "3zR "C` "D* "LR "N* "RR "SD( "TD, "Y*0 "] 8 "^ < "_ @ "` D &"ayH "d=X "gR "ig= "lR "w "x "z* "} "~R " \" \" " "`""" " "*"W"R"R" U"U "W("W,"#H0Lrcu"y0"8@" D"%H"7P"Ux"8" c" "U" U"U"c" " \ "  " ">&"y" "!"1"$"1&".y"<U&"F%@@ %*?%@@#.'#n0sp#*es# ds#"#$#&#*(#*0#~08#*X#*`cr2#*h#*p#*x#0#* #W#D#*#*# /=fpu# f/@($ N'$ )S'%@@ y'.m@ q@1'' (.k N'  k  ( , k0 k8 X kh %lp *x j  c l O) pR l jW % (% % ( &!)&% &+ &-&/ *")* $ ;3'") $??)3'O)* ' cW)*     0*cX**dF*e~*g*i *l (*+*+\ end+\, , p-"+ cwd-D swd-D twd-D fip-D fcs-D foo-D fos-D-"+-DlD2+*)-*V+ rip-+\ rdp-,\)-.+ fip-/D fcs-0D foo-1D fos-2D -)+ 2+ V+0-@+-A+-B+D+* ;-$l, cwd-%" swd-&" twd-'" fop-("+-5D-6D-9l, -<|, ->+S+D|,*D,*?-Qi- cwd-RD swd-SD twd-TD fip-UD fcs-VD foo-WD fos-XD-Z"+-[ l-\ m-] n-^ o rm-_ p-` q-ai-x-bD( ~-*\-*@-:--; \-< \-= -\-*%@@-O.-P+-Q--R.@ #.8*w@-^w.-_*3-`+-a,3-b-@-cw. .d*%@@-f-/-hW-kW-n\-q\xfd-t\ -wW -zW -W -W-#.@@-f/- \-W-W xfpu@-/-W-*-/-/--/ --/0-.@@.. 0. \.\K0*K'0*? /i0/ /! //" /#'0~0*00*0 0 000W0W0F0F0F111284129O12<O12=O1413<v13=W3> 3:13;41T1 src3A" dst3A "11c!W41(4<24<2 val4 D4!D 4"D4#\4$<2 D4*c24+&c24,#26525X5 3h24'24(4)1A24.\ 41342K34344 45*46*6$K3 fd6%6&6'3(4~34%14/24728434* fn4 3P333~337>47?*7@*7AD cpu7CD8.48\8\(8V4/ct808&V4 4!W94 :4: 4 4; 4;< 4< =5= =54 =5> 75> >" 5 ?)5?*O)?+/  osq?-4 ?/(@ 5@ @ @A5A*A5A55A 6A 5A86A5A5 Bb64B 5B IB }6B6!WC 6@C'74C(86C) I C*&7(C+70C, 8C- 9C. :C/ ;}6!7!767@@D/7D00D1WD2  seqD3?D4!7D5b6 D6:0D7 I8+7(E7E 7E*E 7ED 7777F38FF F88 38G T8GT8*d8* G8=8H8H  Hp8I+8I,I-xJ9J9JW`J*h maxJ*p*9* K (9 sigKT8 K9 LR LSL949 LU LVi9Q9YM9M M c M n9M'9M(M)M-:M. M/M0 9M1M53:M6M7M8 9 M<~:M=M>M?M@MAMS:MT jMUcMVc MY:MZ jM[ M^;M_*M` Ma MJJ;MLMQ MW~:M\:Mb: MEg;MFc;Mg;Mh _fdMiMm;MncMoMpW Y M%<M*9M291_rtM9:MB3:MdJ;Mjg;Mq;)0N \<N N N N ;0N p<< N\< |<N <N!N" (9 N%<N'@9N(*N.]9N0 (9 N3 = saN4< O L=O "O * lenO *O (Pg=P 3'Q$=Q%qQ'Q( 0QD=QM#L=QP(QW)8R :>R\R\R\R\R\ R#\(R,\0S)b>S*\S+b6PS8>S9>S:WHS;WL:>>*8SD>4SEySFC5SGW0 T>H?TKTZTpTTT endTH?KW?8*U!r?U" W U&W?UD?UDr? UD~?UE?UEr? UE?UT ?UY?UZ 5 U[?V @ valV V ?V 6@ valV  V @"S{@"U \"V \"W/ ,W"[@0"hA"ir?"j"k{@cpu"lW"m\"n\ "o\( "cA"*""""A"*" D'@@"B" \" \" \" D" D"* "*("*0"W8%@"C" \" \" \" \" \ " \(" \0" \8" P@" \H" \P" PX" P`" \h" \p" \x"  \"  \"  \"  \" \" \" \" \" \" \" \" \" \%@"E"cA" 5"! \("" \0"# \8"%@"&P"'Q"(R")S", \X"- \`". \h"/ \p"0 Px"1 \"3 \"6 "7E"9 E"; E"=*=avg"GA@C E0"KE"L"M*"N*"OW "P$"Q&"SE(%E"]EEEEE'"`%G"a5"h \"i \ "j \("k \0"l \8"s P@"t \H"uWP "W "W "W "W "W "W "W "W"6X"6rq"JG"E"%G"E"^2G7G%FGEerqFG"G5"W 5"W 5"W5"WM"G" " " " Z"H[b"G[s"D"H"HHX" +H0H :HOGTH*.)") ^H'XIP{tZ y@ D H6P*` *h)p*x 5Z chH\pidpW7IW9 8W:WW; 5W<'x inoW=\W?ƃ W@@WB.ZH/rcuWCy`WDփp]I7J* X)JXWXv[JYoKYpO) uidYq @ gidYr 6@ Ys @Yt 6@Yu @Yv 6@Yw @ Yx 6@$Yy W(Yz0Y{8Y|@Y}HY~PYXY}L`Y}LhY}LpY}LxY cY'YqY<Y,..JK\keyZ}LZ8Z.8Z* semZZ(Z4PZ cXY`Z *h uidZ @p gidZ 6@tZxZ|Z~Z Z*ƆZ9K L L L L L;X[^LP[_8[` [a[b [c[e.Z [h%8[k<@[nX[q`[sd[t%h[wp[xWt[zx[W[W[W[[4[6[ I it[ [& [b> [h [  [I [>tty[͊ [׊ [ ? [\ [ \ [\ [\ [\ [\ [B@ [* [* [* ['* [*  [*( ["*0 [,*8 [*@ [*H ["*P [,*X [*` [*h [=p [ [܊ [` [ [ W [ [ [ [ [N' [C5 [Z0LG [P[5[8[.Z[P QP P P\P\^\^P@]\Q](] (] \ ] (]*],]-]0P aQX^cQ^dO)^e ^g ^k 5^mt^nU(^o0^q[8kQ Qp< Q Q _BR___ R GR aR* aR kR uR*R*> R R8R* R RG0] U]]]] ],].]t0]z@](4H]PP]cX]` ] ]* ]C5 ] W>bdi]  ]( ]Yh ]p ]> ] >ev]H ]W ]W ]W ]` ]W ]5 ]M ]ۣ ] ][ ]:\>cdi]W ]>bb]a ]  ]\ ]   ]((Rh`yU`z a`|W`}|b.a`a(`70`*X`#b`U U U U U U/ !%',/5359<ADHLQUY1VaWacacaa 8Wa!a" $a$WHa'Wa(F keya) a*Wa+c a,c(a-c0a. W8 exta/W@ VW a3 a8 X tpa9 Xa: ca;Da<D8W 53 btYbDb bWb 1 b\b\ inob)\ devb* (b+ , uidb, @0 gidb- 6@4b. 8b/^@b0^Pb1^`b2^pb3\b4\b5Db6Db7\b8\b9Db:Db;DY* c !Y(cYcWc ccYc  cYYZZWcYc#.Zc$5c% c' Z6d6d6deyZe 8ffg g"ZgZg5gZgZZgWgcc(h0:[h1O)h7O) osqh94h;/ h<6h6h6h6h6hi+[i,/ i- j [[[[[ j[jO)jj[Xkq5\kr[ks7 wqkv:\H cpukwP 5\xl\ll\l\( lenlO)Hl\Pl p?\\**\*\*;@m]m]m]m 4m5@@m D\Hm!*m"*m#m$7 m%[ym&y  m'#^0 m(*8>cpum*@>sspm+j^HO)]*`m6#^m75m8\m:\(m;*Hm<#^Pm=Xm>\]mej^mfW sdamg_mh mi_(^GxmD_mE#^mF_mH mIC5(mJ5HmKC5PmL*pmM*xmN*mO*mP*mQ*mR*mS*mTmU*mVC5mWJ mY  m\* m]* m^[ m_j^p#^_*\o^no_on-on-o"(`o#3o$ o% o'L`o( o) o+p`o, o- o!`o&_o*(`o.L` o`_ opso`p` ``o2 ao4*o6Wo7W !W`@2a!W`H[a`pa`q2a`r`sa a)`a```*z`a4`y`*C`a a{a@`|b`[a`*`*`* ` (`,`|b0/rcu`y8`bHa``b` id`bb8*`b`b b(p#cp/ pPpp q cq\q& q)Z ldtq*c8q.*@q9C5Hq:chq;dpq= xqC"|qD~ cr drcr* altr*r*r* r*(r0r8r@rHrPrXr`rhrprxrr r!cd qF#c) \e ^ c `W X8e1lru Y d d e iZe j * k*)( Ree hXI8e s* )( ue z* pp {e |* }* ~O) e) e *) f f csfsr refsƐ8sJHshsWls*p opss xscsfC( Qf Ze e e eH y f W M  gval * f? M?g N c PW: J\g[lru K g: Wg X c Y g?@ Gg I*?g UXI V * \g( [ 0 \ 4 ^*8I@ F h g3 jv?( mwh n* o* q  r  s  t  vW I@ lh h3 zv?0 }h ~* *  c  c  c   c(? )i * * I@ |Li h h3 v' Dqi.g.wh@.)i *qi' j 1 5   XI c P{(W0W4K89@qP p  cx#֣$ % 'ۣ.ii 5jctx 6j j =j >^Z @H?( Xk YZ( \\k b* h* t6 w  }$? k * *I k \k3 y: k ~i qi|  k=rb 5 *j ktbltc Yth Ytjrtktq tsT(tt0tu8tw@t{THt~TPtXt0`tIhtgptxkljk 9m \cid   g@@ Sm  M m  * R}@@ eq.9m@ Z@ *P *X *` *h *ppgd  y'x )  5  ?eq E* LW S  Z/  ]O) _ a5 pZ r  * * * *  *  *( *0 *8 r?@ 5D *H *P '*X 3*` *h(brk *p !*x * * %* 0* jq zq@ q d *h 5p qx % q j &q * *      b O) [ q * * O) Smm*zq*3bq* q qX q q*q8*  Wqpt/cr$t7cr(pmdt9 '0pudt; (8)@tEqHtFqPptetL ~'XptltP%V`tT dh,W r @NNNNN6u66u96u<6uG8sass*s1s1s*s* s*(s0 asFks@6@vsvcvswswcw swB0twD0twE5twFttwGtwHtwIcssxotx qx!Wx"W :tot yt~ty,ty- 5y/ yy0ct)wAtswK w:tw@s twN,uwO*wP wQ (w+zuw, w-w.w/ tt 0puqjr s t cu v"$I(zu,uz"vz#0vz&0vz'0vz' 5vv0v){^v{5{ C{xvH{ :v{v.^v)|3v|4D len|4D|2v v|6\|1vv|8v|iw|j|kw.Z~|rIw|s7|tvH|uy|R"x|TW|U?|Vv|W'x|Xv |YP{0|[U{8|_""|`|`h|a*p|bcx4|dxvv|m7|n/d_u|vwIwIw%x{P{| }~ @ 6@W !f (XI0 c8*@H L P *X *` *hDpDtDxD|5  aDZ**7p"" @0@H P T X \Sf`zh&hHp8SH P(X`h cp,xe{*'@|||#|#|F|n| |(| 0| 8| @| ـH|fP|X|`e{|%@ *  V(!ۥ0!8@"H*P*X*`'xhZp c&#&$5:u  z j  7W Û(&` cD**!D"/ 0 1 4 6W<C5 BF@D""|HFւPIO)XL`O dR:\hSpZqxabLrcucyd[fC5k0&n5@@oHq5Xr`'|!W|#'xW<<A"xv(i<WFivK<s'x'x'xP{"ـ'x" }E }F'x}G}H}I_//4ހ9~a mnt~ /~ 'x9 ak'x'x "#y nid&-*4*7RR‚SUXYZ Wc 8 dJ(/rcueyHgcXj` idmpptqFxr'xu*ււۂ‚O)0384678  xa9t  m " $5@@- lru/80O) mW2 nrW3 nsW44փ*8* val\ !W + + j 6*  Z Z1Zl/rcuZmyZn8Zo )ZvZx"Zy iZu3 1xZ*(Zr{Zt*ZZZF {{Y ZZcZ cʅ* Zօۅ}L}LZ8Zʅ keyZ}LZCZYZHZ5Z{Z *Z *)(ZƆZ*Z*ZZZ " (ZZ3 {? ZZZ v: Z%Z % / 8b*0O)87@ uid @PO)X `$; hYY 8Y gidY 6@8*CY'YhrcuYy>;@@Dg0Dh/ cpuDiWDjWDkW $DlW$DmW$DnW$DoW$DpWDrWDsDtDuWD{ I D|!7(D} I0D~!784D?@@1FI5O+7@P*<`*?8[ɉ[ [! ["*[#\[#\ [$*([$*0['[(\[)\[0&[1 [2 [3 [CA[D[Li[M%[NiA8[Q[R [SA[TJnɉ*IȊ* Ȋ Ҋ8*  %0_.Z4y ` /rss e08.Z@ X ֋ fn 1 arg cx* b֋   D^S5^T^U0C^WV^X7H^Yy8^I q^JP ioc^KQ.5 ^\W0%]P] c]]]]* ]W(]W,]80]W4]t8]ƐH] X] X] X] X]aX]5`]d] Uh]Yp]x(dev](]0] 4]k8]u@]C5H(id] h]*p]x]Y]7][] ]]] T8]!]"]#C5]&0](54])8]*[H]-(fq]2%]3]5C5]6C5]7C5]= ]>50]@4(td]D/8&]Fy@]K.ZP]PC5h]R#]S]U'x]V'x]W'x][C5]] V Z { val d val  <Ɛin*v_8_Z`O)aZbZ$c $d /rcuey reff0 y v * %d,WT0ב** n! . 10  4 4r5W6r7*  ’ @ { 6@ P]W ’  ^^(^8 jHbГ()7*+ ,0-C5@. 5`/ d0h1p2 x3*4Ɣ  < val  %!W6k BE1uidF @1gidG 6@H <DƔwJHHI k k k k k  k( k0 *8 *@H̕* W(W, k0 k8c@ ! ̕@89:;<=Ė >Ė(?Ė0@8Ė]ݖݖɖXDEĖFG HĖIĖ JĖ(K0N җ8O@Q HSP]]͗͗P{kP{<ח P{͗xYZ[\\\]\^\ _\(`\0aP8cP@dHeLf\Pg\Xh\`iPhjp8WWWW WWWino  a( a0ÙWÙә* RWWW WWWWX77 Z(}08}@H7PR7W#UUә<xx_ݖxR8  W Z 0 )H(ops!9 P{)*I9*I*:wn}s ncxuȝ " ; U (0 Ҟ8 @ H P .XQ`eh p x q ͝jLi"XI;XI'KKP @jXIWZZjXIWWcUҞXIUמy .uuQXI3eVjXIٟٟjޟ Ujuuȝ:@^WIf3y:! P{:ߠR " W ߠ %@Za[n\]^ͬ` b(d10eJ8fm@hHjJPkXm`ohp5pr Sxsuvy{}%Mfa k u   (j 75pidI[4uid @@ $ q *WW WW : C5 \I )֣3*y+41,-y8*Pc%0E  EO_V*֥    #( 0 38@LH`PLX``hp 3x  # < < 3[֥     ! +0=;)z* U+ U, U-P. /*(0 09 4:XI8< @=5D> cH? cP@KXAC5`BCYE FC5HxIK c4Q ?   K*K*$ʧϧF\W' pos  WMj4pj"usRjFusuuW ]](]] jq!j!&%N&0' q ljW*Sj'qP{jjکjjߩj *Hj****%VuRjusWRjusRWzjZŪʪ jԪj x/ buf/"/ / / /  / (/ 0/C58 op/X/`/h/cpjjWjjW((W- P(W7'xnP{'xWUF'xP{s_P{ͬP{'x"Ҭ_P{'x1'xP{'xJP{'x6m_P{'xFO_P{'xr_P{'x_P{'xP{'xW_'x0_0DW!X S'x":vP{v\\{ XP{P{'xjW_P{jƮ_'x%_'xC_'xCH *f'xCR mt Z *P{k,WүP{үP{P{#P{3(L8`Qy'xy~ e.'"'x" FP{]<ۂ(PPU A _d'xVFcn *@@TAFBCYD& E( sdF0G^Z8IWJWKWLWMWc\bio֛^z } 4 48 c@HP\X` hpr  t x * 3 . D_г_    \ܳг  *5 rev* ϴ  F/rb5 ns0W8< >@ id\` chݶp/rcuyxϴ ѵ ops! h ʷ"$ %  & /(( R02 89@: RH= kP@XA `ѵ  ض1dirh ض knj cC5 C5@`h "x    @  A %lʷcϷcusccus/cR"4qk!W'p!Wʸ0'&() ps* 0+N,X - 1(ʸFc+DDI 5FS**F* *m*nG*o&QX*0B*1]*2 *3 c*4ɺ *5 (*7 #0*9 8*; #@*= KH*?nPL[BVyYy]`YVYVyFXIĺjYL"κ#jYV"KjYV(njYV'P** * ߻sYy"߻YyF`& 5 X0tu vw!x*ɼyݼ z (+YX*ļ&TݼļμļzssG }O~O_ >bufo  "_*"o*?Kd*ν ɽļɽFļӽļ(F((EFF modG  opsH!kI .JK  -"(L1argM c1strN 1arrOfVWWX" \a max^W_W num`e opsa!kbca0(4)O5* ƿ* W .' K*7`-^. mod/ @0YH mp1cP2)JX ^856]7 9 ;  <3(= C0"h F F3 $C 8,W>r'8EmodF Gp'PpqcrcstW=mtnwr = =W""\ BG?-5Oq*( { Wj^W   9U8( 9U16)59U32*AU64+YG] ]048<m@H}Llptx|m*}*** ** d !)*+,-./q566789:;<BCDEFGHICRSTUVW^e]kl m dn(o-6p.q1r,t3u*x!HDevIJKLMZO.PQR'hijk lm*n;' *]-33*'u * :*     *    L_9`a9bc9d9,e9<I*h'. .*V]q^_`a b cdefi'  ~@ABCD EFG4'LMLUNNOP*Q'V_WXY Z[\*]'bcLUNdef*gl]lm"3n"3o"_3p"*q'pv1wxyz {|}~ 89:<TUVX*w   >'   *'`11 A wA*OR**_'(  !"$% &!'"(8**%'@_`abcd9 e0f8g<**j"uvwxy<M9M]*'x"""""" "]"L"P"Q"R"S"T"X"`"h"p"r"t*j* L CDBMN MOPQ R 4MhSGEip      $ & ( *,02LUN4<=CDB4@=SGL-`*@$56789:;<= > ? 4@ABCD iG *K*/(a***** 0/rcu1y2^Z38* HIJK LM*Nq a %@pHFPXbus]`h cp cxC5^ (msi(8@\H\PX `hx x (idD5 9!!# $%'#)4 + ` , a - b . c / d 9 e < f @Q endF** Q(Q0&Q8:q; <V  !"# $(%0&8'@(H)P*X+`,h-p.x/012345},U(,WlXHxy 5zW|W}C5~0@ %8q5  5 !5 "5 #5 $5 %5 &5 '5 (5 )D5 J @  @  A  B  C  D  E6P\[.Z   W                           W(\\\\#  8((qosB0+,F id-./5 0(1702*X3 I`4 Ih5 Ip6 Ix7 I8*9*:*;*<* dev=> ?  X83( =ops}   WMNFOFP!Q!R! T(U:0V8W @X HY P[X\`^Sh_paxcd pmfXh`aF busb]d eFg h$jE(k0m8n @oHp PqSXr`s!ht!p pmvXxw py55!Sq?`2 3F5!6!8:9 ) ; >(< 0>8@(@ARHC lP pmEXXb"$5$99 .R5Cl5zssW0XYFZ![:\ ^ pm`X(q!W-ȭ@ V!@@  id֋  clsJ "5$zss WW*,W4,W^8  0!fs" ,W1,WB:,WO^cd&e2f4:g lidh G  \ ecma   @/s0x ops1" dev456(7 8 } ^!W!WsEsN0sT @sZTsew@q5qTqEwf**Yfs)ss|s]*8*ss]* 0?(t0$vmat1't2 yt3 *t4*t5* :t>Nt? t@ Y'Nr'*^'w'***qqWqq***''*cF0'!I'pR5pRg'*`Nq'*l!W get[ put k   ( 08@$H$P8XQ`jhpQx8[QRW idSWTsPfLgxhWi~-x[xLkx`p5FFWcFF$x8)xQx=xjFVFFWWocxWx a * WW  mWW' sgl()W*W xMxN UxPWxRW xTW ^  ]CF]D ]I ]N ]S Fe]Ax]B]C%%P ` \  W W   :tR\n\o0\pW\u#\w \x `\z \{ \~W8\5<\P@\[P\:\p\7x:t8* cyc !ccH 5 Zc (.Z0 ! @jFk lenl wpmnxoxpxqxrFs tV(xV*xf*@!*4&*@@+/ H 48W=WBWG mapLTef@@]a.Z@m sbqwW | $ ws( 0W4 8 <!]m]t]u]v]w]x]y]z ]} W]/] w]]] ] ](]0] 8]@]6H] P] KX]s`] h]p] x]] $/ 9 C! R \H]]] @]WD]&Hf]  W]] W]h]i]j]k*]l*]nW]oW]pW ]qW$]rW(]sW,]tW0]uW4]vW8]wW<]xW@]yWD]zWH]{WL]|WP]}WT]~WX]W\]W`]Wd]Wh]Wl]Wp]Wt]Wx]W|]W]W]W]]]]W]W]W]W]]&+DDWcP]]] U@] UHI8* ,0 : B 0JDO Y T n(X0]8b@g HnPr X{ ` / h p C x S  h  ;fa qgPhi k l] tagn o$qW(tW,u U0 biow^8x^@HzX\`\h\pxz|~i ref *. elv%\I c f p zWWWPrqsm m  5    *#opsmapW8 W< W@ WD WH LWPWT cX`hC5pj^4]S]a]a,W]w^W| U UzW*W UWz 6z"Kz*;s UUWcP" U$x U(S  Uzz z!W= I ]a} !WZz{|a741CH5:t icqU c%*I seqWI=%@6 .:@L[@N3)SX[*a cePfqg%m csyWp 5(Y0 X`hWpWt x77'x'xN ,W&:g@@7p95AF*eWW u*!rq"a#}  ++( DP5YPIna^asa a cW W #aWW/ #aW C P4 S #H h aX a !W&  a /rcuby lencd;(gh8iPlm o0p Pr Ts 5Xt`upvrwtxvy*xz*}* idWW lun\W WcKKC5=FF revF B B B B B  B( B0 B8 @ r H WP W  W  W  W  W  W  W  W  W  W  W  W  W  W ppr W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W W\ ` d T8h T8p x [W    &  &   [ c  cWWC5~ % q(%88&') +50,%V8.C5@0`1p2%3)J5.Z6#B7"L9^Z:J<4> @WBWDWGH*QWRWS\\WeghijklWmWnWoWp*q*z W{ W | W  W  W  W  W  W  W  W  W  W  W  W:\:\WW* *(01(irqW48& @& 0c (0&q8 %HOPQR=devS (T^ZUW(idVW  XW  YW! \W" ^W# `W$d (e ,kW0lW4o K8p<q c@rqHG  ,WB a W!D;(JKLM[/rcuOypQSZ*\]_`abdeg sdbjkm Wp Wu Wv Ww= } ~* W =  *i0j!W$Gh*3WW 6a Kc dF m_(t}0}86@6H P X ` h p x        " 9* 4 R; fE N WXag qyF "W$W(W,*0*8@D  W@  WA  WC  WD  WE  WF  WG WL!P!X\`181K8";F_8P}Wcd18* 89%R8W>faWzU.'k88"118,WB G!WL !WZ!WD      45Q678\9 ;X ? BD E F G  H$ I( LD, MD0 ND4 OD8 R@ U cP;0` /deva bD c>qdP  eD(s  *(,Q!--.. //0 1  Kf!*Kv!* v!6hL! busMT#NO^#P Q(% T#T#(6,8@-Ppops- c{! #Ldev LL W W ! Y#  W " "(5#6C5len7W cap8 $:##6, #%` J6,KbusLT#MT#O c P{!(Q;,0SW8T<U>V@WBXWDY HZ I\"J]E,P`O,Xa6,`cDhd le mf n g xh ppini qj"rk`xmD-n\tvc#y  zW( |W- }W. ~W/ W0 W1 W2 W3 W4 W5 W6 W7 W8 W9 W: W; W<WW"N- W W Wo#=dev (irqWS-@ WB W B W B W B W B W B WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB W B W!B W"B W#B W$B W%B W&B W'B W(B W)B W*B W+B W,B W-B W.B W/B{#F H 5Lc-Ps-s- W@M" W`M WaM  c / (vpd# " WPO  - S# "   " D W`P "  " - t "0  2 (rom8  @ FH  *P #X #! @, J,RD-F~/ / y/ /  /( y/0 /8 /@ /H#/P!X!`h.T, I-c-*Ds-*L-* - -(- .! .">.#f.$. -Q.*.T#. .T#.c>.T#W%.f.T#W<2C..T#WDk.;.<5=H W8_ ? @D A('5`q6rst\u" vD$idw(x,y"0z 2{ 3| 4}D8~"<\@ HQRI(P X Y"Z^Z\5X97C5J c@ cH "P "R"I7*t7ch 8  DD0phy P X"Z"\ ^ _5`x)8*+, -\ ."(/\00"81\@2 H3 I45Pphy58X6`7 pt7S9TcUm^=9_c` mch9dh9e 9@p9q"r1s t u8v(w "8:" :iocI D I  8D<S0@ h i jp%2I348id5 67 8'N@90X:6,;%7N<=>? @A Df!E:\F[I:\8J 5@KHLANXM `PdQ hR"jS lT mVC5pWC5X 5Y [ \ ] ^ _ ` a b"d e"f(g"hFNiDj NkDl mDnDop qr"s t uDvDwD x$y%zPN(} 0~ 1 2 3 4 5 6 7 8 9 :6@666H666PII"JXJ"""JXJzJUND cUN  """"  "rK$rK`eNI#1#2\&1&R('&qI7I7I78 5 55 5   "    c  c "(  c0 "8 ":  c@  mH  cP "X "Z "\ "^ (`  mh Dp jNx  5  .Z oN yN D ~N  yN   " " " D " " " (  m " N  "(  (0   m8  "@  NH  P (`  mh yNp "x (  m D D yN "  N  m  yN !D $" %N &  '  (  )yN *yN +N , m -  . 0  1  2  4FN 6 70 8@ 9P : ` ;C5h >N ?N @ N A BN CN DN ED FD GM H  I  J  K  L  M  N 5 O  P  QK RK( S 00 T 04 UW1 V1 W X cY"Z [ \'x]'x^J_J`JaJb$Kd e:I  I:IIIcDmIJ"JI1"6/J4JXJIcmmeJjJzJIcJJJI"JmmJJJI""JJKI"KKD$K1K6K JKI1ZrK D<3M""   "" D     ""DJK" """$"&"( "* ", ". "0  2 3"4"6"8 :M    "MImRMS"T"UDVMD N*vNN'NIK7N* \ +T >\ + U >\ U- C\- c` ` ")`"`")`n7`  "H`"U`aNUsT +V >\ +GV >\ +wV >\ +V >\ +V >\ +W >\ +7W >\ +gW >\ +W >\ PaW"a"aAaPda/X"ua"aAaPa X"b"bJb Ab`+b";bPa QY"b"bJb Ab`+b";b#H\iYUv#OYUvQ~#OYUvT~Q}R@H$Ys#rOYUvT~Q~R@H$# ]YUv#P#ZU Tv bHb#PUZU Tv #PzZU Tv #PZU Tv #PZU Tv X8#OZU}#P[U Tv #O[U}#PC[U Tv #Ph[U Tv#P[U Tv #O[U}#P[U Tv #P[U Tv #P\U Tv aOU}R9\*!)\ .4V  ]TiocV1IXY~-Z"-[ -\"#)P\U|T}QvR0bHb6^Tioc61I89~-:"5-;"-<"-=*+]KG*KG*aG]"(aP` K@^`"`a6aU}Tv#NaX^U}#VOv^U|Ts#)P^U|TQ~R0XsbHbDW^Bcmd71Dc^Bcmd51oG0_BvalG+\BpG6c+_KI0_UI xIe_oBx_BvalB+DBpB6c+g_KDx_UD xDMg_D8\_Bp82+_K: __U: x: e_D3D`Bp32+_K5 `_U5 x5 M_E %c7`0 ;0 GyE|.cr`0|D0|PyVQWE%W`0<0VjEz0`0zCy0zX*a0@%V0T*VQ*Q*ED(U6a0DC%V+NaU*^ *daUE#a030CQ E #a0 30 CQ  D3!aW3<D*+bW3VWG*Vval*D&*HbWB*Lf/**F*R/K/Wg q/ / / / hint W ,/ */1s8e1u8x1s161u16"1s3231u321s641u64XW  / *  1W 2W H I X ] ^ _ `K// $ & ( <W  D e     #/ % & 4 = B ^* h3 m" nD } P  \  \  \  W  W  \ m   P ;;;@;KU*~~ U~ij *W3>kH  F   "   (  0 8 @  H  H  H H  H  H  H  H!@   >   P h  F F | B  G W 5$kp L  W( W, B0  G8 @ A B WD  QH PCmem V@  *  W  g l  v   "( c0 W8 c@ WH WL P WX ` Wh p W x W W    W  W W H c W !H "W % & 9W : ? A D  F  P  QW( T 0l %      % 0  " " P +val     d 0 ,P %        *    p     d   MM  d      W*, fmtFFFWFF$ e" f*gW ha uW v3w3 keyx" \ U V  j keykf n keyof m6 7 8 8` FFFFWW4W key9 (W= 8U V modW XFY Z ([ ,\` 0Fu>v>wCxWyW  *WKb* /1W set3 get57 q%bG a    x( x0)8!B@" [H# yP$ yX%`&h'p(x)*+-,U-Z.-/ 0 1 B23 5 9 A; n>?@ !3 key"3?A*BC =>cx"* !d% + -/  y b d *(,--.. //01  M id cls  @RK*K*K*@Dy endyF** D(D0&D8!-@ #v5WW c [:( W,!W0( 4)6%8*WH+*P,#X5 `6 d8 h: l; p< t=Wx;se?E@$rt@FCdlAGBGFJ"I7J*KWOJXJ]J"`"C@dhWkW l*m n$J o)J(p#0q cXs`ubx dyIhzp{3J*      I BU7("7P$mm-h-p(Kx    *W  W,  W,  W,  W-  W-  W-  W-  W-  W-  W-  W-  W-  W -  W -  W -  W - "W -*'$pid  *# ##(0@KPKX "K%-(-+ c- \. \3 \4B6{B: (=*0>*8A \@D \HG*PH*XK2@`"Nw@T^MW^MZ^M^MNk 4mWNp7 q:7(t*8u*@$fsxaNH{kNP~uNXN`Rh dRp :x : :V>* W~nR AW9> \  \ D#   I 7( #8 xR@  cH RP ,SX 6S` Sh Sp *x S ? W  \  \  \ 4: A  S   D  D "S )T    T0  58  WX !T\ 6T` 5h  @T       !W "W # $* & \ ' \ ( \ ")U 3JT CH D* LOT N* R_T SD( TD, Y*0 ] 8 ^ < _ @ ` D "aUH dl?X giT i7? lsT w x z* } ~xT  \ \  H  *WTTVQW W(W,I0CrcuU0[:@ D#Hw9P[Wx[: c "eW oWyWc  \    >"U !"$$"$".U<W"F,@@I #*?0# D## 0# g# "P#( # #*#*  ;s## ?#s##*  XW $     0!c$!dF!e}!g}!i }!l} {($"8$"9%"<%"=%$#<6%#=W#> #:q%#;$% src#A" dst#A "v%%c$$$W%%(%#&%#& val% D%!D %"D%#\%$#& D%*J&%+&r&%,#&&r&&& J&'&'\' 3w&%'&%(%)%(&%.\ %1&'%2Z'%3%4 %5*%6*($Z' fd(%(&('&'(%'%%%%/&%7&8%'%* fn% '_''''')')\ end)\*;1(,cs*=\,sl*?\,wfe*A\*E(,ss*G\,sti*I\*K\,nmi*M\*P\ *S\0*V\8,lm*X\9*]\:*d\<*(+cs*"+csx*\*'*#)+ss*"+ssx*\*1(*g)* r15*m* r14*n* r13*o* r12*p* bp*q* bx*r*( r11*u*0 r10*v*8 r9*w*@ r8*x*H ax*y*P cx*z*X dx*{*` si*|*h di*}*p**x ip**(** sp**(+B*+C"+D"+E" +E"(,s+E",,dpl+E"-,p+E'"/+F"0,avl+F"4,l+F"5,d+F"6,g+F%"7+F+"8 ,* ,* ,* ,* ,*, 4+ pte,* ,"+, W+ pmd,* ,"@+-%+-%%+-%/c+D-' +pgd-'+-'"+D-p +pud-p*-p"+-++@.H.,.I*(gCg0. 4.*8/;,/</=/? W /@ W$/A W(/B W+!@@0-0B5sp0*es0 ds0"0$0&0*(0*00R580*X0*`cr20*h0*p0*x0q50* 0W0D0*0*0 4;fpu0 :4@-!@@..(m@./r@+4+W+.'."/(k.-. +l .(.,.al0 .9l8.X.klh.%dmp.*x.k. c.im.#.@T.nm. k+ 1 T/1 1 T/#)2 2 p3/ cwd3D swd3D twd3D fip3D fcs3D foo3D fos3D3/3DlD0*%3**0 rip3+\ rdp3,\%3.h0 fip3/D fcs30D foo31D fos32D 3)|00*003@03A03B0D0* 43$@1 cwd3%" swd3&" twd3'" fop3("h035D36D39@1 3<P1 3>0H|0DP1*D`1*?3Q=2 cwd3RD swd3SD twd3TD fip3UD fcs3VD foo3WD fos3XD3Z/3[ l3\ m3] n3^ o rm3_ p3` q3a=2x3bD,/ R2*\b2*@3:23; \3< \3= 2\2*!@@3O2 3P03Qb23R2@ 22*n@3^K33_s/03`03a`103b2@3cK3 \3Y*!@@3f43hW3kW3n\3q\xfd3t\ 3wW 3zW 3W 3W 32@@3:43 \3W3W ofpu@343W3*343434 340 3\3@@\34 44 \4\K4*K4*? 5=55 x5! x5" x5#x4)*R5*b5b5*g5 l56>56?*6@*6AD cpu6CD7 57  8)68*#8+  osq8-5 8/)9)9)9 :6:W:W:F:F:F;6;\;\(;6*ct;<6;&6 6W<7 =07= 57 07> U7>(? 7? ? ?@7@*@7@77@ 7@ 7@8@7@7 A28-A 7A %A M8A7WB j8@B'8-B(8B) % B*8(B+r90B, 8B- 9B. :B/ ;M888j88@@C/r9C0C1WC2  seqC3iAC48C528 C60C7 %88(D9D D*D 9DD 99w99E:EE E: :F $:F$:*4:* F8 :G[:G  G@:H+:H,H-xI:I:IW`I*h maxI*p*:* J : sigJ$: J: KR KS;; KU KV9;!;NLd;L L c L >;L';L(L)L-;L. L/L0 d;L1L5<L6L7L8 d; L<N<L=L>L?L@LALS<LT RLUcLVc LY<LZ RL[ L^<L_*L` La LJ=LLLQ LWN<L\<Lb< LE7=LFc<Lg[=Lh _fdLiLm=LncLoLpW N L%=L*p;L2;+_rtL9;LB<Ld=Lj7=Lq[=%0M ,>M M M M =0M @>= M,> L>M ~>M!M" : M%>M';M(*M.-;M0 : M3> saM4~> N ?N "N * lenN *N (O7?O s#P$l?P%+P'P( 0PD?PM#?PP(PW)8Q  @Q\Q\Q\Q\Q\ Q#\(Q,\0R)2@R*\R+28PR8g@R9g@R:WHR;WL @w@*8RD@-REURF5RGW0 S>ASKSZSpSSS endSAK'A2*T!BAT" W T&'ATDiATDBA TDNATEATEBA TEuATT ATYATZ D# T[AU A valU U AU B valU  U ASKBU \V \W &W[{B0hBiBAjkKBcpulWm\n\ o\( 3C*^C* D'@@C \ \ \ D D* *(*0W8!@E \ \ \ \ \  \( \0 \8 P@ \H \P PX P` \h \p \x  \  \  \  \ \ \ \ \ \ \ \ \ \!@F3C  7! \(" \0# \8%@&P'Q(R)S, \X- \`. \h/ \p0 Px1 \3 \6 7F9F;F=*;avgG^C@E F0KfGLM*N*OW P$Q&SfG(F]xG}GGGG'`H a7h \i \ j \(k \0l \8s P@t \HuWP W W W W W W W W j8X j8rqIkGHG^II#IGZrqIjI.W .W .W.WDI    OIPbjIPsDIIIM IJ  JI$J*## .J'(K8sY U@ D H7P*` *h)`p*x RD#Y c8JQpidpV7KV9 [:V:WV; D#V< inoV=\V?` V@@VBJYH*rcuVCU`VDpp-KK* WKWWWfZKXoYMXp# uidXq A gidXr B Xs AXt BXu AXv BXw A Xx B$Xy W(Xz0X{8X|@X}HX~PXXXMN`XMNhXMNpXMNxX cX¥XrXQ>Xǥ(KYMQkeyYMNY[:YC(ӣYŤ semYY(YϤPY cX`Y Zh uidY Ap gidY BtYOxY|Y~Y Y*aYԤcM RN \N fN pN zN4XZ^RZ_[:Z` ZaZb ZcZeJY Zh#8ZkV>@ZnXZq`ZsdZt#hZwpZxWtZzxZWZWZWZZ-Zj8Z % itZ$ Z Z2@ Z4h Z  ZK Z6ttyZI ZS Z A Z\ Z \ Z\ Z\ Z\ Z\ ZB Z* Z* Z* Z'* Z*  Z*( Z"*0 Z,*8 Z*@ Z*H Z"*P Z,*X Z*` Z*h Z?p Z ZX Zܥ Zm Z W Zw Z Z Z Z- Z5 ZY0N? ZdRZD#Z[:ZJYZ̥ !R iR sR[R[[}R@\,S\0\ 0\ \ \ (\*\,\-\0R 1SX]cS]d#]e ]g ]k D#]ms]n(]o0]q2\8;S S@> S S ^T^U^=^IS T 1T* 1T ;T ET*_T*@ dT nT:T* T T?0\V\\\\ \,\.\s0\@\(<H\P\cX\` \ \* \5 \ W6bdi\  \|( \|h \p \F \ 6ev\P \W \W \W \H \W \D# \U \% \ \2\ \\6cdi\_ \6bb\i \  \\ \  \((Th_yQW_z|a_|W_}b(Wb_b(_w90_*X_#b`V VW `W jW tW ~W````!`%`'`,`/D#`3`5`9`<`A`D`H`L`Q`U`YXa b !X(bXbWb cbXb  bXXYYWcXb#JYb$D#b% b' "YcqYc [:[d d"qYdYdD#duYdYYdWdcc(e0%Ze1#e7# osqe95e; e<)e)e)e)e)ef+Zf, f- gg Zg ZghZhchchh -[h!h" h$WHh'[h(F keyh) h*[h+c h,c(h-c0h. [8 exth/[@ZZ h3 h8\ tph9\h: ch;Dh<D-[ '3 i \"\-\-\2\ ig\i#ii\Xjq\jr2\jsw9 wqjv\H cpujwP \~xk]k~k]k#]( lenk#Hk3]Pk p\#]**3]*C]*4@l^l^l^l -lD#@@l \Hl!*l"*l#l$w9 l%2\pl&U  l'^0 l(*86cpul*@6sspl+^H#-^*`l6^l7D#l8#]l:#](l;*Hl<^Pl=Xl>\-^le^lfW sdalg1`lh li6`^?xlD!`lE^lF!`lH lI5(lJD#HlK5PlL*plM*xlN*lO*lP*lQ*lR*lS*lTlU*lV5lWK lY  l\* l]* l^g\ l_^p^1`*C]^mnj`nB2nB2n"`n#3n$ n% n'`n( n) n+`n, n- n!an&j`n*`n.` n8aH` opsnBa` 8a=an2|an4*n6Wn7W W_@aW_Ha_pb_qa_r_sb b%_1b_Ga_*q_Wb-_U_*<_kb br1b@_b_a_*_*_* _ (_,_b0*rcu_U8_ cHkba_ c_ id_b/c2*_Jc_Oc Jc(oco oPoo p /dp\p& p)Y ldtp*4d8p.*@p95Hp:chp;Cepp= xpC"|pD~ /dq >eqcq* altq*q*q* q*(q0q8q@qHqPqXq`qhqpqxqq q!9d>e pFc%.\xe.^ c.`W.Xe+lru.YTe.d.e.ie.j *.k*%(.Rexe.h(Ke.s* %(.uGf.z* pp.{Lf.|*.}*.~# Gf%.hf.*%.f.g. crgrts refr8rKHrhrWlr*p opsr xrcrf<(.QCgeeQfhf@.U.eg.W. D. ~gval.*.eg8.Mg.N c.PW3.JgPlru.Kg3.Wg.X c.Y~g8@.G_h.I*g.U(K.V * g(.[ 0.\ 4.^*8A@.F}hg0.j+8(.mh.n*.o*.q .r .s .t .vW A@.li}h0.z+80.}gi.~*.*. c. c. c . c(8 .i.*.*.A@.|iigi0.+'.Di(_h(h@(i.*i' k { D# a  ռ(K c 8(W0W4^M8!@P p  cx# $ R% R'%(ii.5(kctx.6-k (k.=]k.>VY.@A(.Xzk.YY(.\k.b*.h*.t6.w .}$8.k.*.*A.lk0.U3.9l.i.is .al;rb.7.*]k flsb_msc sh sjsksq ss(st0su%8sw9@s{Hs~PsaXsu`shspsxpl_m2kzk.m.\cid.. \@@. m. D .m..*. Tt@@.q(m@.Y@.*P.*X.*`.*h.*ppgd.  .x.) .5 .?q.E*.LW.S .Z .]#._.aD#.pY.r..*.*.*.*..* .*(.*0.*8.BA@.D#D.*H.*P.'*X.3*`.*h$brk.*p.!*x.*.*.%*.0*.q.q@.r.He.*h.D#p. rx.#.r.k.& r.*.*.. . ./c.#.2\.*r.*.*.#. msm*q*3Tcq* q r r r %r*>r2*. WPrps/ris7r(pmds9 .0puds; "/8n@sE+HsF+PptesL .XptlsPW`sT +h&W.@s @EEEEE)t6)t9)t<)tG8rsr*r1r1r*r* r*(r0 s>su,*tu- D#u/ Uu0cs0v3}tv40v6v7v8  xav9s  wtw*w7wt revw* twtwuwuw w wuwF*rbw7 nsw0wW8w<w }>v@ idw\`w chwvp*rcuwUxt wu opswvw!vw wuhwvw}xw xw"xw$ xw% x w& x(w( y0w2 8w9@w: yHw= `yPw@yyXwA y`uv v wv+dirw}twtwu vvx5w buf5"5 5 5 5  5 (5 0558 op5VX5`5[h5cpwix knwuwkwvw cw5 w5@w`whw "xw   w  @ w  Aw %dmxxxxwixxxxxxvcxcxvxxcxvcxxxvcxyxx"xY3yxx3y8yx%`yx&'x' Yyyyxx.eyyxx~yWyy0y'zy(yy) sy* %zy+Czy,Mz y- q%(y>c z9z9z>z *z>Hzz{zDz }zWz  z\z\ inoz)\ devz* q(z+ q, uidz, A0 gidz- B4z. 8z/Z@z0ZPz1Z`z2Zpz3\z4\z5Dz6Dz7\z8\z9Dz:Dz;D!{!F! }!m{!n|!o&|X!0|!1{!2 !3 c!4} !5 }(!7 (~0!9 }8!; (~@!= P~H!?s~P{|{|||}||~}|@{@y}{AF{B{C|{D+ {E( sd{Fu0{GVY8{IW{JW{KW{LW{MW|{|}}||}}||}~}>(K}}k||"}(~k||"~P~k||-~s~k||.U~!~! ~! ~x~~|~}"~~|~}F~`{+{{ D#{|{ X~0{t{u {v{w!{x*{y {z (0|~$zy}AB? {}^{~^{n {6buf{~ { "n*"~*?KY*{Ā{݀{{؀ɀ؀F ĀK3*/(||*|*|*|*|* |0*rcu|1U|2VY|33ǁ2* |H#|I#|J|K |L|M*|N/r -!}}|}(@p}H}FP}Xbus}!`}h} cp} cx}5} }}}}$ $msi}(}38}8@}\H}\P}GX} L`}h}Vx} `}}j}}} q$id}D}D#}} }!!}# }$}%}'#}) }+ ` }, a }- b }. c }/ d }9 e }< f-4@@CgCh cpuCiWCjWCkW ClWCmWCnWCoWCpWCrWCsCtCuWC{ % C|8(C} %0C~88-C @@>%F8@*~:6~; ~<~~~  ~!~"~# ~$(~%0~&8~'@~(H~)P~*X~+`~,h~-p~.x~/~0~1~2~3~4~5B((&~Uu&W~lH~x~y D#~zW~|W~}5~~0~@ !8~Ë~6.~  .~ !.~ ".~ #.~ $.~ %.~ &.~ '.~ (.~ )~D~D# ~~K ~،@ ~ @ ~ A ~ B ~ C ~ D ~ E ~j8P~\~2\~JY~~ ~  ~W ~  ~  ~  ~  ~  ~  ~   ~   ~   ~   ~  ~W~~~~~~\~\~\~\~ ~ ($qos~0+،,F id-./D# 0(1w902*X3 %`4 %h5 %p6 %x7 %8*9*:*;*<* dev=(> ? Ë ݌(3 ~|ops~B~~ ~~ ~ ~(|(WMNFOFP!Q!R! T(U0V8W @X HY P[X\`^h_paxcd pmfhԎ(Ԏۏ`ۏaF busb!d eFg h$j(k0m8n @oHp PqXr`s!ht!p pmvxw pyَ(6`2ϐ3F5!6!89 ; (< 0>8@(@AHC 0P pmEX&"}Ԑϐ00}X}YF}Z!}[}\ $}^ pm}`(5*ґcc בBVDVE[FGH*tIcґ +!W"W ` %A˒K :@NO*P Q (+b, -./ ˒ 0p˓qkr s t cu v"$(b"#&'' %FD# <`@"v(F%34D len4D2v6\1֔8ijkJYvr1st@uUR TWUAVWX Y80[=8_" ``՝ha*pbcx-d`۔mn*d_uv11!x{8| }}~ A BW 88! ՝((K0 c8*@eH qL P ZX Z` ZhDpDtDxD|D# / =DY**"" w0@H P T X \H`ľh"8Jp8HH P(ξXؾ`h cpM*'@  .Vj ~( 0 8 @ HNPlX`M!@՝ q*  (!%0!*8/@">H*P*X*`hYp c&M#fp$Փ   k  W  ("F` cDZZ!D"/ 0 y1 4 6W<5 BF@D" HFPI#XL`O RdR\hSpZrxa/tb/tCrcucUd2\f5k0"nD#@@oHqD#Xr`W W$$) Q$WFQ֔3j$[~o8"" EFG՝HIƞ!I mnt  !ggISڝq "ٟ#U nid&-*4*7TRSȠUȠXYZ Wc [: dK(*rcueUHgcXj` idmpptqFxru͠*àٟ# vv v" v$D#@@v-0 lruv/Ҡv0# V2[ nrV3 nsV4[7p*52* val\ W š š  )9>* 9 Y YYl*rcuYmUYn[:Yo %YvYx"Yy EYu΢+xY*(YrYt*Y Y%YF [N YPYcY U*ce* YqvMNMNPYӣYe keyYMNY <YY@Y7YY ZY Z%(YaY*Y*Y Y%Y " (Y|Y΢8 YYY 3 YY*|  ʤ\ [:Tc*0#8@ uid AP#X `$# hXX [:X gidX B2*<X¥XxrcuXU٤\>ܥ*?8ZEZ Z! Z"*Z#\Z#\ Z$*(Z$*0Z'mZ(\Z)\Z0Z1 Z2 Z3 ZCZDmZLZM#ZN8ZQZR ZSZTKE4*KD* D Ng:h* h r#0ۧJY-U ` +*rss M0|8JY@ X R fn q% arg c  D]S]T]Uʡ<]W]X@]YU8]I q]J ioc]KS^( ]\W0!\\ c\\\\* \W(\W,\[:0\W4\s8\H\ X\ X\ X\ X\iX\D#`\d\Vh\|p\x$dev\((\0\ 4\s8\}@\5H$id\ h\*p\x\|\w9\2\\ \\\ $:\!\"\#5\&0\(D#4\)8\*g\H\-#$fq\2-\3\55\65\75\= \>D#0\@4$td\D78"\FU@\KJYP\P5h\R+\S\U\V\W\[5\]   Ƭ val  val Ҭ <  i9n*v8_`#abc d *rcueU reff 09 ĭ v * %&WT ʡ"** yn  d. {0  4d 45W67̮̮*֮ Ѯ ۮ  A Ƭ. B PW }  ZZ(Z8 kHМ(c)*+ ,0-5@. D#`/ d0՝h1p2 x3*4  val c oW6 BE+uidF A+gidG BH DJH      ( 0 Z8 Z@H]* W(W, 0 8c@ ]! ]@89:;<= >(?0@,8b՝'՝'XDڳEFG HI J(K0N 8O:@QSHS,P1՝߳8585!S8?xYGZ[\\\]\^\ _\(`\0aP8cP@dHeLf\Pg\Xh\`iPhjp8WWWW WWWino  =( =0 W G* WWW WWWWXEh (Ƿ08Ƿ@HPh՝gJ՝Wm՝·՝·X՝'·̷՝G8 c W Y c0 sH$ops! 8s***3w} Ѹ Ѹc¸˓ָ5Sl  Ѻ(0 8 6@ OH _P xX`h ͻp x2 B[+++0 NkNi:l(K+X(KNq ̺k(KW̺YNk(KWWNcֺ1(K16N!ONU;_NTx˓Гd(KNN}NͻNNһ(KN##k-( 1 Bk7[˓ГG3^WA0U3ռ!ռ 8ڼ3)iT. " W ) 3!@Z[\]^,`J br(d0e8f@hHjPkXmD`oghppr xsuv yC{a}=   ɾ Ӿ ݾ(Xk g#pidK6uid AA $  *WW WW 3 5 \A ) 0*U+$,X-ĭ92*Pc!0   Fۧ* @   Un ( 0 8@HPX`hp x A i    ڳE 49 CWHR \a k uz4)* 1+ 1,V-. /*(0 09 q4:(K8< @=D#D> cH? cP@FXA5`BC|E F5HsIK c-Q-   K*$ 11F\W6a pos  Wknk"xkFx˓W \)\0\\ #Bk1.Y[k3yGykW*`k.~8kk9kk#k#(  *Uk****2XiTkxW_kxiTWkY kvkAkkWnkkWFW sW8WF8+88,8J"1r8}O8w88F8}8}qD88Wbb.IgDWRzl"8\\ 8 8kW}C8k}%8aH8f  mt Y *8&W18@՝1U8En8+Z8s՝՝ ՝ ՝-"vA՝"i՝FF}}8n՝à  Fc *Qbio= /x - 48 c@HP\X` hpr  t x * 3 . D^r^I    ~r F(EFF modG  opsH!aI .JK  # "L+argM c+strN+arrO\VWWX" \W max^W_W num`M opsa!abcW0(-)F7* * W - .,K*7` -T .| mod / @ 0|H mp 1YP 2KX T8 5 6{ 7  9  ;   <)( = 90"^F F) 9 .&W >h'8 Emod F Gf'P p qc rc s tW;mtn wh 3  3 W " " 8=?#ϡFg*" q {[^[   W-M َz"$}b}W}W}*&W}&W}8}}}} }b0}(}!s}"- (&W}1n&W}B&W}O}c }d&2}e2n}f4}g lid}h   ǁ  ).\ =B)ZcmaQ [ e@/0 ops1"f dev4(56(7 8oo  } )W5a get put  % 9( R0z8@HPX`h)pxG`y5aQRW idSWTPfghWiR2 %9*RF>zFWcWF FF$FFWW$BBk.c`LyWe~hL busMZNOdP Q|(! ZZ(<8@Ppops c# (Cdev-|| W W  _  W " "(565len7W cap8 $3< !` J<KbusLZMZO c P(QA0SW8T<U>V@WBXWDY HZ I\"J]KP`UXa<`cDhd le mf n g xh ppini qj"rkHxmJn\t)viy  zW( |W- }W. ~W/ W0 W1 W2 W3 W4 W5 W6 W7 W8 W9 W: W; W<WW"T W W Wu;dev-$irqWY@ WB W B W B W B W B W B WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB WB W B W!B W"B W#B W$B W%B W&B W'B W(B W)B W*B W+B W,B W-B W.B W/BF H D#LiPyy W@M" W`M WaM  c  $vpd " WPO   H "   " D W`P "  "  s "0  2 $romm8  @ FH  *P #X  F PGJF    ( 0 8 @ H# P!X!`َhZ Oi*Dy*|*   *( &! 6"T#|$ D*&Z6Z+cTZW;|ZW#&YZWD;<D#=H W8_Rakehk l o (r 0k<uW<p<<<6<<D<RWrE@rNurT rZre@+z>rKrg**[r%rrr'2*rr'u8(s0ivmas1.s2 Us3 *s4*s5* 3s>s? 4+s@ W+..*..***>rKrW>r%Kr** *9.*a.*c>Fu.f.@Tz@T.*H+.* & * WW  IWW'[ sgl([)W*W GWMN 1PWRW TW   \CA\D \I \N\SAe\As\B\C #%K ` \  W W   `G[n[oʡ[pW[u#[w [x `[z [{ [~W8[D#<[}R@[2\P[\p[x`2*2 c Uc )ccH D# Yc (JY0 ) @jNk lenl wpmnxoxpxqxrNs t^(x^*xn*@!*-&*@@+ H 48W=WBWG mapLTMn@@]"aJY@m sbqwW | $ ws( 0W4 8 <\m\t \u\v\w\x\y\z \} W\7\ \\\ \ \(\0\ 8\%@\>H\ P\ SX\{`\ h\p\ x\\ ,7 A K) Z dH\\|\ @\WD\&Hn\  W\] W\h!\i\j\k*\l*\nW\oW\pW \qW$\rW(\sW,\tW0\uW4\vW8\wW<\xW@\yWD\zWH\{WL\|WP\}WT\~WX\W\\W`\Wd\Wh\Wl\Wp\Wt\Wx\W|\W\W\W\\\\W\W\W\W\\.3LLWcP\\|\ 1@\ 1HQ2* ,0=: MB bJvO  T (X0]8b@g HnPr $X{G` ah p ux   4fi qghik le tagn o$qW(tW,u 10 biow8x@HX\`\h\pxz|~q ref *( elv-\Q c n x WWW""Prqs D#  ( 2+opsmapW8 W< W@ WD WH LWPWT cX`h5p^<\[\i\i&W\WV V W*WVW >*S*C{V1W!cX"VV'/[ V-#WE Q(eix WZz{|i$<@7` icq c-*Q seqWQE!@6(B@Lg\@N#SX[*a cefqg-m csyWx D#(X0 X`hWpWt x|V &W&B\@@7x9D#AF*MWW &W}*!rq"i#x88$MB]]0Rvg{ii$iicW$WG+iWW)a+iWLuf+zvii W& WBJ a*rcubU lencd*4(g hilm o0p Pr Ts D#Xt`upvrwtxvy*xz*}* idWW lun\W WcKK5FF revF       ( 0 8 @ H WP W  W  W  W  W  W  W  W  W  W  W  W  W  W {ppr W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W  W W\ ` d $:h $:p x 2\W    " -" - 2\ c  cWW5# /r(!8&') +D#0,W8.5@0`1p2#3K5JY6#f7"p9VY:K<<> @WBWDWGH*QWRWS\\WeghijklWmWnWoWp*q*z W{ W | W  W  W  W  W  W  W  W  W  W  W  W\\WW* *(01$irqW4*8"-@"-0c ((0"/r8 J!HOPQQR;devS-(TVYUW$idVW  XW  YW! \W" ^W# `W$d (e ,kW0lW4o K8p!<q c@r/rH   &WBQ=5kW$?h*3WW Za oc dF m(t08Z@ZH P X ` h p x       4 D" ]* D4 v; E N WXag q%yF "W$W(W,*0*8@D  W@  WA  WC  WD  WE  WF  WG WL!P!X\`4(JZKQLMg\*rcuOUpQSZ*\]_`ab1%demgT% sdbj %kd%m Wp Wu Wv Ww } ~* W   o"_FtQWcQQQ 4* D9]QIvWbi{Q1-v"` %&Wf k1U8( 1U16)51U32*A|U64+M? 048<@H&Llptx|6FV*&*6*F* V*f* uur uu !)o*u+u,-./56u7u89u:u;<|BOCuDuEuFuGHIRSuTuUVW\^oe]kNl m n(oo-p.Oq1r,t0u5xHDevIuJuKuLuM[OOPQR'  5 u<* u u u u <u*L_`ab,cd,e<u*h'i  5 v];^_`au bu cuduefiuu  H@a ABCD EFG'L  MLUNN,OP5Qn 'V)! WXY Z[\5] 'b! cLUNd,ef5g6!]l!m"a 0n" 0o")!0p"!5q!'pv"wxyz {|}~uu ! u8u9: !<uTuUV !X5!A# u u #'#     5N#'`##   $ A# $*F#$*5#$5$67u8u9:u;u<u=u > ? -@ABCD }G)$1%& WDT%d%* %WL% WZ%W\&      4&5i%6%7%8\9 4X<'*dev=- > ? B\& E% F% G%  H%$ I%( LD, MD0 ND4 OD8 R@ U cP40`'*deva- b\& c6qd  eD('& x'' (k3y (-(-(2((t(  *  t(  (U(V `(a b Tp(q r(((*6)u ASCuuuT^) ^)(n)*)   ) )n))*h*uu * **\+ A        + ", . / +0 L M N O"P"R T U"V AXA+*A+*8:Z,;<\=D> ? @D A(+`q-rst\u" vD$idw(x,y"0z 2{ 3| 4}D8~"<\@ H!TI'/P X Y"ZVY\_,X-5K c@ cH "P "R&.ch .  \&\&0phy'P X"Z"\ ^ _Z,`x)/*+(, -\ ."(/\00"81\@2 H3 I4Z,Pphy5/X6`7'p&.S/TcUI^/_c` Ic0d0e /X0" 1ioc? D ?  8D<2(@ h i jp!2?34id5 67 8hD@94X:<;%xD<m=>? @A DE\Fg\I\8J D#@KHLDXM `PdQ hR"jS lT mV5pW5X D#Y [ \ ] ^ _ ` a b"d e"f'/g"hDiDjKDkDl mDnDop qr"s t uDvDwD x$y%zD(} 0~ 1 2 3 4 5 6 7 8 9 :-@---H---P @3@c@@""c@@@DD cD  """"  "A$A`D#)#*\"""$("i;---. D# D#D# D#   "    c  c "(  c0 "8 ":  c@  IH  cP "X "Z "\ "^ '/`  Ih Dp Dx  D#  JY D D D D  D   " " " D " " " '/  I " D  "(  '/0   I8  "@  DH  P '/`  Ih Dp "x '/  I D D D "  D  I  D !D $" %D &  '  (  )D *D +D , I -  . 0  1  2  4D 6 70 8@ 9P : ` ;5h >D ?D @ D A BD CE DD ED FD GC H  I  J  K  L  M  N D# O  P  QDA RDA( S y(0 T (4 U6) V) W X cY"Z [ \]^@_@`@a"AbeAd e1N@  @X0@@3@cDI@@E@c@?"-p@u@@?cII@@@?c@@@?"@II$A A"A?""/A4ADA?"QAVADeArAwA A?OA D<tC""   "" D     ""DA" """$"&"( "* ", ". "0  2 3"4"6"8 :C    "C?IR;DS"T"UDV;DDKD*vXD]DhD?KxD*f }DDy?DD*tC/" D/0AC'/D*DD*IE*DE**hIEbuficlenjD7 7Y% I Ecx^I2cEUI8cEʡUI?cEU~FR/FF}'/JPYFF}cռR2pFFSJ F"*FSRFJFFSJFF_GTioc6?`FawHTiocw/?7y4bHU}G7 7H UG7 7H BpFG#Uv#T@#Q B/F H#Uv#T $#Rs#X BF0H#Uv#T $#RsBFHH#UvVLBYFtH#T VFcYF#T RH*H _mH`FackIb{IU+I7g 7gH BFOI#U #T0dF#U R{I*kIWM&I=M(8=M<kKO!IVEEW8NlK=8%8=89kioc:?K;!I)= lKK= cL= 9$L90L9$L90L=L  9ML9YLeLfLvL  MK9L9LcE#T #Q@6W(6L=($k=(7"Tcnt(D=) xK,!IdsE#UT#TQ#QRL %c=L: ;: GUL|.cvL:|D:|PUeWL%WL:<:e^Lz0ЭL:zCU:zX*H! 5A!:!F ^! q!q ! ! Iint F ,! *!,s8R,u8e,s16},u16 ,s32,u32,s64,u64P \!   1F 2F Hc IP X ] ^P _ `:!! <F  '   o   #SB! %{ & 4 = B h n' } 1  ;  ;  F  F   $1  XXX0xx : JKL Wx K  s \x2MH  5  G "V y  ( ;$0 t8 ]@ "H "H "H ~H "H "H "H "H%@    0  RP h  5 5 F @  E F 10kp J  F( F, @0  E8 B@ BA BB FD  OH sP9mem T@ t   F 0 e j  t ~  ( 0 F8 @ FH FL P FX ` Fh p  x F F @$  F  F F $  F !$ "F % &r' 9F : ?0 A0 D } F  P  QF( TE$0N  ; cs =;sl ?;wfe A; Ex ss G;sti I; K;nmi M; P;  S;0 V;8lm X;9 ];: d;<  cs   csx ;    ss   ssx ;   g r15 mr14 nr13 or12 pbp q bx r(r11 u0r10 v8r9 w@r8 xHax yPcx zXdx {`si |hdi }p xip x  sp   B  C  D  E   E (s E ,dpl E -p E' / F 0avl F 4l F 5d F 6g F% 7 F+ 8  % %% *%/ :' pgd' *'"  @H? I"_0_0 48em f g h u vwkeyx\m  U V ? j keyk n keyo ;l<=? F @ F$A F(B F+%-@ (y0FF  4( F,!F0( 4)Y.8*FH+P,(X5 `6 d8 h: l; p< t=Fx6se?@@0rt@A9dlABBBFD&I2JKFODXD]D&`"w>@d]hFkF lm nD oD(p'0q Xs`ubx dy/Dhz0p{D 0 0  /D00 x=01(&2P0mmhpEx    F F, F, F, F- F- F- F- F- F- F- F- F- F - F - F - F -"F -300pid * *( (00((000@>FPCFX 0"{F%v(v+ - ;. ;3 ;4<6=: (=0>8A ;@D ;HGPHXK:`&N;TGWGZG^Hk -mHp0 q1(t8u@0fsxHH{HP~HXI`Lh Lp 5x 5 58 ~FL o<F\4h9 ;  ; u1 2" TD p2( (8 L@  H MP  MX M` Mh Mp x M /: F  ;  ;  ; 4 <  M 0  '  ' "M )M  0  M0  18  FX N\ N` 1h 0  N      !F "F # $ & ; ' ; ( ; &) 3*N C$ D L/N N R?N S'( T', Y0 ] 8 ^ < _ @ ` D &aH d9X gIN i9 lSN w x z } ~XN  ; ;  $  FmNwNNN F(F,vD09rcu04@ D(H4POx4  " O OO  ; >& !"-$"-&.<(O&F-@@l%@@q-spes ds"$&(0-8X`cr2hpx-F' i-6fpu ,@F(  '%@@"d@&i@ - "c c B(,Gd0'd80XQdh%`dpxb ed' Njdb !  >! val   R!! ,>!!! !!  ^! !!R! ! " \ " ?? 2"R! " "2" F, #fmt555F55$O6,# 7 8 8#5555(F(F(4Fkey9 #(#F=#   8U;$V0modW;$X5Y@$ Z ([ ,\#05u$v$w$xFyF,## :$ /$1Fset3Cget5\7 .$D&;$ 5 X {  -( -08!@" ߙH# P$ X%`&/h'Hp(/x)k*+,ٚ-ޚ./ 0 .1 2`3 5 9 ϛ; >k?@=$ !'% + -/  :' !key " ?h' A Bm' Cr' h'' =' >:' '  ;{' ! $0"c("d5"e."gL"i j"lo 5('# N# Np$(cwd$'swd$'twd$'fip$' fcs$'foo$'fos$'$($'l '($*(rip$+;rdp$,;$..)fip$/'fcs$0'foo$1'fos$2' $)B)((0$@d) $Ad) $Bd) 't) ;$$*cwd$% swd$& twd$' fop$( .)$5'$6'$9* $<*$>d)@B) '* '&*?$Q+cwd$R'swd$S'twd$T'fip$U' fcs$V'foo$W'fos$X'$Z($[l$\m$]n$^orm$_p$`q$a+x$b'! +@$:Q+$; ;$< ;$= Q+ ;a+%@@$O+'$Pt)$Q+$R+@ +3P@$^,$_9(.$`t)$a&*.$ba+@$c, ,E%@@$f,$hF$kF$n;$q;xfd$t;$wF$zF$F$F'$+@@$,$ ;$F$F Qfpu@$d-$F$$d-$d-$, $,0'$,@@,% -% ;%; :- - --- -&N&N&N'8.'92.'<2.'=2..(<Y. (=F (> (:.(;.7.src(A  dst(A ..#F).  () /) /val) ')!' )"')#;)$ / ')*G/ )+&G/ ),#t/#*t/*uQ* L/)'/)(6)).%/).; )1/)20)3)4 )5)6 /()30 )%. )/y/ )7/8)`0)fn) t00\o0o030`0+>0+?+@+A'cpu+C'#F,0     - 1- 1  1. 01.0/ K1/ 0a1 0"0u1K1 0a11 11! 1"1 2)12*'2+2"osq2-01 2/0(3 23 3 0304P244P24P224 p24 P2424U24P2 52)5 25 5 25p2#F6 2 @6'q3)6(26)  6*3(6+406,86-96.:6/;2332q3@@7/470~71F72 6 seq73;743752 76077 83(8G48 x88 W48' R4R44G49499 94 4: 4:4 4 :84;4;  ;4<+5<,c<-cx=_5=_5=F`=hmax=p o5 > 5sig>4 >o5 ?RE ?S55 ?U ?V55A@5 @  @  @ 5@'"6@(o@){@-`6@.@/@0 5@1@56@6o@7{@8 5 @<6@=o@>{@?@@@A@S 7@T $@U@V @Y17@Z $@[ @^b7@_@` @a @J7 @L @Q @W6 @\ 7 @b17 @E7@Fb7@g7@h\_fd@i@m8@n@o@pF A @%|8 @*5 @2"6 _rt@9`6 @B6 @d7 @j7 @q70A 8A A A A 80A 8|8 A8 8A  9A!0A" 5 A%N9A'5A(A.5A0 5 A3h9saA4 9 B 9B B lenB B B(C9C {D$9D% D'D( 0DD/:DM#9DPB(DWB)8E :E;E;E;E;E; E#;(E,;0F):F*;F+2PF8:F9:F:FHF;FL :;8FD;;)FEFF1FGF0 G>;GKGZGpGGGendG; :;3H!;H" F H&;HD;HD; HD;HE<HE; HE<HT L<HY<HZ u1 H[(<I o<valIZ I X<I <valI f I {<S<U ;V ;W2"7F[=    0hx=i;jk<cpulFm;n; o;( == '-@@w> ; ; ; ' ' (0F8%@@ ; ; ; ; ;  ;( ;0 ;8 1@ ;H ;P 1X 1` ;h ;p ;x  ;  ;  ;  ; ; ; ; ; ; ; ; ; ;%@qA=' 2! ;(" ;0# ;8%0@&qP'qQ(qR)qS, ;X- ;`. ;h/ ;p0 1x1 ;3 ;6 7qA9{A;{A=6avgG=@@ vA0KAL0MNOF P$Q&SA(A*]BBBBBB-`C'a2h ;i ; j ;(k ;0l ;8s 1@t ;HuFPFFFFFFFF'2X'2rqCACB*^CC(CBRrqCC<F <F <F<F:/DSTDBbCBs'qDqDTD? ~DD D CD'' D-EqRjS @ D Hp2P` h)px u10S DFpidpJ7>FJ9 4J:FJ; u1J<minoJ=;J?y J@]@JBSH/rcuJC`JDypE xSF K{FKFKZTSFLoGLp'uidLq o<gidLr < Ls o<Lt <Lu o<Lv <Lw o< Lx <$Ly F(Lzy0L{y8L|y@L}yHL~yPLqXLH`LHhLHpLHxL L}L iL8L}"}FGFkeyMHM4Moz"{M| semMS(M|PM X|`M huidM o<pgidM <tM{zxM|M~M M||M|G H H H H H;XN^LN_4N` NaNb Nc0NeS Nh(8Nk8@Nn]XNq`NsdNt(hNwpNxFtNzx(NF(NFNFN]N])N2N itNN4N:NƀhN N>FN=ttyNۀNN L<N;N ;N;N;N;N;N<NNNN'N N(N"0N,8N@NHN"PN,XN`NhN/:pNNNnNN FN NBNNNN1NS0IC NLNu1N4NSN^ L L L L M MXOcMOd'Oe Og Ok u1OmRjOn(Oo]0OqT8M M8 M M PMPcPKPWM M N N N %N ?N;; DN NN 5hN hN rN |NhQyNQzYQ|FQ}`["ZQzZ(Q40QXQ#e[`N N O O O #ORNRNRNR!NR%NR'NR,NR/NR3NR5NR9NR<NRANRDNRHNRLNRQNRUNRYN3PShPSSSS PS!sS" }S$FHS'QS(5keyS) S*QS+ S,(S-0S. Q8extS/Q@w'3PhP S3 S8pQtpS9pQS: S;'S<'P * TRT'T TFT  T;T;inoT); devT* (T+ ,uidT, o<0gidT- <4T. r8T/K@T0KPT1K`T2KpT3;T4;T5'T6'T7;T8;T9'T:'T;' qRU#SU$u1U%0 U' R$VN$VN$VNW\SW 4XNTY Y"iSYS Yu1 YnSYSzSYFY(Z0TZ1'Z7'osqZ901Z;2"Z<0$ZN$ZN$ZN$ZN$ZN[+T[,2"[-0 \ TTTTT \T\'\0\TX]qU]rT]s4 wq]vUHcpu]wP Ux^U^^U^U(len^'H^UP^p #UU U \U;@_V_V_V_ )_u1@@_ (UH_!_"_#B_$4_%TU_& _'W0_(8=cpu_*@=ssp_+NWH 'V`_6W_7u1_8U_:U(_;H_<WP_=X_>\V_eNW_fFsda_gX_h"_iX WCx_DX_EW_FX_H _I1(_Ju1H_K1P_Lp_Mx_N_O_P_Q_R_S_TB_U_V1_WSF_Y _\_]_^T__NWp WXUSW`NaX a+ a+a" Ya#a$a%a'/Ya(a)a+SYa,a-a!Y a&X a* Y a./Y aYXopsaYSY YYa2Ya4a6Fa7F #FQ@Z   #FQH@Z   QpuZQqZQrQszZ uZQZQYQVQZ)QQ4QZZWZ@Q`[Q@ZQQQ Q B(Q,Q`[0/rcuQ8Q[HZYQ[QidQ j[[3Q[Q[ [(b\b2"b1b0b  c \c;c& $c)Sldtc*\8c.@c91Hc:hc;]pc= xcC |cD~ \d ]ddaltddd d(d0d\8d\@d\Hd\Pd\Xd\`d\hd\pd\xd\d \d!\\] cF\\]^ `FX^ lruY0] d0 e0i>^ j  k(Rn^]hE^s (u^zpp{^|}~' ^^^_  ^4(Q0_>^n^^^8R_ F  : k_val*R_1M_N PF+J_BlruK0x_+W_X Yk_1@GL`I_UEV  _([ 0\ 4^85@Fj`_.j 1(m`noq r s t vF 5@l`j`.z 10}Ta~     (1 a05@|a`Ta. -Da"L`"`@"a*a- b  u1   E  q(F0F4G8w@pP rp  x#Օ$ % 'ڕ"a5cctx6c c=Cc>AS@;(X`cYS(\cbht%w }$1c5cc.+daaX Gd6rb2Cc Ld Vd[dc`cd;cid Y@@ d : d0 mNZ@@h"d@S@PX`hppgd  x) 5 ?hELFS Z2"]'_au1pSr0$ (08;@u1DHP'X3`h0brkp!x%0hh@h]hu1pix( ib&i  ['T!i' dod h3 [h h iQ i i 5i3$e6N$e9N$ej gGMj gHj gIii 4j9j CjHjh,jh- u1h/ h0RjgAjigK ~g:j g@~ijgNj gO gP gQ r(g+Dkg,g-Bg.Bg/ ~jj 0pkqbr rs t u v $H(Dkji"ki#ki&ki'ki' kkkj(lju1j 4jBl8jljWl"(lk3{lk4'lenk4'k2lWl k6;k1l{lk8lkil kj0 kklS[krm ksx ktk8kukRmkTFkU<kVkkWmkXl kYq0k[q8k_"q`k`uhkapkbx)kdBllkmxkn]/d_ukvlmm%x{q| }~ o< <F !e u(E0 8@H L rP X ` h'p't'x'|u1^ 'Sx0o  000 \?0$@$H P T X \@e`yh&Dp08@H P(X`h pm q-q'@kqkukukvk6vkJv k^v(k nv0k nv8k v@k vHk.wPkLwXkew`-qq%@u0 q r t(!0!8@"HPX`mhSp &!#:D$SXk 0 b b l vxF (&` '!'"/ 0 14 6F<1 B5@D"qHFxPI'XL`O dRUhS]pZ ixaxbx9rcucdTf1k0&nu1@@o0Hqu1Xr0`q#Fku umFuvv vmlu1vvF51vlvJvv;v^vmOvnvmcvvmqsvvmv lEvlFmlGulHlIvvvvwm)wmntm vm mwvGwGwB)w3wmewmuQw n"wn#nidn&n-n4n7mNnRxnSxnUxnX\nYnZ Fnc 4 ndSF(/rcuneHngXnj0`idnmpnptnq5xnrmnuxxxxwjwx'0o3xo4\yo60o7o8 Bxao9Rj  o4yo 0o" \o$u1@@o-\ylruo/xo0' 4yJ2ynrJ3nsJ4y0 ]y ayy3p yvalp; py#Fq y   y r1zrr r$sNteztjzt ez M MMlz/rcuMmMn4Mo BMvzMx My Muzz xM(MrA{MtzMK{MP{M5 A{A{zA M{{ M M {U{ { M{{{H{{HF{{{M{M{keyMHMK{4M| M08M2MA| M  M (M|MMMK{MP{M  (M| MzA|1 M|M0M =z+ M|MU{| | |{u}u 4u[u0u'8ux@uidu o<Pu'Xu `u$>"hL}L 4LgidL } <}34L} L]rcuL}};@@7g~7h2"cpu7iF7jF7kF 7lF7mF7nF7oF7pF7rF7s7t7uF7{  7|3(7} 07~38)7M@@}2~#F7:M        >3@^ N9n?8NN N! \N"N#;N#; N$(N$0N'N(;N);N04N1 $N2 $N3 $NCONDNLwNM(NNwO8NQNR NSONTSF| ƀ >Fր ր  4  v)v(0wlwwwS)w `x /rssx )xq0x8xS@x Xy fny .argy  ez bz z { 'OSA OT0 OUy4OWb OXx8OY8OIqOJiocOKM"A O\F0 b | ҂val|Z || val|f |ނ} v}  }%7F}T^    #q~      . 0 $ 4#F.ۃ   45F679 * % /4`  o<  ҂  <  PF >`  rKK(K8 bHЁ()x*0+0 ,00-1@. u1`/ d0uh1bp2 rx34 { څval ÅGF  #F6(   BEb uidF o< gidG < H څD4JH ( ( ( ( (  (( (0 8 @HЇ0 F(F, (0 (8@ Ї!;$ЇGF        @89:;<=È >È(?È0@8uÈ܈u܈bȈXDEÈFG HÈIÈ JÈ(K0N щ8O@QHSPủ̉q(qڅ։q̉xYZ[;\;];^; _;(`;0a18c1@dHeLf;Pg;Xh;`i1hjp8FFFF FFFino  ( 0‹F‹ ҋ QFFF FFFFX66 Y(|08|@H6PQuGw6uF"TuTҋ;wubw ^u܈wuD8  F S 0 (H0ops!8  q( 8 H+wm}r mwk\Ǐ! : T (0 ѐ8 @ H P -XP`dh p x   ̏ba!E B:E&JJO ?bErFSYbErFFѐE~~֐B -kkPEy2dUB~~iBEؑؑbݑ bkkǏ+?MF5e].+! &q+ޒIN  F ޒ %@Z`[[\~]^`؜ b(d0e78fZ@h}Hj7PkXmҝ`ohp"pr @xsmuvyў{}:S` j t ~  ( b 1pid>F0uid o<o< $ p FF FF r+ 1 ;5 )Օ.*+., -]*P^F    %0c  'c>ltΟ    ( 0 8@9HMP9XM`php x Ϡ  ) ) y  +& 05 ? INۃ ] g q { : :$*Bߘߘ5r;F pos r* Fr5brXb~oi:{b5~oi]kF bߘՙbՙڙ \bFb/qbHbߕ4kbrrMbpb ٚb$PINboi~F.boiIN~F QbQSV[ 3\brreb ϛbrbr~FrbrbrrFԛF =F$m[qmFB5ymqy`qqB؜mqmBݜmqm7qm#Zqm5<}qm_qmҝqmqmFmםGw'FQ@m~'cqc;;h EqrqmbFўqbm֞m0m05 Sm0? mt S qX7F   qΟuqӟqq u9u%Mu>fmfk RuvumϠu~ru5~rԠ q\)ux==B . LQmyt5[ "@@AA5B0CFD֪ E<(sdF90GAS8(IF(JF(KF(LF(MF *  . 'PPW     qq  ZU2_rev Z99  95/rb2ns0F8< >Y@id;` hp/rcux opsJ!T r9hEi y"$ % ɦ & ަ(( 02 ~89B@: H= P@3XA Q`E O  dir d > Ukn9b 1 1@`0h x  ~  B@  BA %`dddUydn~oiɦoiަΦd~rdՙ3drQdr8#Fz  0'֧(V) ji* +, - .(z2ۧ 2"5"5" "mW "n "o&X"0"1 "2 ~"3 "4y "5 ("7 ө0"9 8"; ө@"= H"?PWW )F) LF3~jFQ)2EtbFr~~өbFr~rbFrةbF"N" l" #lF)SF)5~q`֪0 u1 X0t7u LvQw!Vx*yy z (۪7LFAN[(oot֧A`t~ttiyiC }~=buf  ? :/Ed}/xtix5ttd׬5׬>(E>F5modG;$opsH!I JKa ܬì\׬HL argM  strN arrOVWFX \max^F_Fnum`qopsa!b$0(;));>2L t F v   :7` -  .mod /;$@ 0FHmp 1P 2{FX  8 5r 6  7  9  ; ͯ  <( = 0r5~ͯ;$5;$ү;$7F >   -8 ELmod F;$' G7 J       _-P p q r sB tF6mtn w  1  1 F   6;"ܬy>e& o y#QNW/Q  "L Aϱ ϱ `   A   A3%#3  A\*L\ \ \ \ \ \ \ \ \ \  \ !\ "\ #\ $\ %\ &\ '\ (\ )\ *\ +\ ,\ -\ .\ /\ 0\ 1\ 2\ 3\ 4\ 5\ 6\ 7\ 8\ 9\ :\ ;\ <\ =\ >\ ?\ @\ A\ B\ C\ D\ E\ F\ G\ H\ I\  A"qK a M b L % Kint 1u8? #W   1 <!%',/359<ADHLQUYɲʲ˲  6 9 < GK 1 :@ 1T| 1.111-  g l - - - `J 9   % V9  `/V ,4p ,   : ;9 I8 I~ : ; 9 I8 1BI !I : ;9 I84:!;9 I H} 41B  4: ;9 I 4:!;9 IB( H}'I1RBUX YW  : ; 9  : ; 9 I8 I!I/  : ;9 I k: ; 9 I< : ;9 1RBX YW : ;9 I&I: ;9 I : ; 9 I8H} 1RBX YW ! " : ; 9 I#: ;9 I$ U%.: ;9 'I & U':!;9 IB( : ; 9 I k)4I4*4:!;9 IB+:!;9 IB,'- 1..?: ;9 'I</410 : ;9 I112 : ;9 I8 31RBUX YW 4: ; 9 I5 I8 64: ;9 I7: ; 9 I8.?: ;9 '<9 1U: : ; 9 ; <.: ;9 ' =  : ; 9 > : ; 9 ?4: ; 9 I@4: ;9 I A> I: ; 9!B.?: ; 9 '<C 1D : ;9 I 8 E.: ; 9 'I F: ;9 I!G1RBX Y W H  : ;9 I4:!; 9!I J IK.: ; 9 ' L : ;9 I M.?: ;9 '<N : ; 9 I k O  : ;9!P : ;9 I 8Q.?: ; 9 'I<R4: ; 9 IS T : ;9 I8U : ; 9 V : ; 9 I 8 W> !I: ;9!X.1@zY : ;9 I k Z41[H}\ : ; 9 I 8 ]!I^1RBUX Y W _ 1U` : ; 9 Ia I 8 b4: ; 9 I c 1dH}e1f : ; 9 I k g : ;9 I 8 h.?: ; 9 '<i$ > j4I4k.:!;9!'@zl.?:!;9!'@zm: ; 9 In4: ;9 I?<o : ;9 p  : ; 9!q :!;9 r 1s.?:!;9 'I@zt4: ; 9 Iu : ; 9 I8v : ; 9 w :!;9!x :!;9 y1RBUX Y W z.:!;9 'IU@z{.?: ;9 'I |4: ; 9 I?<} : ;9 I~( : ;9  !: ;9  :!;9 .:!;9 'I@z:!;9 I : ;9  !: ; 9!.?:!;9 ' ! 1RBX Y W 'I : ;9  : ; 9 I!  : ;9!I : ; 9 I!H} : ;9 I 8 : ;9 .?:!;9!'IU@| 141 4:!;9 I .1@|5I I8.?: ; 9 '<.:!;9 'U@zH}.?:!;9!'U@z.:!;9!'IU@|:!;9 I4: ; 9 IB>! !I: ; 9! !: ;9!!I/ : ; 9  !: ; 9!( : ; 9 I .?:!;9!'IU@z1UX!YW 41!.:!; 9!'I@z:!; 9 I4:!; 9 IB: ; 9 IB: ; 9 IB.: ; 9!' !.1U@z< !: ; 9   : ;9 (! !!:!;9! ! !:!; 9!.?: ; 9!'<4:!;9 I.:!;9!'I@|H}H}.1U@|.?<n:!;!% U $ > &!I7 4: ; 9 I?' : ; 9 4: ; 9 I? <  : ;9   : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ; 9  I 8 : ; 9 : ; 9 I > I: ;9  : ; 9 I k : ;9 I .?: ; 9 'I<.?: ; 9 n'I<5.?: ;9 '<.?: ;9 'U@| U4: ;9 I1X YW 1RBX Y W .: ;9 'U@|.?: ; 9 'I@z.: ; 9 '@z.: ; 9 'I .: ;9 'I .?: ; 9 'I 41 H}1X Y W 11 1X YW 1.1@.?<n : ;9 I8  : ; 9 I8 I~ : ;9 I8 !II( 'I 1B  : ; 9  H} : ; 9 I8 : ;9 I k<: ; 9 II : ;9  : ; 9 I8!I/ :!;9 IBI~&I : ; 9 I4:!;9 I4: ;9 I : ;9 I4: ;9 I  : ; 9 I k':!;9 IB 1RBX!YW !41B" : ;9 I8 #4:!;9 IB$H}%H}& I8 ' U( :!;9 ) : ;9 I*.?:!;9!'I@z+ : ; 9 , : ;9 I 8 - : ; 9 .: ;9 I/.?: ;9!'<0  : ; 9 14: ; 9 I2  : ;9 3 4: ;9 I!54:!;9 IB6>! I: ; 9!7 I8 : ; 9 I k 9H}:  : ;9!; : ;9 I 8< : ;9 I = : ;9 I8>!I? : ; 9 @> !I: ;9!A I 8 B : ; 9 I!8 C4: ; 9 I D E : ; 9 I k F : ; 9 IG : ; 9 I 8 H : ;9 I k I$ > J 1UK: ; 9 IL : ;9 M : ;9 I 8 N  : ; 9!O.?: ;9 'I<P.: ;9 'I Q : ; 9 I8R: ;9 IS: ; 9 IBT : ;9 U.?: ; 9 '<V4:!;9 IW 1X : ; 9 Y !: ; 9!Z4I4[ 1\'I] : ; 9 I!^  : ;9!_I `41a :!;9!b4:!; 9 IBc : ;9 I 8d : ;9 e : ;9 f(g !: ;9!h1RBX!YW i1RBUX!YW j: ; 9 IBk: ; 9 Il I8m.?:!;9!'IU@zn Uo4I4pH}q41r !: ;9!s : ; 9 t !: ;9 u : ;9 Iv !: ; 9!w.?: ; 9 'I<xy4:!; 9 IBz.:!; 9!'@z{>! !I: ; 9!|!I/}<~ !: ; 9   : ;9  !!:!;9!.?: ;9!'<.?: ; 9!'<.?:!; 9!'< :!;9!.: ; 9 ' .?:!;9!'I ! 1.?<n:!;!% U$ >  &4: ; 9 I?' : ; 9   : ;9   : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ; 9  I 8 : ; 9 I 4: ;9 I?<(  : ; 9 : ; 9 I : ; 9 I  : ; 9 I k1RBUX YW .: ;9 'IU@z.?: ; 9 'I@z .: ; 9 'I 4: ; 9 I.: ; 9 'U@z.: ;9 ' .1U@z 11 1RBUX Y W 1 1U1RBUX Y W .?<nI~1B : ;9 I8  : ; 9 I8 I41BH} !I 4: ;9 I : ;9 I8 4:!;9 I H} 1RBUX YW 4:!;9 IB( 1RBX YW 1RBUX YW 'I 1 U1RBX YW : ;9 I : ; 9  : ; 9 I8 : ;9 II!I/   : ;9  : ;9 I k 1RBX Y W !1"<#&I$: ; 9 I%1RBUX Y W & : ; 9 I8': ;9 IB( 1).: ;9 ' * 1+ : ; 9 I, U-4I4.41/: ;9 I0H}1.?: ;9 '<2.: ;9 'I 3 : ; 9 I k4'5.?: ;9 'I<6:!;9 IB74: ;9 I8 : ;9 I8 91RBUX Y W :: ; 9 I; 1U<4:!;9 IB=: ; 9 I> ?.?: ;9 '<@ I8 A : ;9 IB1RBX Y W C4: ; 9 ID : ;9 I 8 E  : ; 9 F41G H : ; 9 I 1J : ; 9 K4:!; 9!I L  : ;9 M>! I: ; 9!N: ;9 I!O.1@zP.: ; 9 'I Q.: ; 9 ' R4: ;9 I SH}T 1UUH}V.?: ; 9 '<W4I4X :!;9 YI~Z I[> !I: ;9!\.:!;9 'U@z] : ; 9 I k ^  : ;9!_ : ;9 I 8` : ;9 I8a : ; 9 I 8 b : ; 9 c!Id.:!;9!'IU@ze4: ; 9 If : ; 9 I!8 g(h.: ;9 '@zi.:!;9!'I@zj4: ; 9 Ik : ;9 I l : ; 9 Im I 8 n4: ; 9 I oH}p.?: ;9 'I q : ; 9 I k r : ;9 I k s.?: ; 9 '<t$ > u :!;9 vH}w4: ;9 I?<x.?: ; 9 'I<y1z: ; 9 I{ : ;9 I 8 |  : ; 9!} : ;9 ~ 1 : ; 9 I841  : ;9  :!;9  !: ; 9!1X!YW  :!;9 .1U@z'I : ; 9  : ; 9 I!  : ;9! : ;9 I 8 : ;9 I >! !I: ; 9! : ;9! I8 : ; 9  !: ;9!: ; 9 I!.?:!;9!'IU@z .?:!;9!'@z5I !: ;9! !: ;9  : ;9 I !: ; 9!(.?:!;9!'<1UX!YW .?:!;9 'U@z4:!;9 I.?:!;9!' ! : ; 9!!I/< !: ; 9   : ;9  : ; 9 I 4G:!; 9!.?:!; 9!'<1UX! YW! :!;9 I.?:!;9!'I@z1 .?<n:!;!% U$ >  &4: ; 9 I?'4: ; 9 I?<  : ;9   : ;9 4: ; 9 I? < : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ; 9  I 8(  : ; 9 : ; 9 I   : ;9   : ; 9 > I: ;9  : ; 9 I k!4: ;9 I 4: ;9 I?.?: ; 9 n'I<.?: ;9 n'I<.?: ; 9 '<.: ;9 'I 1UX Y W H}4: ;9 I 1X YW .?: ; 9 'I .: ;9 'I H}.?<n : ;9 I8  : ; 9 I8 I : ;9 I8 !II~1B( 'I  : ; 9  4:!;9 I H} : ; 9 I8  4: ;9 I : ;9 I k<: ; 9 I41BI : ; 9 I8 : ;9 !I/ 4:!;9 IB&IH} : ; 9 I1RBUX!YW  : ; 9 I k': ;9 I : ;9 I! : ;9 I8 " 1# $ I8 %.?: ;9 '<& : ;9 I' U( : ; 9 ) : ; 9 *  : ; 9 +1RBX YW ,: ;9 I-:!;9 IB.1RBX YW /4: ;9!I 0>! I: ; 9!1121RBUX YW 3 : ;9 I 8 4 15 I6: ; 9 I7 : ; 9 I k 8.?: ;9 'I<94:!;9 IB:  : ;9!; : ;9 I 84: ; 9 I? @ : ;9 I8A  : ;9 B.?: ; 9 '<C41 D : ; 9 E> !I: ;9!F UG : ; 9 I 8 H : ; 9 I 8 I4I4J4: ; 9 IK : ;9 I L M I 8 N4: ; 9 I O: ;9 I!P.?: ; 9 'I<Q : ; 9 I k R : ; 9 IS : ;9 I k T41U: ; 9 IV.?: ; 9 '<W$ > X!IY:!;9 IBZ  : ; 9![: ; 9 I\ : ;9 ] 1U^41!_.: ; 9 'I `.: ; 9 ' !a : ; 9 I8b1RBUX Y W c.: ;9 ' d : ;9 I 8 e : ;9 fH}g1RBX Y W!h !: ; 9!i 1Uj4: ; 9 Ik'Il : ; 9 m : ; 9 I!n  : ;9!o 1p1RBX Y W q4: ;9 Ir : ;9 I 8s : ;9 t(uI v :!;9 w1RBUX Y W x.:!;9!'IU@zyH}z : ;9!{ I8| !: ;9!}.?: ;9!'<~ :!;9!I~ 1 !: ;9! : ; 9  !: ;9  : ;9 I !: ; 9!4: ;9 I?<: ; 9!I! :!;9! :!;9!.?:!;9!'IU@z4:!; 9 IB.1@z>! !I: ; 9!!I/< !: ; 9   : ;9 4G:!;9 .?:!; 9!'< .:!;9!'I@z41.?:!;9!'U@z.?:!;9!' !:!; 9 IB.?:!;9!'I !.1U@z% U$ >  &5I4: ; 9 I?' : ; 9   : ;9   : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ; 9  I 8 : ; 9 I (  : ; 9  : ; 9 I k: ; 9 I   : ;9 .?: ; 9 n'I<.?: ; 9 '<.: ;9 'U@z1UX YW 4I4H}.?: ;9 'I@z.: ; 9 'IU@z: ; 9 IB.?: ; 9 'I 1 .?<n.?<n: ;  : ;9 I8  : ; 9 I8 I~I : ;9 I8 !I1B4:!;9 I  4: ;9 IB 4: ;9 I ( H}'I : ; 9 H} : ; 9 I8 41B : ;9 I k<I: ; 9 I!I/  : ;9  : ; 9 I8 1:!;9 IB&I1RBUX YW  : ; 9 I.?: ;9 '< : ;9 IB! U" : ; 9 I k# $ : ;9 I8 %'&4:!;9 IB'1RBX YW (: ;9 I): ;9 I* U+ I8 , : ;9 I- .1RBX YW /: ;9 I04: ;9 I 1.:!;9!'I@z2 : ; 9 3 : ; 9 4  : ; 9 5.: ;9 'I 6H}7: ; 9 I8>! I: ; 9!9 : ;9 I 8 :.?: ;9 'I<;4I4<: ; 9 I=4: ; 9 I> I? : ; 9 I k @  : ;9 A : ;9 I B  : ;9!C : ;9 I 8D: ;9 I!E41F G HH}I : ;9 I8J : ; 9 I 8 K4: ;9 IL : ; 9 M> !I: ;9!N 1O.?: ; 9 'I<P : ; 9 I 8 Q.?: ; 9 '<RH}S4: ; 9 IT.: ; 9 'I !U : ; 9 I k V I 8 W4: ; 9 I X1RBUX YW Y : ; 9 IZ : ;9 I k [.:!;9!'IU@z\ 1U]$ > ^!I_4:!;9!I!`: ; 9 Ia : ;9 b.?: ;9 '<c  : ; 9!d1e.?:!;!9!'<f : ;9 I 8 g : ; 9 I8h41i 1Uj.: ; 9 ' k : ;9 l !: ; 9!m 1n1RBUX Y W o :!;9 p'Iq : ; 9 r : ; 9 I!s  : ;9!t !: ;9!u: ; 9 I!v4I4w4:!;9 Ix 1y.: ;9 ' !z.?:!;9 'I !{ : ;9 I 8| : ;9 }(~I 4: ;9 I?<H}.?:!;9 'U@z4:!;9 I 1RBX Y W! 4: ; 9 I : ;9! I8.?: ; 9 '< :!;9 1RBX Y W 1RBUX!Y!W! !: ;9! : ; 9  !: ;9  : ;9 I !: ; 9!.?:!;9!'@z :!;9 1.?<n:!;!5I>! !I: ; 9! : ; 9!!I/< !: ; 9   : ;9  : ; 9 I  !!:!;9!4G:!;9!I41!H}.?:!;9!'I@z.:!;9!'@z4:!; 9 IB.1@z% U $ > &4: ; 9 I?'4: ; 9 I?<  : ;9   : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ; 9  I 8(  : ; 9 : ; 9 I   : ; 9  : ; 9 I k!.?: ;9 n'I<.?: ; 9 n'I<.?: ; 9 '<H}.: ;9 'IU@|1UX YW  : ;9 .?: ;9 'IU@z: ;9 I: ;9 I.: ; 9 '@z: ; 9 IB: ; 9 IB5.?: ; 9 'I H}.1U@z.?<n6 : ;9 I8  : ; 9 I8  : ;9 I8 !II( 'I : ; 9  : ; 9 I8 : ;9 I k < : ; 9 I I~ : ; 9 I8I : ;9 !I/  : ; 9 I&I1B : ; 9 I k'  : ;9 I8  I8 : ;9 I : ;9 I : ; 9  : ; 9 .?: ;9!'<H}   : ; 9 !4:!; 9 I"4: ;9!I #>! I: ; 9!$ I%4:!; 9 I&4:!; 9 IB'4:!;9 I( : ; 9 I k ) : ;9 I 8 *  : ;9!+ : ;9 I 8,H}-: ;9 I. : ;9 I8/ : ; 9 0  : ;9 1> !I: ;9!2 : ; 9 I3 I 8 4 : ; 9 I!8 54: ; 9 I 6 7 : ; 9 I k 8 : ; 9 I 8 9 : ;9 I k : ;$ > 4:!;9 IB?: ; 9 I@ : ;9 A  : ; 9!B: ;9 I!C : ; 9 I8D4: ;9 IE : ;9 F : ;9 I 8 G !: ; 9!H1RB X YW I'IJ : ; 9 K : ; 9 I!L  : ;9!M:!;9 IBN4I4O1RB UX!YW!P : ;9 I 8Q : ;9 R(SI T UUH}V1RB X!Y W W.: ;9 'I !X : ;9!Y I8Z.?: ;9 'I<[.?: ; 9 '<\:!;9 IB]1RB X YW ^1RB X!Y W _ !: ;9!` : ; 9 a !: ;9 b : ;9 Ic !: ; 9!d.?: ;9!'<e.?:!;9!'U@zf4:!;9!IBg :!;9!h:!; 9 IBi:!; 9 IBj k l>! !I: ; 9!m : ; 9!n!I/o<p !: ; 9 q  : ;9 r !: ;9!s.?:!; 9!'<tu.?: ; 9 'I<v.?:!; 9!'U@zw :!; 9!x1RB UX!Y W!y.?:!;9!'I !z% U{ |$ > }&~4: ; 9 I?'  : ;9   : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ; 9  I 8 : ; 9 I 4: ;9 I?<(  : ; 9 : ; 9 I : ; 9 I  : ; 9 I k.?: ; 9 '< : ; 9 .: ; 9 'U@z4: ; 9 IB 141BH}.: ;9 ' .?<n : ;9 I8  : ; 9 I8  : ;9 I8 !II'I(  : ; 9  : ; 9 I8 : ;9 I k < : ; 9 I : ; 9 I8I : ;9 !I/  : ; 9 I&I : ; 9 I k'I~ : ;9 I8 : ;9 I I8  : ;9 I : ; 9  : ; 9   : ; 9 4:!; 9 I : ;9 I 8 4: ;9!I I!>! I: ; 9!"1B#H}$ : ; 9 I k %  : ;9!& : ;9 I 8'  : ;9 ( : ;9 I8) : ; 9 *: ;9 I!+ ,> !I: ;9!-4:!; 9 IB. I 8 / : ; 9 I!8 0: ;9 I1 : ; 9 I2 : ; 9 I k 3 : ;9 I 4 : ; 9 I 8 5 : ;9 I k 64: ; 9!I 7$ > 8!I9: ; 9 I: : ;9 ;  : ; 9!<4:!;9 IB= : ;9 I 8 > : ; 9 I8? : ;9 @.?: ;9 'I<A41BB: ; 9 IC !: ; 9!D.: ; 9 'I !E.: ;9 'I !F'IG : ; 9 H : ; 9 I!I  : ;9!J 1K4: ; 9 IL : ;9 I 8M : ;9 N(OI P1RB X!Y W Q4: ;9 IR : ;9!S I8T:!; 9 IBU :!; 9 V W: ; 9 IX !: ;9!Y : ; 9 Z !: ;9 [ : ;9 I\ !: ; 9!] !: ;9!^.?: ; 9 'I<_1RB X!YW `1RB X Y W aH}bH}c>! !I: ; 9!d!I/e<f !: ; 9 g  : ;9 h : ; 9 I i: ; 9 I!j.?:!;!9!'<k:!; 9 IBl:!;!9 IBm4:!;9 IBn1RB X YW o.:!; 9!' !p% Uq r$ > s&t4: ; 9 I?u'v : ; 9 w  : ;9 x  : ;9 y : ; 9 I 8z  : ; 9 { I |  : ;9 }  : ;9 ~  : ; 9  I 84: ;9 I?<: ; 9 I   : ; 9 (  : ; 9  : ; 9 I k.?: ;9 '<.?: ; 9 '@z U1RB UX YW .?: ; 9 'U@z4: ; 9 IB4I4 : ; 9  .?: ; 9 'I@z.: ; 9 '@z1RB UX Y W 1.: ;9 ' .?: ; 9 '<4: ; 9 I.?<n : ;9 I8  : ; 9 I8  : ;9 I8 !II( 'I : ; 9  : ; 9 I8 : ;9 I k < : ; 9 I : ; 9 I8I : ;9 !I/  : ; 9 I&I : ; 9 I k' : ;9 I8  I8 : ;9 I : ;9 I : ; 9  : ; 9   : ; 9 4: ;9!I >! I: ; 9! I : ; 9 I k : ;9 I 8 !  : ;9!" : ;9 I 8#I~$ : ;9 I8% : ; 9 &> !I: ;9!'  : ;9 ( I 8 )4: ; 9 I * : ; 9 I!8 + : ; 9 I, : ; 9 I k - : ; 9 I 8 . : ;9 I k /$ > 0 : ;9 I 1: ; 9 I2!I3 : ;9 4  : ; 9!5: ;9 I!6 : ; 9 I874:!; 9 I8 : ;9 91B::!;9 I; : ;9 I 8 < !: ; 9!=:!; 9 IB>'I? : ; 9 @ : ; 9 I!A  : ;9!BH}C : ;9 I 8D : ;9 E(FI G : ;9!H I8I.?: ;9 'I<J.?: ; 9 'I<K4:!; 9 IBL.:!;9 'I !M !: ;9!N : ; 9 O !: ;9 P : ;9 IQ !: ; 9!R.?: ; 9!'<ST:!; 9 IBU VH}W.:!; 9!'I@zX>! !I: ; 9!Y!I/Z<[ !: ; 9 \  : ;9 ] !: ;9!^.?:!;!9!'<_.?:!; 9!'@z`H}a.?:!; 9 'U@zb4I4cH}dH}e f% Ug h$ > i&j4: ; 9 I?k'l4: ; 9 I?<m : ; 9 n  : ;9 o  : ;9 p : ; 9 I 8q  : ; 9 r I s  : ;9 t  : ;9 u( v  : ; 9 w I 8x : ; 9 I y4: ;9 I?<z : ; 9 { : ; 9 I k|: ; 9 I }: ; 9 I ~.?: ;9 '<4: ; 9 IB U1RB UX Y W 1RB UX YW  1U41 1RB X YW 4: ;9 I.?<n : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 'I : ; 9 I8 < ( : ; 9 I : ; 9 I I&I!I/ 4:!; 9!I! : ; 9 I8 : ;9  I8  : ;9 I k : ; 9  : ; 9 4: ;9!I '  : ; 9! : ;9 I I : ;9 I8  : ; 9 I k  : ; 9  : ; 9 I k : ; 9 I!$ > " I 8 #>! I: ; 9 $4: ; 9!I %  : ;9!& : ;9 I 8' : ;9 I 8 ( : ; 9 I k) : ; 9 I 8 *: ;9 I+ : ;9 ,:!; 9!I-  : ;9!. : ;9 I / : ; 9 I!8 0 : ;9 I81 : ;9 2'I3!I4 !: ; 9!5  : ;9!6 : ;9 I 8 7> !I: ;9!8 : ; 9 I!9 : ;9 I 8: : ;9 ;  : ; 9!< :!;9!I k = : ; 9 I8>I ? !: ;9!@ I8A : ; 9 B : ;9 IC : ; 9!D : ;9!E!I/F !: ; 9!G>! !I: ; 9!H% I$ > J K&L4: ; 9 I?M'N4: ; 9 I?<O : ; 9 P  : ;9 Q  : ;9 R<S : ;9 T : ; 9 U : ; 9 I 8V  : ; 9 W I X  : ;9 Y  : ;9 Z  : ;9 [  : ; 9 \ I 8] : ; 9 I ^> I: ;9 _( `4G: ; 9 a.?: ; 9 '<b.?: ; 9 'I<( 4: ;9!I $ > 4: ; 9!I &II!I/ 4:!; 9!I  : ; 9 I :!; 9!I!8 >! !I: ; 9  :!;9!I8 > !I: ;9!>! !I: ; 9! !!:!; 9! :!; 9!I8!% $ > : ; 9 I4: ; 9 I?> I: ;9  : ;9 (                 K0~.=.wY~.O%K~. AoAXtX /= "iG1eYsKt Y;/ r<0^f!b[uZY  zt_0JY o$*<K4K(rhXL @KEL z Xf hXX <XUK7vMXJ6XY  ' >'rhX @KELvz Xf hXX JX/U7vMXJnXY  & >&rhX AKzJLiy X fXX5XKW/Z<>=Mu TX2Y >3 Y V)  V)  VtX) YK YK YLv,>YYK <Y-)r<JX "X YJM:$'zPZ Y U*  U*  UtX*Y / =t. <YJ (y <wJ J'wX  XJLMcJ919z .y{Xo h <.+X^X< .+ S Y. t Y.  $?<zX }>:}<tM}g}J=X}eYsKt X Y}X}JK< sX Y}X}<K=lf !X/ 3X J   tX 4voJ k        s J <n <.<4 .oX b tZg<(f sfY<m+  t<K K +%X <t &Jt 0KZ ID  X< (. #X= IK ?[ <3%= XK IK s g.>]P-< ?X R_P^f <(uf<0.J  XX*|XmJ    u: 4<=NJ(= 1<L<> l<l<=N00l<<l<<%J. <%z. 4%z< f%w<NtXt X/J2WJ}tJY~<.JF0 +[0 f>>u$<2~J<^~.v$t,~<=y$J=~X,7?=h(=q0=(== $ [~~X <>YK Ea<4t(<<I [<~.~~)o'<)~JJ tpL r0e/~J.<uJ0  v. X0 f>>  Y= g JnX0 >> Ut p<K  X^#}t}.}<<}.g~..J$<$J<<tXXXf//&xp .'0$;/J=>~t<`J||',<'td<'<.`.K~J<J'X1 Avt$/J=>~ (b t<`f.`t< c a < . a.X'0$;/uhX.=kXI sYr==<`<J Y >xJ!$Z sX/q==e=<`<fk7%-Y;X/ <0^f!JaJ ]Y; [q=X0^f!.9k7%-Y;X/ <0^f!J~J'}.Ju=|^z<,}J't ft |<<Y(%#ugafK~..J !;= = ;YI>H/  atK$tg t (b<`J`Jt c b < f b.X '{.J/=  "=!Y Oo=r>k~t<`<.J.jX{,t'{< ft {<<Z(&s#u`f#<<u`u~..J  `t~t (b`J`< c a < . aJXffX<L > =  <<.f<_ yC [ Y K  tJl<,K X y<= KL = XX <}X [MzJ 1[zX z=  A< jX  << X XK J XXX<<<uYt@U \ w   tY  =s/ #lXltB / XX.2 K=Ae(=IN x<.kEZ  = ut!K: 3fv<  <v.= = sg{)#o| <<:< J=rxJ 38=' yK3 .3vtLt IQ  Jyt @8Z  = w=tsY  w LttgLL8> \J{lzJ[ = st L9f NX >XXQ.  XXq .w wtP ytJ ytJ yXv ({ t s<Y~ ~t | | f  |.X  ({  { ,Z ..fYzzt37 t KXJ5JJX5 h K . ftXtyt_XL ItJ6KsBeIX.6~ JK4XKXJ=JL2W,tN/sY/! Xy/ E!:.^E :Fn t: O+JX7XXK/WOS!s=\X?'m<!fmtftw=tux* t<.t>rvYz.ztw=z. <`J "ts0E])XJ4(t| sJt) sy .s  0tsJ| .  )IJ^ t  "ts0tf(s| sJt) Z X!$p?u!JsYs< tJu #!#q!?Js=s< u fJ f%qt3%t<X.,b< #j jt   jJt it itJ   <.ZfsXJJJX= ip YMg K<" iJKJ3   j J/ j XXfY.=v3~u3nu| fN U!> zX~ItYuu,'t< Xu +< u $ < f+<< g<<J attuuu at .  (c  c.ttA<  cXt< c t] tK  a<Y bp YMgt K<"  ~f= cXJ ..uX c f c<X J Jf<X) 9 Z)- +LJat|t =yX.lJ  `tt/tY att aJi =M  HK K KgyvXl.Wgy=CJ=. <CfX7 >r"/  `tt"Y! att aJi =  HK K K.$$Y =BtOtOt Jt eX=uYtK=uYtK ;u uYytZrv=uYYsuyXHXYyK=~]p| <  }<p f .z)Jh =qf X  K<-Z ,u $K.<iJ"ENG Jw?Jf =UK/=    L+}!mt<0  v&- =Jg1J px1Lt,,?#ft#.x~<  srtWrr.< vwX dJ< <...X <.  h VL }!H*ZH.rJ.X :V/H/hGrJ. $!YvwX r. vwX  }X}L9i0%Xqr.qt| < qJX ]p| Z }<p J .{ vXY'utw<. xX6i,,rtJ tYfbXJJY/J[f.qXg!Z!:L~  =- KW2uX  <Y   2JzzzJB2~f<`<..fX XwXWYX#[#mJ {X$%a.~  <JY vm+M'LXJX.a' XLtf <t<>K+MMXXXjp2t< TXɺ+< Tp YMgt K<"=+ T/;}/}X t  XXy vJJ5XJJX5 </ tJwbb<!f1fk>H* 6Jt<f pKXJ1Y > :uY w.f+vY A{ tXuuV oXJ+B.=<j* ?g:&BtJ=B$=XBt<=B$=XBt<=B$=XBt<=B$=XBt<=B$=XBt<=B$=XBt<= Z:Z0K#< / .t  =N%BtX= X]<.@- - ffKgIt  sX.!YzfB3 ,`'tJu.CX'Ju`c't <> Ap YMgt K<"=> A?UJt At><> Ap YMgt K<"=> A?UJt At><<t> Ap YMgt K<"=> A?UJt At><<t> Ap YMgt K<"=> A?UJ (B t=v7  Bt AJ[ =M u K K<-?J` t t Xt/" "Y &  @t<>t AJ[ =M u K K<*?J_ B=-uA,,?,f.#.x~.+? ;J.  Jxu;=tJV5fQ"u!&1JMN,1P&K!JXJ O"%;s<uؿ<tJY*$HWͿt<N,1JJXK!s=s< 4K4gcxJ! 3 ^   _tX   _tX<! ,x'J)m[f'tJx' F vu&K)^91Y.t = /J//x\t#X\#<"\ #\X=#   ^* .s<J8} t< VxXX = /m%g!0 H!8f 1 gt. F$:J.E.>XJ$ ..K<  ftftuJJ J3J &YJt-K=h!~ A <!~ft!~ VXXM.]A>t/, , v. <Lt tX.=3tYKu!tJYsYs< tJ4uw> X X3%Gz| fzf4-Y/=-! <! .' E<:X%F.~ : E  ּtt (Ҽ << Xl". ~EF!s!JsYs< tJ9 ~~= <vY?J t<+v< t<u:X< t<u:X<ft<"u%Ӿ KM. ~.,n/A VZH("u%oststs.s.. . (}  }t Xw< JYs<.= JY~   | |Jf . |fXf t }X.Q.</Qt+ ty   euK ~ Ysu ,'tgJ't ttg~fK {.KK{ X <|n t!t {J J{tX!t JtXtX1zl3.J ...St 'eXJrue,tJ'e ttL 3<&;tL#uHtt f7!<tNtKK 3VK4<s#'zl3(Jt ...Yt ,d'tJ[+ud,'<J'dt   h h. K w gXt gtX 2NfX h[ =M u Y YJ /.  fYX,v. .*X*)Xf#X#}X4X4XX["ovww ._w5[-gkDX   ~tee<. ~ -XYM>7r>.<Xv Y MqL w}X .FO 0t OJ'0NtJ  }XZ:L&JJJ<}. ^y'N 2t+V^X< (X/XtRtX<~fX8H}9f?/>t. AtXJ t w  tw  tw.X)ttX <ttX.f wX s.f .K u-YK#W~X $.X}X J> }XX J> tXL jXL ~XX J> XXuJfiYeK4W  L_y.CZ Xu. 0 v.1xtt1F.JJ .wXJt( E+t<XJt.tXJ<KJJY} Jt.tXJ<j} #:uxJXXX ~`,% tX.ys1#X ~.X ~<t~½~w½ r~X u~ lw.½Zl uv s rXuurui #u\t uubu#X #Xy#X" <iX$F$8@tZY 1 YX z|,a't<u.Sua' ftG8YL / XJ @u  3X/;zzJ&z/LYZQ>rtJ*Lr=uA<>8sAJJ>8At.>I=KX1 1 wcYt\tt f@ vXf)J!X#f>Xwg{y  .af zg .>gfY#  ^!  ^t!X ^!  ^tX!J XcXX; ^ !  ^t!X  ^tX! ~ k WX xXXaXy&XttXJztJyX W _ U. XvLHZeYtsguWYustu;Yttu;Yttu;Yttu;Yttu;YttttuAu/Ku|&z .wKu {  X.'w'@X  J#<}X&"zXZXYtu;YtKtY|"XLLL}ZXL|H"XL|.ZX <vXZzXZX zuW/9/]/" d/dYK9uX{ZX 1J%.} )!|zJ   aZXZXzY X[ YX 1'a,J.DX;tac'tcJ't rXqif0tf. f!{vJyJhKXrv0[.). r vV/~&ay&<ut.XnxDY<t IK0<K/ LzX,< 4  Q.< /C.[  Q.X%L Q.  QXYZ z< =z%!hK<3Jt<Lt <M{,[ I /XKW=>> JH:Z&JJ'.zX<++Y$9={)=+W+<$Y.3&{JXH;#<Y\v t- zXJ:Z&JJfK> (WI? t,-W0E.; &pXJXP{X  >~:Z&JJ*{( #K{> z /;<LXXo8 X  >~:Z&JJ5I5$| |#Xu{>W#y t X' >~:Z&JJS,@/ff2 |g|!X|J&>~<!}:Z&JJ  O0 O0  OtX0  O<0Y[rJ8t+GXB$/8t$G 7t0#f "wX/;K.* vX/;K)$VX!iUX. U  XUXs.s.s.s.Xr<!;56666yXyyyyyyyyyyyyyyyY/@ > z.?+1! ~Xk  << Xgu I<.7X~t G9.t    h.X J?  << X]X^X~fJ X  <J  XJ X.Hf+KlXX3X   f XsKX }t<< }X >A tXSv+%!zX.XJX.yXXtX.Q.</QtX f. Je  X ~u+zXZX JT2ff KNgzJtf.ftff KTgy.Jt37        Y8$*@Y...BXJl)t<3X .ut tu<Yp~"Z6#X=5"X=3 X=5"XK)XK'X= ~ u sYZu-/-F;*;tJ*=e[* }tXSJ<<8X  =tWgIu ~,}t st/t<<#. ~f}t ~ J~< tX Y;ZY yXJX ~,Jt  ![Y-Jtf* ~XfX~X ~ <}} tX} UZ Xu3XJYX~X$;J$=e~XttY;Z&Xf>Y;Z'gX<<<Xg;ZZ~XY}t fUY;uZ XXfMXX<<KY\JX..XXXyyXK Yz<Y VY!rYY0M>KY\JX..XXyyXKz<YYY!rYY0M>KY\JX..XXXtyyXK Yz<Y VY0LY[J<..XXJyyXK Yz<Y VY!rYY0M>KY\JX..XX  =8\yX88"x=z<YYY!sYY0JJXtX;Y[K w/XtxyXKz<YYY!sYY0MY[J<..XXJtxyXK Zz<Y WY!sYY0MY[J<..XXfwyXK Zz<Y WY!sYY0M<YZY[JX.XXXwyXKz<YYY!sYY0M>KY\JX..XXXwyXK Zz<Y WY!sYY0MKY\JX..XXXtv yXKz<YYY!sYY0MZY\J<..XXtv yXK Zz<Y WY!sYY0MZY\J<..XXu zXK Z7Y Y!Y0M>KY\JX..XXX<\tX777!u = =7YY!sYY0JXfqX>hWK[K  /XXN<zX8u 7YY!Y0MH>KY[JX..XXtt zXK7YY!Y0M>KY\JX..XX.t xXKy<YYZ!sYY0MY\J<.XX8X/Wt=YA<8gXJn FXxX :ffF<X :NB>ht y<YYZ!sYY0J@Y[Y\*L/ pX.s xXK Zy<Y VZ!sYY0MY\J<.XX8J^zX7!X01J<Rt /XJ f/z.Y1IXXs xX Zy<Y VZ!YYȂ0J; XXXY[WYX23MXJghX#XX.r xXK Zy<Y VZ!sYY0MY\J<.XX8J^zXz:J#f.IX=XJ f=WYt=,JXq xX BS ]Zp![yXg>MeY[YX@<MXJg_(f; eX/YqX .qxXK Zy<Y VZ!sYY0MY\J<.XX8JzXBz<='8X07JLX/XJnK YtXK$=J%KN$)I7XpXxX BS ]Zp![yXgLJ;M XY[Yx;MXJg d/<Ypl-X.oxXK Zy<Y VZ!sYY0MY\J<.XX8J^zXz8J#JJKX=XJ f='WYt!1/J XoxX BS ]Zp![yXg>MeY[YX@:MXJga&f; eX%/%YnXX . w.;  XxXnX=xx<!n=z<YYqYYL qXXY=.q  qM J Wu  ,b  O =T #N'fXYiw<+Xd$\t]-X.Y XKU3u -X f\t]-X.Y XKU3u -X f\t]-X.Y XKU3u -Xu I)tu<KItCu IOJX<t.~Xg X;}uZ~fJJ<LghJʞ<h9u<IAX XXlXXXX!X<fX`<fXX                 Y(x y t AX=< ݳt<X(Y<usJ.#ڴX/!XYtY#X<#c[X %WXf ޴hXg %fkg+Z"Vg"  Xп28 K;@t  j<Xq JZt#<<ZX btee<.(X"X:<[:H0VqXJXXX#u5[$huigjJXh5ug&K <-5rX C&  z    K  <Kt < Yg K< $X=Y~ ~ XJY"L<ZY ..-yXv<Z< < J.XBA.t)dXff;e.BZZ ..HBXg^f%X.XfԺ !!lS  y t   Y~ XKXX~  Xw wJ Jtw XZuigj(x t< y<<x xXtxxfY~< vJJ y<*XyXY{g= J.-Y. J..}#_y{yJCt[ {t^({{ <Yz~<{J}X{{ f {.X Y(Χ ӧJti9 wX< <Y~<zJX{ mtX< < ...XX Jt {H(è91 Xt< tYtŪ{ m~ JX + ] {j۬[ A ب <Y~<{JX{ mttX.Jt&6X&X!.Xt   XuXt y. u t tu X u t tu Xt X y < t1 .v. y./  X vJX pXu./ y.  fXy <t   ue=0Ƀ v. Y(v  v Y Y( tI<Yة/X( t 8KHJLssYYũ  [ u1­~~~ tJ(91 Xt< tYt{ m~ JX )h00f N {X[YXuX1t  oeX tu_ ]X tYt's\t;[XrrJ"~tXaX# tt-'X''Xc.V0pXV0`Xgey Ye&/&f~ yX XCt <qJXXlc Jc tc.tcJXp(n( #3X#X#RX,gkXX#kXX#  @J J tXJ tX<Xouv#Z'##X<XXkf~X,x<X]fX#XsfX0 X/Vt)'u~?G L V=tLH> .dZX }%uJuZX# 0W I=XX  J  J  J  J  J=#Xy#X XK5$%M%u5$5#Xn#X #CXKt~.~2XKe!MX2tMtt2MX2#Xh#XS#X#XKL3LtXX3#Xy#Xl#Xy#Xz#H-#Q&#x.#Xv#h #X#X Z u] f&=#X0$XX#Xx#X0#X(P.J % [J/LY"4X#OXIJ6IJ6I<J6ZY"*XXM<K#JL<fXYqtUtt<.*JUYL:YMGW[GM"UX*Y'INUt s<tX v3LX+++++7$+$XJv$XJ#X.Xq#X!XM$YY$ILv&YWP(Yg,KK\N1NwXJ yX<<|{ mXxtxt{Xz6J5JX5(_..MxXJ y<<|{ mXytyt{uWg$xt &<G& <X [ t$txX j~/X/W JeJtltt/]}/-/Y/6xtYZ   /tZ  t(JX.t?XE=W/XtL"[-xD-x.˭9[   /tZ :Y0/tZ t X L. EZ Ѱt[   k ;(ιXt<ȹtYg<. .w<vXHh/t0=<%1YWYX G[  X  /tZ r4Jt1YZJ. L. FY t[   /tZ t"=;X<J(yYs<zXfKzXZY'XXtt\ Y T<-XI&A d | tqJitYiYiftJ.X`#,fXyJ.X~##Xu5XtXteX?hvX<pJtft8\J ttX.O.|t.t<KwXtZ YuYX  WYYK 3"vVLP% VZSt<.4. z<J tL+J. &yJt.t<KJo#Xztg>Xt#Xx#XvD;FJ9FX9 KuKYX Y WYZ!E 9!< #Xy#Xa#X. z<XJ tK+J.|/d Ͳt](ƲzX<<Z~<{JʹҴJ LJX<tf.t&fUJxX'xh,t '#Xx#XqJt"Jf<XX<<~<zJXY#wJu G</s <CJXX   X qYYfYeYX?tt<.u~  D |dtgK. e~ !J!lS  y    f خtX J خJX <(Ҷ"uX~J.@?Yfv& O~ .t< JJX -X0X|$X3X==s=s<XXRX0$}$XX| IKXtJ"uZ,<s <C % HL JLY!]ݶX .tX(YXtYJs<.hZ_X f޳X}JX$$"I{L"~" It'IL#2Y. X .W.|'%XL'KeY" >XUXXXXO<.JtXttX t t X t< t.tB0XXX-#X#XN<.tX iX.>   u--o<zJ WX @ )/ >sX  `@w.< b\J / >!Y2-SX-.SXzt*fJ<tX Y =Ct;XJ.<tXXXgfY(]" ].t"A<eXt<etYu<X)]"] "<] "<..].X XJY*sZ!K[&< Y=M Y = KJ .XYf>I^k f aa ta .a.ta.Svt] D Y t gX"[st= <IX Yz .vt J Z Zv uuK> X!tKY;u <-Y n*;":=-g  K W. k#Y j2J Lz..9u<(9<glgX ..JrXS[J*< XyvXX/W /Zy=$==!/f$Xh"X ?YtvYL* 2Jt<.=suYf yXfJJ^tO w=-uYm* Jt<=suYfXz..t+JJx. u .zu v <-hg:0>\-hJ<Js=  [K o.uxJr.~t c   t ?<Z  tXu vXѦ !X/ dYYX'J  ]X"t ]J" Y<W=Z$X~Z %  YX t$XLZ} v   t}q]x"t<'</-NZ"%</X sY&LKXt'KWY!YYZ%FLZJZt[* $KXjg<Z~ J tw[X$tX t          X8Juv t  X ^uv .t f Zu X[ A5(v t su t f<u[ =M u K KJ ww <w <.wfX<vv ʦJJ v< f <Yv Juv ft v< f u ;uYvv. fJ f ݯv J ѩaJAP  ©ttg.<Y-/f  x.% .HX'6 J 6X] Y uXK@YMft  ft? uo ctf1T(ef tte g K<~< JI<J e~ !!lS  y X   f/1otXqJXg! t d~ !J!lS  y    ]Xft1;&Xw eX~ <~X~~ ~~~C.' u!~'$u%~.~.~~tfzfxF2 H8f/f Xt  t&! f=!Hh & d3f~X<[ >  t!!e<! f=!Hh{<}tJX[t !=M u u KJף#t JJXyg HK eu,tyrXJrt<gt|X tfttt͠tut̠tutˠtutʠtutɠtutȠtutǠtutƠtutŠtutĠtutàtutkt̠ˠʠɠȠǠƠŠĠà tJttttttt[st f <( v>u tK Z X f  ѥt . < ...}X6' cf aX~# 3  XX X )7  X~7:X[7CY oA/ i. tY XJ08=aK:=K.u <IlX%e.~%~ X<]< t!<]tJ" ^!<K_[ =M u K YJ! YF KX j(t t <v{ e | tJKY{ JmE  z    L  <J v{ !!lS  y    ]J tX ~J~{f9. |XJ  s.XfX Ys  .tYXXYuXXa ut pJO .Mq[` X(b teJX=J(!cX!tKYWYcX2(<   J)=bK=KK_t X .!Yc{ !X!lS  y    d{ !J!lS  y     aJXJ. aJXc%g.~%~ X<_<  `t<`J tN<J `[ =M u K K<b.b.c(b ttYsXYs=!fJ+"cX"KJZbX wotXz^  a.~dJ<J.dJX |~[ M"u;X3(XI(y teYzXYzX6@t X>E{ cX !J!lS  y X   X=PJ</XPt/X  G8%H.~%~ 8@?tx@  D |?'V<K'UwMSKqK2+K)2y< WZY"\Lt3LY<t3 y P<\/!W_X~JXLJ5J5]u&uX Jz{ mE  z Xf     < vt vt[ =M u K KJ vyt<x=E{ !!lS  y    X ~N[J =M K = K<1J J #X$&#N#m t{XJ1%T.~  <, <.u=YZ++J) tY  K W  e= X ,K\ %T.~%~ X ,X  J Z!{!yJ_t,{yJKZXj <u;Y& < t,t JX'X X</XTDtX!;;u9T-YX# RX#-XfR!-Jv(R.J % [X- Rt<- RX-Xw#M#mJ2%S.~  <- #M#m {XJ2%S.~  J-..Lu0,wcYv,K+Nt2<=YrLLX4J+L'<K  = W X% Z!h %R.~%~ X .8$gXX X<\b/=XJV LX3t:(L3<VX[th<X)M2 (L3W<VX[thc<X)L3%Q.~%~ /K#KHKXKL<3LX3M2  YfXLfwJJ<Y<=X2 yX5$z e | f %t<yXttY< _.*~{ JmE  z XX   L  <J {XXJnX. {XX  !wJ/ J W  O t w%y.~%~  ;uXi t(s t   vJ t< ZY, Jg1%JY*!uWY r JKq q  / hg is  P1.J.T(s t  qfs<ztw e |tJX X|{ JmE  z XX     < Y.!Jg3K&Y#YK Xg!t  yXtttJYX(s t |tt|X.f<YX_Y.!Jg3 K&eYLt  T'zt. xVX  Xwfz e | fxRtt<Yh ~{ JmE  z XX   L  <Jvttt.<Yh {XJXJk. . {XXJXf . %x.~%~ w. wtX r tus=#r   rtJ  g#=u  !u</ J W  O t  u    utt    /fR(r t <X?Xt{ !X!lS  y    Xr. (r t <X>Xu{ !X!lS  y    X~{rX (r t {t<{Xr  rtXe<YX5YKr   q%m% aXw X(z ztt fw<  <Y<Y yXfz Yg K<~< JIXJ|{ !!lS  y X   ]{|{ !!lS  y    ]J ...S{{ <{ <..{.X ~~{{ z.~< ..|.X } z < z X.. z.XXYz4zJ&J< <>$<]  ;\`JX`J (K4UXt*<UYhcJX*L3XƱXX/L3X f.oXLJ rL[ Xt^( ͪ<<p Yg K<"~fKX=X f-XHYz w <wJ J c<Zh(c<X?Y aJ Xe{ cX !J!lS  y X   d<XJmX eU<X xm[Yhc< V. b.~X{XX }X# .s<pt; r g  r< t'W [ rXJ J(m tIX<vKJK1p{ !J!lS  y    ny= yJ, D?t(m tIX:< tK~)o{ !J!lS  y    my=}˃. yXX J(n twtX<wtYu<`oXwoX_ XUJu XvtK.Y~JXOX rO% y= v+~+.~{mtmtX Jy< ._ m ~|XJ ...# {.tg({8 2Ye<|Xf=|XJ ..t< y.tg(y8 2Ye<yXf=yXJ ..tttYg<W .$ttYg<W6'$[ttYhc< V . ty< my<&o@,`vf8<  <sJ8< .!r[Xz ttKtuzX y f yL/  .. vt . tZH"H>fu f. u   zX v tt X  X=  / I= -Y vXg*f*J J Z < my<4#4JJ Z <(  ptX%z28z Y ZKYZ% Zt%U0s<Jt:vv Jt  ttvw t~v fvX <tZ(t<<XYuuto<XSs  q< J ZV> X=X<u4<A ^  YT,tgu(Yd< >d2Y +XL# KT+ j~T W* ( J ht| JJZ30=""nXftSX+!av    ,tVX(tX f          X    6<{X JKJ*tX]vXXXn  U<)~(V)YYYW=i Kv.ZW( ZX%%[.~%~ XX% uf JzXjKKKuX{ XcX !J!lS  y X   <XJ+ UX)VX)zJv:k# ttXrJ<U)VX)zX U~XX{J(1!    X tXX%OV %.~%~ X z~  D |+WZoJdt)KKo.$ V~ !J!lS  y    ]X7~ fti{ !!lS  y    Yj{ !J!lS  y    K.v=dY%"J g~1tk{ !J!lS  y    ]S~ Jrg K<~< JIXJ{ !!lS  y X   Y~<fX{J`tt<{  ;y<>$<Z<tt<>p YJrg K<"="XJ[u[B{ !J!lS  y    @Xo(Z tZhg<w.5=pJJl <']#J+F+JJ< JZ)c^6JH [(x tsJX=x <w g K<~eJ< XIXJ {{ !!lS  y f   xXtxX{{ !!lS  y    q[s<XgI<_uy<XX:( t ; eYAX>YAX>C{ !J!lS  y    X) ~JH?"IpX XJ¾X ~~<AtYJ`>Y%.~%~ j bYgYYLB t <<up Yg K<" u<K Yw<X/ KGX8<Y IK`GX8E0fp g K<" ܾ~X{X6yC.#| tX=/uT4 utX5(J5 J}ty ͻXOXJXpt )HxXtxXWx X wXX9%X 8|[XXXX]"[X ~J D;DX;F{ Xc< !J!lS  y f   ]<X C~vJJ<XHfT<St '#S#mJ,%Y.~  ' X<'k Xt<i" t<*f*tJXY< M9  yJ(";=(X&/(I=[}Xxf<:tt<IJ[3=& J~XtfL 4<}f X<~&:/JJYi3<X\g<JhX)X<[XL~<+fY=WK[J~ I;l;XXYJ<~X K  Y.u !< L!,]1XNX|  zJ<>JJ<xX|l.JJ/R YK-K Y%X.~%~ X( ^<<XX2 tKPJJ/Y/-=KR g K<~ J<iX X=  VK K KJ tX~.V(|<|Xf>|X)  tJK:uBKX !XX~ .u. u XX>Z6  <X %J.~  z JX< z~  D |t* YEJ:YKeYE.: ~ !X!lS  y     ~O? <,,JJ. Z.0 B5+-P IKyf5x<= f.TJJ<if\g=YOJX<tX. \~ tw$NvJX]X"&K.7J Xgu st <o fJ.nJJ gg r=Z X%Zg%a.~%~ X<Y tMX<&YXJ&[[ =M  ZW Wu = K<%.a 7J$.b7JKCt.37JN2<.P.(] t"stI<?tw$NuJ < fA J#r#m {XJ %x.~  <X . 3ɝ*<*KO!sMX f@ <( f1 . fLqXq.:hqqXhqXqtlq X  >g <g t.mtX  XXX~t{J{!|/ X W  O t| x|  xJvw<yZ(t Y<Xrt  fuX R#t#m {XJ %z.~  <<& &<!tA4A&J XsJ <#s# %y.~  < .,#+;#=!K#-(+G J'->> . <tJtr X AAK@f<&6XYuX  fXXJqtu   fxDvvzp YMg K<"7.(tg{''J<{t{XXX<< .yp Mgt K<"=<<>$Yx  XJ.X <NX|J{J< J{JX   XJXXxJfxJYX!KW(K, L,gy <hyXyHhxythx<yXHhxythL:vX KXX`t0twJfwJYXLV(L,L,gx <ixXxHhxxthx<xXHhxxthL:vX KXX_t2tzztP.. y. y<(y wXt<wyXXYyX/X3tt.f<` wf XzJYwXx)iXX..YXyXyJ< X.y.X Xs*{                Y0  uX$ d.tK(dz< BXf *et. e.tK(ez< BZft<<g l=eXf .$ f.tK(ez< BZft<<g l=fXf .$ f.tX=(f<gX<<h f=gXf .= T @tg)= T @tz>SA, t tXX/_= T @t/t= T @td)= T @t/f= T @t/Wt= T @t= T @t/ef= T @t/ef= T @ttX/hf= T @ttX/hf= T @ttX/gf= T @tf= T @tg= T @ttX/gf= T @t<0a= Brh > :X" HfA^= @x b/> :/h H<A = T @u s0T#= T @u&t ;d"= T @.u:t ;z"t #ff/XYi* =JV<<f.Vf<..ft=zBt;=m;.m<.g t/TJj KJX.KJX.X gW=XX  t!V- !Ytsuv ttW=v XF-YXuv '<v v4%vY*-Yv  vt f vtXX  v X v<% $sY$%%sYv  vtX< ! %$Wu%MK)k)=YYH=KL~<.<#1IJrf  XrX !t ug((2 ~ MW);fX;V#!vvX'tX X          XX< .v.gS<XM7.vtuY `b f bJ< . b.Xu gX yZ YuZ=[< X\,Kff  qXh#<Z<z1UMlztgl xtDt"_i:> mXJf]X%oV<X[g  gJ<  g X X~"%oV<X XPX%oV<X XX=sZw7VZXMM(a  aJ<  a.X .XU!t!? X! /d" X z, Y$u! xX##2"%K' w#v R"tg|{"N Y$fyQX#yG"~ I"N ,2g Z  J#<#|g yZ tW1xXyG"~ Y"N ,+Qx< y_ ytC9 Z  JU/xXyG"~ Y"N ,cQx< KZ  xL x X /<y KZ.] y_ ytC9 Z  Jt.|VV.|fX  w.X/ ' w MUh tKX [ wf  XX   wJ /. ttt.t .tX!W  r< XX<= r X JLh  qJf m~MJgeK  qXL q X /<R JRhhZXXJX  n.X  n<, n X3 Jx99t4op/ t m  /J etX4sN vJ   YzX fXi | X<YX~t<~ ~ /|f Xw wJ w< X=J7XJ3f..~XJ. JJ._'BYthXk  ts<fX.XuX|%.~  <~$Jt1f | + X p  9gt}X !t W=}X~*  s KJ <} X  }XX ?zz J,"uX "vzq ttXO n#KX~f<pXfg} }t }tX<$ |$ {X + fX p  eM$#/pjJ E < v Y y  XJ   ; ytX y<& .t<Zv uX )h< <&h<.5h&J ! Z<.h= L <|*|  |*. t|*   }XXX5h& |ւXXJXm uzJKK"YI=X=X=t |<XsX |< |<  X  $u}X~J}tX t          XLM X JX!WAa/>V= m XoxJI"TYsJ Js sX \s s s Xs JsX X( J$  gXX gxX`x<6xJ ts<=/ %j.~%~ tXXX< f*  gft:ZZ:[(d ttt<e.f* %&eXfS,r.J XJr<J.wY $hxX`x<6xJ ts<=/ %j.~%~ tXXX< f*  hft:ZZ:[(e ttt<f.f* %'eXfS,r.J XJr<J.wY 'ixX`x<6xJ ts<=/%k.~%~ tXXX<g*  hft:ZZ:[(e ttt<f.g* %(fXfS,q.J XJq<J.vY 'ixX6x<6xJ r<>/%k.~%~ tXXX<h* . ift:ZZ:O[(f tgt,g* f &vf J. kY ety tw J'[=-uX=Y* }Jt<t"f ~f .tf^.X  dtZ* }/  dtY* }5<<fs.sfsf9y CtZ]JqJ/Xr Z(ufti PJz=jJ,F<8LKY:Kt~K* ~X,usY{qt!* .?YYfX =CtO T=uYvX  ? <[[-yXJ X X f5yX&?/u Z:<>f <nȬ"w <M  =Ytur IXtW=r X)otofJgYo X!t  ug(J. ttL)trf 4 M-~JfJ XX.1+ jtt/js[.< 4J L Jf . ft< <. f.X'7< @t. tXxX  lJX  l <t>X l  lXm&tnXXtxof<xjF9t5#sgX 4Mv!  vX!   v ! < v X  xtxt (w tt &J K<  /XYuxJfYxX v   X  9uX  yX<XxfX>J wtwt (w tt Y&J Y<Y  0Xguw X  {X  pX{!Z p XzX99 fJ V>g Xt  xX  x <" x X  xXYz/   xt< x X t   wX # w XXtz :Z }(}.K Xv  rXy! r X |J99 f.<X&Ju(n |X  oX|$ o XyJ99 f.$ VL)!X* <=53sZ" Jx" oJ  ^"XJX    o<m  . uYt/HuptW=pXvYKLL#1WJim.Zmt sX!t ug( ~< X~8$tJLtlt<$;KYGi/ X eX l st ) J.zs  st  sX !X9{  y< v. UX y tX xJ fY xXX xJf Y xX>X ~Jx XJu XX WfUf !tXgNK #X3Zb bt bX-xJ fu  fd?tYguYet tX OttX g%\t]-X.Y XKU3u -X  Efyt   ~X Aif. . w. tOu  u  utX !(nJ  ~.  Xh ]f&Xt  FX"ff ~tXY~Jt#  Xtt v:Z  X2.KgZi  iJ<  i XXKgZi  iJ<  i XX x  <\    Jx  J  J  .  u     .v X `h m hXs *# 9xXh  l"!!lSy t  Y ~XKXX ~6X0'XJ2JJfi}NtutX[ػ ~f:?T|Xr#[   YJ}$PX/PX|Jk.Y|jXX>KJ.}XYJ|Xf|XA~t~f|  1$YJ~ ~  |"7><<x | J|YX} vx  o 'dZ'Zr'dZ'Z=X'Y.?sX JN</(Y5vMZz<XM] frZ2\)xX *(W;;X\ X#wXXJt :X jgt.ff=e.fXyfrXi%Vo /%WHhYsZ4.(hJX.5YbMY[#eKh. ht htX0Oo  t :X X 9z .9| y.X  g w wX vH0  X Xz t y  . z X X~ toX  ttXQJX q vH0 nX 9yXhX tzXXfXgXf wXsg ~tXffKxXtf.gXAXfXt|(>( @(8v rX v wX xX wX hH0 Xg         Y tAA%.~%~ yZZVKIK {( t~u} .X YA$Y)<g |J bX .(;hr._ |.X  J~ty7J%(%~X<t$*3~ ..ctu~}Y!LZ'se/(X~)XO~5XX  .tCyKFI ,8 Y ABE 4_FH _ABO$RJC$>Jo["LKBB I(A0A80A(B BBB<FAs AE V AE $;X^$!%&)<KID A(l  DBBE 4kKKC JABLKID A(o  ABBE R ABBJKBB B(A0C8G@ 8A0A(B BBBE o 8G0A(B BBBE  8T0A(B BBBE ,:FA E  E t GBE B(A0A8Dp 8C0A(B BBBE ~ 8D0A(B BBBE $Xp4jJAP AE CATXBB A(D0}(A BBBJ0<LKFD A(Y  CBBE  ABB4NKDF qABTfKBB B(D0D8Fh 8A0A(B BBBE $hDKBB H(A0a(A BBB$5Jc<KDC G(q  AABE (",JEA<KED C( ABB$T($,J]TGEB B(A0E8GHe8D0A(B BBB,sJA\ AE ,U AE <:GBA A(% ABB$(4JRH AE [AlGBB B(A0A8Gt 8C0A(B BBBE |K^B$DaGGA A(G (C ABBE $\KBB B(A0A8D 8D0A(B BBBE $TKBD A(  ABBE |  ABBE $(,JAA\KBB B(D0A8DP= 8C0A(B BBBE <PXXPXYPX\P$J E DKBA A(DXR (A ABBE <KBE B(A0A8FHDLH 8C0A(B BBBE TKBB B(H0A8J@B 8G0A(B BBBE d@ 8A0A(B BBBE  8A0A(B BBBE TKBB E(A0D8G@N 8A0A(B BBBE $@TKBB E(D0A8G@L 8A0A(B BBBE $@x L6GED D(f  ABBE 0U8F0A(4(  HBBE 4YBKD yHB4YBKD yHB4YBKD yHB\4GIB H(A0D8GA 8A0A(B BBBE $Y<[CR AE sAODKED A(G` (A ABBE DKED A(G` (A ABBE LKEE D(A0Gh 0A(A BBBE DKED A(G` (A ABBE DKED A(G` (A ABBE DKED A(G` (A ABBE DKED A(G` (A ABBE DKED A(G` (A ABBE LKEE D(A0Gh 0A(A BBBE LKEB D(D0Gh 0A(A BBBE DKED A(G` (A ABBE DKED A(G` (A ABBE DKED A(G` (A ABBE LKEE D(A0Gh 0A(A BBBE DKED A(G` (A ABBE DKED A(G` (A ABBE DKED A(G` (A ABBE DKED A(G` (A ABBE TKEE E(A0C8Gp 8A0A(B BBBE TKEE E(A0C8Gp 8A0A(B BBBE TKEE E(A0C8Gp 8A0A(B BBBE LKEE D(A0Gh 0A(A BBBE TKEE E(A0C8Gp 8A0A(B BBBE D KEA A(G (A ABBE LKEE D(A0Gh 0A(A BBBE LKEE D(A0Gh 0A(A BBBE LKEE A(C0Gh 0A(A BBBE TKEE E(A0C8Gp 8A0A(B BBBE TKEE B(D0D8Fp 8A0A(B BBBE TKEE E(A0C8Gp 8A0A(B BBBE LKEE D(A0Gh 0A(A BBBE LKEE D(A0Gh 0A(A BBBE TKEE E(A0C8Gp 8A0A(B BBBE LJKEB A(D0F 0A(A BBBE TKEE E(A0C8Gx 8A0A(B BBBE TKEE E(A0C8Gp 8A0A(B BBBE DKED A(G` (A ABBE \GGE E(A0A8J 8A0A(B BBBE $>DKED A(G` (A ABBE DKJD A(Dc (C ABBE $@DKED A(G` (A ABBE \NKJB B(A0D8L 8D0A(B BBBE $>DKED A(G` (A ABBE \rKBB B(I0F8J 8C0A(B BBBE $>DKED A(G` (A ABBE \JKJB B(A0D8L 8D0A(B BBBE $>\KGB B(D0A8Ga 8C0A(B BBBE ,JVpl AE x ,YFHEA,ebIDGIB D(C0q (D EBBE $04/BDD ]ABdGBA A(e  ABBE I  HDIE |  ABBE L(r  HIBE I  HBBE   DGBD H(J (A ABBE ,[mdL4FGKHHHKT AAE PD4_BB H(A0(A BBB$u0TTTIA A(  ABBE A ABB$(,rMX E CdDqEB L(D0G8KX 8A0A(B BBBE L\GJB B(A0A8G 8A0A(B BBBE $,JEu AE ,[R E O\XBB B(D0A8 0A(B BBBE B4PH` AE n AE $OA<KEA A( ABB4$!JRO<FMq AE ^ JJ <xGED F(X ABB,UGEE A(DpL*p (I CBBE s (A ABBE ,}GBD A(4(  ABBE 4GFA tAB-4nFMl AE NQ$!A[,ADSADeGBI D(G0k (D EBBE T0c (A BBBE A(D BBB$JGBB B(A0A8D@O 8A0A(B BBBE P 8D0A(B BBBE D 8A0A(B BBBE [ 8A0A(B BBBE d@] 8A0A(B BBBE K 8F0A(B BBBE :$tGBB B(E0K8D@ 8D0A(B BBBE A8A0A(B BBB4~GAD dGBDGBI A(G0W(D BBBD<GBI A(D0(A BBBLKBB A(A0Dx 0A(A BBBE $+xDKBA A(Dp} (A ABBE $+pKEB E(A0A8DPp 8C0A(B BBBE R 8F0A(B BBBE  8F0A(B BBBE $1PB2,TJACA4*A OE AOL|GBB B(A0D8V0D(E BBB$$8$WKAA ,Q R ABE ,sKBA A(4(Y  ABBE ,@KAA D(4(S  DABE 4dGAH IDB<bGIA A(F ABBT)GBB B(A0A8GH8A0A(B BBBDQAA S ABE J FBE  TGBI B(A0D8o 0A(B BBBE tiGBB B(D0D8G@I 8A0A(B BBBE  8A0A(B BBBE $q@dKBB A(D0 (A BBBE A (C BBBE $ 0t,GBB A(A0Z (A BBBE r (A BBBE o(A BBBL]0O (A BBBE d(E IIB\GGB B(A0D8J 8D0A(B BBBE $x$BoxGBI A(G0 (A BBBE A (D EBBE Y (A BBBE A (D GBBE GIE I(A0G8 0A(B BBBE e 0D(B BBBE A0F(B BBB$Box$BoxT3GBB I(A0G8G@ 8A0A(B BBBE DGEA D(D8+ (A ABBE $P8lGBB B(A0A8, 0D(E BBBE A 0A(B BBBE ,8H@_8lKBB B(D0A8G@HHPR8A0A(B BBBE@jGEB B(A0A8F`] 8A0A(B BBBE c 8A0A(B BBBE  8F0A(B BBBE y 8D0A(B BBBE d`\ 8K0E(I BBBE D 8O0H(B BBBE <FHh AE W AE dKBA E(V  DBBE T  DBBE N ABB,(d0F(KBB B(A0E8i 0D(B BBBE [ 0D(B BBBE  0A(B BBBE ,8_@H8lYBB B(A0D8[ 0A(B BBBE E8\GBB B(A0A8Dpm 8A0A(B BBBE Dp  8D0A(B BBBE TKBB B(A0D8 0A(B BBBE \GJB B(A0D8L 8A0A(B BBBE $<KID C(s  ABBE $4(6GFG B(A0D8c 0A(B BBBE F 0A(B BBBE 0A(B BBBlGBB B(A0A8D 8A0A(B BBBE DGDI$dGEB B(A0A8GBQ 8A0A(B BBBE $\GBB B(A0A8Jc 8A0A(B BBBE 4GjQ,Xi E NGTKBB E(A0A8 0A(B BBBE ,dP E FNTKLB B(A0D8D@ 8A0A(B BBBE GEI A(G0 (A BBBE A (D EBBE Y (A BBBE A (D GBBE tGFE B(A0D8DH 8A0A(B BBBE 8A0A(B BBBlBPBB E(A0E8 0A(B BBBE DE8KEB B(A0A8GhpFxLpAhpZxFgh{ 8A0A(B BBBE pVhgpHhJpYxDIh$h\GBB B(A0C8Q 8D0A(B BBBE $gDXKIE D(A0n(A BBB<MKIA G(g ABB<MKIA G(g ABB11<T(GGB F(A0A8Q8A0A(B BBB4^AG ABtiGBB A(G0o (F BBBE ^ (A BBBE U (A DBEJ <KED A( ABB4(A FEI$RKAA , Y ABE DSKBA A(DH (A ABBE $0H\ KBB B(D0E8G  8A0A(B BBBE $H 4sJE{ AE ]A4sJE{ AE ]A\KBB E(A0A8D`h 8C0A(B BBBE 4`Bhb`\hQ`lKNB B(A0A8GX'`EhBpBx\X 8D0A(B BBBE lKBB B(A0A8GPTXTP 8D0A(B BBBE XB`BhHp`PdKBB B(A0H8JPGXB`BhBp_PM8A0A(B BBBdlKEB B(A0D8DPXA`BhBpQPo8D0A(B BBBTYNK ^ ABE D ABE AFBDJPS AE D AE AFNtHKIB B(A0C8G@h 8A0A(B BBBE  8A0A(B BBBE $@4^KAE EABL tXBE A(A0E (D BBBE A (A BBBE T(A BBB\KBB B(A0A8DX 8A0A(B BBBE $iXKBF B(A0A8G 8A0A(B BBBE JHHIlBHHI$$J\ E \ KBB B(A0A8GR 8A0A(B BBBE d  8F0A(B BBBE  8D0A(B BBBE T. ^DB B(A0D8DX 8F0A(B BBBE ,X `gXx $!A[<GAD GS  AABE ,fd,PAKwHTGBB B(A0A8GX 8D0A(B BBBE $XDaGFD D(D0}(A ABB$0<KEA A(x  ABBE LKBE A(D0~ (A BBBE \QKBB B(A0A8D 8D0A(B BBBE $\KBB B(A0A8G" 8C0A(B BBBE $S\XKBB B(A0A8G 8C0A(B BBBE $\KKBB B(A0A8Gh 8D0A(B BBBE $`h\9KBB B(A0A8G 8A0A(B BBBE $,JEu AE LVFA D(`  ABBE g ABB$_(<KBB B(A0A8DDv 8D0A(B BBBE TEI H(A0D8GhEhH 8D0A(B BBBE  8D0A(B BBBE Dh8A0A(B BBBLKBH A(A0G8\ 0A(A BBBE ,8m@V8LKBH A(A0G8\ 0A(A BBBE ,8m@V8KBB B(A0A8DP] 8A0A(B BBBE c 8A0A(B BBBE I 8D0A(B BBBE 43PKXE`]XAPx N4vKHG TAB4KHG AB4KHG AB4DKHD eAB10E-1.-0.....00.6HhYHhY288!n!4YBKD yHB  \GBB B(A0A8Gp 8A0A(B BBBE $p\KDA D(D8S (H ABBE Z (D ABBE \3KGB B(A0A8G 8D0A(B BBBE $DJKD(I DAE T HAE 4oJKD(C HAE ,@(q DAE 4oJKD(C HAE ,@(q DAE LKAH D0X  DABE T  HABE $3JbTGBB D(A0GO 0A(A BBBE $D-GGD D(G (A ABBE $i4FND] AAE +T{GGB D(A0J 0A(A BBBE $<3GFA GP  AABE Pj$TGBE E(E0G8D@L 8A0A(B BBBE D@ 8A0A(B BBBE d; GBB B(A0A8D 8A0A(B BBBE qp\BBNYEMGBIGG\FOJADDDDDAAIZ AAE +LPHF A(D0  (D BBBE LPHF A(D0 (D BBBE LPHF A(D0 (D BBBE LPEF D(D0 (D BBBE \\BA C(M  FBBE  ABBO(DxKEj KL H AE $/J`$QJ\ E a$IJz\KGB B(D0A8I[ 8A0A(B BBBE $TKBE B(A0C8S 0A(B BBBE $84mJAD(R AAE P(lKDE H(A0G 0D(A BBBE L 0A(A BBBE $+dGEB E(D0I8J 8D0A(B BBBE  c$$gJS E :,nJDZA$CP\ E Ax 4GDA AB,o h HBE 4JAG( AAE (LgKBI A(A0JH 0A(A BBBE $aH\KIE E(D0A8J`" 8A0A(B BBBE $`\KIE E(D0C8J`" 8A0A(B BBBE $s`TlKIB E(D0C8JP 8A0A(B BBBE $[Px \GGB B(D0I8I 8A0A(B BBBE DKMD A(Fz (C ABBE \KGB B(A0D8G| 8A0A(B BBBE $x &6,NJFq AE , 4JRG` AAE J`startparentlookupkernel_siginfostart_scan_sigpoll__compiletime_assert_109SDEV_CANCELkill_sbMaxTargets__bi_remainingnum_bugsnr_requestssecurity_supportedadapter_reply_queuestate_entry_ptrmpt3sas_base_get_msg_framestatssg_localactive_baseschain_depthDEV_DMA_COHERENTswap_slot_free_notifyunsafe_warnconfig_cmdsmpt3sas_base_get_smid_hprstart_databoolbv_len___GFP_RECLAIMABLE_BITinquirymodsctimedestroy_inode__init_waitqueue_headfutex_pi_stateSL_WH_EVENT_TRIGGERS_TBoardTracerNumber__compiletime_assert_127i_mutex_dir_keyrescue_workrestartsASCQdevice_physical_location_vertical_positionget_aclset_aclrdpq_array_enableMpi26DriverTriggerPage2_ts_voppercpuLengthpci_dynidsdescpoll_bioiterate_sharedsym_vdso32_sigreturn_landing_padcma_areafeaturesdelayed_sc_nextrcu_tasks_exit_cpumigrate_from_cpubd_size_lockwriteerror_codebuddy_listldt_structSASNarrowMaxQueueDepthcred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_nameVTIME_INACTIVEeh_target_reset_handlerclass_preempt_is_conditionaltimeout_base_readlSecondaryReferenceTaguring_cmdshrinker_idnr_dirtiedgetattrsetattrsystem_long_wqdelayed_event_ack_nextPageVersionfixupblockMQ_RQ_IDLEdevtlast_cpu__UNIQUE_ID_max_sgl_entries594_base_put_smid_scsi_ioEventMasksprocdirnr_wakeups_localuidhash_nodeworker_privatepoll_eventlinelinkbi_poolMpi2FWUploadReply_tphysfnbi_cookiePageAddressmode___GFP_NOWARN_BITatomic_setport_table_list_sas_nodecookedEnclosureLogicalIDnode_idtargetget_nextdqblkrcu_tasks_idx_base_check_and_enable_high_iops_queuesMpi2EventAckRequest_t__ret_do_oncejournal_infobi_inline_vecstqheadlast_used_atrq_end_io_retsensehres_activemod_namenotes_attrsdelay_workblock_device_operationsoffset_ctxbi_blkgFREEZE_HOLDER_KERNELlast_switch_timerphywakeup_countwait_indexsystem_freezable_power_efficient_wqrunnable_weighthostdiag_unlock_mutextarget_busymax_msix_vectorsclass_releaselast_sum_exec_runtimedd_key_truesa_handlercg_listscsi_transport_templatelocked_vmqueue_rqaddressmq_hctxDefaultstart_timezone_wplugs_hashcookielistpci_set_drvdataRequestCreditWORKER_DESC_LENreply_free_dma_poolsig_okpci_save_stateextabledma_data_directioni_sizeentry_eipsplice_pipexstate_headerinquiry_lendma_addrAddressReplyem_perf_domaind_flags___GFP_HIGHMEM_BIT_large_mapcountfill_in_last_segmentpid_namespacelive__list_add_validclock_was_set_seqspc_warnlimitseqcount_t_MPI2_ADDRESS_REPLY_DESCRIPTORmin_flt__condblock_devicelnkstampt3sas_check_for_pending_internal_cmdsMEMORY_DEVICE_GENERICpkruprojid_tvendoratomic_add_unlessdma_lengthkey_payloadsge_addradd_linkspinnedSCSIIOsubsys_datause_10_for_ms_dummy_bndWQ_FREEZABLE__WQ_ORDEREDMPIVersion__param_mpt3sas_fwfault_debugmpt3sas_ioc_listsaved_stateparent_exec_idutil_sumdd_key_falsesigvalmpt3sas_config_get_bios_pg2mpt3sas_config_get_bios_pg3fsnotify_mark_connector__ubuf_iovecsize_is_constantcputime_atomicdeadlinereset_methodsbio_integrity_payloadlun_in_cdbexit_requestwait_queue_base_send_port_enable_upperclass_write_lock_irq_is_conditionalswap_readahead_infovtimereply_post_free_szexpecting_cc_uas_rootNvdataVersionstack_refcountgrpmask_find_first_bitpm_caps_remove_countlru_genwrite_newack_requestuser_namespaceclass_rwsem_write_is_conditionalpids_active_resethlist_node_base_check_for_trigger_pages_supportblk_features_tsuper_operationsautosleep_enabledwrite_file_infoload_sumresourceaddress_spacecpus_maskdl_yieldedstarget_data_MPI2_SEP_REPLYfile_disp_base_put_smid_defaultread_newd_spc_softlimituse_10_for_rw_MPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTORkrefSecondaryApplicationTagrseq_css_lock_keybuild_zero_len_sge_mpidqi_flagspdevmq_ctxjump_entrypi_top_taskDoorbellpacct_structRPM_REQ_RESUMEreq_boot_deviceuser_sizeMPT_PERF_MODE_DEFAULTis_aero_iocmpt3sas_wait_for_iocats_caplast_queue_ramp_upRMCInterfaceVersionbd_statsMpi2SystemInterfaceRegs_tshow_fdinfoFAULT_FLAG_MKWRITEput_budgetfadvisebase_alloc_rdpq_dma_poolclass_read_lock_irq_is_conditionallinenoMODULE_STATE_LIVEtask_listasync_scanpci_cfg_access_unlockFAULT_FLAG_RETRY_NOWAIT_qprocread_foliosc_data_directionhas_elevatordq_countvpd_pg0nlinksignalshutdown_latencynr_wakeups_passiveself_exec_idstate_syncedws_activebuffer_iomem_physf_epsriov_set_msix_vec_count__this_modulercu_specialscsi_device_handlerentrybackWORK_STRUCT_FLAG_BITSd3cold_allowedcntsrequest_trackersock___GFP_THISNODE_BITsdev_bflagsdispatch_fromWORK_STRUCT_PWQ_SHIFTis_driver_loadingmq_freeze_wqstart_prevent_time_base_wait_for_doorbell_not_usedVersionStringOffsetpgd_tMPI25_SGE_IO_UNIONchain_lookupsigset_tMpi2EventNotificationReply_tHighPriorityVersionOEMRDbucket_idchain_dmaSL_WH_MASTER_TRIGGER_TMpi2BiosPage3_tgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64__list_del_entry_validi_inoserver_has_tasksout_fail_killi_spc_warnlimitbuild_zero_len_sgeunderflowf_poschain_end_physperformancesoftowner_trapnoload_weightio_windowsymlinkclass_rwsem_write_try_is_conditionalkmalloc_noprofbd_queuein_iowaitDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclpci_find_capabilitybdi_writebackrb_leftmostbug_addr_dispmigration_pendingscan_mutexhosttd_realchain_virtMaxSasExpanders__msecs_to_jiffiesdevice_get_match_datahdr_types_max_linksMpi25SCSIIORequest_tscatterlistscsi_device_busythread_headdata_in_dmaacquire_dquotclockid_ttarget_destroyzone_capacityirq_poll_completeFORTIFY_FUNC_strlen_base_config_dma_addressing_MPI2_VERSION_UNIONpref_64_windowpgdval_td_manageshost_recoveryNumberOfPortsSAS_SATA_PORT_SELECTORmfg_pg10_hide_flagmax_device_blockedback_padMIGRATE_SYNCdiag_trigger_activewcharRQ_END_IO_FREEHCBSizeseq_fileulongrestoresge_sizeHPROBE_LEASEDSystemRequestFrameBaseAddressBoardAssemblyHostInterruptMaskATTO_SAS_NVRAMthaw_superis_managedalt_len_MPI2_DEFAULT_REPLY_DESCRIPTORseq_operationsfallocate__rem__ret_call_addrfree_chain_list_MPI2_BOOT_DEVICE_DEVICE_NAMEi_mmap_rwsemundo_listwake_up_processis_probedattribute_groupdma_poolspersonalityprintk_index_sizefunc_strSAS_SATA_SPINUP_HOLDscsi_sglistMPI2_BOOT_DEVICE_SAS_WWIDmsix_enableMPIEventTriggersuprobe_task_statestimestatic_prioMpi2ManufacturingPage1_ttmpfiledqi_formatnvcsw_nr_pages_mappedfrequency__compiletime_assert_39finish_waitmpt3sas_base_scsi_enclosure_processordev_pm_ops__kmalloc_indexirq_poll_scheduledalloc_hintsense_dma_poolblk_mq_ctxno_updateiter_type__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_44DEVICE_PANEL_BOTTOM__compiletime_assert_46__compiletime_assert_47__compiletime_assert_48__const_udelaytransporttreply_post_host_indexMPIEventCodeusleep_range_statenr_wakeupsenabledirqreturnki_filpmultiple_queueswork_func_tpp_magicfpu_state_permGenericFlags0barsfwnode_reference_argsdevres_headbus_listdpc_rp_extensionsscsih_cb_idxioc_stateRPM_REQ_IDLEfilenamebase_dest_lend_pruneDiscoveryStatusrestore_noirq_MPI2_SYSTEM_INTERFACE_REGSsysfs_registered__kmalloc_large_noprofrlockPCI_IOV_RESOURCESsas_node_locki_rt_spc_warnlimitqueue_MPI2_SCSI_IO_REQUEST_DESCRIPTORdevice_remove_in_progressbytesnuma_migrate_retry__param_max_msix_vectorsMEMORY_DEVICE_COHERENTenclavefilterroot_blkgd_revalidatesystem_power_efficient_wq_MPI2_IEEE_SGE_CHAIN_UNIONtracepoints_incoredqsMPI2_SGE_IO_UNIONi_opreplyPostRegisterIndexquota_syncsrcu_have_cbsasync_in_progresssignumdqi_dirty_listpi_lock_base_get_diag_triggerstimespec64main_chain_elementscan_finishedcpu_addrqueue_delayed_worknr_forced_migrationsumount_begin_MPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTORchannelbadblocksblocking_handlesport_idkernfs_node_MPI2_DEFAULT_REPLYkobject_namearch_atomic_readcpumaskptrace_messagelength_boot_devicenvramtag_listbio_alloc_cachepdt_1f_for_no_luni_wb_frn_avg_timerequest_irq_pincountreclaim_statedrv_internal_flags__irq_apply_affinity_hintruntime_errori_sb__poll_tsubvolon_dispatchdirty_inodesymtabd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structfs_parameter_specrcu_data0real_blockedruntime_suspendsysinfo__s16EncapsulatedCommandLengthDMDReportPCIebacktraceoffline_alreadys_umountHostTraceBufferMaxSizeKB_src_lenon_listNvdataVersionDefaultIOCLogInfo_MPI2_CONFIG_PAGE_IOC_1_MPI2_CONFIG_PAGE_IOC_8__param_max_sgl_entriesdata_vmneeds_force_resumeblk_eh_timer_returnFunctionsas_device_init_listcmd_creditrpm_statusCoalescingDepth_find_next_and_bitscsi_host_state__s32rep_nopTK_OFFS_BOOTMPI26_HASH_EXCLUSION_FORMATp_sizechildrencheck_eventsdqi_bgracei_wbhost_nof_inodeserialburstaer_capscsi_target_statehostmsi_device_dataMasterTriggersslave_destroykallsymsi_ino_timelimitinit_timer_keybi_issuebd_holder_opsmpt3sas_base_detachphy_masksrcu_idxSTARGET_CREATEDutil_est__s64mpt3sas_base_sas_iounit_controlhugetlb_usagesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenacct_rss_mem1___orig_eipsrcu_datadevice_physical_locationchains_per_prp_buffer__keycgtimepagefault_disabled_base_put_smid_hi_priority_atomicindexsgl_flagsMpi2ManufacturingPage10_tissue_diag_resets_time_max__mutex_initdelayed_workraw_atomic64_add_returnopen_partitionssa_maskmmappedMPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORbase_is_prp_possibleElf64_Wordactive_timeatomic_flagscallernum_jump_entriesextra_lenPIDTYPE_PGIDpci_irq_vectorelemend_ioquotalensrcu_data_have_cbsnivcsw_tidioc_pg1_copymce_vaddrMPI26_PCIE_IO_UNIT1_PHY_DATAdl_dev_statechain_lengthshowrb_subtree_lasts_listadd_busunique_idmq_pollnr_segssame_target_siblings_base_assign_fw_reported_qdof_match_table_entryino_timelimitparent_devirq_poll_disablecpu_numberMpi2PortFactsReply_tSDEV_EVT_SOFT_THRESHOLD_REACHED_REPORTEDalternative_gpt_sectori_readcountblkcg_polsincrFastPathSCSIIOfreepasid_enabledmpt3sas_base_validate_event_typelock_countthrotl_datareply_dma_max_addresslist_lru_onei_pagesmxcsrWQ_POWER_EFFICIENTrom_bar_overlapclass_rcu_is_conditionalarchdataptrace_entrydata_out_szguest_permwait_queue_headnum_srcu_structsLinknr_activeprev_sum_exec_runtimei_flagsgendisku_flagstag_set_listmpt3sas_atto_validate_nvramlogical_block_sizeSDEV_EVT_MAXBITSinvalidate_lock_keyinfol1d_flush_killMPI2_IEEE_SGE_SIMPLE64phys_addrwrite_beginSHOST_CANCELwrite_infohrtimer_restarts_encoding_flagssessionidd3cold_delays_time_minWORK_STRUCT_PWQ_BITvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrs_stack_depth_base_get_chainFlags__vm_flagssdev_statequeue_depthinternal__dummy2_base_fault_reset_workmpt3sas_port_enable_completepm_messagefred_cschangedcur_ktimeinit__compiletime_assert_612mpt3sas_ctl_event_callback__param_smp_affinity_enablefop_flags_tgroupsmpt3sas_base_make_ioc_readyoffstty_structnotify_nextvirtual_dr6dma_opsreset_wqMpi2SepReply_tdma_addresslast_cpu_idmmap_base__compiletime_assert_623bd_devsyscall_workinit_cmd_privcpumask_of_nodeMpi26DriverTriggerPage3_tlockdep_mapnum_trace_evals_addr_bnd__compiletime_assert_633set_dbd_for_msnumberzone_device_dataquota_readvolnamepinned_vmrevents_MPI2_SGE_SIMPLE32writepagesnuma_faults_localityqrwlock__write_overflow_fieldmpt3sas_wait_for_commands_to_completeNumMPIEventTriggerrw_semaphorefirst_minori_blockstask_fragTimeSyncIntervalsource_listsum_block_runtimeHostTraceBufferMinSizeKBioc_reset_countnuma_scan_period_maxtotal_timepowerrequest_queuenum_ei_funcsi_generationSAS_LINK_RATE_3_0_GBPSflushonline__param_msix_disable_MPI2_CONFIG_EXTENDED_PAGE_HEADERno_vpd_sizebiasformatlast_switch_counthardirq_stack_ptr_MPI2_SGE_SIMPLE64sge_size_ieeelast_wakeeswapnr_setsuint32_tssize_tphy_belongs_to_portRQ_END_IO_NONEvtime_statefind_first_bitpci_ers_result_ttry_vpd_pages__ret_conds_blocksizequeue_numprevent_sleep_timeclass_spinlock_irqsave_try_is_conditionals_readonly_remounti_io_list_base_display_ioc_capabilitieschild_countpcie_bwctrl_dataVTIME_IDLEcompat_uptr_treply_dma_min_addressDEVICE_HORI_POS_LEFT_hugetlb_subpoolend_pfn_base_wait_for_iocstateuclamptgidpci_namelimits_locksg_scmdreleasenr_wakeups_migratestack_vmbuild_prpi_fieldmaskupiddump_stackinsntrace_evalsia_vfsuidmpt3sas_config_get_bios_pg4FirmwareVersionNamequota_format_opsprocenti_datarescue_listfsverity_infocore_threadclosidsched_avgcodesyscore__i_nlinkpmd_tScratchpadsrcu_barrier_cpu_cnt_base_display_fwpkg_versionreadaheadopt_sectorshrtimer_cpu_baseirq_domainwait_liststatic_call_trampfsverity_operationsreply_post_queue_depthcoublockbug_tablemigrate_modeirq_poll_initevent_tg_base_display_OEMs_brandingusing_gplonly_symbolsremovedhandleremulatedsym_vvar_pagemembarrier_stateis_faultdma_pad_masksas_addressbin_sizepost_vectorsFORTIFY_FUNC_strlcattrigger_flagsrcu_read_lock_nestingMpiSimpleCoalescingTimeoutrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_tio_bitmapDEVICE_VERT_POS_CENTERsbitmap_wordpcie_capability_read_wordlong unsigned intcalc_setsirq_set_affinity_and_hintmax_timelast_queue_full_countread_file_infosge_chain_countexec_startia_sizempt3sas_config_get_ioc_pg8BidirectionalDataLengthio_queue_numRPM_RESUMINGMODULE_STATE_COMINGsym___kernel_sigreturninit_completionFWVersiondma_alloc_coherentuser_cpus_ptrd_opstate_initializedpend_os_device_add_szrelease_dquotplugsoftirq_activatedresid_leninv_weight_raw_spin_lock_irqsavesecurityMpiChainGlobalFlagskernel_symboldl_timerlockdep_map_pmodule_param_attrsno_read_capacity_16scsi_host_template__user_state_sizechainedVTIME_GUESTretriessdtrsysvsemdisconnectstashedpasid_no_tlpuser_xfeatures__kmalloc_cache_noprofHostMSIxVectorsuse_memdelayMPT_BUILD_SGnr_cached_objectshas_timeouttime_sync_intervalcommcallback_headrqstexception_table_entrytotalswapin_hrtirqdelayed_event_ack_listfactor1factor2_overruncondDEV_DMA_NON_COHERENTcoredumpd_sbio_lock_cls_keyksetno_msisleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsnodesysvshmno_highmemtk_offsetsfirstport_enable_cb_idxWORK_OFFQ_BH_BITMPI26_DRIVER_MASTER_TRIGGER_ENTRYactive_countnr_active_requests_shared_tagspci_disable_devicenum_tracepointsueventsharednext_cpu_batchdisk_events__UNIQUE_ID_max_msix_vectors600s_sysfs_namesigval_tcombined_reply_index_countSDEV_QUIESCEbitsbase_pfnbuff_ptrclass_mutex_try_is_conditionalresource_size_tmpt3sas_config_get_number_hba_physsem_undo_listcompat_rmtpclass_local_lock_is_conditional_MPI2_SAS_IO_UNIT1_PHY_DATA_scsih_set_fwfault_debugdiag_trigger_mpistatic_key_true_stimeMPI2_SCSI_IO_REQUEST_DESCRIPTORAdapterOrderAuxperf_event_ctxpfwfault_debugcostxcomp_bvio_contextmsix_enabledPIDTYPE_PIDwakee_flipsvlagufdssegment_boundary_maskioctlprev_cputimesaved_cap_spacehorizontal_position__UNIQUE_ID_perf_modetype604em_perf_tablebi_crypt_contextSAS_PROTOCOL_NONEprivatelog_infoswp_entry_tcharmatchnr_failed_migrations_hotreg_offsetAddress32__param_perf_modequeue_stoppedFORTIFY_FUNC_UNKNOWN_MPI26_DRIVER_IOCSTATUS_LOGINFO_TRIGGER_ENTRYbin_attrscpu_itimerMPT3SAS_FLUSH_RUNNING_CMDSPrimitiveSignature0Signature1Signature2devres_lockMpi2BiosPage4_tfiles_structchain_endpre_vectors__ret_onceblk_zoneSDEV_RUNNINGicq_treevfsuid_tf_lockexec_vmkernel_paramvertical_positionshutdown_prerelease_foliobi_io_vecpri_capget_msix_index_for_smliovendor_idmtimearchrobust_listasync_probe_requestedthaw_earlySAS_EDGE_EXPANDER_DEVICEvectors_securitysplice_writeport_enable_failedparam_lock__param_poll_queuesreq_listPackageNamei_opflagsPCIeEncapsulateddentry_operationsstats_sectorss_blocksize_bitskfreeaccess_statusenclosure_logical_idexp_hintclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapdevice_remove_in_progress_szstrnlenpfactstg_flags_head_2asym___kernel_vsyscallopen_muteximm_readyfortify_funcreduce_szmpi_event_tgStartSlotget_timeki_flagss_inode_wblist_lockflags_lengthioc_link_reset_in_progresspermchain_bufferdestroy_workcpumask_firstlockableuprobes_statemm_counttrace_overrunargsargvdiag_trigger_scsi_MPI25_SGE_IO_UNIONuclamp_reqswap_info_structdynidss_qcopblk_mq_queue_mapchip__kernel_long_tsrcu_usagefaultableskip_init_reply_post_free_queueMPT3SAS_ADAPTERMPT_BUILD_ZERO_LEN_SGEprp1_entryexit_hctxqueue_delayed_work_onin_execveLMIDrlim_maxsimple_tagsSlotNumbertarget_listmutex_lockmpt3sas_remove_dead_ioc_funccoherent_dma_maskEvent__data_lendriver_flagsfile_ra_statek_sigaction_hugetlb_hwpoisonTriggerFlagstemp_sensors_countdisable_irq_nosyncReplyFrameAddressreadahead_controlfwnode_operationsswait_queue_headMaxNumPhysicalMappedIDsmemory_typePciBusNumbervm_userfaultfd_ctxTT_NONEnum_prp_in_chainmap_pagesmod_tree_nodecmd_flagss_bdev_filedev_pagemapis_mcpu_endpointcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fsbios_pg4host_eh_scheduledsoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLErb_nodereturn_consumerround_robinMsgFlagsi_private_datadst_chain_addrptracer_credWORK_STRUCT_COLOR_BITSsrcu_barrier_headleadercheckprp_page_dmahtb_rel_queryTT_COMPATtop_of_stackcap_effectivemsix_taskexit_statefaultscan_startmax_sges_in_chain_messagesubvendorbios_pg2WORK_STRUCT_COLOR_SHIFTbios_pg3numa_pages_migratedPCISlotNummax_sges_in_main_messagesched_tagssupported_modepsgeMpi2PortEnableRequest_tsbitmap_queueis_gen35_iocpci_p2pdmano_cgroup_migrationirq_flagsattached_handlesched_datachain_listprintk_index_startindex_keyperf_modebreserved_tags__bi_nr_segmentsneeds_freset_MPI2_IEEE_SGE_SIMPLE_UNIONrcecinterval__param_str_poll_queuesbug_entrytimers_activeEnvironmentVariableOffsetnum_classesvma_lockwait_state_countIeeeSimpledl_throttledseccompDEVICE_VERT_POS_UPPERblk_holder_opsstatic_key_modport_siblingsfilter_countatomic_decmknodnode_listdescriptormax_discard_sectorstuple_sizelatch_tree_noderequest_descript_typeumode_t__init_workdestroy_workqueueinitial_nsnon_compliant_bars_base_check_pcie_native_sglmaskno_pmGRPQUOTA_base_assign_reply_queuesia_vfsgidmpt3sas_ctl_pre_reset_handlerioctx_locktimer_slack_nss_bdixarraycan_wakeuppdeath_signalnr_wakeups_idledqi_igraceqf_nextmaple_treensproxymanu_pg10manu_pg11slave_dir__p_len__write_overflow_pkeykernfs_rootucountsget_next_idDD_CLASS_TYPE_LEVEL_NUMmpt3sas_config_set_iounit_pg1high_iops_outstandingrefcount_ttimestamp_update_countErrorResponseBaseAddresscmd_lenDEVICE_PANEL_TOPmax_hw_discard_sectorsint32_txol_areadefault_locktmp_stringguess_capacitysrcu_gp_mutexdmd_orignal_MPI2_CONFIG_PAGE_BIOS_2_MPI2_CONFIG_PAGE_BIOS_3_MPI2_CONFIG_PAGE_BIOS_4debugfs_dirwakee_flip_decay_tsprio_listevent_dataMPI2_BOOT_DEVICE_ENCLOSURE_SLOTlast_timeBiosVersionrequestblk_unique_idsas_address_parentSDEV_DELMasterDatacontexthost_lockcpumask_checktotalhighrwlock_tvm_fault_tSAS_PHY_RESET_PROBLEMuse_autosuspendPCIeEncapsulatedSuccessclass_spinlock_irq_try_is_conditionalcfs_rqsas_iounit_pg1virt_boundary_maskcgroupsdefault_reply_tr_listcore_occupationget_policycore_cookieMpi2ManufacturingPage11_trefcount_struct__kernel_ulong_tfwnodestatic_call_keydelayed_scnamespace__UNIQUE_ID_smp_affinity_enable598parametersgroup_leaderdma_channelrunnable_avgMpi2IOCPage8_tlookaheadiowait_countshstkdelayed_trioac__kernel_clock_t___GFP_DMA32_BITwas_resetgp_seqscsi_device_stateuuidmaj_flt_sc_listcached_requested_keydqb_rsvspace___GFP_NOMEMALLOC_BIT__wake_upmpt3sas_scsih_scsi_lookup_get__s8inode_operations__kernel_size_tdma_configurefile_leaseclass_local_lock_nested_bh_is_conditionalWQ_BHgpl_symsktime_divns_base_alloc_irq_vectorsraw_atomic_incpci_vpdpercpu_rw_semaphorearch_spinlock_tseqcount_raw_spinlock_thighthread_pid_MPI2_FW_UPLOAD_REPLYevent_loghcb_size_base_get_high_iops_msix_indexdl_non_contendingcurr_ret_stackpgtable_tmax_bus_speed__u8q_usage_counterwakeirqi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyssdev_targetcore_forceidle_sumget_offset_ctxbase_readl_ext_retryreleasedexport_operationsqc_state__UNIQUE_ID_msix_disable596get_budgetBLK_INTEGRITY_CSUM_IPmempool_smempool_t_MPI2_FW_IMAGE_HEADERd_inodespecial_vecPollingIntervalworkqueue_structi_lock_keySAS_PHY_VIRTUALuevent_suppressgraveyard_linkbi_opfscsi_cmndfs_superswait_for_discovery_to_complete__read_overflow2wce_default_on__rcu_icq_cache___GFP_KSWAPD_RECLAIM_BITcap_ambientqstrtaskss_d_opreply_post_free_array_dmano_report_lunsmpt3sas_config_set_bios_pg4i_rcuSenseBufferAddressHigh__count__already_donedma_pool_zallocinit_requestGET_MSIX_INDEXio_optpcountbio_listwlockeddevicemodule_kobjectpercpu_count_ptrMpi26DriverTriggerPage4_tpcie_mpssnr_ia_rangesthawtlbflush_unmap_batchremovebvec_iteroom_mmsrc_virt_membpf_local_storagename_linkcompat_long_tcnivcswchain_dma_poolats_stushort inttrc_reader_specialscsi_lookup_locklogging_levelgtimepscr_ret__disk_events_disable_depththread_group_cputimersizemigrate_to_ramreset_from_userUTASK_SSTEP_ACKbroadcast_aen_pendingloginuiddesc_structi_wb_lists_umount_keyquota_type__init_swait_queue_headnameeob_clone_chainIoIndexsetleaseMaxEnclosuresbitmap_tagsmnt_rootpsi_flagspage_offset_baseusleep_rangesighandaddrMpi2ReplyDescriptorsUnion_tseconds__rcu_headMPI2_SGE_SIMPLE_UNIONac_utimeksm_zero_pagesqueuedataissue_resetprivate_data_MPI2_REPLY_DESCRIPTORS_UNIONscsiio_trackermpt3sas_base_disable_msixreply_free_host_indexfs_struct_raw_spin_unlockMpi2SCSIIORequest_tnuma_nodedev_archdatanr_perf_statess_flagsrcu_nodeorig_pmdrb_rightktime_to_mskmalloc_array_noprofclock_baseclass_irq_is_conditionallaunder_foliowake_batchReserved11Reserved12delayed_tr_volume_lists_vfs_rename_mutexReassignmentDeviceNameElf64_Xwordcurrent_eventflockReserved1ahandler_dataReserved26__paddingio_lockdep_mapatomic_write_hw_boundaryiowait_sumdescriptionDescriptorTypeDependentbi_nextblk_status_tUSRQUOTA_base_sas_ioc_infoReserved38driver_privateReserved3CReserved3E__flush_workqueueWORK_OFFQ_POOL_BITSpm_onlyd_rt_spc_warnsset_read_onlypgmapactive_refReserved40hctx_tableinit_wait_entryReserved48kernfs_open_fileReserved4CPortFlagsMpi2IOCPage1_t_event_ack_lists_iflagspci_dev_flags_tprintedNumDevsPerEnclosurenr_hw_queuesiounit_pg0iounit_pg1codetagstate_mutexReserved50Reserved54Reserved58last_queue_full_depthReserved5Ccid_worki_versionpcie_iounit_pg1swap_deactivateclass_rwsem_read_is_conditionalqueue_limitsil_weightstarved_listdma_parmsKOBJ_NS_TYPEScmin_fltarch_uprobe_taskis_hotplug_bridgearch_atomic_setwrite_protect_seqclearedkobj_ns_type_operations_MPI2_SGE_IO_UNIONshutdownevent_countsched_statisticspci_ops__kernel_uid32_tallocorig_pterq_timeout_base_make_ioc_operationalkeysinit_nameSDEV_EVT_FIRSTReserved80MPI25_FP_SCSI_IO_SUCCESS_REPLY_DESCRIPTORfile_lockstatfsMPI2_IOUNIT8_SENSORrw_semdevice_privatevm_policydl_deadlinetracepoint_extclass_mutex_is_conditionalfpregs_statetracker_listWORK_STRUCT_PENDING_BITmemcg_datadqb_curinodesmpt3sas_config_get_manufacturing_pg0mpt3sas_config_get_manufacturing_pg1fileattr_seteh_actionpage_linkFlashOffsetDEVICE_PANEL_UNKNOWNPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetsas_port_listmce_ripvDL_DEV_NO_DRIVERret_stackSAS_PROTOCOL_INTERNAL_ABORTreal_timerenclosure_dev_nexti_privatealloc_tag_base_build_nvme_prpextended_state_areanum_kprobe_blacklistaccesssubdirsvariable__ffsdev_release_MPI2_EVENT_NOTIFICATION_REPLY_enclosure_nodeMPI2_SGE_CHAIN_UNIONmlock_countscsi_cmd_privget_next_child_nodemempolicyperf_event_mutex_bandcurrent_boot_devicepollfddev_tdma_poolSAS_LINK_RATE_UNKNOWNplatform_dataf_refprev_posenv_endfileattrs_subtypeusage_countpr_opsstate_in_sysfsdqb_ihardlimitaer_statsunlocked_ioctluprobebd_mappingkmem_cachenuma_next_scansg_pagebudget_mapbsg_devsrcu_last_gp_endclass_local_lock_irq_is_conditionalpage_listproperty_read_int_arraywdtrmq_rq_stateholders_dirMODULE_STATE_UNFORMEDmsleepst_value__warn_flushing_systemwide_wqbufferramMpi2EventNotificationRequest_tlist_head_base_build_sg_ieeeptrace_bpsreply_free_queue_depthAtomicRequestDescriptorPostsgl_flags_end_buffers_user_nsbase_cmdsmax_nvme_qdreply_free_iomemtagset_refcntqueuecommand_may_blockarch_tlbflush_unmap_batchquick_threadsdefer_syncMpi25IeeeSgeChain64_t_base_diag_resetreq_alt_boot_devicemissed__param_str_max_queue_depthstatus_tgsum_sleep_runtimecleanup_rqd_spc_timerd_ino_hardlimitpausechange_cookiebi_statusdl_periods_dquotwq_flagsfsnotify_sb_inforecent_cida_opsmpi_req_iomematomic_desc_capablempt3sas_base_free_irqpad_untilperf_event_listirq_pollinterval_expevent_typeReservedD0ReservedD4ReservedD8___GFP_LAST_BITdevfnReservedDCtagsPhyNumki_completeRequestDescriptorPostHighpgprotuint16_ttimespec_type__UNIQUE_ID_max_queue_depth592bd_devicefind_special_pagedquot_operationsMPI2_IEEE_SGE_SIMPLE32ReservedE0ReservedE4ReservedE8posix_cputimers_workgsbaseReservedECcpu_max_bits_warnMPI25_SCSI_IO_CDB_UNIONio_tlb_memseq_showcpusfilescb_funcinblockReservedF0dst_addr_physReservedF4ReservedF8bd_claimingcpu_relaxtails_magicdma_alias_mask_base_allocate_chain_dma_poolnuma_faultsmem_dqblk_MPI2_BIOS4_ENTRYEEDPBlockSizestatusSGEModifierMaskWRITE_LIFE_NONEIocLogInforead_countwait_for_completion_timeoutHRTIMER_NORESTARTlast_update_timeNVME_BUILD_PRPinternal_smidReserved1Reserved2sas_ss_spReserved4Reserved5Reserved6Reserved7dpc_rp_log_sizeReserved9cpumask_nextLogEntryQualifierpanelSAS_PROTOCOL_SMP___GFP_ZEROTAGS_BITmax_allowed_capacityopen_moderead_pos___GFP_ACCOUNT_BITmpt3sas_ctl_clear_outstanding_ioctlsD_REAL_METADATAgpl_crcs_MPI2_BOOT_DEVICE_ENCLOSURE_SLOTclass_raw_spinlock_try_is_conditional__must_check_overflowkiocbRAIDAccelerator__UNIQUE_ID_y_616__UNIQUE_ID_y_618config_req___GFP_MEMALLOC_BITexecute_only_pkey_MPI26_EVENT_DATA_PCIE_ENUMERATIONblk_mq_unique_tag_to_tagpci_release_selected_regionsreturn_instancesma_lockblk_mq_queue_datadockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsChipRevisiondentryioremapsequential_iowait_pidfds_writersgroup_stop_count__UNIQUE_ID_y_622swap_lock_base_send_ioc_resetvm_opsckSumMPI2_RAID_ACCEL_REQUEST_DESCRIPTORSEPDevHandleread_before_msreply_postget_unmapped_areamkobjsym_VDSO32_NOTE_MASKsharedramfrozenactive_uprobeget_parent_sas_phymin_vruntimel1ssconnector_namehost_resetPCI_STD_RESOURCESclass_disable_irq_is_conditionalControllerPhyDeviceInfosyscrnr_mapssyscwsync_ionum_bpf_raw_eventsmpt3sas_base_coredump_infowork_qnr_phys_allocatedorig_nentski_posSAS_PROTOCOL_SSPavx512_timestampend_io_datafree_cached_objectstaints_BooloverflowSAS_PROTOCOL_STPxol_vaddrlist_lru_nodeuclamp_ses_time_granNumSensors__UNIQUE_ID_y_645blk_integrity__UNIQUE_ID_y_647kuid_tdev_pm_qosbd_holdersdriver_exclusive_resourceFlagsLength_sifieldstask_MPI2_IOC_FACTS_REQUEST_MPI26_DRIVER_SCSI_SENSE_TRIGGER_ENTRYIeeeChainresetsched_reset_on_forkcompound_headnr_retriessgl_flags_last_elementmultipath_on_hbaevent_contextwake_irqbranchtarget_port_protocolsi_cdevchip_physhba_queue_depthi_fsnotify_marksqueue_ramp_up_periodin_thrashingdl_defervpd_pg80vpd_pg83vm_startvpd_pg89mprotectquota_ond_automountDEVICE_REMOVABLE_NOT_SUPPORTEDromlenatimeAddlFlags3get_ownershipf_task_workSignaturemy_qeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalsectors_wb_errtotal_io_cnt__q_size_base_event_notification__num_online_cpuscloseSAS_END_DEVICEPhyDataiopl_warnelevator_queuereply_post_struct__param_str_smp_affinity_enablepasid_requiredptracedWORK_NR_COLORSdonesym___kernel_rt_sigreturnsrcu_struct_ptrsmpt3sas_base_doneSlotStatusTaskTagMPI2_SAS_IO_UNIT1_PHY_DATAskip_ms_page_3fbuild_sginodesos_irqmemcg_awarei_atime_sechost_waitmanage_shutdownMPI26_DRIVER_MPI_EVENT_TRIGGER_ENTRYqsize_t__fpstatedma_free_attrsqf_ownerSATAMaxQDepthsuspend_noirqd_inamebi_flagsIOCStatusLoginfoTriggerslinks_countprealloc_pterdevd_ino_countarg_lockDEVICE_REMOVABLE_UNKNOWNignore_childrenIRQ_HANDLED__compiletime_assert_624freeze_fsraw_atomic_setin_eventfdresume_earlystart_scan_failedmax_dev_sectorsdup_xol_workalimitmsix_capir_firmwarempt3sas_port_factssrc_chain_addrnuma_groupInitiatorDevHandleblk_independent_access_rangeskmap_ctrlfscrypt_operationsscsiio_requestrangesfs_contextmnt_idretry_hwerror_MPI2_CONFIG_REPLY_base_put_smid_hi_prioritydrop_inodeorc_unwindbroken_parity_statusgraph_get_next_endpoint_base_reduce_hba_queue_depthlast_sector_bugmq_mapOEMIdentifierkprojid_t__u16saved_end_iosyscall_dispatchdl_densityon_rqSL_WH_MPI_TRIGGERS_Taltmapmin_perf_statercu_tasks_exit_listmsi_enabledsp_regdma_drain_bufinternal_lookuplast_resets_master_keysflagsdiag_buffer_dmaIOCParametermpt3sas_config_get_ioc_pg1bd_holder_locknr_threadsvm_mmnum_entries__u32EventTriggerEntryPrimaryApplicationTagrcec_eamax_secure_erase_sectorsseq_nextMpi2SasEnclosurePage0_tmpt3sas_base_sync_reply_irqsMpi2IOCFactsReply_ts_quota_typesvm_lock_MPI2_SCSI_TARGET_REQUEST_DESCRIPTORremainder_ddebugFAULT_FLAG_ORIG_PTE_VALID__UNIQUE_ID_perf_mode605rt_spc_timelimit__UNIQUE_ID_smp_affinity_enabletype597mpt3sas_scsih_is_pcie_scsi_devicedelaysf_modectl_smidcntdnFORCE_BIG_HAMMERtimerqueue_headSGEModifierShiftBLK_INTEGRITY_CSUM_CRCsdev_groupskioctx_tableksm_rmap_itemsclass_read_lock_is_conditionalptm_capKMALLOC_RECLAIM_base_put_smid_fast_path_atomic__u64revoked_at_folio_nr_pageswritepageis_dirty_writebackpkey_allocation_maplink_bwctrldq_iddisable_depthem_perf_stateReplyFreeQueueDepththread_shstkminimum_linkrateposix_timerswait_chldexitsas_ss_flagsunmap_limit_for_wssas_device_type_MPI2_IOC_FACTS_REPLYrom_base_regpcie_sg_listReserved3bi_itersrcu_cblist_invoking__wq_entryiopollbridge_ctliov_lenlatency_record__basePrimFlags_get_st_from_smid_base_send_ioc_initSAS_LINK_RATE_1_5_GBPSmsi_capiopoll_q_start_indexEnclosureHandlesector_sizeiounit_pg8d_releasekasan_check_writedev_dma_attrexpiresnuma_scan_seqmnt_sbdev_to_nodehashnodemask_tIOCNumbersignalfd_wqhhang_detecteddevice_driversupports_trigger_pageslast_zone_capacityfault_codepend_os_device_addfsindexraw_spinlock_t_MPI25_SCSI_IO_REQUESTs_copcombined_reply_queues_active__WQ_DESTROYINGnum_argstag_size_MPI2_BOOT_DEVICE_ADAPTER_ORDERs_uuidclear_child_tidruntime_statusdqb_btimedq_opAdapterFlagsno_command_memoryshow_pathdl_serverVTIME_USERquota_disablesched_delayedmpt3sas_base_lock_host_diagnosticWORK_OFFQ_DISABLE_BITSsrcu_gp_seq_neededCompressedtask_structcurrent_may_mountkmalloc_cachesHeaderrequest_dmapushsas_protocolis_noirq_suspendedfwnode_endpointfind_next_bitcounterReqAltBootDeviceFormsuspendStartAddresssupported_eventsoom_score_adj_minfw_img_hdrzone_wplugs_pooldomain_datapage_maskcopy_file_rangeAddlFlags2srcu_gp_startreport_zones_cbSAS_HAxa_flagswakeup_preparedtv_nsecmsi_lockmax_zone_append_sectorssas_ss_sizebridge_d3Mpi2EventDataSasDiscovery_ts_inode_list_lockUTASK_SSTEPCurrentHostPageSizeehandlerdq_sbexpecting_lun_changescsi_targetRAIDAcceleratorSuccesss_mountssriov_configureSDEV_EVT_MEDIA_CHANGE__UNIQUE_ID_irqpoll_weighttype601OperationSDEV_EVT_INQUIRY_CHANGE_REPORTEDBLK_EH_DONEMpi2SepRequest_tsym_pvclock_pageReplyPostHostIndexpage_fragbuffer_iomemrun_workfsuidRPM_REQ_AUTOSUSPENDirq_poll_fnrom_attr_enabledsrcversionlist_add_tailtrace_event_callwakeup_sourceis_partially_uptodatehost_faileddl_runtimemay_splitio_uring_cmdread_dqblkchain_flags_raw_spin_unlock_irqrestoretransport_cb_idxpcie_device_lockImageOffsetsrcu_parentsuppliersfile_operationsmpt3sas_halt_firmware__param_str_irqpoll_weightblist_flags_tmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotNVMeAbortTO__param_str_max_msix_vectorsdpc_capis_preparedpgprotval_ttrc_holdout_list_base_reset_done_handlerWriteSequenceMaxTargetPortConnectTimeasync_suspendq_nodescsi_tgclass_mutex_intr_is_conditionalstrtabpage_freeftopHPROBE_CONSUMEDi_mmapdirty_paused_whenirq_get___GFP_COMP_BITdriver_managed_dmaSAS_SATA_PMcapacitymax_channelversionarch_atomic_dec__WQ_BH_ALLOWSbuffer_rel_conditionget_reference_argsllisthiwater_vmUniqueValuemax_perf_statebi_idx_base_irqpollfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntrseqReassignmentWWIDtarget_kn_MPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORlimit0limit1pi_blocked_onpid_tvmemmap_shiftusage__kernel_time64_tMPITriggerEntryrq_qos_mutexlink_active_reportingscsi_data_bufferi_securityreply_freedevice_physical_location_panelbase_mod64limitsq_lock_cls_keytransport_cmdsenvpactive_memcg__targetsElf64_Halfallow_reinittimer_autosuspendsratelimit_MPI26_DRIVER_MASTER_TRIGGER_ENTRYSHOST_DELsysdata_softexpirespd_handlesautosuspend_delaydma_alloc_counti_flctxlist_lockvm_faultwriteq_lockoptimistic_spin_queuepermissionscmdtrigger_typempt3sas_scsih_event_callbackflush_listctl_cmdspci_free_irq_vectorsSASWideMaxQueueDepthreap_refsystem_unbound_wqDEVICE_FIXEDlast_statusReservedSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsgioc_lockslice_maxp2pdmaMpi2SasIOUnitPage1_tIS_ERRbi_max_vecs_MPI26_IOUNIT_CONTROL_REPLYthaw_noirqsched_debugfs_dirSAS_PROTOCOL_STP_ALLaccounting_timestamppasid_capserial_numbersges_left_base_handshake_req_reply_waitcan_matchtime_archcmd_sizechunk_sectorshlist_bl_headqc_dqblkpasid_activated__fortify_panicbvec_integrity_poolSizearch_data_oldSAS_SATA_PENDINGio_uring_poll_queueshrink_controlegidenvp_idx_base_writeqcrypto_kobject___GFP_NO_OBJ_EXT_BITtagged_supportedSystemRequestFrameSizeMpi2PortFactsRequest_tvpd_pgb0vpd_pgb1vpd_pgb2vpd_pgb7folioBuildDateStringOffsetruntime_autopref_node_forkclassslotsprev_scan_seq_perfput_smid_fast_pathhardirq_stack_inuseReserved8io_missing_delay_originalwait_queue_head_tpci_select_barsFAULT_FLAG_INSTRUCTIONuser_nsclass_raw_spinlock_irqsave_is_conditionalnvme_blocks_needed_base_async_eventsyms__param_irqpoll_weight_flagsFlashSizeSasAddr_MPI2_PORT_FACTS_REPLYErrorResponseAllocationLengthmpt3sas_base_get_sense_bufferdevcapsyncSAS_SATA_DEV_base_clone_reply_to_sys_memmq_freeze_lockMPI2_ADDRESS_REPLY_DESCRIPTOR__UNIQUE_ID_irqpoll_weight602sg_prot_tablesizepcie_sgl_dma_poold_childreneh_host_reset_handlerNvdataVersionPersistentMpi2RequestDescriptorUnion_tddebug_class_map__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115__compiletime_assert_116__compiletime_assert_117__compiletime_assert_118__compiletime_assert_119prealloc_bufaudit_contextfl_owner_tipi_listdoorbellAdditionalControlFlagsWordsSAS_FANOUT_EXPANDER_DEVICEnum_online_cpusmight_resched__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126i_pipe__compiletime_assert_128__compiletime_assert_129d_waitllist_headsense_buffernr_phys_segmentscurrent_stateMaxInitiatorswait_page_queuesas_rphyreply_post_freeFAULT_FLAG_REMOTE__compiletime_assert_130dl_bw__compiletime_assert_132__compiletime_assert_133__compiletime_assert_134__compiletime_assert_135__compiletime_assert_136__compiletime_assert_137__compiletime_assert_138pci_device_idret_vali_dir_seqheaderRequestFlagswatchdog_stamplist_op_pendingdatasrcu_cb_mutexsysfs_lockbroken_intx_maskingmsix_ioSimple32no_callbackssaved_trap_nrclock_listfolioq_slotmpt3sas_base_get_pcie_sgl_dmaUnitMODULE_STATE_GOINGxattr_handlerring_buffer_szSDEV_EVT_CAPACITY_CHANGE_REPORTEDbuild_sg_scmdrqos_debugfs_dirCDB32prot_sdbunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_lockfromnextentseventblk_mq_rq_from_pdukeytype__kernel_gid32_tdev_pm_domainnentsstart_time_nsMpi26IoUnitControlRequest_tuaddr2f_securityprot_oppd_handles_sz__param_ops_mpt3sas_fwfault_debugbridgedefparamdiscard_granularitypcie_sgl_dmaSimple64smp_affinity_enablecmp_img_hdrProductSpecificiotmo_cntclass_raw_spinlock_irq_is_conditional__bi_cntSAS_PHY_RESET_IN_PROGRESSrcuwaitattributes_maskdl_defer_runningmax_sge_elementsqueuecommandresourcesmaximum_linkratesrcpmpt3sas_blk_mq_pollia_validsrcuBuildTimeStringOffsetinstrument_atomic_writeiorequest_cntsrcu_size_jiffiesmpi_request_szclassespasid_featuresstatic_call_siteis_virtfnblk_mq_unique_tag_to_hwqHostInterruptStatussubdevicebuff_ptr_physsrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitrchari_verity_info_addr_pkeyrw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countSTARGET_RUNNINGbuild_nvme_prpatomic_openput_smid_default__mptrsigactionrlimmce_addr__q_size_fieldf_freeptrPrimaryReferenceTag__sighandler_tclass_spinlock_try_is_conditional_MPI25_FW_UPLOAD_REQUESTzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMEShash_lenMPI26_DRIVER_SCSI_SENSE_TRIGGER_ENTRYmax_target_blockedfs_flagsvm_filei_countuser_structaddress_space_operationsFAULT_FLAG_USERkey_perm_tTargetAssistSuccessMPT_PERF_MODE_LATENCY_base_get_event_diag_triggersReserved10max_wideport_qdMaxMSIxVectorsHeaderVersionSasWwidtimer_listdma_pool_destroyrun_delayNotFlashImagenum_ftrace_callsiteschange_queue_depthsrcu_cblistblk_independent_access_rangedivisorreset_devicesNVMeMaxQueueDepthmax_narrowport_qdtlb_ubcpme_supportpgtables_bytesi_lrusimple_sgl_flagsGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stack_MPI26_DRIVER_MPI_EVENT_TRIGGER_ENTRYtrc_ipi_to_cpudesired_eventPageType__WQ_LEGACYallow_restartmin_slicecommit_rqsput_smid_scsi_iosysfs_opsinq_periph_qual_find_next_bitHCBAddressHighatomic_write_hw_unit_maxcmaj_fltbio_integrity_poolkparam_arraympt3sas_base_hard_reset_handlerFORTIFY_FUNC_strscpypercpu_refevict_inodeignore_media_changedqb_itimeMPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTOR_internal_cmdthread_keyringmap_nrlist_delcpumask_tpcpu_hottotalramActualImageSize_raw_spin_lockgfp_maskdma_addr_tirq_handler_tinactive_timerDEVICE_COUNT_RESOURCEsense_dmaattributeMPI25_FP_SCSI_IO_REQUEST_DESCRIPTORinit_hctxmm_lock_seqhotplugFORTIFY_FUNC_memchrkernfs_elem_symlinkBLK_UID_T10_base_wait_for_doorbell_intReserved44_debug_dump_mf_base_get_port_facts_base_build_sg_scmd_ieee__kernel_dev_tcrypt_keyslotPhyFlagsTimeStamppm_domainfsgidsector_tMPI2_DEFAULT_REPLY_DESCRIPTOR_sys_privatesignal_structactive_mmstate_savedkernfs_iattrsshow_devnamethread_infoi_mmap_writableMPI2_VERSION_STRUCTreadWORK_OFFQ_DISABLE_SHIFT_clone_sg_entriessecondarydevicesatomic_write_max_sectorsgroup_exit_codedma_set_coherent_maskFORTIFY_FUNC_memcmpopc1ignore_loginfosreply_queue_listpriv_flagsSGEModifierValuePciDeviceAndFunctionNumberSMIDclear_retrain_linkmpt3sas_base_attachexec_maxSenseBufferLowAddresssync_stateMpi2ConfigRequest_tdev_groupsDMA_FROM_DEVICEdividendkernfs_elem_dirpercpu_counter_printkDMA_BIDIRECTIONALsequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startUTASK_RUNNINGhctx_typeopenseglenoverride_only__compiletime_assert_45EEDPFlagsFORTIFY_FUNC_memcpy__kernel_ssize_tvdso_imagesi_signounused_hctx_lockfirst_prp_lenatomic_readrseq_sigresultrefsmpt3sas_base_get_reply_virt_addrdelayed_callmpt3sas_config_get_driver_trigger_pg0mpt3sas_config_get_driver_trigger_pg1mpt3sas_config_get_driver_trigger_pg2mpt3sas_config_get_driver_trigger_pg3mpt3sas_config_get_driver_trigger_pg4time_slicenr_rangeStructpci_power_tspc_timelimitMPI2_BIOSPAGE2_BOOT_DEVICEblk_mq_req_flags_t_base_check_ioc_facts_changesresumeWQ_CPU_INTENSIVEreset_doneregsbi_write_hintrq_nextsyscall_user_dispatchshort_inquiryattr_base_get_buffer_bar0d_aliasis_suspendeddqio_semspin_unlock_irqrestorerestore_sigmask__UNIQUE_ID_x_608requeue_lockmmio_enabledscsi_io_cb_idxPackageVersionkcsan_check_accessevent_workreply_post_free_arrayMPT_PERF_MODE_BALANCEDnr_deferred__UNIQUE_ID_x_613__UNIQUE_ID_x_615list_emptysrcu_ssp__UNIQUE_ID_x_619i_lockreply_post_free_contiguser_event_mmbtrace_seqs_devsiblingcdl_supportedia_rangeSkipCount_base_recovery_check__UNIQUE_ID_x_621ldt_usr_semGenericFlags1__udelay__UNIQUE_ID_x_629posix_cputimerstry_rc_10_firstRPM_INVALIDfreeze_kcountrequest_key_authblockspercpu_ref_data__UNIQUE_ID_x_634d_spc_warns__UNIQUE_ID_x_636srcu_sup__UNIQUE_ID_x_638freeptr_tns_typeRPM_REQ_NONEThresholdforce_runtime_start_on_system_startPCI_STD_RESOURCE_ENDsg_timeoutmaximum_linkrate_hwixol_MPI26_IOUNIT_CONTROL_REQUEST__UNIQUE_ID_x_640fasync__UNIQUE_ID_x_644arg_start__UNIQUE_ID_x_646__UNIQUE_ID_x_648kprobes_text_sizesge_countblk_crypto_profilefop_flagsmpt3sas_base_unmap_resources_MPI26_ATOMIC_REQUEST_DESCRIPTOR_addr_lsb_addrpfn_mkwriteuaddrKMALLOC_DMAsas_device_lockioerr_cnt_uidMpi2PortEnableReply_tmpt3sas_port_enable_dones_fs_info__rb_parent_colorWRITE_LIFE_EXTREMEicq_listslave_configuremm_users_pp_mapping_pad_MPI2_EVENT_ACK_REQUESTdebugfs_rootNextChainOffsetkey_serial_tno_uld_attachfolioqiomapshost_groups_MPI26_PCIE_IO_UNIT1_PHY_DATAsiblingscputimernrpageswake_q_node_base_build_zero_len_sgeblk_flags_t__news_maxbyteshd_geometryioctx_tabledma_io_tlb_memKMALLOC_CGROUPeh_cmd_qFunctionDependent1FunctionDependent2FunctionDependent3FunctionDependent5get_unique_idkasan_check_readVP_IDNR_KMALLOC_TYPESexpire_countis_writewake_cpu__param_str_max_sgl_entriesbio_split___GFP_DMA_BITfreeze_superraw_atomic_add_unlesstick_dep_maskcall_depthkey_typecpu_msix_tablepci_busqc_infompt3sas_base_get_iocstatefault_flaglist_is_headpio_chipmodnameCurrentBootDeviceMPI2_BIOS4_ENTRYsg_nextia_ctimetrace_eval_mapasync_put_workresvnum_static_call_sitesvm_lock_seq_base_build_sgFORTIFY_FUNC_strncatMPI2_SCSI_IO_CDB_UNIONprimarytm_cb_idxmpt3sas_config_set_sas_iounit_pg1Elf64_Addrwait_queue_entry_tMpi26PCIeIOUnitPage1_tseqlock_tmpt3sas_base_get_sense_buffer_dmalatency_record_countSL_WH_SCSI_TRIGGER_Tnr_integrity_segmentsMPI2_CONFIG_PAGE_HEADERhost_blockedmay_skip_resumeprot_flagsVTIME_SYSalloc_tag_countersbase0base1base2block_cfg_accessSHOST_CREATEDbase_cb_idxbio_setPortNumberalignment_offsetrdpq_array_capablelinksSL_WH_MPI_TRIGGER_Tbasesfutex_staterseq_lenkobj_completionsg_virti_spc_timelimit_base_get_buffer_phys_bar0f_opchains_needed_per_ioprp_sizenargscpuhp_onlineImageSizempt3sas_atto_get_sas_addrmm_mtgid_tdelayed_tr_listrelease_workno_report_opcodessynchronize_irqfault_reset_work_q_namercu_read_unlock_specialtls_array_MPI2_IOUNIT8_SENSOReetlp_prefix_pathIoFlagstask_io_accountingHCBAddressLowf_raDEVICE_PANEL_FRONTmodule_memorysites_base_wait_for_doorbell_ackAddresscompat_robust_list_headthread_nodestatic_call_mods_shrinkgp_countkrealloc_noprofnr_sectorsreply_queue_countbpf_raw_eventshi_priorityiommumemap_sztimer_expiresbpf_storageSAS_SATA_PM_PORTkset_uevent_opsAckRequired_base_interruptf_owner__state_permSenseBufferLengthDEVICE_PANEL_BACKreply_post_free_array_dma_pool_syscallIOCParameterValuediskSHOST_DEL_RECOVERYring_buffer_offsetreply_byteshide_drivesmsix_vector_countsrcu_lock_countlink_statetrc_blkd_cpugp_wait__compiletime_assert_131WORK_OFFQ_FLAG_ENDiommu_mmfuncenable_irqio_uring_task__WQ_DRAININGshared_tagspri_reqs_allocRequestedBootDevicejit_keyrings_fsnotify_infodma_handleEnumerationStatus_base_init_irqpollsfunctionraw_atomic_decSAS_LINK_RATE_12_0_GBPSevent_maskport_enable_cmdsprojidmce_kill_mema_external_lock_base_dump_reg_setWORK_OFFQ_FLAG_BITSpid_linksconv_zones_bitmapscsi_target_idpcie_flags_regs_dio_done_wqbase_add_sg_singlereply_post_free_array_szq_sizesystem_wqhlist_headloss_of_dword_sync_countioc_nodethrottle_diskbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblk_base_get_cb_idxFREEZE_HOLDER_USERSPACEpoll_queuesrunningrw_hintblk_integrity_checksumioc_dumpdma_skip_sync_base_update_ioc_page1_inlinewith_perf_modeMpi26DriverTriggerPage0_tpartition_meta_infompi_status_tgDEVICE_VERT_POS_LOWERReservedFCclass_spinlock_irqsave_is_conditionalutf8datampt3sas_base_check_cmd_timeoutrequeue_workof_node_reuseddyndbg_infoirq_update_affinity_hintFORTIFY_FUNC_strncpyElf64_Symhtb_relsaved_config_spaceIRVolumeMappingFlagsd_rt_spc_softlimitpollmpt3sas_base_get_pcie_sglfree_file_infoin_lru_faultsched_contributes_to_loadtlb_genruntime_idleacs_capmap_countDiagRWDatapcie_caphost_scribblei_rt_spc_timelimitqc_type_stateNumPhyss_dentry_lrus_bdevvmemmap_baseskip_vpd_pagescrcssense_lenRDPQBaseAddressrun_listdiag_buffer_szuevent_opsabort_workmax_cmd_lensched_classutil_avganon_vmadma_pool_freerequest_bytes_pidsigcntDD_CLASS_TYPE_LEVEL_NAMESmpt3sas_base_fault_infomodinfo_attrsst_spaceclass_map_typekparam_stringd_real_typemaxrsspoolcredkernfs_open_nodePhysicalPortarch_atomic_try_cmpxchgf_wb_errmm_cid_active__cpu_online_mask_base_enable_msixkzalloc_noprofWQ_MEM_RECLAIMmodule_sect_attrsreq_flags_truntime_resumempt3sas_trigger_masterktime_get_with_offsetgroup_exec_taskrestrict_linkget_inode_usagekmalloc_typexarray_startbpf_ctxpm_domain_dataBASE_READ_REGserver_pick_task__p_size_fieldload_avgcor_error_detectedi_private_lockget_dqblkmq_listphysical_block_sizepio_szpgoffporthi_priority_smidtm_tr_cb_idxhandlematch_drivermodelfreeze_lated2_support__list_del_entry_base_scsi_dma_mapcount_objectsvma_numab_statempt3sas_base_unmask_interruptsdma_map_opsdq_dirtymax_lunexit_cmd_privbus_idscsi_cmd_to_rqatomic_write_boundary_sectorsEnclosureSlotmax_queue_depthwrite_bytesReserved0xAReserved0xCeh_entrylist_addpending_eventsoom_reaper_listnumab_stateSDEV_EVT_MODE_PARAMETER_CHANGE_REPORTEDfutex_offsetsubsys_fmt_prefixdq_lockintegrityMPI2_SCSI_IO_CDB_EEDP32pte_tnr_scanned__stateMpi2SGESimple64_tmpt3sas_factsnr_iosn_io_portslicedrv_groupstrack_queue_depthcustom_slicepci_slothotplug_user_indicators_base_display_event_datamq_freeze_depthpadding1nestedatomic_write_segments_maxfall_backReplyFreeHostIndexnr_dirtied_pausequeue_kobj_MPI2_CONFIG_PAGE_MAN_1real_addressbd_holder_dirinvalidate_locknum_exentries_copy_lenfix_capacityio_portblk_mode_tpmdval_thost_tagsetkvecPCIDomainSegmentsimple_sgl_flags_lasteh_noresumeset_latency_tolerancedepthDescriptorTypeDependent2d_ino_timerprobenetlink_nsdev_ueventsgel_nextdep_mappage_mkwritepage_mask_resultlast_busyvm_flags_tReplyDescriptorPostQueueDepthres_attrnr_failed_migrations_affined_in_lookup_hashprocsptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLERreschedule_countmax_hang_timeexternal_facingcmd_per_lun__dummycdl_enablecutimelockrefsize_addtlb_flush_batched___GFP_HIGH_BITia_uidautogroupsequencercu_syncarg_endclass_spinlock_irq_is_conditional_dummy_pkeyvruntimehostdata___GFP_HARDWALL_BITSAS_LINK_RATE_22_5_GBPSbus_flagsstart_stop_pwr_condmsecs_to_jiffiesfeatures_locked__kernel_pid_tdevice_blockedMpi2IOUnitPage0_tMajorPIDTYPE_SIDcinblockdma_alignmentprot_type__kernel_loff_tset_performance_stateserial_nodeSAS_PHY_UNUSEDchains_per_smiddelayed_tr_next_base_wait_on_iocstateMPT_CALLBACKstate_remove_uevent_sentnotify_countHostDiagnosticevent_maskssingle_lunhprobempt3sas_base_mask_interruptssg_reserved_sizeswap_activatedqb_isoftlimitsaved_auxvnoinstr_text_sizedl_overruniattrdetachedloff_tWWIDoom_flag_origindesc_lendma_devfault_reset_workoom_score_adjmpt3sas_base_pause_mq_pollingcompleted_cmdsSHOST_RECOVERYrq_end_io_fnksm_merging_pagesgraph_parse_endpointrmidsoftirq_pendinglist_lrudevice_removablefxsavedev_pagemap_opsbv_offsetset_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETd_lockrefSCSI_EH_DONEsession_keyringseeksmem_flagsshost_devd_deleted_ino_softlimitd_weak_revalidateresource_sizealloc_time_nsi_devicespcie_devicedqb_curspace_MPI2_REQUEST_HEADERtm_cmds_MPI2_CONFIG_PAGE_IO_UNIT_0_MPI2_CONFIG_PAGE_IO_UNIT_1alloc_lock_MPI2_CONFIG_PAGE_IO_UNIT_8early_initOEMSpecificFlags0OEMSpecificFlags1total_numa_faultssge_lenwritable_sizemax_segmentsdma_need_drainint_status_MPI2_PORT_ENABLE_REPLYobj_cgroupem_tablemq_sysfs_init_doneMpi2IOUnitPage8_tchain_sgl_flagsactive_queueshba_mpi_version_belongedMsgVersionpage_size__lstatepackage_versionMPI2_SCSI_TARGET_REQUEST_DESCRIPTORmpt3sas_config_get_manufacturing_pg10mpt3sas_config_get_manufacturing_pg11MPI26_PCIE_ENCAPSULATED_SUCCESS_REPLY_DESCRIPTORinoderetry_szReplyFreeQueueAddresssense_szpci_is_enabledbd_fsfreeze_mutexhrtimeratomic_write_unit_maxMinormpi_requestFAULT_FLAG_UNSHARE_base_allocate_pcie_sgl_pooltask_sizemust_resumeRPM_ACTIVE__param_str_msix_disableend_code__SCT__might_reschedpreempt_notifierstlb_flush_pendingmigration_flagsMasterTriggerFlagsDEVICE_PANEL_RIGHTpcie_device_listHostTraceBufferFlagspci_drivercap_inheritablekobj_sigvaleh_timeout__stack_chk_fail_MPI2_PORT_ENABLE_REQUESTsrcu_n_exp_nodelayseqcount_spinlock_tlowmem_page_addresstrigger_pg3graph_get_remote_endpoints_rootsprepare_to_wait_event__int128 unsigned_base_put_smid_default_atomicmpt3sas_base_unlock_and_get_host_diagnosticcpu_countwait_sumuprobe_xol_opsFirmwareVersionNameWhatmin_align_masknextevtthis_idrcu_segcblistreported_split_lockpref_windowreturn_instancewait_countconfirm_switchnr_wakeups_affine_attemptspud_ti_ino_warnlimitpreallocprp2_entryProtocolFlagsmax_open_zonesrmtpnext_offsetbase_chainmax_sgl_entries__param_str_mpt3sas_fwfault_debugacpi_device_idctx_idutaskpoweroff_noirqbroken_cmd_complactive_modesdev_datacb_idxis_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexdelayed_event_ackauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangstm_tr_volume_cb_idxcss_setfwnode_handlegfp_tEEDPTagModetype__vpp_verifyqf_fmt_idpageatomic_write_unit_minsleep_startmemalloc_noiobegintypetabuse_192_bytes_for_3fnr_reserved_tagsi_crypt_info_base_static_config_pagesDEVICE_HORI_POS_CENTERio_start_time_nsfree_irqaudit_ttynr_zonesmutex_unlock_base_check_enable_msixjobctlsi_errnosend_update_to_fwnr_leaves_on_treequeue_ctxmin_shallow_depthpcie_device_init_list_sigchld__le16HPROBE_STABLEquota_format_typebio_crypt_ctxatomic_incpercpu_ref_func_tpm_message_tac_memdata_out_dmapprevpending_io_countino_warnlimitbroken_fua_base_clear_outstanding_commandsMaxPostedCmdBufferszone_wplugs_lockmnt_flagsac_stimelast_mergememcg_nr_pages_over_highsw_reservedDCRDatabase_chain_phys__le32wbt_flagsproc_dir_entrypci_enable_device_memscsi_dma_unmapobjcgno_read_disc_infoblock_startvm_area_structnum_gpl_symsdrv_support_bitmapselect_no_atn__compiletime_assert_2__compiletime_assert_3__compiletime_assert_4__compiletime_assert_5__compiletime_assert_6PageNumbermap_busControlphy_reset_problem_countTK_OFFS_REALlong long unsigned intWRITE_LIFE_MEDIUM__builtin_memcpyirq_line_enablepci_stop_and_remove_bus_device_lockedtmf_in_progressSDEV_CREATED_BLOCKhuge_faulti_fop_base_get_chain_buffer_dma_to_chain_bufferautasklast_task_numa_placementmpt3sas_trigger_mpi__le64fortify_memcpy_chk_pcie_devicerefcntfreeze_holdersubordinatecdevperf_eventkernel_ulong_tPageBufferSGEunregfunc_base_set_and_get_msix_indexrearm_timerseqcountirqpollschedule_dead_ioc_flush_running_cmdsclass_idbitsetNumMasterTriggerWORK_STRUCT_LINKED_BITfactsPCI_BRIDGE_RESOURCE_ENDinquiry_mutexof_device_iddisk_statsbusn_resmanage_runtime_start_stopmpt3sas_base_put_smid_nvme_encapclass_migrate_is_conditionalsriov_get_vf_total_msixclass_write_lock_is_conditionals_xattrpartmpi_replyBLK_EH_RESET_TIMERil_prevd_initmax_slack_shiftpanicget_name_prefix__UNIQUE_ID_x_610fileattr_get__kmalloc_noprofReplyFrameSizedma_free_coherentclass_groupsSDEV_TRANSPORT_OFFLINE__ret_warn_on__call_single_nodeunicode_mappathblk_mq_unique_tagpci_request_selected_regionspreempt_countrecent_used_cpuruntimeno_64bit_msiold_time32_tmsix_load_balancedev_flagsraw_atomic_fetch_add_unlessSASAddressframe_szspinlock_check_MPI26_COMPONENT_IMAGE_HEADER__UNIQUE_ID_x_625__UNIQUE_ID_x_627__state_sizetry_msixunsigned intsbitmaprequest_dma_szput_smid_hi_priorityclass_irqsave_is_conditionalcore_kallsymsIOCStatusscsi_devicerb_lefts_fsnotify_maskis_physfnsas_linkratescan_objectsslotbi_privatedevice_info__UNIQUE_ID_x_631DD_CLASS_TYPE_DISJOINT_BITSevent_liststartupnvme_encap_requestMPI2_BOOT_DEVICE_DEVICE_NAMEmpt3sas_ctl_reset_done_handlerkeyring_index_keychain_tracker__UNIQUE_ID_poll_queuestype606iov_iterd_rcustatic_key_false___GFP_DIRECT_RECLAIM_BIThim_registeruintptr_thost_diagnosticudelaywake_entryrcu_tasks_holdoutMPI2_HIGH_PRIORITY_REQUEST_DESCRIPTORfreezeassoc_array_ptrbatchcacheold_timespec32rcu_blocked_nodejiffies_at_allocLogInfost_namegroup_nodei_mtime_secbus_dma_region__UNIQUE_ID_x_642fw_event_lock_MPI2_EVENT_DATA_SAS_DISCOVERYstatic_rqsmpt3sas_config_get_sas_iounit_pg1sas_addrstarget_sdev_user_base_allocate_memory_poolslegacy_ioPrimaryApplicationTagMaskac_majflt_base_determine_wait_on_discoverymce_kflags___GFP_NORETRY_BIT_base_allocate_reply_free_dma_poolktime_get_realFORTIFY_FUNC_memsetVendorNameWhat__oldsdevscheduledbus_dma_limit__UNIQUE_ID_x_650ubufbtimePageLengthTK_OFFS_TAIia_gidltr_pathscsi_device_eventmigrate_foliorq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrenclosure_devnext_posix_timer_idmq_opsmax_sata_qd_mapcountstarttimeHCTX_TYPE_DEFAULTreschedule_jiffies__list_delWORK_BUSY_RUNNINGhprobe_statei_sb_listquota_offMPI2_IEEE_SGE_CHAIN32VendorIDfault_reset_work_qshm_clistio_uring_poll_queuesptm_rootdev_set_drvdatacb_headarch_atomic_inczone_wplugs_hash_bitspi_offsetac_flagpt_regsdata_lengthmax_request_credit_base_allocate_reply_post_free_arraymmap_missexpires_nextloginfo_typeIOCMaxChainSegmentSizeblk_opf_tstart_addressreport_zones___GFP_ZERO_BITpool_sznum_trace_bprintk_fmtcdrom_device_infoaccess_stateDeviceNameraid_device_locksdev_gendevphy_idmpt_callbackswork_structtrueraw_atomic_try_cmpxchglast_queuedmpt3sas_base_clear_stri_timerMpi26EventDataPCIeEnumeration_tpipe_bufsEnclosureLevelIOCExceptionsbp_offsetkmalloc_cache_typetm_sas_control_cb_idxhba_portMPI2_IEEE_SGE_CHAIN64LinkFlagsreply_address_MPI2_IOC_INIT_REPLYsaved_scratch_registertracepoints_ptrsApplicationSpecificblock_maxstatic_keyqueue_rqsFAULT_FLAG_VMA_LOCK_base_is_controller_msix_enableddma_range_mapKOBJ_NS_TYPE_NONEfwpkg_data_dataFAULT_FLAG_WRITEshow_optionswait_queue_entryPortp_leni_uidtagset_freedmax_sectorsexpirybmap__outrescue_workqueuebase_make_prp_nvmedispatch_wait_lockscsi_bufflenscsi_levelfsavei_write_hintsuspended_timeread_byteszone_wplugs_worksum_sched_runtimeinternal_depths_writers_keyMpi2SasIoUnitControlReply_tSecondaryFlashOffsetfreeswapstart_boottimepci_bus_flags_tmpt3sas_scsih_pre_reset_handlerentriesi_modedata_in_szcap_permitted__writel_flags_2a__writeqBLK_UID_NAAstart_codeirqreturn_tvm_flagssi_codenvme_pg_sizeseqcount_spinlockheadHPROBE_GONEioc_statuslast_siginfodiag_trigger_locksched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signal_base_clone_mpi_to_sys_memmax_user_sectorsdworkdevice_dma_parametersdir_contextiopl_emulSDEV_EVT_POWER_ON_RESET_OCCURREDconsumerspoll_queue_procratelimit_statepower_statedq_flagsis_late_suspendedcapture_controlqueue_offsetclass_device_is_conditionalnon_rcuput_super_MPI25_SCSI_IO_CDB_UNIONshostSCSIIOSuccessdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_stat_base_build_zero_len_sge_ieeeEEDP32HighPriorityCreditChain32iopoll_q_countirq_affinityFAULT_FLAG_INTERRUPTIBLEs_inodes_wbignore_hotplugfolio_queue_MPI2_MPI2_BIOSPAGE2_BOOT_DEVICEinit_fs_contextuprobe_taskf_mappingMPI2_BOOT_DEVICE_ADAPTER_ORDERpci_alloc_irq_vectors_affinitystart_stacktrigger_pg0trigger_pg1trigger_pg2DL_DEV_PROBINGtrigger_pg4i_linksriovmpi3_version_unionats_enabledstack_vm_areaChain64_base_unmask_eventsd_hashMpi26AtomicRequestDescriptor_tdl_server_pick_f_MPI2_BOOT_DEVICE_SAS_WWIDtty_old_pgrpnr_cpusst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquota_MPI2_ADAPTER_ORDER_AUXNumPerDevEventsorc_entrydma_drain_lenPCI_IOV_RESOURCE_ENDSCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listMaxVolumesutimemmapshrinkeralloc_dquotmax_shutdown_latencyTK_OFFS_MAXSensormappingdl_defer_armedMpi2IOCInitRDPQArrayEntrysas_expander_listChipNamerunnable_sumis_warpdriveshort unsigned inteventsget_rq_budget_tokenFastPathSCSIIOSuccessreply_dma_poolPCI_ROM_RESOURCEdevice_noderequeue_listscsiio_depthpcie_link_statep_size_fieldsges_in_segmentAddress64long long intsym_vvar_startenable_cnt_hugetlb_cgroup_rsvdsival_ptrproc_namepercpu_sizeinvalidate_foliois_vallocclass_pci_dev_is_conditionaldrop_nsWORK_STRUCT_INACTIVE_BITSDEV_EVT_LUN_CHANGE_REPORTEDPUT_SMID_IO_FP_HIPaen_event_read_flagnr_queuesmpt3sas_base_free_smidno_pm_callbackscountproduct_specificd_parentSequenceNumbersched_task_group__UNIQUE_ID_poll_queues607update_timeioc_coredump_looppidsof_nodefw_event_workrun_nodehide_ir_msgdata_sourcesubmit_bio___GFP_UNUSED_BITs_instancesvm_rcubd_start_sectpage_table_locksysv_semquota_infoquota_enableprp_entry_dma_base_allocate_sense_dma_pool__kernel_timer_tMPI2_ADAPTER_INFOdomain_tagmax_integrity_segmentscmaxrsssas_device_listit_real_incrprobestubextable_lenlast_arrivalwake_indexmpt3sas_base_get_smid_scsiioswap_rwreserveMPT_PERF_MODE_IOPSCoreDumpTOSecnegotiated_linkrateerror_staterunning_disparity_error_countsrcu_gp_seq_needed_expDEVICE_HORI_POS_RIGHTSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOia_mtimenr_thpsvphys_listnode_to_cpumask_mapsysv_shmfopssuppress_bind_attrsinsnlenmpt3sas_base_stop_watchdogsas_identify__page_1__page_2WORK_CPU_UNBOUNDi_mutex_keykey_restrictionquota_writeirqpoll_weightdomainHCTX_MAX_TYPESget_linkfree_foliodata_lensnprintf___GFP_NOFAIL_BITMpi2IOUnitPage1_taddr1addr2sa_flagsno_start_on_addcancelled_write_bytesdispatch_busydiag_bufferRequestedAltBootDevicetask_worksmm_cidatomic_write_hw_max_ddebug_infoparam_ops_intstats_lockmpt3sas_config_get_pcie_iounit_pg1num_kpunique_tagSTARGET_CREATED_REMOVE_base_readl_ext_retrympt3sas_check_same_4gb_regionshost_gendevMEMORY_DEVICE_PRIVATEirq_managed__bd_flagssuper_blockbi_bvec_donebus_typeget_named_child_nodeassoc_arrayactormpt3sas_base_register_callback_handler_MPI2_SGE_CHAIN_UNIONkobj_ns_typedeferred_resumesched_shared_tagsConfigurationFlagslong intMPI2_IEEE_SGE_CHAIN_UNIONnvme_cmdcore_nodemem_dqinfodevnodesaved_sigmaskBLK_UID_EUI64MEMORY_DEVICE_PCI_P2PDMAdq_offpinsblkcg_mutexis_visibledisk_nameconfig_pageuuid_tenclosure_listmpi_scsi_tg__kernel_clockid_twritabledqb_bsoftlimit_MPI2_EVENT_NOTIFICATION_REQUESTreply_descriptorMaxMinLinkRateio_window_1kvfork_donethresh_holdtask_cputime_atomicki_waitqra_pagesgroupdst_iomemmmap_compat_legacy_basedevice_dma_supportedsysfs_dir_lockspin_lockscsi_cmnd_submitterignored_posix_timerslockedsival_intmpt3sas_base_get_smidia_filewakeup_cntrequest_pendingconfig_page_szSystemReplyAddressHighdl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsclass_read_lock_irqsave_is_conditionalpri_enabledinitiator_port_protocolsblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startrobust_list_headDataSizeunsigned charwake_qrethooksnuma_scan_periodnr_tagssda_is_staticwakeup_pathresult_maskFORTIFY_FUNC_memscanscsi_timeout_actionei_funcs__func__MinDevHandletablespipe_inode_inforaw_spinlockVendorNameMaxChainDepthsas_idMpi2SGESimple32_tinstrument_atomic_readktypecls_mskmpt3sas_base_start_watchdogissue_host_resetmigration_disabledPCIBusNumRPM_REQ_SUSPENDpgprot_ttracepoint_ptr_tChainOffsetphysical_locationnum_vf_base_mpi_ep_writeqSOFT_RESETnvme_mdtsPIDTYPE_MAXbi_sizeCurrentBootDeviceFormwatcherscrypt_ctxstopwait_maxclass_write_lock_irqsave_is_conditionaliovec_MPI2_VERSION_STRUCTa_flagsd_dnameScsi_Hostnr_migrations_coldmnt_idmap___GFP_FS_BITMPI2RequestHeader_tWORK_OFFQ_LEFTnr_cpu_idsquotactl_opski_iopriosched_remote_wakeuptag_alloc_policymemcpyfreehightracing_graph_pauseread_iter_MPI2_REQUEST_DESCRIPTOR_UNIONsuspend_latefront_padsdev_devi_rwsembi_integritydriver_nameis_addedexitio_uringeh_device_reset_handlerchild_ns_typediagnostic_flagspci_devBoardNameslave_bdevscommit_dqblkclass_local_lock_irqsave_is_conditionalpcie_sglmark_dirtynr_ctxkernfs_opsoom_reaper_timermodulebd_security_entire_mapcount_base_put_smid_mpi_ep_scsi_ioqueue_lockfast_pathf_pathstatic_call_siteself64_sym_base_release_memory_poolsunlinkcur_bus_speedcpumask_var_t_MPI2_DEFAULT_REQUEST_DESCRIPTORtime64_tdrivers_diri_gidmap_queuesFORTIFY_FUNC_strnlenrq_qosmark_deadicq_hintrmdirdq_dqbspeedmemory_failureblkcg_gqdma_flagsSUBMITTED_BY_BLOCK_LAYER_MPI26_HASH_EXCLUSION_FORMATmax_hw_sectorsoriginator_MPI2_SAS_IOUNIT_CONTROL_REPLYselectors_mtdmod_kallsymss_typeMpi2IOCInitReply_tirq_poll_schedremount_fsbd_holderdelayed_sc_listtask_delay_infopi_sesubsystem_vendorOffsetin_useSAS_PHY_DISABLEDrq_countMIGRATE_SYNC_LIGHTerrseq_ttransparentkstatfsid_tablemems_allowed_seqSDEV_EVT_LASTmax_user_discard_sectorsunusedWhoInittarget_allocbug_listhigh_iops_queuesmax_nr_cidmod_arch_specificHCTX_TYPE_READDMA_NONEtransfersizesharebpf_net_contextLookupMethodis_msi_managed_MPI25_IEEE_SGE_CHAIN64ftrace_timestampbi_iopriod_ino_warnskernfs_elem_attrreset_preparei_ctime_nsecNumSlotsfw_events_cleanuptry_ioapici_private_listbinfmtftrace_sleeptimei_stateno_d3coldSCSITriggerEntrybv_pagedoorbell_regpcpu_cidsupported_speedsmessage_controlsched_migratedchildMPI2DefaultReply_tdup_xol_addrdevice_configurepci_error_handlersPROBE_PREFER_ASYNCHRONOUSdma_set_maskrcu_node_entryno_vf_scanreverse_orderingMpi26IoUnitControlReply_tfile_system_typeorig_ret_vaddrmmu_notifier_subscriptionsdefault_groups__sifieldsMSIxIndexnr_watchesDL_DEV_DRIVER_BOUNDAdapterOrdersmidcurr_ret_depthstarved_entryMpi26NVMeEncapsulatedRequest_tSCSITargethba_msix_vector_count__fillerdestroy_dquot__task_fpstatefilldir_ttry_32bit_dmampt3sas_perf_modeget_reserved_spaceremote_identifyioprioKMALLOC_NORMALcreatedirtied_time_whenstart_scan_seqperf_rdpmc_allowedsym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerpci_alloc_irq_vectorsbd_openersdq_inuseclass_maskChassisSlotofflinedev_pm_infomremapin_memstallhost_self_blockedtph_enabledpoweroff_latei_nlinkwakeupcb_list___GFP_IO_BITdirect_iocpu_idscsi_host_busypushable_tasksraw_atomic_readdriver_overrideprev_fw_factstty_audit_bufmaxlenkernel_cap_tptm_enabledIRQ_NONEbpf_funcmems_allowedreply_free_dmaMpi2ManufacturingPage0_tSAS_LINK_RATE_G2s_inode_lrucached_rqsd1_supportinternal_dmaset_sizemmap_compat_baseprepareconfig_cb_idxclock_op_might_sleepf_sb_errneed_mbd_namecheck_flagsi_sequence_base_put_smid_scsi_io_atomicrt_priorityrequest_szkretprobe_instancesHashExclusioncrypto_profile__be32iov_basecpus_ptrq_lockdep_map_base_update_diag_trigger_pagesloadfuncscpu_bitmap_MPI2_SAS_IOUNIT_CONTROL_REQUESTpci_error_recoverySTARGET_DELMPIEventCodeSpecificatomic_write_lensaved_tfHCTX_TYPE_POLLcfg_sizexa_headdetach__UNIQUE_ID_x_617SAS_PROTOCOL_SATAremove_hostproperty_read_string_arrayget_statetracepoint_funcd_seqRequestDescriptorPostLownuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmtExtPageTypekthread_create_on_node__be64out_unlockedblkg_listnum_symtabexec_update_lockfscrypt_inode_infosplice_readneed_qsctx_mapbd_disknumberszone_wplugs_wqpMpi25IeeeSgeChain64_tDMAFlagsApplicationTagTranslationMaskWRITE_LIFE_SHORTsigpendingpi_entrys_inodesdirtied_when_MPI2_CONFIG_PAGE_SASIOUNIT_1MIGRATE_ASYNCmsix_disablenext_scangsindexcompletempt3sas_config_set_ioc_pg1_MPI2_SEP_REQUESTwatch_listeh_abort_listd_sibmodule_attributeinstrument_atomic_read_writemax_host_blockedslot_reset__builtin_memsetneed_tsin_dpm_listrdpq_array_enable_assignedwordwork__list_add_valid_or_reportDescriptorTypeDependent1multiprocessquiesce_depthclass_task_lock_is_conditionalvphys_maskdma_pool_createtask_groupf_pos_lockshpc_managednum_physbio_pooltimeout_workwrite_endLoadAddresssrcu_barrier_completionirq_poll_enablepacctblk_mq_tag_setcurr_targetreset_typevm_page_protbitmapplist_nodefile_ref_tMpi26ComponentImageHeader_tdqi_max_spc_limitFORTIFY_FUNC_strcatperf_event_contextatomic64_tnoinstr_text_startHRTIMER_RESTARTrpm_autosuspend_delayis_thunderboltSlotbusystack_canary_base_request_irqreply_post_free_dma_poolnon_operational_loopmax_write_zeroes_sectors_utimetmf_work_q__fortify_size_MPI2_CONFIG_REQUESTMPI2_IEEE_SGE_SIMPLE_UNION_flags_1_flags_2__ptrtaskstatsmpt3sas_base_release_callback_handlerMPI26_PCIE_ENCAPSULATED_REQUEST_DESCRIPTORposix_acli_dio_count__UNIQUE_ID_y_609_MPI2_PORT_FACTS_REQUESTmfg_pg1SL_WH_EVENT_TRIGGER_Tarch_rwlock_taddend1addend2driversym_timens_page__UNIQUE_ID_y_611__UNIQUE_ID_y_614waitersoffsetprot_guard_typedev_iommumap_typeclass_rwsem_read_intr_is_conditionalcompletionnode_stampclass_raw_spinlock_nested_is_conditional__UNIQUE_ID_y_620fiemaprcu_usersDiagRWAddressHigh__UNIQUE_ID_y_626__UNIQUE_ID_y_628SDEV_BLOCKbacking_dev_infoi_mappingctl_cb_idxIOCCapabilitiesdiscard_alignmentbsg_deviceshow_stats_res_base_add_sg_single_32__UNIQUE_ID_y_630__UNIQUE_ID_y_632mpt3sas_base_update_missing_delay__UNIQUE_ID_y_635__UNIQUE_ID_y_637__UNIQUE_ID_y_639s_vfs_rename_keysubmitteretypei_bytes___GFP_WRITE_BITnormal_priompt3sas_base_map_resourcesWQ_UNBOUNDSDEV_CREATEDshost_datadispatch_wait__UNIQUE_ID_y_641srcu_node__UNIQUE_ID_y_643config_rrs_svlast_mm_cid__UNIQUE_ID_y_649chain_pages_MPI26_NVME_ENCAPSULATED_REQUESTis_busmastervaddrscsi_vpderr_handleris_softnext_cpuspin_unlock__UNIQUE_ID_y_651grab_current_nspci_access_mutexminimum_linkrate_hwclass_names__param_str_perf_modeMaxReplyDescriptorPostQueueDepthlock_class_keympt3sas_atto_initsum_exec_runtimecompatible_base_add_sg_single_64setupdev_pin_infoinvalid_dword_countpoll_table_structmce_whole_pageia_modercu_tasks_holdout_listsched_rt_mutexloadsmpt3sas_free_enclosure_lists_pinsout_free_resourcesskip_init_reply_post_host_indexnon_seqfifo_timeNumSCSISenseTriggerhctx_listrenamemajorktime_tparam_get_intonstackPRJQUOTAlocal_max_msix_vectorskprobe_blacklistjump_entriesdio_offset_alignreserved_tags_base_clear_outstanding_mpt_commandsdma_masksa_restorerqueuelistdatalenmkdirio_missing_delaynextrelax_countrestore_earlyPCI_NUM_RESOURCESPIDTYPE_TGIDilenMaxPersistentEntriesprp_pagemax_active_zonesdevice_physical_location_horizontal_positionpci_read_config_word__list_add_MPI2_SGE_SIMPLE_UNIONkobj_uevent_env___GFP_MOVABLE_BITkprobes_text_startSDEV_EVT_ALUA_STATE_CHANGE_REPORTEDDiagRWAddressLowpid_typestargetfown_structi_default_aclfregs_statephy_identifiershift__devicesFORTIFY_FUNC_strcpypendingNVDATAVersionfirmware_event_threadIODeviceMissingDelayioc_pg1ioc_pg8dma_boundarybd_nr_sectors_MPI2_CONFIG_PAGE_MAN_0__intSAS_LINK_RATE_6_0_GBPSnr_eventsconfig_page_dmakstatanon_vma_namerequest_threaded_irqSGLFlagsdq_hashsbitmap_weight_MPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTOR__iovgp_stategrphintabiommu_mm_datachain_physzone_wplugs_err_listma_flagsarch_uprobebio_issueold_factsDL_DEV_UNBINDINGchaincurrent_taskKMALLOC_RANDOM_ENDbroadcast_aen_busyport_numrefcountmem_unitBLK_MQ_UNIQUE_TAG_MASKMpi26DriverTriggerPage1_tsrcu_reader_flavorinternal_free_listtimerqueue_nodereal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_allowedis_scsiio_requse_16_for_syncrt_mutex_waiter_src_charsReportDeviceMissingDelaySAS_PROTOCOL_ALLmmio_always_onlegacy_mempage_pooldq_dqb_lockdiag_trigger_eventf_flagsblk_qc_tshow_info_base_pre_reset_handlerslave_allocflush_requiredsg_tableattributesblk_queue_statsgrplokgid_terror_detectedkey_userpci_channel_state_treadlinkoffline_disabledd_comparei_wb_frn_winnerqspinlock__UNIQUE_ID_max_sgl_entriestype593__compiletime_assert_451sighand_struct_base_get_mpi_diag_triggerssas_hbastart_brksas_loginfoSenseKeydio_completeshost_statelocked_pendingmpt3sas_base_initialize_callback_handlerBootFlagsbase_readlMpi25FWUploadRequest_tscmd_printks_idmpt3sas_base_free_resourcescore_statereply_dmaalignsym_int80_landing_padscsih_cmdsngroupspme_pollMPI2_DEFAULT_REQUEST_DESCRIPTORsp_offset__sigrestore_tRPM_SUSPENDEDsystem_highpri_wqDMA_TO_DEVICEmutexattrsbi_sectoreh_deadlinempt3sas_config_set_manufacturing_pg11fsbasesrcu_barrier_mutex_keyswregs_state_base_clone_to_sys_mem__kernel_timespeceh_should_retry_cmdhpr_lookuppci_set_masterioc_reset_in_progress_lockWQ_HIGHPRId_lrud_fieldmaskcountersfaults_disabled_mappingnameidatafailedpoweroffuntrusted_base_get_chain_physnr_msix_vectorsminorsmpt3sas_scsih_reset_done_handlermpt3sas_base_check_for_fault_and_issue_reset_MPI2_SCSI_IO_REQUESTelemsizerlim_curFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagreadldebugfs_entrywaituptimeshow_rqcan_queuefw_event_listst_shndxreservedSL_WH_SCSI_TRIGGERS_Ti_wb_frn_historyctxsprocess_keyringset_dqblkPCI_BRIDGE_RESOURCESmpt3sas_config_update_driver_trigger_pg1mpt3sas_config_update_driver_trigger_pg2mpt3sas_config_update_driver_trigger_pg3mpt3sas_config_update_driver_trigger_pg4restart_blocks_opbi_end_ioATTO_SAS_ADDRESSkobjectposix_cputimer_baseleveluser_definedpcie_target_idcow_page__warn_printkmsix_indexnanosleepfalsetemppi_state_listtv_secac_exitcodeLookupAddresssuid_base_process_reply_queueKMALLOC_RANDOM_STARTpci_cfg_access_lockMsgLengthdismissi_hashmm_cid_next_scanenable_sdev_max_qdfreeze_noirqoublockcancel_delayed_work_sync_base_get_scsi_diag_triggersia_atime_timerhotplug_slotparam_set_intrespondingvm_private_dataskip_ms_page_8work_bitsTargetCommandBuffermmap_lockmask_interruptsmpt3sas_port_enabledq_freeSHOST_RUNNINGrootmpt3sas_scsih_clear_outstanding_scsi_tm_commandsfind_next_and_bitgot_task_abort_from_ioctlpolicycpu_base__real_strnlenraid_device_listMPI2_ADAPTER_ORDER_AUXsize_mulcap_bsetImageTypenr_itemschain_offsetseq_startbp_regbvec_poolrb_root_cachedwwidwriteli_blkbitswritervm_pgoff_base_build_sg_scmdMPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTOR_refcountcsum_typebin_attributesuccessmath_emu_infopushable_dl_tasksValidEntriestestmanu_pg0sched_infogroup_infotailseh_eflagsend_addressdqi_fmt_idDataLengthdevice_missing_delaysoftirq_next_timerrevisionis_child_subreapersg_tablesizeexit_codefile_lock_contextwriteback_indexfiemap_extent_infofilemempool_free_tProductIDrt_spc_warnlimitptr_first_sglcmndatomic_write_hw_unit_mintimer__empty_rangessbq_wait_statedev_namei387__p_sizeMpi2ConfigReply_tWORK_OFFQ_POOL_SHIFT_base_put_smid_fast_pathd3hot_delaywb_err_base_get_master_diag_triggersbudget_tokenhba_vphywrite_dquotf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachestorebi_bdevst_infoNumIOCStatusLogInfoTriggerdispatchdescpdescsquiesced_bydqi_max_ino_limitllseek_MPI2_CONFIG_PAGE_HEADERlocal_fwnodeRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessiblebudget__UNIQUE_ID_max_msix_vectorstype599msg_dmano_d1d2get_projidbuild_sg_mpiprp_entry__sectorpart0cnvcswmsix_basecallskqidmem_cgroupfree_inodesiglockwait_queue_func_tperf_recursionnr_wakeups_remoted_spacei_ctime_sec_base_display_reply_infodebugfs_id_base_sync_drv_fw_timestampnext_timer_typeTT_NATIVEMPI26_DRIVER_IOCSTATUS_LOGINFO_TRIGGER_ENTRYhlist_bl_nodenum_descsmpt3sas_config_get_iounit_pg0mpt3sas_config_get_iounit_pg1mpt3sas_config_get_iounit_pg8freeram_head_1_head_2clockiddelayed_work_timer_fn_MPI2_SCSI_IO_CDB_UNION__read_overflow2_fieldFREEZE_MAY_NESTMpi2IOCInitRequest_tsym_hvclock_pagetotal_szEventDataLengthremap_file_rangeloginfommap_legacy_basesubcodeend_dataxa_lockfutex_exit_mutexuse_16_for_rwiommu_group_base_get_ioc_factsProxyVF_IDEventContextmempool_alloc_tdevice_get_dma_attrtarget_blockedis_triggerMpi2BiosPage2_tMpi2FWImageHeader_talloc_inodepayloaddirty_foliofscrypt_keyringActionis_hardasync_sizetrap_nrf_iocb_flagsnvme_abort_timeout__flagsmultifunctiontotal_vm_MPI2_CONFIG_PAGE_SAS_ENCLOSURE_0iteratoruse_32bit_dmalastpool_dataqf_opsforce_atomicskip_bus_pmrsvdreal_credno_difblkcnt_td_rt_spacesigned charpcie_cap_lockhas_child_subreaper_base_get_chain_buffer_trackermountreply_post_free_dmablk_flush_queueres_attr_wcsched_entitydev_links_infos_uuid_len___GFP_RETRY_MAYFAIL_BIT_base_get_msix_indexdqi_priv_base_allocate_reply_poolINIT_LIST_HEADHostPageSizeIOCRequestFrameSizefmode_trpm_autosuspendsweventremove_busactivatefxregs_state_MPI2_RAID_ACCEL_REQUEST_DESCRIPTORMpi2IOCFactsRequest_t__bad_udelay_lowerreply_szidentifypaddingDEVICE_REMOVABLEVF_IDtimer_rand_statearch_atomic64_add_returnrequest_hdr_base_add_sg_single_ieeellist_nodeNVMe_Commandbpf_run_ctx_MPI2_HIGH_PRIORITY_REQUEST_DESCRIPTORbio_slabDCRAddressstate_add_uevent_sentMpi2SasIoUnitControlRequest_tNextImageHeaderOffsetenv_startno_write_samemodule_notes_attrsio_cqsystem_freezable_wqControlFlagsrangebvecacct_vm_mem1on_cpumanage_system_start_stopReasonCodestringSHOST_CANCEL_RECOVERYnuma_preferred_niddmd_newmemsetfree_diskvmem_altmapchain_buffer_dmabiotailwait_start_MPI2_ADAPTER_INFOelevatorspinlockBLK_MQ_UNIQUE_TAG_BITSsrcu_barrier_seqfwpkg_data_dmai_aclptm_granularitynr_msixtrigger_info_dwordsnofaultia_rangesq_size_fieldHostTraceBufferDecrementSizeKBis_reltablepteval_t__param_max_queue_depth_MPI2_IOC_INIT_REQUEST_MPI2_IEEE_SGE_SIMPLE32blk_mq_tagsDEVICE_PANEL_LEFTorc_unwind_ipdiag_buffer_statustm_custom_handlingrel_deadlinekobj_typeskip_settle_delaysb_writersdma_cleanupeh_timed_outdriver_datampt3sas_fwfault_debugis_iouring_poll_qphys_addr_tcurrent_timedma_iommumax_idirq_saferescue_lockdefault_timer_slack_nsxregs_statedelays_statecompletion_cntssleep_deferred_listcurr_nrset_child_tidbio_vecacpi_match_tablenfdsrlimit__UNIQUE_ID_msix_disabletype595SCSISenseTriggers_MPI2_IEEE_SGE_SIMPLE64__UNIQUE_ID_mpt3sas_fwfault_debug603HeaderSizeIRQ_WAKE_THREAD__list_del_entry_valid_or_reportmpt3sas_base_wait_for_coredump_completionidle_notificationmodule_stateWORK_OFFQ_FLAG_SHIFTMPT_BUILD_SG_SCMDwait_lockf_pipegetgeowrite_iterMaxDevHandleD_REAL_DATAEventValueacct_timexpdclock_mutexchain_segment_sznr_failed_migrations_runninguserfaultfd_ctx__UNIQUE_ID_max_queue_depthtype591event_flagsthread_structpci_irq_get_affinitymm_context_tcurr_buffenclosure_handlebd_stamp_base_spin_on_doorbell_intdio_mem_aligncstimereplyMPI2_CONFIG_EXTENDED_PAGE_HEADERprot_capabilitiesatomic_long_trpm_requestirq_reroute_variantpci_srioviounmapMQ_RQ_COMPLETEio_comp_batchhi_priority_dmadma_alloc_attrsf_credtrace_events_MPI2_SCSI_IO_CDB_EEDP32Checksumd_iputrdpq_szReqBootDeviceFormMPI2_VERSION_UNIONnr_wakeups_syncretry_allocationstackSAS_LINK_RATE_G1blockedchain_reqmpt3sas_nvme_cmdallowedmce_countweightblk_plugtrc_reader_nestingfpstateiounit_pg1_flags_base_readl_aerosgeltag_setis_roxno_scsi2_lun_in_cdbprevseqcount_raw_spinlockschedule_timeout_MPI26_CONFIG_PAGE_PIOUNIT_1paddrbios_paramdma_pool_allocnum_orcsFORTIFY_FUNC_kmemdupDevHandlebuflenmpt3sas_base_resume_mq_pollingTransferLengthWRITE_LIFE_LONGMPI25_IEEE_SGE_CHAIN64ari_enabledexpiry_activeeh_bus_reset_handlerscsi_dma_mapmtd_infoenclosure_levelis_confidentialreset_in_progress_mutexi_dentryfixupswq_misc_constspcie_sg_lookupvm_endvm_structmemcgfsync_MPI2_IOC_INIT_RDPQ_ARRAY_ENTRYsgidcompat_robust_listnuma_workprioprivsi_meminfovalueReplyFlagsreply_qcurrent_stack_pointerac_minflt_hugetlb_cgroup_msecs_to_jiffiesPackageNameWhatset_policyinternal_taghide_flagthreadftrace_callsitesuint64_tmpi_reply_szmmlistconfig_vaddrusecpage_typeclass_spinlock_is_conditionalReplyDescriptorPostQueueAddressusermynodeseq_stopWORK_BUSY_PENDINGblk_trace_MPI26_CONFIG_PAGE_DRIVER_TRIGGER_0_MPI26_CONFIG_PAGE_DRIVER_TRIGGER_1_MPI26_CONFIG_PAGE_DRIVER_TRIGGER_2_MPI26_CONFIG_PAGE_DRIVER_TRIGGER_3_MPI26_CONFIG_PAGE_DRIVER_TRIGGER_4alloc_workqueueactionentry_lenpi_waitersdoe_mbsEventData_base_sas_log_infohi_priority_depthatomic_tpcp_listdiag_trigger_masterqueue_flagsMPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTORrb_rootExtPageLengthsubsystem_devicesas_phyutf8data_tablecpu_msix_table_szSAS_LINK_RATE_FAILEDexe_filePUT_SMID_DEFAULTWordSGLOffset0SGLOffset1SGLOffset2SGLOffset3uid_telementshpr_free_listd_fsdataoriginator_strkey_restrict_link_func_tepoll_watchesrandompm_subsys_dataSASBroadcastPrimitiveMasksPortTypedef_flagssrcu_n_lock_retriesraw_locksrcu_structprp1prp2is_guestio_minatomic64_add_returnsplice_eofs_sync_lockanon_vma_chainSASNotifyPrimitiveMasksi_mtime_nsecrseq_event_maskem_pdi_fsnotify_maskshared_pending__int128__mce_reservedwriteback_controlmm_struct__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEreset_timeoutbuild_ids_export_opMPT_ADD_SGElen_descseg_boundary_maskWQ_SYSFSanon_namesched_dl_entitypp_ref_countactivest_otherstartparentlookupkernel_siginfostart_scan_sigpoll__compiletime_assert_109SDEV_CANCELkill_sbMaxTargets__bi_remainingnum_bugsnr_requestssecurity_supportedadapter_reply_queuestate_entry_ptrmpt3sas_base_get_msg_framestatsactive_baseschain_depthDEV_DMA_COHERENTswap_slot_free_notifyunsafe_warnconfig_cmdsstart_databoolbv_len___GFP_RECLAIMABLE_BITinquirymodsctimedestroy_inodefutex_pi_stateSL_WH_EVENT_TRIGGERS_TBoardTracerNumberNegotiatedLinkRatei_mutex_dir_keyrescue_workrestartsASCQdevice_physical_location_vertical_positionget_aclset_aclrdpq_array_enableMpi26DriverTriggerPage2_ts_voppercpuLengthpci_dynidsdescpoll_bioiterate_sharedsym_vdso32_sigreturn_landing_padcma_areafeaturesrcu_tasks_exit_cpumigrate_from_cpubd_size_lockwriteerror_codebuddy_list_MPI2_RAIDCONFIG0_CONFIG_ELEMENTldt_structSASNarrowMaxQueueDepthcred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_nameVTIME_INACTIVEeh_target_reset_handlerclass_preempt_is_conditionaltimeouturing_cmdshrinker_idnr_dirtiedgetattrsetattrPageVersionfixupblockMQ_RQ_IDLEdevtlast_cpuprocdirnr_wakeups_localuidhash_nodeworker_privatepoll_eventlinelinkbi_poolphysfnbi_cookiePageAddressmodeMpi2IOUnitPage3_t___GFP_NOWARN_BITport_table_listmpi_tgEnclosureLogicalIDnode_idtargetget_nextdqblkrcu_tasks_idxMpi2ManufacturingPage1_t__ret_do_oncejournal_infobi_inline_vecstqheadlast_used_atrq_end_io_retsensehres_activemod_name__q_sizenotes_attrsdelay_workblock_device_operationsoffset_ctxbi_blkgFREEZE_HOLDER_KERNELlast_switch_time_config_free_config_dma_memoryrphywakeup_countwait_indexrunnable_weighthostdiag_unlock_mutextarget_busyclass_releaselast_sum_exec_runtimeResyncRatedd_key_truesa_handlercg_listscsi_transport_templatelocked_vmNOIOBqueue_rqaddressmq_hctxDefaultstart_timezone_wplugs_hashcookielistRequestCreditreply_free_dma_poolsig_okextabledma_data_directioni_sizeentry_eipsplice_pipexstate_headerinquiry_lendma_addrpage_dmaAddressReplyem_perf_domaind_flags___GFP_HIGHMEM_BIT_large_mapcountpid_namespacelive_MPI2_RAIDPHYSDISK0_INQUIRY_DATAclock_was_set_seqspc_warnlimitseqcount_t_MPI2_ADDRESS_REPLY_DESCRIPTORmin_fltblock_deviceMEMORY_DEVICE_GENERICpkruprojid_tvendordma_lengthkey_payloadadd_linkspinnedsubsys_datause_10_for_ms_dummy_bndsaved_stateparent_exec_idutil_sumdd_key_falsesigvalmpt3sas_config_get_bios_pg2mpt3sas_config_get_bios_pg3fsnotify_mark_connector__ubuf_iovecsize_is_constantcputime_atomicdeadlinereset_methodsbio_integrity_payloadlun_in_cdbexit_requestwait_queue_upperclass_write_lock_irq_is_conditionalswap_readahead_infovtimeexpecting_cc_uas_rootstack_refcountgrpmaskpm_caps_remove_countlru_genwrite_newuser_namespaceclass_rwsem_write_is_conditionalpids_active_resethlist_nodeNegotiatedPortWidthblk_features_tsuper_operationsautosleep_enabledwrite_file_infoload_sumresourceaddress_spacecpus_maskdl_yieldedstarget_datafile_dispread_newd_spc_softlimituse_10_for_rw_MPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTORkrefrseq_css_lock_keybuild_zero_len_sge_mpidqi_flagspdevmq_ctxjump_entrypi_top_taskDoorbellpacct_structRPM_REQ_RESUMEreq_boot_deviceuser_sizeis_aero_iocmpt3sas_wait_for_iocats_caplast_queue_ramp_upbd_statsMpi2SystemInterfaceRegs_tshow_fdinfoFAULT_FLAG_MKWRITEput_budgetfadviseclass_read_lock_irq_is_conditionallinenoMODULE_STATE_LIVEtask_listasync_scanFAULT_FLAG_RETRY_NOWAIT_qprocread_foliosc_data_directionhas_elevatordq_countvpd_pg0nlinksignalshutdown_latencynr_wakeups_passiveself_exec_idstate_syncedws_activef_epsriov_set_msix_vec_countPhysDiskSettingsrcu_specialscsi_device_handlerentrybacksda_is_staticd3cold_allowedsz_config_pgcntsrequest_trackersock___GFP_THISNODE_BITsdev_bflagsdispatch_fromdqio_semis_driver_loadingmq_freeze_wqstart_prevent_timepgd_tchain_lookupsigset_t_debug_dump_replyOEMRDbucket_idLocationSL_WH_MASTER_TRIGGER_TMpi2BiosPage3_tgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64i_inoserver_has_tasksAttachedPhyInfo_killi_spc_warnlimitbuild_zero_len_sgeunderflowf_posperformancesoftowner_trapnoload_weightio_windowsymlinkclass_rwsem_write_try_is_conditionalkmalloc_noprofbd_queuein_iowaitDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclbdi_writebackrb_leftmostbug_addr_dispmigration_pendingscan_mutexhosttd_realMaxSasExpanders_MPI2_RAIDVOL0_SETTINGSdevice_get_match_datahdr_types_max_linksscatterlistthread_headacquire_dquotclockid_ttarget_destroyzone_capacityFORTIFY_FUNC_strlen_MPI2_VERSION_UNIONpref_64_windowpgdval_td_manageshost_recoveryNumberOfPortsSAS_SATA_PORT_SELECTORmfg_pg10_hide_flagmpt3sas_config_get_expander_pg1max_device_blockedback_padMIGRATE_SYNCdiag_trigger_activewcharRQ_END_IO_FREEHCBSizeseq_fileulongrestoresge_sizeHPROBE_LEASEDBoardAssemblyHostInterruptMaskthaw_superis_managedalt_len_MPI2_DEFAULT_REPLY_DESCRIPTORseq_operationsfallocate_call_addrfree_chain_list_MPI2_BOOT_DEVICE_DEVICE_NAMEi_mmap_rwsemundo_listis_probedattribute_groupdma_poolspersonalityprintk_index_sizeMPI2_BOOT_DEVICE_SAS_WWIDConfigNummsix_enableMPIEventTriggersuprobe_task_statestimestatic_priotmpfiledqi_formatnvcsw_nr_pages_mappedfrequencydev_pm_ops__kmalloc_indexirq_poll_scheduledalloc_hintsense_dma_poolblk_mq_ctxno_updateiter_typeDEVICE_PANEL_BOTTOMVolumeTypetransporttreply_post_host_indexMPIEventCodeSubsystemIDnr_wakeupsenabledki_filpmultiple_queueswork_func_tpp_magicfpu_state_permGenericFlags0barsfwnode_reference_argsdevres_headbus_listdpc_rp_extensionsscsih_cb_idxRPM_REQ_IDLEShutdownLatencyfilenamebased_pruneDiscoveryStatusrestore_noirq_MPI2_SYSTEM_INTERFACE_REGSsysfs_registeredrlocksas_node_locki_rt_spc_warnlimitqueuedevice_remove_in_progressbytesnuma_migrate_retryMEMORY_DEVICE_COHERENTenclavefilterroot_blkgd_revalidate_MPI2_IEEE_SGE_CHAIN_UNIONtracepoints_incoredqsMPI2_SGE_IO_UNIONi_opreplyPostRegisterIndexquota_syncsrcu_have_cbsasync_in_progresssignumdqi_dirty_listpi_locktimespec64scan_finishedcpu_addrnr_forced_migrationsumount_begin_MPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTORchannelbadblocksblocking_handlesport_idkernfs_node_MPI2_DEFAULT_REPLYcpumaskptrace_messageExpanderRouteIndexeslength_boot_devicetag_listbio_alloc_cachepdt_1f_for_no_luni_wb_frn_avg_time_pincountreclaim_statedrv_internal_flagsruntime_errori_sb__poll_tsubvolon_dispatchdirty_inodesymtabd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structfs_parameter_specrcu_data0real_blockedruntime_suspend_MPI2_BOOT_DEVICE_ENCLOSURE_SLOT__s16DMDReportPCIebacktraceoffline_alreadys_umountHostTraceBufferMaxSizeKBon_listNvdataVersionDefaultIOCLogInfo_MPI2_CONFIG_PAGE_IOC_1_MPI2_CONFIG_PAGE_IOC_8data_vmneeds_force_resumeblk_eh_timer_returnFunctionsas_device_init_listMPI2_RAIDCONFIG0_CONFIG_ELEMENTrpm_statusCoalescingDepthscsi_host_state__s32p_sizechildrencheck_eventsdqi_bgracei_wbhost_nof_inodeserialburstaer_capscsi_target_statehostmsi_device_dataMasterTriggersslave_destroykallsymsi_ino_timelimitbi_issuebd_holder_opsphy_masksrcu_idxSTARGET_CREATEDutil_est__s64hugetlb_usagesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenacct_rss_mem1___orig_eipsrcu_datadevice_physical_locationchains_per_prp_buffer__keycgtimepagefault_disabledindexMpi2ManufacturingPage10_ts_time_maxdelayed_workopen_partitionssa_maskmmappedMPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORElf64_Wordactive_timeatomic_flagscallernum_jump_entriesextra_lenPIDTYPE_PGIDelemend_ioquotalensrcu_data_have_cbsnivcsw_tidioc_pg1_copymce_vaddrMPI26_PCIE_IO_UNIT1_PHY_DATAdl_dev_stateshowrb_subtree_lasts_listadd_busunique_idmq_pollnr_segssame_target_siblingsof_match_table_entryino_timelimitparent_devalternative_gpt_sectori_readcountblkcg_polsOfflineReasonincrmpt3sas_config_get_phys_disk_pg0freepasid_enabledlock_countthrotl_datareply_dma_max_addresslist_lru_onei_pagesmxcsrrom_bar_overlapclass_rcu_is_conditionalarchdataptrace_entryguest_permwait_queue_headnum_srcu_structsLinknr_activeprev_sum_exec_runtimei_flagsgendisku_flagstag_set_listMPI2_RAIDPHYSDISK0_INQUIRY_DATAlogical_block_sizeinvalidate_lock_keyinfol1d_flush_killMPI2_IEEE_SGE_SIMPLE64write_beginSHOST_CANCELwrite_infohrtimer_restarts_encoding_flagssessionidd3cold_delays_time_minvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrs_stack_depthFlags__vm_flagssdev_statequeue_depthinternalpm_messagefred_cschangedcur_ktimeinitfop_flags_tgroupsoffstty_structnotify_nextvirtual_dr6dma_opsreset_wq_MPI2_CONFIG_PAGE_SAS_PHY_0_MPI2_CONFIG_PAGE_SAS_PHY_1dma_addressmmap_basebd_devsyscall_workinit_cmd_privMpi26DriverTriggerPage3_tlockdep_mapnum_trace_evals_addr_bndset_dbd_for_msnumberzone_device_dataquota_readpinned_vmreventswritepagesnuma_faults_localityqrwlock__write_overflow_fieldNumMPIEventTriggerrw_semaphorefirst_minori_blockstask_fragTimeSyncIntervalsource_listsum_block_runtimeHostTraceBufferMinSizeKBioc_reset_countnuma_scan_period_maxtotal_timepowerrequest_queuenum_ei_funcsi_generationSAS_LINK_RATE_3_0_GBPSflushonline_MPI2_CONFIG_EXTENDED_PAGE_HEADERno_vpd_sizeformatlast_switch_countsge_size_ieeelast_wakeeswapuint32_tssize_tphy_belongs_to_portRQ_END_IO_NONEvtime_statepci_ers_result_ttry_vpd_pagesPinout__ret_condEnclosureNames_blocksizequeue_numprevent_sleep_timeclass_spinlock_irqsave_try_is_conditionals_readonly_remounteh_should_retry_cmdi_io_listChangeCountchild_countpcie_bwctrl_dataVTIME_IDLEDeviceIDcompat_uptr_treply_dma_min_addressDEVICE_HORI_POS_LEFT_hugetlb_subpoolend_pfnuclamptgidlimits_lockreleasenr_wakeups_migratestack_vmi_fieldmaskupidinsntrace_evalsia_vfsuidmpt3sas_config_get_bios_pg4quota_format_opsprocenti_datarescue_listfsverity_infocore_threadclosidsched_avgcodesyscore__i_nlinkpmd_tScratchpadsrcu_barrier_cpu_cntreadaheadopt_sectorshrtimer_cpu_baseirq_domainwait_liststatic_call_trampfsverity_operationsreply_post_queue_depthcoublockbug_tablemigrate_modeevent_tgBlockSizeusing_gplonly_symbolsremovedhandleremulatedsym_vvar_pagemembarrier_statedma_pad_masksas_addressbin_sizeFORTIFY_FUNC_strlcatrcu_read_lock_nestingMpiSimpleCoalescingTimeoutrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_tio_bitmapDEVICE_VERT_POS_CENTERZoneGroupretry_countsbitmap_wordlong unsigned intmax_timelast_queue_full_countread_file_infoexec_startia_sizempt3sas_config_get_ioc_pg8io_queue_numRPM_RESUMINGMODULE_STATE_COMINGsym___kernel_sigreturninit_completionFWVersiondma_alloc_coherentuser_cpus_ptrd_opstate_initializedpend_os_device_add_szrelease_dquotplugsoftirq_activatedresid_leninv_weightVolDevHandlesecurityMpiChainGlobalFlagskernel_symboldl_timerlockdep_map_pmodule_param_attrsno_read_capacity_16scsi_host_template__user_state_sizechainedVTIME_GUESTretriessdtrsysvsemdisconnectstashedpasid_no_tlpuser_xfeatures__kmalloc_cache_noprofuse_memdelayMPT_BUILD_SGnr_cached_objectshas_timeouttime_sync_intervalcommcallback_headexception_table_entryin_hrtirqdelayed_event_ack_list_overruncondDEV_DMA_NON_COHERENTcoredumpd_sbio_lock_cls_keyksetno_msisleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsnodesysvshmno_highmemfirstport_enable_cb_idxMPI26_DRIVER_MASTER_TRIGGER_ENTRYactive_countnr_active_requests_shared_tagsnum_tracepointsueventsharednext_cpu_batchdisk_eventss_sysfs_namesigval_tcombined_reply_index_countSDEV_QUIESCEbitsbase_pfnclass_mutex_try_is_conditionalresource_size_tmpt3sas_config_get_number_hba_physRAIDSetNumsem_undo_listcompat_rmtpclass_local_lock_is_conditional_MPI2_SAS_IO_UNIT1_PHY_DATAdiag_trigger_mpistatic_key_true_stimeAdapterOrderAuxperf_event_ctxpfwfault_debugcostxcomp_bvio_contextmsix_enabledPIDTYPE_PIDwakee_flipsvlagMaxPortConnectionsufdssegment_boundary_maskReceptacleIDioctlprev_cputimesaved_cap_spacehorizontal_positionem_perf_tablebi_crypt_contextSAS_PROTOCOL_NONEprivateswp_entry_tcharmatchnr_failed_migrations_hotreg_offsetAddress32queue_stoppedFORTIFY_FUNC_UNKNOWN_MPI26_DRIVER_IOCSTATUS_LOGINFO_TRIGGER_ENTRYbin_attrscpu_itimerMPT3SAS_FLUSH_RUNNING_CMDSdevres_lockMpi2BiosPage4_tfiles_struct__ret_onceblk_zoneSDEV_RUNNINGicq_treevfsuid_tf_lockexec_vmkernel_paramMPI2_MANPAGE7_CONNECTOR_INFOvertical_positionshutdown_prerelease_foliobi_io_vecpri_capget_msix_index_for_smliovendor_idmtimearchrobust_listasync_probe_requestedthaw_earlySAS_EDGE_EXPANDER_DEVICEvectors_securitysplice_writeport_enable_failedparam_lockreq_listi_opflagsdentry_operationsstats_sectorss_blocksize_bitskfreeaccess_statusenclosure_logical_idexp_hintclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapdevice_remove_in_progress_szpfacts_head_2asym___kernel_vsyscallopen_muteximm_readyfortify_funcStartSlotget_timeki_flagss_inode_wblist_lockioc_link_reset_in_progresspermchain_bufferdestroy_workMpi2RaidVolPage0_tlockableuprobes_statemm_countMaxLBAtrace_overrunargsargvdiag_trigger_scsiuclamp_reqswap_info_structdynidss_qcopblk_mq_queue_mapchip__kernel_long_tsrcu_usagefaultableMPT3SAS_ADAPTERMPT_BUILD_ZERO_LEN_SGEexit_hctxin_execveGPIOValrlim_maxsimple_tagsSlotNumbertarget_listmutex_lockcoherent_dma_mask__data_lendriver_flagsfile_ra_statek_sigaction_MPI2_SAS_IO_UNIT0_PHY_DATA_hugetlb_hwpoisonTriggerFlagstemp_sensors_countReplyFrameAddressreadahead_controlfwnode_operationsswait_queue_headMaxNumPhysicalMappedIDsmemory_typePciBusNumbervm_userfaultfd_ctxTT_NONEmap_pagesmod_tree_nodempt3sas_config_get_number_pdscmd_flagss_bdev_filedev_pagemapmaster_tgis_mcpu_endpointcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fshost_eh_scheduledsoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLEElementFlagsrb_nodereturn_consumerround_robinMsgFlagsi_private_datavolume_handleptracer_credsrcu_barrier_headleadercheckhtb_rel_queryTT_COMPATcap_effectiveexit_statefaultscan_startmax_sges_in_chain_messagesubvendorbios_pg2bios_pg3numa_pages_migratedPCISlotNummax_sges_in_main_messagesched_tagssupported_modesbitmap_queueis_gen35_iocpci_p2pdmano_cgroup_migrationattached_handlesched_dataprintk_index_startindex_keybreserved_tags__bi_nr_segmentsneeds_freset_MPI2_IEEE_SGE_SIMPLE_UNIONrcecintervalbug_entrytimers_activenum_classesform_specificActiveZoneManagerSASAddressvma_lockIeeeSimpledl_throttledseccompDEVICE_VERT_POS_UPPERblk_holder_opsstatic_key_modport_siblingsfilter_countmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodeSupportedLinkRatesumode_tinitial_nsnon_compliant_barsno_pmGRPQUOTAia_vfsgidioctx_locktimer_slack_nss_bdixarraycan_wakeuppdeath_signalnr_wakeups_idledqi_igraceqf_nextmaple_treensproxymanu_pg10manu_pg11slave_dir__write_overflow_pkeykernfs_rootmpt3sas_config_get_volume_wwiducountsget_next_idDD_CLASS_TYPE_LEVEL_NUMmpt3sas_config_set_iounit_pg1high_iops_outstandingrefcount_ttimestamp_update_countErrorResponseBaseAddresscmd_lenDEVICE_PANEL_TOPmax_hw_discard_sectorsint32_txol_areadefault_locktmp_stringguess_capacitysrcu_gp_mutex_MPI2_CONFIG_PAGE_BIOS_2_MPI2_CONFIG_PAGE_BIOS_3_MPI2_CONFIG_PAGE_BIOS_4debugfs_dirwakee_flip_decay_tsprio_listMPI2_BOOT_DEVICE_ENCLOSURE_SLOTlast_timeBiosVersionrequestblk_unique_idsas_address_parentSDEV_DELMasterDatacontexthost_lockrwlock_tvm_fault_tSAS_PHY_RESET_PROBLEMuse_autosuspendPCIeEncapsulatedSuccessclass_spinlock_irq_try_is_conditionalcfs_rqvirt_boundary_maskcgroupscore_occupationget_policycore_cookieMpi2ManufacturingPage11_trefcount_struct__kernel_ulong_tfwnodestatic_call_keynamespaceparametersgroup_leaderdma_channelrunnable_avgMpi2IOCPage8_tlookaheadiowait_countshstkioac__kernel_clock_tMpi2SasDevicePage0_t___GFP_DMA32_BITwas_resetgp_seqscsi_device_stateuuidmaj_fltcached_requested_keydqb_rsvspace___GFP_NOMEMALLOC_BIT__s8inode_operations__kernel_size_tdma_configurefile_leaseclass_local_lock_nested_bh_is_conditionalgpl_symspci_vpdpercpu_rw_semaphorearch_spinlock_tseqcount_raw_spinlock_tthread_pidevent_logInactiveStatusdl_non_contendingcurr_ret_stackpgtable_tmax_bus_speed__u8q_usage_counterwakeirqi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyssdev_targetcore_forceidle_sumget_offset_ctxbase_readl_ext_retryreleasedexport_operationsqc_stateget_budgetBLK_INTEGRITY_CSUM_IPmempool_smempool_td_inodespecial_vecMPI2_RAIDVOL0_PHYS_DISKPollingIntervalworkqueue_structi_lock_keySAS_PHY_VIRTUALuevent_suppressgraveyard_linkbi_opfscsi_cmndfs_superswait_for_discovery_to_complete__read_overflow2wce_default_on__rcu_icq_cache___GFP_KSWAPD_RECLAIM_BITcap_ambientqstrtaskss_d_opreply_post_free_array_dmano_report_lunsmpt3sas_config_set_bios_pg4i_rcu__count__already_doneinit_requestGET_MSIX_INDEXio_optpcountSubsystemVendorIDbio_listwlockeddevicemodule_kobjectpercpu_count_ptrMpi26DriverTriggerPage4_tpcie_mpssnr_ia_rangesthawcalling_function_nametlbflush_unmap_batchremoveInvalidDwordCountbvec_iteroom_mmbpf_local_storagename_linkcompat_long_tcnivcswchain_dma_poolats_stushort inttrc_reader_specialscsi_lookup_locklogging_levelgtimedisk_events_disable_depththread_group_cputimersizemigrate_to_ramreset_from_userUTASK_SSTEP_ACKbroadcast_aen_pendingloginuiddesc_structi_wb_lists_umount_keyquota_type__init_swait_queue_headnameIoIndexsetleaseMaxEnclosuresbitmap_tagsmnt_rootpsi_flagsconfig_requestsighandaddrMpi2ReplyDescriptorsUnion_tmpt3sas_config_get_phy_pg0mpt3sas_config_get_phy_pg1__rcu_headMPI2_SGE_SIMPLE_UNIONac_utimeksm_zero_pagesqueuedataprivate_data_MPI2_REPLY_DESCRIPTORS_UNIONreply_free_host_indexfs_structnuma_nodedev_archdatanr_perf_statess_flagsrcu_nodeorig_pmdrb_rightclock_baseclass_irq_is_conditionallaunder_foliowake_batchReserved11Reserved12delayed_tr_volume_lists_vfs_rename_mutexReassignmentDeviceNameElf64_XwordflockReserved1ahandler_dataReserved21__paddingMPI2_RAIDVOL0_SETTINGSio_lockdep_mapatomic_write_hw_boundaryiowait_sumdescriptionSasWwidbi_nextblk_status_tUSRQUOTAdriver_privatepm_onlyd_rt_spc_warnsset_read_onlypgmapactive_refhctx_tablePhyResetProblemCountkernfs_open_filePortFlagsMpi2IOCPage1_ts_iflagspci_dev_flags_tprintedNumDevsPerEnclosurenr_hw_queuesiounit_pg0iounit_pg1codetagstate_mutexlast_queue_full_depthcid_worki_versionMpi2SasIOUnitPage0_tswap_deactivateclass_rwsem_read_is_conditionalSlotx2Slotx4queue_limitsil_weightstarved_listdma_parmsKOBJ_NS_TYPES_config_set_driver_trigger_pg0_config_set_driver_trigger_pg1_config_set_driver_trigger_pg2_config_set_driver_trigger_pg3_config_set_driver_trigger_pg4cmin_fltarch_uprobe_taskis_hotplug_bridgewrite_protect_seqclearedkobj_ns_type_operations_MPI2_SGE_IO_UNIONshutdownevent_countsched_statisticspci_ops__kernel_uid32_tallocorig_pterq_timeoutkeysinit_nameMPI25_FP_SCSI_IO_SUCCESS_REPLY_DESCRIPTORfile_lockstatfsMPI2_IOUNIT8_SENSORrw_semdevice_privatevm_policydl_deadlinetracepoint_extclass_mutex_is_conditionalfpregs_statetracker_listInquiryDatamemcg_datadqb_curinodesmpt3sas_config_get_manufacturing_pg0mpt3sas_config_get_manufacturing_pg1fileattr_seteh_actionmpt3sas_config_get_manufacturing_pg7page_linkno_write_sameDEVICE_PANEL_UNKNOWNPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetsas_port_listmce_ripvDL_DEV_NO_DRIVERret_stackSAS_PROTOCOL_INTERNAL_ABORTreal_timeri_privatealloc_tagextended_state_areanum_kprobe_blacklistaccesssubdirsAddlFlags3dev_releaseMPI2_SGE_CHAIN_UNIONmlock_countget_next_child_nodemempolicyperf_event_mutex_bandcurrent_boot_devicepollfddev_tdma_poolSAS_LINK_RATE_UNKNOWNplatform_dataf_refprev_posenv_endfileattrs_subtypeusage_countpr_opsstate_in_sysfsdqb_ihardlimitaer_statsunlocked_ioctluprobebd_mappingkmem_cachenuma_next_scanbudget_mapbsg_devsrcu_last_gp_endclass_local_lock_irq_is_conditionalpage_listproperty_read_int_arraywdtrmq_rq_stateholders_dirMODULE_STATE_UNFORMED_MPI2_CONFIG_PAGE_MAN_7st_valuelist_headptrace_bpsreply_free_queue_depthAtomicRequestDescriptorPosts_user_nsbase_cmdsmax_nvme_qdtagset_refcntqueuecommand_may_blockarch_tlbflush_unmap_batchquick_threadsdefer_syncreq_alt_boot_devicemissedsum_sleep_runtimecleanup_rqd_spc_timerd_ino_hardlimitpausechange_cookiebi_statusdl_periods_dquotfsnotify_sb_inforecent_cida_opsatomic_desc_capablepad_untilperf_event_listirq_pollinterval_expevent_type___GFP_LAST_BITdevfntagsPhyNumki_completeRequestDescriptorPostHighpgprotuint16_ttimespec_typebd_devicefind_special_pagedquot_operationsMPI2_IEEE_SGE_SIMPLE32posix_cputimers_workgsbaseio_tlb_memseq_showcpusfilesinblockbd_claimingtail_MPI2_CONFIG_PAGE_SAS_DEV_0_MPI2_CONFIG_PAGE_SAS_DEV_1s_magicdma_alias_masknuma_faultsmem_dqblk_MPI2_BIOS4_ENTRYstatusWRITE_LIFE_NONEIocLogInforead_countwait_for_completion_timeoutHRTIMER_NORESTART__UNIQUE_ID_y_600last_update_timeNVME_BUILD_PRPinternal_smidReserved0Reserved1Reserved2sas_ss_spReserved4Reserved5Reserved6Reserved7dpc_rp_log_sizeReserved9LogEntryQualifierpanelSAS_PROTOCOL_SMP___GFP_ZEROTAGS_BITmax_allowed_capacityopen_moderead_pos___GFP_ACCOUNT_BITD_REAL_METADATAgpl_crcsclass_raw_spinlock_try_is_conditionalkiocbConnectorInfo___GFP_MEMALLOC_BITexecute_only_pkeyreturn_instancesma_lockblk_mq_queue_datadockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsChipRevisiondentrysequential_iowait_pidfds_writersgroup_stop_countswap_lockvm_opsSEPDevHandleread_before_msreply_postget_unmapped_areamkobjsym_VDSO32_NOTE_MASKfrozenactive_uprobeget_parent_sas_phymin_vruntimel1ssconnector_namehost_resetclass_disable_irq_is_conditionalControllerPhyDeviceInfosyscrnr_mapssyscwsync_ionum_bpf_raw_eventswork_qnr_phys_allocatedorig_nentski_posSAS_PROTOCOL_SSPavx512_timestampend_io_datafree_cached_objectstaints_BoolSAS_PROTOCOL_STPxol_vaddrlist_lru_nodeuclamp_ses_time_granNumSensorsblk_integritykuid_tdev_pm_qosmpt3sas_config_get_expander_pg0bd_holdersdriver_exclusive_resourceFlagsLength_sifieldstask_MPI26_DRIVER_SCSI_SENSE_TRIGGER_ENTRYIeeeChainresetsched_reset_on_forkcompound_headnr_retriesmultipath_on_hbaevent_contextwake_irqbranchtarget_port_protocolsi_cdevchip_physProgrammedLinkRatei_fsnotify_marksin_thrashingdl_defervpd_pg80vpd_pg83vm_startvpd_pg89mprotectquota_ond_automountMpi26PCIeDevicePage0_tDEVICE_REMOVABLE_NOT_SUPPORTEDromlenatimeInitialRegDeviceFISget_ownershipf_task_workmy_qeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalsectors_wb_errtotal_io_cnt_MPI2_CONFIG_PAGE_EXPANDER_0_MPI2_CONFIG_PAGE_EXPANDER_1closeSAS_END_DEVICEPhyDataiopl_warnelevator_queuereply_post_structpasid_requiredptracedmpt3sas_config_get_volume_handledoneOwnerDevHandlesym___kernel_rt_sigreturnsrcu_struct_ptrsTaskTagMPI2_SAS_IO_UNIT1_PHY_DATAskip_ms_page_3fbuild_sginodesos_irqmemcg_awarei_atime_sechost_waitmanage_shutdownMPI26_DRIVER_MPI_EVENT_TRIGGER_ENTRYqsize_t__fpstatedma_free_attrsqf_ownerSATAMaxQDepthsuspend_noirqControllerDevHandled_iname_MPI2_CONFIG_PAGE_RAID_CONFIGURATION_0bi_flagsIOCStatusLoginfoTriggerslinks_countprealloc_pterdevd_ino_countarg_lockDEVICE_REMOVABLE_UNKNOWNignore_childrenfreeze_fsin_eventfdresume_earlystart_scan_failedmax_dev_sectorsdup_xol_workalimitmsix_capir_firmwarempt3sas_port_factsnuma_groupInitiatorDevHandleblk_independent_access_rangeskmap_ctrlfscrypt_operationsrangesfs_contextmnt_idretry_hwerror_MPI2_CONFIG_REPLYdrop_inodeorc_unwindbroken_parity_statusgraph_get_next_endpointlast_sector_bugmq_mapOEMIdentifierkprojid_t__u16saved_end_iosyscall_dispatchdl_densityon_rqSL_WH_MPI_TRIGGERS_Taltmapmin_perf_statercu_tasks_exit_listmsi_enabledsp_regdma_drain_bufinternal_lookuplast_resets_master_keysflagsdiag_buffer_dmampt3sas_config_get_ioc_pg1bd_holder_locknr_threadsvm_mm__u32EventTriggerEntryrcec_eamax_secure_erase_sectorsseq_next_MPI2_CONFIG_PAGE_RD_PDISK_0Mpi2SasEnclosurePage0_ts_quota_typesvm_lock_ddebugFAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitdelaysf_modeFORCE_BIG_HAMMERtimerqueue_headBLK_INTEGRITY_CSUM_CRCsdev_groupskioctx_table_MPI2_RAIDPHYSDISK0_SETTINGSksm_rmap_itemsclass_read_lock_is_conditionalptm_capKMALLOC_RECLAIM__u64revoked_at_folio_nr_pageswritepageis_dirty_writebackpkey_allocation_maplink_bwctrldq_iddisable_depthem_perf_statethread_shstkminimum_linkrateposix_timerswait_chldexitsas_ss_flagsunmap_limit_for_wssas_device_typerom_base_regpcie_sg_listReserved3GUIDbi_itersrcu_cblist_invokingiopollbridge_ctliov_lenlatency_recordSAS_LINK_RATE_1_5_GBPSmsi_capiopoll_q_start_indexEnclosureHandlesector_sizeNumVolumes__UNIQUE_ID_x_591__UNIQUE_ID_x_593__UNIQUE_ID_x_595__UNIQUE_ID_x_597__UNIQUE_ID_x_599d_releasedev_dma_attrMpi2SasDevicePage1_texpiresnuma_scan_seqmnt_sbNumHotSpareshashnodemask_tIOCNumbersignalfd_wqhhang_detecteddevice_driversupports_trigger_pageslast_zone_capacityNamepend_os_device_addfsindexraw_spinlock_ts_copcombined_reply_queues_activenum_argstag_size_MPI2_BOOT_DEVICE_ADAPTER_ORDERs_uuidclear_child_tidruntime_statusdqb_btimedq_opAdapterFlagsno_command_memoryshow_pathdl_serverVTIME_USERquota_disablesched_delayedsrcu_gp_seq_neededtask_structcurrent_may_mountkmalloc_cachesHeaderrequest_dmapushsas_protocolis_noirq_suspendedfwnode_endpointcounterReqAltBootDeviceFormsuspendsupported_eventsoom_score_adj_minzone_wplugs_pooldomain_datacopy_file_rangeAddlFlags2srcu_gp_startreport_zones_cbSAS_HAxa_flagswakeup_preparedtv_nsecmsi_lockmax_zone_append_sectorssas_ss_sizebridge_d3s_inode_list_lockUTASK_SSTEPCurrentHostPageSizeehandlerdq_sbexpecting_lun_changescsi_targetRAIDAcceleratorSuccesss_mountssriov_configureMpi2RaidConfigurationPage0_tBLK_EH_DONEsym_pvclock_pageReplyPostHostIndexpage_fragrun_workfsuidRPM_REQ_AUTOSUSPENDirq_poll_fnrom_attr_enabledsrcversiontrace_event_callwakeup_sourceis_partially_uptodatehost_faileddl_runtimemay_splitio_uring_cmdread_dqblktransport_cb_idxpcie_device_locksrcu_parentsuppliersfile_operations_config_display_some_debugblist_flags_tmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotNVMeAbortTOdpc_capis_preparedpgprotval_ttrc_holdout_listWriteSequenceMaxTargetPortConnectTimeasync_suspendq_nodescsi_tgclass_mutex_intr_is_conditionalstrtabpage_freeftopHPROBE_CONSUMEDi_mmapdirty_paused_whenirq_get___GFP_COMP_BITdriver_managed_dmaSAS_SATA_PMcapacitymax_channelversionbuffer_rel_conditionget_reference_argsllisthiwater_vmUniqueValuemax_perf_statebi_idxfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntrseqReassignmentWWIDtarget_kn_MPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORlimit0limit1pi_blocked_onpid_tvmemmap_shiftusage__kernel_time64_tMPITriggerEntryrq_qos_mutexlink_active_reportingscsi_data_bufferi_securityreply_freedevice_physical_location_panellimitsq_lock_cls_keytransport_cmdsenvpactive_memcg__targetsElf64_Halfallow_reinitPortNumtimer_autosuspendsratelimit_MPI26_DRIVER_MASTER_TRIGGER_ENTRYSHOST_DELsysdata_softexpirespd_handlesautosuspend_delayi_flctxlist_lockvm_faultoptimistic_spin_queuepermissiontrigger_typeflush_listctl_cmdsSASWideMaxQueueDepthreap_refDEVICE_FIXEDlast_statusReservedSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsslice_maxp2pdmaMpi2SasIOUnitPage1_tbi_max_vecsthaw_noirqsched_debugfs_dirSAS_PROTOCOL_STP_ALLaccounting_timestamppasid_capserial_numberRevisionIDcan_matchtime_archcmd_sizechunk_sectorshlist_bl_headqc_dqblkpasid_activatedNumTableEntriesProgrammed__fortify_panicbvec_integrity_poolarch_data_oldSAS_SATA_PENDINGio_uring_poll_queueshrink_controlegidenvp_idxcrypto_kobject___GFP_NO_OBJ_EXT_BITtagged_supportedvpd_pgb0vpd_pgb1vpd_pgb2vpd_pgb7folioruntime_autopref_node_forkclassslotsprev_scan_seq_perfput_smid_fast_pathReserved8wait_queue_head_tFAULT_FLAG_INSTRUCTIONuser_nsclass_raw_spinlock_irqsave_is_conditionalsyms_flagsErrorResponseAllocationLengthdevcapsyncSAS_SATA_DEVmq_freeze_lockMPI2_ADDRESS_REPLY_DESCRIPTORsg_prot_tablesizepcie_sgl_dma_poold_childrenControlGroupeh_host_reset_handlerNvdataVersionPersistentddebug_class_map__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115__compiletime_assert_116__compiletime_assert_117__compiletime_assert_118__compiletime_assert_119prealloc_bufaudit_contextfl_owner_tipi_listAdditionalControlFlagsWordsSAS_FANOUT_EXPANDER_DEVICE__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126i_pipe__compiletime_assert_128__compiletime_assert_129d_waitllist_headsense_buffernr_phys_segmentsMaxInitiatorswait_page_queuesas_rphyreply_post_freeFAULT_FLAG_REMOTE__compiletime_assert_130dl_bw__compiletime_assert_132__compiletime_assert_133__compiletime_assert_134__compiletime_assert_135__compiletime_assert_136__compiletime_assert_137__compiletime_assert_138pci_device_idi_dir_seqheaderwatchdog_stamplist_op_pendingdatasrcu_cb_mutexsysfs_lockbroken_intx_maskingSimple32no_callbackssaved_trap_nrclock_listfolioq_slotUnitMODULE_STATE_GOINGxattr_handlerring_buffer_szbuild_sg_scmdrqos_debugfs_dirprot_sdbunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_lockfromnextentseventkeytype__kernel_gid32_tdev_pm_domainProductRevLevelnentsstart_time_nsuaddr2f_securityprot_oppd_handles_szbridgedefparamdiscard_granularitypcie_sgl_dmaSimple64smp_affinity_enableProductSpecificiotmo_cntclass_raw_spinlock_irq_is_conditional__bi_cntSAS_PHY_RESET_IN_PROGRESSrcuwaitattributes_maskdl_defer_runningqueuecommandresourcesmaximum_linkrateia_validsrcuiorequest_cntsrcu_size_jiffiesclassespasid_featuresstatic_call_siteis_virtfnHostInterruptStatussubdevicesrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitrchari_verity_info_addr_pkeyrw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countSTARGET_RUNNINGbuild_nvme_prpatomic_openput_smid_defaultsigactionrlimmce_addr__q_size_fieldf_freeptr__sighandler_tclass_spinlock_try_is_conditionalzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMEShash_lenMPI26_DRIVER_SCSI_SENSE_TRIGGER_ENTRYmax_target_blockedfs_flagsvm_filei_countuser_structaddress_space_operationsFAULT_FLAG_USERkey_perm_tTargetAssistSuccessCoercedMaxLBAReserved10max_wideport_qdMaxMSIxVectorsHeaderVersiontimer_listrun_delaynum_ftrace_callsiteschange_queue_depthsrcu_cblistblk_independent_access_rangeNVMeMaxQueueDepthmax_narrowport_qdtlb_ubcpme_supportpgtables_bytesTimeToReducedFunci_lruGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stack_MPI26_DRIVER_MPI_EVENT_TRIGGER_ENTRYtrc_ipi_to_cpuPageTypeallow_restartmin_slicecommit_rqsput_smid_scsi_iosysfs_opsinq_periph_qualHCBAddressHighatomic_write_hw_unit_maxcmaj_fltbio_integrity_poolkparam_arraympt3sas_base_hard_reset_handlerFORTIFY_FUNC_strscpypercpu_refevict_inodeignore_media_changedqb_itimeMPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTOR_internal_cmdthread_keyringmap_nrcpumask_trb_leftgfp_maskdma_addr_tinactive_timersense_dmaattributeinit_hctxmm_lock_seqhotplugFORTIFY_FUNC_memchr_debug_dump_configkernfs_elem_symlinkBLK_UID_T10_debug_dump_mf__kernel_dev_tcrypt_keyslotPhyFlagsConnectorNamepm_domainfsgidsector_tMPI2_DEFAULT_REPLY_DESCRIPTOR_sys_privatesignal_structactive_mmstate_savedkernfs_iattrsshow_devnamethread_infoPhyInfoi_mmap_writableMPI2_VERSION_STRUCTreadsecondarydevicesatomic_write_max_sectorsgroup_exit_codeFORTIFY_FUNC_memcmpopc1ignore_loginfosreply_queue_listpriv_flagsPciDeviceAndFunctionNumberSMIDclear_retrain_linkexec_maxsync_stateMpi2ConfigRequest_tdev_groupsDMA_FROM_DEVICEkernfs_elem_dirpercpu_counter_printkDMA_BIDIRECTIONALsequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startmpt3sas_config_get_sas_device_pg0mpt3sas_config_get_sas_device_pg1UTASK_RUNNINGopenseglenoverride_onlyFORTIFY_FUNC_memcpy__kernel_ssize_tvdso_imagesi_signounused_hctx_lockSTPMaxConnectTimeLimitrseq_sigresultrefsmpt3sas_base_get_reply_virt_addrdelayed_callmpt3sas_config_get_driver_trigger_pg0mpt3sas_config_get_driver_trigger_pg1mpt3sas_config_get_driver_trigger_pg2mpt3sas_config_get_driver_trigger_pg3mpt3sas_config_get_driver_trigger_pg4time_slicenr_rangeStructpci_power_tspc_timelimitMPI2_BIOSPAGE2_BOOT_DEVICEresumereset_doneregsbi_write_hintrq_nextsyscall_user_dispatchshort_inquiryattrd_aliasis_suspendedrestore_sigmaskrequeue_lockmmio_enabledscsi_io_cb_idxmpt3sas_config_get_enclosure_pg0event_workreply_post_free_arraynr_deferredsrcu_sspi_lockuser_event_mmbtrace_seqs_devsiblingcdl_supportedia_rangeldt_usr_semGenericFlags1phy_numberposix_cputimerstry_rc_10_firstRPM_INVALIDfreeze_kcountrequest_key_authblockspercpu_ref_datad_spc_warnssrcu_supfreeptr_tns_typeRPM_REQ_NONEThresholdforce_runtime_start_on_system_startsg_timeoutmaximum_linkrate_hwixolfasyncarg_startkprobes_text_sizeblk_crypto_profilefop_flagsParentDevHandle_addr_lsb_addrpfn_mkwriteuaddrKMALLOC_DMAsas_device_lockioerr_cnt_uids_fs_info__rb_parent_colorWRITE_LIFE_EXTREMEicq_listslave_configuremm_users_pp_mapping_paddebugfs_rootSTPBusInactivityTimeLimitNextChainOffsetkey_serial_tno_uld_attachfolioqiomapshost_groups_MPI26_PCIE_IO_UNIT1_PHY_DATAsiblingscputimernrpageswake_q_nodeblk_flags_ts_maxbyteshd_geometryioctx_tabledma_io_tlb_memKMALLOC_CGROUPeh_cmd_qFunctionDependent1FunctionDependent2FunctionDependent3FunctionDependent5get_unique_idVP_IDNR_KMALLOC_TYPESexpire_countwake_cpubio_split___GFP_DMA_BITfreeze_supertick_dep_maskkey_typecpu_msix_tablepci_busInitialTimeToReducedFuncqc_infofault_flagmodnameCurrentBootDeviceMPI2_BIOS4_ENTRYia_ctimetrace_eval_mapasync_put_workresvnum_static_call_sitesvm_lock_seqFORTIFY_FUNC_strncatPortGroupsDeviceInfoprimarytm_cb_idxmpt3sas_config_set_sas_iounit_pg1Elf64_Addrwait_queue_entry_tMpi26PCIeIOUnitPage1_tseqlock_tlatency_record_countSL_WH_SCSI_TRIGGER_Tnr_integrity_segmentsMPI2_CONFIG_PAGE_HEADERhost_blockedmay_skip_resumeprot_flagsVTIME_SYSalloc_tag_countersbase0base1base2block_cfg_accessSHOST_CREATEDbase_cb_idxraid_vol_pg1bio_setpd_handlePortNumberalignment_offsetrdpq_array_capablelinksSL_WH_MPI_TRIGGER_Tbasesfutex_staterseq_lenkobj_completioni_spc_timelimitf_opchains_needed_per_ionargscpuhp_onlinemm_mtgid_tdelayed_tr_listrelease_workno_report_opcodesfault_reset_work_q_namercu_read_unlock_specialtls_array_MPI2_IOUNIT8_SENSOReetlp_prefix_pathtask_io_accountingHCBAddressLowf_raDEVICE_PANEL_FRONTmodule_memorysitesAddresscompat_robust_list_headthread_nodestatic_call_mods_shrink__compiletime_assert_127gp_countnr_sectorsreply_queue_countbpf_raw_eventshi_priorityiommutimer_expiresbpf_storageSAS_SATA_PM_PORTkset_uevent_opsf_owner__state_permDEVICE_PANEL_BACKreply_post_free_array_dma_pool_syscalldiskSHOST_DEL_RECOVERYring_buffer_offsethide_drivesmsix_vector_countsrcu_lock_countlink_statetrc_blkd_cpugp_waitCapabilities__compiletime_assert_131AttachedDevHandleiommu_mmfuncio_uring_taskSAS_LINK_RATE_22_5_GBPSshared_tagspri_reqs_allocRequestedBootDevicejit_keyrings_fsnotify_infodma_handlefunctionSAS_LINK_RATE_12_0_GBPSport_enable_cmdsprojidmce_kill_mema_external_lockpid_linksconv_zones_bitmapscsi_target_idpcie_flags_regs_dio_done_wqbase_add_sg_singleq_sizetrigger_flaghlist_headloss_of_dword_sync_countioc_nodethrottle_diskbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACErunningrw_hintblk_integrity_checksumioc_dumpdma_skip_syncMpi26DriverTriggerPage0_tpartition_meta_infoDEVICE_VERT_POS_LOWERclass_spinlock_irqsave_is_conditionalutf8datampt3sas_base_check_cmd_timeoutrequeue_workof_node_reuseddyndbg_infoFORTIFY_FUNC_strncpyElf64_Symhtb_relsaved_config_spaceIRVolumeMappingFlagsd_rt_spc_softlimitpollfree_file_infoin_lru_faultsched_contributes_to_loadtlb_genruntime_idleacs_capmap_countDiagRWDatapcie_caphost_scribblei_rt_spc_timelimitqc_type_stateNumPhyss_dentry_lrus_bdevskip_vpd_pagescrcssense_lenRDPQBaseAddressrun_listdiag_buffer_szuevent_opsabort_workmax_cmd_lenMaxChainDepthsched_classutil_avganon_vma_pidsigcntDD_CLASS_TYPE_LEVEL_NAMESmpt3sas_config_get_pcie_device_pg0mpt3sas_config_get_pcie_device_pg2modinfo_attrsst_spaceclass_map_typekparam_stringd_real_typemaxrsscredkernfs_open_nodePhysicalPortAttachedPhyIdentifierf_wb_errmm_cid_activemodule_sect_attrsreq_flags_truntime_resumegroup_exec_taskrestrict_linkget_inode_usagekmalloc_typexarray_startbpf_ctxpm_domain_dataBASE_READ_REGserver_pick_task__p_size_fieldload_avgcor_error_detectedi_private_lockget_dqblkmq_listphysical_block_sizepgoffporthi_priority_smidtm_tr_cb_idxhandlematch_drivermodelfreeze_lated2_supportcount_objectsvma_numab_statedma_map_opsdq_dirtymax_lunexit_cmd_privatomic_write_boundary_sectorsEnclosureSlotmax_queue_depthwrite_bytesReserved0xAReserved0xCeh_entrypending_eventsoom_reaper_listnumab_statefutex_offsetZoneLockInactivityLimitsubsys_fmt_prefixdq_lockintegritypte_tnr_scanned__statempt3sas_factsnr_iosn_io_portslicedrv_groupstrack_queue_depthcustom_slicepci_slothotplug_user_indicatorsmq_freeze_depthpadding1mpt3sas_config_get_raid_volume_pg0mpt3sas_config_get_raid_volume_pg1nestedatomic_write_segments_maxReplyFreeHostIndexnr_dirtied_pausequeue_kobj_MPI2_CONFIG_PAGE_MAN_1real_addressbd_holder_dirinvalidate_locknum_exentriesfix_capacityio_portblk_mode_tpmdval_thost_tagsetkvecPCIDomainSegmenteh_noresumeset_latency_tolerancedepthDescriptorTypeDependent2d_ino_timerprobenetlink_nsdev_ueventdep_mappage_mkwritelast_busyvm_flags_tres_attrnr_failed_migrations_affined_in_lookup_hashptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLERreschedule_countmax_hang_timeexternal_facingcmd_per_luncdl_enablecutimelockreftlb_flush_batched___GFP_HIGH_BITia_uidautogroupsequencercu_syncarg_endclass_spinlock_irq_is_conditional_dummy_pkeyvruntimehostdata___GFP_HARDWALL_BITbus_flagsstart_stop_pwr_condfeatures_locked__kernel_pid_tdevice_blockedMpi2IOUnitPage0_tMajorPIDTYPE_SIDcinblockdma_alignmentprot_typeNumElements__kernel_loff_tDmaGroupset_performance_stateserial_nodeSAS_PHY_UNUSEDchains_per_smid_MPI2_MANPAGE7_CONNECTOR_INFOstate_remove_uevent_sentnotify_counthba_queue_depthHostDiagnosticevent_maskssingle_lunhprobesg_reserved_sizeswap_activatedqb_isoftlimitsaved_auxvnoinstr_text_sizedl_overruniattrdetachedloff_tWWIDoom_flag_origindesc_lendma_devfault_reset_workoom_score_adjSHOST_RECOVERYrq_end_io_fnksm_merging_pagesgraph_parse_endpointrmid_sas_nodelist_lrudevice_removablefxsavedev_pagemap_opsbv_offsetset_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETd_lockrefMaxPortWidthSCSI_EH_DONEsession_keyringshost_devd_deleted_ino_softlimitd_weak_revalidatealloc_time_nsi_devicesdqb_curspacetm_cmds_MPI2_CONFIG_PAGE_IO_UNIT_0_MPI2_CONFIG_PAGE_IO_UNIT_1_MPI2_CONFIG_PAGE_IO_UNIT_3alloc_lock_MPI2_CONFIG_PAGE_IO_UNIT_8early_initOEMSpecificFlags0OEMSpecificFlags1total_numa_faultswritable_sizemax_segmentsdma_need_drainobj_cgroupem_tablemq_sysfs_init_doneactive_queueshba_mpi_version_belongedMsgVersionpage_size__lstateSelfConfigStatusmpt3sas_config_get_manufacturing_pg10mpt3sas_config_get_manufacturing_pg11MPI26_PCIE_ENCAPSULATED_SUCCESS_REPLY_DESCRIPTORinodeConfigGUIDbd_fsfreeze_mutexhrtimeratomic_write_unit_maxPhysDiskMinormpi_requestFAULT_FLAG_UNSHAREtask_sizemust_resumeRPM_ACTIVEend_codepreempt_notifierstlb_flush_pendingmigration_flagsMasterTriggerFlagsDEVICE_PANEL_RIGHTpcie_device_listHostTraceBufferFlagspci_drivercap_inheritablekobj_sigvaleh_timeout__stack_chk_failsrcu_n_exp_nodelayseqcount_spinlock_tgraph_get_remote_endpoints_roots__int128 unsignedcpu_countwait_sumuprobe_xol_opsmin_align_masknextevtthis_idrcu_segcblistreported_split_lockpref_windowreturn_instancewait_countconfirm_switchnr_wakeups_affine_attemptspud_ti_ino_warnlimitMpi26PCIeDevicePage2_tpreallocProtocolFlagsmax_open_zonesrmtpnext_offsetacpi_device_idctx_idutaskpoweroff_noirqbroken_cmd_complactive_modesdev_datacb_idxis_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangstm_tr_volume_cb_idxcss_setfwnode_handlegfp_tEEDPTagModetypeqf_fmt_idNumPhysDiskspageatomic_write_unit_minsleep_startmemalloc_noiobegintypetabuse_192_bytes_for_3fnr_reserved_tagsi_crypt_infoDEVICE_HORI_POS_CENTERio_start_time_nsaudit_ttynr_zonesmutex_unlockjobctlsi_errnonr_leaves_on_treequeue_ctxmin_shallow_depthpcie_device_init_list_sigchld__le16HPROBE_STABLEquota_format_typebio_crypt_ctxpercpu_ref_func_tpm_message_tac_mem_MPI2_RAIDVOL0_PHYS_DISKpprevpending_io_countino_warnlimitbroken_fuaDeviceMaxLBASTP_SMP_NexusLossTimeMaxPostedCmdBufferszone_wplugs_lockmnt_flagsac_stimelast_mergememcg_nr_pages_over_highsw_reservedDCRData__le32wbt_flagsproc_dir_entryobjcgno_read_disc_infoblock_startvm_area_structnum_gpl_symsdrv_support_bitmapselect_no_atnPageNumbermap_busphy_reset_problem_countMaximumDataTransferSizelong long unsigned intWRITE_LIFE_MEDIUM__builtin_memcpyirq_line_enabletmf_in_progressSDEV_CREATED_BLOCKhuge_faulti_fopautasklast_task_numa_placement__le64fortify_memcpy_chk_pcie_devicerefcntfreeze_holdersubordinatecdevperf_eventkernel_ulong_tPageBufferSGEunregfuncSerialNumseqcountirqpollschedule_dead_ioc_flush_running_cmdsclass_idbitsetNumMasterTriggerfactsfree_meminquiry_mutexof_device_iddisk_statsbusn_resmanage_runtime_start_stopclass_migrate_is_conditionalsriov_get_vf_total_msixclass_write_lock_is_conditionals_xattrpartmpi_replyBLK_EH_RESET_TIMERil_prevd_initmax_slack_shiftpanicget_name_prefixfileattr_get__kmalloc_noprofReplyFrameSizedma_free_coherentclass_groupsSDEV_TRANSPORT_OFFLINE__ret_warn_on__call_single_nodeunicode_mappathrecent_used_cpuruntimeno_64bit_msiold_time32_tmsix_load_balancedev_flagsSASAddress__state_sizeunsigned intsbitmaprequest_dma_szput_smid_hi_priorityclass_irqsave_is_conditionalcore_kallsymsIOCStatusscsi_devices_fsnotify_maskis_physfnsas_linkratescan_objectsslotbi_privatedevice_infoDD_CLASS_TYPE_DISJOINT_BITSevent_liststartupMPI2_BOOT_DEVICE_DEVICE_NAMEkeyring_index_keychain_trackeriov_iterd_rcustatic_key_false___GFP_DIRECT_RECLAIM_BITwake_entryrcu_tasks_holdoutfreezeassoc_array_ptrbatchcacheold_timespec32rcu_blocked_nodejiffies_at_allocLogInfost_namegroup_nodei_mtime_secbus_dma_regionfw_event_lockstatic_rqsmpt3sas_config_get_sas_iounit_pg1starget_sdev_userlegacy_ioac_majfltmce_kflags___GFP_NORETRY_BITFORTIFY_FUNC_memsetscheduledbus_dma_limitubuftg_pg0tg_pg1tg_pg2tg_pg3tg_pg4btimePageLengthia_gidltr_pathmigrate_foliorq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrnext_posix_timer_idmq_opsmax_sata_qd_mapcountstarttimereschedule_jiffieshprobe_statei_sb_listquota_offMPI2_IEEE_SGE_CHAIN32VendorIDfault_reset_work_qshm_clistio_uring_poll_queuesptm_rootcb_headzone_wplugs_hash_bitspi_offsetac_flagpt_regsmmap_missexpires_nextIOCMaxChainSegmentSizeblk_opf_treport_zones___GFP_ZERO_BITnum_trace_bprintk_fmtcdrom_device_infoaccess_stateDeviceNameraid_device_locksdev_gendevphy_idwork_structtruelast_queuedri_timerpipe_bufsEnclosureLevelIOCExceptionsbp_offsetkmalloc_cache_typetm_sas_control_cb_idxhba_portMPI2_IEEE_SGE_CHAIN64LinkFlagssaved_scratch_registertracepoints_ptrsblock_maxstatic_keyqueue_rqsFAULT_FLAG_VMA_LOCKdma_range_mapKOBJ_NS_TYPE_NONE_dataFAULT_FLAG_WRITEshow_optionswait_queue_entryPorti_uidtagset_freedmax_sectorsexpirybmaprescue_workqueuedispatch_wait_lockscsi_levelfsavei_write_hintsuspended_timeread_byteszone_wplugs_worksum_sched_runtimeinternal_depths_writers_keyMpi2IOUnitPage8_tstart_boottimepci_bus_flags_tentriesi_modecap_permitted_flags_2aBLK_UID_NAAstart_codevm_flagssi_codeseqcount_spinlockheadHPROBE_GONEioc_statuslast_siginfodiag_trigger_locksched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorsdevice_dma_parametersdir_contextiopl_emulconsumersPhysDiskDevHandlepoll_queue_procSupportedPhysDisksratelimit_statepower_statedq_flagsis_late_suspendedcapture_controlqueue_offsetclass_device_is_conditionalnon_rcuput_supershostSCSIIOSuccessdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_stat__kmalloc_large_noprofHighPriorityCreditChain32FAULT_FLAG_INTERRUPTIBLEs_inodes_wbignore_hotplugfolio_queue_MPI2_MPI2_BIOSPAGE2_BOOT_DEVICEinit_fs_contextuprobe_taskf_mappingMPI2_BOOT_DEVICE_ADAPTER_ORDERstart_stack__UNIQUE_ID_y_592__UNIQUE_ID_y_594__UNIQUE_ID_y_596__UNIQUE_ID_y_598DL_DEV_PROBINGi_linksriovmpi3_version_unionats_enabledstack_vm_areaChain64d_hashMPI2_RAIDPHYSDISK0_SETTINGSdl_server_pick_f_MPI2_BOOT_DEVICE_SAS_WWIDtty_old_pgrpst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquota_MPI2_ADAPTER_ORDER_AUXNumPerDevEventsorc_entrydma_drain_lenSCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listMaxVolumesutimemmapshrinkeralloc_dquotVolumeStatusFlagsmax_shutdown_latencySensormappingdl_defer_armedMpi2IOCInitRDPQArrayEntrysas_expander_listChipNamerunnable_sumis_warpdriveshort unsigned inteventsget_rq_budget_tokenFastPathSCSIIOSuccessreply_dma_poolqueue_ramp_up_perioddevice_noderequeue_listMaxNumRoutedSasAddressespcie_link_statep_size_fieldAddress64long long intsym_vvar_startenable_cnt_hugetlb_cgroup_rsvdsival_ptrproc_namepercpu_sizeinvalidate_folioMpi2SasPhyPage0_tis_vallocclass_pci_dev_is_conditionaldrop_nsPUT_SMID_IO_FP_HIPaen_event_read_flagnr_queuesmpt3sas_base_free_smidno_pm_callbackscountproduct_specificd_parentSequenceNumbersched_task_groupupdate_timeioc_coredump_looppidsof_nodefw_event_workrun_nodehide_ir_msgdata_sourcesubmit_bio___GFP_UNUSED_BITs_instancesvm_rcubd_start_sectpage_table_locksysv_semquota_infoquota_enable__kernel_timer_t_config_requestMPI2_ADAPTER_INFOdomain_tagmax_integrity_segmentscmaxrsssas_device_listit_real_incrprobestubextable_lenlast_arrivalwake_indexswap_rwreserveCoreDumpTOSecnegotiated_linkraterunning_disparity_error_countsrcu_gp_seq_needed_expExpanderChangeCountDEVICE_HORI_POS_RIGHTSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOia_mtimenr_thpsvphys_listsysv_shmfopssuppress_bind_attrsinsnlensas_identify__page_1__page_2i_mutex_keykey_restrictionquota_writedomainget_linkPhysDiskStatefree_foliocur_bus_speed___GFP_NOFAIL_BITMpi2IOUnitPage1_tformsa_flagsno_start_on_addcancelled_write_bytesdispatch_busydiag_bufferRequestedAltBootDevicetask_worksmm_cidatomic_write_hw_max_ddebug_infostats_lockmpt3sas_config_get_pcie_iounit_pg1num_kpSTARGET_CREATED_REMOVEshost_gendevMEMORY_DEVICE_PRIVATEirq_managed__bd_flagssuper_blocknum_pdsbi_bvec_donebus_typeget_named_child_nodeassoc_arrayactor_MPI2_SGE_CHAIN_UNIONkobj_ns_typedeferred_resumesched_shared_tagslong intMPI2_IEEE_SGE_CHAIN_UNIONcore_nodemem_dqinfodevnodesaved_sigmaskBLK_UID_EUI64MEMORY_DEVICE_PCI_P2PDMAMpi2ExpanderPage0_tdq_offpinsblkcg_mutexis_visibledisk_nameconfig_pageuuid_tenclosure_list__kernel_clockid_twritabledqb_bsoftlimitMaxMinLinkRateio_window_1kvfork_donethresh_holdtask_cputime_atomicki_waitqra_pagesmmap_compat_legacy_basedevice_dma_supportedsysfs_dir_lockVolumeStatempt3sas_config_get_sas_iounit_pg0ignored_posix_timerslockedsival_intmpt3sas_base_get_smidia_filewakeup_cntrequest_pendingconfig_page_szdl_server_has_tasks_fkernel_param_opsctl_cb_idxnotifier_subscriptionsclass_read_lock_irqsave_is_conditionalpri_enabledinitiator_port_protocolsblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startrobust_list_headunsigned charwake_qrethooksnuma_scan_periodnr_tagswakeup_pathresult_maskFORTIFY_FUNC_memscanscsi_timeout_actionei_funcs__func__MinDevHandletablespipe_inode_inforaw_spinlockEncapsulatedCommandLengthsas_idktypecls_mskissue_host_resetmigration_disabledPCIBusNumRPM_REQ_SUSPENDpgprot_ttracepoint_ptr_tChainOffsetphysical_locationnum_vfSOFT_RESETnvme_mdtsPIDTYPE_MAXbi_sizeCurrentBootDeviceFormwatcherscrypt_ctxstopwait_maxclass_write_lock_irqsave_is_conditionaliovec_MPI2_VERSION_STRUCTa_flagsd_dnameScsi_Hostnr_migrations_coldmnt_idmap___GFP_FS_BITseeksquotactl_opski_ioprioIncompatibleReasonsched_remote_wakeuptag_alloc_policymemcpytracing_graph_pauseread_itersuspend_latefront_padDataScrubDurationsdev_devi_rwsembi_integritydriver_nameis_addedexitio_uringeh_device_reset_handlerchild_ns_typediagnostic_flagspci_devBoardNameslave_bdevscommit_dqblkclass_local_lock_irqsave_is_conditionalpcie_sglmark_dirtynr_ctxkernfs_opsoom_reaper_timermodulebd_security_entire_mapcountqueue_lockfast_pathf_pathstatic_call_siteself64_symunlinkmap_queuescpumask_var_ttime64_tdrivers_diri_gidFORTIFY_FUNC_strnlenrq_qosmark_deadicq_hintrmdirdq_dqbmemory_failureblkcg_gqdma_flagsSUBMITTED_BY_BLOCK_LAYERmax_hw_sectorsselectors_mtdmod_kallsymss_typeremount_fsbd_holderdelayed_sc_listtask_delay_infopi_seHostMaxLBAsubsystem_vendorin_useSAS_PHY_DISABLEDrq_countMIGRATE_SYNC_LIGHTerrseq_ttransparentkstatfsid_tablemems_allowed_seqmax_user_discard_sectorsWhoInittarget_allocbug_listhigh_iops_queuesmax_nr_cidmod_arch_specificDMA_NONEtransfersizesharebpf_net_contextPhysDiskMapis_msi_managedftrace_timestampbi_iopriod_ino_warnskernfs_elem_attrreset_preparei_ctime_nsecNumSlotsfw_events_cleanupi_private_listbinfmtftrace_sleeptimei_stateno_d3coldSCSITriggerEntrybv_pagepcpu_cidsupported_speedssched_migratedchildMPI2DefaultReply_tdup_xol_addrdevice_configurepci_error_handlersPROBE_PREFER_ASYNCHRONOUSrcu_node_entryno_vf_scanreverse_orderingfile_system_typeorig_ret_vaddrmmu_notifier_subscriptionsdefault_groupsConnector__sifieldsMSIxIndexnr_watchesDL_DEV_DRIVER_BOUNDAdapterOrdersmidcurr_ret_depthstarved_entryMpi26NVMeEncapsulatedRequest_t__fillerdestroy_dquot__task_fpstatefilldir_tget_reserved_spaceremote_identifyioprioKMALLOC_NORMALcreatedirtied_time_whenstart_scan_seqperf_rdpmc_allowedsym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerbd_openersdq_inuseclass_maskChassisSlotofflinedev_pm_infomremapin_memstallhost_self_blockedtph_enabledpoweroff_latei_nlinkwakeupcb_list___GFP_IO_BITcpu_idpushable_tasksdriver_overrideprev_fw_factstty_audit_bufmaxlenkernel_cap_tptm_enabledbpf_funcmems_allowedreply_free_dmaMpi2ManufacturingPage0_tSAS_LINK_RATE_G2s_inode_lrucached_rqsd1_supportinternal_dmammap_compat_basempt3sas_config_doneprepareconfig_cb_idxDiscoveryInfoclock_op_might_sleepf_sb_errneed_mbd_namecheck_flagsi_sequencert_priorityrequest_szkretprobe_instancescrypto_profileiov_basecpus_ptrq_lockdep_maploadfuncscpu_bitmappci_error_recoverySTARGET_DELMPIEventCodeSpecificatomic_write_lensaved_tfcfg_sizexa_headdetachSAS_PROTOCOL_SATAHotSparePoolremove_hostproperty_read_string_arrayget_statetracepoint_funcd_seqRequestDescriptorPostLownuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmtExtPageTypeblkg_listStripeSizenum_symtabexec_update_lockfscrypt_inode_infosplice_readneed_qsctx_mapbd_disknumberszone_wplugs_wqWRITE_LIFE_SHORTsigpendingpi_entrys_inodesdirtied_when_MPI2_CONFIG_PAGE_SASIOUNIT_0_MPI2_CONFIG_PAGE_SASIOUNIT_1MIGRATE_ASYNCnext_scangsindexcompletempt3sas_config_set_ioc_pg1watch_listeh_abort_listd_sibmodule_attributemax_host_blockedscsiio_depthslot_reset__builtin_memsetneed_tsin_dpm_listrdpq_array_enable_assignedwordworkDescriptorTypeDependent1multiprocessquiesce_depthclass_task_lock_is_conditionalvphys_masktask_groupphys_disk_dev_handlef_pos_lockshpc_managednum_physbio_pooltimeout_workwrite_endconfig_numsrcu_barrier_completionpacctblk_mq_tag_setcurr_targetPhysDiskStatusFlagsreset_typevm_page_protbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatperf_event_contextatomic64_tnoinstr_text_startHRTIMER_RESTARTrpm_autosuspend_delayis_thunderboltSlotbusystack_canaryreply_post_free_dma_poolnon_operational_loopmax_write_zeroes_sectorsHwLinkRate_utimetmf_work_q__fortify_size_MPI2_CONFIG_REQUESTMPI2_IEEE_SGE_SIMPLE_UNION_flags_1_flags_2taskstatsposix_acli_dio_countSL_WH_EVENT_TRIGGER_Tarch_rwlock_tdriversym_timens_pagewaitersoffsetprot_guard_typedev_iommumap_typeclass_rwsem_read_intr_is_conditionalcompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_usersDiagRWAddressHighSDEV_BLOCKbacking_dev_infoi_mappingMaxReducedFuncTimeIOCCapabilitiesdiscard_alignmentbsg_deviceshow_stats_ress_vfs_rename_keysubmitteretypeMpi2ManufacturingPage7_ti_bytes___GFP_WRITE_BITnormal_prioSDEV_CREATEDshost_datadispatch_waitsrcu_nodeconfig_rrs_svlast_mm_cidchain_pages_MPI26_NVME_ENCAPSULATED_REQUESTPhysDiskAttributesis_busmastervaddrscsi_vpderr_handleris_softnext_cpugrab_current_nspci_access_mutexminimum_linkrate_hwclass_namesMaxReplyDescriptorPostQueueDepthlock_class_keysum_exec_runtimecompatiblesetupdev_pin_infoinvalid_dword_countpoll_table_structmce_whole_pageia_modercu_tasks_holdout_listsched_rt_mutexs_pinsnon_seqfifo_timeNumSCSISenseTriggerhctx_listrenamemajorktime_tPRJQUOTAkprobe_blacklistjump_entriesdio_offset_alignreserved_tagsdma_masksa_restorerqueuelistdatalenmkdirio_missing_delaynextrelax_countrestore_earlyPIDTYPE_TGIDilenMaxPersistentEntriesmax_active_zonesdevice_physical_location_horizontal_position_MPI2_SGE_SIMPLE_UNIONkobj_uevent_env___GFP_MOVABLE_BITkprobes_text_startDiagRWAddressLowpid_typestargetfown_structi_default_aclscsi_cmnd_submitterfregs_statephy_identifiershift__devicesFORTIFY_FUNC_strcpypending_config_alloc_config_dma_memoryfirmware_event_threadIODeviceMissingDelayioc_pg8dma_boundarybd_nr_sectors_MPI2_CONFIG_PAGE_MAN_0SAS_LINK_RATE_6_0_GBPSnr_eventsconfig_page_dmakstatanon_vma_nameSGLFlagsdq_hash_MPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTOR__iovgp_stategrphintabiommu_mm_dataMpi2SasPhyPage1_tSASLevelzone_wplugs_err_listma_flagsarch_uprobebio_issueDL_DEV_UNBINDINGConfigElementKMALLOC_RANDOM_ENDbroadcast_aen_busyport_numrefcountmmap_lockControllerResetTOMpi26DriverTriggerPage1_tsrcu_reader_flavorinternal_free_listtimerqueue_nodeGPIOCountreal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_alloweduse_16_for_syncrt_mutex_waiterReportDeviceMissingDelaySAS_PROTOCOL_ALLmmio_always_onlegacy_mempage_pooldq_dqb_lockdiag_trigger_eventf_flagsblk_qc_tshow_infoslave_allocflush_requiredsg_tableattributesblk_queue_stats_MPI2_CONFIG_PAGE_RAID_VOL_0_MPI2_CONFIG_PAGE_RAID_VOL_1grplokgid_terror_detectedkey_userpci_channel_state_treadlinkoffline_disabledd_comparei_wb_frn_winnerqspinlock__compiletime_assert_451sighand_structsas_hbastart_brkSenseKeydio_completeshost_statelocked_pendingbase_readl_MPI26_CONFIG_PAGE_PCIEDEV_0_MPI26_CONFIG_PAGE_PCIEDEV_2s_idcore_statereply_dmaalignsym_int80_landing_padcurrent_eventscsih_cmdsngroupspme_pollsp_offset__sigrestore_tRPM_SUSPENDEDvolnameDMA_TO_DEVICEmutexattrsbi_sectoreh_deadlinempt3sas_config_set_manufacturing_pg11fsbasesrcu_barrier_mutexelement_type_keyswregs_state__kernel_timespecAttachedDeviceInfohpr_lookupioc_reset_in_progress_lockd_lrud_fieldmaskcountersReportGenLengthfaults_disabled_mappingnameidatapoweroffuntrustedminorsmpt3sas_base_check_for_fault_and_issue_resetelemsizerlim_curFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagdebugfs_entrywaitshow_rqMpi2ExpanderPage1_tcan_queuefw_event_listst_shndxreservedSL_WH_SCSI_TRIGGERS_Ti_wb_frn_historyctxsprocess_keyringset_dqblkmpt3sas_config_update_driver_trigger_pg0mpt3sas_config_update_driver_trigger_pg1mpt3sas_config_update_driver_trigger_pg2mpt3sas_config_update_driver_trigger_pg3mpt3sas_config_update_driver_trigger_pg4restart_blocks_opbi_end_iokobjectposix_cputimer_baseleveluser_definedpcie_target_idcow_page__warn_printkmsix_indexnanosleepfalsepi_state_listtv_secac_exitcodesuidKMALLOC_RANDOM_STARTMsgLengthdismissi_hashmm_cid_next_scanenable_sdev_max_qdfreeze_noirqoublockia_atime_timerhotplug_slotrespondingMpi2RaidVolPage1_tvm_private_dataskip_ms_page_8TargetCommandBuffermask_interruptsdq_freeSHOST_RUNNINGrootgot_task_abort_from_ioctlpolicycpu_baseraid_device_listMPI2_ADAPTER_ORDER_AUXcap_bsetnr_itemschain_offsetseq_startbp_regbvec_poolrb_root_cachedwwidi_blkbitswritervm_pgoffMPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTOR_refcountcsum_typebin_attributemath_emu_infopushable_dl_tasksValidEntriestestmanu_pg0sched_infogroup_infotailseh_eflagsdqi_fmt_idDataLengthdevice_missing_delaysoftirq_next_timerrevisionis_child_subreapersg_tablesizeexit_codefile_lock_contextwriteback_indexfiemap_extent_infofilemempool_free_tProductIDrt_spc_warnlimitcmndatomic_write_hw_unit_mintimer__empty_rangessbq_wait_statedev_namei387__p_sizeMpi2ConfigReply_terror_stated3hot_delaywb_errbudget_tokenhba_vphywrite_dquotf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachestorebi_bdevst_infoNumIOCStatusLogInfoTriggerdispatchdescsquiesced_bydqi_max_ino_limitllseek_MPI2_CONFIG_PAGE_HEADERlocal_fwnodeRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleno_d1d2get_projidbuild_sg_mpi__sectorpart0cnvcswmsix_basecallskqidmem_cgroupfree_inodesiglockwait_queue_func_tperf_recursionnr_wakeups_remoted_spacei_ctime_secdebugfs_idnext_timer_typeTT_NATIVEMPI26_DRIVER_IOCSTATUS_LOGINFO_TRIGGER_ENTRYhlist_bl_nodenum_descsmpt3sas_config_get_iounit_pg0mpt3sas_config_get_iounit_pg1mpt3sas_config_get_iounit_pg3mpt3sas_config_get_iounit_pg8_head_1_head_2clockid__read_overflow2_fieldFREEZE_MAY_NESTsym_hvclock_pageremap_file_rangemmap_legacy_baseend_dataxa_lockfutex_exit_mutexuse_16_for_rwiommu_groupProxyVF_IDmempool_alloc_tdevice_get_dma_attrtarget_blockedMpi2BiosPage2_talloc_inodepayloaddirty_foliofscrypt_keyringActionis_hardasync_sizetrap_nrf_iocb_flagsnvme_abort_timeout__flagsmultifunctiontotal_vm_MPI2_CONFIG_PAGE_SAS_ENCLOSURE_0iteratoruse_32bit_dmalastpool_dataqf_opsforce_atomicskip_bus_pmreal_credno_difblkcnt_td_rt_spacesigned charpcie_cap_lockhas_child_subreapermountreply_post_free_dmablk_flush_queueres_attr_wcsched_entitydev_links_infos_uuid_len___GFP_RETRY_MAYFAIL_BITdqi_privIOCRequestFrameSizefmode_trpm_autosuspendsweventremove_busactivatefxregs_stateSAS_SATA_SPINUP_HOLD_lowerreply_szidentifypaddingDEVICE_REMOVABLEVF_IDtimer_rand_statellist_nodeNVMe_Commandbpf_run_ctxbio_slabDCRAddressstate_add_uevent_sentenv_startmodule_notes_attrsio_cqControlFlagsrangebvecacct_vm_mem1on_cpumanage_system_start_stopstringSHOST_CANCEL_RECOVERYnuma_preferred_nidmemsetfree_diskvmem_altmapchain_buffer_dmabiotailwait_start_MPI2_ADAPTER_INFOelevatorspinlocksrcu_barrier_seqi_aclptm_granularitytrigger_info_dwordsnofaultia_rangesq_size_fieldHostTraceBufferDecrementSizeKBis_reltablepteval_t_MPI2_IEEE_SGE_SIMPLE32AccessStatusblk_mq_tagsDEVICE_PANEL_LEFTorc_unwind_ipdiag_buffer_statustm_custom_handlingrel_deadlinekobj_typeskip_settle_delaysb_writersdma_cleanupeh_timed_outdriver_dataLossDwordSynchCountis_iouring_poll_qphys_addr_tdma_iommumax_idirq_saferescue_lockdefault_timer_slack_nsxregs_states_statecompletion_cnt_deferred_listcurr_nrset_child_tidbio_vecacpi_match_tablenfdsrlimitSCSISenseTriggers_MPI2_IEEE_SGE_SIMPLE64MPI2_SAS_IO_UNIT0_PHY_DATAidle_notificationmodule_stateMPT_BUILD_SG_SCMDwait_lockf_pipegetgeowrite_iterMaxDevHandleD_REAL_DATAEventValueacct_timexpdclock_mutexVolumeSettingschain_segment_sznr_failed_migrations_runninguserfaultfd_ctxevent_flagsthread_structmm_context_tenclosure_handlebd_stampdio_mem_aligncstimereplyMPI2_CONFIG_EXTENDED_PAGE_HEADERprot_capabilitiesatomic_long_trpm_requestirq_reroute_variantpci_sriovMQ_RQ_COMPLETEio_comp_batchRunningDisparityErrorCounthi_priority_dmadma_alloc_attrsf_credtrace_eventsretry_configd_iputReqBootDeviceFormMPI2_VERSION_UNIONnr_wakeups_syncstackExpanderDevHandleSAS_LINK_RATE_G1blockedallowedmce_countweightblk_plugtrc_reader_nestingfpstatetag_setis_roxno_scsi2_lun_in_cdbprevPhysDiskNumseqcount_raw_spinlock_MPI26_CONFIG_PAGE_PIOUNIT_1bios_paramnum_orcsFORTIFY_FUNC_kmemdupDevHandlebuflenWRITE_LIFE_LONGari_enabledexpiry_activeeh_bus_reset_handlermtd_infoenclosure_levelis_confidentialreset_in_progress_mutexi_dentryfixupspcie_sg_lookupvm_endvm_structmemcgfsync_MPI2_IOC_INIT_RDPQ_ARRAY_ENTRYsgidcompat_robust_listnuma_workpriocurrent_stateprivvalueReplyFlagsreply_qcurrent_stack_pointerac_minflt_hugetlb_cgroupSettingsset_policyinternal_tagthreadftrace_callsitesmmlistconfig_vaddrpage_typeclass_spinlock_is_conditionalusermynodeseq_stopblk_trace_MPI26_CONFIG_PAGE_DRIVER_TRIGGER_0_MPI26_CONFIG_PAGE_DRIVER_TRIGGER_1_MPI26_CONFIG_PAGE_DRIVER_TRIGGER_2_MPI26_CONFIG_PAGE_DRIVER_TRIGGER_3_MPI26_CONFIG_PAGE_DRIVER_TRIGGER_4actionpi_waitersdoe_mbsMpi2RaidPhysDiskPage0_thi_priority_depthatomic_tpcp_listdiag_trigger_masterqueue_flagsMPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTORrb_rootExtPageLengthsubsystem_devicesas_phyutf8data_tablecpu_msix_table_szSAS_LINK_RATE_FAILEDexe_filePUT_SMID_DEFAULTWorduid_telementshpr_free_listd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_dataPortTypedef_flagssrcu_n_lock_retriesraw_locksrcu_structis_guestio_minsplice_eofs_sync_lockanon_vma_chaini_mtime_nsecrseq_event_maskem_pdi_fsnotify_maskshared_pending__int128__mce_reservedwriteback_controlmm_structPhyIdentifier__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEreset_timeoutbuild_ids_export_opMPT_ADD_SGElen_descseg_boundary_maskanon_namesched_dl_entitypp_ref_countactivest_otherstartparentlookupkernel_siginfostart_scanmpt3sas_init_warpdrive_properties_sigpollparam_array_opsSDEV_CANCELkill_sbMaxTargets__param_str_logging_level__bi_remainingnum_bugsnr_requestssecurity_supportedport_identifieradapter_reply_queueklist_scsih_issue_delayed_event_ack__param_str_max_sectorsstate_entry_ptrmpt3sas_base_get_msg_framestatsQUEUED_scsih_internal_device_blockMPI2_EVENT_IR_CONFIG_ELEMENTactive_baseschain_depthDEV_DMA_COHERENTswap_slot_free_notifyunsafe_warnconfig_cmdsmpt3sas_base_get_smid_hprstart_databoolbv_len___GFP_RECLAIMABLE_BITalloc_fw_event_workinquirymodsctimedestroy_inodefutex_pi_statehbas_to_enumerateLogDataBoardTracerNumberNegotiatedLinkRateMpi2BiosPage2BootDevice_ti_mutex_dir_keyrescue_workrestartsASCQdevice_physical_location_vertical_positionget_aclset_aclrdpq_array_enablesas_targettarget_priv_datas_voppercpuLengthpci_dynids_scsih_determine_hba_mpi_versiondescpoll_biosas_enable_tlriterate_sharedmpt3sas_transport_port_addsym_vdso32_sigreturn_landing_padssp_targetcma_areafeaturesrcu_tasks_exit_cpumigrate_from_cpubd_size_lockwriteerror_codebuddy_listldt_structSASNarrowMaxQueueDepthcred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_name_sas_portVTIME_INACTIVEeh_target_reset_handlerclass_preempt_is_conditional_MPI2_EVENT_DATA_SAS_TOPOLOGY_CHANGE_LISTtimeoutforeign_config_MPI2_RAID_COMPATIBILITY_RESULT_STRUCTSecondaryReferenceTaguring_cmdshrinker_idnr_dirtiedFAST_IO_FAILgetattrsetattrreq_get_ioprioPageVersionfixup_scsih_del_dirty_port_entriesblockMQ_RQ_IDLEdevtlast_cpuprocdirnr_wakeups_local__param_max_sectorsvolume_mapping_flagsuidhash_nodeworker_privatepoll_event__compiletime_assert_578mpt3sas_raid_templatelinelinkbi_poolmpt3sas_base_detachphysfnbi_cookiemode___GFP_NOWARN_BITatomic_setport_table_list_sas_nodeEnclosureLogicalIDnode_idtargetget_nextdqblkSOFT_ERRORcancel_work_syncrcu_tasks_idxMpi2EventAckRequest_t__ret_do_oncejournal_infobi_inline_vecstqheadlast_used_atrq_end_io_retsense__UNIQUE_ID_diag_buffer_enabletype605hres_activepcie_device_getmod_name__q_sizenotes_attrsdelay_work_scsih_expander_node_addblock_device_operations_scsih_nvme_shutdownoffset_ctxbi_blkg__UNIQUE_ID_hbas_to_enumeratetype603FREEZE_HOLDER_KERNELarch_test_bitlast_switch_timerphywakeup_countwait_indexrunnable_weighthostdiag_unlock_mutex_scsih_check_ir_config_unhide_eventstarget_busyclass_releaselast_sum_exec_runtime_scsih_check_pcie_access_statusResyncRatedd_key_truet10_pi_ref_tagsa_handlercg_listscsi_transport_templatelocked_vmNOIOBqueue_rqaddressmq_hctxDefaultstart_timezone_wplugs_hashcookielistscsi_scan_hostRequestCreditWORKER_DESC_LENreply_free_dma_pooldesc_ioc_statesig_okphy_listextabledma_data_directiontr_timeouti_sizeentry_eipsplice_pipexstate_headerinquiry_len__param_str_host_tagset_enableblock_exponentdma_addrAddressReplyem_perf_domaind_flags___GFP_HIGHMEM_BIT_large_mapcountpid_namespacelive_MPI2_RAIDPHYSDISK0_INQUIRY_DATAclock_was_set_seqspc_warnlimitseqcount_t_MPI2_ADDRESS_REPLY_DESCRIPTORmin_fltblock_devicencq_prio_enablescsih_pci_slot_resetmpt3sas_check_for_pending_internal_cmdsMEMORY_DEVICE_GENERICpkruNewValueattribute_containerprojid_tvendorprot_maskdma_lengthscsi_print_commandkey_payloadadd_linkspinnedsubsys_dataSHOST_DIF_TYPE3_PROTECTIONuse_10_for_ms_scsih_expander_node_remove_dummy_bndWQ_FREEZABLErefcount_saturation_type__WQ_ORDERED__param_hbas_to_enumerate_scsih_get_shost_and_ioc_scsih_sas_ir_physical_disk_eventmpt3sas_ioc_listsaved_stateparent_exec_idutil_sumdd_key_false_scsih_enable_tlrsigvaldev_to_shostfsnotify_mark_connector__ubuf_iovecsize_is_constantcputime_atomicdeadlinereset_methodsbio_integrity_payload__mpt3sas_get_pdev_by_idchannellun_in_cdbexit_requestwait_queue_upperclass_write_lock_irq_is_conditionalswap_readahead_infovtimeRAID_STATE_UNKNOWNexpecting_cc_uas_rootstack_refcountgrpmaskdevice_attribute_find_first_bitpm_caps_remove_countlru_genMpi26EventDataPCIeDeviceStatusChange_twrite_newack_requestuser_namespaceclass_rwsem_write_is_conditionalpids_active_resethlist_nodeNegotiatedPortWidthblk_features_tsuper_operationsautosleep_enabledwrite_file_infoload_sumresourceaddress_spacecpus_maskdl_yieldedstarget_data_MPI2_SEP_REPLYfile_dispread_newd_spc_softlimituse_10_for_rw_MPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTORkrefSecondaryApplicationTagrseq_csDID_ERRORs_lock_keybuild_zero_len_sge_mpidqi_flags_scsih_tm_display_infopdevmq_ctxjump_entrypi_top_taskDoorbellset_host_bytelist_del_initpacct_structRPM_REQ_RESUMEreq_boot_deviceuser_sizeRAID_LEVEL_LINEARis_aero_iocslot_numberats_caplast_queue_ramp_upkref_get__UNIQUE_ID___addressable_init_module621bd_statsMpi2SystemInterfaceRegs_tshow_fdinfoFAULT_FLAG_MKWRITEput_budgetfadviseclass_read_lock_irq_is_conditionalskip__UNIQUE_ID_version594linenoMODULE_STATE_LIVEtask_listmpt3sas_raid_device_find_by_handleasync_scanEEDPErrorOffsetFAULT_FLAG_RETRY_NOWAIT_qprocread_foliosc_data_directionhas_elevatordq_countvpd_pg0nlinksignalshutdown_latencynr_wakeups_passiveself_exec_idstate_syncedws_activef_epscsih_removesriov_set_msix_vec_count__this_modulePhysDiskSettingsrcu_specialscsi_device_handler_scsih_set_levelentrybackWORK_STRUCT_FLAG_BITSd3cold_allowedcntsrequest_trackersock___GFP_THISNODE_BITsdev_bflagsdispatch_fromWORK_STRUCT_PWQ_SHIFTis_driver_loadingmq_freeze_wqstart_prevent_timeSCSI_PROT_WRITE_STRIPpgd_tMPI25_SGE_IO_UNIONchain_lookupsigset_tMpi2EventNotificationReply_tOEMRDbucket_id__UNIQUE_ID_max_lun602_scsih_turn_on_pfa_ledSL_WH_MASTER_TRIGGER_TresyncMpi2BiosPage3_tgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64_scsih_sas_device_discovery_error_event__list_del_entry_validvolume_pg0volume_pg1__real_strlcati_inoserver_has_tasksAttachedPhyInfoout_fail_killi_spc_warnlimitbuild_zero_len_sgeunderflowf_posperformancesoftowner_trapnoload_weightSCSI_PROT_NORMALio_windowMPI2_RAID_ACTION_RATE_DATAsymlinkclass_rwsem_write_try_is_conditionalkmalloc_noproffw_event_work_getbd_queuein_iowaitDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclbdi_writebackrb_leftmostbug_addr_dispmigration_pendingscan_mutexhosttd_realMaxSasExpanders_scsih_update_device_qdepthscsi_set_resid_MPI2_RAIDVOL0_SETTINGSdevice_get_match_datahdr_types_max_linksMpi25SCSIIORequest_tscatterlistscsi_device_busythread_headacquire_dquotclockid_ttarget_destroyzone_capacityFORTIFY_FUNC_strlen_MPI2_VERSION_UNIONpref_64_windowpgdval_td_manageshost_recoveryNumberOfPortsRAID_LEVEL_UNKNOWN_scsih_sas_device_removeSAS_SATA_PORT_SELECTORmfg_pg10_hide_flagmpt3sas_config_get_expander_pg1max_device_blockedback_padMIGRATE_SYNCdiag_trigger_activewcharRQ_END_IO_FREEHCBSizeseq_fileulongrestoresge_sizeHPROBE_LEASEDBoardAssemblyHostInterruptMaskthaw_superis_managedalt_len_MPI2_DEFAULT_REPLY_DESCRIPTORseq_operationsfallocate__remjiffies_to_msecs__ret_call_addrfree_chain_listport_next_MPI2_BOOT_DEVICE_DEVICE_NAMEi_mmap_rwsem_scsih_is_nvme_pciescsi_deviceBidirectionalTransferCountundo_listis_probedattribute_groupdma_poolspersonalityprintk_index_sizeMPI2_BOOT_DEVICE_SAS_WWIDConfigNummsix_enablestripe_szuprobe_task_statestimesas_release_transportstatic_priotmpfiledqi_formatnvcswrequest_payload_nr_pages_mappedfrequencyRaidCompatibilityResultmpt3sas_base_scsi_enclosure_processordev_pm_ops__refcount_sub_and_test__kmalloc_indexirq_poll_scheduledget_enclosure_identifieralloc_hintsense_dma_poolblk_mq_ctxsas_device_pg0no_updateiter_type__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_44DEVICE_PANEL_BOTTOM__compiletime_assert_46__compiletime_assert_47__compiletime_assert_48__compiletime_assert_49__UNIQUE_ID_hbas_to_enumerate604VolumeTypetransporttreply_post_host_indexMpi2EventDataLogEntryAdded_t_scsih_pcie_topology_change_event__compiletime_assert_50__compiletime_assert_51__compiletime_assert_52__compiletime_assert_53__compiletime_assert_54__compiletime_assert_55__compiletime_assert_56__compiletime_assert_57SubsystemIDnr_wakeupsenabledki_filpmultiple_queueswork_func_tpp_magicfpu_state_permGenericFlags0bars__compiletime_assert_69fwnode_reference_argsdevres_headbus_listdpc_rp_extensionsscsih_cb_idxtmp_listioc_stateraid_nextRPM_REQ_IDLEShutdownLatencyfilenamebase__compiletime_assert_70__compiletime_assert_71__compiletime_assert_72__compiletime_assert_73__compiletime_assert_74__compiletime_assert_75__compiletime_assert_76__compiletime_assert_77d_prune__compiletime_assert_79DiscoveryStatusmpt3sas_transport_add_phy_to_an_existing_portrestore_noirq_MPI2_SYSTEM_INTERFACE_REGSsysfs_registered__kmalloc_large_noprofrlocksas_node_locki_rt_spc_warnlimitqueuedevice_remove_in_progressstrcat__compiletime_assert_81__compiletime_assert_82__compiletime_assert_83__compiletime_assert_84__compiletime_assert_85__compiletime_assert_86__compiletime_assert_87__compiletime_assert_88__compiletime_assert_89SCSI_PROT_GUARD_CHECKbytesnuma_migrate_retryMEMORY_DEVICE_COHERENTenclavefilterelement_strroot_blkgd_revalidate__compiletime_assert_90__compiletime_assert_91__compiletime_assert_92__compiletime_assert_93__compiletime_assert_94__compiletime_assert_95__compiletime_assert_96__compiletime_assert_97__compiletime_assert_98PhyBitstracepoints_incoredqsi_opreplyPostRegisterIndexquota_syncsrcu_have_cbsasync_in_progresssignumdqi_dirty_listpi_locktimespec64scan_finishednr_forced_migrations__mpt3sas_get_sdev_by_rphyumount_begin_MPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTORchannelbadblocksblocking_handlesport_idkernfs_node_MPI2_DEFAULT_REPLYkobject_namearch_atomic_readscsih_qcmdcpumaskptrace_messageExpanderRouteIndexeslength_scsih_mark_responding_raid_device_boot_deviceMpi26EventDataActiveCableExcept_ttag_list_MPI2_RAID_ACTION_START_RAID_FUNCTIONbio_alloc_cachepdt_1f_for_no_luni_wb_frn_avg_time_pincountreclaim_state__param_disable_discoverydrv_internal_flagsruntime_errori_sb__poll_tsubvolon_dispatchdirty_inodesymtabd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structfs_parameter_specqueued_spin_is_lockedrcu_data0real_blockedruntime_suspend_MPI2_BOOT_DEVICE_ENCLOSURE_SLOTxfer_cnt__s16sas_identify_scsih_sas_volume_addbacktracerefcount_incoffline_alreadys_umountn_nodeHostTraceBufferMaxSizeKBon_listNvdataVersionDefaultIOCLogInfo_MPI2_CONFIG_PAGE_IOC_1_scsih_sas_device_status_change_event_debug_MPI2_CONFIG_PAGE_IOC_8data_vmneeds_force_resumeblk_eh_timer_returnFunctionsas_device_init_listrpm_statusCoalescingDepthscsi_host_state__s32MPI2_RAID_VOL_INDICATORp_sizechildrenfw_workcheck_eventsdqi_bgracei_wbhost_nof_inodeResponseInfoserialburstaer_capscsi_target_statehostmsi_device_datamaskslave_destroylog_entrykallsymsi_ino_timelimitreply_payloadbi_issuebd_holder_opsphy_masksas_device_put_scsih_scsi_ioc_infosrcu_idxSTARGET_CREATEDutil_est__s64hugetlb_usagesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenacct_rss_mem1___orig_eipsrcu_datadevice_physical_locationchains_per_prp_buffer__keycgtimepagefault_disabledStopRaidFunctionindexEEDPObservedAppTagMpi2ManufacturingPage10_ts_time_max_scsih_sas_device_status_change_event__mutex_initdelayed_workmpt3sas_scsih_expander_find_by_handleopen_partitionssa_maskmmappedMPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORElf64_Wordactive_timeatomic_flagscallernum_jump_entriesextra_lenPIDTYPE_PGIDelemend_ioquotalensrcu_data_have_cbsnivcsw_scsih_sas_broadcast_primitive_event_tidioc_pg1_copymce_vaddrdl_dev_stateshowrb_subtree_lasts_listadd_busunique_idmq_pollnr_segssame_target_siblingsof_match_table_entryino_timelimitparent_devSDEV_EVT_SOFT_THRESHOLD_REACHED_REPORTEDalternative_gpt_sectori_readcountblkcg_polsSCSI_PROT_IP_CHECKSUMOfflineReasonincrmpt3sas_config_get_phys_disk_pg0freepasid_enabledlock_countthrotl_datareply_dma_max_address_sas_devicelist_lru_onescsih_aborti_pagesmxcsrconfigured_lunWQ_POWER_EFFICIENTrom_bar_overlapclass_rcu_is_conditionalarchdataptrace_entryguest_permwait_queue_headnum_srcu_structsnr_activeprev_sum_exec_runtimei_flagsgendisku_flagstag_set_listexpander_handleMPI2_RAIDPHYSDISK0_INQUIRY_DATA_MPI2_RAID_ACTION_HOT_SPARElogical_block_sizeSDEV_EVT_MAXBITSinvalidate_lock_keyinfoattribute_container_find_class_devicel1d_flush_kill_scsih_is_boot_deviceMPI2_IEEE_SGE_SIMPLE64_scsih_tm_volume_tr_completewrite_beginSHOST_CANCELwrite_infosas_disable_tlrhrtimer_restarts_encoding_flagssessionidd3cold_delays_time_minWORK_STRUCT_PWQ_BITvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrs_stack_depthFlags__vm_flagssdev_statequeue_depthinternal__dummy2mpt3sas_port_enable_completepm_messagefred_cschangedsmp_handlercur_ktimeinitparent_handlefop_flags_tgroupsmpt3sas_base_make_ioc_readyoffstty_structnotify_nextvirtual_dr6dma_opsreset_wqMpi2SepReply_t_MPI2_CONFIG_PAGE_SAS_PHY_0ResponseCodedma_addressmmap_basebd_devsyscall_workinit_cmd_privMpi2BootDeviceEnclosureSlot_tlockdep_mapnum_trace_evals_scsih_sas_ir_operation_status_eventbidi_rq_addr_bndscsih_tm_cmd_map_statusset_dbd_for_msnumberzone_device_dataquota_readIOPRIO_CLASS_NONEpinned_vmreventswritepagesnuma_faults_localityqrwlock__write_overflow_fieldrw_semaphorePCI_ERS_RESULT_NONEfirst_minori_blockstask_frag_mpt3sas_err_handlerTimeSyncIntervalsource_listsum_block_runtimeHostTraceBufferMinSizeKBPCI_ERS_RESULT_NO_AER_DRIVERioc_reset_countnuma_scan_period_maxtotal_timepowerrequest_queuenum_ei_funcsi_generationSAS_LINK_RATE_3_0_GBPSflushonline_MPI2_CONFIG_EXTENDED_PAGE_HEADER_MPI2_RAID_VOL_INDICATOR_scsih_mark_responding_pcie_deviceno_vpd_size_scsih_tm_tr_volume_sendformatlast_switch_countsge_size_ieeelast_wakeeswapuint32_tssize_tphy_belongs_to_portRQ_END_IO_NONEvtime_statefind_first_bitpci_ers_result_ttry_vpd_pages__ret_conds_blocksizequeue_numprevent_sleep_timeset_bitclass_spinlock_irqsave_try_is_conditionalclear_bits_readonly_remounteh_should_retry_cmdi_io_listChangeCountchild_countpcie_bwctrl_dataVTIME_IDLEDeviceIDcompat_uptr_treply_dma_min_addressDEVICE_HORI_POS_LEFT__UNIQUE_ID___addressable_cleanup_module622_hugetlb_subpoolend_pfnuclamptgidpci_namelimits_lockrelease_scsih_pcie_check_devicenr_wakeups_migratestack_vmi_fieldmaskupidinsntrace_evals_scsih_sas_discovery_eventia_vfsuidquota_format_opsprocenti_datascsi_prot_intervalrescue_listfsverity_info_scsih_block_io_all_devicecore_threadclosidsched_avgdesc_scsi_statuscodearch_atomic_fetch_addbsg_jobsyscorevol_pg0__i_nlinkpmd_t_scsih_check_volume_delete_eventsScratchpadsrcu_barrier_cpu_cntreadaheadopt_sectorshrtimer_cpu_baseirq_domainwait_liststatic_call_trampfsverity_operationsreply_post_queue_depthcoublockPhyStatus_scsih_setup_eedp_scsih_block_io_devicebug_tablemigrate_mode_scsih_set_volume_handle_for_trBlockSizeusing_gplonly_symbolsremovedhandleremulatedsym_vvar_page__UNIQUE_ID_alias595membarrier_statedma_pad_masksas_addressbin_sizescsih_pm_opsFORTIFY_FUNC_strlcatrcu_read_lock_nestingsam_statusCoalescingTimeoutrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_t_scsih_display_enclosure_chassis_infoio_bitmapDEVICE_VERT_POS_CENTERZoneGroupretry_countsbitmap_wordlong unsigned intmax_timeout_unlocklast_queue_full_countread_file_infoexec_startia_sizeBidirectionalDataLengthio_queue_numRPM_RESUMINGMODULE_STATE_COMINGsym___kernel_sigreturninit_completionFWVersionuser_cpus_ptrd_opstate_initializedpend_os_device_add_szrelease_dquotplugsoftirq_activatedresid_len__UNIQUE_ID_prot_mask610inv_weight_raw_spin_lock_irqsaveVolDevHandlesecurityMpi2SasIoUnitControlRequest_tGlobalFlagskernel_symboldl_timerlockdep_map_pmodule_param_attrsno_read_capacity_16scsi_host_template__user_state_size__UNIQUE_ID_max_sectors598chainedVTIME_GUESTretriessdtrsysvsemdisconnectstashed_scsih_probe_devicespasid_no_tlpuser_xfeatures__kmalloc_cache_noprofuse_memdelayMPT_BUILD_SGnr_cached_objectshas_timeouttime_sync_intervalpayload_lencommcallback_headmpt3sas_setup_direct_ioexception_table_entryin_hrtirqdelayed_event_ack_listfactor1factor2_overruncondDEV_DMA_NON_COHERENTcoredumpd_sbio_lock_cls_keylist_move_tailMATCHED_WITH_ADDR_AND_SUBPHYMASKksetno_msisleep_maxmq_kobjxmm_spaceprobe_type__param_missing_delaynum_trace_eventsnodesysvshm_scsih_ublock_io_all_deviceno_highmemREFCOUNT_ADD_UAFfirstport_enable_cb_idxWORK_OFFQ_BH_BITactive_countnr_active_requests_shared_tagsnum_tracepointsueventsharednext_cpu_batchdisk_eventss_sysfs_namesigval_tcombined_reply_index_countSDEV_QUIESCEbitsbase_pfndevice_handleclass_mutex_try_is_conditionalresource_size_tmpt3sas_config_get_number_hba_physRAIDSetNum_scsih_get_port_table_after_resetsem_undo_listcompat_rmtpclass_local_lock_is_conditional_MPI2_SAS_IO_UNIT1_PHY_DATAdiag_trigger_mpistatic_key_true_stimeEEDPObservedRefTagAdapterOrderAuxperf_event_ctxpfwfault_debugcostxcomp_bvio_contextmsix_enabledPIDTYPE_PIDwakee_flipsvlagMaxPortConnections__UNIQUE_ID_author591ufdssegment_boundary_maskReceptacleIDioctlprev_cputimesaved_cap_space_scsih_device_remove_by_handleout_attach_failhorizontal_positionem_perf_tablebi_crypt_contextSAS_PROTOCOL_NONEprivatelog_infoswp_entry_tcharmatchnr_failed_migrations_hotreg_offsetAddress32queue_stopped_scsih_error_recovery_delete_devicesFORTIFY_FUNC_UNKNOWNbin_attrs_scsih_sas_device_init_addcpu_itimerMPT3SAS_FLUSH_RUNNING_CMDSPrimitivedevres_lock_MPI2_RAID_ACTION_REPLYfiles_struct__ret_onceblk_zoneSDEV_RUNNINGicq_treevfsuid_tf_lockexec_vmkernel_paramvertical_positionraw_atomic_fetch_add_relaxedshutdown_prerelease_foliobi_io_vecstatus_strpri_capget_msix_index_for_smliovendor_idmtimearchrobust_listasync_probe_requestedthaw_earlySAS_EDGE_EXPANDER_DEVICEvectors_securitysplice_writeport_enable_failedparam_lockreq_listdesc_scsi_statei_opflagsdentry_operationsstats_sectorss_blocksize_bitskfreeaccess_status_scsih_set_nvme_max_shutdown_latencyenclosure_logical_idexp_hintdisable_discoveryclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapdevice_remove_in_progress_szstrnlenpfacts_head_2a__UNIQUE_ID_missing_delay600sym___kernel_vsyscallopen_muteximm_readyfortify_funcLinkRateStartSlot_MPI2_SCSI_TASK_MANAGE_REQUESTget_timeki_flagss_inode_wblist_lockscsih_target_allocioc_link_reset_in_progresspermchain_bufferdestroy_workMpi2RaidVolPage0_tlockableuprobes_statemm_countMaxLBAtrace_overrunargsargvdiag_trigger_scsi_MPI25_SGE_IO_UNIONraid_function_templateuclamp_reqswap_info_structdynidss_qcopblk_mq_queue_mapchip__kernel_long_tsrcu_usagefaultableMPT3SAS_ADAPTERMPT_BUILD_ZERO_LEN_SGEparam_ops_boolSAM_STAT_BUSYexit_hctxmpt3sas_get_pdev_from_targetin_execveEEDPObservedGuardrlim_maxphy_resetsimple_tagsSlotNumbertarget_listmutex_lock_scsih_sas_device_addcoherent_dma_maskEvent__data_lendriver_flagsfile_ra_stateRAID_STATE_OFFLINEk_sigaction_MPI2_SAS_IO_UNIT0_PHY_DATA_hugetlb_hwpoisontemp_sensors_countReplyFrameAddressreadahead_controlfwnode_operationsswait_queue_headMaxNumPhysicalMappedIDsmemory_typePciBusNumbervm_userfaultfd_ctxTT_NONEmap_pagesmod_tree_node_scsih_donempt3sas_config_get_number_pdscmd_flagss_bdev_filedev_pagemapis_mcpu_endpointcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fsparent_sas_addresshost_eh_scheduledsoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLEElementFlagsrb_nodereturn_consumerMpi2EventDataIrOperationStatus_tround_robinMsgFlagsi_private_datavolume_handleptracer_credWORK_STRUCT_COLOR_BITSsrcu_barrier_headleadercheckhtb_rel_queryTT_COMPATcap_effectivemsix_taskexit_statefaultscan_startmax_sges_in_chain_messagesubvendorbios_pg2WORK_STRUCT_COLOR_SHIFTbios_pg3numa_pages_migratedPCISlotNummax_sges_in_main_messagesched_tagssupported_mode_scsih_check_access_status_MPI26_EVENT_DATA_PCIE_DEVICE_STATUS_CHANGE_scsih_internal_device_unblocksbitmap_queueis_gen35_iocpci_p2pdmano_cgroup_migrationscsih_scan_finishedattached_handlesched_datachain_listprintk_index_startindex_keybreserved_tags__bi_nr_segmentsscsi_change_queue_depthneeds_fresetSHOST_DIX_TYPE0_PROTECTIONtask_abort_retriesrcecintervalbug_entrytimers_activenum_classes__UNIQUE_ID_logging_level596_scsih_set_satl_pendingActiveZoneManagerSASAddressvma_lockdevice_stateIeeeSimpledl_throttledseccompDEVICE_VERT_POS_UPPERblk_holder_opsraid_attrsstatic_key_modport_siblingsfilter_countmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodeSupportedLinkRatesumode_t__init_workdestroy_workqueueinitial_nsnon_compliant_barsno_pmGRPQUOTAia_vfsgidioctx_lockfw_eventtimer_slack_nss_bdimpt3sas_setup_debugfsxarraycan_wakeuppdeath_signalnr_wakeups_idledqi_igrace_scsih_sas_pd_deleteqf_nextmaple_treensproxymanu_pg10manu_pg11slave_dir__p_len__write_overflow_pkeykernfs_rootmpt3sas_config_get_volume_wwiducountsget_next_idDD_CLASS_TYPE_LEVEL_NUMhigh_iops_outstandingrefcount_ttimestamp_update_countErrorResponseBaseAddresscmd_lenDEVICE_PANEL_TOPmax_hw_discard_sectorsint32_txol_areaport_listraid_leveldefault_locktmp_stringguess_capacitysrcu_gp_mutexSAM_STAT_RESERVATION_CONFLICT_MPI2_CONFIG_PAGE_BIOS_2_MPI2_CONFIG_PAGE_BIOS_3debugfs_dirwakee_flip_decay_tsprio_listevent_dataMPI2_BOOT_DEVICE_ENCLOSURE_SLOT_MPI2_EVENT_DATA_SAS_ENCL_DEV_STATUS_CHANGElast_timeBiosVersionrequestblk_unique_idsas_address_parentSDEV_DELscsi_internal_device_unblock_nowaitDID_PARITYMasterDatacontexthost_lockrwlock_tvm_fault_tSAS_PHY_RESET_PROBLEMuse_autosuspendPCIeEncapsulatedSuccessclass_spinlock_irq_try_is_conditional_MPI2_RAID_ACTION_STOP_RAID_FUNCTIONcfs_rqsas_iounit_pg0sas_iounit_pg1phy_list_mutexvirt_boundary_maskcgroups_tr_listcore_occupationget_policycore_cookiedel_listMpi2ManufacturingPage11_trefcount_structpcie_device_pg0__kernel_ulong_tpcie_device_pg2sas_phy_linkratesfwnodestatic_call_key_scsih_add_devicedelayed_scnamespaceeedp_flagsparametersgroup_leaderdma_channelrunnable_avgMpi2IOCPage8_tlookaheadiowait_countshstkdelayed_trioac__kernel_clock_tMpi2SasDevicePage0_t___GFP_DMA32_BITwas_resetgp_seqscsi_device_stateuuidmaj_flt_sc_list_scsih_search_responding_sas_devicescached_requested_keydqb_rsvspace___GFP_NOMEMALLOC_BIT_MPI2_EVENT_DATA_IR_OPERATION_STATUSmpt3sas_scsih_scsi_lookup_get__s8inode_operationsMaxVolumes__kernel_size_tdma_configurefile_leaseclass_local_lock_nested_bh_is_conditionalWQ_BHgpl_symssas_devicepci_vpdblock_szpercpu_rw_semaphoreis_chassis_slot_validarch_spinlock_tseqcount_raw_spinlock_tthread_pidevent_logInactiveStatusdl_non_contendingcurr_ret_stackpgtable_tmax_bus_speed__u8q_usage_counterwakeirqSCSI_RETURN_NOT_HANDLEDi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyssdev_targetcore_forceidle_sumget_offset_ctxbase_readl_ext_retryreleasedexport_operationsqc_stateget_budgetBLK_INTEGRITY_CSUM_IPmempool_smempool_td_inodespecial_vecMPI2_RAIDVOL0_PHYS_DISKworkqueue_structi_lock_keySAS_PHY_VIRTUALuevent_suppressgraveyard_linkbi_opfscsi_cmndfs_superswait_for_discovery_to_complete__read_overflow2wce_default_on__rcu_icq_cache___GFP_KSWAPD_RECLAIM_BITcap_ambientqstrtaskss_d_opreply_post_free_array_dmano_report_lunsi_rcu__count__already_doneinit_requestGET_MSIX_INDEXio_optpcountSubsystemVendorIDbio_listwlockedSCSIStatetest_and_set_bitdevicemodule_kobjectMpi2RaidActionReply_tpercpu_count_ptrpcie_mpssnr_ia_rangesthawmpt3sas_scsih_clear_tm_flagtlbflush_unmap_batchremovebvec_iteroom_mmbpf_local_storagename_linkcompat_long_tcnivcswchain_dma_pool_raid_deviceats_stushort inttrc_reader_specialscsi_lookup_locklogging_levelgtimedisk_events_disable_depththread_group_cputimersizemigrate_to_ramreset_from_userUTASK_SSTEP_ACKbroadcast_aen_pendingloginuiddesc_structi_wb_lists_umount_keyquota_typeMpi2EventDataSasTopologyChangeList_t__UNIQUE_ID_disable_discovery608__init_swait_queue_headnameIoIndexStatus_dev_errsetleaseMaxEnclosuresbitmap_tagsmnt_rootpsi_flags__real_strnlensighandpcie_device_putaddrMpi2ReplyDescriptorsUnion_tmpt3sas_config_get_phy_pg0seconds__rcu_headMPI2_SGE_SIMPLE_UNIONac_utimeksm_zero_pagesqueuedataissue_resetprivate_datascsih_dev_reset_MPI2_REPLY_DESCRIPTORS_UNIONscsiio_trackermpt3sas_base_disable_msixreply_free_host_indexfs_struct_raw_spin_unlocknuma_nodedev_archdatanr_perf_statess_flagsrcu_nodescsi_host_find_tagorig_pmdrb_rightkmalloc_array_noprofSHOST_DIX_GUARD_IPclock_baseclass_irq_is_conditionallaunder_foliowake_batchReserved11Reserved12smid_taskdelayed_tr_volume_lists_vfs_rename_mutexdev_get_drvdataElf64_Xwordcurrent_eventflockReserved1ahandler_dataReserved21__paddingMPI2_RAIDVOL0_SETTINGSio_lockdep_mapatomic_write_hw_boundaryiowait_sumdescriptionSasWwidDID_TRANSPORT_DISRUPTEDbi_nextblk_status_tUSRQUOTAdriver_privateWORK_OFFQ_POOL_BITSpm_onlyd_rt_spc_warnsset_read_onlypgmapactive_refhctx_tablekernfs_open_filePortFlagsMpi2IOCPage1_t_event_ack_lists_iflagspci_dev_flags_tprintedNumDevsPerEnclosurenr_hw_queuesiounit_pg0iounit_pg1codetagstate_mutexlast_queue_full_depthcid_worki_versionMpi2SasIOUnitPage0_tswap_deactivateclass_rwsem_read_is_conditionalqueue_limitsil_weightstarved_listdma_parmsKOBJ_NS_TYPESSAM_STAT_GOODcmin_fltarch_uprobe_taskis_hotplug_bridgeSenseKeywrite_protect_seqclearedkobj_ns_type_operationsshutdownevent_countNOT_MATCHED__mpt3sas_get_sdev_by_addrsched_statisticspci_ops__kernel_uid32_tallocorig_pterq_timeoutkeysinit_nameSDEV_EVT_FIRSTscsih_target_resetMPI25_FP_SCSI_IO_SUCCESS_REPLY_DESCRIPTORfile_lockstatfsrw_semdevice_privatevm_policydl_deadlinetracepoint_extclass_mutex_is_conditionalfpregs_statetracker_listexpander_siblingWORK_STRUCT_PENDING_BITmemcg_datadqb_curinodesblk_mq_rq_to_pdu_MPI2_RAID_ACTION_RATE_DATA_scsih_look_and_get_matched_port_entryfileattr_seteh_actionpage_linkno_write_sameDEVICE_PANEL_UNKNOWNPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetsas_port_listmce_ripvDL_DEV_NO_DRIVERret_stackSAS_PROTOCOL_INTERNAL_ABORTreal_timeri_privatealloc_tagextended_state_areanum_kprobe_blacklistaccessattached_sas_addr_scsih_pcie_device_status_change_eventsubdirsvariable__ffsdev_release_MPI2_EVENT_NOTIFICATION_REPLY_enclosure_nodemlock_countscsi_cmd_privget_next_child_nodemempolicyperf_event_mutex_bandkref_putcurrent_boot_devicepollfddev_tdma_poolSAS_LINK_RATE_UNKNOWNplatform_dataf_refprev_posDID_TRANSPORT_FAILFASTenv_endfileattrs_subtypeusage_count_MPI2_SCSI_IO_REPLYpr_opsstate_in_sysfsdqb_ihardlimitaer_statsmpt3sas_ctl_initunlocked_ioctluprobebd_mappingkmem_cachenuma_next_scanbudget_mapbsg_devsrcu_last_gp_endclass_local_lock_irq_is_conditionalpage_listRAID_STATE_ACTIVEproperty_read_int_arraySensorNumwdtrmq_rq_stateholders_dirMODULE_STATE_UNFORMEDmsleeplocal_event_datast_valueMPT3SAS_TARGETlist_headptrace_bpsscsih_is_raidreply_free_queue_depth_MPI2_RAID_ACTION_REPLY_DATAAtomicRequestDescriptorPosts_user_nsbase_cmdsmax_nvme_qdtagset_refcntqueuecommand_may_blockarch_tlbflush_unmap_batchquick_threadsdefer_syncreq_alt_boot_devicemissedmax_physsum_sleep_runtimecleanup_rqraid_set_stated_spc_timerd_ino_hardlimitpausechange_cookiebi_statusdl_periods_dquotwq_flagsfsnotify_sb_infosas_is_tlr_enabledrecent_cida_ops_dev_printkatomic_desc_capablempt3sas_base_free_irqpad_until__mpt3sas_get_sdev_by_handleperf_event_listirq_pollenclosure_pg0interval_expparam_ops_ullongevent_type___GFP_LAST_BITdevfntagsPhyNumki_completeRequestDescriptorPostHighpgprotuint16_ttimespec_typebd_devicefind_special_pagedquot_operationsSupportedPhysDisksfw_event_work_putposix_cputimers_workgsbase_scsih_search_responding_raid_devicesMPI25_SCSI_IO_CDB_UNIONio_tlb_memseq_show_scsih_sas_topology_change_event_debugcpusfilesinblockStartPortNumbd_claimingtail_MPI2_CONFIG_PAGE_SAS_DEV_0s_magicdma_alias_maskcontainersnuma_faultsmem_dqblkEEDPBlockSizestatusWRITE_LIFE_NONEIocLogInforead_countwait_for_completion_timeoutHRTIMER_NORESTARTlast_update_timeNVME_BUILD_PRPinternal_smidReserved0Reserved1Reserved2sas_ss_spReserved4Reserved5Reserved6Reserved7dpc_rp_log_sizeReserved9LogEntryQualifierpanelmpi_request_3vSAS_PROTOCOL_SMP___GFP_ZEROTAGS_BITGenericAttributesmax_allowed_capacityopen_mode_MPI2_EVENT_DATA_LOG_ENTRY_ADDEDread_posDID_REQUEUE___GFP_ACCOUNT_BITascqD_REAL_METADATAgpl_crcsmpt3sas_transport_add_expander_phy_scsih_search_responding_expandersclass_raw_spinlock_try_is_conditional__must_check_overflowkiocb_scsih_pcie_device_init_add__UNIQUE_ID_y_618___GFP_MEMALLOC_BITexecute_only_pkeyget_bay_identifier_MPI26_EVENT_DATA_PCIE_ENUMERATIONblk_mq_unique_tag_to_tagreturn_instancesma_lockblk_mq_queue_datadockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsChipRevisiondentrympi_controlsequential_iowait_pidfdMpi2BootDeviceDeviceName_ts_writersgroup_stop_countswap_lockvm_opsscsi_device_set_stateprev_link_rateSEPDevHandleread_before_msmpt3sas_scsih_enclosure_find_by_handlereply_postget_unmapped_areamkobjsym_VDSO32_NOTE_MASKfrozenactive_uprobeget_parent_sas_phymin_vruntimel1ssconnector_nameMpi2EventDataSasBroadcastPrimitive_thost_resetclass_disable_irq_is_conditionalControllerPhyDeviceInfosyscrnr_mapssyscwsync_ionum_bpf_raw_eventsmpt3sas_base_coredump_infowork_qnr_phys_allocatedorig_nentski_posSL_WH_EVENT_TRIGGERS_TSAS_PROTOCOL_SSPavx512_timestampend_io_datapci_channel_io_frozenfree_cached_objectstaints_BooloverflowSAS_PROTOCOL_STPxol_vaddrlist_lru_nodeuclamp_ses_time_granblk_integritykuid_tdev_pm_qosmpt3sas_config_get_expander_pg0bd_holdersdriver_exclusive_resourceFlagsLength_sifieldstaskIeeeChainresetsched_reset_on_forkcompound_headnr_retriesshost_priv_scsih_block_io_to_children_attached_to_exmultipath_on_hbampt3sas_scsih_set_tm_flagevent_contextwake_irqbranchtarget_port_protocolsi_cdevchip_phys_dev_infoProgrammedLinkRatei_fsnotify_marksin_thrashingpcie_device_make_activedl_defervpd_pg80vpd_pg83vm_startvpd_pg89mprotectquota_ond_automountMpi26PCIeDevicePage0_tDEVICE_REMOVABLE_NOT_SUPPORTEDromlen_scsih_block_io_to_children_attached_directlyatimeAddlFlags3get_ownershipscsi_build_sensef_task_workmy_qeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalsectors_wb_errtotal_io_cnt_MPI2_CONFIG_PAGE_EXPANDER_0_MPI2_CONFIG_PAGE_EXPANDER_1hide_drivesresidata_command_pendingissue_hard_resetcloseSAS_END_DEVICEOEMSpecificAttributesPhyDataiopl_warnelevator_queuereply_post_structpasid_requiredptracedmpt3sas_config_get_volume_handleWORK_NR_COLORSdoneOwnerDevHandlesym___kernel_rt_sigreturnsrcu_struct_ptrsmpt3sas_base_doneSlotStatusTaskTagMPI2_SAS_IO_UNIT1_PHY_DATAskip_ms_page_3fbuild_sginodesos_irqmemcg_awarei_atime_sechost_waitmanage_shutdown_MPI2_RAID_ACTION_DATAqsize_t__fpstateqf_ownerSATAMaxQDepthsuspend_noirqControllerDevHandled_inamebi_flagslinks_countprealloc_pterdevd_ino_countarg_lockmpt3sas_transport_functionsscsi_host_allocsectorsDEVICE_REMOVABLE_UNKNOWNignore_childrensas_expanderis_pdfreeze_fsraw_atomic_setin_eventfdresume_earlystart_scan_failedmax_dev_sectorsdup_xol_workalimitmsix_capir_firmwarempt3sas_port_factsmatched_portnuma_groupdiag_buffer_enableInitiatorDevHandleblk_independent_access_rangeskmap_ctrlfscrypt_operationsrangesfs_contextmnt_idretry_hwerror_MPI2_CONFIG_REPLYdrop_inodek_lockorc_unwindbroken_parity_statusgraph_get_next_endpointwantedlast_sector_bugmpt2_idsmq_mapOEMIdentifier_scsih_turn_off_pfa_ledkprojid_t_scsih_create_enclosure_list_after_reset__u16saved_end_iosyscall_dispatchdl_densityon_rq_MPI2_SCSI_TASK_MANAGE_REPLYSL_WH_MPI_TRIGGERS_Taltmappfa_led_onmin_perf_statercu_tasks_exit_listmsi_enabledsp_regdma_drain_bufinternal_lookuplast_resets_master_keysflagsdiag_buffer_dmaIOCParameterbd_holder_locknr_threadsvm_mm__u32EventTriggerEntryPrimaryApplicationTagrcec_eaTaskMIDmax_secure_erase_sectorsseq_next_MPI2_CONFIG_PAGE_RD_PDISK_0Mpi2SasEnclosurePage0_t_scsih_sas_volume_deletempt3sas_base_sync_reply_irqss_quota_typesvm_lock_ddebugFAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitpci_device_is_presentmpt3sas_scsih_is_pcie_scsi_devicedelaysf_modescsi_add_deviceFORCE_BIG_HAMMERtimerqueue_headBLK_INTEGRITY_CSUM_CRCsdev_groupskioctx_table_MPI2_RAIDPHYSDISK0_SETTINGSksm_rmap_itemsclass_read_lock_is_conditionalptm_capKMALLOC_RECLAIM__u64revoked_at_folio_nr_pageswritepageis_dirty_writebackpkey_allocation_maplink_bwctrlSCSI_PROT_WRITE_INSERTdq_idraid_set_resyncdisable_depthem_perf_statethread_shstkminimum_linkrateposix_timerswait_chldexitsas_ss_flagsunmap_limit_for_wssas_device_typerom_base_reg__param_str_missing_delaypcie_sg_listpercent_completeReserved3GUIDbi_itersrcu_cblist_invokingiopollbridge_ctltgt_priviov_lenlatency_record__basePrimFlagshba_mpi_versionSAS_LINK_RATE_1_5_GBPSmsi_capiopoll_q_start_indexEnclosureHandlesector_sized_releasekasan_check_writedev_dma_attrexpiresnuma_scan_seq__param_host_tagset_enablemnt_sbhashnodemask_tmpt3sas_scsih_expander_find_by_sas_addressmpt3sas_enable_diag_buffercylindersIOCNumbersignalfd_wqhhang_detecteddevice_driverraid_statesupports_trigger_pageslast_zone_capacityNamestatisticspend_os_device_addfsindexraw_spinlock_t_MPI25_SCSI_IO_REQUEST_scsih_fw_event_del_from_lists_copcombined_reply_queues_active__WQ_DESTROYINGnum_argstag_size_MPI2_BOOT_DEVICE_ADAPTER_ORDER_scsih_sas_ir_volume_events_uuidclear_child_tidruntime_statusdqb_btime_MPI2_EVENT_IR_CONFIG_ELEMENTdq_opAdapterFlagsbidi_biono_command_memoryshow_pathdl_serverVTIME_USERquota_disablesched_delayedWORK_OFFQ_DISABLE_BITSsrcu_gp_seq_neededtask_structcurrent_may_mountkmalloc_cachesHeaderREFCOUNT_ADD_OVFrequest_dmapushMPI2_EVENT_SAS_TOPO_PHY_ENTRY_scsih_get_volume_capabilitiessas_protocolMpi2EventDataIrConfigChangeList_tis_noirq_suspendedfwnode_endpointcounterReqAltBootDeviceFormsuspendsupported_eventsoom_score_adj_minzone_wplugs_pooltermination_countdomain_datacopy_file_rangeAddlFlags2srcu_gp_startreport_zones_cbSAS_HAxa_flagswakeup_preparedmpt3sas_scsih_change_queue_depthtv_nsecmsi_lockmax_zone_append_sectorssas_ss_sizebridge_d3RAID_LEVEL_0RAID_LEVEL_1Mpi2EventDataSasDiscovery_tRAID_LEVEL_3s_inode_list_lockRAID_LEVEL_5UTASK_SSTEPCurrentHostPageSizeehandlerdq_sbexpecting_lun_changeblk_mq_pci_map_queuesscsi_targetRAIDAcceleratorSuccesss_mountssriov_configureSDEV_EVT_MEDIA_CHANGEOperationSDEV_EVT_INQUIRY_CHANGE_REPORTEDBLK_EH_DONEMpi2SepRequest_tsym_pvclock_pageReplyPostHostIndexPreviousValuepage_fragrun_workfsuidRPM_REQ_AUTOSUSPENDirq_poll_fnrom_attr_enabledsrcversionlist_add_tailtrace_event_callwakeup_sourceis_partially_uptodatehost_faileddl_runtimemay_splitio_uring_cmd_scsih_sas_port_refreshread_dqblk_raw_spin_unlock_irqrestorescsih_get_statevolume_typetransport_cb_idxpcie_device_locksrcu_parentphy_releasesuppliersfile_operations_scsih_allow_scmd_to_devicempt3sas_halt_firmwareDID_ABORTblist_flags_tmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotNVMeAbortTOdpc_capis_preparedSCSIStatuspgprotval_ttrc_holdout_listWriteSequenceMaxTargetPortConnectTimeasync_suspendq_nodeclass_mutex_intr_is_conditionalstrtabpage_freeftopHPROBE_CONSUMEDi_mmapdirty_paused_whenirq_get___GFP_COMP_BITdriver_managed_dmaSAS_SATA_PMmpt3sas_host_groupscapacitymax_channelversion__WQ_BH_ALLOWSbuffer_rel_conditionget_reference_argsllisthiwater_vmUniqueValuemax_perf_statebi_idxfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntrseq__param_multipath_on_hbatarget_kn_MPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORlimit0limit1pi_blocked_onpid_tvmemmap_shiftmpt3sas_dev_groupsusage__kernel_time64_tMPITriggerEntryrq_qos_mutexlink_active_reportingscsi_data_bufferi_securityreply_freedevice_physical_location_panellimitsq_lock_cls_keytransport_cmdsenvpactive_memcg__targetsElf64_Halfallow_reinitPortNumtimer_autosuspendsratelimitSHOST_DEL_test_bitsysdata_softexpirespd_handlesautosuspend_delayi_flctxlist_lockvm_faultscsi_host_prot_capabilitiesoptimistic_spin_queuepermissionscmdtrigger_typetransport_containermpt3sas_scsih_event_callbackflush_listctl_cmdsSASWideMaxQueueDepthreap_refDEVICE_FIXEDlast_statusReservedSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsgioc_lockslice_maxp2pdmaMpi2SasIOUnitPage1_tbi_max_vecsMpi2SCSIIOReply_t_MPI26_IOUNIT_CONTROL_REPLYthaw_noirqsched_debugfs_dir_scsih_ir_fastpathSAS_PROTOCOL_STP_ALLaccounting_timestamppasid_capserial_numberRevisionIDcan_matchtime_archcmd_sizechunk_sectorshlist_bl_headqc_dqblkpasid_activatedMpi2EventDataIrPhysicalDisk_tNumTableEntriesProgrammed__fortify_panicbvec_integrity_poolarch_data_oldSAS_SATA_PENDINGio_uring_poll_queueshrink_controlegidSCSI_PROT_TRANSFER_PISwitchStatusparamsenvp_idxcrypto_kobjectMpi2EventDataTemperature_t___GFP_NO_OBJ_EXT_BITtagged_supportedvpd_pgb0vpd_pgb1vpd_pgb2actualvpd_pgb7folioruntime_autopref_node_forkscsiclassslotsprev_scan_seq_perfput_smid_fast_pathReserved8scsih_slave_destroywait_queue_head_tFAULT_FLAG_INSTRUCTIONstripe_exponentuser_nsclass_raw_spinlock_irqsave_is_conditional_scsih_srch_boot_device_namesymsMATCHED_WITH_ADDR_flagssas_device_listErrorResponseAllocationLengthmpt3sas_base_get_sense_bufferdevcapsyncSAS_SATA_DEVmq_freeze_lockMPI2_ADDRESS_REPLY_DESCRIPTORsg_prot_tablesizeSHOST_DIX_TYPE1_PROTECTIONpcie_sgl_dma_poold_childrenMpi2EventDataSasDeviceStatusChange_tControlGroupeh_host_reset_handlerNvdataVersionPersistentddebug_class_map__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115__compiletime_assert_116__compiletime_assert_117__compiletime_assert_118__compiletime_assert_119prealloc_bufSAM_STAT_INTERMEDIATEint_to_scsilunaudit_contextfl_owner_tipi_listdoorbellAdditionalControlFlagsWordsSAS_FANOUT_EXPANDER_DEVICE__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126i_pipe__compiletime_assert_128__compiletime_assert_129d_waitllist_headsense_buffernr_phys_segmentsscsih_scan_startMaxInitiatorswait_page_queuesas_rphyreply_post_freeFAULT_FLAG_REMOTEpcie_device_next__compiletime_assert_130dl_bw__compiletime_assert_132__compiletime_assert_133__compiletime_assert_134__compiletime_assert_135__compiletime_assert_136__compiletime_assert_137__compiletime_assert_138pci_device_idPercentCompletei_dir_seqheaderwatchdog_stamprefcount_setMpi2BootDeviceSasWwid_tlist_op_pendingdatasrcu_cb_mutexsysfs_lockbroken_intx_maskingmsix_iono_callbackssaved_trap_nr_scsih_send_event_to_turn_on_pfa_ledclock_listfolioq_slotUnitMODULE_STATE_GOINGxattr_handlerring_buffer_szTIMEOUT_ERRORSDEV_EVT_CAPACITY_CHANGE_REPORTEDbuild_sg_scmdsg_cntrqos_debugfs_dirCDB32prot_sdbunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_lockfromnextentseventblk_mq_rq_from_pdukeytype__kernel_gid32_tdev_pm_domainProductRevLevelMpi2EventDataSasEnclDevStatusChange_tnentsstart_time_nsMpi26IoUnitControlRequest_tuaddr2f_securityprot_oppd_handles_szbridgevariable_test_bitdefparamdiscard_granularitypcie_sgl_dmasmp_affinity_enableProductSpecificiotmo_cntclass_raw_spinlock_irq_is_conditionalmportmpt3sas_get_pdev_by_handle__bi_cntSAS_PHY_RESET_IN_PROGRESSignorercuwaitattributes_maskdl_defer_runningmpt3sas_transport_del_phy_from_an_existing_port__refcount_dec_and_testqueuecommandSenseCountresourcesmaximum_linkratempt3sas_blk_mq_pollia_validsrcuinstrument_atomic_writeiorequest_cntsrcu_size_jiffiesSAM_STAT_CONDITION_METclassesDID_BAD_TARGETpasid_featuresstatic_call_site_MPI2_RAID_ACTION_FW_UPDATE_MODEis_virtfnblk_mq_unique_tag_to_hwqHostInterruptStatusmpt3sas_raid_functionssubdevicesrcu_unlock_countma_rootbi_vcntmpi_request_tmregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitrcharbdevi_verity_info_MPI25_EVENT_DATA_SAS_DEVICE_DISCOVERY_ERROR_addr_pkeyscsih_is_nvmerw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countSTARGET_RUNNINGbuild_nvme_prpushortatomic_openput_smid_defaultresponse_info__mptrsigactionrlimmce_addr__q_size_fieldf_freeptrPrimaryReferenceTag__sighandler_tclass_spinlock_try_is_conditionalzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMEShash_lenphy_nummax_target_blockedfs_flagsvm_filei_countmpt3sas_exit_debugfsuser_structaddress_space_operationsFAULT_FLAG_USERkey_perm_tTargetAssistSuccessCoercedMaxLBAReserved10max_wideport_qdMaxMSIxVectorsHeaderVersion__UNIQUE_ID_max_luntype601timer_listrun_delayarch_atomic_set_scsih_display_sata_capabilitiesnum_ftrace_callsiteschange_queue_depthsrcu_cblistblk_independent_access_rangeDID_BUS_BUSYmax_narrowport_qdtlb_ubcpme_supportpgtables_bytesTimeToReducedFunci_lrusas_devGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacktrc_ipi_to_cpuscsi_lunPageType__WQ_LEGACYallow_restartmin_slicecommit_rqs_scsih_del_dirty_vphyput_smid_scsi_iosysfs_opsinq_periph_qualrequest_lenHCBAddressHighatomic_write_hw_unit_maxcmaj_fltbio_integrity_poolkparam_arraympt3sas_base_hard_reset_handlerswitch_handleFORTIFY_FUNC_strscpypercpu_refevict_inodeignore_media_changedqb_itimeMPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTOR_internal_cmd_scsih_raid_device_find_by_idNEEDS_RETRYthread_keyringmap_nrMPI2_RAID_ACTION_STOP_RAID_FUNCTIONlist_delcpumask_trb_leftscsi_get_resid_raw_spin_lockgfp_maskdma_addr_tinactive_timersense_dmaattributeinit_hctxmm_lock_seqhotplugFORTIFY_FUNC_memchrkernfs_elem_symlinkRAID_LEVEL_10BLK_UID_T10_debug_dump_mfRAID_LEVEL_1E__kernel_dev_tcrypt_keyslotPhyFlagsConnectorNameTimeStamp_scsih_sas_topology_change_eventpm_domainfsgidsector_tMPI2_DEFAULT_REPLY_DESCRIPTOR_sys_privatesignal_structactive_mmstate_savedkernfs_iattrsshow_devnamethread_infoPhyInfoi_mmap_writablevolume_status_flags_scsih_probe_raidMPI2_VERSION_STRUCTreadmpt3sas_get_sdev_from_targetWORK_OFFQ_DISABLE_SHIFTpci_unregister_driverRAID_LEVEL_50secondarydevicesatomic_write_max_sectorsgroup_exit_codempt3sas_transport_doneIOPRIO_CLASS_BEFORTIFY_FUNC_memcmpopc1ignore_loginfosREFCOUNT_SUB_UAFreply_queue_listpriv_flagsPciDeviceAndFunctionNumberSMIDclear_retrain_linkmpt3sas_base_attachActiveCableEventDataexec_maxmax_retriesSenseBufferLowAddressreason_codesync_stateresponse_code__compiletime_assert_39dev_groupsDMA_FROM_DEVICEkernfs_elem_dirpercpu_counter_printkDMA_BIDIRECTIONAL__scsi_iterate_devicessequential_io_avgptracePROBE_DEFAULT_STRATEGYRaidVolumeIndicatortrace_bprintk_fmt_startmpt3sas_config_get_sas_device_pg0pci_ers_resultUTASK_RUNNINGhctx_typeopenseglenoverride_only__compiletime_assert_45EEDPFlagsFORTIFY_FUNC_memcpy__kernel_ssize_tlcountvdso_imagesi_signo_scsih_probe_pcieconst_test_bit_scsih_probeunused_hctx_lockSTPMaxConnectTimeLimitrseq_sigresultrefsmpt3sas_base_get_reply_virt_addrdelayed_calltime_slicenr_rangeStructpci_power_tspc_timelimitMPI2_BIOSPAGE2_BOOT_DEVICEblk_mq_req_flags_tresumeWQ_CPU_INTENSIVEreset_doneregsbi_write_hinterrorrq_nextsyscall_user_dispatchshort_inquiry__compiletime_assert_58attrd_aliasPCI_ERS_RESULT_NEED_RESETis_suspendeddqio_semspin_unlock_irqrestorerestore_sigmaskblk_mq_tag_to_rqsas_target_priv_dataskeyrequeue_lockmmio_enabledmpt3sas_transport_update_linksscsi_io_cb_idxmpt3sas_config_get_enclosure_pg0kcsan_check_accessevent_workreply_post_free_arraynr_deferredSAM_STAT_TASK_ABORTEDlist_emptysrcu_ssp__UNIQUE_ID_x_619i_lockuser_event_mmbtrace_seqs_devsiblingcdl_supportedia_rangeSkipCountldt_usr_semGenericFlags1phy_numberposix_cputimerstry_rc_10_firstRPM_INVALIDdd_datafreeze_kcountrequest_key_authblockspercpu_ref_datad_spc_warnssrcu_supfreeptr_tport_countns_type__compiletime_assert_78_scsih_get_sas_addressRPM_REQ_NONEforce_runtime_start_on_system_startsg_timeoutmaximum_linkrate_hwixol_MPI26_IOUNIT_CONTROL_REQUESTraid_class_attachfasyncarg_startkprobes_text_sizebypass_dirty_port_flagblk_crypto_profilefop_flagsParentDevHandle_addr_lsb_addrpfn_mkwriteuaddrKMALLOC_DMAsas_device_lockioerr_cnt__compiletime_assert_80_scsih_block_io_to_pcie_children_attached_directly_uidmpt3sas_port_enable_dones_fs_info__rb_parent_colorWRITE_LIFE_EXTREMEicq_listslave_configuremm_users_pp_mapping_pad_MPI2_EVENT_ACK_REQUESTdebugfs_rootSTPBusInactivityTimeLimitNextChainOffsetkey_serial_tno_uld_attachfolioqiomapshost_groupssiblingscputimernrpageswake_q_nodeblk_flags_ts_maxbyteshd_geometryioctx_tabledma_io_tlb_memKMALLOC_CGROUPeh_cmd_qFunctionDependent1FunctionDependent2FunctionDependent3FunctionDependent5get_unique_idkasan_check_readVP_IDNR_KMALLOC_TYPESexpire_countwake_cpubio_split___GFP_DMA_BITfreeze_supertick_dep_masktr_methodkey_typecpu_msix_tablepci_busInitialTimeToReducedFuncqc_infofault_flaglist_is_headDID_TIME_OUTmodnameIOPRIO_CLASS_RTCurrentBootDeviceevent_reply__UNIQUE_ID_diag_buffer_enable606scsih_change_queue_depthmpt3sas_device_remove_by_sas_addressia_ctimetrace_eval_mapmpt3sas_scsih_issue_tmsas_read_port_mode_pageasync_put_workresvnum_static_call_sitessdev_prefix_printkvm_lock_seqFORTIFY_FUNC_strncatPortGroupsmpt3sas_ctl_add_to_event_logDeviceInfoprimaryPCI_ERS_RESULT_RECOVEREDtm_cb_idx__compiletime_assert_109Elf64_Addrwait_queue_entry_tseqlock_tlatency_record_countSL_WH_SCSI_TRIGGER_Tnr_integrity_segmentsMPI2_CONFIG_PAGE_HEADERhost_blockedmay_skip_resumeprot_flagsVTIME_SYSalloc_tag_countersbase0base1base2block_cfg_accessSHOST_CREATEDbase_cb_idxbio_setpd_handlePortNumberalignment_offsetrdpq_array_capablelinksSL_WH_MPI_TRIGGER_TbasesFAILEDfutex_staterseq_lenkobj_completioni_spc_timelimitf_opchains_needed_per_ionargs_scsih_pcie_topology_change_event_debugcpuhp_onlinemax_lbamm_mtgid_tdelayed_tr_listrelease_work_firmware_event_workmpt3sas_ctl_doneno_report_opcodesphy_enablefault_reset_work_q_namercu_read_unlock_specialtls_arraycopy_leneetlp_prefix_pathIoFlagstask_io_accountingHCBAddressLowf_raDEVICE_PANEL_FRONTmodule_memorysitesmatched_port_entryAddresscompat_robust_list_headthread_nodestatic_call_mods_shrink__compiletime_assert_127NumEntriesgp_countnr_sectorsreply_queue_countbpf_raw_eventshi_priorityMATCHED_WITH_ADDR_SUBPHYMASK_AND_PORT__param_str_hbas_to_enumerateiommutimer_expiresbpf_storageSAS_SATA_PM_PORTmpt3sas_expander_removekset_uevent_opsAckRequiredf_ownerhost_tagset_enable__state_permSenseBufferLengthDEVICE_PANEL_BACKreply_post_free_array_dma_pool_syscallIOCParameterValuediskSHOST_DEL_RECOVERYring_buffer_offsetvolume_wwidsdevmsix_vector_countsrcu_lock_countlink_statetrc_blkd_cpugp_waitCapabilities__compiletime_assert_131AttachedDevHandleRatesWORK_OFFQ_FLAG_ENDiommu_mmfunc__UNIQUE_ID_multipath_on_hbatype613arch_clear_bitio_uring_task__WQ_DRAININGshared_tagspri_reqs_allocRequestedBootDevicesas_nodejit_keyringStartPhyNums_fsnotify_info_MPI2_EVENT_DATA_IR_VOLUMEEnumerationStatusscsi_unblock_requestsfunctionSAS_LINK_RATE_12_0_GBPSActionDataport_enable_cmdsprojidmce_kill_mema_external_lockWORK_OFFQ_FLAG_BITSpid_linkstm_busyconv_zones_bitmapscsi_target_idpcie_flags_regs_dio_done_wqbase_add_sg_single__refcount_addq_sizehlist_headloss_of_dword_sync_countioc_nodethrottle_disksas_device_nextbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACE__fortify_strlenrunningrw_hintblk_integrity_checksumioc_dumpdma_skip_syncpartition_meta_infoDEVICE_VERT_POS_LOWER_scsih_sas_pd_hideclass_spinlock_irqsave_is_conditionalutf8datampt3sas_base_check_cmd_timeoutTaskTyperequeue_workof_node_reuseddyndbg_infoFORTIFY_FUNC_strncpyd3hot_delayElf64_Symhtb_relsaved_config_spaceIRVolumeMappingFlagsd_rt_spc_softlimitpoll_scsih_pcie_device_status_change_event_debug_scsih_check_devicefree_file_infoin_lru_faultspin_lockdevice_strsched_contributes_to_loadtlb_genruntime_idleacs_capmap_countDiagRWDataport_table_entrypcie_caphost_scribblei_rt_spc_timelimitqc_type_stateNumPhyss_dentry_lru_scsih_determine_boot_devices_bdevMPI2_RAID_ACTION_FW_UPDATE_MODEskip_vpd_pagescrcssense_lenRDPQBaseAddressrun_list__param_ops_logging_leveldiag_buffer_szuevent_opsabort_workmax_cmd_lenmpt3sas_ctl_releaseMaxChainDepthsched_classutil_avganon_vmapci_disable_link_state__param_diag_buffer_enable_pidsigcntDD_CLASS_TYPE_LEVEL_NAMESmpt3sas_config_get_pcie_device_pg0mpt3sas_config_get_pcie_device_pg2mpt3sas_base_fault_infomodinfo_attrsst_spacetlr_snoop_checkclass_map_typekparam_stringd_real_typemaxrsscredkernfs_open_node_scsih_remove_devicePhysicalPortAttachedPhyIdentifierf_wb_errmm_cid_activekzalloc_noprofWQ_MEM_RECLAIMmodule_sect_attrsreq_flags_truntime_resumempt3sas_trigger_mastergroup_exec_taskrestrict_linkget_inode_usagekmalloc_typexarray_startphy_setupblk_rq_posbpf_ctxpm_domain_dataBASE_READ_REGserver_pick_task_scsih_pcie_device_remove_by_handle__p_size_fieldload_avgcor_error_detectedi_private_lockget_dqblkmq_listphysical_block_sizeMPT3SAS_DEVICEpgoffporthi_priority_smidtm_tr_cb_idx_MPI2_RAID_ACTION_REQUESThandlematch_drivermodelfreeze_lated2_support__list_del_entrycount_objectsvma_numab_statempt3sas_base_unmask_interruptsdma_map_opsdq_dirtyREFCOUNT_ADD_NOT_ZERO_OVFmax_lunexit_cmd_privscsi_cmd_to_rqatomic_write_boundary_sectorsEnclosureSlotmax_queue_depthwrite_byteseh_entrylist_addpending_eventsoom_reaper_listnumab_stateSDEV_EVT_MODE_PARAMETER_CHANGE_REPORTEDfutex_offsetout_no_lockZoneLockInactivityLimitsubsys_fmt_prefixdq_lockintegrityMPI2_SCSI_IO_CDB_EEDP32pte_tnr_scanned__statempt3sas_factsmpt3sas_portelementnr_iosk_listn_io_portslicedrv_groupstrack_queue_depthcustom_slicepci_slothotplug_user_indicatorsmq_freeze_depthpadding1mpt3sas_config_get_raid_volume_pg0mpt3sas_config_get_raid_volume_pg1nestedatomic_write_segments_maxReplyFreeHostIndexnr_dirtied_pausequeue_kobjreal_address_scsih_alloc_vphybd_holder_dirmpt3sas_trigger_scsiinvalidate_locknum_exentriesscsi_prot_operationsfix_capacityio_portblk_mode_tpmdval_thost_tagsetkvecPCIDomainSegmenteh_noresumearch_set_bitblk_mq_rq_stateset_latency_tolerancedepthDescriptorTypeDependent2d_ino_timerprobenetlink_nsdev_ueventSHOST_DIF_TYPE1_PROTECTIONdep_mapExpStatuspage_mkwritelast_busyvm_flags_tstrlcatres_attr_MPI26_EVENT_DATA_PCIE_TOPOLOGY_CHANGE_LISTnr_failed_migrations_affine_scsih_remove_unresponding_devicesd_in_lookup_hashptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLER_mpt3sas_exitreschedule_countActiveCablePowerRequirementmax_hang_timeexternal_facingcmd_per_lun__dummycdl_enablecutimelockrefsize_addtlb_flush_batchedRAID_STATE_DEGRADED___GFP_HIGH_BIT_scsih_pcie_add_deviceia_uidautogroupsequencercu_syncarg_endclass_spinlock_irq_is_conditionalSHOST_DIX_GUARD_CRC_dummy_pkeyvruntimehostdata_scsih_complete_devices_scanning___GFP_HARDWALL_BITSAS_LINK_RATE_22_5_GBPSbus_flags__param_str_prot_maskstart_stop_pwr_condfeatures_locked__kernel_pid_tresponse_bytesdevice_blockedMpi2IOUnitPage0_tMajorPIDTYPE_SIDcinblockdma_alignmentprot_typeNumElements__kernel_loff_tDmaGroupset_performance_stateserial_nodeSAS_PHY_UNUSEDchains_per_smidMPT_CALLBACKstate_remove_uevent_sentnotify_counthba_queue_depthHostDiagnosticevent_maskssingle_lunhprobempt3sas_base_mask_interruptssg_reserved_sizeswap_activatedqb_isoftlimitsaved_auxv_scsih_check_for_pending_tmnoinstr_text_sizedl_overruniattrdetachedloff_tWWIDoom_flag_origindesc_lendma_devfault_reset_workoom_score_adjmpt3sas_base_pause_mq_pollingSHOST_RECOVERYrq_end_io_fnksm_merging_pagesgraph_parse_endpointrmidraid_devicelist_lrudevice_removablefxsavedev_pagemap_opsbv_offsetset_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETd_lockrefMaxPortWidthSCSI_EH_DONEsession_keyringseeksshost_dev__mpt3sas_get_pdev_by_handled_deleted_ino_softlimitd_weak_revalidatePreviousPortInfoalloc_time_nsi_devicespcie_devicedqb_curspacecomponent_counttm_cmds_MPI2_CONFIG_PAGE_IO_UNIT_0_MPI2_CONFIG_PAGE_IO_UNIT_1alloc_lockearly_initPCI_ERS_RESULT_DISCONNECTOEMSpecificFlags0OEMSpecificFlags1total_numa_faultswritable_sizemax_segmentsdma_need_drainobj_cgroup_scsih_update_vphys_after_resetem_tablemq_sysfs_init_donesas_attach_transportactive_queues_scsih_add_or_del_phys_from_existing_porthba_mpi_version_belongedMsgVersionpage_size__lstateSelfConfigStatusMPI26_PCIE_ENCAPSULATED_SUCCESS_REPLY_DESCRIPTORinodebd_fsfreeze_mutexhrtimeratomic_write_unit_maxPhysDiskavailMinor__UNIQUE_ID_license593mpi_requestFAULT_FLAG_UNSHAREtask_sizemust_resumeRPM_ACTIVEend_codeuintpreempt_notifiers__UNIQUE_ID_missing_delaytype599tlb_flush_pendingmigration_flagsDEVICE_PANEL_RIGHTPortWidthsense_infopcie_device_listHostTraceBufferFlagspci_drivercap_inheritablekobj_sigvaleh_timeout__stack_chk_failsrcu_n_exp_nodelayseqcount_spinlock_tgraph_get_remote_endpoints_roots__int128 unsignedSCSI_PROT_READ_PASScpu_countwait_sumuprobe_xol_opsmin_align_masknextevtpci_get_drvdatathis_idCurrentPortInforcu_segcblistreported_split_lockpref_windowfound_device_scsih_probe_sasreturn_instancewait_countconfirm_switch_scsih_expander_addnr_wakeups_affine_attemptspud_ti_ino_warnlimitMpi26PCIeDevicePage2_tpreallocProtocolFlagsmax_open_zonesrmtpnext_offsetacpi_device_idctx_idutaskpoweroff_noirqbroken_cmd_complactive_modesdev_datacb_idxis_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexdelayed_event_ackauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangsTerminationCounttm_tr_volume_cb_idxdummycss_setfwnode_handlegfp_tEEDPTagModetypeqf_fmt_idNumPhysDiskspageatomic_write_unit_minsleep_startmemalloc_noiobegintypetabuse_192_bytes_for_3f_MPI2_EVENT_DATA_SAS_DEVICE_STATUS_CHANGEscsih_map_queuesnr_reserved_tagsi_crypt_infoscsi_host_in_recoveryDEVICE_HORI_POS_CENTERio_start_time_nsaudit_ttynr_zonesmutex_unlock_scsih_search_responding_pcie_devicesjobctlsi_errnonr_leaves_on_treequeue_ctxSCSI_PROT_REF_CHECKmin_shallow_depthpci_channel_io_normalpcie_device_init_list_sigchld__le16HPROBE_STABLEquota_format_typebio_crypt_ctxpercpu_ref_func_tpm_message_tscsih_get_resyncac_mem_MPI2_RAIDVOL0_PHYS_DISKpprevpending_io_countino_warnlimitbroken_fuaDeviceMaxLBASTP_SMP_NexusLossTimeMaxPostedCmdBufferszone_wplugs_lockmnt_flagsscsi_device_reprobeac_stimempt3sas_driverlast_mergememcg_nr_pages_over_highsw_reservedDCRData__le32wbt_flagsproc_dir_entrysas_device_freescsi_add_host_with_dmalink_ratepcienextscsi_dma_unmapobjcghba_port_entryno_read_disc_infoblock_startvm_area_structnum_gpl_symsdrv_support_bitmapselect_no_atn__compiletime_assert_0__compiletime_assert_1__compiletime_assert_2__compiletime_assert_3__compiletime_assert_4PageNumbermap_busControlphy_reset_problem_countDID_OKMaximumDataTransferSizelong long unsigned intWRITE_LIFE_MEDIUM__builtin_memcpyirq_line_enabletmf_in_progressdirect_io_enabledSDEV_CREATED_BLOCKqdepthhuge_faulti_fopautasklast_task_numa_placement__le64list_moveSwitchDevHandlefortify_memcpy_chk_pcie_devicerefcntfreeze_holderqueue_work_onsubordinatecdevperf_eventraid_set_levelkernel_ulong_tIOPRIO_CLASS_INVALIDscsi_prot_flagsunregfuncSerialNumseqcountirqpollget_linkerrorsschedule_dead_ioc_flush_running_cmdsclass_idbitsetsas_idWORK_STRUCT_LINKED_BITfacts__param_str_disable_discoveryinquiry_mutexstargetof_device_iddisk_statsbusn_resmanage_runtime_start_stopclass_migrate_is_conditionalsriov_get_vf_total_msixclass_write_lock_is_conditionals_xattrpartmpt3sas_ctl_exit_scsih_tm_donempi_replyBLK_EH_RESET_TIMERil_prevd_initmax_slack_shiftget_name_prefixfileattr_get__kmalloc_noprofReplyFrameSizeclass_groupsSDEV_TRANSPORT_OFFLINE__ret_warn_on__call_single_nodeunicode_mappathrecent_used_cpuruntimeno_64bit_msiold_time32_tmsix_load_balancedev_flagsSASAddressspinlock_check__UNIQUE_ID_host_tagset_enable616__state_sizeunsigned intsbitmap__param_enable_sdev_max_qdrequest_dma_szput_smid_hi_priorityMpi2RaidActionRequest_tclass_irqsave_is_conditionalcore_kallsymsIOCStatusmpt2sas_raid_templatescsi_devices_fsnotify_maskis_physfnsas_linkratescan_objectsslotbi_privatedevice_infompt3sas_transport_templateDD_CLASS_TYPE_DISJOINT_BITSevent_liststartupMPI2_BOOT_DEVICE_DEVICE_NAME_scsih_flush_running_cmdskeyring_index_keychain_trackeriov_iterd_rcustatic_key_false___GFP_DIRECT_RECLAIM_BITuintptr_twake_entryrcu_tasks_holdoutfreezeassoc_array_ptrbatchcacheold_timespec32rcu_blocked_nodejiffies_at_allocst_namegroup_nodei_mtime_secbus_dma_regionfw_event_lock_MPI2_EVENT_DATA_SAS_DISCOVERYstatic_rqsmpt3sas_config_get_sas_iounit_pg1sas_addrstarget_sdev_userlegacy_ioPrimaryApplicationTagMaskac_majfltmce_kflags___GFP_NORETRY_BITFORTIFY_FUNC_memsetscsih_shutdownscheduledbus_dma_limitubufbtimePageLengthia_gidltr_pathscsi_device_eventmigrate_foliorq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrenclosure_devnext_posix_timer_idmq_opsmax_sata_qd_mapcountstarttimescsih_device_configureHCTX_TYPE_DEFAULTreschedule_jiffies__list_delWORK_BUSY_RUNNINGhprobe_statei_sb_listquota_offVendorIDfault_reset_work_qshm_clistio_uring_poll_queuesptm_rootcb_headzone_wplugs_hash_bitspi_offsetac_flagpt_regsmmap_missexpires_nextSAM_STAT_TASK_SET_FULLIOCMaxChainSegmentSizeblk_opf_treport_zones___GFP_ZERO_BITnum_trace_bprintk_fmtcdrom_device_infoaccess_stateDeviceNamefoundraid_device_locksdev_gendevphy_idwork_structtruelast_queuedmpt3sas_base_clear_stri_timerMpi26EventDataPCIeEnumeration_tpipe_bufsEnclosureLevelIOCExceptionsbp_offsetkmalloc_cache_typetm_sas_control_cb_idxhba_portscsi_block_requestssaved_scratch_registertracepoints_ptrsraid_datablock_maxstatic_keyqueue_rqsFAULT_FLAG_VMA_LOCKdma_range_mapKOBJ_NS_TYPE_NONE_datascsi_add_hostFAULT_FLAG_WRITEshow_optionsRAID_LEVEL_4wait_queue_entryRAID_LEVEL_6Portp_leni_uidtagset_freedmax_sectorsexpiryMpi26EventDataPCIeTopologyChangeList_tbmaprescue_workqueuempt3_idsdispatch_wait_lockstarget_for_each_devicescsi_bufflenscsi_levelfsavei_write_hintsuspended_timeread_byteszone_wplugs_worksum_sched_runtimeinternal_depths_writers_keyMpi2SasIoUnitControlReply_tstart_boottimepci_bus_flags_tmpt3sas_scsih_pre_reset_handlerentriesi_modecap_permittedMPI2_RAID_COMPATIBILITY_RESULT_STRUCT_flags_2aBLK_UID_NAAstart_code__UNIQUE_ID_multipath_on_hba614vm_flagssi_codeseqcount_spinlockheadHPROBE_GONEioc_statuslast_siginfoqueue_offsetdiag_trigger_locksched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorssg_listdevice_dma_parametersdir_contextiopl_emulSDEV_EVT_POWER_ON_RESET_OCCURREDconsumersPhysDiskDevHandleActionDataWordpoll_queue_procratelimit_statepower_state__pci_register_driverdq_flagsis_late_suspendedcapture_controlraw_atomic_fetch_sub_releaseSAM_STAT_COMMAND_TERMINATEDbsg_buffer_MPI2_EVENT_DATA_TEMPERATURETransferCountclass_device_is_conditionalnon_rcuput_super_MPI25_SCSI_IO_CDB_UNIONshostSCSIIOSuccessdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_statEEDP32HighPriorityCreditiopoll_q_countFAULT_FLAG_INTERRUPTIBLEs_inodes_wbignore_hotplugfolio_queue_MPI2_MPI2_BIOSPAGE2_BOOT_DEVICEIOPRIO_CLASS_IDLE_scsih_pcie_device_addinit_fs_contextuprobe_taskmpt3sas_init_debugfsf_mappingMPI2_BOOT_DEVICE_ADAPTER_ORDERconstant_test_bitstart_stackscsih_initpcie_devDL_DEV_PROBINGi_linksriov_scsih_fw_event_addmpi3_version_unionats_enabledstack_vm_aread_hashMPI2_RAIDPHYSDISK0_SETTINGSdl_server_pick_fscsi_prot_ref_tag_MPI2_BOOT_DEVICE_SAS_WWIDrefcount_dec_and_testtty_old_pgrpst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquota_MPI2_ADAPTER_ORDER_AUXNumPerDevEventsorc_entrydma_drain_lenSCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listDID_PASSTHROUGHutimemmapphy_pg0shrinkeralloc_dquotscsih_slave_allocVolumeStatusFlagsmax_shutdown_latencymissing_delaymappingdl_defer_armedMpi2IOCInitRDPQArrayEntrysas_expander_listChipNamerunnable_sumatomic_fetch_sub_releaseis_warpdriveshort unsigned inteventsget_rq_budget_tokenFastPathSCSIIOSuccessreply_dma_poolqueue_ramp_up_perioddevice_nodescsih_pci_mmio_enabledrequeue_listMaxNumRoutedSasAddressespcie_link_statep_size_fieldAddress64long long intSAM_STAT_CHECK_CONDITIONsym_vvar_startenable_cnt_hugetlb_cgroup_rsvdsival_ptrproc_namepercpu_size_scsih_sas_host_add_scsih_srch_boot_encl_slotinvalidate_folioMpi2SasPhyPage0_tis_vallocclass_pci_dev_is_conditionalRateOrModedrop_nspci_restore_stateWORK_STRUCT_INACTIVE_BITSDEV_EVT_LUN_CHANGE_REPORTEDPUT_SMID_IO_FP_HIPaen_event_read_flagnr_queuesmpt3sas_base_free_smidpcie_device_freeno_pm_callbackscountproduct_specificheadsd_parentraid_device_nextSequenceNumbersched_task_groupscsi_doneupdate_timeioc_coredump_looppidsof_nodequery_countfw_event_workrun_nodescsi_statuschassis_slothide_ir_msgdata_sourcesubmit_bio___GFP_UNUSED_BITs_instancesvm_rcubd_start_sectpage_table_locksysv_semquota_infoquota_enable__kernel_timer_tpriv_targetMPI2_ADAPTER_INFOdomain_tagmax_integrity_segmentscmaxrssscsi_host_guard_typeit_real_incrprobestubextable_lenlast_arrivalwake_indexmpt3sas_base_get_smid_scsiioPortStatusswap_rwvphy_nextreserveCoreDumpTOSecnegotiated_linkrateerror_statesas_expander_nextrunning_disparity_error_countsrcu_gp_seq_needed_expExpanderChangeCountDEVICE_HORI_POS_RIGHTSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOia_mtimenr_thpsvphys_listsysv_shmfopssuppress_bind_attrsinsnlenmpt3sas_base_stop_watchdog__page_1__page_2WORK_CPU_UNBOUNDi_mutex_keyraid_class_releasekey_restrictionquota_writedomain_scsih_scsi_lookup_find_by_targetHCTX_MAX_TYPESget_linkqoffPhysDiskStatemax_depthfree_foliocur_bus_speed___GFP_NOFAIL_BITSCSI_PROT_REF_INCREMENTMpi2IOUnitPage1_tphys_disk_numBlocksRemainingformsa_flagsno_start_on_addcancelled_write_bytesdispatch_busydiag_bufferRequestedAltBootDevicetask_worksmm_cidatomic_write_hw_maxSCSI_PROT_READ_STRIP_ddebug_infoparam_ops_int__param_logging_levelstats_locknum_kpblk_mq_map_queuesunique_tagSTARGET_CREATED_REMOVEshost_gendevMEMORY_DEVICE_PRIVATEirq_managed__bd_flagssuper_blocknum_pdsbi_bvec_donebus_typebaen_dataget_named_child_nodeassoc_arrayis_raidactormpt3sas_base_register_callback_handlerkobj_ns_typedeferred_resumescsi_dispositionsched_shared_tagslong int_scsih_ir_shutdowncore_nodemem_dqinfodevnodesaved_sigmaskBLK_UID_EUI64MEMORY_DEVICE_PCI_P2PDMAMpi2ExpanderPage0_tdq_offpinsblkcg_mutexis_visiblearch_test_and_set_bitdisk_nameconfig_pagepend_sas_rphy_adduuid_tenclosure_list__kernel_clockid_twritabledqb_bsoftlimitMaxMinLinkRateio_window_1kvfork_donethresh_holdtask_cputime_atomicki_waitqra_pages__param_str_multipath_on_hbammap_compat_legacy_basedevice_dma_supportedsysfs_dir_lockmpt3sas_pci_tableVolumeStatempt3sas_config_get_sas_iounit_pg0ignored_posix_timerslockedsival_intmpt3sas_base_get_smidia_filewakeup_cntrequest_pendingconfig_page_sz_scsih_smart_predicted_faultdl_server_has_tasks_fkernel_param_opsctl_cb_idxnotifier_subscriptions_scsih_fw_event_cleanup_queueclass_read_lock_irqsave_is_conditionalpri_enabledinitiator_port_protocolsblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startvphyrobust_list_headunsigned char_scsih_pcie_device_removewake_qrethooksnuma_scan_periodnr_tagssda_is_staticwakeup_pathresult_maskFORTIFY_FUNC_memscanscsi_timeout_actionei_funcsfw_event_work_free__func__MinDevHandletablespipe_inode_inforaw_spinlockEncapsulatedCommandLengthSCSI_PROT_WRITE_PASSinstrument_atomic_readktypecls_mskupdate_latencyscsi_host_set_guardmpt3sas_base_start_watchdog_scsih_reprobe_lunSL_WH_TRIGGERS_EVENT_DATA_Tmigration_disabledmpt3sas_driver_templatescsih_exitPCIBusNumRPM_REQ_SUSPENDpgprot_ttracepoint_ptr_tmpt3sas_get_sdev_by_handleChainOffset__mpt3sas_get_pdev_from_targetphysical_location_scsih_normalize_sensenum_vf_scsih_scsi_lookup_find_by_lunSOFT_RESETnvme_mdtsPIDTYPE_MAXbi_sizeCurrentBootDeviceFormwatcherscrypt_ctxstopwait_maxclass_write_lock_irqsave_is_conditionaliovec_MPI2_VERSION_STRUCTa_flagsd_dnameScsi_Hostnr_migrations_coldmnt_idmap___GFP_FS_BITWORK_OFFQ_LEFTquotactl_opski_ioprioADD_TO_MLQUEUEIncompatibleReasonsched_remote_wakeuptag_alloc_policymemcpytracing_graph_pauseread_itersuspend_latefront_padFwUpdateModeDataScrubDurationsdev_devi_rwsembi_integritydriver_nameis_addedexitio_uringeh_device_reset_handlerchild_ns_typediagnostic_flagspci_devmpt2sas_driver_templateBoardNameslave_bdevs_scsih_del_phy_part_of_anther_portcommit_dqblkclass_local_lock_irqsave_is_conditionalpcie_sglmark_dirtynr_ctxkernfs_opsoom_reaper_timermodulebd_security_entire_mapcountqueue_lockfast_pathatomic_readf_pathstatic_call_siteself64_symunlinkmap_queuescpumask_var_trefcount_warn_saturate_scsih_sas_enclosure_dev_status_change_eventtime64_tdrivers_diri_gidFORTIFY_FUNC_strnlenrq_qosmark_deadREFCOUNT_DEC_LEAKicq_hintrmdirdq_dqbStartRaidFunctionmemory_failureblkcg_gq_scsih_eedp_error_handlingdma_flagsport_tableSUBMITTED_BY_BLOCK_LAYERmax_hw_sectors_MPI2_SAS_IOUNIT_CONTROL_REPLYselectors_mtdmod_kallsymss_typesas_device_priv_dataremount_fsbd_holderdelayed_sc_list_scsih_refresh_expander_linkstask_delay_infopi_seHostMaxLBAexpander_devicesubsystem_vendorin_useSAS_PHY_DISABLEDrq_countMIGRATE_SYNC_LIGHTerrseq_ttransparentkstatfsreply_payload_rcv_lenid_tablemems_allowed_seqSDEV_EVT_LASTmax_user_discard_sectorsWhoInittarget_alloc_scsih_tm_tr_sendsas_function_templatebug_listhigh_iops_queuesvirtual_phymax_nr_cidmod_arch_specificHCTX_TYPE_READmpt3sas_get_vphy_by_phyDMA_NONEtransfersizesharebpf_net_contextscsih_target_destroyPhysDiskMapis_msi_managed_MPI25_IEEE_SGE_CHAIN64ftrace_timestampbi_ioprioexpander_pg0expander_pg1d_ino_warnskernfs_elem_attrreset_preparei_ctime_nsecNumSlotsfw_events_cleanupi_private_listbinfmtftrace_sleeptimei_stateno_d3coldSCSITriggerEntrybv_pagepcpu_cidsupported_speedsNumPortssched_migratedchildMPI2DefaultReply_tdup_xol_addrdevice_configurepci_error_handlersPROBE_PREFER_ASYNCHRONOUSrcu_node_entryno_vf_scanreverse_ordering_scsih_sas_ir_config_change_event_debugMpi26IoUnitControlReply_tfile_system_typeorig_ret_vaddrscsih_suspendmmu_notifier_subscriptions_scsih_srch_boot_sas_addressdefault_groups__sifieldsMSIxIndex__param_max_lunnr_watchesDL_DEV_DRIVER_BOUNDStateAdapterOrdersmidcurr_ret_depth_scsih_raid_device_addstarved_entryMpi26NVMeEncapsulatedRequest_t__fillerdestroy_dquot__task_fpstatefilldir_tmpt3sas_base_get_sense_buffer_dmaMpi2EventIrConfigElement_tget_reserved_spaceMPI26_EVENT_PCIE_TOPO_PORT_ENTRYremote_identifyioprior_levelKMALLOC_NORMALcreatePCI_ERS_RESULT_CAN_RECOVERdirtied_time_whenstart_scan_seqperf_rdpmc_allowedLogSequencesym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerbd_openersdq_inuseclass_maskChassisSlotofflinedev_pm_infoget_next_sas_devicemremap_scsih_is_end_devicein_memstallSHOST_DIX_TYPE3_PROTECTIONhost_self_blockedtph_enabledpoweroff_latei_nlinkwakeupcb_list___GFP_IO_BITdirect_iocpu_idpushable_tasksraw_atomic_readdriver_overrideprev_fw_factstty_audit_bufmaxlenkernel_cap_tptm_enabled_scsih_sas_enclosure_dev_status_change_event_debugbpf_funcmems_allowedreply_free_dmaMpi2ManufacturingPage0_tSAS_LINK_RATE_G2s_inode_lruMATCHED_WITH_ADDR_AND_PHYMASKcached_rqsd1_supportinternal_dmammap_compat_baseretvalmpt3sas_config_doneprepareconfig_cb_idxDiscoveryInfoclock_op_might_sleepf_sb_errneed_mbd_namempt3sas_get_port_by_idcheck_flagsi_sequencert_priorityrequest_szkretprobe_instancescrypto_profile__be32iov_basecpus_ptrq_lockdep_maploadfuncscpu_bitmap_MPI2_SAS_IOUNIT_CONTROL_REQUESTpci_error_recoverySTARGET_DELatomic_write_lensaved_tfHCTX_TYPE_POLLcfg_sizexa_headdetach__UNIQUE_ID_x_617SAS_PROTOCOL_SATAHotSparePoolremove_hostproperty_read_string_arrayget_statetracepoint_funcCurrentTemperatured_seqRequestDescriptorPostLownuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmtDID_NO_CONNECTExtPageType__UNIQUE_ID_max_sectorstype597blkg_listStripeSizenum_symtabexec_update_lockfscrypt_inode_infosplice_readout_thread_failneed_qsctx_mapMPI2_RAID_ACTION_DATAbd_disk_scsih_ublock_io_devicenumberszone_wplugs_wqDMAFlagsApplicationTagTranslationMaskWRITE_LIFE_SHORTsigpendingpi_entrys_inodesdirtied_when_scsih_sas_control_complete_MPI2_CONFIG_PAGE_SASIOUNIT_0_MPI2_CONFIG_PAGE_SASIOUNIT_1MIGRATE_ASYNCnext_scangsindexcompletempt3sas_config_set_ioc_pg1_MPI2_SEP_REQUESTwatch_listeh_abort_listd_sib__UNIQUE_ID_enable_sdev_max_qd612module_attribute_scsih_pcie_device_remove_from_smlmax_host_blockedscsiio_depthslot_reset__builtin_memsetneed_tsin_dpm_listdevice_namewordworkdevice_reprobe__list_add_valid_or_reportDescriptorTypeDependent1multiprocessquiesce_depthclass_task_lock_is_conditionalvphys_masktask_groupRAIDFunctionf_pos_lockshpc_managednum_physrdpq_array_enable_assignedbio_pooltimeout_workwrite_endsrcu_barrier_completionpacctblk_mq_tag_setcurr_target__UNIQUE_ID_enable_sdev_max_qdtype611PhysDiskStatusFlagsreset_typevm_page_protbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatperf_event_contextatomic64_tnoinstr_text_startHRTIMER_RESTARTqueue_workmpt3sas_get_sdev_by_addrrpm_autosuspend_delayis_thunderbolt_scsih_check_topo_delete_eventsSlotbusystack_canaryreply_post_free_dma_poolnon_operational_loopmax_write_zeroes_sectorsHwLinkRate_utimetmf_work_q__fortify_size_flags_1_flags_2taskstatscomponent_listmpt3sas_base_release_callback_handler_scsih_issue_delayed_sas_io_unit_ctrlposix_acli_dio_countmpt3sas_get_num_volumesSL_WH_EVENT_TRIGGER_Tarch_rwlock_taddend1addend2driverget_resyncsym_timens_pagewaitersoffsetSHOST_DIF_TYPE2_PROTECTIONprot_guard_typedev_iommu_scsih_mark_responding_expandermap_typeclass_rwsem_read_intr_is_conditionalcompletionnode_stampclass_raw_spinlock_nested_is_conditional__UNIQUE_ID_y_620fiemaprcu_usersDiagRWAddressHighSDEV_BLOCKbacking_dev_infoi_mappingMaxReducedFuncTimeIOCCapabilities_scsih_pcie_enumeration_eventdiscard_alignmentbsg_deviceshow_stats_resmpt3sas_base_update_missing_delayscsih_bios_params_vfs_rename_keysubmitteretypei_bytes___GFP_WRITE_BITnormal_priompt3sas_base_map_resourcesWQ_UNBOUNDSDEV_CREATEDshost_datadispatch_waitsrcu_nodeconfig_rrs_svlast_mm_cidget_next_pcie_devicechain_pages_MPI26_NVME_ENCAPSULATED_REQUESTPhysDiskAttributesis_busmastervaddrscsi_vpderr_handleris_soft_scsih_sas_ir_operation_status_event_debugnext_cpuspin_unlockgrab_current_nspci_access_mutexminimum_linkrate_hwclass_namesparam_ops_ushortMaxReplyDescriptorPostQueueDepthlock_class_key__param_str_max_lunsum_exec_runtimecompatiblesetupdev_pin_infoMpi2SCSITaskManagementReply_tinvalid_dword_countpoll_table_structmce_whole_pagesas_device_getia_modeport_entryrcu_tasks_holdout_listsched_rt_mutex__UNIQUE_ID_prot_masktype609LookupMethodmpt3sas_free_enclosure_list__UNIQUE_ID_description592s_pinsnum_lunsnon_seqfifo_timehctx_listrenamemajorscsi_statektime_tparam_get_intMPI2_RAID_ACTION_START_RAID_FUNCTIONonstackPRJQUOTAkprobe_blacklistjump_entriesdio_offset_alignreserved_tagsdma_masksa_restorerqueuelistdatalenmkdirio_missing_delaynextrelax_countrestore_earlyPIDTYPE_TGIDilenMaxPersistentEntriesmax_active_zonesdevice_physical_location_horizontal_position__list_add_MPI2_SGE_SIMPLE_UNIONkobj_uevent_env___GFP_MOVABLE_BITkprobes_text_startSDEV_EVT_ALUA_STATE_CHANGE_REPORTEDkref_initMpi2EventDataIrVolume_tDiagRWAddressLowpid_type_MPI2_EVENT_DATA_IR_PHYSICAL_DISKHotSparefown_structi_default_aclscsih_host_reset_scsih_set_volume_delete_flagscsi_cmnd_submitterfregs_stateSCSI_PROT_READ_INSERTphy_identifiershift__devicesFORTIFY_FUNC_strcpypendingfirmware_event_threadIODeviceMissingDelayioc_pg8dma_boundarybd_nr_sectors_MPI2_CONFIG_PAGE_MAN_0SAS_LINK_RATE_6_0_GBPSnr_eventsMPI2_RAID_ACTION_REPLY_DATAconfig_page_dmakstatanon_vma_nameSGLFlagsdq_hashmpt3sas_trigger_eventsbitmap_weight_MPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTOR__iovgp_stategrphintabiommu_mm_dataSASLevelzone_wplugs_err_listma_flagsarch_uprobebio_issue_scsih_sas_pd_addDL_DEV_UNBINDINGConfigElementKMALLOC_RANDOM_ENDbroadcast_aen_busyport_numrefcountmmap_lockMPI2_RAID_ACTION_HOT_SPAREControllerResetTODID_TRANSPORT_MARGINALBLK_MQ_UNIQUE_TAG_MASKsrcu_reader_flavorinternal_free_listtimerqueue_nodelog_codereal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_allowedsprintfuse_16_for_syncrt_mutex_waiterReportDeviceMissingDelayset_phy_speedSAS_PROTOCOL_ALLmmio_always_onlegacy_mempage_pooldq_dqb_lockdiag_trigger_eventf_flagsblk_qc_tshow_infoslave_allocflush_requireddequeue_next_fw_eventsg_tableattributesblk_queue_stats_MPI2_CONFIG_PAGE_RAID_VOL_0_MPI2_CONFIG_PAGE_RAID_VOL_1grplokgid_terror_detectedkey_userpci_channel_state_treadlinkoffline_disabledd_comparei_wb_frn_winnerqspinlock__compiletime_assert_451sighand_structsas_hbascsih_pci_resumestart_brkSAM_STAT_ACA_ACTIVEDID_BAD_INTRdio_completeshost_statelocked_pendingmpt3sas_base_initialize_callback_handlerbase_readl_scsih_sas_pd_expose_MPI26_CONFIG_PAGE_PCIEDEV_0_MPI26_CONFIG_PAGE_PCIEDEV_2s_idmpt3sas_base_free_resourcesblk_mq_request_startedInquiryDatacore_statereply_dmaalignsym_int80_landing_padscsih_cmdsngroupspme_pollsp_offset__sigrestore_tRPM_SUSPENDED_scsih_probe_boot_devicesvolnameDMA_TO_DEVICEmutexn_refattrsboot_device_scsih_response_codebi_sectoreh_deadlinefsbasesrcu_barrier_mutexelement_type_keyswregs_state__kernel_timespecAttachedDeviceInfohpr_lookupioc_reset_in_progress_lockWQ_HIGHPRId_lrud_fieldmaskmpt3sas_process_trigger_datacountersReportGenLengthfaults_disabled_mappingnameidatapoweroffuntrustednr_msix_vectorsminorsmpt3sas_scsih_reset_done_handlerelemsizescsi_host_set_protrlim_curFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagSCSIStatusQualifierdebugfs_entrywait__list_add_validshow_rqMpi2ExpanderPage1_tcan_queueout_add_shost_failfw_event_listst_shndxreservedSL_WH_SCSI_TRIGGERS_Twas_on_pcie_device_listi_wb_frn_historyctxsprocess_keyringset_dqblkis_backlinkrestart_blocks_opbi_end_iokobjectposix_cputimer_baseleveluser_definedpcie_target_idcow_page__warn_printkmsix_indexnanosleepfalse__mod_device_table__pci__mpt3sas_pci_tablepi_state_listtv_secac_exitcodeLookupAddresssuidscsi_host_statusdeletedKMALLOC_RANDOM_STARTSAM_STAT_INTERMEDIATE_CONDITION_METjiffiesMsgLengthdismissi_hashmm_cid_next_scanenable_sdev_max_qdfreeze_noirqoublockia_atime_timerhotplug_slotparam_set_intrespondingMpi2RaidVolPage1_tvm_private_data__UNIQUE_ID_host_tagset_enabletype615skip_ms_page_8work_bitsTargetCommandBufferMpi25EventDataSasDeviceDiscoveryError_tmask_interruptsmpt3sas_port_enabledq_freeSHOST_RUNNINGrootmpt3sas_scsih_clear_outstanding_scsi_tm_commandsgot_task_abort_from_ioctlpolicycpu_baseraid_device_listMPI2_ADAPTER_ORDER_AUXsize_mulraid_templatemastercap_bsetnr_itemschain_offsetseq_startbp_regbvec_poolrb_root_cachedwwidi_blkbitswritervm_pgoffMPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTOR_refcountRAID_LEVEL_JBODcsum_typebin_attributemath_emu_infopushable_dl_tasksValidEntriestestRAIDOperationmanu_pg0sched_infogroup_infoSUCCESStailsport_typeDID_IMM_RETRYeh_eflagsdqi_fmt_id__param_str_diag_buffer_enableDataLengthdevice_missing_delaysoftirq_next_timerrevisionis_child_subreapersg_tablesizeexit_codefile_lock_contextwriteback_indexfiemap_extent_infofilemempool_free_tProductIDrt_spc_warnlimitcmndatomic_write_hw_unit_minarch_test_and_clear_bitMpi2SCSITaskManagementRequest_ttimer__empty_rangessbq_wait_stateActionDataSGEdev_namei387__p_size_scsih_temp_threshold_eventsMpi2ConfigReply_tWORK_OFFQ_POOL_SHIFTn_klistwb_errbudget_tokenhba_vphytm_retrywrite_dquotf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachestorebi_bdevst_infodispatchdescsquiesced_bydqi_max_ino_limitllseek_MPI2_CONFIG_PAGE_HEADERlocal_fwnodeRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditional_scsih_raid_device_removeinaccessibleno_d1d2get_projidbuild_sg_mpivolstate__sectorpart0hba_port_matched_codescnvcswmsix_basecallskqidmem_cgroupfree_inodesiglockwait_queue_func_tperf_recursionnr_wakeups_remoted_spacei_ctime_sec_MPI26_EVENT_DATA_ACTIVE_CABLE_EXCEPTdebugfs_idnext_timer_typeTT_NATIVEhlist_bl_nodeoldbitnum_descs__mpt3sas_get_sdev_from_target_head_1_head_2clockid__read_overflow2_fieldFREEZE_MAY_NESTsym_hvclock_pageEventDataLengthremap_file_rangemmap_legacy_baseend_data_scsih_sas_ir_config_change_eventxa_lockfutex_exit_mutexuse_16_for_rwiommu_groupEventContextmempool_alloc_tdevice_get_dma_attrtarget_blockedMpi2BiosPage2_talloc_inodepayloaddirty_foliofscrypt_keyringActionis_hardasync_sizeDID_SOFT_ERRORtrap_nrf_iocb_flagsnvme_abort_timeout__flagsmultifunctiontotal_vm_MPI2_CONFIG_PAGE_SAS_ENCLOSURE_0iteratoruse_32bit_dmalastpool_dataqf_opsforce_atomicskip_bus_pmreal_credno_difblkcnt_td_rt_spacempt3sas_transport_port_removesigned charpcie_cap_lockhas_child_subreapermountRAID_STATE_RESYNCINGreply_post_free_dmablk_flush_queueres_attr_wcsched_entitydev_links_infos_uuid_len_scsih_set_debug_level___GFP_RETRY_MAYFAIL_BITdqi_privINIT_LIST_HEADIOCRequestFrameSizefmode_trpm_autosuspendsweventremove_busactivatefxregs_stateSAS_SATA_SPINUP_HOLD_lowerreply_szidentifypaddingDEVICE_REMOVABLEVF_IDtimer_rand_stateDID_RESETElapsedSecondsllist_nodeNVMe_Commandbpf_run_ctx_scsih_prep_device_scanbio_slabDCRAddressbroadcast_aen_retrystate_add_uevent_sentenv_startmodule_notes_attrsio_cqRateToChangeControlFlagsrangebvecacct_vm_mem1on_cpumanage_system_start_stopReasonCodestringSHOST_CANCEL_RECOVERYatomic_fetch_add_relaxednuma_preferred_nidmemsetfree_diskvmem_altmapchain_buffer_dmabiotailwait_startmpt3sas_destroy_debugfsreason_str_MPI26_EVENT_PCIE_TOPO_PORT_ENTRY_MPI2_ADAPTER_INFOelevatorspinlock_scsih_sas_host_refreshBLK_MQ_UNIQUE_TAG_BITSsrcu_barrier_seq_scsih_raid_device_find_by_wwidi_aclptm_granularitytrigger_info_dwordsnofaultia_rangesq_size_fieldHostTraceBufferDecrementSizeKB_scsih_io_doneis_rel__ilog2_u32tablepteval_t_mpt3sas_fw_workAccessStatus__param_arr_missing_delayblk_mq_tagsDEVICE_PANEL_LEFTorc_unwind_ipport_number__UNIQUE_ID_disable_discoverytype607diag_buffer_statustm_custom_handlingrel_deadlinescsih_pci_error_detectedkobj_typenext_portskip_settle_delaysb_writersdma_cleanupeh_timed_outdriver_datais_iouring_poll_qphys_addr_tdma_iommumax_idirq_saferescue_lockdefault_timer_slack_nsxregs_states_statecompletion_cntssleep_deferred_listcurr_nrset_child_tidbio_vecacpi_match_tablenfdsrlimit_MPI2_IEEE_SGE_SIMPLE64MPI2_SAS_IO_UNIT0_PHY_DATApd_pg0__list_del_entry_valid_or_reportmpt3sas_base_wait_for_coredump_completionidle_notificationmodule_stateWORK_OFFQ_FLAG_SHIFTMPT_BUILD_SG_SCMDwait_lockf_pipegetgeowrite_itersense_dataMaxDevHandleD_REAL_DATAEventValuematched_codeacct_timexpd__param_prot_maskclock_mutexVolumeSettingschain_segment_szmpt3sas_send_trigger_data_eventnr_failed_migrations_runninguserfaultfd_ctxevent_flagsthread_structoldp__mpt3sas_get_pdev_by_wwid__param_str_enable_sdev_max_qdmm_context_treply_lenenclosure_handlebd_stampsas_device_make_activedio_mem_aligncstimesmid_sas_ctrlreplyMPI2_CONFIG_EXTENDED_PAGE_HEADERprot_capabilitiesatomic_long_trpm_requestirq_reroute_variant__refcount_incpci_sriov_scsih_check_pcie_topo_remove_eventsMQ_RQ_COMPLETEio_comp_batchhi_priority_dmampt3sas_scsih_issue_locked_tm_MPI2_EVENT_DATA_IR_CONFIG_CHANGE_LISTf_credtrace_events_MPI2_SCSI_IO_CDB_EEDP32d_iputReqBootDeviceFormMPI2_VERSION_UNIONnr_wakeups_syncscsih_resumeklist_nodestackExpanderDevHandleSAS_LINK_RATE_G1queue_logical_block_size_mpt3sas_initblockedallowedmce_countweightmpt3sas_get_pdev_by_wwid_scsih_mark_responding_sas_deviceblk_plugtrc_reader_nestingfpstatetag_setis_roxno_scsi2_lun_in_cdbprevPhysDiskNumseqcount_raw_spinlockinstrument_atomic_read_writeSHOST_DIX_TYPE2_PROTECTIONbios_paramnot_satanum_orcsFORTIFY_FUNC_kmemdupDevHandlebuflenscsi_host_putTransferLengthWRITE_LIFE_LONGMPI25_IEEE_SGE_CHAIN64ari_enabledexpiry_activeeh_bus_reset_handlermtd_infoenclosure_levelis_confidentialreset_in_progress_mutexi_dentryfixupswq_misc_constspcie_sg_lookupvm_endvm_structsas_portmemcgfsyncPortEntry_MPI2_IOC_INIT_RDPQ_ARRAY_ENTRYsgidcompat_robust_listnuma_workskip_to_saspriocurrent_stateprivvalueReplyFlagsreply_qcurrent_stack_pointerac_minflt_hugetlb_cgroupSettingsDeviceFirmwareUpdateModeTimeoutset_policyinternal_tagthreadftrace_callsitesuint64_tmmlistconfig_vaddrTotalBlockspci_channel_io_perm_failurepage_typeclass_spinlock_is_conditionalmpt3sas_base_get_iocstateusermynodeseq_stopWORK_BUSY_PENDINGblk_tracealloc_workqueueactionpi_waitersdoe_mbsEventDataMpi2RaidPhysDiskPage0_thi_priority_depthscsi_remove_targetatomic_tpcp_listdiag_trigger_masterqueue_flagsMPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTORmpt2sas_raid_functionsrb_rootExtPageLengthsubsystem_devicesas_remove_hostsas_phyutf8data_tablecpu_msix_table_szscsi_is_host_deviceSAS_LINK_RATE_FAILEDexe_filePUT_SMID_DEFAULTWordSGLOffset0SGLOffset1SGLOffset2SGLOffset3uid_telementshpr_free_listd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_data_MPI2_EVENT_SAS_TOPO_PHY_ENTRYPortType_scsih_tm_tr_completedef_flagsscsih_tm_post_processingsrcu_n_lock_retriesraw_locksrcu_structis_guestio_minmpt3sas_transport_add_host_physplice_eofs_sync_lockanon_vma_chainscsi_get_prot_opi_mtime_nsecignore_delay_removerseq_event_maskem_pdi_fsnotify_maskshared_pending__int128__mce_reservedwriteback_controlmm_structPhyIdentifier_scsih_scan_for_devices_after_reset__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEreset_timeoutbuild_id_MPI2_EVENT_DATA_SAS_BROADCAST_PRIMITIVEs_export_opMPT_ADD_SGEscsi_internal_device_block_nowaitlen_descseg_boundary_maskWQ_SYSFSanon_nametest_and_clear_bitsched_dl_entitypp_ref_countactivest_otherstartparentlookupkernel_siginfostart_scan_sigpoll__compiletime_assert_109SDEV_CANCELkill_sbMaxTargets__bi_remainingnum_bugsnr_requestssecurity_supportedport_identifieradapter_reply_queuestate_entry_ptrmpt3sas_base_get_msg_framestatsactive_baseschain_depthDEV_DMA_COHERENTswap_slot_free_notifyunsafe_warnconfig_cmdsstart_databoolbv_len___GFP_RECLAIMABLE_BITinquirymodsctime__write_overflowdestroy_inodefutex_pi_stateSL_WH_EVENT_TRIGGERS_TBoardTracerNumberNegotiatedLinkRatei_mutex_dir_keyrescue_workrestartsASCQdevice_physical_location_vertical_positionget_aclset_aclrdpq_array_enables_voppercpuLengthpci_dynidsdescpoll_bioiterate_sharedmpt3sas_transport_port_addsym_vdso32_sigreturn_landing_padcma_areafeaturesrcu_tasks_exit_cpumigrate_from_cpubd_size_lockwriteerror_codebuddy_listldt_structSASNarrowMaxQueueDepthcred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_name_sas_portVTIME_INACTIVEeh_target_reset_handlerclass_preempt_is_conditionaltimeouturing_cmdshrinker_idnr_dirtiedgetattrsetattrPageVersionfixupblockMQ_RQ_IDLEdevtlast_cpuprocdirnr_wakeups_localuidhash_nodeworker_privatepoll_eventlinelinkbi_poolphysfnbi_cookiemode___GFP_NOWARN_BITport_table_listEnclosureLogicalIDnode_idtargetget_nextdqblkrcu_tasks_idx__compiletime_assert_593__compiletime_assert_594__compiletime_assert_597__compiletime_assert_598__ret_do_oncejournal_infobi_inline_vecstqheadlast_used_atrq_end_io_retsensehres_activemod_name__q_sizenotes_attrsdelay_workblock_device_operationsoffset_ctxbi_blkgFREEZE_HOLDER_KERNELlast_switch_timerphywakeup_countwait_indexrunnable_weighthostdiag_unlock_mutextarget_busysas_expander_deviceclass_releaselast_sum_exec_runtimedd_key_truesa_handlercg_listedevscsi_transport_templatelocked_vmqueue_rqaddressmq_hctxDefaultstart_timezone_wplugs_hashcookielistRequestCreditResponseDataLengthreply_free_dma_poolsig_okphy_listextabledma_data_directioni_sizeentry_eipsplice_pipexstate_headerinquiry_lendma_addrAddressReplyem_perf_domaind_flags___GFP_HIGHMEM_BIT_large_mapcountpid_namespaceliveclock_was_set_seqspc_warnlimitseqcount_t_MPI2_ADDRESS_REPLY_DESCRIPTORmin_fltblock_deviceMEMORY_DEVICE_GENERICpkruprojid_tvendordma_lengthkey_payloadadd_linkspinnedsubsys_datause_10_for_ms_dummy_bndrefcount_saturation_typesaved_stateparent_exec_idutil_sumdd_key_falsesigvaldev_to_shostfsnotify_mark_connector__ubuf_iovecsize_is_constantcputime_atomicdeadlinereset_methodsbio_integrity_payloadlun_in_cdbexit_requestwait_queue_upperclass_write_lock_irq_is_conditionalswap_readahead_infovtimeexpecting_cc_uas_rootstack_refcountgrpmaskSASStatuspm_caps_remove_countlru_genwrite_newuser_namespaceclass_rwsem_write_is_conditionalpids_active_resethlist_nodeblk_features_tsuper_operationsautosleep_enabledwrite_file_infoload_sumresourceaddress_spacecpus_maskdl_yieldedstarget_datafile_dispread_newd_spc_softlimituse_10_for_rw_MPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTORkrefrseq_css_lock_keybuild_zero_len_sge_mpidqi_flagspdevmq_ctxjump_entrypi_top_taskDoorbellpacct_structRPM_REQ_RESUMEsas_end_device_allocMpi2SmpPassthroughRequest_treq_boot_deviceuser_sizeis_aero_iocmpt3sas_wait_for_iocats_caplast_queue_ramp_upbd_statsMpi2SystemInterfaceRegs_tshow_fdinfoFAULT_FLAG_MKWRITEput_budgetfadviseclass_read_lock_irq_is_conditional_MPI2_SMP_PASSTHROUGH_REQUESTlinenoMODULE_STATE_LIVEtask_listasync_scanFAULT_FLAG_RETRY_NOWAITReqAltBootDeviceForm_qprocread_foliosc_data_directionhas_elevatordq_countvpd_pg0nlinksignalshutdown_latencynr_wakeups_passiveself_exec_idstate_syncedws_activef_epsriov_set_msix_vec_countrcu_specialscsi_device_handlerentrybacksda_is_staticd3cold_allowedcntsrequest_trackersock___GFP_THISNODE_BITsdev_bflagsdispatch_fromdqio_semis_driver_loadingmq_freeze_wqstart_prevent_timepgd_tchain_lookupsigset_tbucket_idSL_WH_MASTER_TRIGGER_TMpi2BiosPage3_tgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64__list_del_entry_validi_inoserver_has_tasksAttachedPhyInfoout_fail_killi_spc_warnlimitbuild_zero_len_sgeunderflowf_posperformancesoftowner_trapnoload_weightio_windowsymlinkclass_rwsem_write_try_is_conditionalkmalloc_noprofbd_queuein_iowaitMpi2SmpPassthroughReply_tDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclbdi_writebackrb_leftmostbug_addr_dispmigration_pendingscan_mutexhosttd_realMaxSasExpandersdevice_get_match_datahdr_types_max_linksscatterlistthread_headdata_in_dmaacquire_dquotclockid_ttarget_destroyzone_capacityFORTIFY_FUNC_strlen_MPI2_VERSION_UNIONpref_64_windowpgdval_td_manageshost_recoveryNumberOfPortsSAS_SATA_PORT_SELECTORmfg_pg10_hide_flagmax_device_blockedback_padMIGRATE_SYNCdiag_trigger_activewcharRQ_END_IO_FREEHCBSizeseq_fileulongrestoresge_sizeHPROBE_LEASEDBoardAssemblyHostInterruptMaskthaw_superis_managedalt_len_MPI2_DEFAULT_REPLY_DESCRIPTORseq_operationsfallocate__ret_call_addrfree_chain_list_transport_get_port_id_by_sas_phy_MPI2_BOOT_DEVICE_DEVICE_NAMEi_mmap_rwsemundo_listis_probedattribute_groupdma_poolspersonalityprintk_index_sizeMPI2_BOOT_DEVICE_SAS_WWIDfunction_resultmsix_enableuprobe_task_statestimestatic_priotmpfiledqi_formatnvcswrequest_payload_nr_pages_mappedfrequency__compiletime_assert_39_transport_convert_phy_link_ratedev_pm_ops__refcount_sub_and_test__kmalloc_indexirq_poll_scheduledget_enclosure_identifieralloc_hintsense_dma_poolblk_mq_ctxsas_device_pg0no_updateiter_type__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_44DEVICE_PANEL_BOTTOM__compiletime_assert_46__compiletime_assert_47__compiletime_assert_48transporttreply_post_host_indexnr_wakeupsenabledki_filpmultiple_queueswork_func_tpp_magicfpu_state_permGenericFlags0barsrequest_lengthfwnode_reference_argsdevres_headbus_listdpc_rp_extensionsscsih_cb_idxRPM_REQ_IDLEfilenamebase_dest_lend_pruneDiscoveryStatusmpt3sas_transport_add_phy_to_an_existing_portrestore_noirq_MPI2_SYSTEM_INTERFACE_REGSsysfs_registeredrlocksas_node_locki_rt_spc_warnlimitqueuedevice_remove_in_progressbytesnuma_migrate_retryMEMORY_DEVICE_COHERENTenclavefilterroot_blkgd_revalidatetracepoints_incoredqsi_opreplyPostRegisterIndexquota_syncsrcu_have_cbsasync_in_progresssignumdqi_dirty_listrphy_to_iocpi_locktimespec64scan_finishedcpu_addrnr_forced_migrations__mpt3sas_get_sdev_by_rphyumount_begin_MPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTORchannelbadblocksblocking_handlesport_idkernfs_node_MPI2_DEFAULT_REPLYcpumaskptrace_messagelength_boot_devicetag_listbio_alloc_cachepdt_1f_for_no_luni_wb_frn_avg_time_pincountreclaim_statedrv_internal_flagsruntime_errori_sb__poll_tsubvolon_dispatchdirty_inodesymtabd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structfs_parameter_specrcu_data0real_blockedruntime_suspend_MPI2_BOOT_DEVICE_ENCLOSURE_SLOT__s16sas_identifybacktraceoffline_alreadys_umountHostTraceBufferMaxSizeKB_src_lenon_listNvdataVersionDefaultIOCLogInfo_MPI2_CONFIG_PAGE_IOC_1_MPI2_CONFIG_PAGE_IOC_8data_vmneeds_force_resumeblk_eh_timer_returnFunctionsas_device_init_listrpm_statusCoalescingDepthscsi_host_state__s32p_sizechildrencheck_eventsdqi_bgracei_wbhost_nof_inodeserialburstaer_capscsi_target_statehostmsi_device_dataslave_destroykallsymsi_ino_timelimitreply_payloadbi_issuebd_holder_opsphy_masksas_device_putsrcu_idxSTARGET_CREATEDutil_est__s64mpt3sas_base_sas_iounit_controlhugetlb_usagesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenacct_rss_mem1___orig_eipsrcu_datadevice_physical_locationchains_per_prp_buffer__keycgtimepagefault_disabledindexMpi2ManufacturingPage10_ts_time_maxdelayed_workcomponent_revision_idopen_partitionssa_maskmmappedMPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORElf64_Wordactive_timeatomic_flagscallernum_jump_entriesextra_lenPassthroughFlagsPIDTYPE_PGIDelemend_ioquotalensrcu_data_have_cbsnivcsw_tidioc_pg1_copymce_vaddrdl_dev_stateshowrb_subtree_lasts_listadd_busmq_pollnr_segssame_target_siblingsof_match_table_entryino_timelimitparent_devSDEV_EVT_SOFT_THRESHOLD_REACHED_REPORTEDalternative_gpt_sectori_readcountblkcg_polsincr_transport_get_bay_identifierfreepasid_enabledlock_countthrotl_datareply_dma_max_address_sas_devicelist_lru_onei_pagesmxcsrrom_bar_overlapclass_rcu_is_conditionalarchdataptrace_entrydata_out_szguest_permwait_queue_headnum_srcu_structsnr_activeprev_sum_exec_runtimei_flagsgendisku_flagstag_set_listlogical_block_sizeSDEV_EVT_MAXBITSinvalidate_lock_keyinfol1d_flush_killMPI2_IEEE_SGE_SIMPLE64write_beginSHOST_CANCELwrite_infohrtimer_restarts_encoding_flagssessionidd3cold_delays_time_minvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrs_stack_depthFlags__vm_flagssdev_statequeue_depthinternal__compiletime_assert_601__compiletime_assert_602__compiletime_assert_605__compiletime_assert_606__dummy2pm_messagefred_cschangedsmp_handlercur_ktimeinitfop_flags_tgroupsoffstty_structnotify_nextvirtual_dr6dma_opsreset_wq_MPI2_CONFIG_PAGE_SAS_PHY_0_MPI2_CONFIG_PAGE_SAS_PHY_1dma_addressmmap_basebd_devsyscall_workinit_cmd_privlockdep_mapnum_trace_evalsbidi_rq_addr_bndset_dbd_for_msnumberzone_device_dataquota_readpinned_vmreventswritepagesnuma_faults_localityqrwlock__write_overflow_fielddma_addr_outrw_semaphorefirst_minori_blockstask_fragTimeSyncIntervalsource_listsum_block_runtimeHostTraceBufferMinSizeKBioc_reset_countnuma_scan_period_maxtotal_timepowerrequest_queuenum_ei_funcsi_generationSAS_LINK_RATE_3_0_GBPSflushonline_MPI2_CONFIG_EXTENDED_PAGE_HEADERno_vpd_sizeformatlast_switch_countsge_size_ieeelast_wakeeswapuint32_tssize_tphy_belongs_to_portRQ_END_IO_NONEvtime_statepci_ers_result_ttry_vpd_pages__ret_conds_blocksizequeue_numprevent_sleep_timeclass_spinlock_irqsave_try_is_conditionals_readonly_remounti_io_listChangeCountchild_countpcie_bwctrl_dataVTIME_IDLEcompat_uptr_treply_dma_min_addressDEVICE_HORI_POS_LEFT_hugetlb_subpoolend_pfnuclamptgidlimits_lockreleasenr_wakeups_migratestack_vmi_fieldmaskupidinsntrace_evalsia_vfsuidquota_format_opsprocent_transport_unmap_smp_bufferi_datarescue_listfsverity_infocore_threadreserved0closidreserved2reserved3sched_avgcodearch_atomic_fetch_addbsg_jobsyscore__i_nlinkpmd_tallocated_response_lengthScratchpadsrcu_barrier_cpu_cntreadaheadopt_sectorshrtimer_cpu_baseirq_domainwait_liststatic_call_trampfsverity_operationsreply_post_queue_depthcoublockbug_tablemigrate_modeunmap_inusing_gplonly_symbolsnext_phyremovedhandleremulatedsym_vvar_pagemembarrier_statedma_pad_masksas_addressbin_sizeFORTIFY_FUNC_strlcatrcu_read_lock_nestingMpiSimpleCoalescingTimeoutrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_trep_manu_replyio_bitmapDEVICE_VERT_POS_CENTERZoneGroupsbitmap_wordlong unsigned intmax_timelast_queue_full_countread_file_infoexec_startia_sizeio_queue_numRPM_RESUMINGMODULE_STATE_COMINGsym___kernel_sigreturninit_completionFWVersiondma_alloc_coherentuser_cpus_ptrd_opstate_initializedpend_os_device_add_szrelease_dquotplugsoftirq_activatedresid_leninv_weight_raw_spin_lock_irqsavesecurityMpi2SasIoUnitControlRequest_tGlobalFlagskernel_symboldl_timerlockdep_map_pmodule_param_attrsno_read_capacity_16scsi_host_template__user_state_sizechainedVTIME_GUESTretriessdtrsysvsemdisconnectstashedpasid_no_tlpuser_xfeatures__kmalloc_cache_noprofuse_memdelayMPT_BUILD_SGnr_cached_objectshas_timeouttime_sync_intervalpayload_lencommcallback_headexception_table_entryin_hrtirqaddr_indelayed_event_ack_listfactor1factor2_overruncondDEV_DMA_NON_COHERENTcoredumpd_sbio_lock_cls_keyksetno_msisleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsnodesysvshmno_highmemdata_outREFCOUNT_ADD_UAFsas_phy_allocfirstport_enable_cb_idxactive_countnr_active_requests_shared_tagsnum_tracepointsueventsharednext_cpu_batchdisk_eventss_sysfs_namesigval_tcombined_reply_index_countSDEV_QUIESCEbitsbase_pfnclass_mutex_try_is_conditionalresource_size_tsem_undo_listcompat_rmtpclass_local_lock_is_conditional_MPI2_SAS_IO_UNIT1_PHY_DATAdiag_trigger_mpistatic_key_true_stimeAdapterOrderAuxperf_event_ctxpfwfault_debugcostxcomp_bvio_contextmsix_enabledPIDTYPE_PIDwakee_flipsvlagMaxPortConnectionsufdssegment_boundary_maskioctlprev_cputimesaved_cap_spacehorizontal_positionem_perf_tablebi_crypt_contextSAS_PROTOCOL_NONE_transport_phy_speedprivateswp_entry_tcharmatchnr_failed_migrations_hotreg_offsetAddress32queue_stoppedFORTIFY_FUNC_UNKNOWNbin_attrscpu_itimerMPT3SAS_FLUSH_RUNNING_CMDSPrimitivedevres_lockfiles_struct__ret_onceblk_zoneSDEV_RUNNINGicq_treevfsuid_tf_lockexec_vmkernel_paramvertical_positionshutdown_prerelease_foliobi_io_vecpri_capget_msix_index_for_smliovendor_idmtimearchrobust_listasync_probe_requestedthaw_earlySAS_EDGE_EXPANDER_DEVICEvectors_securitysplice_writeport_enable_failedparam_lockreq_listi_opflagsdentry_operationsstats_sectorss_blocksize_bitskfreeaccess_statusenclosure_logical_idexp_hintclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapdevice_remove_in_progress_szstrnlenpfacts_head_2asym___kernel_vsyscallopen_muteximm_readyfortify_funcout_delete_portget_timeki_flagss_inode_wblist_lockioc_link_reset_in_progresspermchain_bufferdestroy_worklockableuprobes_statemm_counttrace_overrunargsargvdiag_trigger_scsiuclamp_reqswap_info_structdynidss_qcopblk_mq_queue_mapchip__kernel_long_tsrcu_usagefaultableMPT3SAS_ADAPTERMPT_BUILD_ZERO_LEN_SGEexit_hctxin_execverlim_maxphy_resetsimple_tagsSlotNumbertarget_listmutex_lockcoherent_dma_mask__data_lendriver_flagsfile_ra_statek_sigaction_MPI2_SAS_IO_UNIT0_PHY_DATA_hugetlb_hwpoisontemp_sensors_countReplyFrameAddressreadahead_controlfwnode_operationsswait_queue_headMaxNumPhysicalMappedIDsmemory_typePciBusNumbervm_userfaultfd_ctxsas_port_addTT_NONEmap_pagesmod_tree_nodecmd_flagss_bdev_filedev_pagemapis_mcpu_endpointcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fshost_eh_scheduledsoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLErb_node_transport_get_enclosure_identifierreturn_consumerround_robinMsgFlagsi_private_datavolume_handleptracer_credsrcu_barrier_headleadercheckhtb_rel_queryTT_COMPATcap_effectiveexit_statefaultscan_startmax_sges_in_chain_messagesubvendorbios_pg2bios_pg3numa_pages_migratedPCISlotNummax_sges_in_main_messagesched_tagssupported_modepsgesbitmap_queueis_gen35_iocpci_p2pdmano_cgroup_migrationattached_handlesched_dataprintk_index_startindex_keybreserved_tags__bi_nr_segmentsneeds_freset_MPI2_IEEE_SGE_SIMPLE_UNIONrcecintervalbug_entrytimers_activenum_classesvma_lockIeeeSimpledl_throttledseccompDEVICE_VERT_POS_UPPERblk_holder_opsstatic_key_modport_siblingsfilter_countmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodeumode_tinitial_nsnon_compliant_barsno_pmGRPQUOTAia_vfsgidioctx_locktimer_slack_nss_bdixarraycan_wakeuppdeath_signalnr_wakeups_idledqi_igraceqf_nextmaple_treensproxymanu_pg10manu_pg11slave_dir__p_lendma_unmap_sg_attrs_pkeykernfs_rootucountsget_next_idDD_CLASS_TYPE_LEVEL_NUMhigh_iops_outstandingrefcount_ttimestamp_update_countErrorResponseBaseAddresscmd_lenDEVICE_PANEL_TOPmax_hw_discard_sectorsint32_txol_areaport_listdefault_locktmp_stringguess_capacitysrcu_gp_mutex_MPI2_CONFIG_PAGE_BIOS_2_MPI2_CONFIG_PAGE_BIOS_3debugfs_dirwakee_flip_decay_tsprio_listMPI2_BOOT_DEVICE_ENCLOSURE_SLOTlast_timeBiosVersionrequestblk_unique_idsas_address_parentSDEV_DELMasterDatacontexthost_lockAttachedDeviceInforwlock_tvm_fault_tSAS_PHY_RESET_PROBLEMuse_autosuspendPCIeEncapsulatedSuccessclass_spinlock_irq_try_is_conditionalcfs_rqsas_iounit_pg0sas_iounit_pg1phy_list_mutexvirt_boundary_maskcgroupscore_occupationget_policycore_cookiedel_listMpi2ManufacturingPage11_trefcount_struct__kernel_ulong_tsas_phy_linkratesfwnodestatic_call_keydma_len_outnamespaceparametersgroup_leaderdma_channelrunnable_avgMpi2IOCPage8_tlookaheadiowait_countshstkioac__kernel_clock_tMpi2SasDevicePage0_t___GFP_DMA32_BITwas_resetgp_seqscsi_device_stateuuidmaj_fltcached_requested_keydqb_rsvspace___GFP_NOMEMALLOC_BITreslen__s8inode_operations__kernel_size_tdma_configurefile_leaseclass_local_lock_nested_bh_is_conditionalgpl_symssas_devicepci_vpdpercpu_rw_semaphoreis_chassis_slot_validarch_spinlock_tseqcount_raw_spinlock_tthread_pidevent_logdl_non_contendingcurr_ret_stackpgtable_tmax_bus_speed__u8q_usage_counterwakeirqi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyssdev_targetcore_forceidle_sumget_offset_ctxbase_readl_ext_retryreleasedexport_operationsqc_stateget_budgetBLK_INTEGRITY_CSUM_IPmempool_smempool_td_inodespecial_vecworkqueue_structi_lock_keySAS_PHY_VIRTUALuevent_suppressgraveyard_linkbi_opfscsi_cmndfs_superswait_for_discovery_to_complete__read_overflow2wce_default_on__rcu_icq_cache___GFP_KSWAPD_RECLAIM_BITcap_ambientqstrtaskss_d_opreply_post_free_array_dmano_report_lunsphy_operationi_rcu__count__already_doneinit_requestGET_MSIX_INDEXio_optpcountbio_listwlockeddma_map_sg_attrsdevicemodule_kobjectpercpu_count_ptrpcie_mpssnr_ia_rangesthawtlbflush_unmap_batchremovejob_doneInvalidDwordCountbvec_iteroom_mmbpf_local_storagename_linkcompat_long_tcnivcswchain_dma_poolats_stushort inttrc_reader_specialscsi_lookup_locklogging_levelgtimedisk_events_disable_depththread_group_cputimersizemigrate_to_ramreset_from_userUTASK_SSTEP_ACKbroadcast_aen_pendingloginuiddesc_structi_wb_lists_umount_keyquota_type__init_swait_queue_headnameIoIndexsetleaseMaxEnclosuresbitmap_tagsmnt_rootpsi_flags__real_strnlensighandaddrMpi2ReplyDescriptorsUnion_tmpt3sas_config_get_phy_pg0mpt3sas_config_get_phy_pg1__rcu_headMPI2_SGE_SIMPLE_UNIONac_utimeksm_zero_pagesqueuedataissue_resetprivate_data_MPI2_REPLY_DESCRIPTORS_UNIONreply_free_host_indexfs_structnuma_nodedev_archdatanr_perf_statess_flagsrcu_nodeorig_pmdrb_rightclock_baseclass_irq_is_conditionallaunder_foliowake_batchReserved11Reserved12delayed_tr_volume_lists_vfs_rename_mutexElf64_Xwordflockhandler_data__paddingio_lockdep_mapatomic_write_hw_boundaryiowait_sumdescriptionSasWwidbi_nextblk_status_tUSRQUOTAdriver_privatepm_onlyd_rt_spc_warnsset_read_onlypgmapactive_refdma_addr_inhctx_tablePhyResetProblemCountkernfs_open_filePortFlagsMpi2IOCPage1_ts_iflagspci_dev_flags_tprintedNumDevsPerEnclosurenr_hw_queuesiounit_pg0iounit_pg1codetagstate_mutexlast_queue_full_depthcid_worki_versionMpi2SasIOUnitPage0_tswap_deactivateclass_rwsem_read_is_conditionalqueue_limitsil_weightstarved_listdma_parmsKOBJ_NS_TYPEScmin_fltarch_uprobe_taskis_hotplug_bridgewrite_protect_seqclearedkobj_ns_type_operationsshutdownevent_countsched_statisticspci_ops__kernel_uid32_tallocorig_pterq_timeoutkeysinit_nameSDEV_EVT_FIRSTMPI25_FP_SCSI_IO_SUCCESS_REPLY_DESCRIPTORfile_lockstatfsrw_semdevice_privatevm_policydl_deadlinetracepoint_extclass_mutex_is_conditionalfpregs_statetracker_listmemcg_datadqb_curinodesfileattr_seteh_actionpage_linkno_write_sameDEVICE_PANEL_UNKNOWNPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetsas_port_listmce_ripvDL_DEV_NO_DRIVERret_stackSAS_PROTOCOL_INTERNAL_ABORTreal_timeri_privatealloc_tagextended_state_areanum_kprobe_blacklistaccesssubdirsdev_releasemlock_countget_next_child_nodemempolicyperf_event_mutex_bandkref_putcurrent_boot_devicepollfddev_tdma_poolSAS_LINK_RATE_UNKNOWNplatform_dataf_refprev_posenv_endfileattrs_subtypeusage_countpr_opsstate_in_sysfsdqb_ihardlimitaer_statsunlocked_ioctluprobebd_mappingkmem_cachenuma_next_scanbudget_mapbsg_devsrcu_last_gp_endclass_local_lock_irq_is_conditionalpage_listproperty_read_int_arraywdtrmq_rq_stateholders_dirMODULE_STATE_UNFORMEDst_valuelist_headptrace_bpsreply_free_queue_depthAtomicRequestDescriptorPosts_user_nsbase_cmdsmax_nvme_qdtagset_refcntqueuecommand_may_blockarch_tlbflush_unmap_batchquick_threadsdefer_syncreq_alt_boot_devicemissedsum_sleep_runtimecleanup_rqd_spc_timerd_ino_hardlimitpausechange_cookiebi_statusdl_periods_dquotfsnotify_sb_inforecent_cida_ops_dev_printkatomic_desc_capablepad_untilperf_event_listirq_pollinterval_expevent_type___GFP_LAST_BITdevfntagsPhyNumki_completeRequestDescriptorPostHighpgprotuint16_ttimespec_typebd_devicefind_special_pagedquot_operationsMPI2_IEEE_SGE_SIMPLE32posix_cputimers_workgsbaseio_tlb_memseq_showcpusfilesinblockbd_claimingtail_MPI2_CONFIG_PAGE_SAS_DEV_0s_magicdma_alias_masknuma_faultsmem_dqblkstatusWRITE_LIFE_NONEIocLogInforead_countwait_for_completion_timeoutHRTIMER_NORESTART__UNIQUE_ID_y_600last_update_timeNVME_BUILD_PRPinternal_smid__UNIQUE_ID_y_604Reserved1Reserved2sas_ss_spReserved4Reserved5Reserved6Reserved7dpc_rp_log_sizeReserved9LogEntryQualifierpanelSAS_PROTOCOL_SMP___GFP_ZEROTAGS_BITmax_allowed_capacityopen_moderead_pos___GFP_ACCOUNT_BITD_REAL_METADATAgpl_crcsmpt3sas_transport_add_expander_phyclass_raw_spinlock_try_is_conditional__must_check_overflowkiocb___GFP_MEMALLOC_BITexecute_only_pkeyget_bay_identifierreturn_instancesma_lockblk_mq_queue_datadockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsChipRevisiondentrysequential_iowait_pidfds_writersgroup_stop_countswap_lockvm_opsread_before_msreply_postget_unmapped_areamkobjsym_VDSO32_NOTE_MASKfrozenactive_uprobeget_parent_sas_phymin_vruntimel1ssconnector_namehost_resetclass_disable_irq_is_conditionalControllerPhyDeviceInfosyscrnr_mapssyscwsync_ionum_bpf_raw_eventswork_qnr_phys_allocatedorig_nentski_posSAS_PROTOCOL_SSPavx512_timestampend_io_datafree_cached_objectstaints_BooloverflowSAS_PROTOCOL_STPxol_vaddrlist_lru_nodeuclamp_ses_time_granblk_integritykuid_tdev_pm_qosbd_holdersdriver_exclusive_resourceFlagsLength_sifieldstaskresetsched_reset_on_forkcompound_headnr_retriesshost_privmultipath_on_hbaevent_contextwake_irqbranchtarget_port_protocolsi_cdevchip_phys_dev_infoProgrammedLinkRatei_fsnotify_marksin_thrashingdl_defervpd_pg80vpd_pg83vm_startvpd_pg89mprotectquota_ond_automountDEVICE_REMOVABLE_NOT_SUPPORTEDromlenatimeAddlFlags3get_ownershipf_task_workmy_qeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalsectors_wb_errtotal_io_cnt_MPI2_CONFIG_PAGE_EXPANDER_1closeSAS_END_DEVICEPhyDataiopl_warnelevator_queuereply_post_structpasid_requiredptraceddoneOwnerDevHandlesym___kernel_rt_sigreturnsrcu_struct_ptrsTaskTagMPI2_SAS_IO_UNIT1_PHY_DATAskip_ms_page_3fbuild_sginodesos_irqmemcg_awarei_atime_sechost_waitmanage_shutdownqsize_t__fpstatedma_free_attrsqf_ownerSATAMaxQDepthsuspend_noirqControllerDevHandled_inamebi_flagslinks_countprealloc_pterdevd_ino_countarg_lockmpt3sas_transport_functionsDEVICE_REMOVABLE_UNKNOWNignore_childrensas_expanderfreeze_fsin_eventfdresume_earlystart_scan_failedmax_dev_sectorsdup_xol_workalimitmsix_capir_firmwarempt3sas_port_factsnuma_groupInitiatorDevHandleblk_independent_access_rangeskmap_ctrlfscrypt_operationsrangesfs_contextmnt_idretry_hwerror_MPI2_CONFIG_REPLYdrop_inodeorc_unwindloss_of_dword_syncbroken_parity_statusgraph_get_next_endpointlast_sector_bugmq_mapOEMIdentifier_transport_smp_handlerkprojid_t__u16saved_end_iosyscall_dispatchdl_densityon_rqSL_WH_MPI_TRIGGERS_Taltmappfa_led_onmin_perf_statercu_tasks_exit_listphy_error_log_requestmsi_enabledsp_regdma_drain_bufinternal_lookuplast_resets_master_keysflagsdiag_buffer_dmaIOCParameterbd_holder_locknr_threadsvm_mm__u32EventTriggerEntryrcec_eamax_secure_erase_sectorsseq_nexts_quota_typesvm_lock_ddebugFAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitdelaysf_modeFORCE_BIG_HAMMERtimerqueue_headBLK_INTEGRITY_CSUM_CRCsdev_groupskioctx_tableksm_rmap_itemsclass_read_lock_is_conditionalptm_capKMALLOC_RECLAIM__u64revoked_at_folio_nr_pageswritepageis_dirty_writebackpkey_allocation_maplink_bwctrldq_iddisable_depthem_perf_statethread_shstkminimum_linkrateposix_timerswait_chldexitsas_ss_flagsunmap_limit_for_wssas_device_typerom_base_regpcie_sg_listReserved3bi_itersrcu_cblist_invokingiopollbridge_ctliov_lenlatency_recordPrimFlagsSAS_LINK_RATE_1_5_GBPSmsi_capiopoll_q_start_indexEnclosureHandlesector_size__UNIQUE_ID_x_591__UNIQUE_ID_x_595__UNIQUE_ID_x_599d_releasekasan_check_writecomponent_vendor_iddev_dma_attrexpiresnuma_scan_seqmnt_sbhashnodemask_tmpt3sas_scsih_expander_find_by_sas_addressIOCNumbersignalfd_wqhhang_detecteddevice_driversupports_trigger_pageslast_zone_capacitypend_os_device_addfsindexraw_spinlock_ts_copcombined_reply_queues_activenum_argstag_size_MPI2_BOOT_DEVICE_ADAPTER_ORDERs_uuidclear_child_tidruntime_statusdqb_btimedq_opAdapterFlagsbidi_biono_command_memoryshow_pathdl_serverVTIME_USERquota_disablesched_delayedsrcu_gp_seq_neededtask_structcurrent_may_mountkmalloc_cachesHeaderREFCOUNT_ADD_OVFrequest_dmapushsas_protocolis_noirq_suspendedfwnode_endpointcounterunique_idsuspendsupported_eventsoom_score_adj_minzone_wplugs_pooldomain_datacopy_file_rangesas_formatAddlFlags2srcu_gp_startreport_zones_cbSAS_HAxa_flagswakeup_preparedtv_nsecmsi_lockmax_zone_append_sectorssas_ss_sizebridge_d3s_inode_list_lockUTASK_SSTEPsas_phy_freeCurrentHostPageSizeehandlerdq_sbexpecting_lun_changescsi_targetRAIDAcceleratorSuccesss_mountssriov_configureSDEV_EVT_MEDIA_CHANGEOperationSDEV_EVT_INQUIRY_CHANGE_REPORTEDBLK_EH_DONEsym_pvclock_pageReplyPostHostIndexpage_fragrun_workfsuidRPM_REQ_AUTOSUSPENDirq_poll_fnrom_attr_enabledsrcversionMPI2_SIMPLE_SGE_UNIONlist_add_tailtrace_event_callwakeup_sourceis_partially_uptodatehost_faileddl_runtimemay_splitio_uring_cmdread_dqblk_raw_spin_unlock_irqrestoretransport_cb_idxpcie_device_locksrcu_parentphy_releasesuppliersfile_operationsblist_flags_tmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotNVMeAbortTOdpc_capis_preparedpgprotval_ttrc_holdout_listWriteSequenceMaxTargetPortConnectTimeasync_suspendq_nodeclass_mutex_intr_is_conditionalstrtabpage_freeftopHPROBE_CONSUMEDi_mmapdirty_paused_whenirq_get___GFP_COMP_BITdriver_managed_dmaSAS_SATA_PMcapacitymax_channelversionbuffer_rel_conditionget_reference_argsllisthiwater_vmUniqueValuemax_perf_statebi_idxfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntrseqtarget_kn_MPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORlimit0limit1pi_blocked_onpid_tvmemmap_shiftusage__kernel_time64_tMPITriggerEntryrq_qos_mutexlink_active_reportingscsi_data_bufferi_securityreply_freedevice_physical_location_panellimitsq_lock_cls_keytransport_cmdsenvpactive_memcg__targetsElf64_Halfallow_reinit_transport_expander_report_manufacturetimer_autosuspendsratelimitSHOST_DELsysdata_softexpirespd_handlesautosuspend_delayi_flctxlist_lockvm_faultoptimistic_spin_queuepermissiontrigger_type_transport_expander_phy_controlflush_listctl_cmdsSASWideMaxQueueDepthreap_refDEVICE_FIXEDlast_statusReservedSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsslice_maxp2pdmaMpi2SasIOUnitPage1_tResponseDatabi_max_vecsthaw_noirqsched_debugfs_dirSAS_PROTOCOL_STP_ALLaccounting_timestamppasid_capserial_numbercan_matchtime_archcmd_sizechunk_sectorshlist_bl_headqc_dqblkpasid_activatedNumTableEntriesProgrammed__fortify_panicbvec_integrity_poolarch_data_oldSAS_SATA_PENDINGio_uring_poll_queueshrink_controlegidenvp_idxcrypto_kobject___GFP_NO_OBJ_EXT_BITattached_device_nametagged_supportedvpd_pgb0vpd_pgb1vpd_pgb2vpd_pgb7folioruntime_autopref_node_forkclassslotsprev_scan_seq_perfput_smid_fast_pathReserved8wait_queue_head_tFAULT_FLAG_INSTRUCTIONuser_nsclass_raw_spinlock_irqsave_is_conditionalsymsphy_reset_problem_flagsErrorResponseAllocationLengthdevcapsyncSAS_SATA_DEVmq_freeze_lockMPI2_ADDRESS_REPLY_DESCRIPTORsg_prot_tablesizepcie_sgl_dma_poold_childrenControlGroupeh_host_reset_handlerNvdataVersionPersistentddebug_class_map__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115__compiletime_assert_116__compiletime_assert_117__compiletime_assert_118__compiletime_assert_119prealloc_bufaudit_contextfl_owner_tipi_listAdditionalControlFlagsWordsSAS_FANOUT_EXPANDER_DEVICE__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126i_pipe__compiletime_assert_128__compiletime_assert_129d_waitllist_headsense_buffernr_phys_segmentscurrent_stateMaxInitiatorswait_page_queuesas_rphyreply_post_freeFAULT_FLAG_REMOTE__compiletime_assert_130dl_bw__compiletime_assert_132__compiletime_assert_133__compiletime_assert_134__compiletime_assert_135__compiletime_assert_136__compiletime_assert_137__compiletime_assert_138pci_device_idi_dir_seqheaderwatchdog_stamplist_op_pendingdatasrcu_cb_mutexsysfs_lockbroken_intx_maskingSimple32no_callbackssaved_trap_nrclock_listfolioq_slotUnitMODULE_STATE_GOINGxattr_handlerring_buffer_szSDEV_EVT_CAPACITY_CHANGE_REPORTEDbuild_sg_scmdsg_cntrqos_debugfs_dirprot_sdbunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_lockfromnextentseventkeytype__kernel_gid32_tdev_pm_domainnentsstart_time_nsuaddr2f_securityprot_oppd_handles_szbridgedefparammanufacture_replydiscard_granularitypcie_sgl_dmaSimple64smp_affinity_enableProductSpecificiotmo_cntclass_raw_spinlock_irq_is_conditional__bi_cntSAS_PHY_RESET_IN_PROGRESSrcuwaitattributes_maskcomponent_iddl_defer_runningmpt3sas_transport_del_phy_from_an_existing_port__refcount_dec_and_testqueuecommandresourcesmaximum_linkrateia_validsrcuiorequest_cntsrcu_size_jiffiesclassespasid_featuresstatic_call_siteis_virtfnHostInterruptStatussubdevicesrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitrchari_verity_info_addr_pkeyrw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countSTARGET_RUNNINGbuild_nvme_prpatomic_openput_smid_default__mptrsigactionrlimmce_addr_transport_sanity_check__q_size_fieldf_freeptr__sighandler_tclass_spinlock_try_is_conditionalzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMEShash_lenmax_target_blockedfs_flagsvm_filei_countuser_struct_transport_get_linkerrorsaddress_space_operationsFAULT_FLAG_USERkey_perm_tTargetAssistSuccessReserved10max_wideport_qdMaxMSIxVectorsHeaderVersiontimer_listrun_delaynum_ftrace_callsiteschange_queue_depthsrcu_cblistvendor_specificblk_independent_access_rangemax_narrowport_qdtlb_ubcpme_supportpgtables_bytesi_lruGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacktrc_ipi_to_cpuPageTypeallow_restartmin_slicecommit_rqsput_smid_scsi_iosysfs_opsinq_periph_qualrequest_lenHCBAddressHighatomic_write_hw_unit_maxcmaj_fltbio_integrity_poolkparam_arraympt3sas_base_hard_reset_handlerFORTIFY_FUNC_strscpypercpu_refevict_inodeignore_media_changedqb_itimeMPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTOR_internal_cmdthread_keyringmap_nrlist_delcpumask_trb_leftgfp_maskdma_addr_tinactive_timersense_dmaattributeinit_hctxmm_lock_seqhotplugFORTIFY_FUNC_memchrkernfs_elem_symlinkBLK_UID_T10_debug_dump_mf__kernel_dev_tcrypt_keyslotPhyFlagsConnectorNamepm_domainfsgidsector_tMPI2_DEFAULT_REPLY_DESCRIPTORrep_manu_request_sys_privatesignal_structactive_mmstate_savedkernfs_iattrsshow_devnamethread_infoPhyInfoi_mmap_writableMPI2_VERSION_STRUCTreadRequestDataLengthsecondarydevicesatomic_write_max_sectorsgroup_exit_codempt3sas_transport_doneFORTIFY_FUNC_memcmpopc1ignore_loginfosREFCOUNT_SUB_UAFreply_queue_listpriv_flagsPciDeviceAndFunctionNumberSMIDclear_retrain_linkexec_maxsync_statedev_groupsDMA_FROM_DEVICEkernfs_elem_dir_transport_add_phypercpu_counter_printkDMA_BIDIRECTIONALsequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startmpt3sas_config_get_sas_device_pg0UTASK_RUNNINGhctx_typeopenseglenoverride_only__compiletime_assert_45FORTIFY_FUNC_memcpy__kernel_ssize_tvdso_imagesi_signounused_hctx_lockrseq_sigresultrefsmpt3sas_base_get_reply_virt_addrdelayed_calltime_slicenr_rangeStructpci_power_tspc_timelimitMPI2_BIOSPAGE2_BOOT_DEVICEblk_mq_req_flags_tresumereset_doneregsbi_write_hintrq_nextsyscall_user_dispatchshort_inquiryattrd_aliasis_suspendedspin_unlock_irqrestorerestore_sigmask__UNIQUE_ID_x_603requeue_lockmmio_enabledphy_srchmpt3sas_transport_update_linksscsi_io_cb_idxkcsan_check_accessevent_workreply_post_free_arraynr_deferredsrcu_sspi_lockuser_event_mmbtrace_seqs_devsiblingcdl_supportedia_rangeldt_usr_semGenericFlags1phy_numberposix_cputimerstry_rc_10_firstRPM_INVALIDdd_datafreeze_kcountrequest_key_authblockspercpu_ref_datad_spc_warnssrcu_supfreeptr_tns_typeRPM_REQ_NONEforce_runtime_start_on_system_startsg_timeoutmaximum_linkrate_hwixolfasyncarg_startkprobes_text_sizeblk_crypto_profilefop_flagsParentDevHandle_addr_lsb_addrpfn_mkwriteuaddrKMALLOC_DMAsas_device_lockioerr_cnt_uids_fs_info__rb_parent_colorWRITE_LIFE_EXTREMEicq_listslave_configuremm_users_pp_mapping_paddebugfs_rootkey_serial_tno_uld_attachfolioqiomapshost_groupssiblingscputimernrpageswake_q_nodeblk_flags_ts_maxbyteshd_geometryioctx_tabledma_io_tlb_memKMALLOC_CGROUPeh_cmd_qFunctionDependent1FunctionDependent2FunctionDependent3FunctionDependent5get_unique_idVP_IDNR_KMALLOC_TYPESexpire_countwake_cpubio_split___GFP_DMA_BITfreeze_superproduct_revtick_dep_maskkey_typecpu_msix_tablepci_busqc_infofault_flaglist_is_headmodnameCurrentBootDevicempt3sas_device_remove_by_sas_addressia_ctimetrace_eval_mapasync_put_workresvnum_static_call_sitesvm_lock_seqFORTIFY_FUNC_strncatPortGroupsDeviceInfoprimarytm_cb_idxmpt3sas_config_set_sas_iounit_pg1Elf64_Addrwait_queue_entry_tseqlock_tlatency_record_countSL_WH_SCSI_TRIGGER_Tnr_integrity_segmentsMPI2_CONFIG_PAGE_HEADERhost_blockedmay_skip_resumeprot_flagsVTIME_SYSalloc_tag_countersbase0base1base2block_cfg_accessSHOST_CREATEDbase_cb_idxbio_setPortNumberalignment_offsetrdpq_array_capablelinksSL_WH_MPI_TRIGGER_Tbasesfutex_staterseq_lenkobj_completioni_spc_timelimitf_opchains_needed_per_ionargscpuhp_onlinemm_mtgid_tdelayed_tr_listrelease_workno_report_opcodesphy_enablefault_reset_work_q_namercu_read_unlock_specialtls_arrayeetlp_prefix_pathtask_io_accountingHCBAddressLowf_raDEVICE_PANEL_FRONTmodule_memorysitesAddresscompat_robust_list_headthread_nodestatic_call_mods_shrink__compiletime_assert_127gp_countnr_sectorsreply_queue_countbpf_raw_eventshi_priorityiommutimer_expiresbpf_storageSAS_SATA_PM_PORTmpt3sas_expander_removekset_uevent_opsf_owner__state_permDEVICE_PANEL_BACKreply_post_free_array_dma_pool_syscallIOCParameterValuediskSHOST_DEL_RECOVERYring_buffer_offsetvolume_wwidhide_drivesmsix_vector_countsrcu_lock_countlink_statetrc_blkd_cpugp_wait__compiletime_assert_131AttachedDevHandleiommu_mmfuncio_uring_taskSAS_LINK_RATE_22_5_GBPSshared_tagspri_reqs_allocRequestedBootDevicejit_keyrings_fsnotify_infodma_handlefunctionSAS_LINK_RATE_12_0_GBPSport_enable_cmdsprojidmce_kill_mema_external_lockpid_linksconv_zones_bitmapscsi_target_idpcie_flags_regs_dio_done_wqbase_add_sg_singleq_sizehlist_headloss_of_dword_sync_countioc_nodethrottle_diskbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACErunningrw_hintblk_integrity_checksumioc_dumpdma_skip_syncpartition_meta_infoDEVICE_VERT_POS_LOWERclass_spinlock_irqsave_is_conditionalutf8datarequeue_workof_node_reuseddyndbg_infoFORTIFY_FUNC_strncpyElf64_Symhtb_relsaved_config_spaceIRVolumeMappingFlagsd_rt_spc_softlimitpollfree_file_infoin_lru_faultsched_contributes_to_loadtlb_genruntime_idleacs_capmap_countDiagRWDatapcie_caphost_scribblei_rt_spc_timelimitqc_type_stateNumPhyss_dentry_lrus_bdevskip_vpd_pagescrcssense_lenRDPQBaseAddressrun_listdiag_buffer_szuevent_opsabort_workmax_cmd_lenMaxChainDepthsched_classutil_avganon_vma_pidsigcntDD_CLASS_TYPE_LEVEL_NAMESmodinfo_attrsst_spaceclass_map_typekparam_stringd_real_typemaxrsscredkernfs_open_nodesas_nodeunmap_outPhysicalPortAttachedPhyIdentifierf_wb_errmm_cid_activekzalloc_noprofmodule_sect_attrsreq_flags_truntime_resumegroup_exec_taskrestrict_linkget_inode_usagekmalloc_typexarray_startphy_setupbpf_ctxpm_domain_dataBASE_READ_REGserver_pick_task__p_size_fieldload_avgcor_error_detectedi_private_lockget_dqblkmq_listphysical_block_sizepgoffporthi_priority_smidtm_tr_cb_idxhandlematch_drivermodelfreeze_lated2_support__list_del_entrycount_objectsvma_numab_statedma_map_opsdq_dirtyREFCOUNT_ADD_NOT_ZERO_OVFmax_lunexit_cmd_privatomic_write_boundary_sectorsEnclosureSlotmax_queue_depthwrite_byteseh_entrypending_eventsoom_reaper_listnumab_stateSDEV_EVT_MODE_PARAMETER_CHANGE_REPORTEDfutex_offsetsubsys_fmt_prefixdq_lockintegritypte_tnr_scanned__statempt3sas_factsmpt3sas_portnr_iosn_io_portslicedrv_groupstrack_queue_depthcustom_slicepci_slot_transport_map_smp_bufferhotplug_user_indicatorsmq_freeze_depthpadding1nestedatomic_write_segments_maxReplyFreeHostIndexsas_port_add_phynr_dirtied_pausequeue_kobjreal_addressbd_holder_dirinvalidate_locknum_exentries_copy_lenfix_capacityio_portblk_mode_tpmdval_thost_tagsetkvecPCIDomainSegmenteh_noresumeset_latency_tolerancedepthDescriptorTypeDependent2d_ino_timerprobenetlink_nsdev_uevent_transport_get_port_id_by_rphydep_mappage_mkwritelast_busyvm_flags_tres_attrnr_failed_migrations_affined_in_lookup_hashptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLERreschedule_countmax_hang_timeexternal_facingcmd_per_lun__dummycdl_enablecutimelockrefsize_addtlb_flush_batched___GFP_HIGH_BITia_uidautogroupsequencercu_syncarg_endclass_spinlock_irq_is_conditional_dummy_pkeyvruntimehostdata___GFP_HARDWALL_BITbus_flagsstart_stop_pwr_condfeatures_locked__kernel_pid_tdevice_blockedMpi2IOUnitPage0_tMajorPIDTYPE_SIDcinblockdma_alignmentprot_type__kernel_loff_tDmaGroupset_performance_stateserial_nodeSAS_PHY_UNUSEDchains_per_smidstate_remove_uevent_sentnotify_counthba_queue_depthHostDiagnosticevent_maskssingle_lunhprobesg_reserved_sizeswap_activatedqb_isoftlimitsaved_auxvnoinstr_text_size_transport_sas_node_find_by_sas_addressdl_overruniattrdetachedloff_tWWIDoom_flag_origindesc_lendma_devfault_reset_workoom_score_adjSHOST_RECOVERYrq_end_io_fnksm_merging_pagesgraph_parse_endpointrmid_sas_nodelist_lrudevice_removablefxsavedev_pagemap_opsbv_offsetset_infoFAULT_FLAG_ALLOW_RETRYhba_port_nextWRITE_LIFE_NOT_SETd_lockrefSCSI_EH_DONEsession_keyringphy_pg1shost_devd_deleted_ino_softlimitd_weak_revalidatealloc_time_nsi_devicesdqb_curspacetm_cmds_MPI2_CONFIG_PAGE_IO_UNIT_0_MPI2_CONFIG_PAGE_IO_UNIT_1alloc_lockearly_initOEMSpecificFlags0OEMSpecificFlags1total_numa_faultswritable_sizemax_segmentsdma_need_drainobj_cgroupem_tablemq_sysfs_init_doneactive_queueshba_mpi_version_belongedMsgVersionpage_size__lstateSelfConfigStatusMPI26_PCIE_ENCAPSULATED_SUCCESS_REPLY_DESCRIPTORinodebd_fsfreeze_mutexhrtimeratomic_write_unit_maxMinormpi_requestFAULT_FLAG_UNSHAREtask_sizemust_resumeRPM_ACTIVEend_codepreempt_notifierstlb_flush_pendingmigration_flagsDEVICE_PANEL_RIGHTpcie_device_listHostTraceBufferFlagspci_drivercap_inheritablekobj_sigvaleh_timeout__stack_chk_failsrcu_n_exp_nodelayseqcount_spinlock_tgraph_get_remote_endpoints_roots__int128 unsignedcpu_countwait_sumuprobe_xol_opsmin_align_masknextevtthis_idrcu_segcblistreported_split_lockpref_windowreturn_instancewait_countconfirm_switchnr_wakeups_affine_attemptspud_ti_ino_warnlimitpreallocProtocolFlagsmax_open_zonesrmtpnext_offsetexpander_change_countacpi_device_idctx_idutaskpoweroff_noirqbroken_cmd_complactive_modesdev_datacb_idxis_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangstm_tr_volume_cb_idxcss_setfwnode_handlegfp_tEEDPTagModetypeqf_fmt_idpageatomic_write_unit_minsleep_startmemalloc_noionext_port_idbegintypetabuse_192_bytes_for_3fnr_reserved_tagsi_crypt_infoDEVICE_HORI_POS_CENTERio_start_time_nsaudit_ttynr_zonesmutex_unlockjobctlsi_errnonr_leaves_on_treequeue_ctxmin_shallow_depthpcie_device_init_list_sigchld__le16HPROBE_STABLEquota_format_typebio_crypt_ctxpercpu_ref_func_tpm_message_tac_memdata_out_dmapprevpending_io_countino_warnlimitbroken_fuaMaxPostedCmdBufferszone_wplugs_lockmnt_flagsac_stimelast_mergememcg_nr_pages_over_highsw_reservedDCRData__le32wbt_flagsproc_dir_entrylink_rateobjcgno_read_disc_infoblock_startvm_area_structnum_gpl_symsdrv_support_bitmapselect_no_atn__compiletime_assert_0__compiletime_assert_1__compiletime_assert_2__compiletime_assert_3PageNumbermap_busphy_reset_problem_countlong long unsigned intWRITE_LIFE_MEDIUM__builtin_memcpyirq_line_enabletmf_in_progressSDEV_CREATED_BLOCKhuge_faulti_fopautasklast_task_numa_placement__le64fortify_memcpy_chk_pcie_devicerefcntfreeze_holdersubordinatecdevperf_eventkernel_ulong_tunregfuncreserved_1reserved_2reserved_3seqcountirqpollget_linkerrorsschedule_dead_ioc_flush_running_cmdsclass_idbitsetsas_idfactsinquiry_mutexof_device_iddisk_statsbusn_resmanage_runtime_start_stopclass_migrate_is_conditionalsriov_get_vf_total_msixclass_write_lock_is_conditionals_xattrpartmpi_replyBLK_EH_RESET_TIMERil_prevd_initmax_slack_shiftget_name_prefixfileattr_get__kmalloc_noprofReplyFrameSizedma_free_coherentprogrammed_min_physical_link_rateclass_groupsSDEV_TRANSPORT_OFFLINE__ret_warn_on__call_single_nodeunicode_mappathrecent_used_cpuruntimeno_64bit_msiold_time32_tmsix_load_balancedev_flagsSASAddressspinlock_check__state_sizeunsigned intsbitmaprequest_dma_szput_smid_hi_priorityclass_irqsave_is_conditionalcore_kallsymsIOCStatussas_port_delete_physcsi_devices_fsnotify_maskis_physfnsas_linkratescan_objectsslotbi_privatedevice_infompt3sas_transport_templateDD_CLASS_TYPE_DISJOINT_BITSevent_liststartupMPI2_BOOT_DEVICE_DEVICE_NAMEkeyring_index_keychain_trackeriov_iterd_rcustatic_key_false___GFP_DIRECT_RECLAIM_BITwake_entryrcu_tasks_holdoutfreezeassoc_array_ptrbatchcacheold_timespec32rcu_blocked_nodejiffies_at_allocphy_to_iocst_namegroup_nodei_mtime_secbus_dma_regionfw_event_lockstatic_rqsmpt3sas_config_get_sas_iounit_pg1starget_sdev_userlegacy_ioac_majfltmce_kflags___GFP_NORETRY_BITFORTIFY_FUNC_memsetrunning_disparity_errorscheduledbus_dma_limitubufbtimePageLengthia_gidltr_pathscsi_device_eventmigrate_foliorq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrmpt3sas_phynext_posix_timer_idmq_opsmax_sata_qd_mapcountstarttimeHCTX_TYPE_DEFAULTreschedule_jiffies__list_delhprobe_statei_sb_listquota_offfault_reset_work_qshm_clistio_uring_poll_queuesptm_rootcb_headzone_wplugs_hash_bitspi_offsetac_flagpt_regsmmap_missexpires_nextIOCMaxChainSegmentSizeblk_opf_treport_zones___GFP_ZERO_BITnum_trace_bprintk_fmtcdrom_device_infoaccess_stateDeviceNamefoundraid_device_locksdev_gendevphy_idwork_structtruelast_queuedri_timerpipe_bufsEnclosureLevelIOCExceptionsbp_offsetkmalloc_cache_typetm_sas_control_cb_idxhba_portsaved_scratch_registertracepoints_ptrsblock_maxstatic_keyqueue_rqsFAULT_FLAG_VMA_LOCKdma_range_mapKOBJ_NS_TYPE_NONE_dataFAULT_FLAG_WRITEshow_optionswait_queue_entryPortp_leni_uidtagset_freedmax_sectorsexpirybmaprescue_workqueuedispatch_wait_lockscsi_levelfsavei_write_hintsuspended_timeread_byteszone_wplugs_worksum_sched_runtimeinternal_depths_writers_keyMpi2SasIoUnitControlReply_tstart_boottimepci_bus_flags_tentriesi_modedata_in_szcap_permitted_flags_2aBLK_UID_NAAstart_codevm_flagssi_codeseqcount_spinlockheadHPROBE_GONEioc_statuslast_siginfodiag_trigger_locksched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorssg_listdevice_dma_parametersdir_contextdma_leniopl_emulSDEV_EVT_POWER_ON_RESET_OCCURREDconsumerspoll_queue_procratelimit_statepower_statedq_flagsis_late_suspendedcapture_controlraw_atomic_fetch_sub_releasebsg_bufferqueue_offsetbsg_job_doneclass_device_is_conditionalnon_rcuput_supershostSCSIIOSuccessdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_stat__kmalloc_large_noprofHighPriorityCreditFAULT_FLAG_INTERRUPTIBLEs_inodes_wbignore_hotplugfolio_queue_MPI2_MPI2_BIOSPAGE2_BOOT_DEVICEinit_fs_contextuprobe_taskf_mappingMPI2_BOOT_DEVICE_ADAPTER_ORDERphy_error_log_replystart_stack__UNIQUE_ID_y_592__UNIQUE_ID_y_596phy_control_replyDL_DEV_PROBINGi_linkidentifiersriovmpi3_version_unionats_enabledstack_vm_aread_hashdl_server_pick_f_MPI2_BOOT_DEVICE_SAS_WWIDrefcount_dec_and_testtty_old_pgrpst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquota_MPI2_ADAPTER_ORDER_AUXNumPerDevEventsorc_entrydma_drain_lenSCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listMaxVolumesutimemmapphy_pg0shrinkeralloc_dquotmax_shutdown_latencymappingdl_defer_armedMpi2IOCInitRDPQArrayEntrysas_expander_listChipNamerunnable_sumatomic_fetch_sub_releaseis_warpdriveshort unsigned inteventsget_rq_budget_tokenFastPathSCSIIOSuccessreply_dma_poolqueue_ramp_up_perioddevice_noderequeue_listscsiio_depthpcie_link_statep_size_fieldAddress64long long intsym_vvar_startenable_cnt_hugetlb_cgroup_rsvdsival_ptrproc_namepercpu_sizeinvalidate_folioMpi2SasPhyPage0_tis_vallocclass_pci_dev_is_conditionaldrop_nsSDEV_EVT_LUN_CHANGE_REPORTEDPUT_SMID_IO_FP_HIPaen_event_read_flagnr_queuesmpt3sas_base_free_smidno_pm_callbackscountproduct_specificd_parentSequenceNumbersched_task_groupupdate_timeioc_coredump_looppidsof_nodefw_event_workrun_nodeMpi2ManufacturingPage0_tchassis_slothide_ir_msg_transport_set_identifydata_sourcesubmit_bio___GFP_UNUSED_BITs_instancesvm_rcubd_start_sectpage_table_locksysv_semquota_infoquota_enable__kernel_timer_tMPI2_ADAPTER_INFOdomain_tagmax_integrity_segmentscmaxrsssas_device_listit_real_incrprobestubextable_lenlast_arrivalwake_indexswap_rwvphy_nextreserveCoreDumpTOSecnegotiated_linkraterunning_disparity_error_countsrcu_gp_seq_needed_expDEVICE_HORI_POS_RIGHTSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOia_mtimenr_thpsvphys_listsysv_shmfopssuppress_bind_attrsinsnlen__page_1__page_2i_mutex_keykey_restrictionquota_writedomainHCTX_MAX_TYPESget_linkfree_folio___GFP_NOFAIL_BITMpi2IOUnitPage1_tsa_flagsno_start_on_addcancelled_write_bytesdispatch_busydiag_bufferRequestedAltBootDevicetask_worksmm_cidatomic_write_hw_max_ddebug_infostats_locknum_kpSTARGET_CREATED_REMOVEshost_gendevMEMORY_DEVICE_PRIVATEirq_managed__bd_flagssuper_blockbi_bvec_donebus_typeget_named_child_nodeassoc_arrayactorkobj_ns_typedeferred_resumesched_shared_tagslong intcore_nodemem_dqinfodevnodesaved_sigmaskBLK_UID_EUI64MEMORY_DEVICE_PCI_P2PDMAdq_offpinsblkcg_mutexis_visibledisk_nameconfig_pagepend_sas_rphy_adduuid_tenclosure_list__kernel_clockid_twritabledqb_bsoftlimitMaxMinLinkRateio_window_1kvfork_donethresh_holdtask_cputime_atomicki_waitqra_pagesmmap_compat_legacy_basedevice_dma_supportedsysfs_dir_lockproduct_idscsi_cmnd_submittermpt3sas_config_get_sas_iounit_pg0ignored_posix_timerslockedsival_intmpt3sas_base_get_smidia_filewakeup_cntrequest_pendingconfig_page_szdl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsclass_read_lock_irqsave_is_conditionalpri_enabledinitiator_port_protocolsblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startvphyratesrobust_list_headunsigned charwake_qrethooksnuma_scan_periodnr_tagswakeup_pathresult_maskFORTIFY_FUNC_memscanscsi_timeout_actionei_funcs__func__MinDevHandletablespipe_inode_inforaw_spinlockEncapsulatedCommandLengthktypecls_mskissue_host_resetmigration_disabledPCIBusNumRPM_REQ_SUSPENDpgprot_ttracepoint_ptr_tenableChainOffsetphysical_locationnum_vfSOFT_RESETnvme_mdtsPIDTYPE_MAXbi_sizeCurrentBootDeviceFormwatcherscrypt_ctxstopwait_maxclass_write_lock_irqsave_is_conditionaliovec_MPI2_VERSION_STRUCTa_flagsd_dnameScsi_Hostnr_migrations_coldmnt_idmap___GFP_FS_BITseeksquotactl_opski_iopriosched_remote_wakeuptag_alloc_policymemcpytracing_graph_pauseread_itersuspend_latefront_pad_transport_phy_resetsdev_devi_rwsembi_integritydriver_nameis_addedexitio_uringeh_device_reset_handlerchild_ns_typediagnostic_flagspci_dev_transport_delete_portBoardNameslave_bdevscommit_dqblkclass_local_lock_irqsave_is_conditionalpcie_sglmark_dirtynr_ctxkernfs_opsoom_reaper_timermodulebd_security_entire_mapcountqueue_lockfast_pathf_pathstatic_call_siteself64_symunlinkcur_bus_speedcpumask_var_trefcount_warn_saturatetime64_tdrivers_diri_gidmap_queuesFORTIFY_FUNC_strnlenrq_qosmark_deadREFCOUNT_DEC_LEAKicq_hintrmdirdq_dqbmemory_failureblkcg_gqdma_flagsSUBMITTED_BY_BLOCK_LAYERmax_hw_sectors_MPI2_SAS_IOUNIT_CONTROL_REPLYselectors_mtdmod_kallsymss_typeremount_fsbd_holderdelayed_sc_listtask_delay_infopi_sesubsystem_vendorin_useSAS_PHY_DISABLEDrq_countMIGRATE_SYNC_LIGHTerrseq_ttransparentkstatfsreply_payload_rcv_lenid_tablemems_allowed_seqSDEV_EVT_LASTmax_user_discard_sectorsWhoInittarget_allocsas_function_templatebug_listhigh_iops_queuesvirtual_phymax_nr_cidmod_arch_specificHCTX_TYPE_READmpt3sas_get_vphy_by_phyDMA_NONEtransfersizesharebpf_net_contextis_msi_managedftrace_timestampbi_ioprioexpander_pg1d_ino_warnskernfs_elem_attrreset_preparei_ctime_nsecfw_events_cleanupi_private_listbinfmtftrace_sleeptimei_stateno_d3coldSCSITriggerEntrybv_pagepcpu_cidsupported_speedssched_migratedchildMPI2DefaultReply_tdup_xol_addrdevice_configurepci_error_handlersPROBE_PREFER_ASYNCHRONOUSrcu_node_entryno_vf_scanreverse_orderingfile_system_typeorig_ret_vaddrmmu_notifier_subscriptionsdefault_groups__sifieldsMSIxIndexnr_watchesDL_DEV_DRIVER_BOUNDAdapterOrdersmidcurr_ret_depthstarved_entryMpi26NVMeEncapsulatedRequest_t__fillerdestroy_dquot__task_fpstatefilldir_tget_reserved_spaceremote_identifyioprioKMALLOC_NORMALcreatedirtied_time_whenstart_scan_seqperf_rdpmc_allowedsym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerbd_openersdq_inuseclass_maskofflinedev_pm_infomremapin_memstallhost_self_blockedtph_enabledpoweroff_latei_nlinkwakeupcb_list___GFP_IO_BITcpu_idpushable_tasksdriver_overrideprev_fw_factstty_audit_bufmaxlenkernel_cap_tptm_enabled__be16bpf_funcmems_allowedreply_free_dmaSAS_LINK_RATE_G1SAS_LINK_RATE_G2s_inode_lrucached_rqsd1_supportinternal_dmammap_compat_baseprepareconfig_cb_idxDiscoveryInfoclock_op_might_sleepf_sb_errneed_mbd_namempt3sas_get_port_by_idcheck_flagsi_sequencert_priorityrequest_szkretprobe_instancescrypto_profile__be32iov_basecpus_ptrq_lockdep_maploadfuncscpu_bitmap_MPI2_SAS_IOUNIT_CONTROL_REQUESTpci_error_recoverySTARGET_DELatomic_write_lensaved_tfHCTX_TYPE_POLLcfg_sizexa_headdetachSAS_PROTOCOL_SATAremove_hostproperty_read_string_arrayget_statetracepoint_funcd_seqRequestDescriptorPostLownuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmtExtPageTypeblkg_listnum_symtabexec_update_lockfscrypt_inode_infosplice_readneed_qsctx_mapbd_disknumberszone_wplugs_wqsas_rphy_addWRITE_LIFE_SHORTsigpendingpi_entrys_inodesdirtied_when_MPI2_CONFIG_PAGE_SASIOUNIT_0_MPI2_CONFIG_PAGE_SASIOUNIT_1MIGRATE_ASYNCnext_scangsindexcompletehard_resetwatch_listeh_abort_listd_sibmodule_attributemax_host_blockedslot_resetneed_tsin_dpm_listdevice_namewordwork__list_add_valid_or_reportDescriptorTypeDependent1multiprocessquiesce_depthclass_task_lock_is_conditionalvphys_masktask_groupf_pos_lockshpc_managednum_physrdpq_array_enable_assignedbio_pooltimeout_workwrite_endsrcu_barrier_completionpacctblk_mq_tag_setcurr_targetreset_typevm_page_protbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatperf_event_contextatomic64_tnoinstr_text_startHRTIMER_RESTARTmpt3sas_get_sdev_by_addrrpm_autosuspend_delayis_thunderboltSlotbusystack_canaryreply_post_free_dma_poolnon_operational_loopmax_write_zeroes_sectorsHwLinkRate_utimetmf_work_q__fortify_sizeMPI2_IEEE_SGE_SIMPLE_UNION_flags_1_flags_2taskstatsposix_acli_dio_countSL_WH_EVENT_TRIGGER_Tarch_rwlock_taddend1addend2driversas_device_freesym_timens_pagewaitersoffsetprot_guard_typedev_iommusmp_frame_typemap_typeclass_rwsem_read_intr_is_conditionalsg_copy_to_buffercompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_usersDiagRWAddressHighSDEV_BLOCKbacking_dev_infoi_mappingctl_cb_idxIOCCapabilitiesdiscard_alignmentbsg_deviceshow_stats_ress_vfs_rename_keysubmitteretypei_bytes___GFP_WRITE_BITnormal_prioSDEV_CREATEDshost_datadispatch_waitsrcu_nodeconfig_rrs_svlast_mm_cidchain_pages_MPI26_NVME_ENCAPSULATED_REQUESTis_busmastervaddrscsi_vpderr_handleris_softnext_cpugrab_current_nspci_access_mutexminimum_linkrate_hwclass_namesMaxReplyDescriptorPostQueueDepthlock_class_keysum_exec_runtimecompatiblesetupdev_pin_infoinvalid_dword_countpoll_table_structmce_whole_pageia_modercu_tasks_holdout_listsas_phy_addsched_rt_mutexLookupMethods_pinsnon_seqfifo_timehctx_listrenamemajorktime_tPRJQUOTAprogrammed_max_physical_link_ratekprobe_blacklistjump_entriesdio_offset_alignsas_port_deletereserved_tagsdma_masksa_restorerqueuelistdatalenmkdirio_missing_delaynextrelax_countrestore_earlyPIDTYPE_TGIDilenMaxPersistentEntriesmax_active_zonesdevice_physical_location_horizontal_position__list_add_MPI2_SGE_SIMPLE_UNIONkobj_uevent_env___GFP_MOVABLE_BITkprobes_text_startSDEV_EVT_ALUA_STATE_CHANGE_REPORTEDDiagRWAddressLowpid_typestargetfown_structi_default_aclfregs_statephy_identifiershift__devicesFORTIFY_FUNC_strcpypendingfirmware_event_threadIODeviceMissingDelayioc_pg8dma_boundarybd_nr_sectors_MPI2_CONFIG_PAGE_MAN_0SAS_LINK_RATE_6_0_GBPSnr_eventsconfig_page_dmakstatanon_vma_nameSGLFlagsdq_hash_MPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTOR__iovgp_stategrphintabiommu_mm_dataMpi2SasPhyPage1_tzone_wplugs_err_listma_flagsarch_uprobebio_issueDL_DEV_UNBINDINGKMALLOC_RANDOM_ENDbroadcast_aen_busyport_numrefcountmmap_locksrcu_reader_flavorinternal_free_listtimerqueue_nodereal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_alloweduse_16_for_syncrt_mutex_waiter_src_charsReportDeviceMissingDelayset_phy_speedSAS_PROTOCOL_ALLmmio_always_onlegacy_mempage_pooldq_dqb_lockdiag_trigger_eventf_flagsblk_qc_tshow_infoslave_allocflush_requiredsg_tableattributesblk_queue_statssas_port_alloc_numgrplokgid_terror_detectedkey_userpci_channel_state_treadlinkoffline_disabledd_comparei_wb_frn_winnerqspinlock__compiletime_assert_451sighand_structsas_hbastart_brkSenseKeydio_completeshost_statelocked_pendingbase_readls_idcore_statereply_dmaalignsym_int80_landing_padcurrent_eventscsih_cmdsngroupspme_pollsp_offset__sigrestore_tRPM_SUSPENDEDvolnameDMA_TO_DEVICEmutexattrsbi_sectoreh_deadlinefsbasesrcu_barrier_mutex_keyswregs_state__kernel_timespeceh_should_retry_cmdhpr_lookupioc_reset_in_progress_lockd_lrud_fieldmaskcountersfaults_disabled_mappingnameidatapoweroffuntrustedminorselemsizerlim_curFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagdebugfs_entrywait__list_add_validshow_rqMpi2ExpanderPage1_tcan_queuefw_event_listst_shndxreservedSL_WH_SCSI_TRIGGERS_Ti_wb_frn_historyctxsprocess_keyringset_dqblkis_backlinkrestart_blocks_opbi_end_iokobjectposix_cputimer_baseleveluser_definedpcie_target_idcow_page__warn_printkmsix_indexnanosleepfalsepi_state_listtv_secac_exitcodeLookupAddresssuidKMALLOC_RANDOM_STARTmutex_lock_interruptibleMsgLengthdismissi_hashmm_cid_next_scan_transport_delete_phyenable_sdev_max_qdfreeze_noirqoublockia_atime_timerhotplug_slotrespondingvm_private_dataskip_ms_page_8TargetCommandBuffermask_interruptsdq_freeSHOST_RUNNINGrootgot_task_abort_from_ioctlpolicycpu_baseraid_device_listMPI2_ADAPTER_ORDER_AUXsize_mulcap_bsetnr_itemschain_offsetseq_startaddr_outbp_regbvec_poolrb_root_cachedwwidi_blkbitswritervm_pgoffMPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTOR_refcountcsum_typebin_attributemath_emu_infopushable_dl_tasksValidEntriestestmanu_pg0sched_infogroup_infotailsport_typeeh_eflagsdqi_fmt_idDataLengthdevice_missing_delaysoftirq_next_timerrevisionis_child_subreapersg_tablesizeexit_codefile_lock_contextwriteback_index_MPI2_SMP_PASSTHROUGH_REPLYfiemap_extent_infofilemempool_free_tProductIDrt_spc_warnlimitcmndatomic_write_hw_unit_mintimer__empty_rangessbq_wait_statedev_namei387__p_sizeMpi2ConfigReply_terror_stated3hot_delaywb_errbudget_tokenhba_vphy_transport_get_expander_phy_error_logwrite_dquotf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachestorebi_bdevst_infodispatchdescsquiesced_bydqi_max_ino_limitllseek_MPI2_CONFIG_PAGE_HEADERlocal_fwnodeRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleno_d1d2get_projidbuild_sg_mpidma_len_in__sectorpart0sas_expander_alloccnvcswmsix_basecallskqidmem_cgroupfree_inodesiglockwait_queue_func_tperf_recursionnr_wakeups_remoted_spacei_ctime_secinvalid_dworddebugfs_idnext_timer_typeTT_NATIVEhlist_bl_nodenum_descs_head_1_head_2clockid__read_overflow2_fieldFREEZE_MAY_NESTsym_hvclock_pageremap_file_rangemmap_legacy_baseend_dataxa_lockfutex_exit_mutexuse_16_for_rwiommu_groupmempool_alloc_tdevice_get_dma_attrtarget_blockedMpi2BiosPage2_talloc_inodepayloaddirty_foliofscrypt_keyringActionis_hardasync_sizetrap_nrf_iocb_flagsnvme_abort_timeout__flagsmultifunctiontotal_vmiteratoruse_32bit_dmalastpool_dataqf_opsforce_atomicskip_bus_pmreal_credno_difblkcnt_td_rt_spacempt3sas_transport_port_removesigned charpcie_cap_lockhas_child_subreapermountreply_post_free_dmablk_flush_queueres_attr_wcsched_entitydev_links_infos_uuid_len___GFP_RETRY_MAYFAIL_BITdqi_privINIT_LIST_HEADIOCRequestFrameSizefmode_trpm_autosuspendsweventremove_busresponse_lengthphy_indexactivatefxregs_stateSAS_SATA_SPINUP_HOLD_lowerreply_szidentifypaddingDEVICE_REMOVABLEVF_IDtimer_rand_statellist_nodeNVMe_Commandbpf_run_ctxbio_slabDCRAddressstate_add_uevent_sentenv_startmodule_notes_attrsio_cqControlFlagsrangebvecacct_vm_mem1on_cpumanage_system_start_stopstringSHOST_CANCEL_RECOVERYnuma_preferred_nidfree_diskvmem_altmapchain_buffer_dmabiotailwait_start_MPI2_ADAPTER_INFOelevatorspinlocksrcu_barrier_seqi_aclptm_granularitytrigger_info_dwordsnofaultia_rangesq_size_fieldHostTraceBufferDecrementSizeKBis_reltablepteval_t_MPI2_IEEE_SGE_SIMPLE32AccessStatusblk_mq_tagsDEVICE_PANEL_LEFTorc_unwind_ipdiag_buffer_statustm_custom_handlingrel_deadlinekobj_typeskip_settle_delayphy_control_requestsb_writersdma_cleanupeh_timed_outdriver_dataLossDwordSynchCountis_iouring_poll_qphys_addr_tdma_iommumax_idirq_saferescue_lockdefault_timer_slack_nsxregs_states_statecompletion_cnt_deferred_listcurr_nrset_child_tidbio_vecacpi_match_tablenfdsrlimit_MPI2_IEEE_SGE_SIMPLE64MPI2_SAS_IO_UNIT0_PHY_DATA__list_del_entry_valid_or_reportidle_notificationmodule_stateMPT_BUILD_SG_SCMDwait_lockf_pipegetgeowrite_iterMaxDevHandleD_REAL_DATAEventValueacct_timexpdclock_mutexchain_segment_sznr_failed_migrations_runninguserfaultfd_ctxevent_flagsthread_structoldpmanufacture_requestmm_context_treply_lenenclosure_handlebd_stampdio_mem_aligncstimereplyMPI2_CONFIG_EXTENDED_PAGE_HEADERprot_capabilitiesatomic_long_trpm_requestirq_reroute_variantpci_sriovMQ_RQ_COMPLETEio_comp_batchRunningDisparityErrorCounthi_priority_dmadma_alloc_attrsf_credtrace_eventsd_iputReqBootDeviceFormMPI2_VERSION_UNIONnr_wakeups_syncstackExpanderDevHandleblockedallowedmce_countweightblk_plugtrc_reader_nestingfpstatetag_setis_roxno_scsi2_lun_in_cdbprevseqcount_raw_spinlock_MPI2_SIMPLE_SGE_UNIONinstrument_atomic_read_writebios_paramnum_orcsFORTIFY_FUNC_kmemdupDevHandlebuflensas_rphy_freeWRITE_LIFE_LONGari_enabledexpiry_activeeh_bus_reset_handlermtd_infoenclosure_levelis_confidentialreset_in_progress_mutexi_dentryfixupspcie_sg_lookupvm_endvm_structsas_port_transport_phy_enablememcgfsync_MPI2_IOC_INIT_RDPQ_ARRAY_ENTRYsgidcompat_robust_listnuma_workprioprivvalueReplyFlagsreply_qcurrent_stack_pointerac_minflt_hugetlb_cgroupset_policyinternal_tagthreadftrace_callsitesmmlistconfig_vaddrpage_typeclass_spinlock_is_conditionalusermynodeseq_stopblk_traceactiondiscovery_activepi_waitersdoe_mbshi_priority_depthatomic_tpcp_listdiag_trigger_masterqueue_flagsMPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTORrb_rootExtPageLengthsubsystem_devicesas_phyutf8data_tablecpu_msix_table_szscsi_is_host_deviceSAS_LINK_RATE_FAILEDexe_filePUT_SMID_DEFAULTWorduid_telementshpr_free_listd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_dataPortTypedef_flagssrcu_n_lock_retriesraw_locksrcu_structis_guestio_minmpt3sas_transport_add_host_physplice_eofs_sync_lockanon_vma_chaini_mtime_nsecrseq_event_maskem_pdi_fsnotify_maskshared_pending__int128__mce_reservedwriteback_controlmm_structPhyIdentifier__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEreset_timeoutbuild_ids_export_opMPT_ADD_SGElen_descseg_boundary_maskanon_namesched_dl_entitypp_ref_countactivest_otherstartparentlookupkernel_siginfostart_scan_sigpoll__compiletime_assert_109SDEV_CANCELkill_sbMaxTargets__bi_remainingnum_bugsnr_requestssecurity_supportedadapter_reply_queuerequest_data_szstate_entry_ptrmpt3sas_base_get_msg_framestatsactive_baseschain_depthDEV_DMA_COHERENTswap_slot_free_notifyunsafe_warnconfig_cmdsmpt3sas_base_get_smid_hprstart_databoolbv_len___GFP_RECLAIMABLE_BITinquirymodsctimedestroy_inodedata_out_buf_ptr__init_waitqueue_headfutex_pi_statehbas_to_enumerateSL_WH_EVENT_TRIGGERS_TBoardTracerNumber__compiletime_assert_127i_mutex_dir_keyrescue_workrestartsASCQdevice_physical_location_vertical_positionget_aclset_aclrdpq_array_enablesas_targets_voppercpuLengthpci_dynidsdescpoll_bioiterate_sharedsym_vdso32_sigreturn_landing_padcma_areafeaturesrcu_tasks_exit_cpumigrate_from_cpubd_size_lockwriteerror_codebuddy_listldt_structcred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_nameVTIME_INACTIVEeh_target_reset_handlerclass_preempt_is_conditionaltimeoutSecondaryReferenceTaguring_cmdshrinker_idnr_dirtiedgetattrsetattrPageVersionfixupblockMQ_RQ_IDLEdevtlast_cpuprocdirnr_wakeups_localuidhash_nodeworker_privatepoll_eventlinelinkbi_poolphysfnbi_cookiePageAddressmodeMpi2IOUnitPage3_tsegment_id___GFP_NOWARN_BITport_table_listmpi_tg_sas_nodeEnclosureLogicalIDnode_idtargetget_nextdqblkmpt3_ioctl_commandrcu_tasks_idx__ret_do_oncejournal_infobi_inline_vecstqheadlast_used_atrq_end_io_retsensehres_activemod_namenotes_attrsdelay_workblock_device_operationsoffset_ctxbi_blkgFREEZE_HOLDER_KERNELarch_test_bit_ctl_diag_capabilitylast_switch_timerphywakeup_countwait_indexrunnable_weighthostdiag_unlock_mutextarget_busyclass_releaselast_sum_exec_runtimedd_key_truesa_handlercg_listscsi_transport_templatelocked_vmqueue_rqaddressmq_hctxDefaultstart_timezone_wplugs_hashcookielistRequestCreditreply_free_dma_poolsig_okextabledma_data_directioni_sizeentry_eipsplice_pipexstate_headerinquiry_lenblock_exponentdma_addrAddressReplyem_perf_domaind_flagsctl_gen2_fops___GFP_HIGHMEM_BIT_large_mapcountpid_namespaceliveclock_was_set_seqspc_warnlimitseqcount_t_MPI2_ADDRESS_REPLY_DESCRIPTORmin_fltblock_devicencq_prio_enableMEMORY_DEVICE_GENERICpkruprojid_tvendordma_lengthkey_payloadadd_linkspinnedsubsys_datause_10_for_msdev_attr_version_product_dummy_bndrefcount_saturation_typempt3sas_ioc_listsaved_stateparent_exec_idutil_sumdd_key_falsesigvalfsnotify_mark_connector__ubuf_iovecsize_is_constantcputime_atomicdeadlinereset_methodsbio_integrity_payloaddev_attr_host_trace_buffer_enablelun_in_cdbexit_requestwait_queue_upperclass_write_lock_irq_is_conditionalswap_readahead_infovtimeexpecting_cc_uas_rootstack_refcountgrpmaskdevice_attributepm_caps_remove_countlru_genwrite_newuser_namespaceclass_rwsem_write_is_conditionalpids_active_resethlist_nodeblk_features_tsuper_operationsautosleep_enabledwrite_file_infoload_sumresourceaddress_spacecpus_maskdl_yieldedstarget_datafile_dispread_newd_spc_softlimituse_10_for_rw_MPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTORkrefSecondaryApplicationTagrseq_css_lock_keybuild_zero_len_sge_mpidqi_flagspdevmq_ctxjump_entrypi_top_taskDoorbellgen2_ctl_devpacct_structRPM_REQ_RESUMEMpi2SmpPassthroughRequest_treq_boot_deviceuser_sizeis_aero_iocmpt3sas_wait_for_iocats_caplast_queue_ramp_upioc_reset_count_showbd_statsMpi2SystemInterfaceRegs_tshow_fdinfoFAULT_FLAG_MKWRITEput_budgetfadviseclass_read_lock_irq_is_conditional_MPI2_SMP_PASSTHROUGH_REQUESTlinenoMODULE_STATE_LIVEtask_listmpt3sas_raid_device_find_by_handleasync_scanFAULT_FLAG_RETRY_NOWAIT_qprocread_foliosc_data_directionhas_elevatordq_countvpd_pg0nlinksignalshutdown_latencynr_wakeups_passiveself_exec_idstate_syncedws_activef_epsriov_set_msix_vec_count__this_modulercu_specialscsi_device_handlerentrybacksda_is_staticd3cold_allowedcntsrequest_trackersock___GFP_THISNODE_BITdev_attr_sas_device_handlesdev_bflagsdispatch_fromdqio_semis_driver_loadingmq_freeze_wqtotal_buffer_sizestart_prevent_timepgd_tchain_lookupsigset_tMpi2EventNotificationReply_tbucket_idadapter_typeSL_WH_MASTER_TRIGGER_TMpi2BiosPage3_tgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64__real_strlcati_inoserver_has_tasks_killi_spc_warnlimitbuild_zero_len_sgeunderflowf_posperformancesoftowner_trapnoload_weightio_windowsymlinkclass_rwsem_write_try_is_conditionalkmalloc_noprofbd_queuein_iowaitDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclbdi_writebackrb_leftmostbug_addr_dispmigration_pendingscan_mutexhosttd_realMaxSasExpandersdevice_get_match_datahdr_types_max_linksthis_devicescatterlistthread_headdata_in_dmaacquire_dquotclockid_ttarget_destroyzone_capacityFORTIFY_FUNC_strlen_MPI2_VERSION_UNIONsas_ncq_prio_supported_showpref_64_windowpgdval_td_manageshost_recoveryNumberOfPortsSAS_SATA_PORT_SELECTORmfg_pg10_hide_flagmax_device_blockedback_padMIGRATE_SYNCdiag_trigger_activewcharRQ_END_IO_FREEHCBSizeseq_fileulongrestoresge_sizeHPROBE_LEASEDBoardAssemblyHostInterruptMaskthaw_superis_managedalt_len_MPI2_DEFAULT_REPLY_DESCRIPTORseq_operationsfallocate__ret_call_addrfree_chain_list_MPI2_BOOT_DEVICE_DEVICE_NAMEi_mmap_rwsemBidirectionalTransferCountundo_listis_probedattribute_groupdma_poolspersonalityprintk_index_sizeMPI2_BOOT_DEVICE_SAS_WWIDmsix_enablestripe_szuprobe_task_statestimestatic_priotmpfiledata_indqi_formatnvcswio_delay_show_nr_pages_mappedfrequency__compiletime_assert_39fa_fddev_pm_ops__refcount_sub_and_test__kmalloc_indexirq_poll_scheduledalloc_hintsense_dma_poolblk_mq_ctxno_updateiter_type__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_44DEVICE_PANEL_BOTTOM__compiletime_assert_46__compiletime_assert_47__compiletime_assert_48__compiletime_assert_49mpt3sas_send_diag_releasetransporttreply_post_host_index__compiletime_assert_50__compiletime_assert_51__compiletime_assert_52__compiletime_assert_53__compiletime_assert_54__compiletime_assert_55__compiletime_assert_56__compiletime_assert_57__compiletime_assert_58nr_wakeupssense_data_ptrenabledki_filpmultiple_queueswork_func_tpp_magicfpu_state_permGenericFlags0bars__compiletime_assert_69fwnode_reference_argsdevres_headbus_listdpc_rp_extensionsscsih_cb_idxioc_stateRPM_REQ_IDLEfilenamebase__compiletime_assert_70__compiletime_assert_71__compiletime_assert_72__compiletime_assert_73__compiletime_assert_74__compiletime_assert_75__compiletime_assert_76__compiletime_assert_77d_prune__compiletime_assert_79restore_noirq_MPI2_SYSTEM_INTERFACE_REGSsysfs_registered__kmalloc_large_noprofrlocksas_node_locki_rt_spc_warnlimitqueuedevice_remove_in_progressstrcat__compiletime_assert_81__compiletime_assert_82__compiletime_assert_83__compiletime_assert_84__compiletime_assert_85__compiletime_assert_86__compiletime_assert_87__compiletime_assert_88__compiletime_assert_89bytesnuma_migrate_retryvmd_devMEMORY_DEVICE_COHERENTenclavefilterroot_blkgd_revalidate__compiletime_assert_90__compiletime_assert_91__compiletime_assert_92__compiletime_assert_93__compiletime_assert_94__compiletime_assert_95__compiletime_assert_96__compiletime_assert_97__compiletime_assert_98_MPI2_IEEE_SGE_CHAIN_UNIONtracepoints_incoredqsMPI2_SGE_IO_UNIONi_opreplyPostRegisterIndexquota_syncsrcu_have_cbsasync_in_progresssignumdqi_dirty_listpi_locktimespec64scan_finishedcpu_addrmpt3_ioctl_diag_resetnr_forced_migrationsumount_begin_MPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTORchannelbadblocksblocking_handlesport_idkernfs_node_MPI2_DEFAULT_REPLYcpumaskptrace_messagelength_boot_devicetag_listbio_alloc_cachepdt_1f_for_no_luni_wb_frn_avg_time_pincountreclaim_statedrv_internal_flagsruntime_errori_sb__poll_tsubvolon_dispatchdirty_inodesymtabd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structfs_parameter_specrcu_data0real_blockedruntime_suspend_MPI2_BOOT_DEVICE_ENCLOSURE_SLOT__s16sas_identifybacktraceoffline_alreadys_umountHostTraceBufferMaxSizeKBon_listNvdataVersionDefaultIOCLogInfo_MPI2_CONFIG_PAGE_IOC_1_MPI2_CONFIG_PAGE_IOC_8data_vmneeds_force_resumeblk_eh_timer_returnFunctionsas_device_init_listrpm_statusCoalescingDepthscsi_host_state__s32logging_level_storep_sizechildrencheck_eventsdqi_bgracei_wbhost_nof_inodeResponseInfoserialburstdiag_trigger_master_showaer_capnvme_error_replyscsi_target_statehostmsi_device_datamaskslave_destroykallsymsi_ino_timelimitbi_issuebd_holder_opsphy_masksas_device_putsrcu_idxSTARGET_CREATEDutil_est__s64hugetlb_usagesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenrel_queryacct_rss_mem1___orig_eipsrcu_datadevice_physical_locationchains_per_prp_buffer__keycgtimepagefault_disabledindexEEDPObservedAppTagMpi2ManufacturingPage10_ts_time_maxdelayed_workopen_partitionssa_maskmmappedMPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORElf64_Wordactive_timeatomic_flagscallernum_jump_entriesextra_lenPassthroughFlagsPIDTYPE_PGIDelemend_ioquotalensrcu_data_have_cbsnivcsw_tidioc_pg1_copyBufferAddressmce_vaddrstrcpydl_dev_stateshowrb_subtree_lasts_listadd_busunique_idmq_pollnr_segssame_target_siblingsof_match_table_entry_ctl_eventenableino_timelimitparent_devSDEV_EVT_SOFT_THRESHOLD_REACHED_REPORTEDalternative_gpt_sectori_readcountblkcg_polsincrfreepasid_enabledmpt3sas_base_validate_event_typelock_countthrotl_datareply_dma_max_address_sas_devicelist_lru_onei_pagesmxcsrconfigured_lunrom_bar_overlapclass_rcu_is_conditionalarchdataptrace_entrydata_out_szguest_permwait_queue_headnum_srcu_structsnr_activeprev_sum_exec_runtimedev_attr_version_fwi_flagsgendisku_flagspci_informationtag_set_listlogical_block_sizeSDEV_EVT_MAXBITSinvalidate_lock_keyinfol1d_flush_killbuffer_typeMPI2_IEEE_SGE_SIMPLE64write_beginSHOST_CANCEL__copy_overflowwrite_infohrtimer_restarts_encoding_flagssessionidd3cold_delays_time_minvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrs_stack_depthFlags__vm_flagssdev_statequeue_depthinternal__compiletime_assert_607__dummy2pm_messagefred_cschangedcur_ktimeinit__compiletime_assert_610__compiletime_assert_613fop_flags_t__compiletime_assert_616groupsoffstty_structnotify_nextpoll_waitvirtual_dr6dma_opsreset_wqResponseCodedma_addressmmap_basebd_devsyscall_workinit_cmd_privlockdep_mapnum_trace_evals_addr_bnddata_in_sizeset_dbd_for_msnumberzone_device_dataquota_readsas_ata_ncq_prio_supportedpinned_vmreventswritepagesnuma_faults_localityqrwlock__write_overflow_fieldrw_semaphorefirst_minori_blockstask_fragTimeSyncIntervalsource_listsum_block_runtimepci_idHostTraceBufferMinSizeKBioc_reset_countnuma_scan_period_maxtotal_timepowerrequest_queuenum_ei_funcsi_generationSAS_LINK_RATE_3_0_GBPSflushonline_ctl_enable_diag_sbr_reloadno_vpd_sizeformatlast_switch_count_MPI2_SGE_SIMPLE64sge_size_ieeelast_wakeeswapuint32_tssize_tphy_belongs_to_portRQ_END_IO_NONEvtime_statepci_ers_result_ttry_vpd_pages__ret_conds_blocksize_ctl_pollqueue_numfwfault_debug_storeprevent_sleep_timeclass_spinlock_irqsave_try_is_conditionals_readonly_remountcheck_object_sizei_io_list_copy_from_userchild_countpcie_bwctrl_dataVTIME_IDLEcompat_uptr_treply_dma_min_addressDEVICE_HORI_POS_LEFT_hugetlb_subpoolend_pfnpci_domain_nruclamptgidlimits_lockreleasenr_wakeups_migratestack_vmi_fieldmaskupidinsntrace_evalsia_vfsuidquota_format_opsprocentdev_attr_diag_trigger_eventi_datarescue_listfsverity_infocore_threadclosidreserved2sched_avgcodearch_atomic_fetch_addlogging_level_showsyscore__i_nlinkpmd_tScratchpadsrcu_barrier_cpu_cntreadaheadopt_sectorshrtimer_cpu_baseirq_domainwait_liststatic_call_trampfsverity_operationsreply_post_queue_depthcoublockbug_tablemigrate_mode_ctl_ioctl_mainevent_tgusing_gplonly_symbolsremovedhandleremulatedsym_vvar_pagemembarrier_statedma_pad_masksas_addressbin_sizeFORTIFY_FUNC_strlcatrcu_read_lock_nestingMpiSimpleCoalescingTimeoutrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_tio_bitmapdev_attr_sas_addressDEVICE_VERT_POS_CENTERsbitmap_wordlong unsigned intmax_timelast_queue_full_countread_file_infoexec_startia_sizeBidirectionalDataLengthio_queue_numRPM_RESUMINGMODULE_STATE_COMINGsym___kernel_sigreturninit_completionFWVersiondma_alloc_coherentuser_cpus_ptrd_opstate_initializedpend_os_device_add_szhost_trace_buffer_showrelease_dquotplugsoftirq_activatedresid_leninv_weight_raw_spin_lock_irqsavesecurityMpiChainGlobalFlagskernel_symboldl_timerlockdep_map_pmodule_param_attrsno_read_capacity_16scsi_host_template__user_state_sizechainedVTIME_GUESTretriessdtrsysvsemdisconnectstashedpasid_no_tlpuser_xfeatures__kmalloc_cache_noprofuse_memdelayMPT_BUILD_SGnr_cached_objectshas_timeouttime_sync_intervalcommcallback_headexception_table_entryin_hrtirqdelayed_event_ack_list_overruncondDEV_DMA_NON_COHERENTcoredumpd_sbio_lock_cls_keyksetno_msisleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsnodesysvshmno_highmemdata_outREFCOUNT_ADD_UAFmisc_registertrace_buff_sizefirstport_enable_cb_idxactive_countnr_active_requests_shared_tagsnum_tracepointsiocppueventsharednext_cpu_batchdisk_eventss_sysfs_namesigval_tcombined_reply_index_countSDEV_QUIESCEbitsbase_pfndevice_handleclass_mutex_try_is_conditionalresource_size_tsem_undo_listcompat_rmtpdev_attr_ioc_reset_countclass_local_lock_is_conditionaldiag_trigger_mpistatic_key_truescsiio_reply_stimeEEDPObservedRefTagAdapterOrderAuxperf_event_ctxpfwfault_debugcostxcomp_bvio_contextmsix_enabledPIDTYPE_PIDwakee_flipsscsilun_to_intvlagufdssegment_boundary_maskioctlprev_cputimesaved_cap_spacereply_frame_buf_ptrhorizontal_positionem_perf_tablebi_crypt_contextSAS_PROTOCOL_NONEprivateswp_entry_tcharmatchErrorResponseCountnr_failed_migrations_hotreg_offsetAddress32queue_stoppedFORTIFY_FUNC_UNKNOWNbin_attrscpu_itimerMPT3SAS_FLUSH_RUNNING_CMDSPrimitivedevres_lockfiles_structdev_attr_version_nvdata_default__ret_onceblk_zoneSDEV_RUNNINGicq_treevfsuid_tf_lockexec_vmkernel_paramvertical_positionshutdown_prerelease_foliobi_io_vecpri_capget_msix_index_for_smliovendor_idmtimearchrobust_listasync_probe_requestedthaw_earlySAS_EDGE_EXPANDER_DEVICEvectors_securitysplice_writeport_enable_failedversion_product_showparam_lockreq_listi_opflagsdentry_operationsstats_sectorss_blocksize_bitskfreeaccess_statusenclosure_logical_idexp_hintclass_srcu_is_conditionalbits_to_registerprealloc_mutexbpf_raw_event_mapdevice_remove_in_progress_szstrnlenpfacts_head_2asym___kernel_vsyscallopen_mutexwake_batchimm_readyfortify_funcacpi_device_MPI2_SCSI_TASK_MANAGE_REQUEST_ctl_getiocinfoget_timeki_flagss_inode_wblist_lockioc_link_reset_in_progresspermchain_bufferdestroy_worklockableuprobes_statemm_counttrace_overrunargsargvdiag_trigger_scsiuclamp_reqswap_info_structdynidss_qcopblk_mq_queue_mapchip__kernel_long_tdev_attr_diag_trigger_scsisrcu_usagefaultableMPT3SAS_ADAPTERMPT_BUILD_ZERO_LEN_SGEexit_hctxdev_attr_board_namein_execve__builtin_strlenEEDPObservedGuardGPIOValrlim_maxversion_mpi_showsimple_tagsSlotNumbertarget_listmutex_lockcoherent_dma_maskEvent__data_lendriver_flagsBLOCKINGfile_ra_statek_sigaction_hugetlb_hwpoisontemp_sensors_countReplyFrameAddressreadahead_controlfwnode_operationsswait_queue_headMaxNumPhysicalMappedIDsmemory_typePciBusNumbervm_userfaultfd_ctxTT_NONEmap_pagesmod_tree_nodecmd_flagss_bdev_filedev_pagemapmaster_tgis_mcpu_endpointcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fshost_eh_scheduledsoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLErb_nodereturn_consumerround_robinMsgFlagsi_private_datavolume_handleptracer_credsrcu_barrier_headleadercheckhtb_rel_queryTT_COMPATcap_effectiveexit_statefaultscan_startmax_sges_in_chain_messagesubvendorbios_pg2bios_pg3numa_pages_migratedPCISlotNummax_sges_in_main_messagesched_tagssupported_modepsgesbitmap_queueis_gen35_iocpci_p2pdmano_cgroup_migrationattached_handlesched_datachain_listmax_data_sizeprintk_index_startindex_keybreserved_tags__bi_nr_segmentsneeds_freset_MPI2_IEEE_SGE_SIMPLE_UNIONrcecintervalbug_entrytimers_activenum_classesvma_lockIeeeSimpledl_throttledseccompDEVICE_VERT_POS_UPPERblk_holder_opsstatic_key_modport_siblingsfilter_countmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodestarting_offsetumode_tinitial_nsnon_compliant_barsno_pmGRPQUOTAia_vfsgidmpt3sas_ctl_pre_reset_handlerioctx_locktimer_slack_nss_bdixarraycan_wakeuppdeath_signalnr_wakeups_idledqi_igraceqf_nextmaple_treensproxymanu_pg10manu_pg11slave_dir__p_len__write_overflow_pkeykernfs_rootucountsget_next_idMpi2ToolboxCleanRequest_tDD_CLASS_TYPE_LEVEL_NUMhigh_iops_outstandingrefcount_ttimestamp_update_countErrorResponseBaseAddresstoolbox_requestcmd_lenDEVICE_PANEL_TOPmax_hw_discard_sectorsint32_txol_areadefault_locktmp_stringguess_capacitysrcu_gp_mutex_MPI2_CONFIG_PAGE_BIOS_2_MPI2_CONFIG_PAGE_BIOS_3debugfs_dirwakee_flip_decay_tsBRM_status_showprio_listevent_dataMPI2_BOOT_DEVICE_ENCLOSURE_SLOTlast_timeBiosVersionrequestblk_unique_idsas_address_parentSDEV_DELMasterDatacontexthost_lockrwlock_tvm_fault_tSAS_PHY_RESET_PROBLEMuse_autosuspendPCIeEncapsulatedSuccessclass_spinlock_irq_try_is_conditionalcfs_rqvirt_boundary_maskcgroupscore_occupationget_policycore_cookiedev_attr_version_mpiMpi2ManufacturingPage11_t_ctl_diag_releaserefcount_struct__kernel_ulong_tfwnodedev_attr_logging_levelstatic_call_keydecr_trace_buff_sizenamespaceparametersgroup_leaderdma_channelrunnable_avgMpi2IOCPage8_tlookaheadiowait_countshstkioac__kernel_clock_t___GFP_DMA32_BITwas_resetgp_seqscsi_device_stateuuidmaj_fltcached_requested_keydqb_rsvspace___GFP_NOMEMALLOC_BIT__wake_updev_attr_version_biosmpt3sas_scsih_scsi_lookup_get__s8inode_operations__kernel_size_tdma_configurefile_leaseclass_local_lock_nested_bh_is_conditionalgpl_symssas_devicepci_vpdblock_szpercpu_rw_semaphoreis_chassis_slot_validarch_spinlock_tseqcount_raw_spinlock_tthread_pidevent_logdl_non_contendingcurr_ret_stackpgtable_tmax_bus_speed__u8q_usage_counterwakeirqi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyssdev_targetcore_forceidle_summiscdeviceget_offset_ctxbase_readl_ext_retryreleasedexport_operations__compiletime_assert_203__compiletime_assert_204__compiletime_assert_206qc_stateget_budgetBLK_INTEGRITY_CSUM_IPmempool_smempool_td_inodespecial_vecworkqueue_structi_lock_keySAS_PHY_VIRTUALuevent_suppressgraveyard_linkbi_opfscsi_cmndfs_superswait_for_discovery_to_complete__read_overflow2wce_default_on__rcu_icq_cache___GFP_KSWAPD_RECLAIM_BITcap_ambientcheck_copy_sizeqstrtaskss_d_opreply_post_free_array_dmano_report_lunsi_rcu__count__already_doneinit_requestGET_MSIX_INDEXio_opt_ctl_diag_registerpcountbio_listwlockedSCSIStatedevicemodule_kobjectboard_tracer_showpercpu_count_ptrpcie_mpssnr_ia_rangesthawmpt3sas_scsih_clear_tm_flagcalling_function_nametlbflush_unmap_batchremovesz_argbvec_iteroom_mmbpf_local_storagename_linkcompat_long_tcnivcswchain_dma_pool_raid_deviceats_stushort inttrc_reader_specialscsi_lookup_locklogging_levelgtimedisk_events_disable_depththread_group_cputimersizemigrate_to_ramreset_from_userUTASK_SSTEP_ACKbroadcast_aen_pendingloginuiddesc_structi_wb_lists_umount_keyquota_type__init_swait_queue_headnameIoIndexhost_trace_buffer_enable_showsetleaseMaxEnclosuresbitmap_tags_MPI2_TOOLBOX_CLEAN_REQUESTmnt_rootpsi_flagsctl_fops__real_strnlenconfig_requestsighandpcie_device_putaddrMpi2ReplyDescriptorsUnion_t__rcu_headMPI2_SGE_SIMPLE_UNIONac_utimeksm_zero_pagesqueuedataissue_resetprivate_data_MPI2_REPLY_DESCRIPTORS_UNIONscsiio_trackerreply_free_host_indexfs_struct_raw_spin_unlockMpi2SCSIIORequest_tnuma_nodedev_archdatanr_perf_statess_flagsrcu_nodeorig_pmdrb_rightkmalloc_array_noprofvolume_typeclock_baseclass_irq_is_conditionallaunder_folioReserved10Reserved11Reserved12delayed_tr_volume_lists_vfs_rename_mutexElf64_Xwordflock_ctl_ioctl_compatcompanionhandler_data__paddingMpi2DiagReleaseReply_tio_lockdep_mapatomic_write_hw_boundaryiowait_sumdescriptionSasWwidbi_nextblk_status_tUSRQUOTAdriver_privatepm_onlyd_rt_spc_warnsset_read_onlypgmapactive_refhctx_tablekernfs_open_fileMpi2IOCPage1_ts_iflagspci_dev_flags_tprintedNumDevsPerEnclosurenr_hw_queuesiounit_pg0iounit_pg1codetagstate_mutexlast_queue_full_depthcid_worki_versionenable_sdev_max_qd_storeswap_deactivateclass_rwsem_read_is_conditionalqueue_limitsil_weightstarved_listdiag_trigger_scsi_showdma_parms_ctl_diag_read_bufferKOBJ_NS_TYPEScmin_fltarch_uprobe_taskis_hotplug_bridgewrite_protect_seqclearedkobj_ns_type_operations_MPI2_SGE_IO_UNIONdiag_trigger_mpi_showshutdownevent_countsched_statisticspci_ops__kernel_uid32_t__bad_copy_toallocorig_pterq_timeoutevent_typeskeysinit_nameSDEV_EVT_FIRSTMPI25_FP_SCSI_IO_SUCCESS_REPLY_DESCRIPTORfile_lockstatfsmax_sense_bytesrw_semdevice_privateio_unit_pg3vm_policydl_deadlinetracepoint_extclass_mutex_is_conditionalfpregs_statetracker_listmemcg_datadqb_curinodesfileattr_seteh_actionpage_linkno_write_sameDEVICE_PANEL_UNKNOWNPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetsas_port_listmce_ripvDL_DEV_NO_DRIVERret_stackSAS_PROTOCOL_INTERNAL_ABORTreal_timeri_privatealloc_tagextended_state_areanum_kprobe_blacklistaccess_ctl_check_event_typesubdirsdev_release_MPI2_EVENT_NOTIFICATION_REPLYMPI2_SGE_CHAIN_UNIONmlock_countscsi_cmd_privget_next_child_nodemempolicyperf_event_mutex_bandkref_putcurrent_boot_devicepollfddev_tdma_poolSAS_LINK_RATE_UNKNOWNplatform_dataf_refprev_posenv_endfileattrs_subtypeusage_count_MPI2_SCSI_IO_REPLYpr_opsstate_in_sysfsdqb_ihardlimitaer_statsmpt3sas_ctl_initbackup_rail_monitor_statusunlocked_ioctluprobebd_mappingkmem_cachenuma_next_scanbudget_mapbsg_devsrcu_last_gp_endclass_local_lock_irq_is_conditionalpage_listproperty_read_int_arraywdtrdev_attr_io_delaymq_rq_stateholders_dirMODULE_STATE_UNFORMEDst_valueMPT3SAS_TARGETlist_headptrace_bpsreply_free_queue_depthAtomicRequestDescriptorPosts_user_nsbase_cmdsmax_nvme_qdtagset_refcntqueuecommand_may_blockarch_tlbflush_unmap_batchquick_threadsdefer_syncreq_alt_boot_devicemissedsum_sleep_runtimecleanup_rqd_spc_timerd_ino_hardlimitpausecompatchange_cookiebi_statusdl_periods_dquotfsnotify_sb_inforecent_cida_opsatomic_desc_capablepad_untilperf_event_listioctl_headerirq_pollinterval_expevent_type___GFP_LAST_BITdevfntagsPhyNumki_completeRequestDescriptorPostHighpgprotuint16_ttimespec_typebd_devicefind_special_pagedquot_operationsMPI2_IEEE_SGE_SIMPLE32posix_cputimers_workgsbasestrlenio_tlb_memseq_showminorcpusfilepfilesinblockbd_claimingtails_magicdma_alias_masknuma_faultsmem_dqblkEEDPBlockSizestatusWRITE_LIFE_NONEIocLogInforead_countwait_for_completion_timeoutHRTIMER_NORESTARTrsvd0rsvd1last_update_timeNVME_BUILD_PRPinternal_smid__UNIQUE_ID_y_604Reserved1Reserved2sas_ss_spReserved4Reserved5Reserved6Reserved7dpc_rp_log_sizeReserved9kstrtoboolLogEntryQualifierpanelSAS_PROTOCOL_SMP___GFP_ZEROTAGS_BITmax_allowed_capacityopen_moderead_posdev_attr_reply_queue_count___GFP_ACCOUNT_BITmpt3sas_ctl_clear_outstanding_ioctlsD_REAL_METADATAgpl_crcs_ctl_diag_queryclass_raw_spinlock_try_is_conditional__must_check_overflowkiocb___GFP_MEMALLOC_BITexecute_only_pkeyreturn_instancesma_lockblk_mq_queue_datadockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsChipRevisiondentrysequential_iowait_pidfds_writersgroup_stop_countswap_lockvm_opsread_before_msreply_postget_unmapped_areamkobjis_sourcesym_VDSO32_NOTE_MASKfrozenactive_uprobeget_parent_sas_phymin_vruntimel1ssconnector_namehost_resetclass_disable_irq_is_conditionalsyscrnr_mapssyscwsync_ionum_bpf_raw_eventswork_qnr_phys_allocatedorig_nentstm_replyki_posSAS_PROTOCOL_SSPDIAG_BUFFER_STARTavx512_timestampend_io_datafree_cached_objectstaints_BooloverflowSAS_PROTOCOL_STPxol_vaddrlist_lru_nodeuclamp_ses_time_granblk_integritykuid_tdev_pm_qosbd_holdersdriver_exclusive_resourceFlagsLength_sifieldstaskIeeeChainresetsched_reset_on_forkcompound_headnr_retriesshost_privmultipath_on_hbampt3sas_scsih_set_tm_flagevent_contextwake_irqbranchtarget_port_protocolsi_cdevchip_physhba_queue_depthi_fsnotify_marksin_thrashingdl_defervpd_pg80vpd_pg83vm_startvpd_pg89mprotectquota_ond_automountDEVICE_REMOVABLE_NOT_SUPPORTEDromlenatimeAddlFlags3get_ownershipf_task_workmy_qeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalsectors_wb_errtotal_io_cnt__q_sizehide_drivesata_command_pendingcloseSAS_END_DEVICEiopl_warnelevator_queuereply_post_structpasid_requiredptraceddonesym___kernel_rt_sigreturnsrcu_struct_ptrsTaskTagskip_ms_page_3fbuild_sginodesos_irqmemcg_awarei_atime_sechost_waitmanage_shutdownmpt3_ioctl_iocinfoqsize_t__fpstatedma_free_attrsqf_ownersuspend_noirqd_inamebi_flagslinks_countprealloc_pterdevd_ino_countarg_lockDEVICE_REMOVABLE_UNKNOWNignore_childrenfreeze_fshost_sas_address_showin_eventfdresume_earlystart_scan_failedmax_dev_sectorsdup_xol_workalimitmsix_capir_firmwarempt3sas_port_factsnuma_groupInitiatorDevHandleblk_independent_access_rangeskmap_ctrlfscrypt_operationsscsiio_requestrangesfs_contextmnt_idretry_hwerror_MPI2_CONFIG_REPLYdrop_inodeorc_unwindbroken_parity_statusgraph_get_next_endpointwantedlast_sector_bugmq_mapOEMIdentifierkprojid_t__u16saved_end_iosyscall_dispatchdl_densityon_rq_MPI2_SCSI_TASK_MANAGE_REPLYSL_WH_MPI_TRIGGERS_Taltmappfa_led_onmin_perf_statercu_tasks_exit_listmsi_enabledsp_regdma_drain_bufinternal_lookuplast_resets_master_keysflagsdiag_buffer_dmaIOCParameterbd_holder_locknr_threadsvm_mm__u32EventTriggerEntryPrimaryApplicationTagmpt3_ioctl_eventreportrcec_eaTaskMIDmax_secure_erase_sectorsseq_nextscsi_requests_quota_typesvm_lock_ddebugFAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitdelaysf_modeFORCE_BIG_HAMMERtimerqueue_headBLK_INTEGRITY_CSUM_CRCstrcmpsdev_groupskioctx_tableksm_rmap_itemsclass_read_lock_is_conditionalptm_capKMALLOC_RECLAIM__u64revoked_at_folio_nr_pageswritepageis_dirty_writebackpkey_allocation_maplink_bwctrldq_iddisable_depthbytes_to_readem_perf_stateasync_queuethread_shstkminimum_linkrateposix_timerswait_chldexitsas_ss_flagsunmap_limit_for_wssas_device_typempt3_diag_releaserom_base_regpcie_sg_listpercent_completeReserved3bi_itersrcu_cblist_invokingiopollbridge_ctliov_lenlatency_recordPrimFlagsSAS_LINK_RATE_1_5_GBPSmsi_capiopoll_q_start_indexsector_size__UNIQUE_ID_x_591__UNIQUE_ID_x_593__UNIQUE_ID_x_595__UNIQUE_ID_x_597__UNIQUE_ID_x_599d_releasekasan_check_writedev_dma_attrexpiresnuma_scan_seqmnt_sbversion_bios_showhashnodemask_tmpt3sas_enable_diag_bufferIOCNumbersignalfd_wqhhang_detectedscsi_iddevice_driversupports_trigger_pageslast_zone_capacitydev_attr_version_nvdata_persistentpend_os_device_addfsindexraw_spinlock_ts_copcombined_reply_queues_activenum_argsfa_locktag_size_MPI2_BOOT_DEVICE_ADAPTER_ORDERdev_attr_sas_ncq_prio_supporteds_uuidclear_child_tidruntime_statusdqb_btimedevice_delay_showdq_opAdapterFlagsno_command_memoryshow_pathdl_serverVTIME_USERquota_disablesched_delayedmpt3sas_base_lock_host_diagnosticsrcu_gp_seq_neededtask_structcurrent_may_mountkmalloc_cachesHeaderREFCOUNT_ADD_OVFrequest_dmapushsas_protocolis_noirq_suspendedfwnode_endpointcounterReqAltBootDeviceFormsuspendsupported_eventsoom_score_adj_minzone_wplugs_pooldomain_datacopy_file_rangeAddlFlags2srcu_gp_startreport_zones_cbmpt3_diag_unregisterSAS_HAxa_flagswakeup_preparedmpt3sas_scsih_change_queue_depthtv_nsecmsi_lockmax_zone_append_sectorssas_ss_sizebridge_d3s_inode_list_lockUTASK_SSTEPCurrentHostPageSizeehandlerdq_sbexpecting_lun_changescsi_targetRAIDAcceleratorSuccesss_mountssriov_configureSDEV_EVT_MEDIA_CHANGEOperationSDEV_EVT_INQUIRY_CHANGE_REPORTEDBLK_EH_DONEsym_pvclock_pageReplyPostHostIndexpage_fragrun_workfsuidRPM_REQ_AUTOSUSPENDirq_poll_fnrom_attr_enabledsrcversionMPI2_SIMPLE_SGE_UNIONtrace_event_callwakeup_sourceis_partially_uptodatepci_sysdatadl_runtimemay_splitio_uring_cmdread_dqblk_raw_spin_unlock_irqrestoretransport_cb_idxpcie_device_locksrcu_parentsuppliersfile_operationsmpt3sas_halt_firmwareblist_flags_tmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotNVMeAbortTOdpc_capis_preparedSCSIStatuspgprotval_ttrc_holdout_listWriteSequenceasync_suspendq_nodescsi_tgclass_mutex_intr_is_conditionalstrtabpage_freeftopHPROBE_CONSUMEDi_mmapdirty_paused_whenirq_get___GFP_COMP_BITdriver_managed_dmaSAS_SATA_PMmpt3sas_host_groupscapacitymax_channelversionsas_ncq_prio_enable_showbuffer_rel_conditionget_reference_argsllistdev_attr_BRM_statushiwater_vmUniqueValuemax_perf_statebi_idxfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntToolrseqmagictarget_kn_MPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORlimit0limit1pi_blocked_onpid_tvmemmap_shiftmpt3sas_dev_groupsusage__kernel_time64_tMPITriggerEntryrq_qos_mutexlink_active_reportingscsi_data_bufferi_securityreply_freedevice_physical_location_panellimitsq_lock_cls_keytransport_cmdsenvpactive_memcg__targetshost_trace_buffer_enable_storeElf64_Halfallow_reinittimer_autosuspendsratelimitSHOST_DEL_test_bitsysdata_softexpirespd_handlesautosuspend_delayi_flctxlist_lockvm_faulttm_requestoptimistic_spin_queuepermissionscmdtrigger_type_ctl_set_task_midflush_listctl_cmdsreap_refDEVICE_FIXEDlast_statusReservedSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsgioc_lockslice_maxp2pdmabi_max_vecsMpi2SCSIIOReply_tthaw_noirqsched_debugfs_dirSAS_PROTOCOL_STP_ALLaccounting_timestamppasid_capserial_numbermin_trace_buff_sizecan_matchtime_archcmd_sizechunk_sectorshlist_bl_headqc_dqblkpasid_activatedfa_next__fortify_panicbvec_integrity_poolSizearch_data_oldSAS_SATA_PENDINGio_uring_poll_queueshrink_controlegidenvp_idxcrypto_kobject___GFP_NO_OBJ_EXT_BITtagged_supportedvpd_pgb0vpd_pgb1vpd_pgb2actualvpd_pgb7folioruntime_autopref_node_forkclassslotsprev_scan_seq_perfput_smid_fast_pathReserved8wait_queue_head_t_ctl_eventquery_ctl_diag_register_2FAULT_FLAG_INSTRUCTIONstripe_exponentdev_attr_host_trace_buffer_sizeuser_nsclass_raw_spinlock_irqsave_is_conditionalsymspi_offset_flagsErrorResponseAllocationLengthmpt3sas_base_get_sense_bufferdevcapsyncSAS_SATA_DEVenable_sdev_max_qd_showmq_freeze_lockMPI2_ADDRESS_REPLY_DESCRIPTORsg_prot_tablesizepcie_sgl_dma_poold_childreneh_host_reset_handlerNvdataVersionPersistentddebug_class_map__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115__compiletime_assert_116__compiletime_assert_117__compiletime_assert_118__compiletime_assert_119prealloc_bufaudit_contextfl_owner_tipi_listWordsSAS_FANOUT_EXPANDER_DEVICE__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126i_pipe__compiletime_assert_128__compiletime_assert_129d_waitllist_headsense_buffernr_phys_segmentscurrent_stateMaxInitiatorswait_page_queuesas_rphyreply_post_freeFAULT_FLAG_REMOTE__compiletime_assert_130dl_bw__compiletime_assert_132__compiletime_assert_133__compiletime_assert_134__compiletime_assert_135__compiletime_assert_136__compiletime_assert_137__compiletime_assert_138pci_device_idret_vali_dir_seqheaderwatchdog_stamplist_op_pendingdriver_added_buffer_sizedatasrcu_cb_mutexsysfs_lockbroken_intx_maskingmsix_ioSimple32no_callbackssaved_trap_nrclock_listfolioq_slotUnitMODULE_STATE_GOINGxattr_handlerring_buffer_szSDEV_EVT_CAPACITY_CHANGE_REPORTEDbuild_sg_scmdrqos_debugfs_dirCDB32prot_sdbunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_lockfromMpi2DiagBufferPostRequest_tnextentseventkeytype__kernel_gid32_tdev_pm_domainnentsstart_time_nsuaddr2f_securityprot_oppd_handles_szbridgevariable_test_bitdefparamdiscard_granularitypcie_sgl_dmaSimple64smp_affinity_enableProductSpecificiotmo_cntclass_raw_spinlock_irq_is_conditionalmpt3sas_get_pdev_by_handle__bi_cntSAS_PHY_RESET_IN_PROGRESSrcuwaitattributes_maskdl_defer_runningout_unlock_pciaccess__refcount_dec_and_testqueuecommandSenseCountresourcesmaximum_linkrateia_validsrcuiorequest_cnt__compiletime_assert_199srcu_size_jiffiesclassespasid_featuresstatic_call_siteis_virtfnHostInterruptStatussubdevicesrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitrchari_verity_info_addr_pkey_copy_to_userrw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countSTARGET_RUNNINGbuild_nvme_prpushortatomic_openput_smid_default__mptrsigactionrlimmce_addr__q_size_fieldf_freeptrPrimaryReferenceTag__sighandler_tclass_spinlock_try_is_conditionalzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMEShash_lenmax_target_blockedfs_flagsvm_filei_countuser_structaddress_space_operationsFAULT_FLAG_USERkey_perm_tTargetAssistSuccessmax_wideport_qdMaxMSIxVectorsHeaderVersiontimer_listrun_delaynum_ftrace_callsiteschange_queue_depthsrcu_cblistblk_independent_access_rangemax_narrowport_qdtlb_ubcpme_supportpgtables_bytesi_lrufirmware_versionsas_devGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacktrc_ipi_to_cpuscsi_lundesired_eventPageTypeallow_restartmin_slicecommit_rqsput_smid_scsi_iosysfs_opsinq_periph_qualHCBAddressHighatomic_write_hw_unit_maxcmaj_fltbio_integrity_poolkparam_arraympt3sas_base_hard_reset_handlerFORTIFY_FUNC_strscpypercpu_refevict_inodeignore_media_changedqb_itimeMPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTOR_internal_cmdthread_keyringmap_nrcpumask_trb_leftBufferType_raw_spin_lockgfp_maskdma_addr_tinactive_timersense_dmaattributeinit_hctxmm_lock_seqhotplugFORTIFY_FUNC_memchrkernfs_elem_symlinkBLK_UID_T10_debug_dump_mf__kernel_dev_tcrypt_keyslotfa_filepcie_target_idpm_domainnumber_bytesfsgidsector_tMPI2_DEFAULT_REPLY_DESCRIPTOR_sys_privatesignal_structactive_mmstate_savedkernfs_iattrsshow_devnamethread_infoi_mmap_writableMPI2_VERSION_STRUCTreadRequestDataLengthsecondarydevicesatomic_write_max_sectorsgroup_exit_codeFORTIFY_FUNC_memcmpopc1ignore_loginfosREFCOUNT_SUB_UAFreply_queue_listpriv_flagsPciDeviceAndFunctionNumberSMIDclear_retrain_linkexec_maxSenseBufferLowAddresssync_stateMpi2ConfigRequest_tdev_groupsDMA_FROM_DEVICEkernfs_elem_dirpercpu_counter_printkDMA_BIDIRECTIONAL__scsi_iterate_devicessequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_start_ctl_eventreportUTASK_RUNNINGhctx_typeopenseglenoverride_only__compiletime_assert_45EEDPFlagsFORTIFY_FUNC_memcpy__kernel_ssize_tvdso_imagesi_signoconst_test_bitunused_hctx_lockrseq_sigresultrefsmpt3sas_base_get_reply_virt_addrdelayed_calltime_slicediag_trigger_master_storenr_rangeStructpci_power_tspc_timelimitMPI2_BIOSPAGE2_BOOT_DEVICEblk_mq_req_flags_tresumereset_doneregsbi_write_hintrq_nextsyscall_user_dispatchshort_inquiryattrd_aliasis_suspendedspin_unlock_irqrestorerestore_sigmask__UNIQUE_ID_x_601__UNIQUE_ID_x_603__UNIQUE_ID_x_605__UNIQUE_ID_x_608sas_target_priv_datarequeue_lockmmio_enabledscsi_io_cb_idx__check_object_sizekcsan_check_accessevent_workreply_post_free_arraynr_deferred__UNIQUE_ID_x_611__UNIQUE_ID_x_614list_emptysrcu_sspi_lockuser_event_mmbtrace_seqkstrtoints_devsiblingcdl_supportedia_rangeSkipCountldt_usr_semGenericFlags1posix_cputimerstry_rc_10_firstRPM_INVALIDfreeze_kcountrequest_key_authblockspercpu_ref_datad_spc_warnssrcu_supfreeptr_tns_type__compiletime_assert_78RPM_REQ_NONEforce_runtime_start_on_system_startsg_timeoutmaximum_linkrate_hwixolfasyncarg_startkprobes_text_sizeblk_crypto_profilefop_flags_addr_lsb_addrpfn_mkwritedriver_versionuaddrKMALLOC_DMAsas_device_lockioerr_cnt__compiletime_assert_80_uids_fs_info__rb_parent_colorWRITE_LIFE_EXTREMEhost_trace_buffer_storeicq_listslave_configure_ctl_btdh_search_sas_devicemm_users_pp_mapping_paddebugfs_rootNextChainOffsetkey_serial_tno_uld_attachfolioqiomapshost_groupssiblingscputimernrpageswake_q_nodecopy_from_userblk_flags_ts_maxbyteshd_geometryioctx_tabledma_io_tlb_memKMALLOC_CGROUPeh_cmd_qFunctionDependent1FunctionDependent2FunctionDependent3FunctionDependent5get_unique_idkasan_check_readVP_IDNR_KMALLOC_TYPESexpire_countwake_cpubio_split___GFP_DMA_BITfreeze_supertick_dep_maskkey_typecpu_msix_tablepci_busqc_infofault_flagfasync_helperlist_is_headmodnameCurrentBootDevicewait_addressia_ctimetrace_eval_mapasync_put_workresvnum_static_call_sitesvm_lock_seqFORTIFY_FUNC_strncatuarg_MPI2_DIAG_RELEASE_REQUESTmpt3sas_ctl_add_to_event_logMPI2_SCSI_IO_CDB_UNIONprimarytm_cb_idxElf64_Addrwait_queue_entry_tversion_fw_showseqlock_tlatency_record_countSL_WH_SCSI_TRIGGER_Tnr_integrity_segmentsMPI2_CONFIG_PAGE_HEADERhost_blockedmay_skip_resumeprot_flagspoll_tableVTIME_SYSalloc_tag_countersbase0base1base2block_cfg_accessSHOST_CREATEDbase_cb_idxbio_setpd_handlePortNumberalignment_offsetrdpq_array_capablelinksSL_WH_MPI_TRIGGER_Tbasesfutex_staterseq_lenkobj_completioni_spc_timelimitf_opchains_needed_per_ionargscpuhp_onlinemax_lbamm_mtgid_tdelayed_tr_listrelease_workmpt3sas_ctl_doneno_report_opcodesfault_reset_work_q_namercu_read_unlock_specialtls_arrayeetlp_prefix_pathIoFlags_MPI2_DIAG_RELEASE_REPLYtask_io_accountingHCBAddressLowf_raDEVICE_PANEL_FRONTmodule_memorysitesctl_poll_waitAddresscompat_robust_list_headthread_nodestatic_call_mods_shrinkgp_countnr_sectorsreply_queue_countbpf_raw_eventshi_priorityiommutimer_expiresbpf_storageSAS_SATA_PM_PORTkset_uevent_opsAckRequiredf_owner__state_permSenseBufferLengthDEVICE_PANEL_BACKreply_post_free_array_dma_pool_ctl_btdh_search_pcie_device_syscallIOCParameterValuediskSHOST_DEL_RECOVERYring_buffer_offsetvolume_wwidsdevioc_numbermsix_vector_countsrcu_lock_countlink_statetrc_blkd_cpugp_waitcopy_len__compiletime_assert_131iommu_mmfuncio_uring_taskSAS_LINK_RATE_22_5_GBPSshared_tagspri_reqs_allocRequestedBootDevicejit_keyrings_fsnotify_infodma_handlefunctionSAS_LINK_RATE_12_0_GBPSport_enable_cmdsprojidmce_kill_me__bad_copy_fromma_external_lockpid_linkstm_busyconv_zones_bitmapscsi_target_idpcie_flags_regs_dio_done_wq_ctl_diag_unregisterbase_add_sg_singleq_sizehlist_headloss_of_dword_sync_countioc_nodethrottle_diskbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACE__fortify_strlenrunningrw_hintblk_integrity_checksumioc_dumpdma_skip_syncpartition_meta_infoDEVICE_VERT_POS_LOWERclass_spinlock_irqsave_is_conditionalutf8datampt3sas_base_check_cmd_timeoutTaskTyperequeue_workof_node_reuseddyndbg_infoFORTIFY_FUNC_strncpyElf64_Symhtb_relsaved_config_spaceIRVolumeMappingFlagsd_rt_spc_softlimitpollfree_file_infoin_lru_faultsched_contributes_to_loadtlb_genruntime_idleacs_capmap_countDiagRWDatapcie_caphost_scribblei_rt_spc_timelimitqc_type_states_dentry_lrutask_mids_bdevskip_vpd_pagescrcssense_lenRDPQBaseAddressrun_listdiag_buffer_szuevent_opsabort_workmax_cmd_lenmpt3sas_ctl_releaseMaxChainDepthsched_classutil_avganon_vma_pidsigcntDD_CLASS_TYPE_LEVEL_NAMESmodinfo_attrsst_spacetlr_snoop_checkclass_map_typekparam_stringd_real_typemaxrsscredkernfs_open_nodePhysicalPortf_wb_errmm_cid_activekzalloc_noprofmodule_sect_attrsreq_flags_truntime_resumempt3sas_trigger_mastergroup_exec_taskrestrict_linkget_inode_usagekmalloc_typexarray_startbpf_ctxpm_domain_dataBASE_READ_REGserver_pick_task__p_size_fieldload_avgcor_error_detectedi_private_lockget_dqblkmq_listhost_trace_buffer_size_showphysical_block_sizeMPT3SAS_DEVICEpgoffporthi_priority_smidtm_tr_cb_idxhandlematch_drivermodelfreeze_latereply_queue_count_showd2_supportcount_objectsvma_numab_statedma_map_opsdq_dirtyREFCOUNT_ADD_NOT_ZERO_OVFmax_lunexit_cmd_privatomic_write_boundary_sectorsEnclosureSlotmax_queue_depthwrite_byteseh_entrypending_eventsoom_reaper_listnumab_stateSDEV_EVT_MODE_PARAMETER_CHANGE_REPORTEDMpi2ToolboxMemMoveRequest_tdev_attr_diag_trigger_masterfutex_offsetsubsys_fmt_prefixdq_lockintegrityMPI2_SCSI_IO_CDB_EEDP32pte_tnr_scanned__stateMpi2SGESimple64_tmpt3sas_factsnr_ios__compiletime_assert_200__compiletime_assert_201__compiletime_assert_202n_io_portslice__compiletime_assert_205drv_groups__compiletime_assert_207__compiletime_assert_208track_queue_depthcustom_slicepci_slothotplug_user_indicatorsmq_freeze_depthpadding1nestedatomic_write_segments_maxReplyFreeHostIndexnr_dirtied_pausequeue_kobjreal_addressversion_nvdata_persistent_showbd_holder_dirinvalidate_locknum_exentriesfix_capacity_ctl_do_resetio_portblk_mode_tpmdval_thost_tagsetkvecPCIDomainSegmenteh_noresumesas_device_handle_showset_latency_tolerancedepthDescriptorTypeDependent2d_ino_timerprobenetlink_nsdev_ueventdep_mappage_mkwritelast_busyvm_flags_tstrlcatres_attruptrnr_failed_migrations_affined_in_lookup_hashptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLERreschedule_countmax_hang_timeexternal_facingcmd_per_lun__dummycdl_enablecutimelockreftlb_flush_batched___GFP_HIGH_BITia_uidautogroupsequencercu_syncarg_enddev_attr_host_trace_bufferclass_spinlock_irq_is_conditional_dummy_pkeyvruntimehostdata___GFP_HARDWALL_BITbus_flagsstart_stop_pwr_condfeatures_locked__kernel_pid_tsas_address_showdevice_blockedMpi2IOUnitPage0_tMajorPIDTYPE_SIDcinblockdma_alignmentprot_type__kernel_loff_tdiag_trigger_event_storempt3_ioctl_headerset_performance_stateserial_nodeSAS_PHY_UNUSEDchains_per_smidstate_remove_uevent_sentnotify_countHostDiagnosticevent_maskssingle_lunhprobe_ctl_verify_adaptersg_reserved_sizeswap_activatedqb_isoftlimitsaved_auxvapplication_flags_MPI2_DIAG_BUFFER_POST_REPLYnoinstr_text_sizedl_overruniattrdetachedloff_tWWIDoom_flag_origindesc_lendma_devfault_reset_workoom_score_adjSHOST_RECOVERYrq_end_io_fnksm_merging_pagesgraph_parse_endpointrmidraid_devicelist_lrudevice_removablefxsavedev_pagemap_opsbv_offsetset_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETd_lockrefto_userSCSI_EH_DONEsession_keyringshost_devd_deleted_ino_softlimitd_weak_revalidatealloc_time_nsi_devicespcie_devicedqb_curspace_MPI2_REQUEST_HEADERtm_cmds_MPI2_CONFIG_PAGE_IO_UNIT_0_MPI2_CONFIG_PAGE_IO_UNIT_1_MPI2_CONFIG_PAGE_IO_UNIT_3alloc_lockearly_initOEMSpecificFlags0OEMSpecificFlags1total_numa_faultswritable_sizemax_segmentsdma_need_drainobj_cgroupboard_name_showem_tablemq_sysfs_init_doneactive_queueshba_mpi_version_belongedMsgVersionpage_size__lstateMPI26_PCIE_ENCAPSULATED_SUCCESS_REPLY_DESCRIPTORinodebd_fsfreeze_mutexhrtimeratomic_write_unit_maxavailMinormpi_requestFAULT_FLAG_UNSHAREtask_sizemust_resumeRPM_ACTIVEend_codeuintpreempt_notifierstlb_flush_pendingmigration_flagsDEVICE_PANEL_RIGHT_ctl_compat_mpt_commandpcie_device_listHostTraceBufferFlagspci_drivercap_inheritablekobj_sigvaleh_timeout__stack_chk_failsrcu_n_exp_nodelayseqcount_spinlock_tgraph_get_remote_endpoints_roots__int128 unsignedmpt3sas_base_unlock_and_get_host_diagnosticcpu_countwait_sumuprobe_xol_opsmin_align_masknextevtthis_idrcu_segcblistreported_split_lockpref_window_ctl_fasyncreturn_instancewait_countconfirm_switchnr_wakeups_affine_attemptspud_ti_ino_warnlimitpreallocProtocolFlagsmax_open_zonesrmtpnext_offsetacpi_device_idctx_idutaskpoweroff_noirqbroken_cmd_complactive_modesdev_datacb_idxis_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangsTerminationCounttm_tr_volume_cb_idxcss_setfwnode_handlegfp_tEEDPTagModetypeqf_fmt_idEEDPErrorOffsetpageatomic_write_unit_minsleep_startmemalloc_noiobegintypetabuse_192_bytes_for_3fnr_reserved_tagsi_crypt_infoDEVICE_HORI_POS_CENTERio_start_time_nsaudit_ttynr_zonesmutex_unlockjobctlsi_errnonr_leaves_on_treequeue_ctxmin_shallow_depthpcie_device_init_list_sigchld__le16HPROBE_STABLEquota_format_typebio_crypt_ctxpercpu_ref_func_tpm_message_tac_memdata_out_dmapprevpending_io_countino_warnlimitbroken_fuaMaxPostedCmdBufferszone_wplugs_lockmnt_flagsac_stimelast_mergememcg_nr_pages_over_highsw_reservedDCRDatamem_move_request__le32wbt_flagsrequested_buffer_sizeproc_dir_entryobjcgno_read_disc_infoblock_startvm_area_structnum_gpl_symsdrv_support_bitmapselect_no_atn__compiletime_assert_6PageNumbermap_busControlphy_reset_problem_countlong long unsigned intWRITE_LIFE_MEDIUM__builtin_memcpyirq_line_enabletmf_in_progressdirect_io_enabledSDEV_CREATED_BLOCKqdepthhuge_faulti_fopautaskblock_statelast_task_numa_placement__le64fortify_memcpy_chk_pcie_devicerefcntfreeze_holdersubordinatecdevperf_eventkernel_ulong_tPageBufferSGEunregfuncMpi2DiagBufferPostReply_tseqcountirqpollExtendedTypeschedule_dead_ioc_flush_running_cmdsclass_idbitsetsas_idfactsinquiry_mutexof_device_iddisk_statsbusn_resmanage_runtime_start_stopmpt3sas_base_put_smid_nvme_encapclass_migrate_is_conditionalsriov_get_vf_total_msixclass_write_lock_is_conditionals_xattrpartmpt3sas_ctl_exitmpi_replyBLK_EH_RESET_TIMERil_prevbtdhd_initmax_slack_shiftget_name_prefixfileattr_get__kmalloc_noprofReplyFrameSizedma_free_coherentclass_groupsSDEV_TRANSPORT_OFFLINE__ret_warn_on__call_single_nodeunicode_mappathrecent_used_cpuruntime_ctl_addnl_diag_queryno_64bit_msiold_time32_tmsix_load_balancedev_flagsSASAddressspinlock_check__state_sizeunsigned intdata_in_buf_ptrsbitmapdata_sge_offsetrequest_dma_szput_smid_hi_priorityclass_irqsave_is_conditionalcore_kallsymsIOCStatusscsi_devices_fsnotify_maskis_physfnsas_linkratescan_objectsslotbi_privatempt3_addnl_diag_querydevice_infoDD_CLASS_TYPE_DISJOINT_BITSevent_liststartupnvme_encap_requestMPI2_BOOT_DEVICE_DEVICE_NAMEevent_data_szmpt3sas_ctl_reset_done_handlerkeyring_index_keychain_trackeriov_iterd_rcustatic_key_false___GFP_DIRECT_RECLAIM_BITuintptr_thost_diagnostic_ctl_mpt2_ioctl_compatwake_entryrcu_tasks_holdoutfreezeassoc_array_ptrbatchcacheold_timespec32rcu_blocked_nodejiffies_at_allocst_namegroup_nodei_mtime_secbus_dma_regionfw_event_lockstatic_rqsstarget_sdev_userlegacy_ioPrimaryApplicationTagMaskac_majfltmce_kflags___GFP_NORETRY_BITFORTIFY_FUNC_memsetscheduledbus_dma_limitBufferLengthreset_neededubufrequest_data_dmabtimePageLengthdiag_dataia_gidltr_pathscsi_device_eventmigrate_foliorq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrnext_posix_timer_idmq_opsmax_sata_qd_mapcountstarttimeHCTX_TYPE_DEFAULTreschedule_jiffieshprobe_statei_sb_listquota_offMPI2_IEEE_SGE_CHAIN32fault_reset_work_qshm_clistio_uring_poll_queuesptm_rootcb_headzone_wplugs_hash_bits_MPI26_NVME_ENCAPSULATED_REQUESTac_flagpt_regsmmap_missexpires_nextIOCMaxChainSegmentSizeblk_opf_treport_zones___GFP_ZERO_BITnum_trace_bprintk_fmtcdrom_device_infoaccess_stateDeviceNamefoundraid_device_locksdev_gendevphy_idwork_structtruelast_queuedmpt3sas_scsih_is_pcie_scsi_deviceri_timerpipe_bufsIOCExceptionsbp_offsetkmalloc_cache_typetm_sas_control_cb_idxhba_portMPI2_IEEE_SGE_CHAIN64saved_scratch_registertracepoints_ptrsblock_maxstatic_keyqueue_rqsFAULT_FLAG_VMA_LOCKcopy_overflowdma_range_mapKOBJ_NS_TYPE_NONE_dataFAULT_FLAG_WRITEshow_optionswait_queue_entryp_leni_uidtagset_freedmax_sectorsexpirybmaprescue_workqueuecopy_to_userdispatch_wait_lockscsi_levelfsavei_write_hintsuspended_timeread_byteszone_wplugs_worksum_sched_runtimeinternal_depths_writers_keystart_boottime_ctl_ioctlpci_bus_flags_tentriesi_modedata_in_szcap_permitted_flags_2aBLK_UID_NAAstart_codevm_flagssi_codeseqcount_spinlockkill_fasyncheadHPROBE_GONEioc_statuslast_siginfoqueue_offsetdiag_trigger_locksched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorsdevice_dma_parametersdir_contextiopl_emulSDEV_EVT_POWER_ON_RESET_OCCURREDconsumerspoll_queue_procratelimit_statepower_statedq_flagsis_late_suspendedcapture_controlraw_atomic_fetch_sub_releaseTransferCountdev_attr_fw_queue_depthclass_device_is_conditionalnon_rcuput_supershostSCSIIOSuccessdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_statdrv_support_bitmap_showEEDP32HighPriorityCreditChain32FAULT_FLAG_INTERRUPTIBLEs_inodes_wbignore_hotplugfolio_queue_MPI2_MPI2_BIOSPAGE2_BOOT_DEVICEinit_fs_contextuprobe_taskf_mappingMPI2_BOOT_DEVICE_ADAPTER_ORDERconstant_test_bitstart_stack__UNIQUE_ID_y_592__UNIQUE_ID_y_594__UNIQUE_ID_y_596__UNIQUE_ID_y_598pcie_devDL_DEV_PROBINGi_linksriovmpi3_version_unionats_enabledstack_vm_areaChain64d_hashdl_server_pick_f_MPI2_BOOT_DEVICE_SAS_WWIDrefcount_dec_and_testtty_old_pgrpst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquota_MPI2_ADAPTER_ORDER_AUXNumPerDevEventsorc_entrydma_drain_lenSCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listMaxVolumesutimemmappriv_datashrinkeralloc_dquotrsvd2max_shutdown_latencyDiagVersionmappingdl_defer_armedMpi2IOCInitRDPQArrayEntrysas_expander_list_ctl_do_mpt_commandChipNamerunnable_sumatomic_fetch_sub_releaseis_warpdriveshort unsigned inteventsget_rq_budget_tokenFastPathSCSIIOSuccessreply_dma_poolqueue_ramp_up_perioddevice_noderequeue_listscsiio_depthpcie_link_statep_size_fieldAddress64long long intsym_vvar_startenable_cnt_hugetlb_cgroup_rsvdsival_ptrproc_namepercpu_sizeinvalidate_foliois_vallocclass_pci_dev_is_conditionaldrop_nsSDEV_EVT_LUN_CHANGE_REPORTEDPUT_SMID_IO_FP_HIPaen_event_read_flagnr_queuesmpt3sas_base_free_smidpcie_device_freeno_pm_callbackscountproduct_specificd_parentSequenceNumbersched_task_groupmpt3sas_dev_attrsupdate_timeioc_coredump_looppidsof_nodefw_event_workrun_nodechassis_slothide_ir_msghost_faileddata_sourcesubmit_bio___GFP_UNUSED_BITs_instancesvm_rcubd_start_sectpage_table_locksysv_semquota_infoquota_enable__kernel_timer_tMPI2_ADAPTER_INFOdomain_tagmax_integrity_segmentscmaxrsssas_device_listit_real_incrprobestubextable_lenlast_arrivalwake_indexswap_rwreservefwfault_debug_showCoreDumpTOSecnegotiated_linkraterunning_disparity_error_countsrcu_gp_seq_needed_exp_MPI2_DIAG_BUFFER_POST_REQUESTDEVICE_HORI_POS_RIGHTSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOia_mtimenr_thpsvphys_listsysv_shmfopssuppress_bind_attrsinsnlen__page_1__page_2i_mutex_key_MPI2_TOOLBOX_MEM_MOVE_REQUESTkey_restrictionquota_writedomainHCTX_MAX_TYPESget_linkfree_foliosnprintf___GFP_NOFAIL_BITMpi2IOUnitPage1_tsa_flagskargno_start_on_addcancelled_write_bytesdispatch_busydiag_buffermpt3sas_ctl_event_callbackRequestedAltBootDevicetask_worksmm_cidatomic_write_hw_max_ddebug_infostats_locknum_kpSTARGET_CREATED_REMOVEshost_gendevMEMORY_DEVICE_PRIVATEirq_managed__bd_flagssuper_blocknum_pdsbi_bvec_donebus_typeget_named_child_nodeassoc_arrayactor_MPI2_SGE_CHAIN_UNIONversion_nvdata_default_showkobj_ns_typedeferred_resumesched_shared_tagslong intMPI2_IEEE_SGE_CHAIN_UNIONcore_nodemem_dqinfodevnodesaved_sigmaskto_pci_sysdatactl_devBLK_UID_EUI64MEMORY_DEVICE_PCI_P2PDMAdq_offpinsblkcg_mutexis_visibledisk_namempt3sas_host_attrsconfig_pagepend_sas_rphy_adduuid_tenclosure_list__kernel_clockid_twritabledqb_bsoftlimitio_window_1kvfork_donethresh_holdtask_cputime_atomicki_waitqra_pagesmmap_compat_legacy_basedevice_dma_supportedsysfs_dir_lockspin_lockscsi_cmnd_submittermpi_versionignored_posix_timerslockedsival_intmpt3sas_base_get_smidia_filewakeup_cntrequest_pendingconfig_page_szdl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsclass_read_lock_irqsave_is_conditionalpri_enabledinitiator_port_protocolsblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startrobust_list_headunsigned charwake_qrethooksnuma_scan_periodnr_tagswakeup_pathresult_maskFORTIFY_FUNC_memscanscsi_timeout_actionei_funcs__func__MinDevHandletablespipe_inode_inforaw_spinlockEncapsulatedCommandLengthinstrument_atomic_readktypecls_mskdev_attr_enable_sdev_max_qdmax_eventsissue_host_resetmigration_disabledfw_queue_depth_showmpt3sas_dev_attr_groupPCIBusNumRPM_REQ_SUSPENDpgprot_ttracepoint_ptr_tmpt3sas_get_sdev_by_handleChainOffsetsscanfphysical_locationnum_vfSOFT_RESETnvme_mdtsPIDTYPE_MAXbi_sizeCurrentBootDeviceFormwatcherscrypt_ctxstopwait_maxclass_write_lock_irqsave_is_conditionaliovec_MPI2_VERSION_STRUCTa_flagsd_dnameScsi_Hostnr_migrations_coldmnt_idmap___GFP_FS_BITMPI2RequestHeader_tseeksquotactl_opski_iopriompt3_ioctl_btdh_mappingsched_remote_wakeuptag_alloc_policymemcpytracing_graph_pauseread_itersuspend_latefront_padmutex_trylocksdev_devhw_revi_rwsembi_integritydriver_nameis_addedexitio_uringeh_device_reset_handlerchild_ns_typediagnostic_flagspci_devBoardNameslave_bdevscommit_dqblkclass_local_lock_irqsave_is_conditionalpcie_sglmark_dirtynr_ctxkernfs_opsoom_reaper_timermodulebd_security_entire_mapcountqueue_lockfast_pathf_pathstatic_call_siteself64_symunlinkcur_bus_speedcpumask_var_trefcount_warn_saturatetime64_tdrivers_diri_gidmap_queuesFORTIFY_FUNC_strnlenrq_qosmark_deadREFCOUNT_DEC_LEAKicq_hintrmdirdq_dqbmemory_failureblkcg_gqdma_flagsSUBMITTED_BY_BLOCK_LAYERmax_hw_sectorsselectors_mtdmod_kallsymss_typesas_device_priv_dataremount_fsbd_holderdelayed_sc_listtask_delay_infopi_sesubsystem_vendorin_useSAS_PHY_DISABLEDrq_countMIGRATE_SYNC_LIGHTerrseq_ttransparentkstatfsid_tablemems_allowed_seqSDEV_EVT_LASTmax_user_discard_sectorsWhoInittarget_allocbug_listhigh_iops_queuesmax_nr_cidmod_arch_specificHCTX_TYPE_READDMA_NONEtransfersizesharebpf_net_contextsmp_request_MPI26_NVME_ENCAPSULATED_ERROR_REPLYis_msi_managedftrace_timestampbi_iopriod_ino_warnskernfs_elem_attrreset_preparei_ctime_nsecfw_events_cleanupi_private_listbinfmtftrace_sleeptimei_stateno_d3coldSCSITriggerEntrybv_pagepcpu_cidsupported_speedssched_migratedchildMPI2DefaultReply_tdup_xol_addrdevice_configurepci_error_handlersPROBE_PREFER_ASYNCHRONOUSrcu_node_entryno_vf_scanreverse_orderingfile_system_typeorig_ret_vaddrmmu_notifier_subscriptionsdefault_groups__sifieldsMSIxIndexsas_ncq_prio_enable_storenr_watchesmpt3_diag_queryDL_DEV_DRIVER_BOUNDAdapterOrdersmidcurr_ret_depthdev_attr_board_tracerstarved_entryMpi26NVMeEncapsulatedRequest_t__fillerdestroy_dquot__task_fpstatefilldir_tmpt3sas_base_get_sense_buffer_dmaget_reserved_spaceremote_identifyioprioKMALLOC_NORMALcreatedirtied_time_whenstart_scan_seqperf_rdpmc_allowedcopy_sizeboard_assembly_showsym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerbd_openersdq_inuseclass_maskmpt3_ioctl_command32offlinedev_pm_infomremapin_memstallhost_self_blockedrequest_sizetph_enabledpoweroff_latei_nlinkwakeupcb_list___GFP_IO_BITdirect_iocpu_idpushable_tasksdriver_overrideprev_fw_factstty_audit_bufmaxlenkernel_cap_tptm_enabledbpf_funcmems_allowedreply_free_dmaMpi2ManufacturingPage0_tSAS_LINK_RATE_G2s_inode_lrucached_rqsd1_supportinternal_dmammap_compat_baseretvalevent_entriesprepareconfig_cb_idxclock_op_might_sleepf_sb_errneed_mbd_namecheck_flagsi_sequencediag_trigger_mpi_storert_priorityrequest_szkretprobe_instancescrypto_profile__be32iov_basecpus_ptrq_lockdep_maploadfuncscpu_bitmap_MPI2_SAS_IOUNIT_CONTROL_REQUESTpci_error_recoverySTARGET_DELatomic_write_lensaved_tfHCTX_TYPE_POLLcfg_sizexa_headdetachSAS_PROTOCOL_SATAscsi_replyremove_hostproperty_read_string_arrayget_statetracepoint_funcd_seqRequestDescriptorPostLownuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmtExtPageTypeblkg_listnum_symtabexec_update_lockfscrypt_inode_infosplice_read_ctl_btdh_search_raid_deviceneed_qsctx_mapbd_disknumberszone_wplugs_wqApplicationTagTranslationMaskWRITE_LIFE_SHORTsigpendingpi_entrys_inodesdirtied_whenMIGRATE_ASYNCnext_scangsindexcompletewatch_listeh_abort_listd_sibmodule_attributemax_host_blockedslot_reset__builtin_memsetneed_tsin_dpm_listdevice_namewordworkDescriptorTypeDependent1multiprocessquiesce_depth_ctl_btdh_mappingclass_task_lock_is_conditionalvphys_masktask_groupf_pos_lockshpc_managednum_physrdpq_array_enable_assignedbio_pooltimeout_workwrite_endsrcu_barrier_completionpacctblk_mq_tag_setcurr_targetreset_typevm_page_protbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatperf_event_contextatomic64_tnoinstr_text_startHRTIMER_RESTARTrpm_autosuspend_delayis_thunderboltbusystack_canaryreply_post_free_dma_poolnon_operational_loopmax_write_zeroes_sectors_utimetmf_work_q__fortify_size_MPI2_CONFIG_REQUESTMPI2_IEEE_SGE_SIMPLE_UNION_flags_1_flags_2taskstatsposix_acl__UNIQUE_ID_y_602i_dio_count__UNIQUE_ID_y_606__UNIQUE_ID_y_609SL_WH_EVENT_TRIGGER_Tarch_rwlock_tdriversas_device_freesym_timens_pagediagnostic_data__UNIQUE_ID_y_612__UNIQUE_ID_y_615waitersoffsetprot_guard_typedev_iommumap_typeclass_rwsem_read_intr_is_conditionalcompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_usersDiagRWAddressHighSDEV_BLOCKbacking_dev_infoi_mappingctl_cb_idxIOCCapabilitiesdiscard_alignmentbsg_deviceshow_stats_ress_vfs_rename_keysubmitteretypei_bytes___GFP_WRITE_BITnormal_prioSDEV_CREATED__UNIQUE_ID_y_600shost_datadispatch_waitsrcu_nodeconfig_rrs_svlast_mm_cidchain_pagesis_busmastervaddrscsi_vpderr_handleris_softnext_cpuspin_unlockgrab_current_nspci_access_mutexdiag_trigger_scsi_storeminimum_linkrate_hwclass_namesMaxReplyDescriptorPostQueueDepthlock_class_keysum_exec_runtimecompatiblesetupdev_pin_infoMpi2SCSITaskManagementReply_tinvalid_dword_countpoll_table_structmce_whole_pageia_modercu_tasks_holdout_listsched_rt_mutexLookupMethods_pinsnum_lunsnon_seqfifo_timehctx_listrenamemajorktime_tPRJQUOTAdev_attr_fwfault_debugkprobe_blacklistjump_entriesdio_offset_alignreserved_tagsdma_masksa_restorerqueuelistdatalenmkdirio_missing_delaynextrelax_countrestore_earlyPIDTYPE_TGIDilenMaxPersistentEntriesmax_active_zonesMPT3_IOCTL_EVENTSdevice_physical_location_horizontal_positiondev_attr_host_sas_address_MPI2_SGE_SIMPLE_UNIONkobj_uevent_env___GFP_MOVABLE_BITkprobes_text_startSDEV_EVT_ALUA_STATE_CHANGE_REPORTEDDiagRWAddressLowpid_typestargetfown_structi_default_aclfregs_statephy_identifiershift__devicesFORTIFY_FUNC_strcpypendingfirmware_event_threadioc_pg8dma_boundarybd_nr_sectors_MPI2_CONFIG_PAGE_MAN_0SAS_LINK_RATE_6_0_GBPSnr_eventsconfig_page_dmakstatanon_vma_nameSGLFlagsdq_hashfa_rcu_MPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTOR__iovgp_stategrphintabiommu_mm_datazone_wplugs_err_listma_flagsarch_uprobebio_issueDL_DEV_UNBINDINGKMALLOC_RANDOM_ENDbroadcast_aen_busyport_numrefcountmmap_locksrcu_reader_flavorinternal_free_listtimerqueue_nodeGPIOCountreal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_alloweduse_16_for_syncrt_mutex_waiterSAS_PROTOCOL_ALLmmio_always_onlegacy_mempage_pooldq_dqb_lockdiag_trigger_eventf_flagsblk_qc_tshow_infompt3_diag_read_bufferslave_allocflush_requiredsg_tableMpi26NVMeEncapsulatedErrorReply_tattributesblk_queue_statsgrplokgid_terror_detectedkey_userpci_channel_state_treadlinkoffline_disabledd_comparei_wb_frn_winnerqspinlock__compiletime_assert_451sighand_structsas_hbastart_brkdiag_registerSenseKeydio_completeshost_statelocked_pendingbase_readls_idcore_statereply_dmadev_attr_sas_ncq_prio_enablealignsym_int80_landing_padcurrent_eventscsih_cmdsngroupspme_pollsp_offset__sigrestore_tRPM_SUSPENDEDvolnameDMA_TO_DEVICEmutexattrsbi_sectoreh_deadlinefsbasesrcu_barrier_mutex_keyswregs_state__kernel_timespeceh_should_retry_cmdhpr_lookupioc_reset_in_progress_lockd_lrud_fieldmaskcountersfaults_disabled_mappingnameidatapoweroffuntrustedminors_MPI2_SCSI_IO_REQUESTelemsizerlim_curFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagSCSIStatusQualifierdebugfs_entrywaitshow_rqcan_queuefw_event_listst_shndxmisc_deregisterreservedSL_WH_SCSI_TRIGGERS_Ti_wb_frn_historyctxsprocess_keyringset_dqblkmpt3sas_config_update_driver_trigger_pg1mpt3sas_config_update_driver_trigger_pg2mpt3sas_config_update_driver_trigger_pg3mpt3sas_config_update_driver_trigger_pg4restart_blocks_opbi_end_iokobjectposix_cputimer_baseleveluser_definedcow_page__warn_printkmsix_indexnanosleepfalsemax_reply_bytespi_state_listtv_secac_exitcodeLookupAddresssuiddeleteddiag_trigger_event_showKMALLOC_RANDOM_STARTMpi2DiagReleaseRequest_tmutex_lock_interruptibleMsgLengthdismissi_hashmm_cid_next_scanenable_sdev_max_qdfreeze_noirqoublockia_atime_timerhotplug_slotrespondingvm_private_dataskip_ms_page_8TargetCommandBuffermask_interruptsdq_freeSHOST_RUNNINGrootgot_task_abort_from_ioctlpolicycpu_baseraid_device_listMPI2_ADAPTER_ORDER_AUXdev_attr_diag_trigger_mpicap_bsetnr_itemschain_offsetseq_startbp_regbvec_poolrb_root_cachedwwidwriteli_blkbitswritervm_pgoffMPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTOR_refcountcsum_typebin_attributemath_emu_infopushable_dl_tasksValidEntriestestmanu_pg0sched_infogroup_infotailsport_typeeh_eflagsdqi_fmt_idDataLengthdevice_missing_delaysoftirq_next_timerrevisionis_child_subreapersg_tablesizeexit_codefile_lock_contextmpt3sas_host_attr_groupwriteback_indexfiemap_extent_infofilemempool_free_tProductIDrt_spc_warnlimitfilpcmndatomic_write_hw_unit_minMpi2SCSITaskManagementRequest_tdata_out_sizetimer__empty_rangessbq_wait_statedev_namei387__p_sizesysfs_emitMpi2ConfigReply_terror_stated3hot_delaywb_errbudget_tokenhba_vphywrite_dquotf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachestorebi_bdevst_infodispatchdescsquiesced_bydqi_max_ino_limitllseek_MPI2_CONFIG_PAGE_HEADERlocal_fwnodeRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleno_d1d2get_projidbuild_sg_mpi__sectorpart0cnvcswmsix_basecallskqidmem_cgroupfree_inodesiglockwait_queue_func_tperf_recursionnr_wakeups_remoted_spacei_ctime_secdebugfs_id_ctl_diag_get_bufftypenext_timer_typeTT_NATIVEhlist_bl_nodeoldbitnum_descsmpt3sas_config_get_iounit_pg3_head_1_head_2mpt3_ioctl_eventqueryclockid_MPI2_SCSI_IO_CDB_UNION__read_overflow2_fieldFREEZE_MAY_NESTsym_hvclock_pageEventDataLengthremap_file_rangemmap_legacy_baseend_dataxa_lockfutex_exit_mutexuse_16_for_rwiommu_groupProxyVF_IDEventContextmempool_alloc_tdevice_get_dma_attrtarget_blockeduint8_tMpi2BiosPage2_talloc_inodekarg32payloaddirty_foliofscrypt_keyringActionis_hardasync_sizetrap_nrfasync_structf_iocb_flagsdev_attr_board_assemblynvme_abort_timeout__flagsmultifunctionnodenametotal_vmiteratoruse_32bit_dmalastpool_dataqf_opsforce_atomicskip_bus_pmrsvdreal_credno_difblkcnt_td_rt_spacesigned charpcie_cap_lockhas_child_subreapermountreply_post_free_dmablk_flush_queueres_attr_wcsched_entitydev_links_infos_uuid_len___GFP_RETRY_MAYFAIL_BITdqi_privIOCRequestFrameSizefmode_trpm_autosuspendsweventremove_busactivatefxregs_stateSAS_SATA_SPINUP_HOLD_lowerreply_szidentifypaddingDEVICE_REMOVABLEVF_IDtimer_rand_staterequest_datallist_nodeNVMe_Commandbpf_run_ctxbio_slabDCRAddressstate_add_uevent_sentMpi2SasIoUnitControlRequest_tenv_startmodule_notes_attrsio_cqrangebvecacct_vm_mem1on_cpumanage_system_start_stopstringSHOST_CANCEL_RECOVERYnuma_preferred_nidmemsetfree_diskvmem_altmapchain_buffer_dmabiotailwait_start_MPI2_ADAPTER_INFOelevatorspinlocksrcu_barrier_seqi_aclptm_granularitytrigger_info_dwordsnofaultia_rangesq_size_fieldHostTraceBufferDecrementSizeKBis_reltablepteval_t_MPI2_IEEE_SGE_SIMPLE32blk_mq_tagsDEVICE_PANEL_LEFTorc_unwind_ipport_numberdiag_buffer_statustm_custom_handlingrel_deadlinekobj_typeskip_settle_delaysb_writersdma_cleanupeh_timed_outdriver_datais_iouring_poll_qphys_addr_tdma_iommumax_id_ctl_mpt2_ioctlirq_saferescue_lockdefault_timer_slack_nsxregs_states_statecompletion_cnt_deferred_listcurr_nrset_child_tidsasiounit_requestbio_vecacpi_match_tablenfdsrlimit_MPI2_IEEE_SGE_SIMPLE64idle_notificationmodule_stateMPT_BUILD_SG_SCMDwait_lockf_pipegetgeowrite_itersense_dataMaxDevHandleD_REAL_DATAEventValueacct_timexpdclock_mutexchain_segment_sznr_failed_migrations_runninguserfaultfd_ctxevent_flagsthread_structoldpmm_context_tenclosure_handlebd_stampdio_mem_aligncstimereplyprot_capabilitiesatomic_long_trpm_requestirq_reroute_variantpci_sriovMQ_RQ_COMPLETEio_comp_batchhi_priority_dmampt3sas_scsih_issue_locked_tmdma_alloc_attrsf_credtrace_events_MPI2_SCSI_IO_CDB_EEDP32send_aend_iputReqBootDeviceFormMPI2_VERSION_UNIONnr_wakeups_syncstackSAS_LINK_RATE_G1blockedallowedbios_versionmce_countweightblk_plugtrc_reader_nestingfpstatetag_setis_roxno_scsi2_lun_in_cdbprevseqcount_raw_spinlock_MPI2_SIMPLE_SGE_UNIONinstrument_atomic_read_writebios_parammpt3_ioctl_eventenablenum_orcsFORTIFY_FUNC_kmemdupDevHandlebuflenTransferLengthWRITE_LIFE_LONGari_enabledexpiry_activeeh_bus_reset_handlermtd_infoenclosure_levelis_confidentialreset_in_progress_mutexi_dentryfixupspcie_sg_lookupvm_endvm_structmemcgfsync_MPI2_IOC_INIT_RDPQ_ARRAY_ENTRYsgidcompat_robust_listnuma_workprioprivvalueReplyFlagsreply_qcurrent_stack_pointerac_minflt_hugetlb_cgroupset_policyinternal_tagthreadftrace_callsitesmmlistconfig_vaddrpage_typeclass_spinlock_is_conditionalmpt3sas_base_get_iocstateusermynodeseq_stopblk_traceactionpi_waitersdoe_mbsEventDatahi_priority_depthatomic_tpcp_listdiag_trigger_masterqueue_flagsMPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTORrb_rootNON_BLOCKINGExtPageLengthsubsystem_devicesas_phyutf8data_tablecpu_msix_table_szSAS_LINK_RATE_FAILEDexe_filePUT_SMID_DEFAULTcompat_ptrWordSGLOffset0SGLOffset1SGLOffset2SGLOffset3uid_t_ctl_display_some_debugelementshpr_free_listd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_datadev_attr_drv_support_bitmapmpt3_diag_registerPortTypedef_flagssrcu_n_lock_retriesraw_locksrcu_structis_guestio_minsplice_eofs_sync_lockmpt3_ioctl_pci_infoanon_vma_chaini_mtime_nsecignore_delay_removerseq_event_maskem_pdi_fsnotify_maskshared_pending__int128__mce_reservedwriteback_controldev_attr_device_delaymm_struct__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEreset_timeoutbuild_ids_export_opMPT_ADD_SGElen_descseg_boundary_maskanon_namesched_dl_entitypp_ref_countactivest_otherscsi_io_cb_idxbuffer_rel_condition___GFP_THISNODE_BITlineget_budgetlinkdiagnostic_flagsstart_timekernfs_nodeRPM_REQ_IDLEReplyFrameSizesuppliersmanu_pg0dev_tFREEZE_HOLDER_USERSPACEmsi_caphost_blockeddup_xol_addrshared_tagscapture_controlnr_wakeupsprev_fw_factsstartput_budgetstart_brkbudget_mapstatic_key_modreq_flags_td_ino_softlimitxregs_stateWRITE_LIFE_LONGdma_flagsuclamp_setag_listElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersrq_end_io_retzone_wplugs_lockbridged_releasestates_d_opmce_whole_pagestatsreadblk_mq_queue_datanetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsSAS_PROTOCOL_SSPattributessbitmap_wordcached_rqsIOCRequestFrameSizeset_child_tidblk_unique_id_overrunfound_matchtmpfilercu_read_lock_nestingem_perf_statemin_nrtick_dep_masksbitmap_queuefifo_time_MPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTORtransport_cb_idxSAS_PROTOCOL_STPlistthrottle_disksi_errnoromlenMaxVolumess_inode_lrusector_sizesrcu_size_stateblk_plugmastertracker_listscsi_host_stateneed_tsof_nodeWriteSequencerefsmmap_compat_basetrace_eventsenv_startDMA_FROM_DEVICEtotal_io_cntdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTMPI2_DEFAULT_REPLY_DESCRIPTOReh_should_retry_cmddevfnregsslice_maxlast_switch_countqsize_tevent_triggerTimeSyncIntervalfilesdevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolallow_restartbd_mappingsym_vvar_pagemodule_sect_attrsreturn_instancebio_end_io_tsoftirq_activatedSHOST_RECOVERYpdevzone_wplugs_workpcie_device_listpci_power_tclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intSUBMITTED_BY_SCSI_ERROR_HANDLERgendisk__compiletime_assert_116spc_timelimits_instancesnvme_abort_timeoutdescseqcountremove_busoom_score_adjeh_entryd_seqbi_crypt_contextinit_requestia_vfsgidprot_capabilitiessize_tacpi_device_idptm_enabledcap_permittedscsih_cb_idxinitiator_port_protocolsTT_NATIVEmask_interruptstransfersizeclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchessas_device_lockrcu_tasks_idxenclosure_levelerror_statercu_tasks_holdoutport_enable_cmdstarget_listno_64bit_msidelayed_tr_volume_listpasid_activatedpi_seinternal_free_list__compiletime_assert_125get_offset_ctxcore_forceidle_sum__compiletime_assert_127exit_requestfreeze_ucountreply_free_dma_pooli_ctime_nsecreset_wqcpuhp_deadneeds_fresetrphys_remove_countsyscall_workdevice_physical_location_vertical_positionidentifyreply_free_host_indexatomic_long_tpreallocReserved11Reserved12pfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcusas_rphypgtables_bytestarget_destroyget_linkreq_boot_devicefmode_tSTARGET_RUNNINGcputime_atomicno_difRequestDescriptorPostHighpci_channel_state_thost_lockrestoredelayed_callbi_iter__compiletime_assert_134DescriptorTypeDependent1DescriptorTypeDependent2SAS_PROTOCOL_ALLmax_nr_cid__compiletime_assert_137_statusmark_deadd_sibkernel_ulong_tdma_ops_MPI2_BOOT_DEVICE_DEVICE_NAMEbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedhdr_typelimits_lockdl_dev_stateUnitgsindexexpires_next_MPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTORi_io_listemulatedf_epminimum_linkrate_hwsrcu_barrier_seqmsi_locklinks_countreturn_consumerioc_reset_in_progress_lockrelease_dqblkin_thrashinguaddr2__kernel_timer_tdpc_rp_extensionsIocLogInfocpu_msix_tableclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskno_highmematomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodews_activetmf_in_progressfile_leasescsi_device_statemodelscan_objectspid_typewb_errcputimerfree_chain_listtrace_recursionbv_lenhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdma_drain_buf_MPI2_SYSTEM_INTERFACE_REGSrcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthchange_queue_depthdata_vm__s32entry_eiptaskstatshugetlb_usage__dummyratelimit_states_pinsEncapsulatedCommandLengthscsi_cmnd_submitterattr_entry_ptrstarget_dataget_next_child_nodeFAULT_FLAG_WRITEtm_tr_cb_idxstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDio_uring_poll_queuesblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountinq_periph_qualforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointsupported_eventsresvnr_wakeups_idleFORTIFY_FUNC_memsetOEMIdentifierio_cqres_attr_wcelf64_symdevice_blockedlatch_tree_nodeis_iouring_poll_qpercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSuse_192_bytes_for_3fBLK_UID_NAAp2pdmasyscoreprot_guard_type__s64dqi_bgrace__kernel_pid_tioc_reset_countstatic_call_modmax_cmd_len_timerdma_map_opsma_external_lockdevice_physical_location_panelhost_resetuid_tpend_os_device_add_szflush_requiredpcie_flags_regsum_block_runtimehctx_listpgmapmin_perf_statedq_opsdev_dataWordrcu_tasks_nvcswcrypt_keyslotwritetypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_poolsmsix_vector_count_addr_lsbPortNumberi_generation_sigpollprocentmxcsrdevtsas_addressd_rt_spc_hardlimitbi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexstarget_sdev_userdriver_datathread_headlast_queue_full_timeend_iodev_pm_qosserial_numberbi_sectormap_typemax_narrowport_qdf_oppids_active_resetrandomconfirm_switchpcie_sgl_dma_poolseqcount_tnuma_scan_seqport_siblingsinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizePageVersionsas_device_typeptm_granularityshost_groupsid_tabledq_sbptm_roothost_norun_worksighand_structdiag_bufferflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entryNumPerDevEvents___GFP_NOWARN_BITcmin_fltrw_semdqio_semCoreDumpTOSecprev_sum_exec_runtimenestedalloc_time_nsnr_forced_migrationsseq_operationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirinit_hctxpcie_link_statesockSCSI_EH_NOT_HANDLEDbi_write_hinthash_lenget_policytmf_work_qHRTIMER_RESTARTexternal_facingcurrent_boot_deviceSDEV_QUIESCE__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtime__ret_do_oncenumbersbi_vcnttry_rc_10_first_softexpiresMPI2_CONFIG_PAGE_HEADERrq_flagskey_user_hugetlb_cgroup_rsvdskip_ms_page_3ffaultableio_comp_batchstate_mutexhi_priorityshutdowndq_locki_cdevldt_structenv_endobj_cgroupnon_operational_looprescue_workqueueptrace_messagenum_trace_eventsptm_cap_sys_privatealignment_offsetopen_mutexscan_finishedsas_idinit_fs_contexts_subtypeheaderfuncperf_event_contextPUT_SMID_IO_FP_HIPmpt3sas_trigger_eventtlbflush_unmap_batchsoftcrypto_kobject__sifieldsswap_lockrcu_read_unlock_specialread_bytesUniqueValuefsverity_operationsirq_poll_scheduledCurrentBootDeviceFormwake_q_noderequest_key_authdispatch_busyallowedvirtual_dr6kprobes_text_sizereply_dma_poolstatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherskmalloc_cachescompletionbase_readlsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobehi_priority_dmashow_optionsdiskAdapterFlagsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodepri_capcurr_nrsector_tenclosure_handletrc_blkd_cpuin_memstallpermission_utimepm_subsys_datahost_failedbsg_devpasid_featuresscsi_target_stateget_dquots_raw_spin_unlock_irqrestoreRequestedAltBootDevicenum_orcsclass_task_lock_is_conditionalshow_rqFAULT_FLAG_MKWRITESTARGET_CREATED_REMOVEoom_reaper_timers_uuiddestroy_dquothost_eh_scheduledd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printkvm_operations_structSAS_SATA_PENDINGMpi2EventNotificationReply_tbin_attrs_newrpm_autosuspendbio_alloc_cachebi_bdevconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrendirty_folioblk_status_tis_softcntsRPM_SUSPENDEDreclaim_statechains_per_prp_buffervma_numab_staterethooksnum_symtabMPI2_VERSION_UNIONwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infosaved_cap_spacestats_sectorserror_remove_folioold_time32_tcore_kallsymslast_queue_ramp_upsrcu_parentdetachedhide_ir_msgclock_op_might_sleepenvp_idx_head_1_head_2sg_reserved_sizebd_size_locksense_keybackstate_add_uevent_sentblock_cfg_accessi_hashresultMpi2ManufacturingPage11_tSAS_LINK_RATE_G1SAS_LINK_RATE_G2hlist_nodeio_uringmax_idcore_occupationSMIDsimple_tagsftrace_timestampwritermpt3sas_trigger_masterwait_page_queuesched_remote_wakeupresumesensewake_qcmd_per_lunfileattr_setkzalloc_noprofblocking_handlesrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsproc_nameonlineruntime_resumedup_xol_workqueuestart_time_ns___GFP_WRITE_BITreply_post_free_dmaMEMORY_DEVICE_PCI_P2PDMAsdtrBoardAssemblytotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workioc_pg8oublockrecent_cidhba_portkernel_paramdeferred_resumed_spc_softlimitreported_split_lockadapter_reply_queuecur_bus_speedgfp_tswap_slot_free_notifyseccomp_filterstimereply_dma_max_addressi_mmapthaw_superd_lrusignal_structperf_event_mutexpri_enabledhtb_rel_queryreset_done_MPI2_DEFAULT_REPLY_DESCRIPTORsas_device_init_listdisconnectcrcspgdval_tpage_linksetattrput_smid_fast_pathf_mappingnoinstr_text_startprepareBLK_EH_RESET_TIMERbin_attrssas_ss_flagsf_modeki_completeDevHandlevtime_statempt3sas_ctl_add_to_event_logwakee_flipsset_aclScsi_Hostrom_attr_enabledpids_activeconfig_page_dmadriverHeaderNVME_BUILD_PRPi_opskip_bus_pmldt_usr_semMPI2_BOOT_DEVICE_ENCLOSURE_SLOTSAS_LINK_RATE_1_5_GBPSkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorescan_mutexcredjump_entryno_write_samemax_host_blockedlist_lru_nodetagset_refcntsrcu_gp_seq_needed_expinterval_expAtomicRequestDescriptorPostaddress_space_operationsRQ_END_IO_FREEspinlock_tRequestCreditshow_info__task_fpstateMsgVersion__ret_oncewait_queue_headclass_rwsem_read_try_is_conditionalevent_typefreeze_kcountwork_func_tChipRevisionfwnodeevent_data_szis_dirty_writebacktrace_bprintk_fmt_starthuge_faultpauseHostDiagnosticChipNamekstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysSequenceNumberqueue_kobjmax_sata_qdsas_hbasrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDpage_listexpires___GFP_HARDWALL_BITnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGvendor_idthreadsym_timens_pagesriov_configures_time_minbusn_ress_devcpus_allowed_lockDiagRWAddressHighget_next_idrwlock_tmax_integrity_segmentspgprotfalsed_weak_revalidatecmd_lenremovedshow_pathHostTraceBufferFlagsPIDTYPE_TGIDpriv_flagsMQ_RQ_IDLEcurr_ret_depthac_utimebus_list_dummy_pkeysense_bufferiommu_mm_datamce_countswap_info_structhost_waitsequencesge_size_ieeewas_resetSAS_LINK_RATE_22_5_GBPSrt_spc_warnlimitnr_reserved_tagsac_flagsched_rt_mutexcoredump_datatasksScratchpadSL_WH_MASTER_TRIGGER_T_pidscsi_cmndaddress_spacemm_context_t__q_sizeis_probed__call_single_nodestartupof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatorpanelclass_id__read_overflow2_fieldqueuecommand_may_blockinactive_timer_pkeyfilenames_export_opchain_offsetmsix_load_balancefront_padreplyPostRegisterIndexno_start_on_addi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_prunenr_phys_allocatedIoIndexprintedbarsunused_hctx_lockresume_noirqraid_device_lockpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inodeMaxPersistentEntriesrelease_foliolast_busyi_pipebasehostuaddrdiag_buffer_dmaHCBAddressLows_wb_errshm_clistErrorResponseBaseAddressis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descsskip_settle_delayskip_vpd_pagesexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoirq_managedqueuecommandalloc_inodeDeviceNamefwfault_debuguser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappingtrigger_bitmaskinblockrmidrseq_sigremote_identifyhandledev_pm_domainlimit0limit1nr_zonesevent_workmigrate_modebio_poolphy_identifierpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwkobjmaximum_linkrate_hwfsyncmtd_infoi_flagsblk_crypto_keyslotblk_eh_timer_returnlimitskernel_siginfouprobes_statemanage_shutdownFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeSAS_END_DEVICEblk_queue_statspushable_tasksplatform_datad_comparechain_buffer_dmasighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapalloc_dquotpm_messagemay_split__q_size_fieldmem_cgrouplast_update_timerobust_list_headmultiple_queuescurrent_stateSAS_PROTOCOL_INTERNAL_ABORT__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevelvpd_pg0__kmalloc_noprofMpi26NVMeEncapsulatedRequest_ts_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventulonghlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesioctlshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_begindrv_support_bitmapvdsommap_legacy_baseSenseKeypipe_inode_infouint16_tsecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opssas_expander_listsg_tablesizepref_windowSAS_LINK_RATE_UNKNOWNMpi2BiosPage3_tpoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalwce_default_onsuspend_latewakeupeh_abort_listcg_listlink_bwctrlsrcu_barrier_completionsdev_gendevsaved_config_spacedriver_flagsdevice_remove_in_progress_szsg_timeoutelementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapPCIDomainSegmentfiemapuse_16_for_rwwaiterssubdeviceos_irqsessioniddefault_lock_sifields_hugetlb_subpoold_manageicq_hintchip_physhandler_datafiemap_extent_infoDMA_TO_DEVICEpadding1force_runtime_start_on_system_startllistunmap_limit_for_wsdebugfs_entryacs_capelemnr_retriesbiotailCoalescingTimeoutsigval_talimitundo_listKMALLOC_RANDOM_STARTreply_post_free_dma_poolStructSAS_SATA_SPINUP_HOLDmissedPciDeviceAndFunctionNumberreport_zonesbi_idxquota_readst_shndxcmd_flagsio_start_time_nsfreeparti_wb_frn_avg_timeHCBSizebd_fsfreeze_countfile_ref_ttypemembarrier_statereply_szpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotreply_postinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tsiblingshotplug_slotpathDiagRWAddressLowst_sizebase_add_sg_singlermtpscsi_target_idwait_sumnum_tracepointsupidexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumersshost_datakernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerbreserved_tagsunlinkperiod_contribrcu_node_entrystart_scan_seqnr_ctxfsgidswap_rwneed_parent_lockrcu_syncSAS_PROTOCOL_SATAproc_dir_entryvm_opsschedule_dead_ioc_flush_running_cmdsiopollactive_queuespagesizedisk_names_blocksizevm_pgoffRQ_END_IO_NONEioc_coredump_loopauprobeno_uld_attachnuma_workupdate_timeptrace_dr7no_d1d2shost_dev_call_addrreply_post_free_array_dmarescue_lockmax_segmentsloginuidcheckWhoInitexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkgsge_size__lstatebroadcast_aen_pendingbroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvASCQmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsIOCNumbernr_mapsmod_namesdev_groupsproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlsched_tagsrseq_lenjiffies_at_allocmodule_attributeMPT_BUILD_ZERO_LEN_SGEpollfdIOCMaxChainSegmentSizenr_wakeups_remotepci_busllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionaltrigger_typepending_io_countrseq_csprimarynum_ftrace_callsitesCoalescingDepthsoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkVF_IDmigration_flagsMPT_BUILD_SGnon_compliant_barsCurrentBootDeviceconfig_cmds_pincountEventValuerq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidwrite_protect_seqsilence_suspendltr_pathcompat_robust_list_head_tidshutdown_latencylast_statuss_inode_wblist_lockfrombd_holderdiag_buffer_statusend_codeqspinlock__kmalloc_large_noproflru_geninsnfilldir_tDCRDatampi_triggermax_wideport_qddl_non_contendingdir_contexttracepoint_ptr_tutasksdev_statesched_entityd_spc_hardlimitmq_freeze_wqlong unsigned intsleep_maxmmap_basecombined_reply_index_countrescue_workio_contextmpt3sas_trigger_mpirevisiondiag_trigger_masterquiesce_depthtm_cb_idxhctx_tablegpl_symsseq_showmpt3sas_factsswait_queue_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinkinternal_depthChainOffsethrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgReqBootDeviceFormpci_device_idnodeMpi2ManufacturingPage0_tsdev_targetvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areastatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockexpecting_lun_changefault_reset_work_qatomic_write_hw_maxSCSIIOSuccessl1d_flush_killi_versionuse_10_for_msDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimeraid_device_listmfg_pg10_hide_flagstate_remove_uevent_sentlegacy_memFastPathSCSIIOSuccessfirst_minorMPT3SAS_FLUSH_RUNNING_CMDSia_sizein_hrtirqs_master_keyssas_port_listwchar_addr_bndkernel_symbolsubsys_databi_statusinternal_dmatv_secblk_integrity_checksumpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsbroadcast_aen_busynr_phys_segmentsma_rooturing_cmdnr_failed_migrations_affinerdpq_array_enableparent_devir_firmwarehigh_iops_queuesuser_cpus_ptrpi_top_taskno_read_disc_infoSasWwidslot_MPI2_CONFIG_PAGE_IO_UNIT_0actoruprobeMaxDevHandlenotifier_subscriptionss_readonly_remountsmp_affinity_enableutil_sumst_othercpu_msix_table_szi_mutex_keyWWIDksethrtimer_clock_basevruntimedisable_depthasync_scan_printki_sizedl_deadlinemax_sges_in_chain_message_hugetlb_hwpoisonubufksm_rmap_itemsnr_integrity_segments___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_twait_for_discovery_to_completeautaskuser_namespacevfsuid_traw_spinlockuse_10_for_rwtimer_autosuspendspudval_t__rcu_headwait_indexmce_vaddrquota_offdq_inusecachescsiio_depthdqi_flagsl1sssriov_set_msix_vec_countkfreeread_posstatic_call_trampbtrace_seq_pp_mapping_padlogging_levelsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenSL_WH_SCSI_TRIGGER_TMPI2_BIOSPAGE2_BOOT_DEVICEstatic_rqscodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_list__kernel_timespeclocked_pendingreset_preparechains_needed_per_ionr_deferredfown_structfeatures_lockedtracing_graph_pausequeue_numpermSDEV_BLOCKcompat_robust_listbi_blkgnr_hw_queuesconnector_nameis_msi_managedktypelockrefin_dpm_listdevice_missing_delaysrcu_struct_ptrsmm_struct_MPI2_ADAPTER_ORDER_AUXvlagi_uidhba_queue_depthtablesDMA_BIDIRECTIONALbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfn_boot_devicevm_mmphy_idTaskTagfortify_memcpy_chkdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_disk_MPI2_IOC_INIT_RDPQ_ARRAY_ENTRYrq_nextsp_offsetsrcu_cblist_invokingi_lockd_namecpuhp_onlineget_ownershipufdscrypt_ctxexe_filenr_scannedpcp_listpid_linkshba_mpi_version_belongeds_sysfs_nameMQ_RQ_IN_FLIGHTq_size_fieldrefcountnr_activevaddrrequestValidEntriesrw_hinttimeoutreport_zones_cblast_switch_timenum_classesfirmware_event_threadorc_unwind_ippcie_target_idqc_dqblkretry_hwerrormmappedseqcount_raw_spinlockbd_holder_dirbroken_intx_maskingfault_reset_work_internal_cmdkill_sbd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parametersbuild_zero_len_sge_mpieh_timed_outi_write_hintfxsaveprocess_keyringbase_cb_idxlist_op_pendingiotmo_cntDEVICE_VERT_POS_LOWER__stack_chk_failllist_headiounit_pg0iounit_pg1byteswait_startsense_dmafw_event_lockbios_pg2f_freeptrno_scsi2_lun_in_cdbclass_raw_spinlock_irqsave_try_is_conditional__ret_condshow_fdinfofixupirq_getmpi_replyhashposix_acldd_key_falsebug_addr_dispdqi_igracemax_slack_shiftHeaderVersionstarved_listclass_rwsem_write_try_is_conditional_MPI2_BOOT_DEVICE_SAS_WWIDthaw_noirqMaxSasExpanderspreempt_notifierssrcu_last_gp_endmax_channels_fsnotify_infoloss_of_dword_sync_countMPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTORmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyscsi_timeout_actionGlobalFlagsMPI2_VERSION_STRUCTremoves_magicdl_overrunallocsubvendord_parentirq_polltransparentpayloadac_minflti_sborig_nentsblk_mq_hw_ctxkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxatomic_openMPI2_BOOT_DEVICE_SAS_WWIDstart_prevent_timecondreadahead_controlblk_tracesubordinate__kernel_gid32_tPciBusNumberkernfs_open_filereset_from_userf_credconfig_cb_idxMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesbd_devslave_destroyread_newsignalfd_wqhmmapmodnameasync_put_workmknod_MPI26_NVME_ENCAPSULATED_REQUESTpri_reqs_allocctxsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapdma_alias_maskwritepagessched_statisticsheadminors__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controlfw_event_workuclampattached_handlesuper_operationsbi_cookiesplice_eofHostTraceBufferMinSizeKButil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAsas_phynentsFunctionbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idmap_nruse_16_for_syncd_rt_spc_warnsq_usage_counteri_verity_infotrig_dataphy_maskxsavetimespec_type__rb_parent_colordevres_lockspin_unlock_irqrestorebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_inforeply_post_queue_depthMPT3SAS_ADAPTERats_capblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsFORTIFY_FUNC_memscanlog_entry_qualifier_MPI2_CONFIG_PAGE_MAN_0ReplyFlagsdev_flagsvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typebroken_parity_statusdiskseqPortTypei_pagesatomic_write_hw_boundaryhlist_bl_headino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitdoe_mbspage_fragwrite_byteschardomainunix_inflightbuild_zero_len_sgeholders_dirinit_cmd_privhi_priority_smidfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledgraph_get_port_parentAddressReplymax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkgot_task_abort_from_ioctlbio_slabd_aliasrdpq_array_enable_assigned__iovcpumaskmq_hctxdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimes_rootsdma_data_directionenclosure_logical_idd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nrHostTraceBufferMaxSizeKBbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityno_report_opcodesrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_freebridge_d3parentHighPriorityCreditspecial_vec__dummy2atimecopy_file_rangeinquirytask_cputime_atomiccommit_rqsMpi2SystemInterfaceRegs_tis_aero_iocuser_definedSAS_SATA_PMkey_typeget_named_child_nodelaunder_foliocurr_targetnumberis_suspendeddma_lengthhotplugtimeout_workburstPUT_SMID_DEFAULTetypeei_funcs_MPI2_BOOT_DEVICE_ADAPTER_ORDERmodule_kobjectreply_queue_countactive_memcgSAS_PHY_DISABLEDconfig_vaddrdef_flagsd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updatetarget_blockedvendorcap_bsetopen_modearchdata_sourcepower_stateport_idSDEV_DELnr_perf_statesstack_vm_areaEventDataLengthsaved_statekernfs_elem_attrbasespcie_mpsss_bdev_filenuma_faultswork_qblist_flags_tlinux_binfmtEventTriggerEntrypage_table_lock_sigfaultcountersname_linkchipbvec_poolcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typebuild_sg_scmdsriovpolicysharedwait_queue_entrydismissd_real_typelookahead_bandio_portseq_start__targetsinternal_smidrq_qos_mutexzone_wplugs_wqraw_lockd_dnameget_dqblkPCIeEncapsulatedSuccessscsi_levelmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcechigh_iops_outstandingmin_sliceargs__poll_tfwnode_operationstarget_allocshow_devnamelogical_block_sizerun_delaytailsblk_flags_tlineno_MPI2_EVENT_NOTIFICATION_REPLYrequest_dma_szGenericFlags0GenericFlags1bi_io_vecbase_pfnget_inode_acl_addr_pkeyioc_link_reset_in_progressmigrate_foliocustom_sliceaer_capthread_keyringhosttkparam_arrayutimesecurity_supportedstart_codehostdiag_unlock_mutexis_managedissue_resetis_hardiorequest_cntEEDPTagModefsbasecompatiblesubsystem_deviceSHOST_CANCEL_RECOVERYclock_listattrsNVMe_CommanddynidsAdapterOrdereh_deadlinecpumask_tring_buffer_szswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEsoft_resetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainMpi2IOUnitPage0_tbios_paramdiag_buffer_sz_sigchldpi_offsetdiscard_granularityreset_in_progress_mutexfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetmax_lunnext_cpubsg_devicetime64_tdma_pooli_blocksnuma_faults_localityhas_child_subreaperMaxMSIxVectorsrom_bar_overlap_MPI2_REPLY_DESCRIPTORS_UNIONpref_64_windowi_acl___GFP_ZERO_BITvphys_listwrite_newlist_lockInitiatorDevHandlepm_domainmsix_indexcpu_bitmapipi_listMaxNumPhysicalMappedIDsstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statesas_identifyset_rq_budget_tokendebugfs_rootsoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagsMpi2IOCInitRDPQArrayEntryswp_entry_tMinDevHandlesas_address_parentdelayed_event_ack_listbi_inline_vecs_mapcountia_rangedomain_tagpasid_requiredhang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventhtb_relsg_prot_tablesizeget_unique_idset_performance_statephys_addr_tSHOST_CREATEDclass_preempt_is_conditionalloginfocfg_sizeconsumers_cntmodule_memoryinternalpi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacHostTraceBufferDecrementSizeKBnr_to_scanfs_parameter_specNumberOfPortsdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delaydma_cleanupmaple_treeMPI2_ADAPTER_INFOKMALLOC_DMAdentrylast_mergecpu_itimerpercpusriov_get_vf_total_msixlast_queue_full_countsupports_trigger_pagesrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupsaved_end_ionr_threads__i_nlinkReserved1Reserved2Reserved3Reserved4Reserved5Reserved6Reserved7Reserved8Reserved9pushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAconfig_page_szdelayed_workmq_listmanage_system_start_stophiwater_rsskretprobe_instancesshostrangefutex_exit_mutexpm_onlykernfs_iattrstag_alloc_policytrc_blkd_nodeignore_loginfos__sectord_spacerespondingbase_readl_ext_retrygraveyard_linkMpi2ReplyDescriptorsUnion_treply_queue_listxol_vaddrsplice_readElf64_Addrscsi_deviced_rt_spacenameblk_mq_ctxbi_iopriou_flagsnvcswEnclosureSlotKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typestate_savedi_rdevirq_reroute_variantself_exec_idreplykernfs_opsfile_lockMODULE_STATE_LIVEclearedclass_maskport_enable_failedstopnr_migrationsa_opsreq_listxa_flagssingle_lunphy_reset_problem_countfreezebin_sizemap_busclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITnr_sectorsscsi_lookup_lockd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNBLK_EH_DONEset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqblast_resetuidhash_nodesaved_tfblk_mq_queue_mapElf64_Xwordold_timespec32device_configureGET_MSIX_INDEXlock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkcpu_countis_virtfnmpt3sas_process_trigger_dataMasterDatapercpu_refhorizontal_positionioerr_cntchain_lookuppref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxDoorbellDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploMsgFlagsclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightWordsvm_file___GFP_COMP_BITpfactsmax_device_blockeds_stateuser_sizetabledev_pm_opsHostInterruptMaskcdrom_device_infoSAS_PHY_RESET_PROBLEMscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkmpt3sas_send_trigger_data_eventreset_timeoutreply_free_queue_depthkmalloc_typen_io_portdispatch_wait_lockqstrma_flagsnr_ia_rangesSAS_HAmax_user_discard_sectorsno_msifutex_stateorig_pmdqueue_lockshpc_managedthis_idacct_timexpdSHOST_DEL_RECOVERY__rcu_icq_cachesize_qprocwakeup_sourcef_posscsi_triggernext_posix_timer_id__kernel_long_tDefaulttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsSAS_SATA_PM_PORTchain_pages__le16build_nvme_prpalt_lenstart_scan_failedcinblockextableexitrpm_autosuspend_delaykernel_param_opsbus_dma_regiondpc_capio_uring_cmdthresh_holddirtied_whenpdt_1f_for_no_lun__paddingsem_undo_listpci_error_recoverystatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_head_MPI2_CONFIG_PAGE_IO_UNIT_1SL_WH_MPI_TRIGGER_Trcharfutex_pi_statekstatpci_access_mutex__kernel_uid32_t__le32dispatchq_lock_cls_keyaccess_stateDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockwake_batchget_namefwnode_endpointopt_sectorsepoll_watchesprealloc_pteprot_typesas_node_lockborkenSDEV_CANCELTargetCommandBufferdqb_curspace_entrygp_statebitsetload_avgsched_dataaccesscstimepcie_capcompletion_cntcfs_rqrq_end_io_fn_uidprot_opst_spacemm_cid_next_scanns_typescan_startmsix_enabledac_majfltpasid_enabledposix_cputimers_work_upperCurrentHostPageSizerequest_szmodule_param_attrsshort unsigned intstargetbus_flagstarget_port_protocols__le64same_target_siblingsMsgLengthpcie_sg_lookupi_mutex_dir_keymq_pollq_nodespc_warnlimitSL_WH_TRIGGERS_EVENT_DATA_Ts_encodinggpl_crcsorc_entrykeystmp_stringsmidorig_ptepasid_capdqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutexnanosleep__already_done_MPI2_BOOT_DEVICE_ENCLOSURE_SLOTSTARGET_REMOVEeh_host_reset_handlerFORTIFY_FUNC_kmemdupsbq_wait_statedq_dqb_lock__kernel_ulong_tvolnameio_mindl_periodsym___kernel_vsyscallReplyFreeHostIndexi_fsnotify_markswakeup_pathdio_mem_alignbtime__u8is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTrestartsSAS_LINK_RATE_12_0_GBPSruntime_deferred_listd_waitlocal_fwnodequeue_flagslist_lru_onedevice_physical_location_horizontal_position_MPI2_VERSION_STRUCTMPI2_ADAPTER_ORDER_AUXseq_stopMPI25_FP_SCSI_IO_SUCCESS_REPLY_DESCRIPTORpci_dev_flags_tkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidis_warpdriveaer_statss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalqueue_rqsshrinker_idbio_setrootoom_reaper_listscsi_device_handlershutdown_presym_VDSO32_NOTE_MASKIRVolumeMappingFlagswdtrbpf_storage__data_lenmq_mapno_callbacks__u16timers_activewait_countalloc_hintsig_okOEMSpecificFlags0OEMSpecificFlags1delaysqf_ownerreadaheadkmalloc_cache_typestart_stop_pwr_condpcie_device_lockmutexpgd_tnr_cpus_allowedeh_abort_handlerdiscard_alignmentHostInterruptStatusraw_spinlock_tkey_tagMaxTargetssysdatafs_flagswordworkpgprotval_tkeytypefortify_memset_chksigpendingmq_freeze_depthfsindexshstkslave_configurereserved_tagssrcu_sspSDEV_CREATEDwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdevpending_eventsirq_poll_fn__u32ptracedtrc_reader_specialdevice_get_match_dataHPROBE_GONEmax_nvme_qdactive_timei_sequencepool_datapci_vpddisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendorBASE_READ_REGi_dir_seqwakeup_preparedkqiddefer_syncaccess_statusKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTApd_handles_szbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmauclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typedpc_rp_log_sizeimm_readySL_WH_EVENT_TRIGGERS_TBLK_INTEGRITY_CSUM_CRC64f_iocb_flagsiodone_cntpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infooverride_onlyMaxInitiatorsFORTIFY_FUNC_memmovesched_contributes_to_load_sas_phystatic_key_truedisk_events_disable_depthweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimeNvdataVersionDefaultdeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacitydma_addressvm_startshost_gendevsrcu_gp_seq_neededby_pass_checkstag_list_lockunused_hctx_lists_flagsget_rq_budget_tokenAdapterOrderAuxcpumask_var_tfaultmultipath_on_hbaalternative_gpt_sectorshow_statsdl_densityfreeptr_tset_dbd_for_msread_dqblkintegritydq_flagsSAS_SATA_DEVread_before_msnext_cpu_batchDD_CLASS_TYPE_DISJOINT_NAMESpci_devp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgdma_boundarys_time_grankernel_cap_tSUBMITTED_BY_SCSI_RESET_IOCTLnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITReserved10num_kpPCIBusNumin_execvehost_tagsettlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_lockno_report_lunss_dquotmax_hw_sectorsfolioqtm_cmdstagsprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uidinvalid_dword_countchildrenrb_subtree_lastno_pm_callbacksMaxEnclosuresbuild_idrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_paddevice_infotailia_atimelasttlb_ubcbi_issuevphys_maskquota_format_typemsi_enabledseeksis_driver_loadingtask_structbudget_tokenrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextpcie_device_init_listio_tlb_memis_gen35_iochost_self_blockedarch_spinlock_tsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometrymanufacturerdevcapsuppress_bind_attrsRPM_RESUMINGreg_offsetgsbasedispatch_waits_quota_typesinternal_tagf_llistSAS_PHY_VIRTUALmq_freeze_locki_nlinksdev_devbranchwrite_begingroupserr_handlerno_vf_scanpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalfw_events_cleanupstart_scanon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdriver_namedl_serverSCSI_EH_RESET_TIMERtrc_reader_nestingin_userestart_blockumode_tMpi2IOCPage8_tIOCLogInfoshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_supers_inode_list_lockelevator_queueruntime_idletm_custom_handlingsweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typeBoardTracerNumbermaj_fltarch_rwlock_tctx_mapSHOST_DELput_smid_hi_priorityclock_basediag_trigger_lockcdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalEventDatabpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosfsavekeyring_index_keyqrwlockfast_pathRequestDescriptorPostLowfile_ra_stateuser_structon_rq__p_size_fieldfs_contextmempool_alloc_tNumDevsPerEnclosureprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vf_sas_nodeinternal_lookupunsafe_warnllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameport_enable_cb_idxpoll_queue_prochi_priority_depthunfreeze_fsintervalclasssas_linkrateVP_IDlast_mm_ciduntrustedbuild_sgmax_open_zonescookiebd_stampSTARGET_DELSAS_FANOUT_EXPANDER_DEVICEtargetstarved_entrya_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_tSL_WH_EVENT_TRIGGER_Ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structsense_lencred_guard_mutexbusymajorenclosure_listpci_opssigcnthrtimer_cpu_baseresourcescb_headcheck_quota_fileFORTIFY_FUNC_memchrattributerestrict_linkdev_archdatampi3_version_unioni_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheclass_disable_irq_is_conditionalchain_depthanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrtry_vpd_pagesi_opflagsrobust_listbase_cmdssym___kernel_rt_sigreturnreply_post_freesym_pvclock_pagemmio_enabledserial_nodelen_desc_MPI2_CONFIG_PAGE_BIOS_2_MPI2_CONFIG_PAGE_BIOS_3s_incoredqsd_iputcompat_ioctllockdep_mapfilterMpi2BiosPage2_tcurr_ret_stacklast_queue_full_depth__compiletime_assert_451dockenable_sdev_max_qddev_links_infoloff_tthread_pidinquiry_mutexsrcu_gp_seqia_rangesno_command_memory_archport_numst_valueclass_write_lock_irq_is_conditionalDiagRWDataKOBJ_NS_TYPESpprevcallseh_actioni_default_acleh_target_reset_handlers_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeProductSpecificcombined_reply_queueicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_masknr_requestsHPROBE_STABLENVMeAbortTOIOCStatusrq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorspci_error_handlersWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tMPI2_ADDRESS_REPLY_DESCRIPTORFAULT_FLAG_KILLABLEinodesclass_namestarget_busys_mtdkparam_stringpowerma_lockcleanup_rqevent_flagssched_delayedbd_statsbi_sizeascqsupported_modemodule_state__write_overflow_fieldmq_kobjlast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__stateRPM_REQ_NONEfirstiommu_groupdispatch_fromdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keypcie_sg_listvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexpcie_sgl_dmai_private_dataElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxySASAddresscan_wakeupxol_areatransporttreply_post_host_indexrlockfactsfl_owner_t_rescls_mskRAIDAcceleratorSuccesseuidwaitbug_tabledirtied_time_whendma_drain_lensequential_io_avgexit_cmd_privnum_trace_bprintk_fmtqueue_ramp_up_periodMPITriggerEntryvm_policyperf_rdpmc_allowedrdevprivate_dataput_smid_scsi_ioDEVICE_PANEL_TOPsignumfscrypt_keyringtemp_sensors_counts_mountsuse_memdelayRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpbvec_iterpage_sizectimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenpme_supportdqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetSHOST_RUNNINGblk_crypto_profiledma_devfolio_queuelast_task_numa_placementreply_post_free_arraySAS_LINK_RATE_3_0_GBPSpgtable_tblock_startcgtimedelayed_tr_listsymlinkoom_flag_originDMA_NONEcounterorc_unwindSAS_LINK_RATE_FAILEDMpi2IOCPage1_tWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqio_queue_numReplyFrameAddresstrace_eval_mapdoneSlotNumberring_buffer_offsetfscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexMpi2IOUnitPage1_tioc_statusratelimitfree_foliodebugfs_dirdriver_managed_dmaqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotactl_cb_idxreq_alt_boot_deviceem_perf_tabledl_timerbuild_sg_mpii_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsend_io_datablkcg_gqmap_queuesdelayed_sc_listia_filesival_intnuma_preferred_niddma_need_drain_mpt3sas_raise_sigio_hugetlb_cgroupdentry_operationschannelmemcg_nr_pages_over_highd1_supportqueue_offsetarch_uprobe_Boolsleep_start__p_sizeDCRAddressmin_fltwwidconfig_pageHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatereverse_orderingi_linkresetlistxattr_lowertrap_nrmax_queue_depthasync_probe_requestedcompat_long_tactive_counts_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupswakeup_cntpmd_ts_opsysv_shmIOCCapabilitiesdma_channellast_sector_bugdq_countMPI2_BOOT_DEVICE_DEVICE_NAMEutf8data_tableset_latency_tolerance__func__resource_size_tnr_tagsfoliowake_entryxa_headsuidport_table_listchain_trackeri_readcountmanage_runtime_start_stopblk_integritylocked_vmminimum_linkraterb_leftseq_nextguess_capacitysym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_lentm_tr_volume_cb_idx__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tmax_shutdown_latencyquota_syncdq_free__bd_flagsparent_exec_idignore_media_changeretrieskernfs_elem_dirsrcu_lock_countksm_merging_pagesSAS_PHY_RESET_IN_PROGRESSautosleep_enabledptrace_entryblkg_listhost_scribblerecent_used_cpunum_jump_entriess_qcopatomic_tbv_pageevent_logalloc_tag_counters_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitPCISlotNumshort intmynodepart_tblmaximum_linkratezone_wplugs_hashblk_mq_opsscatterlistbridge_ctlclass_raw_spinlock_irqsave_is_conditionalioc_dumplockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirirqpollVTIME_USERsa_flagstestSAS_EDGE_EXPANDER_DEVICEBLK_INTEGRITY_CSUM_CRCtime_sync_interval__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invpad_untilDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerextra_lenprio_listatomic_write_hw_unit_max_flags_1_flags_2eh_device_reset_handlersbitmaplast_arrivalsupported_speedsem_pdctl_cmdstrace_event_callMPI2_BOOT_DEVICE_ADAPTER_ORDERis_guestdevice_physical_locationpm_domain_dataeh_eflags_MPI2_ADAPTER_INFOpoll_table_structdirect_IOSTARGET_CREATEDReqAltBootDeviceFormfw_event_listwait_queue_entry_televatorcurrent_may_mountseqlock_tskip_ms_page_8bd_queuenuma_scan_offsetreply_dma_min_addressdiag_trigger_activeirq_line_enable___GFP_NO_OBJ_EXT_BITsched_migratedfrozenDataLengthmlock_countin_lru_faultgrpmaskvpd_pg80vpd_pg83vpd_pg89__ret_warn_onregfunctm_sas_control_cb_idxindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validis_mcpu_endpointvertical_positionFORTIFY_FUNC_strncatdiag_trigger_mpii_rcui_atime_secFlagsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITpcie_bwctrl_dataactiveselect_no_atnmpt3sas_send_diag_releasedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listEventno_read_capacity_16tagged_supportedMinorreap_refxarray_start__flagsp_size_fieldfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atscsi_host_templatelast_sum_exec_runtimeiov_iteria_gidSDEV_OFFLINEmanu_pg10manu_pg11attribute_groupMQ_RQ_COMPLETEcontextposix_timersdriver_exclusive_resourceselectorblkcg_polsMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasebi_nextdefault_timer_slack_nspend_os_device_addoffline_alreadysource_listtrigger_info_dwords_keyswap_readahead_info__fpstateactive_refreply_dmaremove_hostpmdval_t___GFP_NOFAIL_BITgroup_infovdso_imageAckRequiredreply_post_structblk_qc_tNvdataVersionPersistentfileof_match_tablepercpu_count_ptr__user_state_sizeMPT_BUILD_SG_SCMDpcie_cap_lockmce_kill_menegotiated_linkratephysical_block_sizeuuid_teh_noresumeproperty_read_int_arraySCSI_EH_DONE___GFP_UNUSED_BITatomic_write_hw_unit_mincount_objectsq_size_stimezone_device_datanr_active_requests_shared_tagsMPT_ADD_SGEf_wb_errio_uring_poll_queuequeuelistphysfndefparamMaxReplyDescriptorPostQueueDepthresid_lenfred_csq_lockdep_mapinquiry_lenreply_post_free_array_dma_poolfault_flagreventsMajorkprojid_tptracer_credtlb_genstoreio_lock_cls_keySDEV_TRANSPORT_OFFLINEpage_mkwritekobjectaudit_ttympt3sas_port_factsmce_ripvstatfstag_setBiosVersionats_enablednumab_stateremovablecan_queueEventContextfeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistreply_free_MPI2_CONFIG_PAGE_IOC_1eetlp_prefix_pathclass_groups_MPI2_CONFIG_PAGE_IOC_8sas_device_listnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedcmndsysfs_registerednum_physAddlFlags2AddlFlags3debugfs_mutexwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opserror_detectedsequential_iois_busmasterSHOST_CANCEL_large_mapcountsda_is_static__compiletime_assert_109formatftopenclave_pcie_deviceSDEV_CREATED_BLOCKbi_privateMPI26_PCIE_ENCAPSULATED_SUCCESS_REPLY_DESCRIPTORexit_hctxrequest_dmacreateiattrreply_qrseqSAS_PROTOCOL_STP_ALLMSIxIndexnfdssigvalvma_lockmax_discard_segmentsperf_event_listgetgeo__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115get_reserved_space__compiletime_assert_117__compiletime_assert_118__compiletime_assert_119hpr_lookupnon_seqstack_refcountinvalidate_lockbmapkey_payloadevent_data_MPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTORtimer_rand_stated_reallink_stateexpiry_activesas_protocol__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124timestamp_update_count__compiletime_assert_126dqi_max_spc_limit__compiletime_assert_128__compiletime_assert_129SCSITriggerEntryexception_table_entryvirt_boundary_maskevent_countProtocolFlagsfallocatei_spc_warnlimitbuddy_listcdl_enablei_ino_timelimitSDEV_RUNNING__compiletime_assert_130__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135__compiletime_assert_136mems_allowed__compiletime_assert_138bios_pg3tlb_flush_batched_ddebug_infoslave_allocis_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startblocksphy_belongs_to_portset_infofileattr_gethandlervectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcat__devices__bi_cnttimer_list_olddevice_dma_supported_MPI2_ADDRESS_REPLY_DESCRIPTORd_ino_warnsMPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORhiwater_vmtracepointPageLengthcompound_headproduct_specificia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqsrcuunique_idrenamevm_area_structrpm_statussb_writersino_timelimitErrorResponseAllocationLengthpci_bus_flags_tsplice_writemsix_capi_rt_spc_timelimit_raw_spin_lock_irqsaverom_base_regqf_nextcdl_supportedio_window_1krangesiommu_mmats_stublk_features_tcutimeem_tableprot_flagspersonalityget_stateIOCExceptionstask_sizes_inodes_addrbinfmtirq_domainnr_queuessigned charprioprivgetattrsched_infod_fieldmaskquiesced_byuprobe_xol_opsseq_filefreeze_noirqrdpq_array_capablescsircu_tasks_idle_cpuwrite_file_infofilter_countget_aclpasid_no_tlpsync_fsparam_locksi_signoenabledfixupsfile_operationsqueue_rqKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tag_killktime_tsymsgroup_nodePageNumberi_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasepins_MPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORpacct_structmust_resumeget_msix_index_for_smlioioc_pg1_copyTargetAssistSuccesslong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ssproperty_presentexpecting_cc_ua__kmalloc_index__write_overflownr_ioscurrent_eventprintk_index_sizesymtabfree_diskaen_event_read_flagsg_tablert_mutex_waiterremount_fss_typeruntime_statusin_iowaitlun_in_cdbunregfuncegidiomap_MPI2_MPI2_BIOSPAGE2_BOOT_DEVICEchain_segment_szdq_hashput_superevent_contextput_smid_defaultfwnode_reference_argspushable_dl_tasksf_flagsiopoll_q_start_indexcodetagtransport_cmdsPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_doneis_thunderboltmark_dirtyeh_cmd_qMaxPostedCmdBuffersnum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameReplyPostHostIndexTT_NONEMPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTORio_missing_delayVTIME_INACTIVEf_inodempt3sas_trigger_scsicancelled_write_bytessrcu_usagebitmapacpi_match_tablesc_data_directionmemcg_sigvalFWVersionhide_drivesbvecnameidatalatency_recordchain_bufferBoardNamemod_kallsymsmnt_idmax_sges_in_main_messagemultifunctiondepthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_colddma_addr_tshiftcheck_eventsssize_tProductIDiopl_emulmax_write_zeroes_sectorswork_structdesc_lenflocktrack_queue_depthtask_io_accountingmremaphprobe__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structmax_target_blockedrunning_disparity_error_countpr_opspi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqreply_free_dmaevent_listshost_recoveryPageTypeclass_spinlock_irq_try_is_conditionaloom_mmehandlerFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lrud3cold_allowedFORTIFY_FUNC_strcpyqueue_depthmsix_enableunderflowgfp_maskpi_state_listrcu_segcblistsubvolsubmitterfault_reset_work_q_namefree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infomq_rq_statesrcu_structrlim_curnofaultmm_countdrv_groupsstackscsi_data_bufferfunctionki_flagsRequestedBootDevicebd_start_sect___GFP_IO_BITcb_idxsrcu_have_cbsd_in_lookup_hasheh_timeoutmax_sectorssgidinitial_nsFREEZE_MAY_NESTscsi_transport_templatesdev_bflagsbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsemSL_WH_SCSI_TRIGGERS_Tget_projidatomic_desc_capablesched_reset_on_forkmq_ctxHPROBE_CONSUMEDMPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTORbpf_net_contextopc1__int128 unsignedpcountwake_indexrestore_noirqdma_pad_maskSL_WH_MPI_TRIGGERS_Tki_filpbitmap_tagsdrv_internal_flagscap_ambientdma_configureruntime_erroractive_modeatomic64_tanon_vmause_32bit_dmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folioSAS_PHY_UNUSEDnr_events_MPI2_CONFIG_PAGE_HEADERchains_per_smid_MPI2_VERSION_UNIONHCBAddressHighiommubi_opfprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxscsi_vpdtph_enabledsplice_pipehostdatashort_inquiryblk_mq_tag_setSAS_SATA_PORT_SELECTORspinlock_checkblk_independent_access_rangess_lock_keyReservedsrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsslotsSUBMITTED_BY_BLOCK_LAYERtqheadeh_bus_reset_handlers_activediag_trigger_eventMEMORY_DEVICE_FS_DAXhpr_free_listclass_mutex_is_conditionalremap_file_rangemin_shallow_depthnr_hangssym_vvar_startgid_twake_cpuchainedio_uring_taskrequest_trackerabort_worktask_worksmemory_failurerb_root_cachedSAS_PROTOCOL_NONEs_copnvme_mdtsdd_key_truehres_activebpf_raw_eventsdq_dirtyscsih_cmdsdl_deferround_robinbug_listdirect_completeblk_mq_tagswbt_flagsxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countlockableLogEntryQualifierkey_restrictionnr_rangeexit_statepd_handlesRDPQBaseAddressis_late_suspendedsysvsemadd_busshost_statebd_nr_sectorsMaxChainDepthhba_vphyignore_childrenresourcerestore_earlyclock_mutexfs_superssense_dma_poolqueue_stoppedvpd_pgb0vpd_pgb1vpd_pgb2chain_dma_poolvpd_pgb7Mpi2ManufacturingPage10_tdqb_bsoftlimitpendingmax_dev_sectorsno_vpd_sizef_task_workdiag_trigger_scsi___GFP_NORETRY_BITiowait_countmatch_driverprot_sdbset_read_onlythrotl_datadma_io_tlb_memstringread_countfix_capacityfutex_offsetlong long intmmio_always_onevent_masksatomic_flagssysvshmpcie_sgldevice_remove_in_progresstimer_expirestrace_evalsactive_basesearly_initrcec_eacmd_sizemprotectsecurityxmm_spaceSAS_PROTOCOL_SMPSAS_LINK_RATE_6_0_GBPSactivatescsi_targetmsix_basef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structbroken_fua___GFP_FS_BITi_bytesdomain_datarelax_countEnclosureLogicalIDtagset_freedscsi_io_cb_idxbuffer_rel_condition___GFP_THISNODE_BITlineget_budgetlinkdiagnostic_flagsstart_timekernfs_nodeRPM_REQ_IDLEReplyFrameSizesuppliersmanu_pg0dev_tFREEZE_HOLDER_USERSPACEmsi_caphost_blockeddup_xol_addrshared_tagscapture_controlnr_wakeupsprev_fw_factsstartput_budgetstart_brkbudget_mapstatic_key_modreq_flags_td_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_setag_listElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersrq_end_io_retzone_wplugs_lockbridgectl_cmdsd_releasestates_d_opmce_whole_pagestatsreadblk_mq_queue_datanetlink_nsneed_qsswap_deactivatempt3sas_setup_direct_ioblkcnt_ticq_treesi_codethread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsSAS_PROTOCOL_SSPattributessbitmap_wordpd_handlecached_rqsIOCRequestFrameSizeset_child_tidblk_unique_id_overruntmpfilercu_read_lock_nestingem_perf_statemin_nrtick_dep_masksbitmap_queuefifo_time_MPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTORtransport_cb_idxSAS_PROTOCOL_STPlistthrottle_disksi_errnoromlenMaxVolumess_inode_lrusector_sizesrcu_size_stateblk_plugVolumeSettingstracker_listscsi_host_stateneed_tsof_nodeWriteSequencerefsmmap_compat_basetrace_eventsenv_startDMA_FROM_DEVICEtotal_io_cntdma_addrcnivcswd_flagsxattr_handlerfreeze_lateGUIDd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTMPI2_DEFAULT_REPLY_DESCRIPTOReh_should_retry_cmddevfnregsslice_maxlast_switch_countqsize_tTimeSyncIntervalfilesdevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolallow_restartbd_mappingsym_vvar_pagemodule_sect_attrspd_pg0return_instancebio_end_io_tsoftirq_activatedSHOST_RECOVERYpdevzone_wplugs_workpcie_device_listpci_power_tclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intSUBMITTED_BY_SCSI_ERROR_HANDLERgendiskspc_timelimits_instancesnvme_abort_timeoutdescseqcountremove_busoom_score_adjeh_entryd_seqbi_crypt_contextinit_requestia_vfsgidprot_capabilitiesSecondaryReferenceTagsize_tacpi_device_idptm_enabledcap_permittedscsih_cb_idxinitiator_port_protocolsTT_NATIVEmask_interruptstransfersizeclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchessas_device_lockrcu_tasks_idxenclosure_levelerror_statercu_tasks_holdoutport_enable_cmdstarget_listno_64bit_msidelayed_tr_volume_listpasid_activatedpi_seinternal_free_listget_offset_ctxcore_forceidle_sumexit_requestfreeze_ucountreply_free_dma_pooli_ctime_nsecreset_wqcpuhp_deadGlobalFlagsrphys_remove_countsyscall_workdevice_physical_location_vertical_positionidentifyreply_free_host_indexatomic_long_tpreallocReserved11Reserved12pfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcusas_rphypgtables_bytestarget_destroyget_linkreq_boot_devicefmode_tSTARGET_RUNNINGcputime_atomicno_difRequestDescriptorPostHighpci_channel_state_thost_lockrestoredelayed_callbi_iterDescriptorTypeDependent1DescriptorTypeDependent2SAS_PROTOCOL_ALLmax_nr_cid_statusmark_deadd_sibkernel_ulong_tdma_ops_MPI2_BOOT_DEVICE_DEVICE_NAMEbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedhdr_typelimits_lockdl_dev_stateUnitgsindexexpires_next_MPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTORi_io_listemulatedf_epminimum_linkrate_hwsrcu_barrier_seqmsi_locklinks_countscsi_cmd_privreturn_consumerioc_reset_in_progress_lockrelease_dqblkin_thrashinguaddr2__kernel_timer_tskip_vpd_pagesIocLogInfocpu_msix_tableclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskno_highmematomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodews_activetmf_in_progressfile_leasescsi_device_statemodelscan_objectspid_typewb_errcputimerfree_chain_listtrace_recursionbv_lenhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdma_drain_buf_MPI2_SYSTEM_INTERFACE_REGSrcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthchange_queue_depthdata_vm__s32entry_eiptaskstatshugetlb_usage__dummyratelimit_states_pinsEncapsulatedCommandLengthSerialNumscsi_cmnd_submitterattr_entry_ptrstarget_dataget_next_child_nodeFAULT_FLAG_WRITEtm_tr_cb_idxstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDio_uring_poll_queuesblk_independent_access_rangempt3sas_raid_device_find_by_handlefind_special_pagebacktrace_entire_mapcountinq_periph_qualApplicationTagTranslationMaskforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointsupported_eventsresvnr_wakeups_idleOEMIdentifierio_cqres_attr_wcelf64_symdevice_blockedmpt3sas_config_get_raid_volume_pg0latch_tree_nodeis_iouring_poll_qpercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listscsiio_trackerPROBE_FORCE_SYNCHRONOUSuse_192_bytes_for_3fBLK_UID_NAAp2pdmasyscoreprot_guard_type__s64dqi_bgrace__kernel_pid_tioc_reset_countstatic_call_modmax_cmd_len_timerdma_map_opsma_external_lockdevice_physical_location_panelhost_resetuid_tpend_os_device_add_szflush_requiredpcie_flags_regsum_block_runtimehctx_listpgmapmin_perf_statedq_opsdev_dataWordrcu_tasks_nvcswcrypt_keyslotwritetypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionaldma_poolsmsix_vector_count_addr_lsbPortNumberi_generation_sigpollprocentmxcsrdevtd_rt_spc_hardlimitbi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexstarget_sdev_userdriver_datathread_headlast_queue_full_timeend_iodev_pm_qosserial_numberbi_sectormap_typemax_narrowport_qdf_oppids_active_resetrandomconfirm_switchno_callbackspcie_sgl_dma_poolseqcount_tnuma_scan_seqport_siblingsinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizePageVersionsas_device_typeptm_granularityshost_groupsid_tabledq_sbptm_roothost_noEEDPFlagsrun_worksighand_structdiag_bufferflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entrysdevNumPerDevEvents___GFP_NOWARN_BITInactiveStatuscmin_fltrw_semdqio_semCoreDumpTOSecprev_sum_exec_runtimenestedalloc_time_nsnr_forced_migrationsseq_operationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootSenseBufferLowAddressnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirinit_hctxpcie_link_statesockSCSI_EH_NOT_HANDLEDbi_write_hinthash_lenget_policytmf_work_qHRTIMER_RESTARTexternal_facingcurrent_boot_deviceSDEV_QUIESCE__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadfind_first_bitclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbers_MPI2_IEEE_SGE_SIMPLE64bi_vcnttry_rc_10_first_softexpiresMPI2_CONFIG_PAGE_HEADERrq_flagskey_user_hugetlb_cgroup_rsvdskip_ms_page_3ffaultableio_comp_batchstate_mutexhi_priorityshutdowndq_locki_cdevldt_structenv_endobj_cgroupnon_operational_looprescue_workqueueptrace_messagenum_trace_eventsSGLOffset3_sys_privatealignment_offsetopen_mutexscan_finishedsas_idinit_fs_contexts_subtypeheaderfuncperf_event_contextPUT_SMID_IO_FP_HIPtlbflush_unmap_batchsoftcrypto_kobject__sifieldsswap_lockrcu_read_unlock_specialread_bytesUniqueValuefsverity_operationsirq_poll_scheduledCurrentBootDeviceFormwake_q_noderequest_key_authdispatch_busyallowedvirtual_dr6kprobes_text_sizereply_dma_poolstatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherskmalloc_cachescompletionbase_readlsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobeMPI2_RAIDPHYSDISK0_INQUIRY_DATAshow_optionsdiskAdapterFlagsbpf_raw_event_mapsize_is_constant__baseFREEZE_HOLDER_KERNELcore_nodepri_capcurr_nrsector_tenclosure_handletrc_blkd_cpuin_memstallpermission_utimepm_subsys_datahost_failedbsg_devpasid_featuresscsi_target_stateget_dquots_raw_spin_unlock_irqrestoreRequestedAltBootDevicenum_orcsclass_task_lock_is_conditionalshow_rqFAULT_FLAG_MKWRITESTARGET_CREATED_REMOVEoom_reaper_timers_uuiddestroy_dquothost_eh_scheduledd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structbin_attrs_newrpm_autosuspendbio_alloc_cachebi_bdevconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsRPM_SUSPENDEDreclaim_statechains_per_prp_buffervma_numab_staterethooksnum_symtabMPI2_VERSION_UNIONwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infosaved_cap_spacestats_sectorserror_remove_foliompt3sas_get_num_volumesold_time32_tcore_kallsymslast_queue_ramp_upsrcu_parentdetachedhide_ir_msgclock_op_might_sleepenvp_idx_head_1_head_2sg_reserved_sizebd_size_lockbackstate_add_uevent_sentblock_cfg_accessi_hashresultMpi2ManufacturingPage11_tSAS_LINK_RATE_G1SAS_LINK_RATE_G2hlist_nodeio_uringmax_idcore_occupationSMIDsimple_tagsftrace_timestampwriterwait_page_queuesched_remote_wakeupresumesensewake_qcmd_per_lunfileattr_setkzalloc_noprofblocking_handlesrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsproc_nameonlineruntime_resumedup_xol_workqueuestart_time_ns___GFP_WRITE_BITreply_post_free_dmaMEMORY_DEVICE_PCI_P2PDMAsdtrBoardAssemblytotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workioc_pg8oublockrecent_cidhba_portkernel_paramrom_bar_overlapdeferred_resumed_spc_softlimitreported_split_lockadapter_reply_queuecur_bus_speedgfp_tswap_slot_free_notifyseccomp_filterstimereply_dma_max_addressi_mmapthaw_superd_lrusignal_structperf_event_mutexpri_enabledhtb_rel_queryreset_done_MPI2_DEFAULT_REPLY_DESCRIPTORsas_device_init_listdisconnectcrcspgdval_tpage_linksetattrput_smid_fast_pathf_mappingnoinstr_text_startprepareBLK_EH_RESET_TIMERbin_attrssas_ss_flagsf_modeki_completeDevHandlevtime_statewakee_flipsset_aclScsi_Hostrom_attr_enabledpids_activeconfig_page_dmadriverHeaderNVME_BUILD_PRPi_opblk_crypto_keyslotldt_usr_semMPI2_BOOT_DEVICE_ENCLOSURE_SLOTSAS_LINK_RATE_1_5_GBPSkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorescan_mutexcredjump_entryno_write_samemax_host_blockedlist_lru_nodetagset_refcntsrcu_gp_seq_needed_expinterval_expAtomicRequestDescriptorPostaddress_space_operationsRQ_END_IO_FREEspinlock_tRequestCreditshow_info__task_fpstateMsgVersionwait_queue_headclass_rwsem_read_try_is_conditionalevent_typefreeze_kcountwork_func_tChipRevisionfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultpauseHostDiagnosticChipNamekstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsExtPageTypegrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysSequenceNumberqueue_kobjmax_sata_qdsas_hbasrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDpage_listexpires___GFP_HARDWALL_BITnivcswMPI25_IEEE_SGE_CHAIN64MODULE_STATE_GOINGDL_DEV_UNBINDINGvendor_idthreadsym_timens_pagesriov_configures_time_minbusn_ress_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalsed_weak_revalidatecmd_lenremovedshow_pathHostTraceBufferFlagsPIDTYPE_TGIDpriv_flagsMQ_RQ_IDLEcurr_ret_depthac_utimebus_list_dummy_pkeysense_bufferiommu_mm_datamce_countswap_info_structhost_waitsequencesge_size_ieeewas_resetSAS_LINK_RATE_22_5_GBPSrt_spc_warnlimitnr_reserved_tagsac_flagMaxLBAsched_rt_mutexcoredump_datatasksScratchpadSL_WH_MASTER_TRIGGER_T_pidscsi_cmndaddress_spacemm_context_tis_probed__call_single_nodestartupof_device_idseqcount_spinlock_tbio_issuei_wbSGLOffset0SGLOffset1SGLOffset2has_elevatorpanelclass_idPhysDiskAttributesqueuecommand_may_blockinactive_timer_pkeyfilenames_export_opchain_offsetmsix_load_balancefront_padreplyPostRegisterIndexno_start_on_addi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_prunenr_phys_allocatedIoIndexprintedbarsunused_hctx_lockresume_noirqraid_device_lockpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsRAIDSetNumdestroy_inodeMaxPersistentEntriesrelease_foliolast_busyi_pipebasehostuaddrdiag_buffer_dmaHCBAddressLows_wb_errshm_clistErrorResponseBaseAddressis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descsskip_settle_delayexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffs_MPI2_SCSI_IO_CDB_EEDP32last_siginfoirq_managedqueuecommandalloc_inodeDeviceNamefwfault_debuguser_event_mmKMALLOC_RECLAIMd_inameIoFlagsdevres_headi_mappinginblockrmidrseq_sigremote_identifyhandledev_pm_domainSenseBufferLengthlimit0limit1nr_zonesevent_workmigrate_modebio_poolphy_identifierpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwkobjmaximum_linkrate_hwfsyncmtd_infoi_flagsblk_eh_timer_returnlimitskernel_siginfouprobes_statemanage_shutdownFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeSAS_END_DEVICEblk_queue_statspushable_tasksplatform_datad_comparechain_buffer_dmasighanditerate_sharedSupportedPhysDisksis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headmultiple_queuescurrent_stateSAS_PROTOCOL_INTERNAL_ABORT__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevelvpd_pg0__kmalloc_noprofMpi26NVMeEncapsulatedRequest_ts_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventulonghlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesioctlshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_begindrv_support_bitmapvdsommap_legacy_baseSenseKeypipe_inode_infouint16_tsecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opssas_expander_listsg_tablesizepref_windowSAS_LINK_RATE_UNKNOWNMpi2BiosPage3_tpoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalwce_default_onsuspend_latewakeupeh_abort_listcg_listlink_bwctrlsrcu_barrier_completionsdev_gendevsaved_config_spacedriver_flagsdevice_remove_in_progress_szsg_timeoutelementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapPCIDomainSegmentfiemapuse_16_for_rwwaiterssubdeviceos_irqsessioniddefault_lock_sifields_hugetlb_subpoold_manageicq_hintchip_physhandler_datafiemap_extent_infoDMA_TO_DEVICEpadding1force_runtime_start_on_system_startllistunmap_limit_for_wsdebugfs_entryacs_capelemnr_retriesbiotailCoalescingTimeoutsigval_talimitundo_listKMALLOC_RANDOM_STARTreply_post_free_dma_poolStructSAS_SATA_SPINUP_HOLDmissedPciDeviceAndFunctionNumberreport_zonesbi_idxquota_readst_shndxcmd_flagsio_start_time_nsfreeparti_wb_frn_avg_timeHCBSizebd_fsfreeze_countfile_ref_ttypemembarrier_statereply_szpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizevol_pg1user_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotreply_postinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tsiblingshotplug_slotpathDiagRWAddressLowst_sizebase_add_sg_singlermtpscsi_target_idwait_sumnum_tracepointsupidexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumersshost_datakernfs_elem_symlinkclock_was_set_seqdma_alias_maskDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerbreserved_tagsunlinkperiod_contribrcu_node_entrystart_scan_seqnr_ctxfsgidswap_rwneed_parent_lockrcu_syncSAS_PROTOCOL_SATAproc_dir_entryvm_opsschedule_dead_ioc_flush_running_cmdsiopollactive_queuespagesizedisk_namehi_priority_dmas_blocksizevm_pgoffRQ_END_IO_NONEioc_coredump_loopauprobeno_uld_attachnuma_workupdate_timeptrace_dr7no_d1d2shost_dev_call_addrreply_post_free_array_dmarescue_lockmax_segmentsloginuidcheckWhoInitexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkgsge_size__lstatempt3sas_init_warpdrive_propertiesbroadcast_aen_pendingbroken_cmd_complchain_listueventlock_countrefcount_tplugchild_countsaved_auxvASCQmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsIOCNumbernr_mapsmod_namesdev_groupsproperty_read_string_arraymm_cidunlocked_ioctlsched_tagsrseq_lenjiffies_at_allocmodule_attributeMPT_BUILD_ZERO_LEN_SGEpollfdIOCMaxChainSegmentSizenr_wakeups_remotepci_busllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionaltrigger_typepending_io_countrseq_csprimarynum_ftrace_callsitesCoalescingDepthsoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkVF_IDmigration_flagsMPT_BUILD_SGnon_compliant_barsCurrentBootDeviceconfig_cmds_pincountEventValuerq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidwrite_protect_seqsilence_suspendltr_pathcompat_robust_list_head_tidshutdown_latencylast_statuss_inode_wblist_lockfrombd_holderInquiryDatadiag_buffer_statusend_codeqspinlock__kmalloc_large_noproflru_geninsnfilldir_tDCRDatamax_wideport_qd__must_check_overflowdl_non_contendingdir_contexttracepoint_ptr_tutasksdev_statesched_entityCDB32d_spc_hardlimitmq_freeze_wqreply_dma_min_addresslong unsigned intsleep_maxmmap_basecombined_reply_index_countrescue_workio_contextrevisiondiag_trigger_masterquiesce_depthtm_cb_idxhctx_tablegpl_symsseq_showmpt3sas_factsswait_queue_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsdpc_rp_extensionsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinkinternal_depthChainOffsethrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgReqBootDeviceFormpci_device_idnodeMpi2ManufacturingPage0_tsdev_targetvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areastatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_format_MPI2_CONFIG_PAGE_RD_PDISK_0exec_update_lockexpecting_lun_changefault_reset_work_qatomic_write_hw_maxSCSIIOSuccessl1d_flush_killi_versionuse_10_for_msDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimeraid_device_liststate_remove_uevent_sentlegacy_memFastPathSCSIIOSuccessfirst_minorMPT3SAS_FLUSH_RUNNING_CMDSia_sizein_hrtirqs_master_keyssas_port_listwchar_addr_bndkernel_symbolsubsys_databi_statusinternal_dmatv_secSkipCountd3cold_delayblk_integrity_checksumpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsbroadcast_aen_busynr_phys_segmentsma_rooturing_cmdnr_failed_migrations_affinerdpq_array_enableparent_devir_firmwarehigh_iops_queuesuser_cpus_ptrpi_top_taskno_read_disc_infoNVMe_CommandSasWwidslot_MPI2_CONFIG_PAGE_IO_UNIT_0actoruprobeMaxDevHandlenotifier_subscriptionss_readonly_remountsmp_affinity_enableutil_sumst_othercpu_msix_table_szi_mutex_key_MPI25_IEEE_SGE_CHAIN64ksethrtimer_clock_basevruntimedisable_depthasync_scan_printki_sizedl_deadlinemax_sges_in_chain_message_hugetlb_hwpoisonPhysDiskubufksm_rmap_itemsskip_bus_pmnr_integrity_segments___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_twait_for_discovery_to_completeautaskuser_namespacevfsuid_traw_spinlockuse_10_for_rwtimer_autosuspendspudval_t__rcu_headwait_indexmce_vaddrquota_offdq_inusecachescsiio_depthdqi_flagsl1sssriov_set_msix_vec_countkfreeread_posstatic_call_trampbtrace_seq_pp_mapping_padlogging_levelsa_maskaddend1addend2request_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageSL_WH_SCSI_TRIGGER_TMPI2_BIOSPAGE2_BOOT_DEVICEMPI2_IEEE_SGE_SIMPLE64static_rqscodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_list__kernel_timespeclocked_pendingreset_preparechains_needed_per_ionr_deferredfown_structfeatures_lockedtracing_graph_pausequeue_numpermSDEV_BLOCKcompat_robust_listbi_blkgnr_hw_queuesconnector_nameis_msi_managedktypelockrefin_dpm_listdevice_missing_delaysrcu_struct_ptrsmm_struct_MPI2_ADAPTER_ORDER_AUXvlagi_uidhba_queue_depthtablesDMA_BIDIRECTIONALNextChainOffsetbi_iocost_costspinlockPhysDiskNumpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmphy_idTaskTagdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_disk_MPI2_IOC_INIT_RDPQ_ARRAY_ENTRYrq_nextsp_offsetsrcu_cblist_invokingi_lockd_namecpuhp_onlineget_ownershipmpt3sas_config_get_number_pdsufdscrypt_ctxexe_filenr_scannedpcp_listpid_linkshba_mpi_version_belongeds_sysfs_nameMpi2ConfigReply_tMQ_RQ_IN_FLIGHTrefcountnr_activevaddrrequestValidEntriesrw_hinttimeoutreport_zones_cblast_switch_timenum_classesfirmware_event_threadorc_unwind_ipcolumnpcie_target_idqc_dqblkretry_hwerrormmappedseqcount_raw_spinlockbd_holder_dirbroken_intx_maskingfault_reset_work_internal_cmdkill_sbstripe_exponentd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parametersbuild_zero_len_sge_mpieh_timed_outi_write_hintfxsaveprocess_keyringbase_cb_idxlist_op_pendingiotmo_cntDEVICE_VERT_POS_LOWER__stack_chk_failllist_headiounit_pg0iounit_pg1byteswait_startsense_dmafw_event_lockbios_pg2f_freeptrno_scsi2_lun_in_cdbclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixupirq_getmpi_replyhashposix_acldd_key_falsebug_addr_dispdqi_igraceHeaderVersionstarved_listclass_rwsem_write_try_is_conditionalVolumeStatusFlags_MPI2_BOOT_DEVICE_SAS_WWIDthaw_noirqv_lbaMaxSasExpanderspreempt_notifierssrcu_last_gp_endmax_channels_fsnotify_infoloss_of_dword_sync_countMPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTORmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyscsi_timeout_actionMPI2_VERSION_STRUCTremoves_magicMpi25SCSIIORequest_tdl_overrunallocsubvendord_parentirq_polltransparentpayloadac_minflti_sborig_nentsblk_mq_hw_ctxkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxatomic_openMPI2_BOOT_DEVICE_SAS_WWIDstart_prevent_timecondreadahead_controlblk_tracesubordinate__kernel_gid32_tPciBusNumberkernfs_open_filereset_from_userf_credconfig_cb_idxMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesbd_devslave_destroyread_newsignalfd_wqhmmapmodnameasync_put_workmknod_MPI26_NVME_ENCAPSULATED_REQUESTpri_reqs_allocctxsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapPrimaryReferenceTagwritepagessched_statisticsheadminors__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controlfw_event_workuclampattached_handlemultifunctionsuper_operationsbi_cookiesplice_eofHostTraceBufferMinSizeKBmax_lbautil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockput_unaligned_be32D_REAL_DATAsas_phySGLFlagsnentsFunctionbd_holderspt_regspipe_bufsControlKOBJ_NS_TYPE_NETctx_idmap_nruse_16_for_syncd_rt_spc_warnsq_usage_counteri_verity_infophy_maskxsavetimespec_type__rb_parent_colordevres_lockspin_unlock_irqrestorebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_inforeply_post_queue_depthMPT3SAS_ADAPTERats_capblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_ops_MPI2_CONFIG_PAGE_MAN_0ReplyFlagsdev_flagsvm_private_dataio_bitmap__bi_remainingblock_exponentuprobe_task_statetimerkobj_typebroken_parity_statusMPI2_RAIDVOL0_SETTINGSdiskseqPortTypei_pagesatomic_write_hw_boundaryhlist_bl_headput_unaligned_be64ino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitdoe_mbspage_fragwrite_byteschardomainunix_inflightbuild_zero_len_sgeholders_dirinit_cmd_privhi_priority_smidfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledgraph_get_port_parentAddressReplymax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkgot_task_abort_from_ioctlbio_slabd_aliasrdpq_array_enable_assigned__iovHotSparePoolcpumaskmq_hctxdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsdma_data_directionenclosure_logical_idd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nrHostTraceBufferMaxSizeKBbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityno_report_opcodesrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_freebridge_d3parentHighPriorityCreditspecial_vec__dummy2atimecopy_file_rangeinquirytask_cputime_atomiccommit_rqsMpi2SystemInterfaceRegs_tis_aero_iocuser_definedSAS_SATA_PMkey_typeget_named_child_nodelaunder_foliocurr_targetnumberis_suspendeddma_lengthDeviceMaxLBAhotplugtimeout_workvariable__ffsburstPUT_SMID_DEFAULTetypeei_funcs_MPI2_BOOT_DEVICE_ADAPTER_ORDERmodule_kobjectreply_queue_countactive_memcgSAS_PHY_DISABLEDconfig_vaddrdef_flagsd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updatetarget_blockedvendorcap_bsetopen_modearchdata_sourcepower_stateport_idSDEV_DELnr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasespcie_mpsss_bdev_fileset_latency_tolerancenuma_faultswork_qblist_flags_tlinux_binfmtEventTriggerEntrypage_table_lock_sigfaultcountersname_linkchipbvec_poolcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_type_find_first_bitbuild_sg_scmdsriovpolicysharedwait_queue_entrydismissd_real_typelookahead_bandio_portseq_start__targetsinternal_smidrq_qos_mutexzone_wplugs_wqraw_lockd_dnameget_dqblkPCIeEncapsulatedSuccessscsi_levelmax_hang_timecpus_maskNumPhysDiskssubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_tdispatch_wait_lockhigh_iops_outstandingmin_sliceargs__poll_tfwnode_operationstarget_allocMPI2_RAIDPHYSDISK0_SETTINGSshow_devnamelogical_block_sizerun_delaytailsblk_flags_tlinenorequest_dma_szGenericFlags0GenericFlags1bi_io_vecbase_pfnget_inode_acl_addr_pkeyioc_link_reset_in_progressmigrate_foliocustom_sliceOfflineReasonaer_capthread_keyringhosttkparam_arrayutimesecurity_supportedstart_codehostdiag_unlock_mutexis_managedvol_pg0is_hardiorequest_cntEEDPTagModefsbasecompatibleblk_status_tSHOST_CANCEL_RECOVERYclock_listattrsBidirectionalDataLengthdynidsAdapterOrdereh_deadlinecpumask_tring_buffer_szswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEsoft_resetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainMpi2IOUnitPage0_tbios_paramdiag_buffer_sz_sigchldSecondaryApplicationTagpi_offsetdiscard_granularityreset_in_progress_mutexsize_addfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetmax_lunnext_cpubsg_devicetime64_tdma_pooli_blocksnuma_faults_localityhas_child_subreaperMaxMSIxVectorsTransferLength_MPI2_REPLY_DESCRIPTORS_UNION_MPI2_CONFIG_PAGE_IO_UNIT_1i_acl___GFP_ZERO_BITvphys_listwrite_newlist_lockLengthInitiatorDevHandlepm_domainmsix_indexcpu_bitmapipi_listMaxNumPhysicalMappedIDsstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statesas_identifyset_rq_budget_tokendebugfs_rootsoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagsMpi2IOCInitRDPQArrayEntryswp_entry_tMinDevHandlesas_address_parentdelayed_event_ack_listbi_inline_vecsuint64_t_mapcountia_rangedomain_tagpasid_requiredhang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventhtb_relsg_prot_tablesizeset_performance_statephys_addr_tSHOST_CREATEDclass_preempt_is_conditionalcfg_sizeconsumers_cntmodule_memoryinternalpi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacSettingsHostTraceBufferDecrementSizeKBnr_to_scanfs_parameter_specNumberOfPortsdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtp_flags_2amax_bus_speedpci_driverSAS_SATA_PENDINGdma_cleanupmaple_treeMPI2_ADAPTER_INFOKMALLOC_DMAdentrylast_mergecpu_itimerpercpuget_unique_idlast_queue_full_countsupports_trigger_pagesrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupsaved_end_ionr_threads__i_nlinkReserved1Reserved2Reserved3Reserved4Reserved5Reserved6Reserved7Reserved8Reserved9pushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAconfig_page_szdelayed_workmq_listmanage_system_start_stophiwater_rsskretprobe_instancesshostrangefutex_exit_mutexpm_onlykernfs_iattrstag_alloc_policytrc_blkd_nodeignore_loginfos__sectord_spacerespondingbase_readl_ext_retrygraveyard_linkMpi2ReplyDescriptorsUnion_treply_queue_listxol_vaddrsplice_readElf64_Addrscsi_deviced_rt_spacenameblk_mq_ctxbi_iopriou_flagsIncompatibleReasonnvcswEnclosureSlotKMALLOC_NORMALwatchdog_stampseglenMPI2_SCSI_IO_CDB_EEDP32task_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingAddressis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typestate_savedi_rdevirq_reroute_variantself_exec_idreplykernfs_opsfile_lockMODULE_STATE_LIVEclearedclass_maskport_enable_failedStripeSizestopnr_migrationsa_opsreq_listxa_flags_MPI2_CONFIG_REPLYsingle_lunphy_reset_problem_countfreezebin_sizemap_bus_MPI2_RAIDVOL0_SETTINGScloseExtPageLengthdev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITnr_sectorsscsi_lookup_lockdma_alignmentd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITBLK_EH_DONEset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqblast_resetuidhash_nodesaved_tfblk_mq_queue_mapElf64_Xwordold_timespec32device_configureGET_MSIX_INDEXlock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkcpu_countis_virtfnMasterDatapercpu_refhorizontal_positionioerr_cntchain_lookuppref_node_forkstripe_offwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxDoorbellDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploMsgFlagsclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightWordsvm_filepfactsmax_device_blocked_MPI2_RAIDPHYSDISK0_INQUIRY_DATAs_stateneeds_fresetuser_sizetabledev_pm_opsHostInterruptMaskcdrom_device_infoSAS_PHY_RESET_PROBLEMscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkreset_timeoutreply_free_queue_depthkmalloc_typesriov_get_vf_total_msixn_io_portqstrma_flagsnr_ia_rangesSAS_HAmax_user_discard_sectorsno_msifutex_stateorig_pmdqueue_lockshpc_managedthis_idacct_timexpdSHOST_DEL_RECOVERY__rcu_icq_cachesize_qprocwakeup_sourcef_posnext_posix_timer_id__kernel_long_tDefaulttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsSAS_SATA_PM_PORTchain_pages__le16build_nvme_prpalt_lenstart_scan_failedcinblockextableexitrpm_autosuspend_delaykernel_param_opsbus_dma_regiondpc_capio_uring_cmdthresh_holddirtied_when_MPI25_SCSI_IO_CDB_UNIONpdt_1f_for_no_lun__paddingsem_undo_listpci_error_recoverystatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headSL_WH_MPI_TRIGGER_Trcharfutex_pi_statekstatpci_access_mutex__kernel_uid32_t__le32dispatchq_lock_cls_keyaccess_statesubsystem_deviceDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockwake_batchget_namefwnode_endpointopt_sectorsepoll_watchesprealloc_pteprot_typesas_node_lockborkenSDEV_CANCELTargetCommandBufferdqb_curspace_entrygp_statebitsetload_avgsched_dataaccesscstimepcie_capcompletion_cntcfs_rqrq_end_io_fn_uidprot_opst_spacemm_cid_next_scanns_typescan_startmsix_enabledMpi2RaidVolPage0_tac_majfltpasid_enabledfactor1factor2posix_cputimers_work_upperCurrentHostPageSizerequest_szmodule_param_attrsshort unsigned intstargetbus_flagstarget_port_protocols__le64same_target_siblingsMsgLengthpcie_sg_lookupi_mutex_dir_keymq_pollq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeystmp_stringsmidorig_ptepasid_capdqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutexnanosleep_MPI2_BOOT_DEVICE_ENCLOSURE_SLOTSTARGET_REMOVEeh_host_reset_handlersrcu_gp_seq_neededsbq_wait_statedq_dqb_lock__kernel_ulong_tvolnameio_mindl_periodsym___kernel_vsyscallReplyFreeHostIndexi_fsnotify_markswakeup_pathdio_mem_alignbtime__u8is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTrestartsSAS_LINK_RATE_12_0_GBPSruntime_deferred_listd_waitlocal_fwnodequeue_flagslist_lru_onedevice_physical_location_horizontal_position_MPI2_VERSION_STRUCTMPI2_ADAPTER_ORDER_AUXseq_stopMPI25_FP_SCSI_IO_SUCCESS_REPLY_DESCRIPTORpci_dev_flags_tkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidis_warpdriveaer_statss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalqueue_rqsshrinker_idbio_setrootoom_reaper_listscsi_device_handlershutdown_presym_VDSO32_NOTE_MASKIRVolumeMappingFlagswdtrbpf_storage__data_lenmq_map__u16timers_activewait_countalloc_hintsig_okout_errorOEMSpecificFlags0OEMSpecificFlags1delaysqf_ownerVolumeStatereadaheadkmalloc_cache_typestart_stop_pwr_condpcie_device_lockmutexpgd_tnr_cpus_allowedeh_abort_handlerdiscard_alignmentHostInterruptStatusraw_spinlock_tkey_tagMaxTargetsgetgeofs_flagswordworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstkslave_configurereserved_tagssrcu_sspSDEV_CREATEDwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdevpending_eventsirq_poll_fn__u32ptracedtrc_reader_specialdevice_get_match_datablock_szHPROBE_GONEmax_nvme_qdactive_timei_sequencepool_data_MPI2_RAIDVOL0_PHYS_DISKpci_vpddisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfresid_lenBASE_READ_REGi_dir_seqVolumeTypewakeup_preparedkqiddefer_syncaccess_statusKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTApd_handles_szbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmauclamp_reqchange_cookiempt3sas_config_get_raid_volume_pg1dl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typedirect_io_enableddpc_rp_log_sizeimm_readySL_WH_EVENT_TRIGGERS_TBLK_INTEGRITY_CSUM_CRC64f_iocb_flagsiodone_cntpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infooverride_onlyMaxInitiatorsdma_flagssched_contributes_to_load_sas_phystatic_key_truedisk_events_disable_depthweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimeNvdataVersionDefaultdeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacitydma_addressvm_startshost_gendevtag_list_lockunused_hctx_lists_flagsget_rq_budget_tokenAdapterOrderAuxcpumask_var_tfaultmultipath_on_hbaalternative_gpt_sectorshow_statsdl_densityfreeptr_tset_dbd_for_msread_dqblkintegritydq_flagsWWIDSAS_SATA_DEVread_before_msnext_cpu_batchDD_CLASS_TYPE_DISJOINT_NAMESpci_devmemcg_datatracepoint_extkprobes_text_startrunnable_avgdma_boundarys_time_grankernel_cap_tSUBMITTED_BY_SCSI_RESET_IOCTLnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_count_warpdrive_disable_ddios_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITReserved10num_kpPCIBusNumin_execvehost_tagsettlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_lockno_report_lunss_dquotmax_hw_sectorsfolioqtm_cmdstagsprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uidinvalid_dword_countchildrenrb_subtree_lastno_pm_callbacksMaxEnclosuresbuild_idrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_paddevice_infotailia_atimeexit_hctxpercent_completelasttlb_ubcbi_issuevphys_maskquota_format_typemsi_enabledseeksis_driver_loadingtask_structbudget_tokenrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextpcie_device_init_listio_tlb_memis_gen35_iochost_self_blockedarch_spinlock_tsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometrymanufacturerdevcapsuppress_bind_attrsRPM_RESUMINGreg_offsetgsbasedispatch_waits_quota_typesinternal_tagf_llistSAS_PHY_VIRTUALmq_freeze_locki_nlinksdev_devbranchwrite_begingroupserr_handlerno_vf_scanpi_blocked_onPrimaryApplicationTagMasks_xattrclass_local_lock_irqsave_is_conditionalfw_events_cleanupstart_scanon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdriver_namedl_serverSCSI_EH_RESET_TIMERtrc_reader_nestingin_userestart_blockumode_tMpi2IOCPage8_tIOCLogInfosharepagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_supers_inode_list_lockelevator_queueruntime_idletm_custom_handlingsweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntab_MPI25_SGE_IO_UNIONdevice_typeBoardTracerNumbermaj_fltarch_rwlock_tctx_mapSHOST_DELput_smid_hi_priorityclock_basediag_trigger_lockcdevmy_qgroup_leadermkdirnextentsnum_pdsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_dataActionmmap_locksysfs_lockrq_qosfsavekeyring_index_keyqrwlockfast_pathRequestDescriptorPostLowoverflowfile_ra_stateuser_structon_rqfs_contextmempool_alloc_tNumDevsPerEnclosureprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfdev_max_lba_sas_nodeinternal_lookupunsafe_warnllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameport_enable_cb_idxpoll_queue_prochi_priority_depthunfreeze_fsintervalclasssas_linkrateVP_IDlast_mm_ciduntrustedbuild_sgmax_open_zonescookiebd_stampSAS_FANOUT_EXPANDER_DEVICEtargetstarved_entrya_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_tSL_WH_EVENT_TRIGGER_Ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structsense_lencred_guard_mutexbusymajorenclosure_listpci_opssigcnthrtimer_cpu_baseresourcescb_headcheck_quota_filedirty_folioattributerestrict_linkdev_archdatampi3_version_unioni_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheclass_disable_irq_is_conditionalchain_depthanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrtry_vpd_pagesi_opflagsrobust_listbase_cmdssym___kernel_rt_sigreturnreply_post_freesym_pvclock_pagemmio_enabledserial_nodelen_desc_MPI2_CONFIG_PAGE_BIOS_2_MPI2_CONFIG_PAGE_BIOS_3s_incoredqsd_iputcompat_ioctllockdep_mapfilterMpi2BiosPage2_tcurr_ret_stacklast_queue_full_depth__compiletime_assert_451dockenable_sdev_max_qddev_links_infoloff_tthread_pidinquiry_mutexsrcu_gp_seqia_rangesno_command_memory_archport_numst_valueclass_write_lock_irq_is_conditionalDiagRWDataKOBJ_NS_TYPESpprevcallseh_actioni_default_acleh_target_reset_handlers_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeProductSpecificcombined_reply_queueicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_masknr_requestsHPROBE_STABLENVMeAbortTOIOCStatusrq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorspci_error_handlersWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tMPI2_ADDRESS_REPLY_DESCRIPTORFAULT_FLAG_KILLABLEinodesclass_namestarget_busys_mtdkparam_stringpowerma_lockcleanup_rqevent_flagssched_delayedbd_statsbi_sizesupported_modemodule_statemq_kobjlast_used_at_MPI25_SCSI_IO_REQUESTvm_endlast_queuednuma_migrate_retryuser_nsPhysDiskState__stateRPM_REQ_NONEfirstiommu_groupdispatch_fromMpi2RaidPhysDiskPage0_tmigrate_to_ramwait_pidfdptrace_bpss_umount_keypcie_sg_listscsi_bufflenvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexpcie_sgl_dmai_private_dataElf64_Halfuse_autosuspendnsproxySASAddresscan_wakeupvol_cntxol_areatransporttreply_post_host_indexrlockfactsfl_owner_t_rescls_mskRAIDAcceleratorSuccesseuidwaitbug_tabledirtied_time_whendma_drain_lensequential_io_avgexit_cmd_privnum_trace_bprintk_fmtqueue_ramp_up_periodMPITriggerEntryvm_policysize_mulperf_rdpmc_allowedrdevprivate_dataput_smid_scsi_ioDEVICE_PANEL_TOPsignumfscrypt_keyringtemp_sensors_counts_mountsuse_memdelayRPM_ACTIVESTARGET_DEL__state_sizecallerthread_structcached_requested_keyenvpbvec_iterpage_sizectimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenpme_supportdqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetSHOST_RUNNINGblk_crypto_profiledma_devfolio_queuePrimaryApplicationTaglast_task_numa_placementreply_post_free_arraySAS_LINK_RATE_3_0_GBPSpgtable_tblock_startcgtimedelayed_tr_listPhysDiskSettingssymlinkoom_flag_originDMA_NONEcounterorc_unwindSAS_LINK_RATE_FAILEDMpi2IOCPage1_tWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqio_queue_numReplyFrameAddresstrace_eval_mapdoneSlotNumberring_buffer_offsetfscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexMpi2IOUnitPage1_tioc_statusratelimitfree_foliodebugfs_dirdriver_managed_dmaqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotactl_cb_idx_MPI2_CONFIG_PAGE_RAID_VOL_0_MPI2_CONFIG_PAGE_RAID_VOL_1req_alt_boot_deviceem_perf_tabledl_timerIeeeSimplebuild_sg_mpii_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsend_io_datablkcg_gqmap_queuesdelayed_sc_listia_filesival_intnuma_preferred_niddma_need_drain_hugetlb_cgroupdentry_operationschannelmemcg_nr_pages_over_highd1_supportqueue_offsetarch_uprobe_Boolsleep_startDCRAddressmin_fltwwidconfig_pageHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatereverse_orderingi_linkresetlistxattrPhysDiskStatusFlags_lowertrap_nrmax_queue_depthasync_probe_requestedcompat_long_td3cold_allowedactive_counts_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupsVendorIDwakeup_cntpmd_ts_opsysv_shmIOCCapabilitiesdma_channellast_sector_bugdq_countMPI2_BOOT_DEVICE_DEVICE_NAMEutf8data_tableDiagRWAddressHighEEDPBlockSize__func__resource_size_tnr_tagsfoliowake_entryxa_headsuidport_table_listchain_trackeri_readcountmanage_runtime_start_stopblk_integritylocked_vmminimum_linkraterb_leftseq_nextguess_capacitysym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_lentm_tr_volume_cb_idx__kernel_clock_tBlockSizeclass_rcu_is_conditionalbpf_local_storageactionclockid_tmax_shutdown_latencyquota_syncdq_free__bd_flagsparent_exec_idignore_media_changeretrieskernfs_elem_dirsrcu_lock_countksm_merging_pagesSAS_PHY_RESET_IN_PROGRESSautosleep_enabledptrace_entryblkg_listhost_scribblerecent_used_cpunum_jump_entriess_qcopatomic_tbv_pageevent_logmpi_requestalloc_tag_counters_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitPCISlotNumshort intmynodepart_tblmaximum_linkratezone_wplugs_hashblk_mq_opsscatterlistbridge_ctlclass_raw_spinlock_irqsave_is_conditionalioc_dumplockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirirqpollVTIME_USERsa_flagstestSAS_EDGE_EXPANDER_DEVICEBLK_INTEGRITY_CSUM_CRCtime_sync_interval__kmalloc_cache_noprofpad_untilDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerextra_lenprio_listatomic_write_hw_unit_max_flags_1_flags_2eh_device_reset_handlersbitmaplast_arrivalsupported_speedsem_pdpref_64_windowtrace_event_callMPI2_BOOT_DEVICE_ADAPTER_ORDERis_guestdevice_physical_locationpm_domain_dataeh_eflags_MPI2_ADAPTER_INFOpoll_table_structdirect_IOSTARGET_CREATEDReqAltBootDeviceFormfw_event_listwait_queue_entry_televatorcurrent_may_mountget_unaligned_be32seqlock_tskip_ms_page_8bd_queuenuma_scan_offsetDMAFlagsdiag_trigger_activeirq_line_enable___GFP_NO_OBJ_EXT_BITsched_migratedfrozenDataLengthmlock_countin_lru_faultgrpmaskvpd_pg80vpd_pg83vpd_pg89regfunctm_sas_control_cb_idxindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validis_mcpu_endpointvertical_positiondiag_trigger_mpii_rcui_atime_secFlagsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITpcie_bwctrl_dataactiveselect_no_atndqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listno_read_capacity_16tagged_supportedMinorreap_refget_unaligned_be64xarray_startfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atscsi_host_templatelast_sum_exec_runtimeiov_iteria_gidSDEV_OFFLINEmanu_pg10manu_pg11attribute_groupMQ_RQ_COMPLETEcontextposix_timersdriver_exclusive_resourceselectorblkcg_polsMEMORY_DEVICE_PRIVATEsas_addressdev_releasebi_nextdefault_timer_slack_nspend_os_device_addoffline_alreadysource_listtrigger_info_dwords_keyswap_readahead_info__fpstateactive_refreply_dmaremove_hostpmdval_t___GFP_NOFAIL_BITgroup_infovdso_imagereply_post_structblk_qc_tNvdataVersionPersistentfileof_match_tablepercpu_count_ptr__user_state_sizeMPT_BUILD_SG_SCMDptm_cappcie_cap_lockmce_kill_menegotiated_linkratephysical_block_sizeuuid_teh_noresumeproperty_read_int_arraySCSI_EH_DONE___GFP_UNUSED_BITatomic_write_hw_unit_mincount_objects_stimezone_device_dataDataScrubDurationnr_active_requests_shared_tagsMPT_ADD_SGEf_wb_errio_uring_poll_queuequeuelistphysfndefparamMaxReplyDescriptorPostQueueDepthfred_csq_lockdep_mapinquiry_lenreply_post_free_array_dma_poolfault_flagreventsMajorkprojid_tptracer_credtlb_genstoreio_lock_cls_keySDEV_TRANSPORT_OFFLINEpage_mkwritekobjectaudit_ttympt3sas_port_factsmce_ripvstatfstag_setBiosVersionvolume_typeats_enablednumab_stateremovablecan_queue__remfeatureson_listResyncRatekgid_ton_cpuFAULT_FLAG_VMA_LOCKReserved0fregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistreply_free_MPI2_CONFIG_PAGE_IOC_1eetlp_prefix_pathclass_groups_MPI2_CONFIG_PAGE_IOC_8sas_device_listnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNstripe_szwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedcmndraid_devicesysfs_registerednum_physAddlFlags2AddlFlags3debugfs_mutexwatch_listaudit_contextpp_ref_countsysfs_opserror_detectedsequential_iois_busmasterSHOST_CANCEL_large_mapcountsda_is_staticformatftopenclave_pcie_deviceSDEV_CREATED_BLOCKbi_privateMPI26_PCIE_ENCAPSULATED_SUCCESS_REPLY_DESCRIPTORMpi2RaidVolPage1_trequest_dmacreateiattrreply_qrseqSAS_PROTOCOL_STP_ALLMSIxIndexnfdssigvalvma_lockmax_discard_segmentsperf_event_listget_reserved_spacehpr_lookupnon_seqstack_refcountinvalidate_lockbmapkey_payload_MPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTORtimer_rand_stated_reallink_stateexpiry_activesas_protocoltimestamp_update_countdqi_max_spc_limitSCSITriggerEntryexception_table_entryvirt_boundary_maskevent_countProtocolFlagsscmdfallocatei_spc_warnlimitbuddy_listcdl_enablei_ino_timelimitSDEV_RUNNINGi_mmap_writablemems_allowedbios_pg3MPI25_SCSI_IO_CDB_UNIONtlb_flush_batched_ddebug_infoslave_allocis_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startblocksphy_belongs_to_portset_infofileattr_gethandlervectormfg_pg10_hide_flag__devices__bi_cnttimer_list_oldblock_expdevice_dma_supported_MPI2_ADDRESS_REPLY_DESCRIPTORd_ino_warnsMPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORhiwater_vmtracepointPageLengthcompound_headproduct_specificia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqunique_idrenamevm_area_structrpm_statussb_writersino_timelimitErrorResponseAllocationLengthpci_bus_flags_tsplice_writemsix_capi_rt_spc_timelimit_raw_spin_lock_irqsavestripe_exprom_base_regqf_nextcdl_supportedio_window_1krangesiommu_mmats_stublk_features_tcutimeem_tableprot_flagspersonalityget_stateIOCExceptionstask_sizes_inodes_addrbinfmtirq_domainnr_queuessigned charprioprivgetattrsched_infod_fieldmaskquiesced_byuprobe_xol_opsseq_filefreeze_noirqrdpq_array_capablercu_tasks_idle_cpuwrite_file_infofilter_countget_aclpasid_no_tlpsync_fsparam_locksi_signoenabledfixupsfile_operationsqueue_rqKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tag_killktime_tsymsgroup_nodePageNumberi_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasepins_MPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORpacct_structmust_resumeget_msix_index_for_smlioioc_pg1_copyTargetAssistSuccesslong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ssproperty_present__pptrexpecting_cc_ua__kmalloc_indexnr_ioscurrent_eventprintk_index_sizesymtabfree_diskaen_event_read_flagsg_table_boot_devicert_mutex_waiterremount_fss_typeruntime_statusin_iowaitlun_in_cdbunregfuncegidiomap_MPI2_MPI2_BIOSPAGE2_BOOT_DEVICEchain_segment_szdq_hashput_superevent_contextput_smid_defaultfwnode_reference_argsCoercedMaxLBApushable_dl_tasksf_flagsiopoll_q_start_indexMPI25_SGE_IO_UNIONcodetagtransport_cmdsPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donePhysDiskMapis_thunderboltmark_dirtyeh_cmd_qMaxPostedCmdBuffersnum_srcu_structsbdi_writebackProductRevLevelkobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameReplyPostHostIndexTT_NONEMPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTORio_missing_delayVTIME_INACTIVEf_inodecancelled_write_bytessrcu_usagebitmapacpi_match_tablesc_data_directionmemcg_sigvalFWVersionhide_drivesbvecnameidatasubsystem_vendorlatency_recordchain_bufferBoardNamemod_kallsymsmnt_idmax_sges_in_main_messageMPI2_RAIDVOL0_PHYS_DISKdepthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldsysdatadma_addr_tshiftcheck_eventsio_windowssize_tProductIDiopl_emulHostMaxLBAmax_write_zeroes_sectorswork_structdesc_lenIeeeChainflocktrack_queue_depthtask_io_accountingmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structmax_target_blockedrunning_disparity_error_countpr_opspi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqreply_free_dmap_lbaevent_listshost_recoveryio_sizePageTypeclass_spinlock_irq_try_is_conditionaloom_mmehandlerFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lrusrcuqueue_depthmsix_enableunderflowdirect_iogfp_maskpi_state_listrcu_segcblistsubvolsubmitterfault_reset_work_q_namefree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infomq_rq_statesrcu_structrlim_curnofaultmm_countdrv_groupsstackscsi_data_bufferfunctionki_flagsRequestedBootDevicebd_start_sect___GFP_IO_BITcb_idxsrcu_have_cbsd_in_lookup_hasheh_timeoutmax_sectorssgidinitial_nsFREEZE_MAY_NESTscsi_transport_templatesdev_bflagsbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrprcecdl_throttledi_rwsemSL_WH_SCSI_TRIGGERS_Tget_projidatomic_desc_capablesched_reset_on_forkmq_ctxHPROBE_CONSUMEDMPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTORbpf_net_contextmsix_ioopc1__int128 unsignedpcountwake_indexrestore_noirqdma_pad_maskSL_WH_MPI_TRIGGERS_Tki_filp_MPI2_RAIDPHYSDISK0_SETTINGSbitmap_tagsdrv_internal_flagscap_ambientdma_configureruntime_errorEEDP32active_modeatomic64_tanon_vmause_32bit_dmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folioSAS_PHY_UNUSEDnr_eventsmpt3sas_config_get_phys_disk_pg0_MPI2_CONFIG_PAGE_HEADERchains_per_smid_MPI2_VERSION_UNIONHCBAddressHighiommubi_opfprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxscsi_vpdtph_enabledsplice_pipehostdatashort_inquiryblk_mq_tag_setSAS_SATA_PORT_SELECTORspinlock_checkblk_independent_access_rangess_lock_keyReservedsrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsslotsSUBMITTED_BY_BLOCK_LAYERtqheadeh_bus_reset_handlers_activediag_trigger_eventMEMORY_DEVICE_FS_DAXhpr_free_listclass_mutex_is_conditionalremap_file_rangemin_shallow_depthnr_hangssym_vvar_startgid_twake_cpuchainedio_uring_taskrequest_trackerabort_worktask_worksmemory_failurerb_root_cached__be32SAS_PROTOCOL_NONEs_copnvme_mdtsdd_key_truehres_activebpf_raw_eventsdq_dirtyscsih_cmdsdl_deferround_robinbug_listdirect_completeblk_mq_tagswbt_flagsxa_lockfxregs_stateload_weightlink_active_reportingkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_count_raid_devicelockableLogEntryQualifierkey_restrictionnr_rangeexit_statepd_handlesRDPQBaseAddressis_late_suspendedsysvsemadd_busshost_statebd_nr_sectorsMaxChainDepthhba_vphyignore_childrenresourcerestore_earlyclock_mutexfs_superssense_dma_poolqueue_stopped__be64vpd_pgb0vpd_pgb1vpd_pgb2chain_dma_poolvpd_pgb7Mpi2ManufacturingPage10_tdqb_bsoftlimitpendingmax_dev_sectorsno_vpd_sizef_task_workdiag_trigger_scsi___GFP_NORETRY_BITiowait_countmatch_driverprot_sdbset_read_onlythrotl_datadma_io_tlb_memstringread_countcor_error_detectedfix_capacityfutex_offsetlong long intmmio_always_onNameevent_masksatomic_flagssysvshmpcie_sgldevice_remove_in_progresstimer_expirestrace_evalsactive_basesearly_initrcec_eacmd_sizemprotectsecurityxmm_spaceSAS_PROTOCOL_SMPSAS_LINK_RATE_6_0_GBPSactivatescsi_targetmsix_basef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structbroken_fua___GFP_FS_BITi_bytesdomain_datarelax_countEnclosureLogicalIDtagset_freedscsi_io_cb_idxbuffer_rel_condition___GFP_THISNODE_BITlineget_budgetlinkdiagnostic_flagsstart_timekernfs_nodeRPM_REQ_IDLEReplyFrameSizesuppliersmanu_pg0dev_tFREEZE_HOLDER_USERSPACEmsi_caphost_blockeddup_xol_addrshared_tagscapture_controlnr_wakeupsEnclosureLogicalIDstartput_budgetstart_brkbudget_mapstatic_key_modreq_flags_td_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_setag_listElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersrq_end_io_retzone_wplugs_lockbridged_releasestates_d_opmce_whole_pagestatsreadblk_mq_queue_datanetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsSAS_PROTOCOL_SSPattributessbitmap_wordcached_rqsIOCRequestFrameSizeset_child_tidblk_unique_id_overruntmpfilercu_read_lock_nestingem_perf_statemin_nrtick_dep_masksbitmap_queuefifo_time_MPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTORtransport_cb_idxSAS_PROTOCOL_STPlistthrottle_disksi_errnoromlenMaxVolumess_inode_lrusector_sizesrcu_size_stateblk_plugtracker_listscsi_host_stateneed_tsof_nodeWriteSequencerefsmmap_compat_basetrace_eventsenv_startDMA_FROM_DEVICEtotal_io_cntdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTMPI2_DEFAULT_REPLY_DESCRIPTOReh_should_retry_cmddevfnregsslice_maxlast_switch_countqsize_tTimeSyncIntervalfilesdevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolallow_restartHCBSizebd_mappingsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedSHOST_RECOVERYpdevzone_wplugs_workpcie_device_listpci_power_tclass_preempt_notrace_is_conditionalreply_queue_listret_stacknode_idautosuspend_delayunsigned intSUBMITTED_BY_SCSI_ERROR_HANDLERgendiskspc_timelimits_instancesnvme_abort_timeoutdescseqcountremove_busoom_score_adjeh_entryd_seqbi_crypt_contextinit_requestia_vfsgidprot_capabilitiessize_tptm_enabledcap_permittedscsih_cb_idxinitiator_port_protocolsTT_NATIVEmask_interruptstransfersizeclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchessas_device_lockrcu_tasks_idxenclosure_levelerror_statercu_tasks_holdoutport_enable_cmdstarget_listno_64bit_msidelayed_tr_volume_listpasid_activatedpi_seinternal_free_listget_offset_ctxcore_forceidle_sumexit_requestfreeze_ucountreply_free_dma_pooli_ctime_nsecreset_wqcpuhp_deadneeds_fresetrphys_remove_countsyscall_workdevice_physical_location_vertical_positionidentifyreply_free_host_indexatomic_long_tpreallocReserved11Reserved12pfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcusas_rphypgtables_bytestarget_destroyget_linkreq_boot_devicefmode_tSTARGET_RUNNINGdevtno_difRequestDescriptorPostHighpci_channel_state_thost_lockrestoredelayed_callbi_iterDescriptorTypeDependent1DescriptorTypeDependent2SAS_PROTOCOL_ALLmax_nr_cid_statusmark_deadd_sibdma_ops_MPI2_BOOT_DEVICE_DEVICE_NAMEbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedRequestedBootDevicehdr_typelimits_lockdl_dev_stateUnitgsindexexpires_next_MPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTORi_io_listemulatedf_epminimum_linkrate_hwsrcu_barrier_seqmsi_locklinks_countreturn_consumerioc_reset_in_progress_lockrelease_dqblkin_thrashinguaddr2__kernel_timer_tdpc_rp_extensionsMpi2IOCInitRDPQArrayEntrycpu_msix_tableclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskno_highmematomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodews_activetmf_in_progressfile_leasescsi_device_statemodelscan_objectspid_typewb_errcputimerfree_chain_listtrace_recursionbv_lenhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdma_drain_buf_MPI2_SYSTEM_INTERFACE_REGSrcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthchange_queue_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsEncapsulatedCommandLengthscsi_cmnd_submitterattr_entry_ptrstarget_dataget_next_child_nodeFAULT_FLAG_WRITEtm_tr_cb_idxvm_fault_ttty_structUTASK_SSTEP_TRAPPEDio_uring_poll_queuesblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountinq_periph_qualforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointsupported_eventsresvnr_wakeups_idleOEMIdentifierio_cqres_attr_wcelf64_symdevice_blockedlatch_tree_nodeis_iouring_poll_qpercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSuse_192_bytes_for_3fBLK_UID_NAAp2pdmablk_mq_req_flags_tsyscoreprot_guard_type__s64dqi_bgrace__kernel_pid_tioc_reset_countstatic_call_modmax_cmd_len_timerdma_map_opsma_external_lockdevice_physical_location_panelhost_resetuid_tpend_os_device_add_szflush_requiredpcie_flags_regsum_block_runtimehctx_listpgmapmin_perf_statedq_opsdev_dataWordrcu_tasks_nvcswcrypt_keyslotwritetypetabmax_user_sectorsmpt3sas_debugfs_rootclass_read_lock_irqsave_is_conditionaldma_poolsmsix_vector_count_addr_lsbPortNumberi_generation_sigpollprocentmxcsrsas_addressd_rt_spc_hardlimitbi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexstarget_sdev_userdriver_datathread_headlast_queue_full_timeend_iodev_pm_qosserial_numberbi_sectormap_typemax_narrowport_qdf_oppids_active_resetrandomconfirm_switchpcie_sgl_dma_poolseqcount_tnuma_scan_seqport_siblingsinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizePageVersionsas_device_typeptm_granularityshost_groupsid_tabledq_sbptm_roothost_norun_worksighand_structdiag_bufferflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entryNumPerDevEvents___GFP_NOWARN_BITcmin_fltrw_semdqio_semCoreDumpTOSecprev_sum_exec_runtimeMPI2_BOOT_DEVICE_SAS_WWIDnestedalloc_time_nsnr_forced_migrationsseq_operationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirinit_hctxpcie_link_statesockSCSI_EH_NOT_HANDLEDbi_write_hinthash_lenget_policytmf_work_qHRTIMER_RESTARTexternal_facingcurrent_boot_deviceSDEV_QUIESCEprev_fw_facts__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbersbi_vcnttry_rc_10_first_softexpiresMPI2_CONFIG_PAGE_HEADERrq_flagskey_user_hugetlb_cgroup_rsvdskip_ms_page_3ffaultableio_comp_batchstate_mutexmpt3sas_destroy_debugfshi_priorityshutdowndq_locki_cdevldt_structenv_endobj_cgroupnon_operational_looprescue_workqueueptrace_messagenum_trace_eventsptm_cap_sys_privatealignment_offsetopen_mutexscan_finishedsas_idinit_fs_contexts_subtypeheaderfuncperf_event_contextPUT_SMID_IO_FP_HIPtlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesUniqueValuefsverity_operationsirq_poll_scheduledCurrentBootDeviceFormwake_q_noderequest_key_authdispatch_busyallowedvirtual_dr6kprobes_text_sizereply_dma_poolstatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherskmalloc_cachescompletionbase_readlsw_reservedmpt3sas_init_debugfsdevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobehi_priority_dmashow_optionsdiskAdapterFlagsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodepri_capcurr_nrsector_tenclosure_handletrc_blkd_cpuin_memstallpermission_utimepm_subsys_datahost_failedbsg_devpasid_featuresmpt3sas_exit_debugfsscsi_target_stateget_dquotsRequestedAltBootDevicenum_orcsclass_task_lock_is_conditionalshow_rqFAULT_FLAG_MKWRITESTARGET_CREATED_REMOVEoom_reaper_timers_uuiddestroy_dquothost_eh_scheduledd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structSAS_SATA_PENDINGbin_attrs_newrpm_autosuspendbio_alloc_cacheruntime_idleconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenblk_status_tis_softcntsRPM_SUSPENDEDreclaim_statechains_per_prp_bufferhostdatavma_numab_staterethooksnum_symtabMPI2_VERSION_UNIONwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infosaved_cap_spacestats_sectorserror_remove_folioold_time32_tcore_kallsymslast_queue_ramp_upsrcu_parentdetachedhide_ir_msgclock_op_might_sleepenvp_idx_head_1_head_2sg_reserved_sizebd_size_lockbackstate_add_uevent_sentblock_cfg_accessi_hashresultMpi2ManufacturingPage11_tSAS_LINK_RATE_G1SAS_LINK_RATE_G2hlist_nodeio_uringmax_idcore_occupationSMIDsimple_tagsftrace_timestampwriterwait_page_queuesched_remote_wakeupresumesensewake_qcmd_per_lunfileattr_setkzalloc_noprofblocking_handlesrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsproc_nameonlineruntime_resumedup_xol_workqueuestart_time_ns___GFP_WRITE_BITreply_post_free_dmaMEMORY_DEVICE_PCI_P2PDMAsdtrBoardAssemblytotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workioc_pg8oublockrecent_cidhba_portkernel_paramdeferred_resumed_spc_softlimitreported_split_lockadapter_reply_queuecur_bus_speedgfp_tswap_slot_free_notifyseccomp_filterstimereply_dma_max_addressi_mmapthaw_superd_lrusignal_structperf_event_mutexpri_enabledhtb_rel_queryreset_done_MPI2_DEFAULT_REPLY_DESCRIPTORsas_device_init_listdisconnectcrcspgdval_tpage_linksetattrput_smid_fast_pathf_mappingnoinstr_text_startprepareBLK_EH_RESET_TIMERbin_attrssas_ss_flagsf_modeki_completeDevHandlevtime_statewakee_flipsset_aclScsi_Hostrom_attr_enabledpids_activeconfig_page_dmadriverHeaderNVME_BUILD_PRPi_opskip_bus_pmldt_usr_semMPI2_BOOT_DEVICE_ENCLOSURE_SLOTSAS_LINK_RATE_1_5_GBPSkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorescan_mutexcredjump_entryno_write_samemax_host_blockedlist_lru_nodetagset_refcntsrcu_gp_seq_needed_expinterval_expAtomicRequestDescriptorPostaddress_space_operationsRQ_END_IO_FREEspinlock_tRequestCreditshow_info__task_fpstateMsgVersionwait_queue_headclass_rwsem_read_try_is_conditionalevent_typefreeze_kcountwork_func_tChipRevisionfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultpauseHostDiagnosticthis_idkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysSequenceNumberqueue_kobjmax_sata_qdsas_hbasrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDpage_listexpires___GFP_HARDWALL_BITnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGvendor_idthreadsym_timens_pagesriov_configures_time_minbusn_ress_devcpus_allowed_lockDiagRWAddressHighget_next_idrwlock_tmax_integrity_segmentspgprotfalsed_weak_revalidatecmd_lenremovedshow_pathHostTraceBufferFlagsPIDTYPE_TGIDpriv_flagsMQ_RQ_IDLEcurr_ret_depthac_utimebus_list_dummy_pkeysense_bufferiommu_mm_datamce_countswap_info_structhost_waitsequencesge_size_ieeewas_resetSAS_LINK_RATE_22_5_GBPSrt_spc_warnlimitnr_reserved_tagsac_flagcoredump_datatasksScratchpadSL_WH_MASTER_TRIGGER_T_pidscsi_cmndaddress_spacemm_context_tis_probed__call_single_nodestartupseqcount_spinlock_tbio_issuei_wbhas_elevatorpanelclass_idqueuecommand_may_blockinactive_timer_pkeyfilenames_export_opchain_offsetmsix_load_balancefront_padreplyPostRegisterIndexno_start_on_addi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_prunenr_phys_allocatedIoIndexprintedbarsunused_hctx_lockresume_noirqraid_device_lockpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inodeMaxPersistentEntriesrelease_foliolast_busyi_pipebasehostuaddrdiag_buffer_dmaHCBAddressLows_wb_errshm_clistErrorResponseBaseAddressis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descsskip_settle_delayskip_vpd_pagesexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoirq_managedqueuecommandalloc_inodeexit_cmd_privfwfault_debuguser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmiddebugfs_create_diri_rt_spc_timelimitrseq_sigremote_identifyhandledev_pm_domainlimit0limit1nr_zonesevent_workmigrate_modebio_poolphy_identifierpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwkobjmaximum_linkrate_hwfsyncmtd_infoi_flagsblk_crypto_keyslotblk_eh_timer_returnlimitskernel_siginfouprobes_statemanage_shutdownFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeSAS_END_DEVICEblk_queue_statspushable_tasksplatform_datad_comparechain_buffer_dmasighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headmultiple_queuescurrent_stateSAS_PROTOCOL_INTERNAL_ABORT__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevelvpd_pg0__kmalloc_noprofMpi26NVMeEncapsulatedRequest_ts_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventulonghlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesioctlshowpci_sriovignore_hotplugd3hot_delayunsigned charMpi2ManufacturingPage0_tumount_begindrv_support_bitmapvdsommap_legacy_baseSenseKeypipe_inode_infouint16_tsecurebitspartition_meta_infostate_initializedChipNameslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opssas_expander_listsg_tablesizepref_windowSAS_LINK_RATE_UNKNOWNMpi2BiosPage3_tpoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalwce_default_onsuspend_latewakeupeh_abort_listcg_listlink_bwctrlsrcu_barrier_completionsdev_gendevsaved_config_spacedriver_flagsdevice_remove_in_progress_szsg_timeoutelementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapPCIDomainSegmentfiemapuse_16_for_rwwaiterssubdeviceos_irqsessioniddefault_lock_sifields_hugetlb_subpoold_manageicq_hintchip_physhandler_datafiemap_extent_infoDMA_TO_DEVICEpadding1force_runtime_start_on_system_startllistunmap_limit_for_wsdebugfs_entrySDEV_EVT_LASTacs_capelemnr_retriesbiotailCoalescingTimeoutsigval_talimitundo_listKMALLOC_RANDOM_STARTreply_post_free_dma_poolStructSAS_SATA_SPINUP_HOLDmissedPciDeviceAndFunctionNumberreport_zonesbi_idxquota_readst_shndxcmd_flagsio_start_time_nsfreeparti_wb_frn_avg_timeswap_lockbd_fsfreeze_countfile_ref_ttypemembarrier_statereply_szpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minkobj_uevent_envfolioq_slotreply_postinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tsiblingshotplug_slotpathDiagRWAddressLowst_sizebase_add_sg_singlermtpscsi_target_idwait_sumnum_tracepointsupidexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumersshost_datakernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerbreserved_tagsiommu_groupperiod_contribrcu_node_entrystart_scan_seqnr_ctxfsgidswap_rwneed_parent_lockis_preparedSAS_PROTOCOL_SATAproc_dir_entryvm_opsschedule_dead_ioc_flush_running_cmdsiopollactive_queuespagesizeHCTX_TYPE_READdisk_names_blocksizevm_pgoffRQ_END_IO_NONEioc_coredump_loopSDEV_EVT_MODE_PARAMETER_CHANGE_REPORTEDSDEV_EVT_FIRSTauprobeno_uld_attachnuma_workupdate_timeptrace_dr7no_d1d2shost_dev_call_addrreply_post_free_array_dmarescue_lockmax_segmentsloginuidcheckWhoInitexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkgsge_size__lstatebroadcast_aen_pendingbroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvASCQmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsIOCNumbernr_mapsmod_namesdev_groupsproperty_read_string_arraymm_cidunlocked_ioctlsched_tagsrseq_lenjiffies_at_allocmodule_attributeMPT_BUILD_ZERO_LEN_SGEpollfdIOCMaxChainSegmentSizenr_wakeups_remoteSDEV_EVT_POWER_ON_RESET_OCCURREDpci_busllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionaltrigger_typepending_io_countrseq_csprimarynum_ftrace_callsitesCoalescingDepthsoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkVF_IDmigration_flagsMPT_BUILD_SGnon_compliant_barsCurrentBootDeviceconfig_cmds_pincountEventValuerq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidwrite_protect_seqsilence_suspendltr_pathcompat_robust_list_head_tidshutdown_latencylast_statuss_inode_wblist_lockfrombd_holderdiag_buffer_statusend_codeqspinlock__kmalloc_large_noproflru_geninsnfilldir_tDCRDatamax_wideport_qddl_non_contendingdir_contexttracepoint_ptr_tutasksdev_statesched_entityd_spc_hardlimitmq_freeze_wqlong unsigned intsleep_maxmmap_basecombined_reply_index_countrescue_workio_contextrevisiondiag_trigger_masterquiesce_depthtm_cb_idxhctx_tablegpl_symsseq_showmpt3sas_factsswait_queue_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinkinternal_depthChainOffsethrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgReqBootDeviceFormpci_device_idnoderesetsdev_targetvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areastatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockexpecting_lun_changefault_reset_work_qatomic_write_hw_maxSCSIIOSuccessl1d_flush_killi_versionuse_10_for_msDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimeraid_device_liststate_remove_uevent_sentlegacy_memFastPathSCSIIOSuccessfirst_minorMPT3SAS_FLUSH_RUNNING_CMDSia_sizein_hrtirqs_master_keyssas_port_listwchar_addr_bndkernel_symbolsubsys_databi_statusinternal_dmatv_secblk_integrity_checksumpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsbroadcast_aen_busynr_phys_segmentsma_rooturing_cmdnr_failed_migrations_affinerdpq_array_enableparent_devir_firmwarehigh_iops_queuesuser_cpus_ptrpi_top_taskno_read_disc_infounlinkSasWwidslot_MPI2_CONFIG_PAGE_IO_UNIT_0actoruprobeMaxDevHandlenotifier_subscriptionss_readonly_remountsmp_affinity_enableutil_sumst_othercpu_msix_table_szi_mutex_keyWWIDksethrtimer_clock_basevruntimehctx_typedisable_depthasync_scan_printki_sizedl_deadlinemax_sges_in_chain_message_hugetlb_hwpoisonubufksm_rmap_itemsnr_integrity_segments___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_twait_for_discovery_to_completeautaskuser_namespaceHCTX_TYPE_POLLvfsuid_traw_spinlockuse_10_for_rwtimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachescsiio_depthdqi_flagsl1sssriov_set_msix_vec_countkfreeread_posstatic_call_trampbtrace_seq_pp_mapping_padlogging_levelsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageSL_WH_SCSI_TRIGGER_TMPI2_BIOSPAGE2_BOOT_DEVICEstatic_rqscodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listsched_rt_mutexlocked_pendingreset_preparechains_needed_per_ionr_deferredfown_structfeatures_lockedtracing_graph_pausequeue_numpermSDEV_BLOCKcompat_robust_listbi_blkgnr_hw_queuesconnector_nameis_msi_managedktypelockrefin_dpm_listdevice_missing_delaysrcu_struct_ptrsmm_struct_MPI2_ADAPTER_ORDER_AUXvlagpposi_uidhba_queue_depthtablesDMA_BIDIRECTIONALbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmphy_idTaskTagdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_disk_MPI2_IOC_INIT_RDPQ_ARRAY_ENTRYrq_nextsp_offsetsrcu_cblist_invokingi_lockd_namedebugfs_removeSDEV_EVT_LUN_CHANGE_REPORTEDcpuhp_onlineget_ownershipufdscrypt_ctxexe_filenr_scannedpcp_listpid_linkshba_mpi_version_belongeds_sysfs_nameMQ_RQ_IN_FLIGHTrefcountnr_activevaddrrequestValidEntriesrw_hinttimeoutreport_zones_cblast_switch_timenum_classesfirmware_event_threadorc_unwind_ippcie_target_idqc_dqblkretry_hwerrormmappedseqcount_raw_spinlockbd_holder_dirbroken_intx_maskingfault_reset_work_internal_cmdkill_sbd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parametersbuild_zero_len_sge_mpieh_timed_outi_write_hintfxsaveprocess_keyringbase_cb_idxlist_op_pendingiotmo_cntDEVICE_VERT_POS_LOWER__stack_chk_failllist_headiounit_pg0iounit_pg1byteswait_startsense_dmafw_event_lockbios_pg2f_freeptrno_scsi2_lun_in_cdbclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceHeaderVersionstarved_listclass_rwsem_write_try_is_conditional_MPI2_BOOT_DEVICE_SAS_WWIDthaw_noirqrcu_syncMaxSasExpanderspreempt_notifierssrcu_last_gp_endmax_channels_fsnotify_infoloss_of_dword_sync_countMPI2_TARGETASSIST_SUCCESS_REPLY_DESCRIPTORmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyscsi_timeout_actionGlobalFlagsMPI2_VERSION_STRUCTremoves_magicdl_overrunallocsubvendord_parentirq_polltransparentpayloadac_minflti_sborig_nentsblk_mq_hw_ctxkmalloc_noprofmatchcommcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxatomic_openbio_end_io_tstart_prevent_timecondreadahead_controlblk_tracesubordinate__kernel_gid32_tPciBusNumberkernfs_open_filereset_from_userf_credconfig_cb_idxMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesbd_devslave_destroyread_newsignalfd_wqhmmapmodnameasync_put_workmknod_MPI26_NVME_ENCAPSULATED_REQUESTpri_reqs_allocctxsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapdma_alias_maskwritepagessched_statisticsheadminors__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controlfw_event_workuclampattached_handlesuper_operationsbi_cookiesplice_eofHostTraceBufferMinSizeKButil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAsas_phynentsFunctionbd_holderspt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idmap_nruse_16_for_syncd_rt_spc_warnsq_usage_counteri_verity_infophy_maskxsavetimespec_type__rb_parent_colordevres_lockbitsmpt3sas_debugfs_iocdump_fopsiopriochildcap_inheritablegp_waitlookupcostdev_pm_inforeply_post_queue_depthMPT3SAS_ADAPTERats_capblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_ops_MPI2_CONFIG_PAGE_MAN_0ReplyFlagsdev_flagsvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typebroken_parity_statusdiskseqPortTypei_pagesatomic_write_hw_boundaryhlist_bl_headino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitdoe_mbspage_fragwrite_bytescharqf_ownerunix_inflightbuild_zero_len_sgeholders_dirinit_cmd_privhi_priority_smidfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledgraph_get_port_parentAddressReplymax_zone_append_sectorsSDEV_EVT_MAXBITS__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkgot_task_abort_from_ioctlbio_slabd_aliasrdpq_array_enable_assigned__iovcpumaskmq_hctxdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsdma_data_directionenclosure_logical_idd_rt_spc_timerevict_inodekernfs_elem_attrlengthmax_hw_discard_sectorsbuflensaved_trap_nr__this_moduleHostTraceBufferMaxSizeKBbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityno_report_opcodesrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_freebridge_d3parentHighPriorityCreditspecial_vecatimecopy_file_rangeinquirytask_cputime_atomiccommit_rqsMpi2SystemInterfaceRegs_tis_aero_iocuser_definedSAS_SATA_PMkey_typeget_named_child_nodelaunder_foliocurr_targetnumberis_suspendeddma_lengthhotplugtimeout_workburstPUT_SMID_DEFAULTetypeei_funcs_MPI2_BOOT_DEVICE_ADAPTER_ORDERmodule_kobjectreply_queue_countactive_memcgSAS_PHY_DISABLEDconfig_vaddrdef_flagsd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updatetarget_blockedvendorcap_bsetopen_modearchdata_sourcepower_stateport_idSDEV_DELnr_perf_statesstack_vm_areasaved_statecfg_sizebasespcie_mpsss_bdev_filenuma_faultswork_qblist_flags_tlinux_binfmtEventTriggerEntrypage_table_lock_sigfaultcountersname_linkchipcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typebuild_sg_scmdsriovpolicysharedwait_queue_entrydismissd_real_typelookahead_bandio_portseq_start__targetsinternal_smidrq_qos_mutexzone_wplugs_wqraw_lockd_dnameget_dqblkwait_indexscsi_levelmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcechigh_iops_outstandingmin_sliceargs__poll_tfwnode_operationstarget_allocshow_devnamelogical_block_sizerun_delaytailsblk_flags_tlinenoSDEV_EVT_SOFT_THRESHOLD_REACHED_REPORTEDrequest_dma_szGenericFlags0GenericFlags1bi_io_vecbase_pfnget_inode_acl_addr_pkeyioc_link_reset_in_progressmigrate_foliocustom_sliceaer_capthread_keyringhosttkparam_arrayutimesecurity_supportedstart_codehostdiag_unlock_mutexis_managedis_hardiorequest_cntEEDPTagModefsbasecompatiblesubsystem_deviceSHOST_CANCEL_RECOVERYclock_listattrsNVMe_CommanddynidsAdapterOrdereh_deadlinecpumask_tring_buffer_szswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEsoft_resetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainMpi2IOUnitPage0_tbios_paramdiag_buffer_sz_sigchldpi_offsetdiscard_granularityreset_in_progress_mutexfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetmax_lunnext_cpubsg_devicetime64_tdma_pooli_blocksnuma_faults_localityhas_child_subreaperMaxMSIxVectorsrom_bar_overlap_MPI2_REPLY_DESCRIPTORS_UNIONpref_64_windowi_acl___GFP_ZERO_BITvphys_listwrite_newlist_lockInitiatorDevHandlepm_domainmsix_indexcpu_bitmapipi_listMaxNumPhysicalMappedIDsstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statesas_identifyset_rq_budget_tokendebugfs_rootsoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagshandlerswp_entry_tMinDevHandlesas_address_parentdelayed_event_ack_listbi_inline_vecs_mapcountdomain_tagpasid_requiredhang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventhtb_relsg_prot_tablesizeget_unique_idset_performance_statephys_addr_tSHOST_CREATEDclass_preempt_is_conditionalconsumers_cntmodule_memoryinternalpi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacHostTraceBufferDecrementSizeKBnr_to_scanfs_parameter_specNumberOfPortsdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delaydma_cleanupmaple_treeMPI2_ADAPTER_INFOKMALLOC_DMAdentrylast_mergecpu_itimerpercpusriov_get_vf_total_msixlast_queue_full_countsupports_trigger_pagesrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupsaved_end_ionr_threads__i_nlinkReserved1Reserved2Reserved3Reserved4Reserved5Reserved6Reserved7Reserved8Reserved9pushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAconfig_page_szdelayed_workmq_listmanage_system_start_stophiwater_rsskretprobe_instancesshostrangefutex_exit_mutexsimple_read_from_bufferpm_onlykernfs_iattrstag_alloc_policytrc_blkd_nodeignore_loginfos__sectord_spacerespondingbase_readl_ext_retrygraveyard_linkMpi2ReplyDescriptorsUnion_txol_vaddrsplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsnvcswEnclosureSlotKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typestate_savedi_rdevirq_reroute_variantself_exec_idreplykernfs_opsfile_lockMODULE_STATE_LIVEclearedclass_maskport_enable_failedstopnr_migrationsa_opsreq_listxa_flagssingle_lunphy_reset_problem_countfreezebin_sizemap_busclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITnr_sectorsscsi_lookup_lockd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITBLK_EH_DONEset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqblast_resetuidhash_nodesaved_tfblk_mq_queue_mapElf64_Xwordold_timespec32device_configureGET_MSIX_INDEXlock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkcpu_countis_virtfnMasterDatapercpu_refhorizontal_positionioerr_cntchain_lookuppref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxDoorbellDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploMsgFlagsclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightWordsvm_filepfactsmax_device_blockeds_stateuser_sizetabledev_pm_opsHostInterruptMaskcdrom_device_infoSAS_PHY_RESET_PROBLEMscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkreset_timeoutreply_free_queue_depthkmalloc_typen_io_portdispatch_wait_lockqstrma_flagsnr_ia_rangesSAS_HAmax_user_discard_sectorsno_msifutex_stateorig_pmdqueue_lockshpc_managedacct_timexpdSHOST_DEL_RECOVERY__rcu_icq_cachempt3sas_setup_debugfssize_qprocwakeup_sourcef_posnext_posix_timer_id__kernel_long_tDefaulttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsSAS_SATA_PM_PORTchain_pages__le16build_nvme_prpalt_lenstart_scan_failedcinblockextableexitrpm_autosuspend_delaykernel_param_opsbus_dma_regiondpc_capio_uring_cmdthresh_holddirtied_whenpdt_1f_for_no_lun__paddingsem_undo_listpci_error_recoverystatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_head_MPI2_CONFIG_PAGE_IO_UNIT_1SL_WH_MPI_TRIGGER_Trcharfutex_pi_statekstatpci_access_mutex__kernel_uid32_t__le32dispatchq_lock_cls_keyaccess_stateDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockwake_batchget_namefwnode_endpointopt_sectorsepoll_watchesprealloc_pteprot_typesas_node_lockborkenSDEV_CANCELTargetCommandBufferdqb_curspace_entrygp_statebitsetload_avgsched_dataaccesscstimepcie_capcompletion_cntcfs_rqbi_bdevrq_end_io_fn_uidprot_opst_spacemm_cid_next_scanns_typescan_startmsix_enabledac_majfltreal_timerpasid_enabledposix_cputimers_work_upperCurrentHostPageSizerequest_szmodule_param_attrsshort unsigned intstargetbus_flagstarget_port_protocols__le64same_target_siblingspcie_sg_lookupi_mutex_dir_keymq_pollq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysRAIDAcceleratorSuccesstmp_stringsmidorig_ptepasid_capdqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutexnanosleep_MPI2_BOOT_DEVICE_ENCLOSURE_SLOTSTARGET_REMOVEeh_host_reset_handlersrcu_gp_seq_neededsbq_wait_statedq_dqb_lock__kernel_ulong_tvolnameio_mindl_periodsym___kernel_vsyscallReplyFreeHostIndexi_fsnotify_markswakeup_pathHCTX_MAX_TYPESdio_mem_alignbtime__u8is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTPCIeEncapsulatedSuccessrestartsSAS_LINK_RATE_12_0_GBPSruntime_deferred_listd_waitlocal_fwnodequeue_flagslist_lru_onedevice_physical_location_horizontal_positionpercpu_ref_func_t_MPI2_VERSION_STRUCTMPI2_ADAPTER_ORDER_AUXseq_stopMPI25_FP_SCSI_IO_SUCCESS_REPLY_DESCRIPTORpci_dev_flags_tkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidis_warpdriveaer_statss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalqueue_rqsshrinker_idbio_setrootoom_reaper_listdebugscsi_device_handlershutdown_presym_VDSO32_NOTE_MASKscsi_devicewdtrbpf_storage__data_lenmq_mapno_callbacks__u16timers_activewait_countalloc_hintsig_okOEMSpecificFlags0OEMSpecificFlags1delaysirq_safereadaheadkmalloc_cache_typestart_stop_pwr_condpcie_device_lockmutexpgd_tnr_cpus_allowedeh_abort_handlerdiscard_alignmentHostInterruptStatusraw_spinlock_tkey_tagMaxTargetssysdatafs_flagswordworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstkslave_configurereserved_tagssrcu_sspSDEV_CREATEDwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdevpending_eventsirq_poll_fn__u32ptracedtrc_reader_specialdevice_get_match_dataHPROBE_GONEmax_nvme_qdactive_timei_sequencepool_datapci_vpddisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendorBASE_READ_REGi_dir_seqwakeup_preparedkqiddefer_syncaccess_statusKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTApd_handles_szbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmacls_mskchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typedpc_rp_log_sizeimm_readySL_WH_EVENT_TRIGGERS_TBLK_INTEGRITY_CSUM_CRC64f_iocb_flagsiodone_cntpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infooverride_onlyMaxInitiatorsdma_flagssched_contributes_to_load_sas_phystatic_key_truedisk_events_disable_depthweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimeNvdataVersionDefaultdeadlinemempool_spinned_vm_debugfs_iocdump_open_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacitydma_addressvm_startshost_gendevtag_list_lockunused_hctx_lists_flagsget_rq_budget_tokenAdapterOrderAuxcpumask_var_tfaultmultipath_on_hbaalternative_gpt_sectorshow_statsdl_densityfreeptr_tset_dbd_for_msread_dqblkintegritydq_flagsdebugfs_create_u8SAS_SATA_DEVread_before_msnext_cpu_batchDD_CLASS_TYPE_DISJOINT_NAMESpci_devmemcg_datatracepoint_extkprobes_text_startrunnable_avgdma_boundarys_time_grankernel_cap_tSUBMITTED_BY_SCSI_RESET_IOCTLnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITReserved10SDEV_EVT_MEDIA_CHANGEnum_kpPCIBusNumin_execvehost_tagsettlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_lockno_report_lunss_dquotmax_hw_sectorsfolioqtm_cmdstagsprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uidinvalid_dword_countchildrenrb_subtree_lastno_pm_callbacksMaxEnclosuresbuild_idrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_paddevice_infotailia_atimelasttlb_ubcbi_issuevphys_maskquota_format_typemsi_enabledseeksis_driver_loadingtask_structbudget_tokenrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextpcie_device_init_listio_tlb_memis_gen35_iochost_self_blockedarch_spinlock_tsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometrymanufacturerdevcapsuppress_bind_attrsRPM_RESUMINGreg_offsetgsbaseSDEV_EVT_ALUA_STATE_CHANGE_REPORTEDdispatch_waits_quota_typesinternal_tagf_llistSAS_PHY_VIRTUALmq_freeze_locki_nlinksdev_devbranchwrite_begingroupserr_handlerno_vf_scanpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalfw_events_cleanupstart_scanon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdriver_namedl_serverSCSI_EH_RESET_TIMERtrc_reader_nestingin_userestart_blockumode_tMpi2IOCPage8_tIOCLogInfosharepagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_supers_inode_list_lockelevator_queuetm_custom_handlingsweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typeBoardTracerNumbermaj_fltarch_rwlock_tctx_mapSHOST_DELput_smid_hi_priorityclock_basediag_trigger_lockcdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_data_debugfs_iocdump_readmmap_locksysfs_lockrq_qosfsavekeyring_index_keyqrwlockfast_pathRequestDescriptorPostLowSDEV_EVT_CAPACITY_CHANGE_REPORTEDfile_ra_stateuser_structon_rqfs_contextmempool_alloc_tNumDevsPerEnclosureprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vf_sas_nodeinternal_lookupIRVolumeMappingFlagsunsafe_warnllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameport_enable_cb_idxpoll_queue_prochi_priority_depthunfreeze_fsintervalclasssas_linkrateVP_IDlast_mm_ciduntrustedbuild_sgmax_open_zonescookiebd_stampSTARGET_DELSAS_FANOUT_EXPANDER_DEVICEtargetstarved_entrya_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_tSL_WH_EVENT_TRIGGER_Ts_maxbytesacpi_device_idd_ino_countlast_cpuilenmnt_flagsvm_structsense_lencred_guard_mutexbusymajorenclosure_listpci_opssigcnthrtimer_cpu_baseresourcescb_headcheck_quota_filedirty_folioattributerestrict_linkdev_archdatampi3_version_unioni_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheclass_disable_irq_is_conditionalchain_depthanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrtry_vpd_pagesi_opflagsrobust_listbase_cmdssym___kernel_rt_sigreturnreply_post_freesym_pvclock_pagemmio_enabledserial_nodelen_desc_MPI2_CONFIG_PAGE_BIOS_2_MPI2_CONFIG_PAGE_BIOS_3s_incoredqsd_iputcompat_ioctllockdep_mapfilterMpi2BiosPage2_tcurr_ret_stacklast_queue_full_depthdockenable_sdev_max_qddev_links_infoloff_tthread_pidinquiry_mutexsrcu_gp_seqia_rangesno_command_memory_archport_numst_valueclass_write_lock_irq_is_conditionalDiagRWDataKOBJ_NS_TYPESpprevcallseh_actioni_default_acleh_target_reset_handlers_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeProductSpecificcombined_reply_queueicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secmemory_typerb_rootnr_wakeups_locals_fsnotify_masknr_requestsHPROBE_STABLENVMeAbortTOIOCStatusrq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorspci_error_handlersWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tMPI2_ADDRESS_REPLY_DESCRIPTORFAULT_FLAG_KILLABLEinodesclass_namestarget_busys_mtdkparam_stringpowerma_lockcleanup_rqevent_flagssched_delayedbd_statsbi_sizesupported_modescsi_device_eventmodule_statemq_kobjlast_used_at__compiletime_assert_473vm_endlast_queuednuma_migrate_retryuser_ns__statefirstdispatch_fromdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keypcie_sg_listvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexpcie_sgl_dmai_private_dataElf64_Halfuse_autosuspendnsproxySASAddresscan_wakeupxol_areatransporttreply_post_host_indexrlockfactsfl_owner_t_resia_rangeeuidwaitbug_tabledirtied_time_whendma_drain_lensequential_io_avgnum_trace_bprintk_fmtqueue_ramp_up_periodMPITriggerEntryvm_policyperf_rdpmc_allowedrdevkernel_ulong_tput_smid_scsi_ioDEVICE_PANEL_TOPsignumfscrypt_keyringtemp_sensors_counts_mountsuse_memdelayRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpbvec_iterpage_sizectimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenpme_supportdqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetSHOST_RUNNINGblk_crypto_profilefolio_queuelast_task_numa_placementreply_post_free_arraySAS_LINK_RATE_3_0_GBPSpgtable_tblock_startcgtimedelayed_tr_listsymlinkoom_flag_originDMA_NONEcounterorc_unwindSAS_LINK_RATE_FAILEDMpi2IOCPage1_tWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqio_queue_numReplyFrameAddresstrace_eval_mapdoneSlotNumberring_buffer_offsetfscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexMpi2IOUnitPage1_tratelimitfree_foliodebugfs_dirdriver_managed_dmaqueuedataMIGRATE_SYNCRPM_REQ_NONEPIDTYPE_PGIDrm_xquotactl_cb_idxreq_alt_boot_deviceem_perf_tabledl_timerbuild_sg_mpii_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsend_io_datablkcg_gqmap_queuesdelayed_sc_listia_filesival_intnuma_preferred_niddma_need_drain_hugetlb_cgroupdentry_operationschannelmemcg_nr_pages_over_highd1_supportqueue_offsetarch_uprobe_Boolsleep_startDCRAddressmin_fltwwidconfig_pageHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatereverse_orderingi_linklistxattr_lowertrap_nrmax_queue_depthasync_probe_requestedcompat_long_tactive_counts_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupswakeup_cntpmd_ts_opd_sbsysv_shmIOCCapabilitiesdma_channellast_sector_bugdq_countMPI2_BOOT_DEVICE_DEVICE_NAMEutf8data_tableset_latency_tolerance__func__resource_size_tnr_tagsfoliowake_entryxa_headsuidport_table_listchain_trackeri_readcountmanage_runtime_start_stopblk_integritylocked_vmminimum_linkraterb_leftseq_nextguess_capacitysym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_lentm_tr_volume_cb_idx__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tmax_shutdown_latencyquota_syncdq_free__bd_flagsparent_exec_idignore_media_changeretrieskernfs_elem_dirsrcu_lock_countksm_merging_pagesSAS_PHY_RESET_IN_PROGRESSautosleep_enabledptrace_entryblkg_listhost_scribblerecent_used_cpuIocLogInfonum_jump_entriess_qcopatomic_tbv_pageevent_logalloc_tag_countersdomain_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitPCISlotNumshort intmynodepart_tblmaximum_linkrateof_device_idblk_mq_opsscatterlistbridge_ctlclass_raw_spinlock_irqsave_is_conditionalioc_dumplockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirirqpollVTIME_USERsa_flagstestSAS_EDGE_EXPANDER_DEVICEBLK_INTEGRITY_CSUM_CRCtime_sync_interval__kmalloc_cache_noprofpad_untilDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerextra_lenprio_listatomic_write_hw_unit_max_flags_1_flags_2eh_device_reset_handlersbitmaplast_arrivalsupported_speedsem_pdctl_cmdstrace_event_callMPI2_BOOT_DEVICE_ADAPTER_ORDERis_guestdevice_physical_locationpm_domain_dataeh_eflags_MPI2_ADAPTER_INFOpoll_table_structdirect_IOSTARGET_CREATEDReqAltBootDeviceFormfw_event_listwait_queue_entry_televatorcurrent_may_mountseqlock_tskip_ms_page_8bd_queuenuma_scan_offsetreply_dma_min_addressdiag_trigger_activeirq_line_enable___GFP_NO_OBJ_EXT_BITsched_migratedfrozenDataLengthmlock_countin_lru_faultgrpmaskvpd_pg80vpd_pg83vpd_pg89regfunctm_sas_control_cb_idxindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validis_mcpu_endpointvertical_positiondiag_trigger_mpii_rcui_atime_secFlagsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITpcie_bwctrl_dataactiveselect_no_atndqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsgetattrFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listno_read_capacity_16tagged_supportedMinorreap_refxarray_startfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atscsi_host_templatelast_sum_exec_runtimeiov_iteria_gidSDEV_OFFLINEmanu_pg10manu_pg11attribute_groupMQ_RQ_COMPLETEcontextposix_timersdriver_exclusive_resourceselectorblkcg_polsMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasebi_nextdefault_timer_slack_nspend_os_device_addoffline_alreadysource_listtrigger_info_dwords_keyswap_readahead_info__fpstateactive_refreply_dmaremove_hostpmdval_t___GFP_NOFAIL_BITprivate_datagroup_infovdso_imagereply_post_structblk_qc_tNvdataVersionPersistentfileof_match_tablepercpu_count_ptr__user_state_sizefilpMPT_BUILD_SG_SCMDpcie_cap_lockmce_kill_menegotiated_linkratephysical_block_sizeuuid_teh_noresumeproperty_read_int_arraySCSI_EH_DONE___GFP_UNUSED_BITatomic_write_hw_unit_mincount_objects_stimezone_device_dataSDEV_EVT_INQUIRY_CHANGE_REPORTEDnr_active_requests_shared_tagsMPT_ADD_SGEf_wb_errio_uring_poll_queuequeuelistphysfndefparamMaxReplyDescriptorPostQueueDepthresid_lenfred_csq_lockdep_mapinquiry_lenreply_post_free_array_dma_poolfault_flagreventsMajorkprojid_tptracer_credtlb_genstoreio_lock_cls_keySDEV_TRANSPORT_OFFLINEpage_mkwritekobjectaudit_ttympt3sas_port_factsmce_ripvstatfstag_set_dev_errBiosVersionats_enablednumab_stateremovablecan_queuefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistreply_free_MPI2_CONFIG_PAGE_IOC_1eetlp_prefix_pathclass_groups_MPI2_CONFIG_PAGE_IOC_8sas_device_listnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedcmndsysfs_registerednum_physAddlFlags2AddlFlags3debugfs_mutexwatch_listaudit_contextpp_ref_countsysfs_opserror_detectedsequential_iois_busmasterSHOST_CANCEL_large_mapcountsda_is_staticformatftopenclave_pcie_deviceSDEV_CREATED_BLOCKbi_privateMPI26_PCIE_ENCAPSULATED_SUCCESS_REPLY_DESCRIPTORexit_hctxsp_regrequest_dmacreateiattrreply_qrseqSAS_PROTOCOL_STP_ALLMSIxIndexnfdssigvalvma_lockmax_discard_segmentsperf_event_listgetgeoget_reserved_spacehpr_lookupnon_seqstack_refcountinvalidate_lockbmapkey_payload_MPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTORtimer_rand_stated_reallink_stateexpiry_activesas_protocoltimestamp_update_countdqi_max_spc_limitSCSITriggerEntryexception_table_entryvirt_boundary_maskevent_countProtocolFlagsfallocatei_spc_warnlimitbuddy_listcdl_enablei_ino_timelimitSDEV_RUNNINGi_mmap_writablemems_allowedbios_pg3tlb_flush_batched_ddebug_infoslave_allocis_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startblocksphy_belongs_to_portset_infofileattr_getvectormfg_pg10_hide_flag__devices__bi_cnttimer_list_olddevice_dma_supported_MPI2_ADDRESS_REPLY_DESCRIPTORd_ino_warnsMPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORhiwater_vmtracepointPageLengthcompound_headproduct_specificia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqsrcuunique_idrenamevm_area_structrpm_statussb_writersino_timelimitErrorResponseAllocationLengthpci_bus_flags_tsplice_writemsix_capstate_in_sysfsdebugfs_create_file_fullrom_base_regqf_nextcdl_supportedio_window_1krangesiommu_mmats_stublk_features_tcutimeem_tableprot_flagspersonalityget_stateIOCExceptionstask_sizes_inodes_addrbinfmtDeviceNameirq_domainnr_queuessigned charprioprividle_notificationsched_infod_fieldmaskquiesced_byuprobe_xol_opsseq_filefreeze_noirqrdpq_array_capablercu_tasks_idle_cpuwrite_file_infofilter_countget_aclpasid_no_tlpsync_fsparam_locksi_signoenabledfixupsfile_operationsqueue_rqKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tag_killktime_tsymsgroup_nodePageNumberi_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasepins_MPI2_SCSI_IO_SUCCESS_REPLY_DESCRIPTORpacct_structmust_resumeget_msix_index_for_smlioioc_pg1_copyzone_wplugs_hashTargetAssistSuccesslong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ssproperty_presentexpecting_cc_ua__kmalloc_indexnr_ioscurrent_eventprintk_index_sizesymtabfree_diskaen_event_read_flagsg_table_boot_devicert_mutex_waiterremount_fss_typeruntime_statusin_iowaitlun_in_cdbunregfuncegidiomap_MPI2_MPI2_BIOSPAGE2_BOOT_DEVICEchain_segment_szdq_hashput_superevent_contextput_smid_defaultfwnode_reference_argspushable_dl_tasksf_flagsiopoll_q_start_indexcodetagtransport_cmdsPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_doneis_thunderboltmark_dirtyeh_cmd_qMaxPostedCmdBuffersnum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameReplyPostHostIndexTT_NONEMPI2_TARGET_COMMAND_BUFFER_REPLY_DESCRIPTORio_missing_delayVTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytesexport_operationssrcu_usagebitmapacpi_match_tablesc_data_directionmemcg_sigvalFWVersionhide_drivesbvecnameidatalatency_recordchain_bufferBoardNamemod_kallsymsmnt_idmax_sges_in_main_messagemultifunctiondepthsnprintfwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_colddma_addr_tshiftcheck_eventsssize_tProductIDiopl_emulmax_write_zeroes_sectorswork_structdesc_lenflocktrack_queue_depthtask_io_accountingmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structmax_target_blockedrunning_disparity_error_countpr_opspi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqreply_free_dmaevent_listshost_recoveryPageTypeclass_spinlock_irq_try_is_conditionaloom_mmehandlerFAULT_FLAG_INTERRUPTIBLEget_reference_args_debugfs_iocdump_releasesrcu_reader_flavortv_nseci_lrud3cold_allowedqueue_depthmsix_enableunderflowgfp_maskpi_state_listrcu_segcblistsubvolsubmitterfault_reset_work_q_namefree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infomq_rq_statesrcu_structrlim_curnofaultmm_countcputime_atomicdrv_groupsstackscsi_data_bufferfunctionki_flagsbvec_poolbd_start_sect___GFP_IO_BITcb_idxsrcu_have_cbsd_in_lookup_hasheh_timeoutmax_sectorssgidinitial_nsFREEZE_MAY_NESTscsi_transport_templatesdev_bflagsbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsemSL_WH_SCSI_TRIGGERS_Tget_projidatomic_desc_capablesched_reset_on_forkmq_ctxHPROBE_CONSUMEDMPI2_RAID_ACCELERATOR_SUCCESS_REPLY_DESCRIPTORbpf_net_contextopc1__int128 unsignedpcountwake_indexmpt3sas_debugfs_bufferrestore_noirqdma_pad_maskSL_WH_MPI_TRIGGERS_Tki_filpbitmap_tagsdrv_internal_flagscap_ambientdma_configureruntime_erroractive_modeatomic64_tanon_vmause_32bit_dmaHCTX_TYPE_DEFAULTruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folioSAS_PHY_UNUSEDnr_events_MPI2_CONFIG_PAGE_HEADERchains_per_smid_MPI2_VERSION_UNIONHCBAddressHighiommubi_opfprivatest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxscsi_vpdtph_enabledsplice_pipeuclamp_reqshort_inquiryblk_mq_tag_setSAS_SATA_PORT_SELECTORblk_independent_access_rangess_lock_keyReservedsrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsslotsSUBMITTED_BY_BLOCK_LAYERtqheadeh_bus_reset_handlers_activediag_trigger_eventMEMORY_DEVICE_FS_DAXhpr_free_listclass_mutex_is_conditionalremap_file_rangemin_shallow_depthnr_hangssym_vvar_startgid_twake_cpuchainedio_uring_taskrequest_trackerabort_worktask_worksmemory_failurerb_root_cachedSAS_PROTOCOL_NONEs_copnvme_mdtsdd_key_truehres_activebpf_raw_eventsdq_dirtyscsih_cmdsdl_deferround_robinbug_listdirect_completeblk_mq_tagswbt_flagsxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countlockableLogEntryQualifierkey_restrictionnr_rangeexit_statepd_handlesRDPQBaseAddressis_late_suspendedsysvsemadd_busshost_statebd_nr_sectorsMaxChainDepthhba_vphyignore_childrenresourcerestore_earlyclock_mutexfs_superssense_dma_poolqueue_stoppedvpd_pgb0vpd_pgb1vpd_pgb2chain_dma_poolvpd_pgb7Mpi2ManufacturingPage10_tdqb_bsoftlimitpendingmax_dev_sectorsno_vpd_sizef_task_workdiag_trigger_scsi___GFP_NORETRY_BITiowait_countmatch_driverprot_sdbset_read_onlythrotl_datadma_io_tlb_memstringread_countfix_capacityfutex_offsetlong long intmmio_always_onevent_masksatomic_flagssysvshmpcie_sgldevice_remove_in_progresstimer_expirestrace_evalsactive_basesearly_initrcec_eacmd_sizemprotectsecurityxmm_spaceSAS_PROTOCOL_SMPSAS_LINK_RATE_6_0_GBPSactivatescsi_targetmsix_basef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structbroken_fua___GFP_FS_BITi_bytesdomain_datarelax_countdma_devtagset_freedlinelinkstart_timekernfs_nodedev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchreschedule_countvfsmountextable_basenoinstr_text_sizeattributesset_child_tid_overruntmpfilercu_read_lock_nestingtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugrefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tUTF8_NMAXfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqia_vfsgidsize_tcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workatomic_long_tpreallocclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicdelayed_callmax_nr_cid_statusd_sibbin_attributepercpu_counternuma_pages_migratedgsindexexpires_nexti_io_listf_epsrcu_barrier_seqreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tHRTIMER_BASE_BOOTTIMEclass_srcu_is_conditionalnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionHRTIMER_BASE_REALTIME_SOFTstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registers_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrstate_in_sysfstty_structUTASK_SSTEP_TRAPPEDbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollnr_wakeups_idleio_cqelf64_symlatch_tree_nodedestroy_work__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerma_external_lockuid_tflush_requiredsum_block_runtimepgmapdq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditional_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitnuma_groupdescriptionclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinei_inodyndbg_infoindexthread_headmap_typef_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_len__UNIQUE_ID_alias473__UNIQUE_ID_alias474__UNIQUE_ID_alias475__UNIQUE_ID_alias476__UNIQUE_ID_alias477HRTIMER_RESTART__UNIQUE_ID_alias479MOD_MEM_NUM_TYPESsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxcpu_basedquotdl_runtime__UNIQUE_ID_alias480__UNIQUE_ID_alias481__UNIQUE_ID_alias482__UNIQUE_ID_alias483__UNIQUE_ID_alias484__UNIQUE_ID_alias485__UNIQUE_ID_alias486__UNIQUE_ID_alias487numbers__UNIQUE_ID_alias489_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroup__UNIQUE_ID_alias490__UNIQUE_ID_alias491ptrace_message__UNIQUE_ID_alias493__UNIQUE_ID_alias494__UNIQUE_ID_alias495__UNIQUE_ID_alias496__UNIQUE_ID_alias497__UNIQUE_ID_alias498num_trace_events_sys_privateUTF8_NFDIinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authHRTIMER_BASE_TAIvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherscompletionsw_reservedUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treequota_onvm_operations_structbin_attrs_newiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdatanrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupwake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlinedup_xol_worktotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramd_spc_softlimitreported_split_lockgfp_tseccomp_filterstimei_mmapthaw_superd_lrusignal_structperf_event_mutexcrcspgdval_tSB_FREEZE_WRITEsetattrf_mappingnoinstr_text_startbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activei_opldt_usr_semkobj_ns_type_operationsDQST_FREE_DQUOTSseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tis_dirty_writebacktrace_bprintk_fmt_startkstatfssitesptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGthreadsym_timens_pages_time_min__UNIQUE_ID_alias503s_devcpus_allowed_lockget_next_idrwlock_tpgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutex_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupseqcount_spinlock_ti_wbclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedpagetrc_holdout_listget_inode_usagenormal_priodestroy_inoderelease_folioi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inameHRTIMER_BASE_MONOTONIC_SOFTi_mappinginblockrmidrseq_siglimit0limit1dqi_max_ino_limitmigrate_modeftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksd_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrDQST_SYNCSstack_vm_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalcg_listsrcu_barrier_completionrw_semaphoremnt_sb_ddebuginfofiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypeinit_modulemembarrier_statepage_poolinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_mempathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwrcu_syncvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstate__UNIQUE_ID_alias478ueventlock_countrefcount_tplugsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttableslist_headtgidwrite_protect_seq__UNIQUE_ID_alias492compat_robust_list_head_tids_inode_wblist_lock__UNIQUE_ID_alias499end_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextgpl_symsseq_showswait_queue_headblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfds_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceobjcgnodeDQST_READSvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvstatic_prioshrinkerdl_yieldeddqi_formatexec_update_lockDQF_PRIVATEDQF_SYS_FILE_Bl1d_flush_killi_versionprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symboltv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskSB_FREEZE_PAGEFAULTactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlock__rcu_headmce_vaddrquota_offdq_inusedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmod_tree_nodef_sb_errwritepagecodegtimesigactionclass_rwsem_read_is_conditionalsum_sched_runtime__UNIQUE_ID_alias500__UNIQUE_ID_alias501__UNIQUE_ID_alias502__kernel_timespec__UNIQUE_ID_alias504__UNIQUE_ID_alias505__UNIQUE_ID_alias506locked_pending__UNIQUE_ID_alias508__UNIQUE_ID_alias509nr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listktypelockref__UNIQUE_ID_alias510srcu_struct_ptrs__UNIQUE_ID_alias512__UNIQUE_ID_alias513__UNIQUE_ID_alias514mm_struct__UNIQUE_ID_alias516__UNIQUE_ID_alias517__UNIQUE_ID_alias518vlagi_uidspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesvm_mmmod_mem_type__UNIQUE_ID_alias520__UNIQUE_ID_alias521__UNIQUE_ID_alias522__UNIQUE_ID_alias523__UNIQUE_ID_alias524debugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipMOD_INIT_RODATAqc_dqblkmmappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCi_write_hintfxsaveprocess_keyringlist_op_pendingllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyioveci_private_lockVTIME_IDLEstatic_keys_magicdl_overrunDQST_ALLOC_DQUOTSd_parentpayloadac_minflti_sbd_sbcommPIDTYPE_PIDatomic_write_segments_maxatomic_openreadahead_control__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupblockedi_securitystats_lockD_REAL_DATApt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colorbitsiopriocap_inheritablegp_waitlookupDD_CLASS_TYPE_LEVEL_NAMESvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vec__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATElf64_Symd_automountparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcestack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkDQST_CACHE_HITScmaxrsstimer_slack_nspolicysharedd_real_typelookahead_bandseq_startraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamerun_delaytailslinenoget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_code__UNIQUE_ID_alias488is_hardfsbaseattrscpumask_tswregs_statedqb_isoftlimitorig_axsched_rt_entitytimerqueue_nodeil_weightmem_dqblknr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pause_sigchldreservedlatency_record_countcgroupsprev_scan_seq_DQST_DQSTAT_LASTrcu_usersoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockUTF8_NFDICFcpu_bitmapstatic_call_keyutil_estucountsMOD_RODATAqc_statesoftirq_next_timercheck_flagsswp_entry_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aMOD_INVALIDmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalautogroupnr_threads__i_nlinkpushdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magicfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsMOD_INIT_DATAnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_infoshared_pendingi_gidmin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idHRTIMER_MAX_CLOCK_BASESkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsxa_flagsbin_sizegrphid_spc_timerjump_entriesassoc_array_ptrsuper_block_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_array__UNIQUE_ID_depends472mnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpref_node_fork__int128dqi_privrss_statmems_allowed_seqrefcntD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxresult_maskdquot_operationsmappinggrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizescheduledclass_raw_spinlock_nested_is_conditionalworker_privateis_relqstrma_flagsfutex_stateHRTIMER_BASE_TAI_SOFTacct_timexpd__rcu_icq_cacheDQST_WRITESsizef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attempts__UNIQUE_ID_srcversion525alt_lencinblockextableexitkernel_param_opsio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tdl_server_has_tasks_frunnable_sumreal_credepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgcstimecfs_rq_uidst_spacemm_cid_next_scanac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysMOD_TEXTdqb_curinodesload__s8invalidate_lock_keyprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_marksdio_mem_alignbtime__u8is_roxlockrlim_maxruntime_deferred_listd_waitlist_lru_oneseq_stopkiocbclass_rwsem_read_intr_is_conditionalfsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeshrinker_idrootoom_reaper_listsym_VDSO32_NOTE_MASKbpf_storage__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingfsindexshstksrcu_ssp__page_1__page_2__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEi_sequencedqb_ihardlimitd_lockrefnum_bpf_raw_eventsaddr_perfi_dir_seqkqidKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typef_iocb_flagscmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagshrtimer_base_typestart_boottimevm_starts_flagsiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listhrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendings_listdqb_rsvspaceversionserialalloc_locks_dquotfolioqprev_posseqcount_spinlocks_umountis_bin_visiblesyscall_user_dispatchrcu_tasks_exit_listia_uidchildrenrb_subtree_lastbuild_idvfork_donenanosleeprt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelayquotalenf_pipei_wb_frn_historylast_wakeenextarch_spinlock_ti_mtime_nsecmmlistutf8_normalizationset_dqblkreg_offsetgsbases_quota_typesf_llisti_nlinkwrite_beginpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedHRTIMER_BASE_BOOTTIME_SOFTfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tquota_enablesched_avgntabmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextprealloc_bufprojiddrop_inodenum_trace_evalsllseeknext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeunfreeze_fsintervallast_mm_cidcookietargeta_flagstrace_overrunsession_keyringfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributerestrict_linkMOD_DATAi_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackloff_tthread_pidsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringma_locksched_delayedmodule_statelast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimemigrate_from_cpusrcu_barrier_mutexi_private_dataElf64_Halfnsproxyxol_areacleanup_modulerlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_datasignumfscrypt_keyrings_mountsuse_memdelay__state_sizethread_structcached_requested_keyenvpctimereleasesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_datasysv_semanon_vma_namefileattrDQST_DROPSlong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionali_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_ts_iflagsmce_kflagstotal_numa_faultss_countd_revalidates_opsysv_shmdq_countutf8data_tablefoliowake_entry__UNIQUE_ID_alias507xa_headsuidi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_lockiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_id__UNIQUE_ID_alias511kernfs_elem_dirsrcu_lock_count__UNIQUE_ID_alias515__UNIQUE_ID_alias519ksm_merging_pagesptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_t_flagsnotify_nextshort intmynodeclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_ownerbp_regVTIME_USERsa_flagstesti_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivaltrace_event_callis_guestpoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keyGRPQUOTAi_private_listia_validi_rcuHRTIMER_BASE_REALTIMEi_atime_secqc_type_statekey_serial_tsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsi_wb_listxarray_startfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectordefault_timer_slack_nssource_listswap_readahead_info__fpstateactive_refgroup_infovdso_imagefile__user_state_sizemce_kill_meuuid_tcount_objects_stimezone_device_dataf_wb_errdefparamfred_cskprojid_tptracer_credtlb_genstorekobjectaudit_ttymce_ripvstatfsnumab_statefeatureson_listkgid_ton_cpufregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisti_mmap_rwsemwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadd_realexpiry_activedqi_max_spc_limitexception_table_entryfallocateHRTIMER_BASE_MONOTONICi_spc_warnlimitbuddy_listi_ino_timelimitSB_FREEZE_FSi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infotracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevfs_structclockiduint32_targ_startblocksset_infofileattr_getvectortimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrrenamevm_area_structsb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextiommu_mmcutimepersonalityget_statetask_sizes_inodes_addrbinfmtsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filercu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataki_posexecute_only_pkeysetleasepacct_structlong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typein_iowaitunregfuncegiddq_hashput_superMOD_INIT_TEXTpushable_dl_tasksf_flagsf_inodemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infoTT_NONEVTIME_INACTIVEcancelled_write_bytessrcu_usagebitmapmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_cold__UNIQUE_ID_name470ssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenDQST_LOOKUPSclass_spinlock_irq_try_is_conditionaloom_mmsrcu_reader_flavortv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idsrcu_structrlim_curnofaultmm_countSB_FREEZE_COMPLETEstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infodatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountki_filpcap_ambientatomic64_tanon_vmarlimread_folionr_eventsprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keysrcu_gp_startopenit_real_incrmodert_prioritymm_lock_seq__UNIQUE_ID_intree471KMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksrb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionexit_statesysvsemMOD_RO_AFTER_INITDQF_ROOT_SQUASH_Bfs_supersSB_UNFROZENdqb_bsoftlimitpendingf_task_workiowait_countstringread_countfutex_offsetlong long intatomic_flagssysvshmtrace_evalsactive_basessecurityxmm_spacef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesclass_rwsem_read_intr_is_conditionalclass_mutex_is_conditionalclass_preempt_notrace_is_conditionalMOD_INIT_RODATAMOD_TEXTclass_srcu_is_conditional_nameclass_rcu_is_conditionalclass_migrate_is_conditionallong long unsigned intNR_KMALLOC_TYPESclass_rwsem_read_is_conditionallong long intsigned charPIDTYPE_SIDclass_preempt_is_conditionalElf32_Wordorc_headerPIDTYPE_TGIDlong intclass_raw_spinlock_irq_is_conditional_descclass_local_lock_nested_bh_is_conditionalHRTIMER_BASE_MONOTONIC_SOFT__UNIQUE_ID_retpoline471class_rwsem_read_try_is_conditionalUTF8_NFDIDQST_LOOKUPSclass_spinlock_irqsave_is_conditionalclass_spinlock_try_is_conditionalclass_local_lock_is_conditionalhrtimer_base_typeMOD_RO_AFTER_INITn_descsz__u8DQST_ALLOC_DQUOTSSB_FREEZE_FSKMALLOC_NORMALDQST_WRITESunsigned int__int128class_irqsave_is_conditionalHRTIMER_BASE_REALTIMElong unsigned int__u32HRTIMER_MAX_CLOCK_BASESclass_spinlock_irqsave_try_is_conditionalclass_spinlock_is_conditionalshort unsigned intHRTIMER_BASE_TAIclass_local_lock_irqsave_is_conditionalclass_read_lock_is_conditionalelf32_noteboolDQST_DROPSclass_local_lock_irq_is_conditionalMOD_RODATAKMALLOC_CGROUPclass_rwsem_write_is_conditionalclass_spinlock_irq_try_is_conditionalclass_spinlock_irq_is_conditionalclass_write_lock_is_conditionaln_typeMOD_DATAclass_write_lock_irqsave_is_conditionalHRTIMER_BASE_BOOTTIMEn_nameszSB_FREEZE_COMPLETESB_FREEZE_WRITEclass_raw_spinlock_nested_is_conditionalMOD_MEM_NUM_TYPESDQST_SYNCSDQST_FREE_DQUOTSmod_mem_typeHRTIMER_BASE_MONOTONICclass_mutex_intr_is_conditionalclass_task_lock_is_conditionalUTF8_NMAX_nhdrPIDTYPE_PGID_Boolunsigned charKMALLOC_RECLAIMHRTIMER_BASE_BOOTTIME_SOFTcurrent_stack_pointershort int_note_18_note_19utf8_normalizationKMALLOC_RANDOM_STARTDQST_CACHE_HITSclass_irq_is_conditionalDQF_PRIVATEPIDTYPE_PIDDQST_READSMOD_INIT_DATAclass_raw_spinlock_try_is_conditionalclass_raw_spinlock_irqsave_is_conditionalPIDTYPE_MAXcharGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackSB_FREEZE_PAGEFAULTUTF8_NFDICFclass_mutex_try_is_conditional_DQST_DQSTAT_LASTclass_write_lock_irq_is_conditionalKMALLOC_RANDOM_ENDMOD_INIT_TEXTclass_raw_spinlock_irqsave_try_is_conditionalpid_typeHRTIMER_BASE_REALTIME_SOFTKMALLOC_DMAclass_read_lock_irq_is_conditionalHRTIMER_BASE_TAI_SOFTSB_UNFROZENclass_raw_spinlock_is_conditionalkmalloc_cache_typeclass_read_lock_irqsave_is_conditionalclass_rwsem_write_try_is_conditionalDQF_SYS_FILE_Bclass_raw_spinlock_irq_try_is_conditionalDQF_ROOT_SQUASH_B__UNIQUE_ID_vermagic470__int128 unsignedMOD_INVALID/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas/mpt3sas_base.c/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas./arch/x86/include/asm./include/linux./include/linux/atomic./include/scsi./include/asm-generic./arch/x86/include/asm/vdso./include/uapi/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/devicedrivers/scsi/mpt3sas/mpimpt3sas_base.cmpt3sas_base.cio.hmpt3sas_debug.hdelay.hslab.hatomic-instrumented.hatomic-arch-fallback.hatomic.hinterrupt.hlist.hdma-mapping.hspinlock.hatomic64_64.hscsi_cmnd.hblk-mq.hdmapool.hscatterlist.hmm.hscsi_device.hmpt3sas_base.hworkqueue.hdelay.hfortify-string.htimekeeping.hktime.hprocessor.hpci.hoverflow.hcompletion.hcpumask.hdevice.htopology.hfind.hioport.hkobject.hkernel.herr.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hsysinfo.hasm.hinit.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.htime64.htime_types.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hcurrent.hsched.hprocessor.hcpumask_types.hmath_emu.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hpage_64.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hpoll.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hpoll.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hfwnode.hirqreturn.hdma-direction.hmempool.hblkzoned.hsbitmap.hmpi2_type.hmpi2.hmpi2_ioc.hmpi2_cnfg.hmpi2_init.hmpi2_sas.hmpi2_pci.hmpi2_image.hscsi_host.hsas.hscsi_transport_sas.hirq_poll.hmpt3sas_trigger_diag.hmpt3sas_trigger_pages.hhardirq.hpanic.hjiffies.hkthread.hsprintf.htimer.hspinlock_api_smp.hinstrumented.hbitops.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas/mpt3sas_config.c/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/devicedrivers/scsi/mpt3sas/mpi./include/scsimpt3sas_config.cmpt3sas_config.cmpt3sas_debug.hfortify-string.hcompletion.hdma-mapping.hslab.hint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hpoll.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hasm.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hpoll.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hioport.hdma-direction.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.hmod_devicetable.hdevice.hfwnode.hmempool.hblkzoned.hsbitmap.hblk-mq.hdelay.hinterrupt.hpci.hscatterlist.hmpi2_type.hmpi2.hmpi2_ioc.hmpi2_cnfg.hmpi2_pci.hscsi_device.hscsi_host.hscsi_cmnd.hsas.hscsi_transport_sas.hirq_poll.hmpt3sas_trigger_diag.hmpt3sas_trigger_pages.hmpt3sas_base.hpanic.h/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas/mpt3sas_scsih.c/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas./include/linux./include/scsi./include/asm-generic/bitops./arch/x86/include/asm./include/linux/atomic./include/asm-generic./include/uapi/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/devicedrivers/scsi/mpt3sas/mpimpt3sas_scsih.cmpt3sas_scsih.cspinlock.hlist.hmpt3sas_base.hcompletion.hfortify-string.hscsi_device.hinstrumented-atomic.hbitops.hscsi_host.hrefcount.hatomic-instrumented.hatomic-arch-fallback.hatomic.hkref.hraid_class.hdevice.hinstrumented-non-atomic.hblk-mq.hscsi_cmnd.ht10-pi.hblkdev.hlog2.hpci.hkobject.hslab.hoverflow.hqspinlock.hworkqueue.hdelay.hscsi_tcq.hmpt3sas_debug.hfind.hint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hpoll.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcred.hkey.hsignal.hbio.hiocontext.hcompat.huprobes.htracepoint-defs.hstat.hwait.hmutex.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hioprio.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hpoll.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hioport.hdma-direction.henergy_model.hklist.hpm.hpm_wakeup.hbus.hdriver.hclass.hmod_devicetable.hdevice.hfwnode.hmempool.hblkzoned.hsbitmap.hinterrupt.hscatterlist.hattribute_container.htransport_class.hmpi2_type.hmpi2.hmpi2_ioc.hmpi2_cnfg.hmpi2_init.hmpi2_raid.hmpi2_sas.hmpi2_pci.hscsi_proto.hscsi_status.hscsi.hsas.hbsg-lib.hscsi_transport_sas.hirq_poll.hmpt3sas_trigger_diag.hjiffies.hscsi_dbg.hblk-mq-pci.hdev_printk.hsprintf.hscsi_common.hspinlock_api_smp.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.hdrivers/scsi/mpt3sas/mpt3sas_transport.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas./include/linux./include/scsi./include/linux/atomic./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/devicedrivers/scsi/mpt3sas/mpimpt3sas_transport.clist.hmpt3sas_transport.cfortify-string.hmpt3sas_debug.hdma-mapping.hcompletion.hscsi_host.hspinlock.hmpt3sas_base.hkref.hrefcount.hatomic-instrumented.hatomic-arch-fallback.hatomic.hoverflow.hslab.hint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hpoll.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.htracepoint-defs.hstat.hwait.hmutex.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hasm.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hpoll.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hdelay.hmod_devicetable.hioport.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hfwnode.hinterrupt.hpci.hscatterlist.hdma-direction.hmempool.hblkzoned.hsbitmap.hblk-mq.hscsi_device.hscsi_cmnd.hsas.hbsg-lib.hscsi_transport_sas.hmpi2_type.hmpi2.hmpi2_ioc.hmpi2_cnfg.hmpi2_sas.hmpi2_pci.hirq_poll.hmpt3sas_trigger_diag.hdev_printk.hspinlock_api_smp.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas/mpt3sas_ctl.c/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas./include/linux./include/scsi./arch/x86/include/asm./include/linux/atomic./include/asm-generic/bitops./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/devicedrivers/scsi/mpt3sas/mpimpt3sas_ctl.cmpt3sas_ctl.cspinlock.hfortify-string.hmpt3sas_debug.hmpt3sas_base.hdma-mapping.hcompletion.hscsi_host.hpci.huaccess.hthread_info.hpoll.hkref.hrefcount.hatomic-instrumented.hatomic-arch-fallback.hatomic.hslab.hinstrumented-non-atomic.hbitops.hcompat.hlist.hio.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hasm.hinit.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.htime64.htime_types.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hsched.hprocessor.hcpumask_types.hmath_emu.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hpoll.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.huprobes.htracepoint-defs.hstat.hwait.hmutex.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hioport.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hfwnode.hinterrupt.hpci.hscatterlist.hdma-direction.hdelay.hmpi2_type.hmpi2.hmpi2_ioc.hmpi2_cnfg.hmpi2_init.hmpi2_tool.hmpi2_sas.hmpi2_pci.hscsi_proto.hmempool.hblkzoned.hsbitmap.hblk-mq.hscsi_device.hscsi_cmnd.hsas.hscsi_transport_sas.hirq_poll.hmpt3sas_trigger_diag.hmiscdevice.hmpt3sas_ctl.hscsi_common.hkstrtox.hstring.hsprintf.hspinlock_api_smp.hoverflow.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas/mpt3sas_trigger_diag.c/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/devicedrivers/scsi/mpt3sas/mpi./include/scsimpt3sas_trigger_diag.cmpt3sas_trigger_diag.cslab.hfortify-string.hspinlock.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.htime64.htime_types.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hsched.hprocessor.hcpumask_types.hmath_emu.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hpoll.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hasm.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hpoll.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hioport.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hfwnode.hinterrupt.hpci.hscatterlist.hdma-direction.hdelay.hmpi2_type.hmpi2.hmpi2_ioc.hmpi2_cnfg.hmpi2_pci.hmempool.hblkzoned.hsbitmap.hblk-mq.hscsi_device.hscsi_host.hscsi_cmnd.hsas.hscsi_transport_sas.hirq_poll.hmpt3sas_trigger_diag.hmpt3sas_base.hspinlock_api_smp.h/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas/mpt3sas_warpdrive.c/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas./include/linux./arch/x86/include/asm./include/scsi./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/scheddrivers/scsi/mpt3sas/mpi./include/linux/devicempt3sas_warpdrive.cmpt3sas_warpdrive.cspinlock.hoverflow.hslab.hfind.hbitops.hunaligned.hscsi_cmnd.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.htime64.htime_types.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hsched.hprocessor.hcpumask_types.hmath_emu.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hpoll.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hasm.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hpoll.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hmpi2_type.hmpi2.hmpi2_ioc.hmpi2_cnfg.hmpi2_init.hmpi2_pci.henergy_model.hdevice.hioport.hpm.hpm_wakeup.hbus.hdriver.hclass.hmod_devicetable.hdevice.hfwnode.hdma-direction.hscatterlist.hmempool.hblkzoned.hsbitmap.hblk-mq.hscsi_device.hscsi_host.hsas.hscsi_transport_sas.hinterrupt.hpci.hirq_poll.hmpt3sas_trigger_diag.hmpt3sas_base.hspinlock_api_smp.h/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas/mpt3sas_debugfs.c/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/device./include/scsidrivers/scsi/mpt3sas/mpimpt3sas_debugfs.cmpt3sas_debugfs.cslab.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hasm.hinit.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hbug.huuid.hmod_devicetable.hioport.hsched.hspinlock_types.hrwlock_types.hcpumask_types.hatomic-long.hstddef.hgfp_types.hsysfs.hllist.hsmp_types.hpreempt.hrestart_block.htime_types.htime32.hpoll.hrange.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hprocessor.hmath_emu.hirqflags.htypes.hshstk.hseq_file.hthread_info.hosq_lock.hmutex_types.hmutex.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.hspinlock.hrcupdate.hwait.hkref.hmaple_tree.hrwsem.hswait.htime64.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hxarray.hlist_lru.hkernfs.hpoll.hkobject_ns.hstat.hkobject.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.huio.hbvec.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hdevice.hfwnode.hinterrupt.hpci.hscatterlist.hdma-direction.hmempool.hblkzoned.hsbitmap.hblk-mq.hscsi_device.hscsi_host.hscsi_cmnd.hmpi2_type.hmpi2.hmpi2_ioc.hmpi2_cnfg.hmpi2_pci.hsas.hscsi_transport_sas.hirq_poll.hmpt3sas_trigger_diag.hmpt3sas_base.hdebugfs.hdev_printk.hsprintf.h/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas/mpt3sas.mod.c/home/thomas/Documents/kernels/stagingdrivers/scsi/mpt3sas./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/schedmpt3sas.mod.cint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hirqflags.htypes.hshstk.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hquota.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hmpt3sas.mod.c/home/thomas/Documents/kernels/stagingscripts/module-common.c/home/thomas/Documents/kernels/stagingscripts./include/uapi/asm-generic./include/linux./include/linux/sched./include/uapi/linux./arch/x86/include/asm./include/asm-genericmodule-common.cint-ll64.htypes.hirqflags.hpreempt.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hpid_types.hhrtimer_defs.hslab.hunicode.hquota.hquota.hfs.helf.hmodule.hasm.hmodule-common.cint-ll64.h)U) ^^U^U^)T)ST S TTSTSTSTSTST P@PP0PS SS0Vr0S00 S 0PPPP0 0 10U000 10U0^^ \\P^^E^PPt4^^^^ ^Mb^^Y p0$0.y" ~ 3%p0$0."___ _MQ_QbS_S_S_SV0VqPqQ~QQP0PQ~0QQ00P0PQ~0Q0Q0Q00P0PQ0Q0Q0Q 0Mb0PQ0~ ~ r~ ~ ~ ~ ~ 000 0Mv00PuQu|~QQP7RRR R T000^0P`Q`o~QQP+RRR R T0000*0D^0P`Q`o~QQQP+RRRR R Te0000*0P]QQQQPQ:SSSSS SS YY<<r<<<+ + +<+<< 8#^^^^^0Pp@H$~~PPUGSGLULSuwUSSUSUSS P 0 p 0'U'\U \,\,>U>/\PSPSPPPSP   $-0--P--P..0 0OSS012 3 4 PP0PR=P>0>CP0 0,0K/0)PPPs Us  s Us  -000PPP  |  U | 8  | 3$U | 3$U z00.0$P  |  P6  | 6 | 6 0#P0!P!D|0,P0P9|0%P0%P0-P0-P0-P0-P0P0-P=<= = =<=<< 8 q T r $ &R P 0 p 0 P Q p Q\$\..\.| #|F`# |FY$Q$Y|Yu]] | 4$V]V | 4$ V VVV^^P^$$00V0 V P  V  !D B @ }p"Op3$p3$* |4$000@$-. 00]p7$]0 ] ] 000VVV$V..V qt" p -( qt" |  -( rt"# |  -('PP6 |#3$169P9V P uVVVF*F-]-1P1X}v]00P0P0000 00 00"0..0 P   |  ##R#N |  # |  # |  # p2% %Q%E p2%  p2%  | 2%  p2%  | 2%  p2%  | 2% V$  qt" rt"# P | Q|  rqu"X\PPppp P | qQ P |  0uU } T } Q| +| ! 0 0P!0PJ0P,RP!*P*e|P!iP1P1i|000 0P!>P>R|\\\\VVVVQ0Q_0___Q00QqQ:R. v| .|RR+ | \\\\J0J]]]}]]J0|^^^P__%RR% |  | %| r"1| r"1B\\\BVVVQQVVq~"1Pq~"1q~"1PPppp0\\\0^^^QQ^^q"1Pq"1q"1*\/4\4@0\\\\ P 0\QQq"1Pq"1q"1_  $ &  $ & _  @\c\ \* |4$P Q | |p"1P |"1 |"1 |#  Q | \F \ G \ L \ ? \ M \   \ N \ O \ D \ ! \ ' \ 4 \ 5 \ 0 \ 1 \ 2USviuiUSS=SPP7U7 ] U ]]U]PRYPYV0V   CVCC VV 0 P VPPVVVVPV0d_dppu_0__0QqQ0PpP0-T-3t3TT T PP~ ~uR RPd ~"P ~"OSOSUTgSggUgSUSU V P :V:BPgqVqtPtVPOSOSUTgSgU V P :V:BPOSOSUTS V P :V:BPPvRRR RUUr U(S VP08P(S VP08P(S VP08P(S VP08P PP P a}} P!SSS1PPQ!SSS1PPQ!SSS1PPQ!SSS1PPQ}PV!\ Q !V!\!^ Q !V \ ^ Q V 1 )PV!\ Q !V!\!^ Q !V \ ^ Q V 1 )P}~.].R.Q.} #PRP]Pr rH$p]6]PPr4]]]f]p]]]\ \+\ \VVVkVVV000f0p0 00000#0#f1p0000P0P0f0p0P0M0MePe\\\\\\0P\NPNZ}Z___f_pP__(    %            }# $U(  ~ $Q$(~(  ] P%^000p000 0  H H+HH HIH H+HHIH H+HHI   +  IH H+HHI   +  I0 0+00H 8p Up UB`}#`dU    Be  Q \ Q \Be\ R RBd~] ] ]L]]] ]]]]%PP}P@V@`P`VPVPVVPVPV P V P V P V V P V PVMVPVPV V V V V VVVPVVVVPVV]G]s0s__/0/G_{0{P^P^/0/L^PV&P&YVYqPqVPVV)P)/V/>P>GV000/L0P^P^/G^      ]] ] ] ]]]]]]]0z001VvVvVvVvV00V0 V 0 V 0 V 0 0 0000000 }}}AA@@ @ @ @@@@@@@P*_ P*_U^^@@@@    PP_}@@@P*_P*_}AAA}              }AAA}@@ @ @ @@@@@@@}000PA @8]S]]] ] ] ] ] ]]]]]]]1] ]]]]P P PPVPPPa]]*P*6VX~P~V   .RPvR] ] ]PiViPV V P V P V}H H H}H H H}     }H H H}H H H }0 0 0 H   8Q]] QP] ]]P!p!7P8EPPTP T q P TP~ ~~V V U U ~V0_T_ 0 \ | \P_ V_S}}S~| ~|~|1S]QQ }[} uuPTSS P P RSPSQ p R T%S 0"_"??D_ T qT t $ &  q $ &QP>] ]]]S)}1:}0V0 0P3P3p}p\\p P&/P]< <  ^"U"SUUSUSS"T"\T\T\a\aeTe\T\T P bVpuVw|PPPVCVC[P[aV}VVj00C0}0S0Pp@H$ @@@@ ???? SSSSP]PP] 0600 P#T`gTT@J$Q S 0Pp@H$ UsTsT 1S0Pp@H$5U5S~|UP$/P0P]PQPr]pPQU'S',U,,SS0p U SUSTS T \T\T\zVzvVVTV0p?p4p;p2p7p=pUdSdjzujSv{u{UTT02 tT2%2: tT2%#:Y tT42%#0GU1KP0USUSSV\VVP[s[\\\\rP\00001"2"+3+4\4400n0x001,\,, ,  S]USv`UQP"5P5`s`nT< <   S6U6@U@QUQUQTTQQ$R$R ur" PYP}PP p  !PUpPpqP%p2$ TZp2$ p2$  p2$    8UR@U@SUSS 0HVPVZQZjp0P0P002P3= =~0~P P R    0 s4$P00P00HH H's4$ s4$ s4$  AV0\ |SPP @B@U@SUSSs s s DDDD<<<<PVVVP PV<<<< <<<< <  (:(S P MVP?VVPS0Pp@H$9\9>|>l\\\\PKVelPVV  S1PPcUcVUV!V!3U3=VcTcST!T!%T%=S,PL!L<!<P^\^cPch\hhPP!\<!< <,6 6  -U-mSmt~{t{U{SS-T-r]r{T{]]T]-Q-p\p{Q{\\Q\APA_PP!p_^0{0O0O\Pp0PV/P/9V90VV! !f0fp  Rq  q    O  O  O  O  O   8& & & & &   8"     SPsP@-U-oSov~{v}U}SS-T-t]t}T}]r]rvTv]-Q-pVp}Q}VrVr}Q}V+P+<s<_P_P_0}0.0.;PP0P\0P0:\:0E0EP gr \ IQ,P, P  P  P  P ,  8D    D 8D D  S P ss.P./@#U#_U__"U"_`_`_`;T;t]tT]]T;Q;SQSSQS;R;DD;X;;Y;YY sQ2%# sQ42%# $ sQ2%$s sQ2%#2VV 0 )S).sV sQ2%# p $0. $0$<p $0.p $0.J0p0PQI55$F5I__$(_(F` '0 V vIVV$FV P ^3EPP^$F^  0p0PQ0p0R__$(_(F`R55$F5 0SsRSS$FSP#Vp>MI0EVEJPJa0anPnVPV.V.PPPVVVxPx~VGUGZXZU3T3STS0Ppx>CP~4Q4>qx>CQ0PSPSSO0hs q#3%s} q#3%} q#3%#000$0$$P$/p D -(/~ D -(000 ~  Pw ~ PPP^D P ^~(U(VUVV P /p|/4P$Q$/q|/4Q0PSPSSK0T_ q#p2%_j q#l2%jo q#l2%#000 0 P +p D -(+o D -(000 ~  Pd ~ PPPOD P O(U(VUVV,P,<p|\>EPGS u s2SSS1PPQ]TVsVUf\fkU T dVdkT Q cSckq} q csckqX3Pp t Jp PTJpQQPPQUASAQpkQ}mUS#T#M\MTP[VdVCsx7\CS u s2SSS1PPQ]TVsVEUESUS S\\ \ ]a] V!30mV0P-pV_P1pPPpP0P0P^PG0n0 0 0 000 0P8?P0P~~N00u^up^0000R0RR 0 0a00 P QQ  s8  s3$U s3$U sp~ X=SPPr4SSSSS S S S SPYzPz^P^PQPP0`^^^~ 0111111 1 1 10000R~RR00 R ~ 0 0SSSS S S(P~PPWvPrsQQ s Pr s  s  s &0P S S Sp  ~  ~  ~ ? sq" P sq"[U[ s ^prt"Prt" zr"UUSP/4/3Z3U~[//3[3U~U^1SST0T0T0q0q0q0 \DN\  |DN||UzSzUSUSSjVoVUVV(SSVvvv#U#VUTvSvT^P$8P8\ PSYSP$8P8\ |8 0 |8 0 |8 0P X]Y\S#SQ#^#S#]Q#^S]Q^ 1#P>U>\}jUP/S/3U4S<VQ>]~Q]*QQQwSwPSPSPSSPSSS^SV~p"V^UU^~p"^  ~"U^~p"^U^7^^~p"^^0nu{2%uY{2%Y]0[n p{"[HI$HI$HI$HI$PEV0PVP.0]]]@@#Q#7%r4$@# 1 $ &4$""BU5P@@>_>@Q@#@#@#@# >@#QRppppppTt@E$!TUU0O Q 'q':Q:GPGIQFUFVUUVFTF\TT\^SpS P P;UUDUD]~jUSSSgVVP^V^cPPRq@HvHOPOTq ^"U"/S/6}6;U;zSz}U&T&4\4;T;BTB}\}T']',U@,p]puU@)0)1P12V2;P;Q0Q]P]{V{P"U"/S/6}6;U;zSz}UKUK\V\aUajUTjTKuK\v\aU#aju us"#  vs"#P0PaPaj0 tuqqqQ1Q1 Q 1P Q QQRQR(PR QSSSfUf^U^U^^I0I_____,RRRRRRRRRR sssss  s   s sss.csssssssPPP900ZZ00ZZ Z  ZZZZ..cZcZZZZZZLTL\\\T \ T \\]]]]SsxSSSSPPPP   u81 u8 1 u8 1Pu8u8u8Qu8QP Q u8)ZZZ ZZZZ..cZcZZZZZZ}p"PPRR RRRR..cRcRRRRRR/PPcTPPJUJ!Z<]]] ]]]]]]]P<RRR RRR..cRcRRRRRR<000 000.00000.PPP PPP.cPPPPPPP,r,R#,r,[#]=D D  0!0PJUJ!H H 5!5 H 1UCQCU<T<Q<UTQ1OPP4]4Z4}4} #PZPQp~8~8~8Pr~8~8~8B]]]]]]]]] ]B BZZZZZZZZZDZ Z}p"PHP PPP#P##### #B000Q000000QQ0Q 0 ] Z]  ]]] ]]]] ]XXX XXXX X[[[ [[[[@ [000 00000 0 0P/PP000 0 000Y0  0  0)XXXXXLQMQMaa{QQL0A0AMRa{00PRQR~8~8~8~ P~8~8~8Pr R 0%p4%%,pp4% q 0 q 0 q 0eUeVUU P \{P0'5p4%5<pp4%ims4%#mssp4%#{0 q 1 q 1 q 1  QQQ)U)3U3UUU)T)3T3KTK_T_mTmTTTT t p  T p  T u ).t q .5T q 5IT u )u23u2u2Z Z_P_ P P P p"'0 U U24U T T24TP t0$0) & T0$0)29 t0$0)P_U_PUPUPITITTT8Q8QQQQQRRur"RRr2$ gur2$ r2$ G gw  G gw  G gw  G gw   r2$    8URUt`UTQTUt`UTQTUZSZ^v|^eUefSfgv|gnUP)\)-U.2\\ uVPOUOS||u|US S v~t` UP#V#)TPsTs ,s \ UU#VT U mSmp|~pzu~z{U{SS}tUS}US u~ ms~mp||pzu|z{U{s~s~]t`Us~]Us~P;V;GTHYPYoVPX\PPPkV{VVP>VVPVVPVV PP@P@@P U mSmp|~pzu~z{U{SS}tUS}US P.APP@@sPs~uTS , s \UU# V TsTVs~0Pp@H$s~s~s~es~s~s~VVVeVV s s/P/7s7^^^e^P^ P R0Q@@@e@0@000101>PD`0`eP00 s~ P,,,e,, ,   s P R P R* @Bs~0Pp@H$U0UU0U UUSUS S .U.NSTTT|T|T.T.I|INTQQQQQ.Q.IINQ\\U\|x\\\#\.N\UU pH%pH%QpH%0]]0]00]].I00u $0.0.0.00.000.0..I00V0TVvV0T00VV.I03__3^^_____ ^^^^^PP!T!TT|T|T.T.I|INTPPP!0!ZZPZ0Z0ZZ.I0!00111 T ,|||T 3~#+~#+  p#+p#+  iSps #s #sp"q"r"#pHs #Hs C sq"# sq"#sp"q"r"#pHs #S3s #s #pq"r"u"#\SSSS\RRRR0.t4%NRt4%#R\tp4%#t4%#tp4%#000P&ppP_T p  0 PpP<TUQ?S?], sp"#sp"q"r"#?s #S] sp"#Ps #*_tu" p 0*Qtu"TU!ZZ z  T!z PQP0P17PRQUP00Q0QUQ0PQUQ8U8<t`F$ddџdxF$}}՟}F$UTF$TP=Q=CpCOQOTQTkQkuQuQQ9R9OROR;UWlUqU)P);QWlPqP)Q)/p/;QWaQalQqQ%R%;RWlRqR;XWlXqX;YWlYqY01@Rb@l@P0RQ1P Q @ 0 Y XQP@0YXPP@0RQPUP@P@0 P* 1tO $U!UOUT!TOTP S PPOSJUJTP$PPP6U67S7<U<]S]lUlSUwTwT P1s1s1s 1Q qq+p+p  qp qp qu  pu p  u  qpS T TPTTP U [KTKTQSQSRnQnRQpXpXXkYkYYYRs Q# s [["T"TTSSEQERRQGXGXXXBYBYYYYR7VDLqLLQ\]VVV\\]P]]T TtaTlT%TTWYbvYvQX1>zy>WXbvXPCWPbvPzp3?tz?VpzzpqZ|ZRrpWRbvRvX[T[T U UTTTQQ  UQSQWUWrSr|U|STWTWYTYT07p7FvMO0 U SDFS T TDFTP t0$0) = T0$0)DF t0$0)  P OTS#U#OS S#U#OSP1s1s1s 1Q qq+p+p  qp qp qs  ps p  s  qpU?S?EUEpSpzUzST@V@ETEqVqzTzVt!V!S1s1s 1 s 1Q+S+0U5xS,V,0T5xVPSVPVVP1s1s1s 1Q qq+p+p  qp qp qs  ps p  s  qpUSPVQ-U->SS!U!8ST>VV!T!8V PP\5P58\SVUUUUMSMRUPPU9S9>UPP"U"6S6;US UTt%TTt&TT"T")T p0$0)!p  )!/ t0)7> p0$0)p0p0p0*U*<U.T.<T.T.<T.tUUTTU5U!T!-S-5TPp@H$QU'S'-U-sSUSUZUZ[U[S& -q ss  DS=S=BUBCUCS P /V>VCgVg{P{VS0Pp@H$5U5fSfpUpSPUS0Pp@H$S Ns0) VP1V p $0) 4s0)4JBUBkYkU8T8T5Q5SQS1U1SUS;T;\T\Q~0P__!PVZPZ VP 0V0Pp=PwP V   PU}U  PPq? p3$"#0? p3$"#0?$q?$/p3$"#0?i{q? p3$"#6ik p3$"#6 ,00 P __ v $ &U v $ &  HUHVUV>VT_T_>_QSQ>QP+]+APAE]ERPR]P]>]0p!P!&pQ0 }  P }  } PP } PP8P VP}PWQWk}kzQz}Q}^P?]??P,, ,6U6]U]GTGSTSQ\Q\P CP ,HUHSUS>ST\T\T\TT>\QVQ>QP3EPHUPUlRR~PRRRRR"R0 R | ~  -P-7 ~  ~ PP ~ PPP8PP P^SS^__^]]P%@P__P^,,,, ,6U6]U]GTGSTSQ\Q\P CP ,HUHVUV>VT_T_>_QSQ>QP-^-APAE^ERPR^P^>^0$p$(P(-pQ7 ~  P ~  ~ PP ~ PP8PP PVP~PWQWk~kzQz~Q~\P?^??P,, ,6U6]U]GTGSTSQ\Q\P CP ,bUb\U\@\Ti]iT]T]T] ] @TbQbiViQ@QPS:P:=S=JPJSSPSS@S   P    PPP :Pp\\b~biQip~~Q~Q~p@@R@R@P<P<_S__Pp,, , ,6U6]U]GTGSTSQ\Q\P CP ,NUNSUS>STTT^~ T>TQQQ]Q>Q PPPPR^^^^ }  P }  } QPQQR8PCSpSC\p\CVpVP1LPiiPC,p,,, ,6U6]U]GTGSTS~Q~\Q\P CP ,?U?_U_PTPSTSQ]Q]KRKVRX^X^&P'NP ,3U3]U];T;STSQ6R6VRX_X_Y^Y%P&MP ,7U7^U^VTVSTQVQVOPPkP ~  ,?U?_U_PTPSTSQ]Q]KRKVRX^X^&P'NP ,;U;^U^LTLSTSQ\Q\GRG]R]$P%JP ,;U;^U^LTLSTSQ\Q\GRG]R]$P%JP ,?U?_U_PTPSTSQ]Q]KRKVRX^X^&P'NP ,?U?_U_PTPVTVQ^Q^KRKSRX\X3P4[P ,?U?_U_PTPSTSQ]Q]KRKVRX^X^&P'NP ,:U:^U^KTKSTSQ]Q]FRFVRP9^P ,;U;^U^LTLSTSQ\Q\GRG]RPCP ,;U;^U^LTLSTSQ\Q\GRG]RPCP ,3U3]U]LTLSTS@PA[P   ,?U?_U_PTPSTSQ]Q]KRKVRX^X^&P'NP ,;U;^U^LTLSTSQ\Q\GRG]RPCP ,?U?_U_PTPSTSQ]Q]KRKVRX^X^&P'NP ,?U?_U_PTPSTSQ]Q]KRKVRX^X^&P'NP ,?U?_U_PTPSTSQ]Q]KRKVRX^X^&P'NP ,6U6]U]GTGSTSyQy\Q\P CP ,6U6]U]GTGSTSyQy\Q\P CP ,6U6]U]GTGSTSyQy\Q\P CP ,6U6]U]GTGSTStQt\Q\P CP ,;U;^U^LTLSTS~Q~\Q\GRG]RPCP ,6U6]U]GTGSTSyQy\Q\P CP ,6U6]U]GTGSTSyQy\Q\P CP ,6U6]U]GTGSTStQt\Q\P CP ,;U;^U^LTLSTSQVQVGRG\R\'P(MP ,;U;^U^LTLSTSQ\Q\GRG]R]PCP ,6U6]U]GTGSTS~Q~\Q\P CP ,6U6]U]GTGSTS~Q~\Q\P CP ,6U6]U]GTGSTSyQy\Q\P CP ,6U6]U]GTGSTSyQy\Q\P CP ,6U6]U]GTGSTSyQy\Q\P CP ,;U;^U^LTLSTSQ\Q\GRG]RPCP ,6U6]U]GTGSTSyQy\Q\P CP ,6U6]U]GTGSTStQt\Q\P CP ,6U6SUUS;T;VTTVFQFQQQFRFRRRPAQo|Q|RQp2$ #q2$ yq2$ q2$ q2$ # y # y # y # y  p2$    8U9S9DUDSs`SSs`t`USs`T;V;TTQ?]?DQD]]Q]R=\=DRD\\R\P&PPPP90D0000 U T\TYUTRVRYTP(S(-s/>PUO\OTU U T\TYUTRVRYTP(S(-s/>PUO\OTU U T\TYUTRVRYTP(S(-s/>PUO\OTUU]V]wU ] V ] V ] V ] V ] V ] V ]V]VV]V]V]V]dTdVSVTVT V S V T V S T S V T V S TVSSVSTVTVSTVTdQd~Q~QQ~QdRdSP]RSRR S ] S R S ] S ] R S ] SR]]S]SRS]SdXdP\\\\\ \ \ \\P\\APPU0P~0~00~ 0 P ~   P  Ÿ  Ÿ 0 0     00~ ~ 00^^0^0 ^ ^ ^ ^ ^ ^v^^0^~##0V 0 0 1 1 0 0 0001  X             X  v     H H HHH H-]]3]-3-0003 p U Q      -( " " " " "    -(   8HHHHH H H HHH H  ,,,,, , , ,,,                                                    , 8v/P/0-]VV]]-uU| T| RHHHHWHHR    W  R    W  R    W  R    W  H 8I^^^q^^ |  -(          \  |  -(   8>EQ        -( &    -(   2{(0(7P7=S3U3BUBBUUu~U$U$/u~/2U'P22PP/Ppp%UBBUUu~U$U$/u~/2U%BB2%BB2UuP9U9TUTTUUu~UU)u~)*U<S<=voBBSSuuSu)u s 4VVu#+UTTUUu~UU)u~)*U+TT*+TT*UuS@U@sSS#U#S]VV#V v Q\g\ PP2P:OP2UssSSuS2ssu2ssuUuV6U6RURRUUu~BUBIUITu~TU=T=RVRRTT!T!BVBPTPWTWV>SS!oSqS s 5\u\/URRUUu~UBIUITu~TWU/RRBW/RRBWUuS@U U U;U;_|_UUU@u~ u~ U;u~;_\_Uu~U+SSS s "V~V uX0 S0S`P`\@U U U;U;_|_UUU .u~@@u~ u~ Uu~U .@@  .@@  u~US u~ u~ U UU0U0WSSUQS0u~0Ws~s~UQs~FVVAVCQV v :\'\)7\*0'00U0WSSUQS -u~WWs~s~CQs~ -WWCQ -WWCQ u~ UVs~s~ SSS~U~VUVUUVUVUxUxVUVUVUVwTwTTTTTTS S }` ~@ SS0P\0P\0\\PV'PP!P!xV       00004ss[`sp`bssb0              A     FUUUPPS 3S3 ,S,], S] 1?P PPP\1 \ T v $S oUo\UUouo|U#u;S;O^OSS`0gV0`0d]0 0 /QO0Q u uu&uu&u@U@fSfi|oinUnxSxUSS=T=nTnwTwTTT*T*:T:|T|TTTT5u5i\inU#nxsxU#\*\*RsR\PV<|VP*Vw0010w0w|1|0UUSUXUXSs3+;s3KUKSPP,OPhPP 0 _ 0 (_(808__7_f_{\{^Pd@P;VdhPhPk}P;]dVs \ V S _00s ]  S _SSSP37P;S'0'0VP'\ s s V V v v  v  0 \S00-U-8S89vo9>U>lSlmvomrUrSStoU"V"'U#'VVV[U#[jVVt`U#PPPUUuVuy}nyunU%T%qSq{~{TPN\NVT uSSSSSsss0Svv ] UU# \ T U XSX]}n]bU5V5<\<@V.\.5|5;\PV\| \hUhUUUu~UU*u~*0USSS+S s VVVf]]PUUUu~UU*u~*+U++UuS vvPlUlUUUu~UU*u~*iUVVV+V0iV v \\\\Q\P(S(KPLWSW|PPS!Q!ESEMQSSS S $T%9S ss^(^(9PPS+]+vSvzu{S_S_]$P$u]uzP])]]P^!S!%U%O^OSUT_^_lUl^U^ S P CSCKP SS ssPS ]P_dPPS Q/7Q^ SP9APUUUu~UU*u~*+U++UuV ||PSObSbfUSUO\U\bsbfuUs Og   UOYUUs UOYUUs 0OY00 1OY11 0OY00 UOYUUsPTfPP1U1U U PU s u*SSS1PPRSp(pU+^U^U^1PPR D\!\\1PPQ <U<S|yuyUSUSS;PP s77ssPyVy]]#]?UPUpVp]  # [     P&s&+V2U2S|yuyUSuSP%QPP/V/JsJ]=]=SPSYV,=, ,   u^;U;^@ ^~nU;T;VTVUTQ)S)dQQQS)P)SPJS5SQSPU^m^q(U\m\RUmC^[~^q(C\[~\RC[~0'J]#PAJP ~^\R ]]0]q] ~'1~ P'0P^q(TqP ^U4VUVUV 1PPQ^TS3U3VUVV T TT3Q3QQPd\\(0&P&SPSPSSPS^^^^s2$s s@ss#sspDsTsp0DPP$P*9P?NPd]]d}} d  d}} d  ] }  8 s2$ Pt\\"P"(\00(0P}U }  }U }  pp1p1p1 p 1|0 V \"\\|"UU|U| UUU| UUU| 000 111 000 UUU|PPP 1 U  1  U   U  PU|0\05\\'\||'|]]] ] ] ]']TPP\0`\\ \0| $ &2$s"#+?TPv\\ 0 `\Q| $ &2$s"#+?vV] TT0T T pT v \\P\Pv v  T0_\Q| $ &2$s"#+?V V V VVVs s s ssss$ 3$s"#$! 3$s"#,!- 3$s"#,- 3$s"#$s$pP 3$s"#$ 3$s"#, 3$s"#, 3$s"#$pPpP p P 3$s"#$ 3$s"#$pP 3$s"#$0_!-_00__ _ __ T ]AbTb]]]9]PPRR ] R)0)\\\\ R \\)0)  R/P/fP4] ]; ; TQTQ000/P/fPH H 555 H 1PP3Q3P3T3@Q3 P T@ Q 1"P$RR$$%V%ss VVVsssP7\\V V.Vs s.sPP%.P P d\ \.\\Pz] ].]v"\ \|"U U | U |"   U U U | U U U | 0 0 0 1 1 1 0 0 0 U U U |P P P 1 U  1  U   U  PU| v ]0\0:\Zo\'\|CX|'| P0E\h\\\ 0| $ &3$s"#*T"]]]] ]'] v Qv \ \0P\Q| $ &3$s"#* 0 [\Q| $ &3$s"#*GUGSUSU S U S~S%^%'S''~'(S()~))S))~))S))~))^)1S13^33S33^33S34^46S66^67~79S99U9;S;;~;=SS~S~S^ S } S ~ S }S}USU~S~SUSUSUSU^U@^U@ ^ U@ ^ sp^}^}^$}$'sp''^''}''^''}''sp'(}((^((}()^))}))}),^,,sp,-^-1}12}22^23}33sp33}34^45sp55}55^55}56}67}77^77sp78^89sp99U@9;sp;;};;sp;<}<<sp<<}<<^^}^}^}^sp^} sp ^ sp ^ } sp } ^ } }@^}@U@^U@}^sp}}U@^U@}U@}U@USUSU S U S~S$^$'S''~''S'(~((S((~()S))~))^)1S12^22S23^33S33^35S56^67~79S99U9;S;;~;<SS~S~S^ S } S ~ S }S}USU~S~SUSUSUSUVVU(V((U(9V9<V V _ V _ }  }  ^V^} V^V} _V_} ^V^} V^V^U@^U@ ^ U@ ^ sp^}^}^$}$'sp''^''}''^''}''sp'(}((^((}()^))}))}),^,,sp,-^-1}12}22^23}33sp33}34^45sp55}55^55}56}67}77^77sp78^89sp9;sp;;};;sp;<}<<sp<<}<<^^}^}^}^sp^} sp ^ sp ^ } sp } ^ } }@^}@U@^U@}^sp}}U@^U@}U@}U@hVV Vh^^ ^PV\\ \v^,^^^1PPQ^^^^UUs0Us0 UUUs0 UUUs0 000 111 000 UUUs0PPP1U1U U PUs0 v \_V&&V'(V&V_^&&^'(^&^_s4&&s4'(s4&s4P%T%%T%R%%RvVVRR QQ%%Q0Q  Q p%%pQvT V&V s4&s4 0U@U@U@s0UUs0Us0 UUUs0 UUUs0 000 111 000 UUUs0PPP 1 U  1  U   U  PUs0V;V^;^~;~V##V))V(V VV^##^))^(^ ^^R0kP\##\()\"P"(\ 00~##~()~(~ ~~-P]##]()](] ]](V(]\!\(0 \ !p\r0(0%P%Y\"P"(\8 8 r6(6 8 1\vQv3\\\1PPQ0V\nV0s4\ns40/Q\n0V!!V""V(V V_!!_""_(_ _\ \!!\(\ \$V$_P\ } U]T}   !! (     "\ \|"U U |"   U U U U 0 0 1 1 0 0 U UP P 1 U  1  U   U  PU|VVVV'VV^^^^'^^E_E]]]]'_]]:}']2}P}P}}P}$~  "~  ~~~~'~~$}P}}#t$UUp}#t$    UU  UU  00  11  00  UUQQ 1 U  1  U   U  QUp}#tQPQP/V_/]P} }v_T} 1QV#$V++VZVrV^#$^++^Z^r^ P P AU##U++U++qTPY\##\++\s4#$s4++s4Zs4rs4vU##U++U++quQ##Q++Q ## ++  Q##Q++Q Q##Q++Q 0##0++0 1##1++1 0##0++0 Q##Q++QP##P*+P 1 Q  1  Q   Q  PQ v \UVrVUs4rs40.Qr0V V VVVVV+,V00VViV VVV^^ } }}}}}+,}00}}i} }}}S.>P>SSSS%%S%&SS\\\$%\\ p sss$%s%&ss+1+^^^^^%&^&&^^___$$_%%_]$%]%%p%%]<P%%P+0+~~~~~~~%&~&~~+0+}}}}}}}}%&}&}} P }}}}}}%&}**}}i} }}} ~~ }#D}#D}#D}#D}#D+,}#D00}#D}#Di}#D }#D}#D}#D } P}}}P&&}&&P&&}''P**}}i} }PPP$$P001 k]p]]]]zVT(HTH_|P!\!FPFl\vPv}v}VDV^D^~D~VV&&V((V++V+,V,.V./V/0VmVVVVV V V'^'spsp&&sp((sp++sp+,sp,.sp./sp/0spm^^spspsp sp ^0^^&&^'(^*+^+,^,.^./^//^^u^^^#_X__''_++_+,_,._.._//__u__#~ $ &3$s"#BLO~ $ &3$s"#BOcp3$s"#Bc~ $ &3$s"#B~ $ &3$s"#B''~ $ &3$s"#B#}?co}?o~ $ &3$s"#D?}?''}? } 0 s4s4&&s4((s4++s4+,s4,.s4./s4/0s4ms4s4s4s4s4 s4 s4P?}}}}V''V)*V**V*+V++V++V/_ P _&'_''P''_))_**_**_++_++_P}&'})*}**}**}++}++}s0s1''0)*1**1*+1++1++10''0''1''0)*0**1**0*+1++0vP/___1PPR__))_**_}))}**} )) **  }))}**} }))}**} 0))0**0 1))1**1 0))0**0 }))}**}P()P**P1}1} } P}T} }T}}_))_**_))** )) **  }))}**} }))}**} 0))0**0 1))1**1 0))0**0 }))}**}P))P**P  1  } 1 }   }  P^V#R1@RP@T#6:TQR@xRvTVVVVVVV_______-~  ~  PP#P#;[;v}}}P}}}}}.Q.7{P?}O[}vT}}T[[[^}[} }#\ UTWUW[{[^}#\U}#\ T^   UHHUU}#\ UHHUU}#\ 0HH00 1HH11 0HH00 UHHUU}#\ PBIPP1U 1 U U PU{}#\T}.}^e[ek} }#\ (U(.}#\^aUae{ek}#\. ^k  U}#\RRU U}#\RRU 0RR0 1RR1 0RR0 U}#\RRUPLSP1U 1 U U PU{}#\ } v }}4 <444 <8vvT}&P&,}P}p&U&,}#\Up}#\,   "U"#}#\U "U"#}#\U #00 #11 #00 "U"#}#\UQQ1U 1 U U QUp}#\   Yv   Yv   YvmVV Vms4s4 s40%\%'| \ Q Q Q r/| $ &3$s"#B9F r/T9FT0(Q0 Pr? x? $| $ &3$s"#D?r?y?$| $ &3$s"#F?[VHV[^H^[~H~ 1vVVVVVV V''VVVV V Vv^^}}}}} }''^^^} ^ ^-s<-1 |3$s"#<19 |3$s"#D9B |3$s"#DB` |3$s"#<s<~<\\\\\ \P\ 0 \|"@\0_____ _P_-s81s81~81vs4s4~4s4~4~4~4~4 ~4''s4s4s4~4 s4 s4V\|V|VVVPV\\\P\}P}}P}]]]P]$~  "~   RPRP8V8]P} } vvT}}}#t  $UU $UU %00 %11 %00 $UUQQ 1 U  1  U   U  Q\\\VVVZPZv}P}Ph0h]00RP{}}}J]] Q]R]R }}}Pp VVVV\\\\kPk}P}P0R}000P}}}]]]]vQRQR vvT }T}}VV V Vs4s4 s4 s4+s<+ |3$s"#< |3$s"#< |3$s"#< |3$s"#< |3$s"#<PPZ\\ \ \+0PQ Q+0hT*V*.U.VVUVVVVVV%%V%&VV V V VVVVVV^}}sp^^sp}^}}%%}%&}} ^ ^ ^^sp}}}!0!__0___##_$$_____\\\&ZZZ~}#$}$$}}}}},rrr,s="ns="s="&}[};]P}}P}}}}##}$$}}}}}PJTTQ }Q}}##}#$}}}}}p?p? $ &2$s"#B?P}}}P}}P}}}$$}%%}}}}} s4s4s4s4s4s4s4s4%%s4%&s4s4 s4 s4 s4s4s4s4s4s4v VV \\ ] ]] 0] ] pp]vvTTVZ} }}}}}}V VVVVVV~0PY}0!P!5Y5~~~~000000PP~  P~ ~ ~~~~~ ~Q~#P~~~~P+P~ ~ ~-~~~~PPvT~(} Y Y }#t (U U U y(  U U U yU U U y0 01 10 0U U U yP P P1U 1 U U P}}#t T~T~4 D5@4 D5@8VVVQQQPPP00PPrrrP z  Qv z  Qv z  QvjVVVjs4s4s40%\%'|\ QQQ r?4| $ &2$s"#C?>K r?4T>KT0%Q0Py4%x4%X!| $ &2$s"#B4%y?x?!| $ &2$s"#B?]V VVPV V]^ ^^P^ ^P(T T0FUPU\\"P"(\.] ]]P] ]*\ \ |'\PQ~ ~~P~ ~v!VV!]] \!\\!0\ \ !pp\vvTT0(0P\"P"(\` ` 1(1 ` 1IVI\P;]3\\\ 1PPQv]RVyVRs4ys40.Qy0V__ } } ^^} V^V} __} ^ ^ }  V ^ VVU@S@DuEIVIKSSUSUU_uS_U_QBVBFvFHVVPSsSSPSsS"U#)S)3UBQTRY\Y[TUTPS!s!0S=J\JQ|QS\S\P%\%'PP\"|"$\\UDSDHuIMVMOSSUSUU_uS_U_QFVFJvJLVVPSsSSPSsSSSPK}}}}P}} } } P T } }_UQSSSuvV UPsSvT} _P___usS U\UQSSSuvV UPsSvT} _P___usSP\| \\]UPsSvT}T\| \UVVV+]+1^1:]]SS P ^!~!/^^^b\bi]ik\\SU]U\}\^]]\] P~^\S} ]VVVM]MT\TV]]I\IP|PR\\]]\| \iVVP,||Q|Q|P|#0P|#0P|#0P|#0I\\ P;U;NSN{U{SU S U S U ^USUSSUS U S U ^ USU<SPt P %T).PS)S:VSpPpV#P#7V ]@])]Pq|P,V,\%V%]%\V]\1*P:0:0 0 0 0:VSpPp}V#P#)V8 8 :6:6 6 6 6 8 1QSVSS S SSS ~  ~ -}}P} } }}}$PPOSS S S SO~~ ~ ~ ~O00 0 _0_^d~X^O00V0 V V VO00\0\0 \ \ \P#}}}}P:__ _s)SS)PP \\)0\\"qq\V#ssV4 D5@4 D5@8 }PS S U ^SSSS S ^S00)0 0 0P} }}}}} }} P V.V.808@P@eVeqV PAV0 0 0 T } T 0 V T }0000 000Q q =Q0]V0]]] V%V0 0 [0000 000 0 S S S S0000 00 Q q14WV0 00000 00P} }}}}} }} p8  p8 p8 SS)S S}})} } QVV$V. ~ !0!\\)\10 0 9P9^^^^^^P^| $ &D~"#[0w0100)0 0[00$0*Q*8p sD sD 0 00000 00P^^)^ P ^  V    V   @  sD QVVAV.P PPVP V|p|p|pV[V[`T`nVVV0wTVT0 QQ4QQ0[[[VN\VVSU US)UR{S U\V V)V ~ 0e\pz\\ })\ \ }0P^} } P)}RuPu{^ }| $ &D}"#0 0 1 0)0 0P2~[~e~ P(3T3EPEgpXgrTryP 0 ] ^ S ^ S ^ ]e^(T(3Q3gTgoQ 0 ^ S P S P S SP)PRmPmR}PDRDe}Q!R!)Q _ ] P ] ] V1]1eVRQ*R P P R] PT Q?GQ QRRPD sD0 0 0)0R{0 0PI^I} } P)}RuPu{^ }V V  @ sD+]^'SPP_=qq P 6qq$0e0PPDRDe}8 8 $6e6 8 1RThV%VV1PPQCVTC}7V T 7}2^ V T } ^ 1 >P)S~$]P]P_ ^s_}~SSS ~  2RRQ^^^S S~ ~h0h_ 0\d|XV V VP} } sV7s s4 <444 <8 }VPISS S SS< ~  ~ QQ/~/V~ V VP~P~]\SS S\}} }\00__ _,P,D}P}0P p\00Q~ ~>\\ \>^^P9}} }P1RR} }'S'^Q'0Q pQU_ s_ }'SS}oS}oSPYVYeu@VUV'00PPVu@VUV '000PP H   H  '111H1pp1p1 p 1 p 1p0 S P VBVBNu@VUVvNUUvuUv JUU JUU K00 K11 K00 JUU"PP1U 1 U U PUv+uUfSfjUjkUkSS s Q s   s Q s  UUt`UAUASnU _|~ ~ \ {  !Q'=Q { QQ { QQ {  { Q { QQ {  {  Q Q {  {  Q Q ]\  \   ]   \~~}P1PPP{,P,L{P^00P{PTQ8 8 _sT{^]m\m||P\P\P 1 sSR QQ0QQpQT PP 1#ST{P{P] ss]P }{RUR_U__ } Q } ~A~A] 0XOeX  Q   PRQRQ_Q}}]K0KbZb}Z}#PP\\PT!NTP}TP} U\!<\TowTovT }ULVLYpnYZUZeVdVdh}mhoUoV}mumU!T!Q\QZTZe\\T ScSoSP)^)-T.9^j^o^TPe0 0 f\fnuXo0 uVVTT SS..S0S S p..pSvpU# vZbvbf]flUlmU#^T ^Zh^hlT SZzSIUIeSejUjmSmrUTrT p $0. S)U)}\#\#@U@\U\)T)}SSTS VUU$U$:u`:>t`>DUDIUUu`t`UUu`t`UTT3T3>R>DTDITTRTTRTQQ0Q0>X>DQDIQQXQQXQRR.R.>P>DRDIRRRRR1I11100I000 6U6]U]]UU]U]6T6SSTTSTS VpUp]]']]SS'SS_ '    ?U?Su`SWt`WbUbbUULTLWRWbTbbTTIQIWXWbQbbQQ"R".PbbP"P"'R3:P:?R?FPFKRKRPRWRW^P^cRcjPjoRovPv{R{PR11";1bb1100";0bb00USUSTVTQQRREPsPPp2$ MSp2$ z~p2$ + M + M + M + M  p2$    8(U(SUSSVSVSVST~~ 0hs0P^~_>^P^_^_^_^ P'~  "~  ~~~Y~~_1__ 0 V\z\\PT^lpPp^^^000Y0f0P0P$$~~>~~0P0P0(0f0     Y0>00P@^>^P^_^_^_^x x Y7>77 x 1>0f0*PX\P\v~  ph  ph  ph   s0S0\0P_$_00 _ $r_ ss ^^ s,SS,__,PPQ QQ,00 Q ttsQ sots ^osTst^P&SS&QQPP&0PPrrP,S,^PV^s s V1U1_U__ 0 <S<sSSS0P]]]]P]0]0P~~~~P~0~- ~ X ~  ~ " ~ Pr ~  ~ ~SS P ;r\\\<\ PttPP<~     P'~00000P1]"P".]  ph  ph ph 00000P]]]]P]] S   S  00000P~~~~P~~ S   S  00<0 PttPP<~8 8 66<6 8 1pDpD D @pD DTS{S < <D <*S#S~QpUpSUSSMVV(V      "  0i]00\T0TnPn___0_P_L^^^\v\\\\\e~P^~^~^^^^~~ PP#P#P~000P____P_ V   V  #00^0 PP#P#P~8 8 #66^6 8 1 sD sD@ sDUQsUVUVUVUTTQ/^/Q S P++0DbPbS P c]]PoSo}P     1FVF^)S)7P7>S%P%0T07PS>|P7| T\ U S Q \US_Q\US_Q\14PpUp\  \UpTpSTST Q p[p@[pRp_RRBXB]X]XNYNYp0pVV0BuBpXpuL@LV 0 %P/FPG0GL1%U%\U\H\TVTHT%Q%QHQ%R%RHR P XXX@P X @P]] ] ]H]PSSs~ S s s~ SHSsss s s# s sHs_ 0_0E Ej[[[[[ [[[[YZYb______H_E ^^^H^ 0~00~~ ~ ~ ~ 0 ~~~~R]]R  K  K  K  >1>1.0.>11   ]]       88P P sP P      HP6TT T T.} ` -(} ` -( } ` -(```` ` ` ` ` ``H`.}} }."} ` -( "} ` -(  "} ` -(                H                H                H                H "} ` -(   8)RR)R\\\\ \H\@@@@ @)@.RR'X'`XdPdP2P p $#@P@PPH88H8  P00H0dPdP2P 8   8  66H6 8 1RQ#t<U>?q p P P ? p 8P P q q q q ss @@ @@R        PP ?8> > > > ? ?8> > > >sss ss     @@@ @@p Qxsss ssx     x@@@ @@x@@@ @@x;;; ;;sPPqvP P:?pp Q?p Qsp Qp  p ss @@ @@       PP ;t::: : ; ;t::: :sss ss     @@@ @@pQxsss ssx     x@@@ @@x@@@ @@xBBB BBsPPqoP PA?ppQ?pQspQp p ss @@ @@       PP BtAAA A B BtAAA Assss    @@@@rPusssssu     u@@@@@u@@@@@uBBBBBPmRnRRRA?rpP?pPmrnPrr ss @@ @@     PP BAAA B BAAAssss    @@@@pQsssss     @@@@@@@@@@AAAAAPPqpPP@?ppQ?pQpQpp ss @@ @@     PP A@@@ A A@@@aSSS2^^~ 0=PPPP sPISSS^^+X+7~X@X@  "X".~X@X@"x".^x@#tx@#t*^^*^^*00*11*00*^^QQQ 1 ^  1  ^  1  ^ 1Qs sP P~ \ \^*U*]U]U]U]U ]1]*T*_T_T_T_T _1_*u*}U#}U#}u}U# }1}U\j\\\\\ \1\TSbSSS1S QQ*t}*}T }T }t}}T  }1} p=%  p=% ~#=% ^P^ 000s8 0 0 0101DPDPPARABRsBRB1BQQ VVV            @1@1/0/@11   VV       88U4}\`}4_\`_ }0|0|0| }u U u#}}__^^xP^^__&}} QRr rQR}__$U$\U\ \ t`UPcSsT;s$1$V$0$]SUJSJW~mW[um[\U\SS#T#S\S\T\\\-PPQQP']'-T.[]] uSSVVPP''P0PPq''qPs^UU# ] T<U<SUSJTJTTTQV]V"V V u Pu V VV1 PPQVVV1PZUZSUSSTVTTVTTTV?T?[V[_T_wVwT%\\\?\|\#\|\#\%\\\?\u*Pu%SSS?S%VVV?V%||||[q|P*Q*PP%v s v s v s v s [qv s PT__T*, ,  T`V#V`]#]`^#^P`_#_ P TsTD D  6\\\1PPQUiSivUvSUSUUSST@V@TTQQQRRR$TEMTTQ,TP.P.T\[hP|\P"P"o\oP&U&'S'3U3SUUS~iUSS~it`U?S?TUT\t`\]U&T&3T3<T<T>T>CTC]TP)QPg\goTpPP#\/P/Y\bb\\{00/P/Y\bb\\H H {55 H 1=4 4  PP \Q ^P \ ]Q ^P\]Q^1:PPUVSV]U]^U^^SLSTV^TLTQ^QLQR^RLRP4\BBP"P(FPFL\QPQPU@S@QUQSUSUUSST?V?TTQQQRRR%_*__d__P#^*^^^K^^P2APA]]]]K]d]P]P6QPj\~PP$\*PP>PP1U1X\\q00P1U1X\\H H q55 H 17, ,  PU\Q^U\T]Q^U\T]Q^1+PP1U1?_?DUDMUMq_qvUv_U_U_X_XsUs{_{t`U_t`U_1T1DTDITIhShTXTXkTkRTSTP6QPP"P",10D0P\\P\\X\X0\10D000P]]]P]0]0]X]X0]010D0P00P0XX010D0P00P0XX0PP@@@@X@@/P/YVV/P'P 10D000H000P00 10D0X@0@000@000@r00/P/YVVH H r55 H 1U4 4   s  ^ s  ^^^P^P ]T^P^P"\\\|"UU|U|"    UUU| UUU| 000 111 000 UUU|PPP 1 U  1  U   U  PU|/]/7u]U}7UU}u8   3UU 3UU 400 411 400 3UU(PP 1 U  1  U   U  PU } uPPVQ^PVSQ^ PV S Q^ 11PP T@@@ }$}$8U8\U\U\8T8]vTv]T] S SSSSSS P 5UUUqTPP^^^SSluS SS |QPQPUUUq u QQQ    QQQ QQQ 000 111 000 QQQPPP1Q 1 Q Q PQ ^(P(QTT(0T|T%U%VnUVnUVnU*T*]T]T]T/TrTsPNSNSPS\\U\u%U%GV4^P\PS __S\MT\T^U_h\hru|UMQUQT|T^u_rU Ms  UHHUZmU UHHUZmU 0HH0Zn0 1HH1Zn1 0HH0Zn0 UHHUZmU P #q #2Q 2?q ?Lt LeQ  q > t >3Q >USUSST\T\TT\T\T \ T \ T \ T \T\\TVV V  @ V  @VVPxxv   v  v C^^ ^ ^ ^ ^^V^^#___ _ __+__.P._P__ _ _ P _+_P^ ^ P ^ ^+^0>____+_PPPTT  +x1xp   1P11P1 ]] 1    1  P  1  1   ] ]11 00001 0  0  0  0  000 x x  X    Q        Q  Q      X  X    ]]] ] ]]],Vv" ^^ ^~ UU~ U ~    UU U ~ UU U ~ 00 0 11 1 00 0 UU U ~QQ Q 1 U  1  U   U  QU~ v" S S  T  P Pp pv"$__ _$UU U $     UU U   UU U   00 0  11 1  00 0  UU U QQQ 1 U  1  U   U  QU v" SSSSppPPPPpppp]]Sv"]] __.._0_ _ p..p_v"v"TTS]PpIPSS8QQ0PVV sTssVV PPPP sTsV P v"  v" AUASUSxSTVTVxV%P%D__P_(_PrPrx_9^^(^T000(0Px0%P%D__P_(_PrPrx_^ ^ p4p2$(p2$OUOSUS+S$u|$s|U s|+s|vv+vDPP9~0\0\0\0+0`0`]]0]+]V U(vv(UU(XX Q(QQ(0Q0 Q (rr Qv"P SS\\P~PPP S\P}U}SUS+SPu|Ps|U s|+s|vv+v@PP0\\e0\0\&\&+00e0^0^+^V SS|| PPPPv"*v*U*X Q*Q*0Q0 Q *r Qv"pxv"PpwP S\ P2U2VUVPVCTCTPT-Q-SQSPS    "  MPMuu+U+VUV(S(*}oFMSMs^}oSs]}oS}os^s]]8]a\v\\\IPPPc^v^ QP&\P\P&\P\PC_]aPa_PP_IPPP 0 0 0 0  1 V _Ss Ss{s{Ss"\|U UU010UP 1 U  1  U   U  P\|U UU010UP 1 U  1  U   U  P }]h} _]h_ s" s"].]U.UX.X Q"Q".Q0.0..QQ.rQs"2:s"P29PUVUVMSM}^S}]}^Ss]S}^}]}^S}]MsM}ns}n}nssns}n}n}ns}n\\S\aSQSSP^^P^P^SsSs{Ss{s"s9}ns}n}n9\\\&SSSs" s" s"s"!SSSs!_________000111000___PPP 1 _  1  _  1  _ 1PSSSsss    ___ ___ 000 111 000 ___PPP  1  _ 1 _   _  PsSs __0 1 0 _ P  1  _ 1 _   _  P ^ s"s9}ns}n}n9\\\\&SSSs" s" s"s"!SSSs!_________000111000___PPP 1 _  1  _  1  _ 1PSSSsss    ___ ___ 000 111 000 ___PPP  1  _ 1 _   _  PsSs __0 1 0 _ P  1  _ 1 _   _  Ps" sn R TQ Q 0QQ sQ s PU]U]SSq]]Ss]S]SssqnnssnsnsP\\P\nP+Q;BQ[VPtVP^PP^TP\\P\@ @ @1TSsSs{Ss{Ss" R s" R s" R s" s" Vs"7s7PqnPXnssnsn@P@X}PP}}XRRRRVIVVVVV s" s" s" s"VAqAI`q`q V!VVv!UUvUvUUvUvUUvUv001100UUvUvPPP 1 U  1  U  1  U 1PV.sV _ ^ s"sTUQQ0QQrQ s" PVUVSUSVTVd\dv $| $-(T\VVPP ^^^]*3]P.QqQ@Q@^qs^]dy]]]_t]]}^_t^^^[p^^^[p^^0[p001[p110[p00^[p^^ PP`P~P 1 ^  1  ^  1  ^ 1P]$6]Of]}$6}Of} $6 Of  ^$(^Of^ ^$(^Of^ 0$(0Of0 1$(1Of1 0$(0Of0 ^$(^Of^ P$PDTP  1  ^ 1 ^   ^  P} QFUFVUU:T:FQFsTT0qP0p P:t:FqFST1t| @$q !y| @$s !RAvA| @$s !202AQQU |@$t!@%P Q |@$t!@% 3$r"PQQQFUFvUvUU`T`vTvTTPNPNSp\cPcyPyPPpP$q$,u,NU#\jqjuU#PP*qP u u u  u*P*/pkxPxpp*U*/p#\kxUxp#\"U"'p#\cpUpwp#\"U"'p#\cpUpwp#\00cw001cw100cw0"U"'p#\cpUpwp#\QYfQ 1 U  1  U  1  U 1QFUFvUvUU`T`vTvTTPNPNSp\cPcyPyPPpP$q$,u,NU#\jqjuU#PP*qP u u u  u*P*/pkxPxpp*U*/p#\kxUxp#\"U"'p#\cpUpwp#\"U"'p#\cpUpwp#\00cw001cw100cw0"U"'p#\cpUpwp#\QYfQ 1 U  1  U  1  U 1Q)U)UUUUUU]UU]9U9U]t`U])T)0S0:T:CSC]T]STSrSrTSTS)Q)/V/:Q:KVK\T\]Q]VQVQQQQQQQ2Q2Q)R)RRRR\RR\RR\!R!\tXR\R\FUFvUvUU`T`vTvTTPNPNSp\cPcyPyPPpP$q$,u,NU#\jqjuU#PP*qP u u u  u*P*/pkxPxpp*U*/p#tkxUxp#t"U"'p#tcpUpwp#t"U"'p#tcpUpwp#t00cw001cw100cw0"U"'p#tcpUpwp#tQYfQ 1 U  1  U  1  U 1QWUWlrnlyUyUunUUrnUunpTpyTyTTTTT`Q`yQyQQQQQPEPNUPUhPhPpPpPPArAEU#N~r~U#rrPP)uaeuPuuu uPR_P_mpvPppUR_U_mp#tvUp#tUN[U[ip#trUp#tUN[U[ip#trUp#t0Ni0r01Ni1r10Ni0r0UN[U[ip#trUp#t QDQQhuQ 1 U  1  U  1  U 1Q9U9SUS[SJTJ\T[T4Q4VQV[V"  A_  '  :U:Q\QXUX\U\U\4\)T)1V1:TV TJQJXQXyQyQQQ4QS'*S*5S5<]U_P_nunnSnPSPSrPP4S  s P'*P*-S-5P_nunqPqUsr S_nuSr s_nusrPD_U#0TT040 P;;PP4S8 8 #6TT646 8 1S] U SUU T VQT S UU V QTUSSSTvnTXunXYUR)RP)T/6/XQ  uR#u#$s$%v`%)u`RsV U U# T,u|,u|#U'S'/UT(V(/TQ*\*/QUSTVQ\1"PU u UUu UU u UUu UU!UOUT!TOTP S PPOSJUJTP$P P$ P #U#DSDJUJSTUSTEVEJTJVTV>0>CPJNP^S^qTqrUrShVhrTrVP P >X?bPUU'U'(U(-U PP$P 1 U 1 U 1 U  1P#U#?S?EUESSSmTmnUT@V@ETEdVdnT909IPS(T()UUS!UUS1PPQ6U6S~yuyUS|y~yuyUS|y~yuyUSS%~y%+uy+,U,}S}|yUUS:T:DD:Q:\QQ8P8VVVVV,hVVPVQ:s:A~AGu}s| ~uQsssP]_]_]_]],]_P]00h0hlPl~V00 000,h0hh 0 0 0 P p APwPPp PPP8Rn{RRRR   ,      &s&+\:u:Ғ0p0p0p0pUUUU$UTTTT$T  UUU$U  UUU$U  0$0  1$1  0$0  UUU$U P PP1U1U U PUVnUUVnU,T,STSTP"@\313 ~0$}0$)\>BT u/SSS 1PPQVUU# \ TXUXV~}UU^ U VcSnu0x}P}SSPkVVVVP`\\\\"0"kS0SSSSSUUsUs UUUs UUUs 000 111 000 UUUsPPP1U1U U PUs v^ISSS(SSS 1PPQS vnyv \ny\(SfsSs"U"(sfiUiss U$sbbU U$sbbU $0bb0 $1bb1 $0bb0 U$sbbUPZaP1U 1 U U PUsIUIfSftUtSUSqSITIgVgtTtTVTVU#TVTVTVTVHVHLTLqVIQIi\itQtQ\Q\U#Q\Q\Q\Q\H\HVQVq\TTTTTTT=]F]]]q]^:i0000^0^^ _6e0000_0__X1`0000X0XX#]n]]]]#^n^^^^___PnyPPPPssss!0!#pn0pP000 ] ^ _3]]]]]00^^^00___00XXX$PPPPPs s s s s .0.3p00pP00 ] ^ s  _:I_ X:IX s :Is !]=P]]]]]]^=P0^0^^_=P0_0_000X!P=PPPPPPPs =Ps s s s s !0!! }s )=P00 ~s )0000]^ _gv_UV}nUV}nunUV}nUV}nUV T :S:TPnSnu~zPS~US~uSPv\\T\\\uP'SPSPS1PPQSS[cSS^[c^^ [c   ^[[^^ ^[[^^ 0[[00 1[[11 0[[00 ^[[^^ PV]PP1^1^ ^ P^ v6;v;B]BHUHIU#Q\v \6@\@HTQ\\S~HLSLS~SWUXYSYh~hlus^HLsLS^SWuXYsYh^hlU Hm  ^HH^Xh^hlU ^HH^Xh^hlU  0HH0Xm0  1HH1Xm1  0HH0Xm0 ^HH^Xh^hlUP>MPNbP  1  ^ 1 ^   ^  Ps ^ uUV~}u}UV'T'S@@SP\T\u%SSSs P %@@@P@@@P@@@000111000P@@@PPP 1P @  1 P @  1 P @ 1PS'S'^ S _ ^ S _ ^ 1 *PPSVvS sVvs @Vv@ @Vv@ 0Vv01Vv10Vv0@Vv@ PLYP\iP 1 @ 1 @ 1 @ 1Pv s Qs v ~xUU#\T5U5VUV}mUVPV0!0P0SSS"P"(SP%TP\T\\\\P\ PPvVVQQ SSS0S S ppSvvTT00(0P~SS"P"(S` ` 11(1 ` 1VS1 v \VM}mMSP?V/SSS 1PPQ ] V:U:VUVUVU[VjVVL\[\\sXS7\S\}]S}^S}]S}^}]}^s7\s\}ns}ns}ns}n}n}nS!&SS#(SPm^P^USSs Ss{s{s"s9}ns}n}n9\\\&SSSs" s" s"s"!SSSs!_________000111000___PPP 1 _  1  _  1  _ 1PSs __0 1 0 _P  1  _ 1 _   _  PSs __0 1 0 _P  1  _ 1 _   _  P ^ s"s-}n}s}n}n-\}\\Sp}SSs" s" s"s"SkxSSs_kx___gt___gt__0gt001gt110gt00_gt__ P]iP~P 1 _  1  _  1  _ 1POUO_U __RTRV TTJ~JNPN~P]P~]]P]~ PA~  ~   ~  "~  Pa~  ~  7\d\\ \ \\'\]P]P8_8\P~ ~ T~]Q]Q.~P~ ~#\ (U(.~#\Up~#\.   U ~#\U U ~#\U  00  11  00 U ~#\UQQ1U 1 U U QUp~#\$000P]]]P]` ` 111 ` 1111 1__QQPPP0PPttPR___]]]PVV]]SSSS SS 00 11 00 SSPPP  1  S 1 S 1 S 1P%]%^%]%\%^]\^1=P%_%]%2  V)]])}})   )SS )SS )00 )11 )00 )SSPP  1  S 1 S   S  P}4)4G)G<)<4)44)444GG<<88_____]]]]]PVVVV]]]SSSSSS SSS 000 111 000 SSSPPP  1  S 1 S 1 S 1P%]%^%]%\%^]\^11P  V Q P Q P Q P Q P Q P Q P_]00UQUTJtXJQT0Q0QQP'U'6PU#Q#/UP6tU/t QJUJmpnmUUU}T}TTTTTS$Suuu u S NpN^U#gpU#|U#SU&pn&T0S&S S uSS"0S05P7CSsU"+U+0s05p7@U@CsU'U',s,1p3<UMPNbP  1  ^ 1 ^   ^  Ps ^ u?U?SUSSPTPVTT4~fmZmp~pyZy|~Z~P_~_>_>aPag__~_000ZZ~0~$~>g~g00c~  ~  :~  P~~~g~P~~^^^g^^^^^~~~g~~GG::^ _P_P>S>~P9~P~~ ssT~_P_P~JQZQT~T]Z]`~ ~#t UJMUMQzQT~#tT]U]`~#t J`  UAAUKTUTU~#t UAAUKTUTU~#t 0AA0KU0 1AA1KU1 0AA0KU0 UAAUKTUTU~#t P;BPENP1U 1 U U PUz~#t#SS#PPZZZ#0##Z0ZqqZ00g000$P$__>_>aPag___  22g222  1pp1p1p1 p 14"D5@4"D5@8cSSc__PG\_  0_sS_0 s \_hSSh__PI\\_  0_s s \ P Q P Q Q P Q PS_$U$CSCS~nSXU(T(O\OXT(Q(Q]QXQP S PPV ^^VUDVDH}nHMU"T":S:MTP S PP\ ]v\UUTTQQUDVDH}nHMU"T":S:MTP S PP\ ]v\U1unPP P !uPU1uoPP P !uPU5uo5<UP P70 P uPU UTTPp U SvxUaTaaQaDaRa@aXaaYaP S PU6U6jVjtqotUVUUU:T:l\lT\TT:Q:n]nuQu{]{Q]QQU7V7AqoABUOdVdnUnoUT9\9BTOf\foTQ;];BQOh]hoQ01S1<T(P6=P uV\] SS0SqSvq U#%vP$PhhUhSU SSlTl]T ]$]$+T+]lQl\Q\ Q \ Q \$\$2Q2KQKj\jQ\Q:t:}T# }$}$+t+}#P#Y[[[f\~\)\PcVc0PVV0P0V0 0 P 0 V 0 V P PP$ FK jj jV0 0V P QDP'T'# # # 0P0 0 0  0K00P~0 0K0 p %  P  ___ _ _ _ __FM__0_0_ 0 _ 000000000 0  fL~Lf ~ f ~ f ~ f ~ L  8TUU,s(s( s(Q, , , U s( TQ UU:s8s8 s8Q: : : U s8 TQ UUUU UUs8s8s8s8 s8s8RR RR00 U s8 TRUUUs(s(Q~Q~U s( TQ~0U+}}}}}}+\\\\\\Q*QGLQ P ,UUUrPYPTP+  QQ QQ QQ}"UUUrRRR RRR RRR 000 111 000 RRRPPP  1  R 1 R   R  PR}"T}!Q7rGNrQ}!T\1U1SUSS1T1VTVTVTV'V'bTbVT0P^0^0^0P+P+^s    +  _____0<QU>BqpQ/3Q6BQ Q++Q2>Q Q++Q2>Q 0++02?0 1++12?1 0++02?0 Q++Q2>Q P!%P(4P 1 Q  1  Q   Q  PQ \ V!U!VUV!T!]T]JsJ_~nds~n P $U@DUGOUOSqVePP?\Hm\0#S#/P/E0MT !U!=VSSsSs{Ss{Ss"U/3U6>U>BqQ/3Q6BQ Q//Q6BQ Q//Q6BQ 0//06C0 1//16C1 0//06C0 Q//Q6BQ P%)P,8P  1  Q 1 Q   Q  PQ ^ \.U.VUVV]s]s]s]s]]s]sP/\/3T3\\\T\\Je\P~'T'~~~~o~~U<VSSsSs{Ss{S s!]]TTPPs!s!u]u~s]s]]]s]s~VVVVVP^^^6^^^^ sQ^ P ____& PP\ 0    \ \   P M_M~P_A~T~ ~ 6~ ~ ~ u00000100 u00P____0P_0_ (((((((((s# (  Q   (((( (  0000 0  VV P  P vPv0}s#(Q_R0U0CUCUUU^  ^  ^3^0T0CTCaTaSTSTS3S0Q0CQCaQaQ3Q0R0CCaRa30X0CXCaXaX3X0Y0CYCaYa]Y]Y]3] PP@4[4@@[@3@___3_00C0PP00P PP       ~ ^^ SS ]]~R\R~RU]U]]"T"STSS\ \^ \  \^ \^- -P \^P 9Q9QQPVV-V-OPXVTS?Qp?~?QP|?QPU]U]]"T"STSS\  \^  \    \^  \^ -  -P \^ P  9Q9QQPVV-V-OPXVTS?Qp?~?QP|?QP%U%_ _U_unU_p`@ _unU P P@ :T:VVTVTV^VTVTVTVPVP^T:Q:SSSQSQQQQ:R:]R]R]R]_]R]R]R]P]P_R 02nPPP\ U 5P5GUG\U\\OP-Q-?PSSrSSO0101011^<VU>CUUiVinU0VSVZsZhS v# $U$s2$v" $Q$s3$v"$U$7S7gU:U"U"uvuU8T8TAQAtSt{U{|Q|SQSARARBVBIU IfVfmU mrVD\Ih\mr\SU Q  U"P"2UT2TQ*U*2Qu|p|&U u}p}PUu3UT3TQ,S,3Qu|U3U Uu3UU"P"8UT8TQ-U-8Qu|p|,U u}p}P!U U"P"8UT8TQ-U-8Qu|p|,U u}p}P!U 9U9tVt}U}VUV T T.Q.v\v}Q}\UQ\=R=RuuKvuKTU 0TvuU 0vuuKvKTU#TvU#vs-5P5essP5KPKZsZePsP%S%8P8FShvPvSPSPTuu\%U%&Q& U&P&1UT1TQ&U&1Quupu%U 0up%U#U%P%0UT0TQ%U%0Quupu$U 0up$U#9U9VUVCTCT>Q>^Q^GRGR9uu9vuU 0vu9u9vU#v#P#H]HLULM]P]P]PP]U]PbQsQQQPS\%RR#,(S\S\S\S n1n}0.11GRGRf0000#P#H]HLULM]P]P]PP]U]   f2222  1DSSSSDD    DD     S    8cs   %S%C\SS\S\S\C S   C S   CSC S    S    8uuv  v  QUoVoq|_qvU!T!vT!Q!LSLvQuuYvuY[|U[`U 0uYvY[|e[`U#EP   8\ v  P9U9VUVCTCT>Q>^Q^GRGR9uu9vuU 0vu9u9vU#v#P#H]HLULM]P]P]PP]U]P_QpQQQPS\%RTR#Ԁ,(S\S\S\S n1n}0.11GRGRf0000#P#H]HLULM]P]P]PP]U] T T f1111 T 1DSSSSDTTTTD    DTTTTD     S T   8`TpTTT T  %S%C\SS\S\S\C S   C S   CTSTTTC S    S   T 8uuv  v  QUV|_U!T!T!Q!SQuuvu|UU 0uv|eU#lPlsT T  8\v T9U9VUVCTCT>Q>^Q^GRGR9uu9vuU 0vu9u9vU#v#P#H]HLULM]P]P]PP]U]P_QpQQQPS\%RTR#Ԁ,(S\S\S\S n1n}0.11GRGRf0000#P#H]HLULM]P]P]PP]U] T T f1111 T 1DSSSSDTTTTD    DTTTTD     S T   8`TpTTT T  %S%C\SS\S\S\C S   C S   CTSTTTC S    S   T 8uuv  v  QUV|_U!T!T!Q!SQuuvu|UU 0uv|eU#lPlsT T  8\v T9U9VUVCTCT>Q>\Q\GRGR9uu9vuU 0vu9u9vU#vPE]EIUIJ]PU]<PPS$R4R#,(S o1o}0.1GRGRc00PE]EIUIJ]PU] 4 4 c33 4 1ASSA44A  A44A   S 4   8=44 *S* * *4*  S   4 8uuv  v  PU<SR>Ruu=vu=BU 0B_vu_dU 0divuu=v=BU#B_v_dU#divSUQ AUAUUUty!UTT!T{Q{QQQ!QAuuAU 0uuuuto!U 0AuAU#uut`!U# p t"p U#"U#  U#"p U#"U#  U#"ENU#  U#"_ap U#"acU#  U#"R"P"ARAOPOURUiPisRs|P r P7 r 7E p E_P_i r ir p r r r r  r   8UbPbjUjnPP!U/T/nTnnTT!TQbUbjQjnUU!QuuVpuV^U 0^bpupu!U 0uVpV^U#^bpp!U#@0@VR^b0!0-Q-6p>BQ+U+SUSSTTTTTQ~QQ~usuuU 0susu?s?Y_YusuU#_s"s"_)0[000 ~  P> ~ P; ~ oPdP)0)1\[020<0R>oR@Ruu;vu;@U 0@Evu6vu6;U 0;@vuu;v;@U#@Ev6v6;U#;@vSUQ#SU%P%-UT-TQ%U%-Quupu!U 0up!U#:U:eVejUjoV6V6;U;@VToT@T/Q/dSdjQjoS5S5:U:;Q;@S>R>oR@Ruu;vu;@U 0@Evu6vu6;U 0;@vuu;v;@U#@Ev6v6;U#;@vSUQ#SU%P%0UT0TQ%U%0Quupu$U 0up$U#U&P&1UT1TQ&U&1Quupu%U 0up%U#U&P&.UT.TQ&U&.Quupu"U 0up"U#U&P&.UT.TQ&U&.Quupu"U 0up"U#U&P&.UT.TQ&U&.Quupu"U 0up"U#U"R"&rn&.UT.TQ&U&.Quururc"U 0urrt"U#U"R"&rn&.UT.TQ&U&.Quururc"U 0urrt"U#U"R"&rn&.UT.TQ&U&.Quururd"U 0urrt"U#U%P%0UT0TQ%U%0Quupu$U 0up$U#U%P%0UT0TQ%U%0Quupu$U 0up$U#U"R"&rn&.UT.TQ&U&.Quururd"U 0urrt"U#U.P.6UT6TQ.U.6Quu"pu"*U 0u"p"*U#UPHUTHTQ?U?HQuupu<U 0up<U# P RUPHUTHTQ?U?HQuupu<U 0up<U#UUTTQQUUTTQQUUTTQQUUTTQQCUC]U]U]U]U U ] U#T#\T\T\T\ T \ T \ T \ T\T\T\T\T\T\I\InTn\T\T\T\T\T\T\T\T \ T \ T \ TQVQVQVQVQ V Q VQVvdQVQVvQVvdVQVQVQVQV+V+QVQVQVQ V Q V QXRX~R RXXX_X_X X _ XS0SSS S S#}0  $0)}0  $0) 0 ] ]   P   P   ]  P ] P P P        V,vX~VH U ~V<u^^uuX X 3S36s6iSSsSsS0-?p cip p 3S36s6iSSsSsS'SSSSSSSSSS=SSVVVVVV=VV101011U\VHSSS\\\Q 7QQ]PPP01001^sQR~~~ QQsssTPTV\H{SSS{\\\P+PvPPHUHQTjUTUT v0v{1001^sPF~c~~PZ_Ps5@ssU TSSS\\\P1PPPUTTT w0ww1001^sPG~~~PPsTS S SS%@SSSS S6V6Q Q QQ%@QQQV V$Q QQv$v$| $ &#2$s" U~V@&S SS&V VV01&2 123$s#$| $ &#2$s" $Q$vKSSSISSSKVVQV+V+IQQQ PPPU~V<S S S SSSS S SVvdQ vd V V VQVV Q QVvdQ vd V V VQVV Q QO[ [#[#9~^w[[\\\\ \P]:]?]]P&sP0  0  0   0  0+x2%+/x2%#/fx|2%# 5R5y~~R9~R~ )Y)r~Y ~-P-V\\\PV p  3RRR 0 0 0 0000 0 P 0 P 0 U~ V  &S SS&R RR01&2 123 AVV A\\ %Y%A~Y&\\%Y%&~Y&11&   %y#+%n~#+y#+ ~#+    \Y ~ 1 s   s    s   s   sSSlS SiViQVlV Q%v $ &#3$s"#v $ &#3$s"#.Fv $ &#3$s"#] U~V@)SSS)\\\ 0 1)2123SSSSVVVVU\V V\ .@$@.@$@. $ .@$@.@$@ .0$0 @   8S&S+rSV&V+rVU~VLj@+@^ & ^@+@^@&@^@+@@ 80+0PPȟ ȟ  @+ @ @ VQQQQSSSSPPr5U5VUV+VTT+T:Q:SQS+SSS+SH H ~ U~S8~ ~~~)U)SUSSYTYVTVVS00_0_{_@@@&=@Fb@ @ H@H @@ 0 @ H   8UTV(01'2')0123V\((U(SUSS(T(VTTTVT(Q(^Q^Q Q ^P\\'Q Q.Q.9s-P-y]y__P] q 'PP9P(PPP0P0V0`w0wy y0 0 0 00r0|0P0QQ QQ ]<U<\U\\dTdSTSS} $ &#3$|"#} $ &#3$|"#} $ &#3$|"#} $ &#3$|"#0]]]]]VTS|USV|+U+wVw|U|V+V5T5T+TP2>P~U~TTxJUJ\U\\GTG_S_TTP/XPxP } :$G } :$G r :$]] r :$]0o0o_q:$0_00s0sX~0x=U=SU SS=T=\T \ T \\T\TT\00  PHJ 0 0P 0 P0 0p2%p2%#Mp|2%#0[0P[0[0G0L0[0P[00^0^0G0L0^0^^0PVVVV$QQ!sfqQ| V]_V_V)VLqVV_V__V)P)q^qysyfP^ q $P!Pf|P,PPH^P0000G0L0000P0QQ QQ @@@@ @  GGGG         R '} }#*(}R'} }#*(}]'} }#*(}\\\\[1[1;0;[1 1  GG    RR \\ 88s#U t [Rp U T  ~  Q  \s# U ~  T ! ~  [ :U:\U\i\hThVTViVP%Q%:pQp0q0: ~<q*Pv}P}-q Q&%rq Q&% r ,(P-q Q&%rq Q&% r ,(TVTViVaȟȟ!ȟp0q0: ~<qX}TVԟv Uv ]S]S1 ]S11U1\U \\aTaST SS \a\~\ \A]|]]]#6UA^AA||^|^^^#6^A |    #6 AH|HHHH#6Hp,PgPPPU^^#6^ HH#6H P 2pmpppP U^^ HHHH a ~  PPqq;]]];;   QppQQ(]]]((   (   (222PixPxqq10QOQpiQQ ]]     PP2 1i111+1~12 2 1i111+1~1]]          p Q]o]o     o     o     o=====rPPqtPP<Opp QOp Qrp Qp p ]]      PP =s<<<< = =s<<<<]A]A     A     Qp ]A]A     A     A     A=====!P!2qtPPP<<Op p  QQO p  2QQp p p ]]      PP =2<<<< = =2<<<<USV\yUyVUVVU VP0:0z0 0 000000c00000000sTs]T] T ] TTTT]T]T] T$0d|0|PSS S SSSSSSSSSISSSSSS0SSSSPS0SSS SP] ]]]]]]]]c]]]]]]] PPP$0d0 0 0 ]00]0]0c000]00]00$0d 0 0000I0c00P\0P \PP%^!  : +( !  : +( !  : +(  !  : +( -!  : +( !  : +( !  : +( !  : +( !  : +( !  : +( !  : +( $0d 0 0000I0c00P0P00%!v  p -(p q -(< q -(*`rs3.( < -( Q #`rs3.(\~2$ }"\ \ ~2$ }" \ ~2$ }" \\\\~2$ }"~2$ }"~2$ }"~2$ }"\\c\~2$ }"\~2$ }"~2$ }"\~2$ }"\ $0d0_0P_ 0 ____0____I_II0__P_0__0__0_0__0_ _ $0d0P~ 0 ~~~~~~~~I~~0~~0~0~0~ $0d0P~0~ 0 ~~~0~0~~~~I~~0~~0~~0~0~0~P~0 ~$0d0 ^ ^ 0 ^^^^I^c^0^0^0^0^ ^PEYPY~0 ~ ~ 0~ ß0 0 0 000 I0II c~ ß0 ~ ß~ 0~ ß0~ ~0~ 0~  ß0   ß$ d P~ Y~   ~~~~~P~~~~~~c~~~ ~~  ~ ~000 0PSS S SSSSSSScSSSSSSSPSSS _ _ QQ QQ \~2$ \~2$  ~2$ ~2$ ~2$ \~2$ \~2$ ~2$ ~2$ ~2$ c~2$ ~2$ \~2$ ~2$ ~2$ ~2$ \\            s____            s____  \\     __  88a@ @@ @  G]`` `` `   }  Qv }  Qv }  Qv]]]]]#]5O]]] ~  Qv ~  Qv ~  QvVVVV$GVV$G]]]#]]0001#R#Y\Y]|]\\\#Y#___"PNlPq Q "p#/P%!v  r -(#P 0!P!$G pQQ%R%?~~ v P% v #~#]\]\1 ] \ 1gSSES PPMSSSSSSS]]]]]>0>fPf~~P~~+0+\\\\(X(jXj<<<<j    j<<<<%R%gRK000XX<<  RR88AXA   A   ARA<<<6161%0%611  X   R << 88Q Q  <<<<<< Q Q    << 88SSP%P%?~~% v P=<$< Q #`rs3.(S]\ S \ 0   S \ 0v#"U(^"Q"(( V 00000000000000 0$vv##U'~#Q#'' %_ _ P%~ P %~ ~_ _~ ~0 0   7~#+ ~#+   _~0 0\ \ 0~ ~ 0^ ^"~ ~"^ ^"1 1"   9~#+ ~#+   ~^1'~']\]\1 ] \ 1 ]P ~ \P~\1 P~ \ 1v#"U#^#~"v#!U"_! ~  Qv ~  Qv ~  QvP ~  Qv ~  Qv ~  Qvp$|$|$\$U$U T $Q$T+P+HPS^P PP% $U$%U T $Q$%TUUTTQQU(S(DshDIUIISS0 ps# $ps#$*ps#*/ pU U&S&+U+LSLPuwPQUQQSS-U-cVchUhmV4V4FUFPV0Ss5S;@S4SU*S*/U T /TQ/QPUQUQUQUQTYTYTY0TZZZZ3 u 5X:wXX y 2$ x 2$0100 y 2$ x 2$\a5:w    x %b x  x   %b    %b   %b  %b    x     8UZz5% 1zO $!1zO $ 1 +(>U>SUUSCTCVTTVNQNQQQNRNRRR P \\^\\\\\/PWPPPPPP?]W]]]p2$ &|2$ |2$ |2$ f  f  f  f   p2$    8V```|: }  }  } :   :   :   :     }    8@@ | a }  }           }    8 S7NS V7NV 7N  \7N\-07N0U u UUu UU u UUu U U T\TYUTRVRYTP(S(-s/>PUO\OTUjuujuUTQUUUU$UTTTT$T  UUU$U  UUU$U  0$0  1$1  0$0  UUU$U P PP1U1U U P'U'qVq~U~VV@ V'T's\sTT'Q'k^k~Q~^f^fQ^'R'u]u~R~]]R]P@SSSYSS _IK_tv_%S'S+S]R]03P3[SPS[00PSSS(U(SeUS[SQTQ\]T\[\QQQVQV[V-P-7pPpP0- ps 3%-7ps 3%# ps 3%ps 3%#ps 3%#P^^[^&0&k1011&< < s s{s ^{^ s ^ s ^+U+SeUSsS[T[V^TVsV[Q[]Q]''s][R[sEPEOpPpP0E ps 2%EOps 2%# ps 2%ps 2%#ps 2%#P$[[[[+[+;>0>10111< < s ss [[ s [ s [)U)SeUSSWTW\]T\\WQW^Q^77S^S^s v2$s"#. v2$s"#.9 v2$s"# v2$s"# v2$s"# v2$s"#0Vv.P.XVVvQQv2VP)YYYY'Y'7D0DX10PP21)< < s suss YuYT s Y s YUS}eUSaSGTGVTVaVPt\}\a\\00101000E1N<^k< < s sQ\s s \Q\\ \ s \ s \5U5SUSS5T5VTV6V6:T:V t uvuzT#zv6v6:t:v 4     8 44 8 8     8 88 US|eUS(S(2|e26t`67U7oST\TTT\STSo\ P YVV,S,444 P .VV1P17V0S0 P YVV, , , 6S6 , 1,<<,@@,  ,@@,  <@ 8s s V U UTU7Q7TQTQ1R1XRXR7PoqP pr % P$PDFP;ZPXZQQ=ut:% R/t/t9/BrW_rt5/[DL[tjuuutut5/{DL{Q r rUPxx r rPxxMUMVUVVUVv`VUVT\T\TTT\&P&]]P]*]VSS*sS 0 3S36s6cSSS")0)9P9=p=?PPS Q " t ") } Zz t z }  t  }  Q #p )Ep QPXQX{|9|9Q*Q*;|:XXX000*0&P&]]P]*] S S p4p2$(p2$    Q t Q  @ Qp QOUO\U\ )X0ESEOPOTS   PTUT\}mU\P ?S ~  PPV | VvUU6U6SUSJS U &UT&TU&U&NUTASAGTGNS+V07VP!PP!P@ @ @ @ 1UP6UT.U./T/6UQ.T./Q/6T!R!.Q./R/6QPPU# xH  ? ,       fQ~   "'#(-.;FILVY\_i%.28;>TV)147ADGJTT  h).IN!Q =c  !!5+3r  ($%(-2 DFDFDF?A#O.14'9:=FK'' xx 5+,/6;  *,05x+P   P   ((  ,@ m242424-/+25 (  $+/6:DL   IF  RF SFQI=+FA>8Nu    m     )/:    #  )/:  :<24    G48KUZ!& (/3^3^3>&*Y*Y*5)  < &) KKB   Q{ !  69= %T (5$)T)-      ,sFTV '+229C1X U\ U\$>AE$>AE$>AE$>AE$ //  //$.6fp ( )-5?kky +%%,1 !!(-cnuz  L GGL    ##/T[g(:(:#&S     1 a  Q "  {#%""%6 >  ,,37>H49#248K#8?FK(l,           !(}   DN    /   $..  !&+05aadi  # %B%U O{$1Nq    $,/+4"+#!&!&".".".". ".*   ++.2:YDD   E ++x# x  >> e    -7;G;G&*8YY+;/  '1!)>A:T:AKT"WA "-,3 $  #0 : Iq      #y00000000000000000000000  #/8;DGbe000000000$25>AJMz} %@00>+04=C+04=CL0@;0>7= /0>^7= /0>7= / 'BKN`c  ~ E    %)bI  %88[Pu+246:ADV+2:ADKQV#%  +  }!MBw!O  ]^gh'A[} )  e  %88  Z]^ahm Zbez+            I     +H x+@@F 14\`  0  0   (/"3B22T*"$%* |$ / ( WQ $ CQs )u @%  " '*5   B  %, qELPfILPfILPU $(  ny(fs$bb q#n3 :I!=P!=P gvFNT;  zzee  11$!] ( <5x/k'cw  )-    hp dd  667:;>DIQ\HKSXY\]bhmHHXXY\]bhm  @  MMNQZ_`ensHHZZ[`in /k'cw/k'cw % ..Vv P, &'*5 <!,monj.q_t[p(6Of((Of "' ("  $)38 %/433  %(4 (  %B;#[j[jjj9!iix -}kxgta =II"  R  R   x  x ua  =II"   &&>9! DSDS 9! >  . .   $$+  *3..  $ *34uuggDGXbM / /  #  #*-#*-#     doot &,,1   AJT_k",7C(3?cj'o!; RdvN`r '#s{nnG]L] ]m#(DIQ\HKSXY\]bhmHHXXY\]bhm BPTKPTKPTTTTT/ '1 (.:  lo  2Z(,     $     *==I# J` JJT`  ##  y   h         HH+  vy}}}  R&BW 01J++011 H=   '.  !1++0     H#) $M  ))H  *R M   %%%%H_f%%* X" +A#.A,VU   <| '# `>HH"  cn")8>F!I   - ! - #',-25:(().16 *  "!#()./4$$%*+0 !3? # (  "-# &)6^L?@CJO\ow   ?@CJO\ow  * %i1J++011  BKO\bgFKOY  _c&*  /2 >AE+2D=))99<h (,   #   _&&'(3,%%3 ;##))(5\n!!""( aaa 4E/E++2A4CJ7M//6E3JQBB~ #+ #&.19A&    0!+0  '   #()/4(- r+0  .Z+g: %3oa-- Q\   ?? usCC [99 {f``  \ !, JV    !"#$&()*+-/134689;=>@BCDFww@"x )x'Hxexx@%x*WAx0xxH1 0Ay0y` Ey5Ɛ }PN<gy}Ny`>fy]]~~ Pyp y   z 0  P,z Xz ;5 Pyzzސ*z!AO)8zzpz`${W_N<{ ]{0{T{`X{@{ 9|p@*|N|)k|| |$|%N~|v  [|P*, PB} +S/ @! B'}. =* -B}/7+ P  ] PUj 8 8 \}7  P< ;}?: ( X%}@ 5 XT pTa` @;" 9- 6)T}A! O.D` Q-}U:m8w 5~W p !++  p4~fa(  PI pG,+'*,+*8G PLT 2a1 013 /,+ 3 p/ -m-+-+++88888"8,86;KO p[WKL   0 M 0X P[+Q 9 Q5 7&B ,K PV ,_ ,h ,q @,z , , , `, , , @, , , , `, , , , , , ," @,, ,6 ,@ ,J ,T ,^ @,h ,t ,~ , ` , ,  , @ , , , , @ , , , ,  @ ,  ,  ,  ,*  @ ,4  ,>  ,H  ,R  @,\  ,f  ,p  ,z  @,  ,  ,  ,  @,  ,  ,  ,  @,  ,  ,  ,  @,  ,  ,  ,  @,$  ,.  ,8  ,B  @,L  ,V  ,`  ,j  0v  `,  ,  ,  ,  `,  ,  ,  ,  `,  ,  ,  ,  `,  ,  ,  ,  `,)  ,4  ,?  ,J  pW  ,b  ,m  ,x  `,    ,    ,  `,  ,    ,  @,  ,  ,  ,  @,  ,#  ,.  ,9  @,D  ,O  ,Z  ,e  ` ,p  ,{    !,  `!,  !%  ",  @"#  ",  ",  #,  0#  `#,  #,  #  $,  @$,*  p$7  $,B  $,M  %Z  @%,e  %,p  %,{  &,  @&,  p&  &,  &,  ',  `',  ',  ',  (,  `(,  (, (,  ), `)," ),- ),8 *,C `*,N *,Y *,d +,o `+,z +, +, ,, `,, ,, ,, @-, -, -+ ., P. ., .,  /, @/,# /,. 0,9 @0,D 0,O 0,Z 1,e `1,p 1,{ 1, 2, `2, 2, 3" @3, 3, 3, 4, @4, 4, 4, 5, @5, 5,$ 5,/ 6,: `6,E 6,P 7,[ @7,f 7,q 8,| @8, 8, 8, 9, `9, 9, :, @:, :, :, ;, h;  ;,  ;, <,# p<0 <,; <,F =S @=,^ p=k =,v =, > @>, >, >, ?, @?, ?, ?, @, @@, @, A, `A, A, A,( B,3 B,> B,I CV @C,a C,l C,w D, @D, D, D, E, @E, E, E, F, @F, F, F, G, @G, G, G,' H,2 `H,= H,H H,S I,^ pIk I,v I, J, `J, J, J, K, `K, K, K, L, pL L, L, M, `M, M,( M,3 N,> `N,I N,T N,_ O,j `O,u O, P, @P, P, P, 0Q `Q, Q, Q, R, `R, R, R, S @S, pS+ S,6 SC T,N @T,Y T,d T,o U,z U* U, V, 0V `V, V V, W, @W, W, W, X, `X, X, Y,% `Y,0 Y,; Y,F Z,Q `Z,\ Z,g Z,r [,} [, [ \, 0\ @\, \, \, ], 0] `],------ <-(K-0Z-8i-@x-H-P-X-`-h-p-x-----,-;-J-Y-h-w---------- - -(+-0:-8I-@X-Hg-Pv-X-`-h-p-x----- --*-9-H-W-f-u--------- -( -0-8)-@8-HG-PV-Xe-`t-h-p-x------- --(-7-F-U-d-s------- -(-0-8 -@-H'-P6-XE-`T-hc-pr-x-----------&-5-D-S-b-q----- -(-0-8-@-H-P-X%-`4-hC-pR-xa-p---------- - -$ -3 -B -Q -` -o -~ - -  -( -0 -8 -@ -H -P -X!-`!-h#!-p2!-xA!-P!-_!-n!-}!-!-!-!-!-!-!-!-!-"-"-""-1"-@"-O"-^"-m"- |"-("-0"-8"-@"-H"-P"-X"-`"-h#-p#-x!#-0#-?#-N#-]#-l#-{#-#-#-#-#-#-#-#-#-$-$- $-/$->$-M$- \$-(k$-0z$-8$-@$-H$-P$-X$-`$-h$-p$-x%-%-%-.%-=%-L%-[%-j%-y%-%-%-%-%-%-%-%-%-&-&-&--&- <&-(K&-0Z&-8i&-@x&-H&-P&-X&-`&-h&-p&-x&-&-&-'-'-,'-;'-J'-Y'-h'-w'-'-'-'-'-'-'- '- '- '-  (- (-( +(-0 :(-8 I(-@ X(-H g(-P v(-X (-` (-h (-p (-x (- (- (- (- (-  )- )- *)- 9)- H)- W)- f)- u)- )- )- )- )- )- )- )() ]* ] @*- O*- ^*y**((* ] ***P( + ] "+_G+ Me+X+x(+ ^+t(++(, ^3,PV, !},(, 0^,+>,i,( - H^ #-&B-e-(}- `^-2--@(- p^.-( .-0 -.-8 <.-@ K.Q.W.].k~6n.RSYX TYpTY~`4.8 .TY. g. e ~.BX>. @a) /X@ b)8/X> `)f/X>/ _)/K _)B ^,/ ^,V @_,_ _,q `,z @`, `, a, a, a,/ 0b/ `b, b, b, c,/ Pc c, c, d,/ @d,0 pd d, d," e,, @e,0 e,0 e,J f,"0 `f,T f,,0 f, g60 @g,t g,@0-H N0-P \0-X j0-` x0-h 0-p 0-x 0- 0- 0- 0- 0- 0- 0- 1- 1-  1- .1- <1- J1- X1- f1- t1- 1- 1- 1- 1- 1- 1-( 1-0 1YY~,~eZPb1Z)I2)[O092\s/\2\0 P p2][2 042]P2 z!!428821^u3 І<0T3^,3 pUrn0D932_ʀ܀```lg+f+d3aϑbbz3+3+3+3+3+3+3+3+3+3+ 4+g8J 488648@4L4+ ![4cOqd8L<@a@xUw4c*4 4 p@}4e4 #Áf-pnf!/0ge4Ng4+ 5+ ,58T558PpJ @ r0 f^'p>5 h]5 0Gp:D i$Z`ij~kŒk<lj5l+5 u58(5m+5 Pv5352m15 v B5cm2ǂ@T 6m*ނ|!6m$I6 p@WV6mQsi64n6@@6npodobpp)I6 ~6scp@i6utq6 6 he+ 7 hG!780f8H+7805780Vh+ r,> `r, > r,+> r,6> s,A> `s,L> s,W> t,b> @t,m> t,x> t,> u,> `u,> u,> v,> `v,> v> v,> w,> @w,> w,> w,> x, ? 0x? `x,!? x,,? x,7? yD? @y,O? y,Z? y,e? z,p? `z,{? z,? {,? `{,? {,? |,? @|,? |,? |,? },? `},? },? },? ~, @ `~,@ ~"@ ~,-@ ,8@ `,C@ ,N@ ,Y@ ,d@ `,o@ ,z@ ,@ ,@ `,@ ,@ @ ,@ @,@ ,@ ,@ ,@ @,@ A , A A ,%A P2A ,=A ,HA ,SA 0`A `,kA ,vA ,A ,A `,A ,A A ,A 0A `,A ,A Ї A ,A ,B P B `,B ,#B ,.B ,9B `,DB &QB ,\B @,gB ,rB ,}B B @,B %B ,B %B @,B ,B ,B ,B `,B ,B ,C ,C `,C ,(C 5C ,@C `,KC ,VC ,aC ,lC `,wC ,C ,C ,C `,C ,C ,C ,C C ,C #C ,C `,C , D #D ,"D `,-D &:D ,ED ,PD `#]D ,hD ,sD ,~D `,D ,D ,D `"D ,D ,D ,D `,D %D ,D ,D `,E ,E ,E `,'E ,2E ,=E @,HE ,SE ,^E @,iE ,tE ,E ,E @,E ,E ,E PE ,E ,E @,E ,E ,E ,E `,F РF ,F 0*F `,5F ,@F (MF ,XF `,cF ,nF "{F ,F `,F ,F УF ,F @,F ,F -F ,F @,F ,F +G ,G @,G ,&G ,1G @,b-Mb-\b-kb-zb-b-b-b-b-b-b-b-b-c-c-c-.c-=c-Lc-[c-jc- yc-(c-0c-8c-@c-Hc-Pc-Xc-`c-hd-pd-xd--d-g dgX(g 0gg"g(g Ph&3h Nh(^h hrh <hY $h(h ph h} ?i 4i(Hi `i J}i" i0 iE iQ 1i >i-j-j-j--j 4j m;j Bj Ij ^Pj,Vj .]j!qjj Pj8`j ` Ĉaj@%OQkv#k &/k 0o`;k|SO pXUk ,_kϽh pKyk`5 @9kk k_kl l '(lKl Wl{l Pl%l #l3B ,/ @,l ,V ,_ ,h @,q ,z ,l , @, , ,l `, , , @, , , , @, , , , `," ,, ,6 ,0 `,@ ,0 ,J ,T ,,0 ,^ ,l @,t ,~ , , `,m , , , `,m  , , `, ,  ,  `,  ,*  ,4  ,H  ,R  ,\  ,f  @,p  ,m   ,  ,  `,  ,  ,  ,  `,  ,  ,  ,  `,  ,  ,$  `,.  ,8  ,L  @,V  ,`  ,'m ,v  @,  ,  ,  ,  @,  ,  ,  ,  @,  ,1m   ,>m 0  `,Km   ,KU-ZU-iU-Xm-xU-U-U-U-U-U-U- U-(U-0U-8V-@V-H,V-P;V-XJV-`YV-hhV-pwV-xV-V-V-V-V-V-V-V-V- W-W-+W-:W-IW-XW-gW-vW-W-W-W-W- W-(W-0W-8W-@W-H X-PX-X*X-`9X-hHX-pgm-xWX-fX-uX-X-X-X-X-vm-X-X-X-X-X- Y-Y-)Y-8Y-GY-VY-eY-tY- Y-(Y-0Y-8Y-@Y-H Z-PZ-X(Z-`m-hFZ-pUZ-xdZ-sZ-Z-Z-mމNPv2PDo100pEȊ-1`.-20K .c`.w.. .`00.! 68pHPHf0288 m!m !֌nm!!m `Yp  m8`n3n0n 0*`2 3=nd{  #Hpf oRn@okn*@ 3܍0n8``njn P-nin nw+n P4`{n o J3o#k Pf@j4o+`D$pBo@; fo Pso3oo pَo++~ 2 QPoVo ,%or#p p,0pPpNop %|pNPp -q p+ p pp p .   q q {l 0"q K pɏߏ@p3q+P.q+P;q8`Eq:B ,/ @,V ,_ ,h ,q `,z ,l , , , , ,l @, ,/ , , @, , , , @ , ,/ , , @ , ,, ,6 ,0 ` ,@ ,0 ,J ,"0 ` ,T ,,0 ,l @ ,60 ,t ,~ , @, ,m , , @, , , , @, , ,  ,  ,*  ,4  ,H  `,R  ,\  ,p  ,z  `,  ,  ,  @,  ,  ,  ,  `,[q   ,  ,  @,  ,  ,$  ,.  @,B  ,L  ,V  ,`  `,'m ,v  ,  ,  `,  ,  ,  ,  `,  ,  ,  ,  `,  ,  ,  ,  `,  ,  ,)  ,?  ,gq ,W  ,m  `,x  ,rq ,    @,  ,    ,}q    @ ,  ,  ,  !,#  `!,q !q !,D  ",O  `",Z  ",e  ",p  #,q `#,  #,  #,q $,q `$,  $,q $,  %,  `%,  %,  &,q @&,  &,  &,q ',7  @',B  ',q ',Z  (,e  @(,p  (,{  (,  ),q @),  ),  ),  *,q P*  *,  *,  +,  @+, +,  +, ,," @,,8 ,,N -,Y `-,r -z -, ., `., ., ., /,r `/,Z-(Z-r /-r 06r 10Mr+@(_r+ tr+ r+ r+ r 20r+ r+@ s+  !s+ 6s+ Os+ rs+ s+ s+` s+@ s+  s+ s+ t+ *t+ Bt+ \t+` ut+ t+ t+ t+@ t+ u+ &u+` Au+@ [u+  wu+  u+ Z-u-Z-Z- [-[-'[-6[-E[-T[-c[-r[-[-[-[- [-([-0[-8[-@[-H\-P\-X&\-`5\-hD\-pS\-xb\-q\-\-\-\-\-\-\-\-\-\-]-]-%]-4]-C]-R]-a]-p]-]-u- u-(]-0]-8]-@]-H]-P]-X]-`]-h^-p^-x$^-3^-B^-Q^-`^-u-o^-~^-^-^-^-^-^-^-^-^-_-_-#_-2_-A_- P_-(__-0n_-8}_-@_-H_-P_-X_-`_-h_-p_-x`-`-"`-1`-@`-O`-^`-m`-|`-`-`-`-`-u-`-`-`-`-a-a-!a- ?a-(Na-0]a-8{a-@a-Ha-Pa-Xa-`a-ha-pa-xa-b-b-u-Mb-\b-kb-zb-b-b-b-b-b-b-b-c-c-c-.c-=c-Lc- [c-(jc-0yc-8c-@c-Hc-Pc-Xd-`d-hd-p-d-xiTPi{pjkkݒ`oo`p<fзP>ȓ֓ # + +9 +/d +D +Y +n + +; +f +” +ה + + += ++h +@ +U +j ++?+j++ӕ+++A+'l+<+Q+f+{+C+n++ϖ+++E+#p+8+M+b+w+G+r++˗+++ I+t+4&K a u 5""Ș#Ә Q*pj5#p2S0t0I ;k ޙQQ5V 8X;0  fu9qгNߴJY@КUP<ncH**PRV bpћ-4O2,B+``9m~6PM- ŜΜ;6[25>ܜOK5-Td0"uv DM`tƝ`E+7HCs̝ƞ0O$`jE5qŸʟ(ܟ 40!10DK]nFD1Z` aP()2><a`,k=(?ҩ CXRhA@Q@V6/VϡޡP:p @Ugv8;Eڢ8*.`bvPUК@$3`U {9%kDR֤(*-C;f|Щ00pۥ+ Of'PW@WI4j@"tǦݦ@:p555b 3,§ʧ;9pjOwzr0TkutC0o E<%lo 1ͨ9 5R+NCQ0Wgxp2ʩ 0>$@vPt Hh0 ֚ U,ު̞`cN `*8\ yRҫ+ pE-+0@pDPiƬѬ 6EZh:b g@m%z@˭Ʒ aD /A 6J4pdЉ bĮQݮ8 0*B^q|CG0R" PVsn:)Qů`̯ţIb'40.LPmZn)@(ذ2=dptr|`UsxP,)f0aܱ*вVePScβǶ@޲ $7Q\w6@oCسp`(FU 7KXq86V 5p6"ft)˴3ٴT:i,,BCc,~Lε" m`<J/`6^ЌE,P9-`'8$  CMP)n|@ON#( f'Ө9&MЧ;Zm| . $ȸ@$ n8Kwvݹ` 9!0QH+QXеfrθ. Us3ȺۺPc*<+@Vnd TD1Pһ+ HU:AWpnzyRϼu߼?,Lj`M0$Z9h mpt3sas_base.c_base_wait_for_doorbell_int.cold__func__.291mpt3sas_atto_get_sas_addr.cold_base_assign_fw_reported_qd.cold__func__.112_base_get_event_diag_triggers.cold__func__.37_base_get_scsi_diag_triggers.cold__func__.35_base_get_mpi_diag_triggers.cold__func__.33_base_release_memory_pools.cold__func__.24_scsih_set_fwfault_debug.cold_clone_sg_entries.coldmpt3sas_base_start_watchdog.cold__func__.408_base_wait_for_doorbell_ack.cold__func__.296_base_handshake_req_reply_wait.cold__func__.288__func__.299_base_get_port_facts.cold__func__.197_base_send_ioc_init.cold__func__.141__func__.379mpt3sas_base_wait_for_coredump_completion.coldmpt3sas_halt_firmware.coldmpt_callbacksmpt3sas_base_unmap_resources.cold__func__.269__func__.267_base_clear_outstanding_mpt_commands.cold__func__.395_base_process_reply_queue.cold__func__.375mpt3sas_base_update_missing_delay.cold__func__.263__func__.257mpt3sas_wait_for_ioc.cold__func__.243mpt3sas_base_unlock_and_get_host_diagnostic.coldmpt3sas_base_lock_host_diagnostic.cold__func__.354mpt3sas_base_check_for_fault_and_issue_reset.cold__func__.359__key.387_base_event_notification.cold__func__.239__func__.135_base_make_ioc_operational.cold__func__.145__func__.31__func__.39_base_get_ioc_facts.cold__func__.326__func__.318mpt3sas_base_map_resources.cold__func__.339__func__.227mpt3sas_base_make_ioc_ready.cold__func__.220mpt3sas_base_free_resources.cold__func__.214mpt3sas_base_attach.cold__func__.212__func__.194__key.211__key.210__key.209__key.208__key.207__key.206__key.205mpt3sas_base_detach.cold__func__.16mpt3sas_base_hard_reset_handler.cold__func__.14__func__.1__func__.8_base_fault_reset_work.cold__func__.393__func__.406mpt3sas_base_sas_iounit_control.cold__func__.253mpt3sas_base_scsi_enclosure_processor.cold__func__.248_entry.0__func__.2_entry.3_entry.4_entry.5_entry.6_entry.7_entry.9_entry.10_entry.11_entry.12_entry.13_entry.15_entry.17_entry.18_entry.19_entry.20_entry.21_entry.22_entry.23_entry.25_entry.26_entry.27_entry.28_entry.29_entry.30_entry.32_entry.34_entry.36_entry.38__func__.40_entry.41_entry.42_entry.43_entry.44__func__.45_entry.46_entry.47_entry.48_entry.49_entry.50_entry.51_entry.52_entry.53_entry.54_entry.55_entry.56_entry.57_entry.58_entry.59_entry.60_entry.61_entry.62_entry.63_entry.64_entry.65_entry.66_entry.67_entry.68_entry.69_entry.70_entry.71_entry.72_entry.73_entry.74_entry.75_entry.76_entry.77_entry.78_entry.79_entry.80_entry.81_entry.82_entry.83_entry.84_entry.85_entry.86_entry.87_entry.88_entry.89_entry.90__func__.91_entry.92_entry.93_entry.94_entry.95_entry.96_entry.97_entry.98_entry.99_entry.100_entry.101_entry.102_entry.103_entry.104_entry.105_entry.106_entry.107_entry.108_entry.109_entry.110_entry.111__func__.113_entry.114_entry.115_entry.116_entry.117__func__.118_entry.119__func__.120_entry.121_entry.122_entry.123__func__.124_entry.125_entry.126_entry.127_entry.128_entry.129_entry.130_entry.131_entry.132_entry.133_entry.134_entry.136_entry.137_entry.138_entry.139_entry.140__func__.142_entry.143_entry.144__func__.146_entry.147__func__.148_entry.149_entry.150_entry.151__func__.152_entry.153_entry.154__func__.155_entry.156_entry.157__func__.158_entry.159_entry.160__func__.161_entry.162_entry.163_entry.164_entry.165_entry.166__func__.167_entry.168_entry.169_entry.170_entry.171_entry.172_entry.173_entry.174_entry.175_entry.176_entry.177_entry.178_entry.179_entry.180_entry.181_entry.182_entry.183_entry.184_entry.185_entry.186_entry.187_entry.188_entry.189_entry.190_entry.191_entry.192_entry.193_entry.195_entry.196__func__.198_entry.199__func__.200_entry.201_entry.202_entry.203_entry.204_entry.213_entry.215_entry.216_entry.217_entry.218_entry.219_entry.221_entry.222_entry.223_entry.224_entry.225_entry.226__func__.228_entry.229__func__.230_entry.231_entry.232_entry.233_entry.234_entry.235_entry.236_entry.237_entry.238_entry.240_entry.241_entry.242_entry.244_entry.245_entry.246_entry.247_entry.249_entry.250_entry.251_entry.252_entry.254_entry.255_entry.256_entry.258_entry.259_entry.260_entry.261_entry.262__func__.264_entry.265_entry.266_entry.268__func__.270_entry.271_entry.272__func__.273_entry.274__func__.275_entry.276_entry.277__func__.278_entry.279_entry.280_entry.281_entry.282_entry.283_entry.284_entry.285_entry.286_entry.287_entry.289_entry.290_entry.292_entry.293_entry.294_entry.295_entry.297_entry.298__func__.300_entry.301_entry.302_entry.303_entry.304_entry.305_entry.306_entry.307_entry.308_entry.309_entry.310_entry.311_entry.312_entry.313_entry.314_entry.315_entry.316_entry.317_entry.319_entry.320_entry.321_entry.322_entry.323_entry.324_entry.325__func__.327_entry.328_entry.329_entry.330_entry.331_entry.332_entry.333_entry.334_entry.335_entry.336_entry.337_entry.338__func__.340_entry.341_entry.342_entry.343_entry.344_entry.345_entry.346_entry.347_entry.348_entry.349_entry.350_entry.351_entry.352_entry.353_entry.355_entry.356_entry.357_entry.358__func__.360_entry.361_entry.362_entry.363_entry.364_entry.365_entry.366_entry.367__func__.368_entry.369__func__.370_entry.371__func__.372_entry.373_entry.374_entry.376_entry.377_entry.378__func__.380_entry.381_entry.382__func__.383_entry.384__func__.385_entry.386_entry.388_entry.389_entry.390_entry.391_entry.392_entry.394_entry.396_entry.397_entry.398_entry.399_entry.400_entry.401_entry.402_entry.403_entry.404_entry.405_entry.407__func__.409_entry.410__func__.411_entry.412_entry.413_entry.414_entry.415__func__.416_entry.417_entry_ptr.418_entry_ptr.419_entry_ptr.420_entry_ptr.421_entry_ptr.422_entry_ptr.424_entry_ptr.425_entry_ptr.426_entry_ptr.427_entry_ptr.428_entry_ptr.429_entry_ptr.430_entry_ptr.431_entry_ptr.433_entry_ptr.434_entry_ptr.435_entry_ptr.436_entry_ptr.437_entry_ptr.438_entry_ptr.439_entry_ptr.440_entry_ptr.441_entry_ptr.442_entry_ptr.443_entry_ptr.444_entry_ptr.445_entry_ptr.446_entry_ptr.447_entry_ptr.448_entry_ptr.449_entry_ptr.450_entry_ptr.451_entry_ptr.452_entry_ptr.453_entry_ptr.454_entry_ptr.455_entry_ptr.456_entry_ptr.457_entry_ptr.458_entry_ptr.459_entry_ptr.460_entry_ptr.461_entry_ptr.462_entry_ptr.463_entry_ptr.464_entry_ptr.465_entry_ptr.466_entry_ptr.467_entry_ptr.468_entry_ptr.469_entry_ptr.470_entry_ptr.471_entry_ptr.472_entry_ptr.474_entry_ptr.475_entry_ptr.476_entry_ptr.477_entry_ptr.478_entry_ptr.479_entry_ptr.480_entry_ptr.481_entry_ptr.482_entry_ptr.483_entry_ptr.484_entry_ptr.485_entry_ptr.486_entry_ptr.487_entry_ptr.488_entry_ptr.489_entry_ptr.490_entry_ptr.491_entry_ptr.492_entry_ptr.493_entry_ptr.494_entry_ptr.496_entry_ptr.498_entry_ptr.499_entry_ptr.500_entry_ptr.502_entry_ptr.504_entry_ptr.505_entry_ptr.506_entry_ptr.507_entry_ptr.508_entry_ptr.509_entry_ptr.510_entry_ptr.511_entry_ptr.512_entry_ptr.513_entry_ptr.514_entry_ptr.515_entry_ptr.516_entry_ptr.517_entry_ptr.518_entry_ptr.519_entry_ptr.520_entry_ptr.521_entry_ptr.522_entry_ptr.523_entry_ptr.524_entry_ptr.525_entry_ptr.526_entry_ptr.527_entry_ptr.528_entry_ptr.529_entry_ptr.530_entry_ptr.531_entry_ptr.532_entry_ptr.533_entry_ptr.534_entry_ptr.535_entry_ptr.536_entry_ptr.537_entry_ptr.538_entry_ptr.539_entry_ptr.540_entry_ptr.541_entry_ptr.542_entry_ptr.543_entry_ptr.544_entry_ptr.545_entry_ptr.546_entry_ptr.547_entry_ptr.548_entry_ptr.549_entry_ptr.550_entry_ptr.551_entry_ptr.552_entry_ptr.553_entry_ptr.554_entry_ptr.555_entry_ptr.556_entry_ptr.557_entry_ptr.558_entry_ptr.559_entry_ptr.560_entry_ptr.561_entry_ptr.562_entry_ptr.563_entry_ptr.564_entry_ptr.565_entry_ptr.566_entry_ptr.567_entry_ptr.568_entry_ptr.569_entry_ptr.570_entry_ptr.571_entry_ptr.572_entry_ptr.573_entry_ptr.574_entry_ptr.575_entry_ptr.576_entry_ptr.577_entry_ptr.578_entry_ptr.579_entry_ptr.580_entry_ptr.581_entry_ptr.582_entry_ptr.583_entry_ptr.584_entry_ptr.585_entry_ptr.586_entry_ptr.587_entry_ptr.588_entry_ptr.589_entry_ptr.590_entry_ptr.591_entry_ptr.592_entry_ptr.593_entry_ptr.594_entry_ptr.595_entry_ptr.596_entry_ptr.597_entry_ptr.598_entry_ptr.599_entry_ptr.600_entry_ptr.601_entry_ptr.602_entry_ptr.603_entry_ptr.604_entry_ptr.605_entry_ptr.606_entry_ptr.608_entry_ptr.609_entry_ptr.610_entry_ptr.611_entry_ptr.612_entry_ptr.613_entry_ptr.614_entry_ptr.615_entry_ptr.616_entry_ptr.617_entry_ptr.618_entry_ptr.619_entry_ptr.620_entry_ptr.621_entry_ptr.622_entry_ptr.623_entry_ptr.624_entry_ptr.625_entry_ptr.626_entry_ptr.627_entry_ptr.628_entry_ptr.629_entry_ptr.631_entry_ptr.633_entry_ptr.634_entry_ptr.635_entry_ptr.636_entry_ptr.637_entry_ptr.638_entry_ptr.639_entry_ptr.640_entry_ptr.641_entry_ptr.642_entry_ptr.643_entry_ptr.644_entry_ptr.645_entry_ptr.646_entry_ptr.647_entry_ptr.648_entry_ptr.649_entry_ptr.650_entry_ptr.651_entry_ptr.652_entry_ptr.653_entry_ptr.654_entry_ptr.655_entry_ptr.656_entry_ptr.657_entry_ptr.658_entry_ptr.659_entry_ptr.660_entry_ptr.661_entry_ptr.662_entry_ptr.663_entry_ptr.664_entry_ptr.665_entry_ptr.666_entry_ptr.667_entry_ptr.668_entry_ptr.669_entry_ptr.670_entry_ptr.671_entry_ptr.672_entry_ptr.673_entry_ptr.674_entry_ptr.675_entry_ptr.676_entry_ptr.677_entry_ptr.678_entry_ptr.679_entry_ptr.680_entry_ptr.681_entry_ptr.682_entry_ptr.683_entry_ptr.684_entry_ptr.685_entry_ptr.686_entry_ptr.687_entry_ptr.688_entry_ptr.689_entry_ptr.690_entry_ptr.691_entry_ptr.692_entry_ptr.693_entry_ptr.694_entry_ptr.695_entry_ptr.696_entry_ptr.697_entry_ptr.698_entry_ptr.699_entry_ptr.700_entry_ptr.701_entry_ptr.702_entry_ptr.703_entry_ptr.704_entry_ptr.705_entry_ptr.706_entry_ptr.707_entry_ptr.708_entry_ptr.709_entry_ptr.710_entry_ptr.711_entry_ptr.712_entry_ptr.713_entry_ptr.714_entry_ptr.715_entry_ptr.717_entry_ptr.718_entry_ptr.719_entry_ptr.720_entry_ptr.721_entry_ptr.722_entry_ptr.723_entry_ptr.724_entry_ptr.725_entry_ptr.726_entry_ptr.727_entry_ptr.728_entry_ptr.729_entry_ptr.730_entry_ptr.731_entry_ptr.732_entry_ptr.733_entry_ptr.734_entry_ptr.735_entry_ptr.736_entry_ptr.737_entry_ptr.738_entry_ptr.739_entry_ptr.740_entry_ptr.741_entry_ptr.742_entry_ptr.743_entry_ptr.744_entry_ptr.745_entry_ptr.746_entry_ptr.747_entry_ptr.748_entry_ptr.749_entry_ptr.750_entry_ptr.751__param_mpt3sas_fwfault_debug__param_str_mpt3sas_fwfault_debug__param_ops_mpt3sas_fwfault_debug_entry_ptr.752_entry_ptr.753__UNIQUE_ID_poll_queues607__UNIQUE_ID_poll_queuestype606__param_poll_queues__param_str_poll_queues__UNIQUE_ID_perf_mode605__UNIQUE_ID_perf_modetype604__param_perf_mode__param_str_perf_mode__UNIQUE_ID_mpt3sas_fwfault_debug603__UNIQUE_ID_irqpoll_weight602__UNIQUE_ID_irqpoll_weighttype601__param_irqpoll_weight__param_str_irqpoll_weight__UNIQUE_ID_max_msix_vectors600__UNIQUE_ID_max_msix_vectorstype599__param_max_msix_vectors__param_str_max_msix_vectors__UNIQUE_ID_smp_affinity_enable598__UNIQUE_ID_smp_affinity_enabletype597__param_smp_affinity_enable__param_str_smp_affinity_enable__UNIQUE_ID_msix_disable596__UNIQUE_ID_msix_disabletype595__param_msix_disable__param_str_msix_disable__UNIQUE_ID_max_sgl_entries594__UNIQUE_ID_max_sgl_entriestype593__param_max_sgl_entries__param_str_max_sgl_entries__UNIQUE_ID_max_queue_depth592__UNIQUE_ID_max_queue_depthtype591__param_max_queue_depth__param_str_max_queue_depth_entry_ptr.754_entry_ptr.755_entry_ptr.756_entry_ptr.757.LC16.LC41.LC23mpt3sas_config.c_config_display_some_debug.cold__key.30_config_request.constprop.0.cold__func__.38__func__.32mpt3sas_config_update_driver_trigger_pg0.cold__func__.11mpt3sas_config_update_driver_trigger_pg1.coldmpt3sas_config_update_driver_trigger_pg2.coldmpt3sas_config_update_driver_trigger_pg3.cold__func__.5mpt3sas_config_update_driver_trigger_pg4.cold_entry.1__func__.15_entry.16__func__.20_entry.24__func__.25_entry.31_entry.33_entry.35_entry.37_entry.40_entry_ptr.42_entry_ptr.43_entry_ptr.44_entry_ptr.45_entry_ptr.46_entry_ptr.47_entry_ptr.48_entry_ptr.49_entry_ptr.50_entry_ptr.51_entry_ptr.53_entry_ptr.55_entry_ptr.57_entry_ptr.58_entry_ptr.60_entry_ptr.62_entry_ptr.63_entry_ptr.64_entry_ptr.65_entry_ptr.66_entry_ptr.67_entry_ptr.68_entry_ptr.69_entry_ptr.70_entry_ptr.71_entry_ptr.72_entry_ptr.73_entry_ptr.74_entry_ptr.75_entry_ptr.76mpt3sas_scsih.c_scsih_check_access_status.cold_scsih_check_pcie_access_status.cold_scsih_set_volume_delete_flag.cold_scsih_display_enclosure_chassis_info.cold_scsih_get_sas_address.cold__func__.553_scsih_display_sata_capabilities.cold__func__.862__key.452_scsih_nvme_shutdown.cold__func__.804_scsih_ir_shutdown.cold__func__.820_scsih_search_responding_raid_devices.coldscsih_scan_start.coldscsi_io_cb_idxtm_cb_idxbase_cb_idxport_enable_cb_idxtransport_cb_idxscsih_cb_idxconfig_cb_idxctl_cb_idxtm_tr_cb_idxtm_tr_volume_cb_idxtm_sas_control_cb_idxmpt2sas_raid_templatempt3sas_raid_templatempt3sas_driver_scsih_set_debug_level.cold_scsih_remove_device.cold__func__.431__func__.427_scsih_pcie_device_remove_from_sml.cold__func__.472_scsih_sas_volume_delete.coldmpt2sas_raid_functionsmpt3sas_raid_functionsmpt2_idsmpt3_ids_scsih_ir_fastpath.isra.0.cold__func__.649scsih_get_resync.cold__func__.887raid_device.883scsih_get_state.cold__func__.884__already_done.274scsih_qcmd.cold__func__.881scsih_pci_mmio_enabled.coldscsih_pci_resume.cold_scsih_raid_device_add.constprop.0.cold__func__.547scsih_suspend.coldscsih_pci_slot_reset.coldscsih_resume.cold__func__.845scsih_scan_finished.cold_scsih_determine_boot_device.part.0.cold__func__.549mpt3sas_driver_templatempt2sas_driver_template__key.828__key.829__key.830_scsih_probe.cold__func__.831_scsih_tm_tr_volume_send.cold__func__.783_scsih_get_volume_capabilities.cold__func__.858__func__.776_scsih_sas_volume_add.isra.0.cold__func__.544_scsih_tm_display_info.cold_scsih_tm_tr_send.cold__func__.766_scsih_tm_volume_tr_complete.cold__func__.892_scsih_tm_tr_complete.cold__func__.897CSWTCH.616CSWTCH.615_scsih_scsi_ioc_info.cold_scsih_pcie_add_device.isra.0.cold__func__.573__func__.584__func__.588mpt3sas_get_port_by_id.cold_scsih_sas_host_refresh.cold__func__.522_scsih_sas_host_add.cold__func__.606_scsih_expander_add.cold__func__.533__func__.865CSWTCH.590scsih_device_configure.cold__func__.851_scsih_add_device.isra.0.cold__func__.556__func__.567__func__.569__func__.531raid_device.492_scsih_flush_running_cmds.coldscsih_pci_error_detected.coldscsih_shutdown.coldCSWTCH.600__already_done.258_scsih_io_done.cold__func__.905mpt3sas_scsih_issue_tm.cold__func__.441mpt3sas_check_for_pending_internal_cmds.cold__func__.691_scsih_sas_control_complete.cold__func__.889scsih_remove.cold__func__.634__func__.641_firmware_event_work.coldCSWTCH.432CSWTCH.437__func__.642CSWTCH.434__func__.656CSWTCH.429CSWTCH.430__func__.659__func__.596CSWTCH.422CSWTCH.438CSWTCH.423__func__.663CSWTCH.425mpt3sas_scsih_pre_reset_handler.cold__func__.696mpt3sas_scsih_clear_outstanding_scsi_tm_commands.cold__func__.698mpt3sas_scsih_reset_done_handler.cold__func__.716__func__.713__func__.702__func__.721__func__.731__func__.704mpt3sas_scsih_event_callback.cold__func__.789__func__.751__func__.919_entry.918__func__.917_entry.916_entry.915_entry.914_entry.913_entry.912_entry.911_entry.910_entry.909_entry.908_entry.907_entry.906_entry.904_entry.903_entry.902_entry.901_entry.900_entry.899_entry.898_entry.896_entry.895_entry.894_entry.893_entry.891_entry.890_entry.888_entry.885_entry.882__func__.880_entry.879_entry.878_entry.877_entry.876_entry.875_entry.874__func__.873_entry.872_entry.871_entry.870__func__.869_entry.868_entry.867_entry.866_entry.864_entry.863_entry.861_entry.860_entry.859_entry.857_entry.856_entry.855_entry.854_entry.853_entry.852_entry.850_entry.849_entry.848_entry.847_entry.846__func__.844_entry.843_entry.842_entry.841_entry.840_entry.839_entry.838_entry.837_entry.836_entry.835_entry.834_entry.833_entry.832__func__.827_entry.826_entry.825_entry.824_entry.823_entry.822_entry.821__func__.819_entry.818__func__.817_entry.816__func__.815_entry.814_entry.813_entry.812__func__.811_entry.810_entry.809_entry.808_entry.807_entry.806_entry.805__func__.803_entry.802__func__.801_entry.800_entry.799__func__.798_entry.797_entry.796__func__.795_entry.794_entry.793_entry.792_entry.791_entry.790__func__.788_entry.787_entry.786_entry.785_entry.784__func__.782_entry.781__func__.780_entry.779__func__.778_entry.777_entry.775_entry.774_entry.773_entry.772_entry.771_entry.770_entry.769_entry.768_entry.767__func__.765_entry.764_entry.763_entry.762_entry.761_entry.760_entry.759_entry.758_entry.757_entry.756_entry.755_entry.754_entry.753_entry.752__func__.750_entry.749__func__.748_entry.747_entry.746_entry.745__func__.744_entry.743_entry.742__func__.741_entry.740_entry.739__func__.738_entry.737_entry.736_entry.735_entry.734_entry.733_entry.732__func__.730_entry.729_entry.728_entry.727_entry.726__func__.725_entry.724_entry.723_entry.722_entry.720_entry.719_entry.718_entry.717_entry.715_entry.714_entry.712_entry.711_entry.710_entry.709_entry.708_entry.707_entry.706_entry.705_entry.703__func__.701_entry.700_entry.699_entry.697_entry.695_entry.694_entry.693_entry.692__func__.690_entry.689__func__.688_entry.687_entry.686__func__.685_entry.684_entry.683_entry.682__func__.681_entry.680_entry.679_entry.678__func__.677_entry.676_entry.675_entry.674__func__.673_entry.672_entry.671_entry.670__func__.669_entry.668_entry.666_entry.665_entry.664_entry.662_entry.661_entry.660_entry.658_entry.657_entry.655_entry.654_entry.653_entry.652_entry.651_entry.650__func__.648_entry.647_entry.646__func__.645_entry.644_entry.643_entry.640_entry.639_entry.638_entry.637_entry.636_entry.635__func__.633_entry.632_entry.631__func__.630_entry.629_entry.628_entry.627__func__.626_entry.625_entry.624_entry.623__func__.622_entry.621_entry.620_entry.619_entry.618_entry.617_entry.616_entry.615_entry.614_entry.613_entry.612_entry.611_entry.610_entry.609_entry.608_entry.607__func__.605_entry.604_entry.603_entry.602__func__.601_entry.600_entry.599_entry.598_entry.597__func__.595_entry.594_entry.593_entry.592_entry.591_entry.590_entry.589_entry.587_entry.586_entry.585__func__.583_entry.582_entry.581_entry.580_entry.579_entry.578_entry.577_entry.576_entry.575_entry.574__func__.572_entry.571_entry.570_entry.568__func__.566_entry.565_entry.564_entry.563_entry.562_entry.561_entry.560_entry.559_entry.558_entry.557_entry.555_entry.554_entry.552_entry.551_entry.550_entry.548_entry.546_entry.545_entry.543_entry.542_entry.541_entry.540_entry.539_entry.538_entry.537_entry.536_entry.535_entry.534_entry.532__func__.530_entry.529_entry.528_entry.527_entry.526_entry.525_entry.524_entry.523__func__.521_entry.520_entry.519_entry.518_entry.517_entry.516_entry.515_entry.514_entry.513_entry.512_entry.511_entry.510_entry.509_entry.508_entry.507_entry.506_entry.505_entry.504_entry.503_entry.502_entry.501_entry.500_entry.499_entry.498_entry.497_entry.496_entry.495_entry.494_entry.493__func__.491_entry.490__func__.489_entry.488__func__.487_entry.486__func__.485_entry.484__func__.483_entry.482_entry.481_entry.480_entry.479_entry.478_entry.477_entry.476_entry.475_entry.474_entry.473__func__.471_entry.470_entry.469_entry.468_entry.467_entry.466_entry.465__func__.464_entry.463__func__.461_entry.460__func__.459_entry.458_entry.457_entry.456_entry.455__func__.454_entry.453_entry.451_entry.450_entry.449_entry.448_entry.447_entry.446_entry.445_entry.444_entry.443_entry.442__func__.440_entry.439_entry.438_entry.437_entry.436_entry.435_entry.434_entry.433_entry.432_entry.430_entry.429_entry.428__func__.426_entry.425__func__.424_entry.423__UNIQUE_ID___addressable_cleanup_module622__UNIQUE_ID___addressable_init_module621_entry_ptr.0_entry_ptr.1_mpt3sas_err_handlerscsih_pm_ops_entry_ptr.2_entry_ptr.3_entry_ptr.4_entry_ptr.5_entry_ptr.6_entry_ptr.7_entry_ptr.8_entry_ptr.9_entry_ptr.10_entry_ptr.11_entry_ptr.12_entry_ptr.13_entry_ptr.14_entry_ptr.15_entry_ptr.16_entry_ptr.17_entry_ptr.18_entry_ptr.19_entry_ptr.20_entry_ptr.21_entry_ptr.22_entry_ptr.23_entry_ptr.24_entry_ptr.25_entry_ptr.26_entry_ptr.27_entry_ptr.28_entry_ptr.29_entry_ptr.30_entry_ptr.31_entry_ptr.32_entry_ptr.33_entry_ptr.34_entry_ptr.35_entry_ptr.36_entry_ptr.37_entry_ptr.38_entry_ptr.39_entry_ptr.40_entry_ptr.41_entry_ptr.52_entry_ptr.54_entry_ptr.56_entry_ptr.59_entry_ptr.61_entry_ptr.77_entry_ptr.78_entry_ptr.79_entry_ptr.80_entry_ptr.81_entry_ptr.82_entry_ptr.83_entry_ptr.84_entry_ptr.85_entry_ptr.86_entry_ptr.87_entry_ptr.88_entry_ptr.89_entry_ptr.90_entry_ptr.91_entry_ptr.92_entry_ptr.93_entry_ptr.94_entry_ptr.95_entry_ptr.96_entry_ptr.97_entry_ptr.98_entry_ptr.99_entry_ptr.100_entry_ptr.101_entry_ptr.102_entry_ptr.103_entry_ptr.104_entry_ptr.105_entry_ptr.107_entry_ptr.108_entry_ptr.109_entry_ptr.110_entry_ptr.111_entry_ptr.112_entry_ptr.114_entry_ptr.115_entry_ptr.116_entry_ptr.117_entry_ptr.118_entry_ptr.119_entry_ptr.120_entry_ptr.121_entry_ptr.122_entry_ptr.123_entry_ptr.124_entry_ptr.125_entry_ptr.126_entry_ptr.127_entry_ptr.128_entry_ptr.129_entry_ptr.130_entry_ptr.131_entry_ptr.132_entry_ptr.133_entry_ptr.134_entry_ptr.135_entry_ptr.136_entry_ptr.137_entry_ptr.138_entry_ptr.139_entry_ptr.140_entry_ptr.141_entry_ptr.142_entry_ptr.143_entry_ptr.144_entry_ptr.145_entry_ptr.146_entry_ptr.147_entry_ptr.148_entry_ptr.149_entry_ptr.150_entry_ptr.151_entry_ptr.152_entry_ptr.153_entry_ptr.154_entry_ptr.155_entry_ptr.156_entry_ptr.157_entry_ptr.158_entry_ptr.159_entry_ptr.160_entry_ptr.161_entry_ptr.162_entry_ptr.164_entry_ptr.165_entry_ptr.166_entry_ptr.167_entry_ptr.168_entry_ptr.169_entry_ptr.170_entry_ptr.172_entry_ptr.173_entry_ptr.174_entry_ptr.175_entry_ptr.176_entry_ptr.177_entry_ptr.178_entry_ptr.179_entry_ptr.180_entry_ptr.181_entry_ptr.182_entry_ptr.183_entry_ptr.184_entry_ptr.185_entry_ptr.186_entry_ptr.187_entry_ptr.188_entry_ptr.189_entry_ptr.190_entry_ptr.191_entry_ptr.192_entry_ptr.193_entry_ptr.194_entry_ptr.195_entry_ptr.196_entry_ptr.197_entry_ptr.199_entry_ptr.200_entry_ptr.201_entry_ptr.202_entry_ptr.203_entry_ptr.204_entry_ptr.205_entry_ptr.206_entry_ptr.208_entry_ptr.209_entry_ptr.211_entry_ptr.212_entry_ptr.213_entry_ptr.214_entry_ptr.215_entry_ptr.216_entry_ptr.217_entry_ptr.218_entry_ptr.219_entry_ptr.220_entry_ptr.221_entry_ptr.222_entry_ptr.223_entry_ptr.224_entry_ptr.225_entry_ptr.226_entry_ptr.227_entry_ptr.228_entry_ptr.229_entry_ptr.230_entry_ptr.231_entry_ptr.232_entry_ptr.233_entry_ptr.234_entry_ptr.235_entry_ptr.236_entry_ptr.237_entry_ptr.238_entry_ptr.239_entry_ptr.240_entry_ptr.241_entry_ptr.242_entry_ptr.243_entry_ptr.244_entry_ptr.245_entry_ptr.246_entry_ptr.247_entry_ptr.248_entry_ptr.249_entry_ptr.250_entry_ptr.251_entry_ptr.252_entry_ptr.253_entry_ptr.254_entry_ptr.255_entry_ptr.256_entry_ptr.259_entry_ptr.260_entry_ptr.261_entry_ptr.262_entry_ptr.263_entry_ptr.264_entry_ptr.265_entry_ptr.266_entry_ptr.267_entry_ptr.268_entry_ptr.269_entry_ptr.270_entry_ptr.271_entry_ptr.272_entry_ptr.273_entry_ptr.275_entry_ptr.276_entry_ptr.277_entry_ptr.278_entry_ptr.279_entry_ptr.280_entry_ptr.281_entry_ptr.282_entry_ptr.283_entry_ptr.284_entry_ptr.285_entry_ptr.286_entry_ptr.287_entry_ptr.288_entry_ptr.289_entry_ptr.290_entry_ptr.291_entry_ptr.292_entry_ptr.293_entry_ptr.294_entry_ptr.295_entry_ptr.296_entry_ptr.297_entry_ptr.298_entry_ptr.299_entry_ptr.300_entry_ptr.301_entry_ptr.302_entry_ptr.303_entry_ptr.304_entry_ptr.305_entry_ptr.306_entry_ptr.307_entry_ptr.308_entry_ptr.309_entry_ptr.310_entry_ptr.311_entry_ptr.312_entry_ptr.313_entry_ptr.314_entry_ptr.316_entry_ptr.317_entry_ptr.318_entry_ptr.319_entry_ptr.320_entry_ptr.321_entry_ptr.322_entry_ptr.323_entry_ptr.324_entry_ptr.325_entry_ptr.326_entry_ptr.327_entry_ptr.328_entry_ptr.329_entry_ptr.330_entry_ptr.331_entry_ptr.332_entry_ptr.333_entry_ptr.334_entry_ptr.335_entry_ptr.336_entry_ptr.337_entry_ptr.338_entry_ptr.340_entry_ptr.341_entry_ptr.342_entry_ptr.343_entry_ptr.344_entry_ptr.345_entry_ptr.346_entry_ptr.347_entry_ptr.348_entry_ptr.349_entry_ptr.350_entry_ptr.351_entry_ptr.352_entry_ptr.353_entry_ptr.354_entry_ptr.355_entry_ptr.356_entry_ptr.357_entry_ptr.358_entry_ptr.359_entry_ptr.360_entry_ptr.361_entry_ptr.362_entry_ptr.363_entry_ptr.364_entry_ptr.365_entry_ptr.366_entry_ptr.367_entry_ptr.368_entry_ptr.369_entry_ptr.370_entry_ptr.371_entry_ptr.372_entry_ptr.373_entry_ptr.374_entry_ptr.375_entry_ptr.376_entry_ptr.377_entry_ptr.378__param_logging_level__param_str_logging_level__param_ops_logging_level_entry_ptr.379__UNIQUE_ID_host_tagset_enable616__UNIQUE_ID_host_tagset_enabletype615__param_host_tagset_enable__param_str_host_tagset_enable__UNIQUE_ID_multipath_on_hba614__UNIQUE_ID_multipath_on_hbatype613__param_multipath_on_hba__param_str_multipath_on_hba__UNIQUE_ID_enable_sdev_max_qd612__UNIQUE_ID_enable_sdev_max_qdtype611__param_enable_sdev_max_qd__param_str_enable_sdev_max_qd__UNIQUE_ID_prot_mask610__UNIQUE_ID_prot_masktype609__param_prot_mask__param_str_prot_mask__UNIQUE_ID_disable_discovery608__UNIQUE_ID_disable_discoverytype607__param_disable_discovery__param_str_disable_discovery__UNIQUE_ID_diag_buffer_enable606__UNIQUE_ID_diag_buffer_enabletype605__param_diag_buffer_enable__param_str_diag_buffer_enable__UNIQUE_ID_hbas_to_enumerate604__UNIQUE_ID_hbas_to_enumeratetype603__param_hbas_to_enumerate__param_str_hbas_to_enumerate__UNIQUE_ID_max_lun602__UNIQUE_ID_max_luntype601__param_max_lun__param_str_max_lun__UNIQUE_ID_missing_delay600__UNIQUE_ID_missing_delaytype599__param_missing_delay__param_str_missing_delay__param_arr_missing_delay__UNIQUE_ID_max_sectors598__UNIQUE_ID_max_sectorstype597__param_max_sectors__param_str_max_sectors__UNIQUE_ID_logging_level596__UNIQUE_ID_alias595__UNIQUE_ID_version594__UNIQUE_ID_license593__UNIQUE_ID_description592__UNIQUE_ID_author591_entry_ptr.388_entry_ptr.389_entry_ptr.390_entry_ptr.391.LC206.LC205.LC207.LC208.LC204.LC49.LC119mpt3sas_transport.c_transport_set_identify.cold__func__.87__key.73_transport_expander_phy_control.coldmpt3sas_transport_del_phy_from_an_existing_port.part.0.cold_transport_get_linkerrors.cold__func__.10__func__.13_transport_phy_reset.coldCSWTCH.51_transport_phy_speed.cold_transport_phy_enable.cold_transport_smp_handler.cold__func__.49mpt3sas_transport_add_phy_to_an_existing_port.coldmpt3sas_transport_port_add.cold__func__.102__func__.83mpt3sas_transport_port_remove.cold__func__.67mpt3sas_transport_add_host_phy.cold__func__.61mpt3sas_transport_add_expander_phy.cold__func__.56mpt3sas_transport_update_links.cold_entry.2_entry.8_entry.14_entry.39_entry.45__func__.50__func__.68_entry.91__func__.103__func__.105__func__.107_entry_ptr.113_entry_ptr.163_entry_ptr.171_entry_ptr.198mpt3sas_ctl.chost_trace_buffer_show.cold__func__.133host_trace_buffer_size_show.cold__func__.130__key.152__already_done.300_ctl_diag_register_2.cold__func__.171BRM_status_show.coldfwfault_debug_store.coldlogging_level_store.coldasync_queue_ctl_getiocinfo.cold__func__.115_ctl_eventreport.cold__func__.69_ctl_diag_register.cold__func__.57_ctl_diag_query.cold__func__.46_ctl_addnl_diag_query.coldctl_poll_wait_ctl_display_some_debug.part.0.cold__func__.110__already_done.341_ctl_do_mpt_command.cold__func__.86_ctl_compat_mpt_command.coldmpt3sas_ctl_clear_outstanding_ioctls.cold__func__.183mpt3sas_ctl_reset_done_handler.cold__func__.181mpt3sas_enable_diag_buffer.coldmpt3sas_send_diag_release.cold__func__.151mpt3sas_ctl_pre_reset_handler.cold__func__.186host_trace_buffer_enable_store.cold__func__.28_ctl_ioctl_main.cold__func__.65__func__.55__func__.77__func__.119__func__.73gen2_ctl_dev__key.123mpt3sas_ctl_init.cold__func__.78_entry.113_entry.118__func__.126__func__.134_entry.135_entry.141_entry.145_entry.146_entry.148_entry.155_entry.158_entry.161_entry.167__func__.172__func__.187_entry.194ctl_gen2_fopsctl_fopsmpt3sas_dev_attr_groupmpt3sas_dev_attrsdev_attr_sas_addressdev_attr_sas_device_handledev_attr_sas_ncq_prio_supporteddev_attr_sas_ncq_prio_enablempt3sas_host_attr_groupmpt3sas_host_attrsdev_attr_version_fwdev_attr_version_biosdev_attr_version_mpidev_attr_version_productdev_attr_version_nvdata_persistentdev_attr_version_nvdata_defaultdev_attr_board_namedev_attr_board_assemblydev_attr_board_tracerdev_attr_io_delaydev_attr_device_delaydev_attr_logging_leveldev_attr_fwfault_debugdev_attr_fw_queue_depthdev_attr_host_sas_addressdev_attr_ioc_reset_countdev_attr_host_trace_buffer_sizedev_attr_host_trace_bufferdev_attr_host_trace_buffer_enabledev_attr_reply_queue_countdev_attr_diag_trigger_masterdev_attr_diag_trigger_eventdev_attr_diag_trigger_scsidev_attr_diag_trigger_mpidev_attr_drv_support_bitmapdev_attr_BRM_statusdev_attr_enable_sdev_max_qd_entry_ptr.210_entry_ptr.257_entry_ptr.258_entry_ptr.274_entry_ptr.315_entry_ptr.339_entry_ptr.380.LC52.LC51.LC29.LC98mpt3sas_trigger_diag.c_mpt3sas_raise_sigio.cold__func__.21mpt3sas_process_trigger_data.cold__func__.26mpt3sas_trigger_master.coldmpt3sas_trigger_event.cold__func__.12mpt3sas_trigger_scsi.cold__func__.7mpt3sas_trigger_mpi.cold__func__.3mpt3sas_warpdrive.cmpt3sas_init_warpdrive_properties.cold__func__.0mpt3sas_debugfs.cmpt3sas_debugfs_rootmpt3sas_init_debugfs.coldmpt3sas_debugfs_iocdump_fopsmpt3sas_setup_debugfs.cold__pfx__base_readl_aero__pfx__base_readl_ext_retry__pfx__base_readl__pfx__base_build_zero_len_sge__pfx__base_add_sg_single_32__pfx__base_add_sg_single_64__pfx__base_build_zero_len_sge_ieee__pfx__base_put_smid_hi_priority_atomic__pfx_mpt3sas_remove_dead_ioc_func__pfx__base_wait_for_doorbell_int__pfx__base_wait_on_iocstate__pfx_kzalloc_noprof__pfx__base_config_dma_addressing__pfx__base_init_irqpolls__pfx_mpt3sas_atto_get_sas_addr__pfx__base_assign_fw_reported_qd__pfx__base_get_event_diag_triggers__pfx__base_get_scsi_diag_triggers__pfx__base_get_mpi_diag_triggers__pfx__base_check_for_trigger_pages_support__pfx__base_release_memory_pools__pfx__base_build_sg__pfx__base_build_sg_ieee__pfx__scsih_set_fwfault_debug__pfx__base_get_msix_index__pfx__base_build_nvme_prp__pfx_kmalloc_array_noprof.constprop.0__pfx__clone_sg_entries__pfx__base_put_smid_hi_priority__pfx__base_set_and_get_msix_index__pfx__base_put_smid_scsi_io__pfx__base_put_smid_fast_path__pfx__base_put_smid_fast_path_atomic__pfx__base_put_smid_scsi_io_atomic__pfx__base_put_smid_default_atomic__pfx__base_put_smid_mpi_ep_scsi_io__pfx__base_put_smid_default__pfx__base_get_high_iops_msix_index__pfx__base_build_sg_scmd_ieee__pfx__base_get_cb_idx__pfx__base_build_sg_scmd__pfx__base_wait_for_doorbell_ack__pfx__base_handshake_req_reply_wait__pfx__base_get_port_facts__pfx__base_send_ioc_init__pfx_mpt3sas_base_unmap_resources__pfx__base_clear_outstanding_mpt_commands__pfx__base_process_reply_queue__pfx__base_interrupt__pfx__base_irqpoll__pfx__base_event_notification__pfx__base_make_ioc_operational__pfx__base_get_ioc_facts__pfx__base_fault_reset_work__pfx__config_display_some_debug__pfx__config_request.constprop.0__pfx_mpt3sas_config_update_driver_trigger_pg0__pfx_scsih_is_raid__pfx_scsih_bios_param__pfx__scsih_check_access_status__pfx__scsih_check_pcie_access_status__pfx__scsih_set_volume_delete_flag__pfx___list_add__pfx__scsih_display_enclosure_chassis_info__pfx_sas_device_free__pfx_pcie_device_free__pfx__scsih_get_sas_address__pfx__scsih_display_sata_capabilities__pfx__scsih_nvme_shutdown__pfx__scsih_ir_shutdown__pfx__scsih_reprobe_lun__pfx__scsih_add_or_del_phys_from_existing_port__pfx__scsih_search_responding_raid_devices__pfx__scsih_done__pfx__scsih_tm_done__pfx_scsih_map_queues__pfx_scsih_scan_start__pfx__scsih_set_debug_level__pfx__scsih_internal_device_unblock__pfx__scsih_ublock_io_device__pfx__scsih_remove_device__pfx__scsih_pcie_device_remove_from_sml__pfx__scsih_ublock_io_all_device__pfx__scsih_internal_device_block__pfx__scsih_sas_volume_delete__pfx__scsih_ir_fastpath.isra.0__pfx__scsih_set_satl_pending.isra.0__pfx_scsih_get_resync__pfx_scsih_get_state__pfx_scsih_qcmd__pfx_scsih_pci_mmio_enabled__pfx_scsih_pci_resume__pfx__scsih_raid_device_add.constprop.0__pfx_scsih_suspend__pfx_scsih_pci_slot_reset__pfx_scsih_resume__pfx_scsih_scan_finished__pfx__scsih_fw_event_cleanup_queue__pfx__scsih_determine_boot_device.part.0__pfx__scsih_probe__pfx__scsih_tm_tr_volume_send__pfx__scsih_get_volume_capabilities__pfx___mpt3sas_get_sdev_by_handle__pfx__scsih_device_remove_by_handle.part.0__pfx__scsih_block_io_device__pfx___mpt3sas_get_pdev_by_handle__pfx___mpt3sas_get_pdev_by_wwid__pfx__scsih_fw_event_add.part.0__pfx__scsih_sas_volume_add.isra.0__pfx__scsih_tm_display_info__pfx_scsih_change_queue_depth__pfx__scsih_tm_tr_send__pfx__scsih_check_for_pending_tm__pfx__scsih_tm_volume_tr_complete__pfx__scsih_tm_tr_complete__pfx_scsih_slave_destroy__pfx__scsih_scsi_ioc_info__pfx_scsih_target_destroy__pfx__scsih_pcie_add_device.isra.0__pfx__scsih_alloc_vphy__pfx__scsih_sas_host_refresh__pfx__scsih_sas_host_add__pfx__scsih_expander_add__pfx_scsih_target_alloc__pfx_scsih_slave_alloc__pfx_mpt3sas_device_remove_by_sas_address.part.0__pfx__scsih_expander_node_remove__pfx__scsih_block_io_to_children_attached_to_ex__pfx_scsih_device_configure__pfx__scsih_add_device.isra.0__pfx_scsih_tm_cmd_map_status__pfx__scsih_flush_running_cmds__pfx_scsih_pci_error_detected__pfx_scsih_shutdown__pfx__scsih_io_done__pfx_scsih_dev_reset__pfx_scsih_abort__pfx__scsih_sas_control_complete__pfx_scsih_remove__pfx__firmware_event_work__pfx__transport_set_identify__pfx__transport_expander_phy_control__pfx_mpt3sas_transport_del_phy_from_an_existing_port.part.0__pfx__transport_get_bay_identifier__pfx__transport_get_enclosure_identifier__pfx__transport_get_linkerrors__pfx__transport_phy_reset__pfx__transport_phy_speed__pfx__transport_phy_enable__pfx__transport_smp_handler__pfx__ctl_diag_capability__pfx_diag_trigger_mpi_show__pfx_diag_trigger_scsi_show__pfx_diag_trigger_event_show__pfx_diag_trigger_master_show__pfx_enable_sdev_max_qd_show__pfx_drv_support_bitmap_show__pfx_reply_queue_count_show__pfx_ioc_reset_count_show__pfx_host_sas_address_show__pfx_fw_queue_depth_show__pfx_fwfault_debug_show__pfx_logging_level_show__pfx_device_delay_show__pfx_io_delay_show__pfx_board_tracer_show__pfx_board_assembly_show__pfx_board_name_show__pfx_version_nvdata_default_show__pfx_version_nvdata_persistent_show__pfx_version_product_show__pfx_version_mpi_show__pfx_version_bios_show__pfx_version_fw_show__pfx_sas_ncq_prio_enable_show__pfx_sas_device_handle_show__pfx_sas_address_show__pfx_host_trace_buffer_show__pfx_host_trace_buffer_size_show__pfx__ctl_diag_register_2__pfx_enable_sdev_max_qd_store__pfx_BRM_status_show__pfx_host_trace_buffer_store__pfx_fwfault_debug_store__pfx_logging_level_store__pfx_sas_ncq_prio_enable_store__pfx_sas_ncq_prio_supported_show__pfx__ctl_fasync__pfx__ctl_getiocinfo__pfx__ctl_eventreport__pfx__ctl_diag_register__pfx__ctl_diag_query__pfx__ctl_addnl_diag_query__pfx_host_trace_buffer_enable_show__pfx__ctl_poll__pfx__ctl_display_some_debug.part.0__pfx__ctl_do_mpt_command__pfx__ctl_compat_mpt_command__pfx_diag_trigger_mpi_store__pfx_diag_trigger_scsi_store__pfx_diag_trigger_event_store__pfx_diag_trigger_master_store__pfx_host_trace_buffer_enable_store__pfx__ctl_ioctl_main__pfx__ctl_mpt2_ioctl_compat__pfx__ctl_mpt2_ioctl__pfx__ctl_ioctl_compat__pfx__ctl_ioctl__pfx__mpt3sas_raise_sigio__pfx__warpdrive_disable_ddio__pfx__debugfs_iocdump_release__pfx__debugfs_iocdump_read__pfx__debugfs_iocdump_open__pfx__debug_dump_mf__pfx__base_dump_reg_set__pfx__base_request_irq__pfx__base_unmask_events.part.0__pfx_base_alloc_rdpq_dma_pool__pfx_mpt3sas_halt_firmware.part.0__pfx__base_diag_reset__pfx__debug_dump_reply__pfx__debug_dump_config__pfx__scsih_set_nvme_max_shutdown_latency__pfx__scsih_response_code__pfx_scsih_host_reset__pfx_scsih_exit__pfx___refcount_add.constprop.0__pfx___list_del_entry__pfx_list_move_tail__pfx_kref_put.isra.0__pfx__scsih_pcie_device_remove.part.0__pfx__scsih_sas_device_remove.part.0__pfx_pcie_device_make_active__pfx__scsih_probe_sas.part.0__pfx__scsih_raid_device_remove__pfx__scsih_probe_raid__pfx__scsih_complete_devices_scanning__pfx__scsih_scan_for_devices_after_reset__pfx_scsih_target_reset__pfx__debug_dump_mf.constprop.0__pfx__mpt3sas_exit__pfx__mpt3sas_initmpt3sas.mod.c__UNIQUE_ID_srcversion525__UNIQUE_ID_alias524__UNIQUE_ID_alias523__UNIQUE_ID_alias522__UNIQUE_ID_alias521__UNIQUE_ID_alias520__UNIQUE_ID_alias519__UNIQUE_ID_alias518__UNIQUE_ID_alias517__UNIQUE_ID_alias516__UNIQUE_ID_alias515__UNIQUE_ID_alias514__UNIQUE_ID_alias513__UNIQUE_ID_alias512__UNIQUE_ID_alias511__UNIQUE_ID_alias510__UNIQUE_ID_alias509__UNIQUE_ID_alias508__UNIQUE_ID_alias507__UNIQUE_ID_alias506__UNIQUE_ID_alias505__UNIQUE_ID_alias504__UNIQUE_ID_alias503__UNIQUE_ID_alias502__UNIQUE_ID_alias501__UNIQUE_ID_alias500__UNIQUE_ID_alias499__UNIQUE_ID_alias498__UNIQUE_ID_alias497__UNIQUE_ID_alias496__UNIQUE_ID_alias495__UNIQUE_ID_alias494__UNIQUE_ID_alias493__UNIQUE_ID_alias492__UNIQUE_ID_alias491__UNIQUE_ID_alias490__UNIQUE_ID_alias489__UNIQUE_ID_alias488__UNIQUE_ID_alias487__UNIQUE_ID_alias486__UNIQUE_ID_alias485__UNIQUE_ID_alias484__UNIQUE_ID_alias483__UNIQUE_ID_alias482__UNIQUE_ID_alias481__UNIQUE_ID_alias480__UNIQUE_ID_alias479__UNIQUE_ID_alias478__UNIQUE_ID_alias477__UNIQUE_ID_alias476__UNIQUE_ID_alias475__UNIQUE_ID_alias474__UNIQUE_ID_alias473__UNIQUE_ID_depends472__UNIQUE_ID_intree471__UNIQUE_ID_name470module-common.c__UNIQUE_ID_retpoline471__UNIQUE_ID_vermagic470_note_19_note_18orc_headerscsi_dma_mapparam_ops_ullongpci_save_state__pfx_mpt3sas_base_mask_interrupts__pfx_mpt3sas_base_wait_for_coredump_completion__pfx_mpt3sas_transport_port_add__pfx_mpt3sas_config_get_iounit_pg0pcie_capability_read_word__pfx_mpt3sas_config_get_manufacturing_pg10__check_object_size__pfx_mpt3sas_base_get_iocstatereset_devicesmpt3sas_transport_template__pfx_mpt3sas_ctl_clear_outstanding_ioctlssas_enable_tlr__pfx_mpt3sas_base_get_pcie_sglmisc_deregister__list_add_valid_or_reportalloc_workqueue__pfx_mpt3sas_base_lock_host_diagnosticpci_cfg_access_unlock__pfx_mpt3sas_base_clear_st__pfx_mpt3sas_config_get_sas_iounit_pg1dma_pool_create__pfx_mpt3sas_transport_add_host_phy_copy_from_userpci_request_selected_regionspci_release_selected_regionswait_for_completion_timeout__num_online_cpus__kmalloc_noprof__pfx_mpt3sas_halt_firmwarepci_enable_device_mem__pfx_mpt3sas_get_vphy_by_phybsg_job_doneparam_ops_ushort__this_modulepci_alloc_irq_vectors__pfx_mpt3sas_base_sync_reply_irqssnprintfqueue_work_on__pfx_mpt3sas_config_get_raid_volume_pg0__pfx_mpt3sas_base_update_missing_delay__pfx_mpt3sas_config_get_enclosure_pg0_find_first_bit__pfx_mpt3sas_trigger_event__pfx_mpt3sas_wait_for_commands_to_complete__pfx_mpt3sas_base_detach__pfx_mpt3sas_config_get_pcie_iounit_pg1__init_swait_queue_head__pfx_mpt3sas_scsih_scsi_lookup_getfinish_waitscsi_build_sense__pfx_mpt3sas_device_remove_by_sas_addresskill_fasync__pfx_mpt3sas_process_trigger_data__pfx_mpt3sas_transport_port_remove__pfx_mpt3sas_config_get_phy_pg0__pci_register_driver__pfx_mpt3sas_base_put_smid_nvme_encap__pfx_mpt3sas_base_map_resources__pfx_mpt3sas_base_release_callback_handler__pfx_mpt3sas_transport_update_links__pfx_mpt3sas_config_get_driver_trigger_pg2iounmap__stop_alloc_tags__pfx_mpt3sas_config_set_iounit_pg1__pfx_mpt3sas_enable_diag_bufferparam_array_opssas_port_alloc_nummemcpyscsi_dma_unmapkfree__pfx_mpt3sas_scsih_issue_locked_tmenable_irqscsi_internal_device_unblock_nowaitpcpu_hot__pfx_mpt3sas_config_get_driver_trigger_pg3int_to_scsilun__pfx_mpt3sas_send_trigger_data_event__pfx_mpt3sas_base_start_watchdogusleep_range_stateprepare_to_wait_event__pfx_mpt3sas_base_fault_info__pfx_mpt3sas_scsih_clear_tm_flag__wake_up__pfx_mpt3sas_scsih_issue_tmpci_irq_vector__scsi_iterate_devicessas_remove_host_raw_spin_lock_irqsave__pfx_mpt3sas_ctl_pre_reset_handler__pfx_mpt3sas_scsih_change_queue_depth_raw_spin_lock__pfx_mpt3sas_config_get_ioc_pg1irq_poll_complete__pfx_mpt3sas_scsih_expander_find_by_sas_addresspci_unregister_driver__pfx_mpt3sas_base_disable_msix__pfx_mpt3sas_setup_direct_io__pfx_mpt3sas_transport_add_phy_to_an_existing_portpci_cfg_access_lock__pfx_mpt3sas_base_check_for_fault_and_issue_reset__fentry__sysfs_emit__pfx_mpt3sas_ctl_reset_done_handler__pfx_mpt3sas_config_set_bios_pg4wake_up_processsas_phy_allocdma_pool_alloc__pfx_mpt3sas_config_get_bios_pg2scsi_device_set_state__pfx_mpt3sas_config_update_driver_trigger_pg1__pfx_mpt3sas_get_pdev_by_handle__pfx_mpt3sas_wait_for_ioc__start_alloc_tags__pfx_mpt3sas_config_get_sas_iounit_pg0__x86_indirect_thunk_r11__x86_indirect_thunk_rax__pfx_mpt3sas_base_get_smid_scsiioblk_mq_pci_map_queuesdump_stack__pfx_mpt3sas_config_set_manufacturing_pg11__pfx_mpt3sas_config_get_sas_device_pg1mpt3sas_host_groupsdevice_reprobeschedule_timeoutstarget_for_each_device__pfx_mpt3sas_config_get_bios_pg3__pfx_mpt3sas_config_get_manufacturing_pg1__pfx_mpt3sas_config_get_manufacturing_pg7__stack_chk_failrefcount_warn_saturatequeue_delayed_work_on__pfx_mpt3sas_base_get_smid__pfx_mpt3sas_base_unmask_interrupts__kmalloc_large_noprof__pfx_mpt3sas_base_register_callback_handler__pfx_mpt3sas_send_diag_release__pfx_mpt3sas_base_pause_mq_polling__pfx_mpt3sas_setup_debugfsstrnlen__pfx_mpt3sas_base_get_smid_hprscsi_add_device__pfx_mpt3sas_transport_del_phy_from_an_existing_port__pfx_mpt3sas_config_get_number_pdspci_disable_link_state_dev_infosas_phy_free__pfx_mpt3sas_config_get_ioc_pg8__pfx_mpt3sas_base_attachpci_select_bars__pfx_mpt3sas_base_get_pcie_sgl_dmapage_offset_base__pfx_mpt3sas_transport_add_expander_phy__pfx_mpt3sas_config_get_expander_pg0__pfx_mpt3sas_base_validate_event_typeattribute_container_find_class_devicepci_find_capability__pfx_mpt3sas_base_done__pfx___mpt3sas_get_sdev_by_addrsynchronize_irq__pfx_mpt3sas_config_get_pcie_device_pg0__pfx_mpt3sas_base_scsi_enclosure_processor__pfx_mpt3sas_config_get_iounit_pg1__pfx_mpt3sas_config_update_driver_trigger_pg3init_wait_entry__mod_device_table__pci__mpt3sas_pci_table__irq_apply_affinity_hint__pfx_init_module_dev_err__pfx_mpt3sas_ctl_donescsi_host_put__pfx_mpt3sas_config_get_iounit_pg3__pfx_mpt3sas_trigger_master__pfx_mpt3sas_config_get_sas_device_pg0raid_class_attachkstrtointrequest_threaded_irqdma_pool_free_find_next_and_bit__pfx_mpt3sas_config_get_raid_volume_pg1mpt3sas_ioc_listmpt3sas_dev_groups__pfx_mpt3sas_raid_device_find_by_handle__pfx_mpt3sas_get_port_by_idsas_port_adddestroy_workqueue__pfx_mpt3sas_base_coredump_infomutex_lockpci_device_is_presentsdev_prefix_printkdma_alloc_attrsscsi_scan_host__pfx_mpt3sas_transport_donedebugfs_removepci_read_config_wordfasync_helper__pfx_mpt3sas_base_get_reply_virt_addr__pfx_mpt3sas_base_make_ioc_ready__pfx_mpt3sas_trigger_mpi__list_del_entry_valid_or_reportioremap__pfx_mpt3sas_scsih_expander_find_by_handle_find_next_bit__cpu_online_mask__pfx_mpt3sas_ctl_add_to_event_log__pfx_mpt3sas_scsih_clear_outstanding_scsi_tm_commandssscanf__mutex_initsas_end_device_allocmutex_lock_interruptible__fortify_panicjiffies_to_msecsgioc_lock__pfx_mpt3sas_config_get_bios_pg4sas_read_port_mode_page_raw_spin_unlock_irqrestoresas_expander_allocpci_restore_statekstrtobool__pfx_cleanup_module__pfx_mpt3sas_free_enclosure_listmemset__x86_indirect_thunk_r10pci_alloc_irq_vectors_affinity__pfx_mpt3sas_port_enable_complete__pfx_mpt3sas_base_resume_mq_pollingmisc_registerscsi_is_host_device__pfx_mpt3sas_init_warpdrive_propertiespci_set_mastersas_attach_transport__pfx_mpt3sas_get_num_volumes__flush_workqueueraid_class_release__x86_return_thunkscsi_internal_device_block_nowaitnr_cpu_ids__pfx_mpt3sas_config_get_volume_handle_copy_to_user__init_waitqueue_headblk_mq_unique_tag__pfx___mpt3sas_get_sdev_by_rphy__pfx_mpt3sas_base_stop_watchdog__pfx_mpt3sas_config_get_pcie_device_pg2__pfx_mpt3sas_config_get_volume_wwid__pfx_mpt3sas_config_get_driver_trigger_pg1scsi_host_busy__pfx_mpt3sas_scsih_pre_reset_handlerstrcmp__pfx_mpt3sas_check_for_pending_internal_cmdsmutex_trylocksas_port_deletejiffiesirq_poll_disabledma_set_coherent_maskkthread_create_on_nodescsi_print_command__pfx_mpt3sas_config_donesi_meminfosas_ata_ncq_prio_supportedsprintf__pfx_mpt3sas_base_free_irqvmemmap_basedma_pool_destroy__pfx_mpt3sas_get_sdev_by_addrparam_set_intsas_rphy_adddma_free_attrs__pfx_mpt3sas_base_sas_iounit_controlscsilun_to_intsas_port_delete_phymutex_unlockcancel_delayed_work_syncinit_timer_keyparam_ops_bool__pfx_mpt3sas_base_get_msg_framescmd_printk__const_udelaysas_rphy_free__pfx_mpt3sas_config_update_driver_trigger_pg4__pfx_mpt3sas_base_unlock_and_get_host_diagnosticsg_next__pfx_mpt3sas_get_sdev_by_handle__pfx_mpt3sas_init_debugfs__kmalloc_cache_noprofcancel_work_sync__warn_printk__pfx_mpt3sas_blk_mq_poll__x86_indirect_thunk_rsisas_port_add_phydelayed_work_timer_fnirq_poll_schedblk_mq_map_queues__pfx_mpt3sas_base_initialize_callback_handler__pfx_mpt3sas_config_get_manufacturing_pg0__pfx_mpt3sas_base_get_sense_buffer_dmairq_poll_enable__pfx_mpt3sas_config_get_manufacturing_pg11debugfs_create_file_full__pfx_mpt3sas_config_get_phy_pg1__pfx_mpt3sas_config_get_number_hba_phys__pfx_mpt3sas_config_get_driver_trigger_pg0pci_disable_devicesas_disable_tlrscsi_done__pfx_mpt3sas_ctl_init__pfx_mpt3sas_scsih_reset_done_handlerscsi_unblock_requestssas_phy_add__pfx_mpt3sas_expander_removepci_stop_and_remove_bus_device_lockeddma_set_masksas_is_tlr_enabledsbitmap_weight__pfx_mpt3sas_destroy_debugfs__pfx_mpt3sas_trigger_scsidma_unmap_sg_attrs__pfx_mpt3sas_scsih_event_callbackirq_poll_init__pfx_mpt3sas_base_check_cmd_timeout__pfx_mpt3sas_ctl_releasedisable_irq_nosync__pfx_mpt3sas_config_get_driver_trigger_pg4pci_irq_get_affinityscsi_block_requestsscsi_add_host_with_dma__pfx_mpt3sas_base_hard_reset_handler__pfx_mpt3sas_config_get_iounit_pg8__pfx_mpt3sas_config_update_driver_trigger_pg2__pfx_mpt3sas_ctl_event_callbackstrlenparam_ops_int_dev_printk__pfx_mpt3sas_config_get_expander_pg1param_get_intdebugfs_create_u8scsi_host_allocdebugfs_create_dir__pfx__scsih_allow_scmd_to_device_raw_spin_unlock__pfx_mpt3sas_base_free_smidpci_free_irq_vectorssas_release_transportsimple_read_from_buffer__pfx_mpt3sas_ctl_exitsg_copy_to_buffer__pfx_mpt3sas_config_set_ioc_pg1__pfx_mpt3sas_port_enablescsi_change_queue_depthnode_to_cpumask_mapmpt3sas_transport_functions__pfx_mpt3sas_scsih_set_tm_flagmsleepktime_get_with_offset__pfx_mpt3sas_base_free_resourcesscsi_remove_target__SCT__might_reschedkmalloc_caches__pfx_mpt3sas_port_enable_donekrealloc_noprof__pfx_mpt3sas_config_set_sas_iounit_pg1dma_map_sg_attrs__pfx_mpt3sas_config_get_phys_disk_pg0__pfx_mpt3sas_exit_debugfs__pfx_mpt3sas_base_get_sense_buffer')Ee ^))e x e )e &)Ee a)e )e ))e 1J :Qx et)e J x )')9)H)g e E=)P e {I p}  e , N8MS q)e  ?JU`kv) e  ) :.$ 8bY qe u )   e  )   e 9  )    e W  )  e  V% S  ` Oo c  O E  O'c rOO:  8OE: mV: : 1 Z: O: : ) e @x gx x )e +)G)a)z)e T)@ )8)D0S)ue >) )e 8)N lz  %e i)V  1e L rx )@ )e @)ee )e )%e U)ue )e yV  e ?)V  A)k@ v)0e   Q 7    l!!l""l"l") #)#l$$ (+$  D$c$l$e %)K%)t%)% %)%)%e M& &x &l&x &l''x 'l'x 'l('(x /(lv()((e ()( x,) |1)^D) GN) b) Xg) w))V ) ) )e )V * *]%*'1* :*)Q*e *x *(**J *w*x *U*)!+e X+x c+}+x +f+ +x + ,q a,W t,x ,J , ,x , ,x =-J I- `-x u- -x -J -L -x .' /.F.)K.x e. j.} o..e . 3/ /)/ /e 0' 11d 2C 2C 82)]2 b2 2e 2 2 2e 2 2)3e 3 3)3 4e m4f4)4)4e 4)5e 75x ^5x 5e 5x 5)5e 5 # 5)6e 6 #)6 # >6 # C6)R6 # W6)u6e |6 # 6)6e 7S $7 /7: H7 7S 7 7)7e 7 7a7 8: 8: <8)N8 X8d8- 8e 8)88: 8e 9)%9e =9)e9e z9)9e 9)9e 9):e .:)5:)U:e p:V : : :): : ;: ;} %;e =;0;);e ;V ; < .<)<< J<)e<e <)<)<e < 1==)=V = J> s>9>Q >9>Q B? ?e ? ?)?D ? !@D -@ X@D @D @ @ @e ^A # sAx C # ,Cx FCD ^CD C)C)D # Dx ND9DyyEEP E ED FW wFx FG@GLG$dGpG GH-H @HHHAH5H)HHHHH IqIe(IY3IM>IOI}ZIeIvIIIIzIIInIbICI7I+IJJ 7JJ UNe sN)N)Ne N)NN\ O> O)EOe O)Oe O P ,P\FP NP^PPP: P)PPP Q%Qe dQ Q: Q)Qe Qx Q)Re 8Rx _R)gR>pR)RR 9R R} R 9R @R} Re S){SS)S %Te IT%TTWTx T:U)%Ue 6UyHU)eUe wU@U)Ux UUUXUe VVr#VW ,VQLV eV #V Vx V W W&W)EWe W)W W\We XUJX nX: X X: Y R \ǁ)ցW ߁Q #- l ~x  Qe *?$SP)]ShX]X e `x ) ճe Z)l5 x X|X յe Px ) Ŷe )3x XX  %e x ) e Ӻ) x 0XyY~ e x r)w e W)ex uWY8Yֿ e x  [: ) e (N)Z e )e )1)Qe ^Zg)n)wZ Z 0)} )e %[) 8* } [[1e PV  \ )e F)V b i ~ 8+  +  \])])\e]K]9: Y: qe :]D)b]n e :^!]- '4 ); )B )I )P )s )  x, ) e ) "-^:W E^[~ G #8 x ,}  k^I^\1e m |^W ^^ #8 G )x 6 E_V^p\{))e      ))1e  ; )f; p)e 1._Z)_ e  )ee )  ))ee { { 1zB)I)ee k) a) e Tc)Ae N @/_ i z? )  x/ *?  0   /  Ae [T qT )e cW:dj s:d cdAe Z exeeede T T 5 x3A K V)qe ~   *) 3  e V F OJgqe  hW h1h8 #8P G\ nx { 5hh\\) h<\qe ))e ^#<f )V  7 ?lb#4j }  e V j#$ ## m#<  7)X#4` n#  e 5J))G %WD )5 >.mPeb }B 6 x x ;x Ux it  5 p5 rx e _m|m 5} )Ee Wmgmu 5z} e mV  ( Ee Ymi"nqymme 0nn 6}   SnCnEe ZnjFown|ne ss s)) # ~+C D qe V  / bq  : :  )Ae )qt)tte !#E: ?#L#LD#EX d i#P#P- 6Z = D O Z a p }  G+Fc #0q~#H#D #0  #0  L =vv  .uQoPwuZut y )'#EH)v 8 vC= yvvve -w) wmx t$p v)e    Lw: twB)dp: : we 5 B)s) e V   E)X `: k }:   e V  T YT ) p (;  :  e U b)) e % 2)c)s e V  & j` y     e p w,V ` gvpwV   '): FV Q :   e UGxV j ;x }_x@xV xx K  ) - < K ue  H< ' >)MV  :    !e M_y`)j y)V 0 tzx  w  $p yy( ;V  y: : y" 4 i yze )D  ,: 5)DD X e zz){ ) zE e [ u { )  { {  W{ )   +{" W 8 {C  x $ p   v{5 e w " : ) V 3  = )L V :      ! e e  U      \ G | V 0}L c Am} ~J}l} K) }( 2}R re  g i ~ m6fG mj } g X b} h hV !0}T d A~}  0i3|h 2e> ef f ^i#*g6 g~i ig gf f e e= c  h hi i ^e 9"{V  : ))6 GV : : V n   :     1e  C~~k~Z)nV     6;pGh~~V   F S: 9V   9 A~:      %e t),p e   ) ) $ p  ! B !} 2!)Q!e !! !4!RC" o" " A#,P#p]#Be#: #)# #Ȁ-$ 5$B$ w$ % % 1%e & &6& I&n& z&&R&&f& &8& &&' ' ' ' (4( z(,(p(\(: (: ()(:(7(_( !)e ) )k*C/*݃T*V d* * *V * + +4+p)+N+ [+`+p+ +)+ + +e 6,)=,)e,e ,), ,)- %-e I-"[-,j-p-V -F 5. F.)U.V */ s/V / / 0 50e 0)0 0)0)1 51e W1$\1p1"1)2V +2~ g2 x2V 2: 2 2V 3 >3 T3 f3 yr3 (Dy3 ~3 3 y3 C3 3 3e 4V 4~ "4 a4 4)4 4: 4 4: 4 4 5e 5V 5 5 6)&6 <6 XDH6} P6V [6 6 6: 6: 6e "7V 57~ x7 7)7: 7) 8 58e 8V 8 E8  9 9 j9 9V 9~ : : 4: E;: G: : : : :: : : ; ; ';_;V ; ;; ;O;) < ,< E6< B< N< _<gu< |< < < < == pl\=#<h= =$=: =  = `E= = =  = 0E= = >: 2> D>z> > >p >Ї> > ? ? *? D1? 6? J? DY? c? u? |? ? ? ?#4? ? ?e |@:@@͈@ A "AV 8A~ LA A)A: A A B+B 5BpABdpB&B B݉BCC%Ce ECV VC~ dC tC)Ce CV C C)Ce D)%De ?DV [D iD)De D)De D)%Ee XE)uEe E2F)9F)QFe F)F)F)!G wG Ge G 'Hw/H7 SHpHԓ{H)He HH0H LH} HHEIe IIYIeI IV I I I II!IaJ] !J)3JQ=J OJ uJe JJ JzKKK kK K L7 LD LL)L6 Mx M `lM MeNO O LO p5O OrPV RQ Q,QpQ RR: aR R FS tS: So T-TpT U: VU Ue Ue UT UT V) VT /V)UVe gVT VT V)VT V)Ve ,W9WGWSW qWR|W9WWW%WnXB yXX #8X GX Xx X XX~ L v ŕe ؕ)6 BڶY6 Ŗ)Ӗ l:  ݘV ) 7~ lB ,™V  $śp .)V C[V ƞ  ֟:  e :Qà{) e  7 R\|)W 9آ [̣x ٣ #` l x $ 3¹@V e )Ee i"V F å Х)ե:  e >"XV jF  ):  e +"V  ֧    /\H h\ ;;) W 'W c˼"x /7= #`U l_ rx  rV- = ee "V ' U )  x.<A P ue "!V 3 d Ǯ Ӯ˽ -Vί %: N)Z     İ e "lV ~   RRO  òem: u: )ɳ  ' Ee   ô !Z ~ VٵV\ ")5n W ȶ2߶x   #`÷ lԷ x  x!vǸV F O V  !: S g e   )ue )ɻػ))e %)Ee pwp ̼V  '  t64 r r߾Jv @tU|w g ͿV  : *w9 IK K e V  I k ([ )  _y  ' h,} O@TOY^Oe l = \ ~    )5e fl oN!   . M o y)e )>V     j ~) e )():)Ue nV  )e V  )e V O ])e V  )e   )5e G R \)ue   )e   )e ' !3 =)ee w , )e   )e  2 )%e 7 ,C J)ee w , )e  9 )e  9 )%e 7 9C J)ee w 2 )e  2 )e  9 )%e 7 =K R)ue  H )e  H  )5e G W ^)e  ] )e  ! )%e 5BVz))))e E O V)y: : e  &+x9ZS:W :V1 =V #`  x  2H})??  l  l" (rH ee  )T ZT AVT vZT 9  %e ` \) "7 E O ue } ) %e - [d) e  &)  %e ^jJ) e J g )5e < #`A ae      D3  D!G Q-f) 74 * 7Lm3 z 3 4  4 +3 8 3 K4 X 4 j e   5G V-_R) e  s8)I ae  T75u-!N)eu e F O+_kS-) Ee y)))e  `x  Z   % 8 =G)N SZ)qe  @q ) p - qB RZhv ( K T}  Ae   : ) #PZ h q 6 y   #`  0Orx x    x x  O --d t-} -*VUVl x x B x x x %> x x x x =mx x w x  P Hm Q}  P( Hm/ Q4} @D W w^ lpY 4w yk6 6 u6  D SH -$D D } " @t, l2 8rR`8rw e  ') e  pD T: cV  ): e %4pt : V  %): %e Udp : V E U)%: Ue p : V - =)K: ue )F V)`)m  5e C) `Q #[ #`" )e  +)Ee VRg)D  e n) e _ h q  )  e J   . W * O Z n   #`    x     5 )\ f e ~ J )   e      =   =( 6 J S  )  e  p Z & - c   ? gV ( 8-Ah }  \)E\  V j  V $  jN} ^@ (7O  <b- !^.BR   3 9~AWk 0Tt -!?WW b# 6 #`E Wx d s7{x 4x P?ex  \' 0V   y} [' ; T a\G  e e Ee ue e #X     #`   `/%e ^V: e     )  e ,.peJpx: V . )e   fc ~ )    e !V 4!R! _!.!)!! !  " " #" E"e "V "J%#0# =#f# s##)# # # # $ 5$e $V $% \% i%&%)% % % % %B%e .&V U&^& & & ')"' /' <' C' H'a'e 'V '9 ' (5():( U(e (()( )e ))= ) ))) )* *$**0*AB*o*x*A* }*} *)* **e j+)+)+e +: +)+e ,,)5,e R,W,ps,),e , f ,,#d,,),e ,#d, -e - n J- v- <----)-#d-.. 5.e A.  #} 9 >} I  Q} [ c} } 5} ) 0A 0} g 0A } e!e D\Y ^}  C  R  ^ S  PN% 3S = D} L: ~ ) }  }  `}  8}  } ! 5} :E PQ X c]} bm Py  c}   H} X   } w  P }   x} m P"} 'r; (@} EY ^} c w |} o  } %  P }  e ))# }  Z  !#' ; @Eae |  Km  } ) } 0 7 Ue m -y  5} ) [ [} e  w} e # H(} 3 h: PB?} K U*f PBm r} w* PB 0}  PB h}   } /. }  } ' /.; @B G } L ._ @f Pp } .  } . 0A  } u- 0A 0 }  } 0A  }  ,/ 0A9 0> } M R } g l }  } B  } + B 0 }  } -  } n/ - " } ' .2  9 > } C 0N  U Z } d 2o z }  } 1   } 2 e | x  PU h# } .  > PUE hJ } U  l q } PU   H } )  } P<  } 7 X x }  ?  $ } 2 TE9 PF O Z gh }  } }  } TE        K PK   \' 0 ; I} d i} ~   v K K  K K ^ < / C W i} FE   L  0 } E. 7 D pTP W a} qaBD aB x} bE /  K K wK `K LK 9K (K& <+K2 7K> CKJ  OKV [Kb gKn sKz zK fK UK BK /K K K K K K <J   J& P+J2 7J> CJJ  OJ] i nJu zJ J J J zJ J  J r fJ UJ J J  J wJ$ `)J0 L5J< 9AJH (MJT YJ` eJl qJx }J BJ /J     K 1 D W \g @;s z c} P @;  c} P @;  c} P }  } )P4 9} >pRGRee x }}  6 p} W  6 } x %)0 5} :ITI  N} WTb g} yT @ } 6Ue  +} c  H}  +Mx c `h} x  x }   } / z4} V [} w \  }  O  }   }    } \* @)G QN S} XwUc Qj ho} z  QC   Q h}   Q } U 5 } V 5  }  W 5#  (} QW\ 5c h} rW} 5 p} 1 p  } V1H\ p# (} KVUH\` !g o} tX  } H\  } H\ 0 } : H\  } @_ Q} e  } c$ 3/  4} 9c@ :Q@_X pb g} l]s p p} H\ p  X } H\ X }  '`4  > C} X A_ j} t y}  }  ? }  }  }  ? ? #} 9 ?@ H} ^ ?e m}  ?  }  ?  }  ? , }  ? E }  ? W }  _ #} PZH\ UH\F H\Y   }   } A A  } ! A-! AJ!  O!} g! A! A! A! ! !} ! A<"  A"} a" A" A" " "} "  " "} "  " "} 1#;#H\A##Q#H\# `#} #  # #} # C$ $ $H\$ o$ $} $ X $ $} $ $} $ % p %} %H\$%W 0% :% ?%} c% #t% % %x % %  % %} & B& d "&} '&H\B& L& Q&} _& Ih&  r& w&} & ( & &} & H& &} & ' !' O'5 Y'H\'H\'  '} ' p' '} ' '} (Q(H\(  !( &(} :( ?(} U(Q_(H\i( 8n(} z( x( (} (l(H\( (H\( PI( (} (Bg( pG( (} (Bg) x)} %)i=) B)} O)ig) r)} w)i) 0)} )i) pG) { )} )qg) `)} )h) pG) )} *,j* PI* *} !*,j,* pG3* 88*} J* PIQ* V*} [*,jf* pGm* hr*} }* * pG* *} * *} * X*} ** *} *+ H+ M+} y+#+|+,  ,} ,, 8,} , h,} - &-l2- 7-} <-l[-l0.G. .S .  .  .  .} / $/} 4/ 09/} A/ F/l^/ `c/} n/ly/ 0~/} / /} /l/  /} "0a;0N0: 0 0 0 00  0  0  0} 1 1} 1l*1l51 @1} O1lZ1 PLa1 i1} n1j1  1} 1m1 21 h1} 1 1 21C 1m1 21 { 1} 1m2 22 2} 2nm$2 2+2 h02} ;2 @2mK2 S2} n2L*2x 2V 2 2 012 h2} 2 2 012C 2V 3  3 B3 7 3} !3m,3 `13} 63mH3U3 01_3  d3} p3 Iz3 7 3} 39n3 /3 3} 3n3 3} 3Ht3 3} 3Ht3 p/3 3} 3co4 -4 $4} *494 4 4} 4Jp4 @5} 56 6} e7 ~7|7 U 7} 7Jp7 )8Ht8 H8} 9 R9 p^9} t9Ht9Ht9 9} Q: PZ:} : :} :\: :} ;\=; B;} Y; };|;  ;} ; H;} ;|< <} `< e<} }<|<Ht<\< =} = r := = =} = =} >  > #>Ht>m > >} >Ht? .?} ?  ? ?Ht? ?} C@m h@ 8m@} u@ @|@ @} ZA h_A} A 0A} Am A B} B  BB XBHtBHtB `B} Bm C 9C} @C  rC CHtC C} Cm D5D p>D} [D `D} }D D} D  D DHtD (D} Em sE E E} E E} E HE} F x F} /F ;F} AFZFiF #pF  uF/F\FHtF\FHtG\#GHt?G\PGHtVG#]G #lG  yGG\G\G\G #H  HH\ H #BH  GHZH\aH #H # HH\H #H 7 HH\H\ I #I O !I0IHt?IHtNIHt]IHtlIHt{IHtIHtIHtJWJWJJpJq-K (2K} BK pIK NK} SKt^K IeK  oK  tK} |KV K K\K K K  K  K} K)L 0 L ` L} (L ?LJL  QL ([L} kL  rL d zL} LvL PL} L pL} L BL  L  L} LV L L\L M $M u ,M} 1Mw>M  FM} [MhM pM} M M} M M M 0XM  M} M<M MM h!M} M~NN  N} :NV BN}fN P[pN huN} N NV N N N N NN N?N P[N  N} OV O}O Ox ;O IO  NOF^Ok eO P[oO  O} O P[O "O 0XO @!O} OO 0XO  O} OO  O P[O  O} Px %P h,P P[1P} Q} UQ<cQ wQQ 9Q 3 Q} QQ 9Q Q} QQ 9Q Q} Q 7Q Q} QQ 7R  R} R<+R >RIR 7PR 3 UR} bR 7iR nR} sRyR * RR  RR t RR  RR  RR  RR  RR  RR  RR  RR  SS  SS  SS  $S+S  0S7S  XLX @aSX &XX} ]XkX @arX x&wX} |XX bX &X} XX bX &X} XX `X 8'X} XX `X 8'X} XY _Y x'Y} Y0'Y _.Y x'3Y} 8Y0FY _MY 'RY} WYeY _lY 'qY} vYYe YV Y Ze Z p(Z  Z  +Z  4Z  AZ (NZ ([Z  dZ (qZ H(}Z  Z  Z )Z} Z GZZ ZZ wZZ ZZ  ZZ [[ 8 [[  [ [ a%[4[C[[[[[ )[ *[} [)[ t\  \ \ \ &\ /\ 8\ A\ 1J\ x)V\ Fb\ Yn\ z\ \ \ )\} \\ *\} \u\ +\} \\ h+\ \]] 8+] $])]:] B] K][] e]} x] +}]} ]] 0] ,]  ]} ]b] 0] ,] 0,]} ]%] z] ,]  ^} ^^ z^ ,#^  (^} -^8^ І?^ +D^} I^Z^ 8-f^} k^r^ І|^ P^} ^^ І^ ,^} ^^ -^} ^V^ p^ +^} ^V^ p^ ,^} ^V_ c _} __ p$_ P)_} ._V9_ -A_} f_ -k_} p_1___A` u`V ` ` ` 0.` `ag aV 2a Ea Ua 0.aa jauag}aV a X.a} a X.a} a a} be b .-b} 5bGQb .Vb} bb ub b b .b} b)be bb bb bb bb bb c c cc c!c (c-c 4c9c @cEc Lc#EVc#4[c(dc#<ic(pc#Ezc cc}c#Hc /c} c cZ c c#Hc c ccc c ,c  c} c d pd 0d} &d5d :dHd 0Pd} _d {d pd  1d} d d h0d} dd)d e e 1e} ek3e =e X1Be} Mee\ekoe ve 1{e} eee 2e} e @2e} e 2e} e f f 2f} l Pl 0elV l 0ll l 0l)l ul ,l  l} m9m Pvm ,$m  )m} .mAn KCn Sn)]n 6bn} ln wn n n} n n n} n gn n Kn n)n 6o} o "o  7'o} 4o $y} 0yEySUy =Zy} _ymy Ўzy <y} y Ўy <y} y :y} yy =y} yy 8=z} zP"z >.z} ?zMzPbz <kz} tzz :z} zz tz ,z X>z} zz >z} z { > {} { { t!{ :&{} +{I{ >Q{} W{ l{ >q{} v{{ { ?{} { { s{ X?{} {u { s{ ,{ X>{} {u { s{ 0?{} {u  | ?|} |8 &| 3|} D| X@b|} | @|} | @|} | A|} } @A }} }<} ^} ?h}} }  @}} } P}}}~~&~ 2~ ,9~  >~} C~-N~ Z~ ,a~  f~} k~-x~ A}~} ~-~~ p~ B~} ~m~~ p~ 0B~} ~m p  hB} ( / hB4} 9I S BX} dr  0B}   ,  } -  ,  } -  ,   } -% B*} =BfX Bf} "  ,  À} Ȁo"Ӏ ߀ ,  } ]# 0C} ! # ,*  /} 4o"? K ,R  W} \e#q B{} 9( p ,  } (ˁ pׁ ,ށ  } ( p ,   } ( p' ,.  3} 8(C pO ,V  [} f(m ,x p  } ( p ,  } Ă pЂ ,ׂ  ܂} ( p ,  } ( p& ,-  2} 7(B pN ,U  Z} _(w `C} (ăĩ(݃(  ,  } + C)} >: C+N Z ,a  f} k+v  ,  } +  ,  } +Ʉ ل  ,  }   ,  } @ L [ ,b  g} 2ƅ ۅ ,  }  y 2 І ,܆  } V  $z+2 0}> ,E -J} O;] 0}i ,p -u} z; 0} , -} ; 0} ,Ƈ -ˇ} Ї;އ 0} , -} ; 0} , -!} &;2 > ,E  T} dpBp | ,  } A  ,  } AÈ AȈ} ͈A؈  ,  } A: `FP} |V <ɉ Љ 0݉A  ,  }  F'} 5BNV oz   F} ڊ  F}  7 } e Y c} kL!u Fz}  F} یV    g2r  ,  }  Ӎ @Gۍ} ) G}  G} + H3} Qv (H{}  0Ύ: pH} l/ H4} F g ~? I} HI} ʏ xI֏} V L#,Q X#+ I} Ӑ I}  J }  HJ} ) pJ2} P:u Jz}  ‘K ґ 0l J} $ E P?^u (Kz} pK} K}  K} V -< P Pi,~  L} hL} 3}  ԓ) Q} K )& .G> gC rz8 K J g J q̔ ,Ӕ  } $R M} %Y; HML} RW] 0d 7i} u  YY 0 :} Y 0 } ו<ߕX ՚} ښlf XP} Qf K j$ g) .j@ 2E} _>hgjr I Q W} ϛ X W}  V } 3 h( p3 X8} F K} R W} \Blh o t} yf~ v S} ^ ל Sp { Y} 0Y} ֝  m 8X} k n  % !} / 4} ; @} EuP RU} ZBle q ,x }} Bl  X} ƞ z˞} Ҟ מ} ܞo Z}  l  ,  $} )z4 @ ,G  L} Qzd Yi} v  PJ~ Ÿ S̟ m"- Pm= I ,P  U} ZBle q ,x  }} Bl ж ,  } 6o Ƞ RР} ߠ S} 8 PW} a Pm} uV 0ޡ 4} al  } rs n~alaluqal 4} alТ  Y} `nBl&Bl+vH k 0 Q} ϣV  PM  ` PSt} `n  V} 1u h0#} (6o; S  WX} ]Cms z X} x * 8  (Tť} ޥ z}  X } vy m' 3 ,:  ?} DBlO [ ,b  g} lBlw S|} Bl  V} Ŧ < P& T0} 5BlH TR} WBle7~ Q} ç PQ֧} ާV / D4V7h7z7 Q} M: : ٩ pRީ} T &Z2T ]Bl Q} (R}   Q}  & XZ+} 0@ ZP} Uːc Zq} vI }  o}  ʫ ,ѫ  ֫} ۫  ,  }   ,#  (} -`8  ? ZG} LX d ,k  p} uR: [ˬ} [} / Z  a \f} r p\}  \} ͭ \ҭ} p 2 V  H\ 9 ;@ E  \} &  ϰ ڰV % F-} 6 G ,N  S} y :  ɱ [ر} U  ,   } 6 @ H[W} mw Z}   ,  } ܲ1 [; @Z ;a f X.³}  V X { X.} ʹ 8]Ҵ} ; `@} G aL} S 8aX} b hag} lw ]|}  8^}  ^}  _} ˵ ]ٵ} [  \  \ $ \. 7 \C ``K} Y `^} nx  7}   Pɶ ,ж X>ն} ڶ P ,  }  } )C8 :=} BpR ] 0`b} gln {  7}   a} a·} Ƿ )  b} ^# : bA bF} Q^\ h bo t} ~^ 9} AŸ} и Fظ} N} ` 0c} J" `) b4} 9RD `K XcP} b `n bu Rz} D J c} ¹٣ɹ uԹ `ٹ}  [ } ;OH cM} YUf[u dz} [U } º ɺ Һ  0d "Q[Zpe d} » dǻ} ӻ d}  u } (2 7R XdW} \/j q 0cv} _  Xc}  bƼ} ˼Ҽ ޼ b R} D _ 0$ b+ 6} ;R @eW} \dn  es} x  b }  xeƽ} ˽ڽ p b }  p b #} -< pH bO T} e pq bx }   b } eȾ Ծ b۾ } e  b } e1 8 b? M} Ref m bt } e  b } eҿ eݿ} O  0c} ٵ ( b-} 2@ L XcQ} x  }  u}    ' f,} 6E(R \ 8fa} f(m w |}   `f v  b  } ] fh mr߾}  b }  b }  f}  b } $ 0 b7 @} m)u:   b} h@  b }  6  = bF} V b bi r}  b }   0c} \ ! b( 1} A M bT ]} g  W  Xc} # 2  > bE RJ} YD x 0g} #` l ,x 9 P uW  `} } V hg}  g} 9 U| g} 6  6  6 N i6 @h} :  g} #: (_9 0d@ JO^ he j} : P b }  P b }  h   P,  8 b? D} L Y  e bl q} y h   Pi   ! i} )+  2 i7} >)h et} m} r} z} 0* k}  0* } J 0* hk} &V1 0*8 j=} L 0*S kX} j 0*q jv} 0* Hj} V 0* m} VJ 0* } J) 0*0 8l5} E 0*L xlQ} d 0*k pmp} {D J 0* m}  0* } <  0* } ) 0*0 ~5} :O 0*V j[} n #u (n}}  # Xn}  # n} # n} } !& 8  C} af m Py Hm Q}  P &}    Hm$ Q)} 5mA H &M} RY e Hml Qq} z P Hm Q}   o} #  Hj} #  po} # & o+} 7#C J ~O} T[ g Hmn Qs}  @o} P p}  P pp}  P 8p}  P o }  P! ~&} +_6 PB HmI kN} ^ Pe pj} t )   hq} ! q-} ? qD} O p`p  r} ? 4            "/< W q`} v q}  t}  P Hm Q} D  P Hm Q} $+ p7 Hm> QC} H\ sa} kS} s}  P Hm Q} D  P Hm Q} u}  P "} 0E `sJ} O Z Pa i} < r}  P xl}  t}  xt} 8F sK} P[ Pb Prg} u s} % s}  r}   P Hm$ Q)} 7D `uI} Q \ 5  P Hm Q} D *5. : HmA QF} R|] ,d ui} nVy p, u}   w} q  v} h  u} v v} Pv} _  v} !_ /_ = xvE} J_ U %\ ~a} f q %x Pw}} \  % }   % m}   % } % } < %$ xl)} .\ 9 %@ E} J\ U -\ xwa} y~  - }   x}   w} =K Y wa} q ~ V  Hm Q} ;   } ; " @o'} 3;@ G pL} \  c ph} u  | ~}    Hm Q} ;   }    y} 0)A3  = (zB} GAN X &]} bm t &y} ~  o}  Hj} ;  @x}   xx} ; $ Hm+ Q0} <;C O HmV Q[} g;r 0y ~~}  0 Hm Q}  Hm Q} ;  Hm Q} 0 Hm Q}  * Hm1 Q6} B;M T &Y} ^.e q Hmx Q}} ;   y}    ~}    po} ;  & Hj+} 0;7  C HmJ QO} _  f pk} pmw  Hm Q}   ~}    8y} m p z} A   }   & +} 7B  I N} e<s x   m} p `z} a   xl} z}  x  } ;(  / xx4} @;M  T xY} l  s @ox}   o}   Hj} ;  z}   z}  7 E }  7& V .} 9 7@ p{E} JU 7\ H{a} fey 08 {}   08 E }   08 V } c  |} K  5 (|} 4! 5 X|} ) .!9 5@ V E} J_!a 5h |r} " 5 V } s# 5 X|} # 5 X|} =# 3 |} &$1 38 V =} Bi%M 3T X|Y} ^+%p 3w }|} U& 3 V } & 3 X|} & }} * h~} * ~} * } : $*/ ~4} <: A*X p]} p} } : * } D HI} ` k} : * (}   - P -  .#} *  /_ 6#F; @be  $ + 0} 7 <%C O#EY ^ e#4s x #< #E#P#Ld pJ `        $ H */ 6 W<A H @ NS Z `e l  frw }m#F     ' #F b)` 0PPPP@ HPPu d   (( 0`ph p    @HpPPP (P0`hPp(PPP x(P0p@ HPd  (P0H@HpP 8( 0 ` `h p        @ H  P           @ H  P           @ H  P           @ H  P         @ H P   @H P   @8"H P h" " @H P  " @H P " " @H P #   @H P  # P# `@ h0p00 (00`h0p00 (00`h0p00  (00` h0p, 0E 0 W (00`_ h0pcPcP (P08p`p (p0`hpp  (0` hp0 X @ HP ppp@X HpPpp p@ HpP   (  0 ` h  p     !Q(! 0!`!h!!p!"("!""("@"""p"@""##@"#`#h#0#p###0##$`$#$@$H$#P$$0$p$$$$p$$@%H%%P%%8%%%%h%%%&&%&@&H&%P&&&p&&&&-& '@('-0'`'h'-p'''-''U '-' (H((-0(`(ph(-p(((-((P(-( )()-0)`)h)-p)))-)) )-) *H(*-0*`*h*-p***-***-* +(+-0+`+h+-p+++-+++-+ ,H(,-0,`,xh,-p,,,-,,,-,@-H--P----- .(.-0...P....p/.//p//@/H/p/P/////0N 0010@0H001P00 00100h001017 1011`1h12p11{ 1211 121 2`(2202`2hh22p22h222@3@ H33P333334434@4 H43P444544p4545555@5 H55P555555565 6p(6606`6h66p6667673 777@7H77P77 7778898@83 H89P888988 898 9(9909`9@h99p99999:c:@;:@:cH:@;P::c:@;:::@;:;;@;;;x#;h;;;;;; <(<P<0<<<p<<<<p<<@= H==P== =p====p==@>XH>>P>>>>>>>>>?8?>?@? H?>P??h?>???>?@@@@@@PH@@P@@@0A@A0A0AA`AhAPBpAAhAPBAAhAPBA B0(BPB0BBBBBB0BBB@CHCCPCCCCCCCCCDDCD@DHDCPDDDCDDDCDEECE@EHECPEEECEEEpGEF8FpGF@F{ HFpGPFF`FpGFFhFpGFGGpGG@GHGpGPGGGPIGGGPIG H(HPI0H`H0hHPIpHHxHPIHHHPIH I(IPI0IIpIpIIIIPLI J(JPL0J`J0hJPLpJJ`JPLJJJPLJ K(KPL0K`K hKPLpKK KPLKKKPLK L0(LPL0LLLpLLL5LpLL M+(MO0M`MHhMOpMM`MOMMx MOM N (NO0N`NzhNOpNNNONN NON O (OO0O`OhOOpOOOOOPPQP@PHPQPPPhPQPPhPQP`QghQ0QpQQ}Q0QQQQ0QQ R(R0Q0R`RhR0QpRRR0QRRR0QR@SxHSSPSS0SpSSTTST@THTpTPTThTPUTThTPUT U(UPU0UUUUUVHVUV`VHhV0VpVVwVVVW W0XW@W@!HW0XPWWh!W0XWW W0XWX!X0XX`XxhXXpXX XP[X Y"(YP[0Y`Y hYP[pYYhYP[YY YP[Y Z (ZP[0Z`Z!hZP[pZZ ZP[ZZhZP[Z [h([P[0[[[[[[\\[\@\H\0\P\#\\0\\#\ \0\\#]]0\]#`]5h]0]p]]]^'^_^'^'^_^'@_x'H__P_'_x'___'`8'```'@`8'H``P`'`x&`@a`'a&a@aa'a&aba'a&aba'`bc hb0bpb (bG b0bb (bL b0bb ( cT (c0b0c (cX cPcc (cG cPcc (dL dPcd (@dT HdPcPd (d? dpdd (dG dpdd (eL epde (@eT HepdPe (e0$eee'eo ege' fp$(fg0f'`f$hfgpf'f fgf'f%fgf'@g#Hg gPg'g$g gg'gg gg gg g g hh h h h (h 0h 8h @hHh Ph Xh `hhh ph xh hh h h h h h h h h h2h h h h h iEi i i i (i 0i 8i @iSHi Pi Xi `i hi pi xi i i i i i i i i i^iiki i j j j j j (j 0j|8j @j Hj Pj Xj `j hj pj xj j j j j j j j j j j j j j j j j k k k k k (k 0k 8k @k Hk Pk Xk `k hk pk xk k k k k k k k k k k k k kk kkllll  l(l30lJ8l`@ltHlPlXllllllll*lBlVlblrlm m(m0m8m@mPmUXm`mm%m)m0m:m?mFmUmdmommmmnnn*nB nV(nb0nr8nz@n bHn@b`nhnpnxnnnn%n)nnn.nnn,@oHooPo,oAooo,o?ooo,p @pop,@pAHpoPp,pX@pop,p@pop,q@qoq,@qAHqoPq,q@Aqoq,q qqq, r0?(rs0r,`rX?hrspr,rX>rsr,r>rsr, s>(ss0s,`s?hssps,s?sss,t:ttt,@tX>HttPt,t>ttt,t>ttt, uXP(uu0u,`uX>huupu,u uuu, v (vPv0v,`v,hvvpv,vX;vvv,vvw;wvw,w$w@w;HwvPw,\wdww8+wvw,www;wvw,wwx<xvx,x$x`xOhx0xpx,|xxxOx0xx,xxxx0xx,xy@y.HyyPy,y.yyy,y.yyy, z (zz0z,`z hzzpz,z-z{z, {-({{0{,`{-h{{p{,{-{0}{,|-|0}|,@|-H|0}P|,|-|0}|,|-|0}|,}-}0}},`}P7h}~p},}7}~},}7}~}, ~7(~~0~,`~h~~p~,~~~~, 8(Ё0,<D`8hЁp,|89Ё,`9Ё, 9(Ё0,`9hЁp,`9Ё, Ё,  (Ё0,`X:hЁp,| Ё,2,@+HpP,,p,cȂpЂ,Pp,@-HpP,LȃЃ, 5(0,6P,6ȄPЄ,P,`5h0p,+І,,І, ,(І0,`PhІp,8-І,H6,`Kh0p,|g0,ć6Ї,  7(Ї0,`hPp,``,`, 7(0,`7hp,0`,@:HP,:,:ȊЊ,@*HP,:ȋЋ,@]HP,<Ў,<Ў, >(Ў0,`<hЎp,8=Ў,=Ў, =(Ў0,`:hЎp,:Ў, (0,`X>hPp,]P,8^P, ^(P0,`_hPp,`P,aP, 8a(P0,`hahPp,aP,aP,  (P0,8], \(0,`\hp,\, 0.(0,<D`X.hp,-, -(0,H\`,ĕ;`, X.(`0,`[h p,\ ,p\ ,F`,[`, ;(`0,<D`X.h`p,[, [(0,` hp, ,  (0,` hp,H[, ,@ HP,ZțЛ, ,@ HP,o,ZȜМ,,@ZHP,[,Z ,QP,XZȞО,@QHP,0P,0?, X?(0,`?hp,OР,`Sh0p,|Y0, Y(0,`0Yhp,Y, 4(0,`4hp,Z,XУ,@HУP,У,X,@zHP,,8X,@XHP, , ȦЦ,@XHP, , ȧЧ,  (0,` hp,+Ȩ0Ш,,0,@3H0P,0,(4ȩ0Щ,p40,W`,W`,` Wh p,,@hUHP,,ȬЬ,V,@VHP,V,@THP,T,, (0,`hp,(T, z(0,`hp,SȰа,ܰS,@ HpP, p, ȱpб, p,@ HpP, p, Ȳpв, p,@ HpP, p,Bȳpг, p,@`CHpP,R, S(0,`PShp,S, S(0,` hжp,h0ж, 2(0,`4hp,4,B, 0B(0,`hBhp,Bȸpи,0Bp,@hBHpP,)ȹй,8*,@*HP, , Ⱥк,A,@ HP, , Ȼл,@0HP,F,F,`0)h0p, , , A(0,`Fhp, , ,  (0,``Fhp, ȿ0п,0,0,`8hp,88,h8,@6HpP, , ,@ HP, , , ,@ HP,C, , ,@ HP, , ,`Bh0p,0C, , B(0,` hp, , ,@,F@,F@,@@GH@P,G@,G@,H@,@(HH@P,pH@,H@,I@,@HIH@P,xI@,I@,I@,@IH@P,J@,HJ@,pJ@,@JH@P,J@,(K@,pK@,@KH@P,K@, L@,hL@,@3H@P,pRp,(R,`Qh0p,XD, 2(0,`X1hp,1,1, 2(0,`@2hp,2,2, 2(0,`83hp, P(0,`Php,Q,Q, PQ(0,`Qhp,R, XN(0,`hPphbPhbPhb (P0hb)P,y0,:0,@ MH0P,70,70,,0,@HMH0P,0,M0,M0,h+`,8+`, (`0,<D`+h`p,+`,`,  (0,`h0hp,0p,0p,@ 1HpP,B, /(0,p@x@@@@@  ^Zb01080  - (0`8p@`HX   P ^XZ`pbx01080  -`pP X bb@0cHPbXcbRbXdb@uHPbdbdbdb@ eHPb0b@e0b`hpbxebb@HPbbebb@HPbbb`b 0c(`0b`Xch`pbR`bc`b u(`0b`h`pbc`bd`b (`0bpbpbpb@HpPbbb0cb Xc(0b`fhpbubb (0b`8fhpbPib  ( 0b`h pb bh b `hPpbPbPb h(P0b<D gb@hbhb@0dHPb\d hb9i A(0i`FhpiNib b 0c( 0b`Xch pbR b0g b u( 0b`hgh pbg bg b`bhpbbbb@HPbbfbb@HPbbbb@HPbbfb b@HPbgb 0db$ `h0pb| `fb `zpHm@zHpPHmkPHm~PHm o(P0Hm`phPpHm8pPHmppPHm p(P0HmQ Hm~ Hmp Hm@HjH PHm@o Hmpo Hm8y Hm@yH PHmy Hmy Hm (z   Hm@ H  P Hm xl   Hm    Hm    Hm@ H  P Hm m   Hm Q   Hm ~(  0 Hm` ph  p Hm Hj   Hm o   Hm @o(  0 Hm` xh  p Hm xx   Hm x   Hm@ QH P Hm ~  Hm Hj  HmoHm@@oHPHmpoHmoHmQHm@~HPHmpHmHjHmoHm@@xHPHm@oHmxxHm Q(P0HmQ0Hm~0HmQ0Hm`QhpHm&HmHm Q(0Hm`&hpHmQHmQHm@&HPHmQHmQHm &(0Hm`QhpHme {m {@rHP {z {spHmQpHm@sHpPHmPHmPrPHm Q(P0Hm`xlhPpHmQPHmQPHm Q(P0Hm`rhPpHmrPHmsPHm `s(P0Hm`shPpHmQPHmsPHm t(P0Hm`xthPpHmPHmtPHm Q(P0Hm`QhPpHmuPHmQPHm `u(P0HmQHm&PHm Q(P0Hm`QhpHmQHmzHm@zH PHmz Hm Hm@ H  P Hm i   Hm i   Hm !i(!!0!Hm`!ih!!p!Hm!w!!!Hm "w("!0"Hm`"xh"!p"Hm"(n"#"Hm"Xn"#"Hm #n(##0#Hm`#nh##p#Hm#~#%#Hm#Pw#%#Hm $($%0$Hm`$xlh$%p$Hm$$%$Hm$$%$Hm %(%%0%Hm`%mh%%p%Hm%~%0*%Hm&j&0*&Hm@&H&0*P&Hm&Hj&0*&Hm&j&0*&Hm'j'0*'Hm@'kH'0*P'Hm'hk'0*'Hm'hk'0*'Hm(k(0*(Hm@(8lH(0*P(Hm(xl(0*(Hm(pm(0*(Hm)m)0*)Hm@)H)0*P)Hm))0*)Hm))0*)Hm*m*0**Hm*u*P**Hm*v*P**Hm+Pv+P*+Hm@+xvH+P*P+Hm+v+P*+Hm+v+P*+Hm, w,P*,Hm@,uH,p,P,Hm,u,,,Hm -(--0-Hm`-xwh--p-Hm-T---Hm .hq(.-0.Hm`.qh.-p.Hm.q.-.Hm.q.-.Hm /q(/-0/Hm`/ rh/-p/Hm/ ///(000 11p1@H102@@2 `2}h23p2P}2X|232P}2V 232P}@3|H33P3P}3X|333P}3V 333P} 4|(4504P}`4X|h45p4P}4X|454P}4V 454P}@5(|H55P5P}5X|555P}5V 555P} 6E (6706P}`6H{h67p6P}6p{676P}6V 676P}@7E H708P7P}7{7087P}7|7087P}8V 8088P}8}8`888}8`88 9~(9`809`9h~h9`8p99~9`8999`89 :p(:`80:`:h:`8p::p:`8:::`8: ;H(;`80;`;h;`8p;;P;;;;z ;} <<;<<z $<} `<(h<0<p<< <+=0,=+D D(08@HP X`hppx    t`$0d$t $(%0T8(@)HPXP*` +h.p/x 223445556t66788$9d999:T: $;(;0d<8<@?H@PLXdM`TNhNpDOxO$QQRRd$T$UdUUDWWftjTmnDottuv |(t0T8@`HPXč`hpxtdTDD$Ԛěģ (08Ĩ@ĩHĪPīXĬ`$h$p$xԳԵĶ$YZP0p (0080@HPdXd`dhbpbx@@@ppp`ijkkD D(0D8po@oHppPXp`@hpxt D 4  0$ P! 0%( )0+8d,@$-H40P41X3`5h6p48x?$CCC$DDD$EtEPFGHItJUUTVVZ$^ 4a(0a8b@cH$fPfXTg`jhpxĊĕDdtDtD  4   T( 0 8 @ H 4P tX ` h dp x  $ d   $ d   $ t  4   $   d $ t $( 0 $8 @ 4H `P X ` `h p Dx  p @    $ T t 4  D              D t( 0 $8 @ H P  X D"` 4$h %p `'x T( ) * + + 4, , , - 4." a!8"4' A pC$C(E,M07M4`8f<@D#iHLuPTX.\t`;d hl?pBtxq|"L  p  &.o&\,.0L22H4u4M7[7J9 c:@gAuA S$r(6R,T0[4[8\<`@DqbHcLkfPhTtkXOl\Do`Qpdarhrlxpytzxu{|||~rzמ%] ] #(]0 8H#P]X `px^ ^ 0^  H^ `^  (8@p^H P`hhp x#L   _#H (08 @PX0` hxP  #Jh  p 3   f ]5l,iP $?(q,&0&4'8'<'@(D&(H(L*P*TW+X|+\+`s,d,h,l_-p-t-xJ.|655rA+CDvFQ7RTUV(]h^^aghkkm(nnnuwwK{X}~}7P5/ ړ ϔ$(,04z8`<E@5D%H#L(P#TX\<`?d4h#l3p8tCx?|DC _O2(m:T MXdˣ!q q $(,048<@DlHLPT2X \V`3dh lpLtx%|2OP+&] %` $s(,&084G8<<p@DHt L P T X\`*dFh`lyptx7|R=h? T>@u" #%J%s%%%u((9**E./722344455 B6V667;8 8$8(<9,y909498-:<4:@:D;H-<LI<P<T<X=\?`CdCh(r>,>0>4A?8?<?@?D @H,@LW@P@T@X@\NA`BdECh]ClCpDtxExE|EEFcGGL+MdMMMMNN5NTNzNNNNNN OODOaOOOPEPPPPP$QcQQ QRRRR R$zS(S,$T0T4$U8dU<U@"VDVHVLDWPWTWXW\IX`mXdXhXlYp;Yt~YxY|YCZZ[7\\\]]^^^p__` aaabZbybbbcccccd-dLdfdddee eefff g$Rh(Lj,tj0j4j8j<j@kDkHkLRlP~lTlXl\+m`:mdTmhnl^npntnx o|oDooo?pZpbppppppppppqq q-q:qqrr s,s:s_sssstttttt ttttu  u$u($u,0u0t Wx h| 5 N |      n     B           c o    4    $_j $(, 0L4X8<@TDHL$PrTX\`_dhlptx|+_u9EP|,;Jt&L i /b $(,'0:4K8< @!D3HhLPTX\+`CdOhWlptxD |Z    ! B   4 v   2 K          Kl'iWS }"< b$(,80z48<5@FDHLPmTX\`dhlp0tx|m}:ER8 $    !P!!!B"n""O# d###,$v$ %$%(0%,&05&4m&8&<&@&D'H'L'P3(T\(X(\(`(d(h(l )p)t"*xS*|c*****++M+o++++d,,-$-H-i---4.T.)/r/// 0400141[112*2f2 w22222  3$=3(S3,}3034384<4@!4D`4Hk4L4P4T4X5\5`5d5h5l5p%6tG6xO6|Z6666!747w777848889i9999F:U:::::: ;&;^;;;;A<^<=g== ==>>1> R>$l>(>,>0>4>8 ?<5?@b?D?H?L?P{@T@XA\!A`7AdKAhAlApAt4Bx\B|B$CDCUCcCCCCCC$D>DLDZDDD$EtEEPF GvGGGH&H.HRHHHIdI{IIII IIIII I$J(2J,`M`````4aaaaa"bcbbbcczdddd!e \eeee$f 7f$f(f,g0Tg4g8g<g@gDhHhL%hP-hT}hXh\h`idSihilipitixi|ij7jLjcjpjxjjjjj7kKkk lAlllmmmnnn oao}oooppmppppp p+qrr5r r$r(r,$s0@s4s8t<Ct@tDtHLuLzuPuTuXu\hv`vvdvhvlvp:wt xxx|xyyyziz{"{6{b{{{{{C|T||||8}I}_}~Q~a~s~~~t5K p̀܀ $%(V,04ہ8<0@rDЂHLPjTX\`,dEhPlgptx|Մ4GXwۅ'HmwƆ؆$ERhƇՇFaш %7F X$v(,04 85<=@_DkHLPĊTjX\΋`d$hElQp~tʌx|`}mj-r&@3”*=Kĕ5XҖoK˜(6 /Bo ě$(,04k8<@ŞDHLP՟TX\`dhl6pQtx|ע#Dh¥ԥ=Wi*էGg &V^ ,<d &$T(},04@8O<t@D H2LcPƮTX\`ͯd$hYlptðx|k}dltȳ&D Y}ص4m޶ӷu ƸN $ (R,f048 <t@DDHL˼PTX\`dhlpstx̿|8HHj+N4e=Tm ~ N$(,0484<Q@tDHLPT2Xd\`dhlp$tBxd|$Bd$Jt 4V$N" 0'G d$(,04U8u<@DH$LPTXD\N`tdhl$pZtx| $]i4` FKiFUH`E D <$R(p,048A<@@DHLPYTgX\`dhxlptNx|,cs)TA=3?o7v  w    C S b $ ( , 30 s4 8 < @ D $H cL P T X D\ $` Td h l p t ,x J| t  E t    4     D             N  Y  m                      !!! !!!!'!7 !$!(!,!70!D4!8!$$J($q,$0$4$8$<$@$ D$F H$o L$ P$ T$ X$ \$ `$= d$Q h$k l$ p$ t$ x$ |$ $! $= $Y $y $ $ $ $ $" $- $I $T $p $ $ $ $ $ $ $# $g $ $ $H$h$h$~$ $`$$$~%%% %%8%d%|% %$%(%4,%M0%f4%n8%<%@%D%H%L%P%*T%gX%\%`%d%h%l%3p%Zt%vx%~|%%%%%%%% %%)%R%n%y%%%%%%% %'%4%g%%%%%%%'%J%n%&&& &&&&3&K &f$&(&,&0&4&B8&i<&x@&D&H&L&P&"T&GX&l\&`&d&h&l&p&"t&Ox&|&&X & & & &N!&!&@"&"&"&"&0#&#&#&#&#&B$&$&$&$&$& %&#%&>%&%&%&%&%&!&&P&&v&&&&&'&''' ' 'N''''''''( '%($'>(('T(,'m(0'(4'(8'(<'(@'(D')H'A)L'q)P')T')X')\')`')d'*h'7*l'U*p'q*t'|*x'*|'*'*'*'L+'+',',',','-'6-'O-'/.'F.'.'.'#/'8/'@/'b/'}/'/'/'0'!0':0'M0'0'0'1'?1'h1'1(1(1(1 (1(2(/2(:2(R2 (m2$(2((2,(20(24(28(2<(3@(3D(03H(G3L(c3P(~3T(3X(3\(3`(3d(#4h(4l(5p(6t(S7x(d7|(}7(7(38(8(9(]9(9(Y:(:(:(:( ;(A;(X;(|;(;(;(;(<(d<(|<(<(=(9=(=(=(>(>(>(-?(?(?(B@)l@)t@)@ )@)^A)A)A)B )AB$)B()B,)8C0)qC4)C8)C<)D@)=DD)_DH)DL)DP)DT) EX)rE\)E`)Ed)Eh)Fl):Fp)YFt)tFx)F|)F)G)>G)xG)G)G)G)H)H)FH)YH)H)H)H)H)H) I)I)I)I)I)I)I) J)J)%J)2J)?J)LJ)YJ)~J)J)J*J*J*1K *MK*sK*{K*K*K *K$*K(*K,*L0*'L4*1L8*>L<*ZL@*yLD*LH*LL*LP*LT*LX*L\*L`*+Md*EMh*ZMl*oMp*Mt*Mx*M|*M*M*M*N*9N*tN*N*N*N*N*N*N*N*N*N*N*O*MO*]O*O*O*O*0P*;P*P*P*P*P*$Q*=Q*TQ*bQ*Q+Q+Q+Q +R+R+*R+TR+mR +S$+S(+S,+3T0+OT4+bT8+T<+T@+TD+TH+UL+6UP+ZUT+uUX+U\+U`+Ud+Uh+Ul+)Vp+CVt+sVx+V|+V+V+V+W+6W+MW+cW+W+W+W+ X+8X+WX+vX+X+X+X+X+Y+2Y+QY+pY+Y+Y+Z+[+\+\+\+\+#]+|]+],],],'^ ,C^,e^,^,^,^ ,^$,^(, _,,(_0,@_4,j_8,_<,_@,_D,@`H,t`L,`P,`T,`X,a\, a`,1ad,Dah,ial,tap,|at,ax,a|,b,,b,4b,Ub,tb,b,b,b,b,b,b,b,c,c, c,,c,8c,Dc,Zc,hc,~c,c,c,c,c,d,4d,Od,^d,d,d,d,e-Ae-ze-e -e-e-e-f-Gf -vf$-f(-8g,-vg0-~g4-g8-g<-g@-gD-gH-hL-KhP-bhT-uhX-h\-h`-hd-hh-`il-ip-it-ix-i|-i-j-$j-4j-j-j-j-j-j-j-k-1k-Dk-Zk-bk-xk-k-k-k-k-l-=l-Hl-Wl-dl-wl-l-l-l-l-l-l-(m.Gm.Ym.qm .m.m.m.n.n .-n$.Bn(.an,.kn0.n4.n8.n<.n@.oD.oH.&oL.3oP.;oT.CoX.Qo\.po`.od.oh.ol.op.*pt.9px.pp|.q.$q.Hq.^q.iq.|q.q.q.q.q.r.-r.8r.Rr.gr.}r.r.r.r.r.r.s.s.&s.Es.Ts.^s.ms.zs.s.s.t. t/2t/Zt/kt /t/t/t/u/ u /u$/#u(/+u,/Lu0/Tu4/u8/ut4fx4{|44Ħ444 4/4Q444է4ݧ44.4C44424L444ݩ44%414>4O4W444*4O4p455ի5 5'5F5o55ʬ 5$5.(5e,5054585ѭ<5@51D5H5L5DP5T5X5\5%`5d5ٰh5,l5Rp5t5ױx5 |5V5l555?5e5555W55Ѵ5?5K5W5f5{5555ص5J5]5w555Զ555<5a55666 66E6s66ĸ 6׸$6(63,6O06y4686<6ع@6D6H6L6LP6yT6X6Ѻ\6`6!d6)h6Pl6op6t6ƻx6|66616V6u66ż66656V6r66Ž66"6S66666L666ܿ66,6P66666+7`7{7 777 797l 7$7(7,707?47t87<7@7D7H7L7EP7qT7X7\7`7d70h7\l7fp7t7x7|77"7I7X77787_7g7|777787T777777777M7h777777"7I7i888 88C8K8p8 8$8(86,8s084888<8@8D8<H8WL8uP8T8X8\8`84d8Ph8ol8zp8t8x8|88848Z8|88888%8B8e8888888 8(8L8p88888*8N8r88889 9%9M 9i999,9C 9S$9;(9_,9~094989<9@9D9BH9`L9|P9T9X9\9`9d9!h9Il9hp9~t9x9|999929J9f999999 9(9H9P9[999999E9h9999999999:D:`:| ::::: :($:D(:`,:x0:4:8:<:@:<D:`H:L:P:T:&X:K\:g`:d:h:l:p:At:\x:x|:::::/:Z:}:::::5:X:|::::*:N:j::::::*:M:d:r::::;;3;X ;w;;;; ; $;D(;`,;0;4;8;<;@;D;H;(L;DP;qT;X;\;`;d;<h;Xl;{p;t;x;|;;;;;3;;;\;;;;;H;j;;;;;";.;:;;/;;;];w;;;;;;; ;<.<@<R <d<v<<< <$<()2 24455 5$6(p6,608488 9<`9@9D9H:LP:P ;T;X`<\<``Md@OhOl QpQtRx T| U`U@WpjPmn@optuvpPp`P@@ К  $(,04 8 < @DгHеLP TX\`dh l+p`,t00x C|CC DDD EpEUUPVV0aab`ccfp@00@      @" 0$$%(P(,)0*4,8,<-@0.DPHLP`+0 bp $(,*004e8p<@DH LPTXl\m`odqhslxptx|  "$&+,2468=@ACEGLPkp4 78:<A $(,048<i@jDlHnLpPuTX\`dhlptx| ]`vz~p s t y                          $ ( , 0 4 8 <@DHLPTX\`dhlQp_tdxf|k~ -<RW`{89;=Bf p $(,048<@DHLPTX\+`-d.h/lcpdtfxh|m 67<=?DPkpt~    $*(.,S0T4Y8`<{@DHLPTX\`dhlptx|78:<>C ?@Epqz "" "$"(","0"4"8"<#@#D#H#L#P #T#X$\$`%d%h%l%p%t%x%|%%k(l(m(o(q(s(u(z(((((())))))))**.*0*5*6*7*9*>*@*W*Y*^*g* k*o**** *$*(*,+0+4'+8,+<.+@3+D4+H5+L<+P;.T<.X=.\?.`A.dC.hE.lJ.ps.t.x.|...////////////1222325272<2f2p222222224%4-4444 44455 ]5$b5(p5,5054585<5@5D6H 6L[6P`6T6X6\6`6d6h6l6p6t7x7|77777777:8;8@8V8W8\8u88888899A9P9~99999:9:@:[:d:h:i: :::::  ;$;(+;,6;09;4;8;<;@;D;H;L;P;T;X(<\)<`+<d-<h2<lD<pE<tG<xI<|N<P<<<<<<<<<<================>>>>>> > > q? ? ? ? ? @ @$ @( @, @0 @4 @8 @< @@ @D @H yCL |CP }CT CX C\ C` Cd Ch Cl Cp Ct Cx C| C C C L L L L ;M E+05:; >E $(,048<+@0D4H5L<PTX\`dhlptx#|()*4DEFHJLNSŲв۳QTUW Y^۵ $(,048<@DHLP˶TնX׶\ٶ`ڶd޶hlvpzt{x}|+045<!*0:ƺɺʺ̺κкҺ׺  k$l(m,o0q4v8{<@DHLPTX\I`MdNhPlRpTtVx[|ڿ  svwy{}LMR^5@ 7@ BFIz~ $(,048<@DHLPTX\`dh@lApCtExJ|S[_hm =@]`wy}=>?ACHr  $(,04 8 <@ D H LPT XD\M`NdOhjlkpmtoxt|uvxz   afhtx#ot OPQS U$W(Y,^0c4p8<@DH LEPPT{X\`d#hJlPpxtzx||~89;=?AFHMPpx !0FS" 0GLPV $(,048<@DHL%P0TGXI\M`NdhlptxR|SUZ`v 8<ACEJU`wy{}~  $(,048<@DH L P TX\`1d2h3l5p7t9x;|@W`IP01246;  $(,=0@4A8C<E@GDIHNLPTX\`dhlqpwtxxz||~"0JK!#%',0KLM     # 0 K L M$ Q( , 0 4 8 < @ D H L P T X U\ `` wd yh l p t x |       / 0 G I K M Q U \                  !!! !!!!! !$!(!,!>0!A4!C8!E0"@4"B8"D<"I@"JD"NH"SL"UP"WT"\X"u\"v`"xd"zh"|l"p"t"x"|"""""""""""""""""""""""""""""""""## #2 #a#{### #$#(#,#0#14#K8#P<#i@#}D#H#L#P#T#X#\#`#d#nh#ol#pp#rt#tx#v|#x#}######## #!#"#$#&#+##################$$$  $$T$`${$} $$$($,$0$4$8$!<$3@$4D$5H$7L$9P$;T$=X$B\$`$d$'h$,l$.p$0t$1x$2|$8$U$V$W$Y$[$]$_$d$$$$$$$$$g$m$n$p$r$t$v${$$$$$$$$%%% %%%%%3 %4$%9(%b,%p0%4%8%<%@%D%H%L%P%T% X% \% `% d% h%% l%& p%( t%* x%/ |%0 %K %M %O %Q %R %W % % % % % % % % % % % % % % % % % % % % % % % %I %K %M &O &P &T  & & & & &  & $& (&< ,&A 0& 4& 8&' <&) @&+ D&- H&. L&/ P&3 T&X&\&`&d&h&l&p&t&x&|&&&&!&"&&&& &"&$&&&(&-&9&@&& &7&A&C&E&F&J&V&O&P&Q&S&U&W&Y&^&'+'4'8 ';'n'o'q's 'x$'(',' 0' 4' 8' <' @' D'O H'` L'~ P' T' X' \' `' d' h' l' p' t' x' |' ' '(!')!'+!'-!'/!'1!'6!'@!'W!'Y!'[!']!'^!'_!'c!'#'#'#'#'#'#'#'#'g$'k$'r$'v$'$'$'$'%( %(7%(<% (>%(@%(A%(B%(I% ('$('(((,((0((4((8((<((@((D((H()L()P(')T())X(+)\(-)`(.)d(/)h(9)l(+p(+t(+x(+|(+(+(+(+(+(+(A,(P,(x,(,(,(,(,(-(-(+-(--(/-(4-(5-(6-(<.(=.(?.(A.(C.(E.(J.(H/(P/(/(/(0) 0)T0)i0 )p0)0)0)0)0 )0$)0()1,) 10);14)G18)I1<)K1@)L1D)P1H)T1L)1P)1T)1X)1\)1`)1d)1h)2l)3p)3t)3x)3|)3)3)3)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)5) 5)5)5*5*5*5 *6*6*6*6* 6 * 6$* 6(*6,*60*64*68*6<*6@*6D*6H*6L*6P*6T*6X*6\*6`*6d*6h*7l*7p*7t*7x*7|*7*7*7*7*7*8*8* 8*;8*@8*B8*D8*E8*F8*M8* 9*9*9* 9*&:*@:*F:*m:*;*;*;*;*;*;*;*;*=*=+=+=+E? +^?+b?+k?+?+? +?$+?(+?,+?0+?4+@8+@<+A@+AD+AH+AL+AP+AT+AX+A\+ C`+Cd++Ch+4Cl+9Cp+=Ct+>Cx+lC|+mC+oC+qC+sC+xC+C+C+C+C+C+C+C+C+C+C+C+ D+D++D+4D+5D+c8/DcX6@\6[`6cd6jh6l6p6t6x6|666666666666Y6Z6\6a6p6666666666 66666A6P6777 7N7P777 7$7(7,7N07P4787<7V@7`D7H7L7P7T7X7\7`7 d7bh7pl7p7t7x7|777^7`7}77777777777r7s7t7v7x7z7|77L7P7k7o7p7t7x777888 878;8<8>8@ 8E$8 (8,8+082484886<87@88D8?H8L8P8T8X8\8`8d8h8Sl8`p8zt8x8|88888888888*85898|888888888888 888+8,84888999 99999 9$9(9,909 4989 <9E@9PD9gH9iL9kP9oT9pX9w\9`9d9h9l9p9t9x9n|9p99999999999999999596979<9M9P9g9n9p9t9u99E9F9G9I:K:M:R ::::: :$: (: ,: 0:4:8:#<:0@:D:H:L: P:^T:`X:w\:y`:~d:h:l:p:t:x:|:::::::!:0:G:I:K:M:N:O:S:::::::::w::{:::::`:a:e;i;m;q ;u;v;w;; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;;; ;";$;);;;0;8;>;?;C;J;N;P;R;T;Y;5;@;`;e;k;o;s;2;6;8;:;<;A;X<`<< <<<<< <$<(<P,<Q0<S4<U8<d<<@< D<hH<sL<BP<GT<X<\<`<d<h<l<p<t< x<*|</<0<J<f<k<<<<<<< < <" <$ <& <* <+ <4 < < < < < < < < < < < < < < = = =+  =, =. =0 =2 =4  =9 $=g (=p ,= 0= 4= 8= <= @= D= H= L= P= T= X= \= `= d=$ h= l= p=! t=# x=% |=' =, =x =y =z =| =~ = = = = = = = = = = = =========f======&>0>Y>` >>>>> >$>(>*,>.0>4>8><>@>D>H>L>P>T>X>\> `> d>h>l>p>t>x>|>>>{ >| >} > > > > > > > > >{!>|!>}!>!>!>!>!>'">0">K">T">Y">^">b">c">m">#>#>#>#?#?#?# ?#?$? $?;$?D$ ?I$$?N$(?R$,?U$0?_$4?%8?%(?@(?[(?h(?l(?m(?s(?(?(@(@(@( @(@(@)@)@") @$)$@&)(@'),@+)0@2)4@*8@*<@*@@*D@*H@*L@*P@*T@*X@*\@+`@+d@+h@+l@,p@ ,t@:,x@@,|@q,@r,@w,@~,@,@,@,@,@,@ -@-@#-@-@-@-@-@.@ .@E.@@@@ @X@`@b@g@p@@@@@A AA' A)A+A,A0A A$A(A,A0A4A8A@Hj?LT Xj`Fdjlwpkx|kikkjwjjgjjjj j j& j(j w$j,0j8,<jD/HjP0Tj\?`kh?lktOxj]jjrj,5 6 6 <5 6 0p (008p@HPXP`phpx`    `p P` (08$@%H(P)X@*`+h.p/xp222345p555`667889P999:@:; ;(P<0<8?@@HLPPMX@N`Nh0OpOxQQRRTUPUU0WWf`j@mpn0o`tuv|`@ (P08Ќ@HPX`ph`pPx@00 (08@HPX`hвpx@  @` ( 08p@PHPPPX`0h0px0```000`0 (08@HPX``hpxp0    @! %)+P,- 0 1346 8? C(C0C8D@pDHDPEX`E`@FhGpHxH`JUU@VVZ^ aabPccff@gjЉ (080@HPPX``аh0px`0p @p ` P    P( 0 8 @ PH P X ` `h p  x p    `   P  `       P p  P  0 ( `0 08 @ H P X @` `h  p x 0      p        0 `        0"  $ % P' @(( )0 *8 +@ +H  ,P ,X ,` ,h  .p x p   P @    P  S T T Y Y a b f f  g i Pi( pj0 k8 k@ `oH oP `pX ` h зp x P    ( 08PgPIp@`@HHPh@  (0@8`@Xp`@//7001@HPX?0 Sj| 2 @( 08@HPX``@h px`@`@  ` 00@PPX`px P@  p# :0 @EPp`Wpg u`  0`@P`p ` !   - 0p@: Phhph`  (@08@HP`XX`@h@/p/x./`!2`2 211`1O`O ONN`N NMM`M M@3 @4(40385@@5H5P4X4``6h 6p5x@ `   IHH`H HGG@GGF F(@F0F8E@-H@-P7X@7`7h6p8x8@88E@EEDD@DDCC@C9`9 9100@00 @@(@0 B8A@AH`APBXB`Ah@pLxL,,`, ,++`+ +**`* *))`) )((`( ( '('0`'8 '@&H&P"X#`"h"p#x`#@$$$$@&&%%@% ` @ `( 08`@ HPX `hp@x  `  ;::@::` ` `  (08`@ HPX``@hpx@@@@@ (0@8@HP@X`hp@x  @    @    @    @  ; LKK `K( K0J8J@`JH JPIXP`Ph@PpPx <??@??>>@>@= !<<==I;@S @T S R R `R(  R0 Q8 Q@ `QH TP  UX T` Th Vp Ux `V V [  [ Z Z `Z  Z Y Y `Y  Y X X W W @W W .  . \ `]( ]0 \8 \@ @\H ^P ^X _` @_h @`p `x a a a ` f f `f  f e e g @g  c b b `b @d d c c @e e( d0 d8 n@ `H  P `X ` h p x     `    `    `   `~  ~ } } `} ~  ( `0 @8 @ H P @X ` `h  p x      `    `    `    @ @   ( @0 8 @ H @P X ` h @p x   @    @    @     `  ` (`0 8@ HP`X `hp`x  `` @@`  ( 08@HPX@`hpx@@` @@`@` (`0 8@H@PX`hp`x` ` `@`  `  @(08`@ HPX`` hpx`@@@@@ @(08@@HPX`` hpx`@@`@` q`  `(q0@q8q@pHpP@pXp`ohop@ox`v` @@ ` tt@tt @(`u0 u8s@`sH sPrXr``rh rpx` ` yy@yxx`xxww@wwv (0@8@HP@X`h px}||@||{`{ {z vu`z z@@`  `( 08@@HPX`` hpx`  `` ` @ (08@@HPX@`hp`x ` ` @@@ (08@`H P X`h`px@@@@@` (0`8 @HP`X `hpx`` @`" "!`! !  `# #""@  (`08@@H PX``h px @    @  @@  `   ( 0 8` @ H P`%X %`$h$p`$x $##@  @ @@ ,+ +(@+0+8*@*H*P)X)`@)h)p(x(@((''@''&&@&&%``  (@08`@ HP X` hpx` ` ` ` ` @ (0@,8,@`-H -P`/X /`.h.p`.x .-@22`233@344`4 455@587 7(@70686@`6H 6P`;X ;`:h:p`:x :99`9 988<;`<1 h #vPh 1  % 0@f %spR %WZYZ& %Z 0@Pv %  %D %P'6 %@+Pv %[ %w & ) *' * , ' '. )3T )w;` )m )M{ )# )XO ) ) )@S )2r )W )" )Zs )Y# ) )u ) ) ) )~@ ) )PL )q )Z ) )M )  )Ծ )% )M1 )= )[P )6W )\ )@h )t ) ) )u ) )@ )[^ )G ) ) )r )j )4 ) ) ).( )\9 ).E )Q )I] )ci ).u )1 )  ) )# ) ) )% )) )_9 )z )3 )z% )^1 )*`> ) K )/c )p )8~ )B  )  ) )6 )  )ܯ )  ) )? , )9 )!F )0iS )`` )$7m )z ) )5K )$ )b )B1 )Q  ). )VT< )J )dX )Lf )?$t )\ ) )  ) Q ) )&T ) )v )P ) )( ) ), ): )QH )VTV )6d )ir )Ե )l )w} )_ )Ç ) ) )= )# ) )GN )f- )2< )K )u=Z )gi )x )* )d= )j )~ ) )@2 )" )Q )# ) )@. )= )iL )i[ )j )8y ) )b( )n )i ). )'  )z% ) ) )- )7 )0- ) ,< )K )1Z ) i )vx )  )o] ) ) )< )E )Q- )DA ) ) ) )-, )< )HQ )^ )au )D )nd ) )N )XR ) ) ),2 )+@ )DM )u V )+^ )k )R5y )x ) )@ )=F )" )X )_a )r ) )W )ܯ )& )S4 )AB )_ )k )w )  ) )e1 ) )F ) ) ): )- )9 )0 F )@tT )ba )n ){ )R. )% ) )r ) ) )I ) ) )F )X )! )2 . ); )H )` )m )z )K )  )F ) )r )m' )j~ )+ )9 )G )#U )^c )Aq )+ )w ) )  )^ ) ) ); )- )y0 )0  )/ )@' )i5 )!C )VQ )=_ )m )5{ )sT ) ) )6{ )! ) )J )4 )b )T# )/ ); )H )߭W )hLd )ܯx )\ ) ) ){ ) ) ){ )*  )u32 )5%N )=\ )j ) )ʺ )^ )* )u3 )M ) )r )T )p )P) )V7 )k )w )\ )( ) )E ) )G  )0 )|1< )cJ )cY )x )k ) )@O ) )r ) )[ )A )B( )5 )rC )5Q )_ )w ) ) )& ) )`D )k. ) ) ),z ) )  )  )\.' )5 )rC )Q )?'_ )m ):{ )yJ ). ) ) )ar )1 ) ) )V% )y4 )\C )S )Lb )Kq )r )>@ )P0 ) )p )6 ) )!f ) ) )5 ) & )5 )KD )S )33b )q ) )y )e3 ) )  )  )  )- )r ). )- )JS% )S4 )W6C )R )a )Qp ) ) )œ ) )D ) ) )xH ) )0 )k% )G5 )CE )U )0 e )Au )? ) ): )E ):i )6 )U )ap )q ) )l% )f%4 )R )W0a )p ) ) )L" )G )L )Rn ).( )N ) )ӭ ) )|*$ )Ly3 )9B )Q )` )|So ):~ )g  ) ) )% ). ) )  )gM )̣ )c )C$ )#3 ) B )xMQ )6` )o )M6~ )7 )Y. ) )d ) )H ) )T )s. )p " )1 )a@ )eO ){^ )vm )| )^ )T )) )F )Er ) ) )m )! ) ! )K3!! )0! )~?! )cN! )OR]! )Z5l! ){! ):! )! )! )! )M! )T! )#! )2'! )," )O" )G " )g/" )K>" )M" )T1\" )k" )i=z" )0" )" )N" )"" )" )" )Y:" ))^" )bb# )^# )# )Y.# )=# )xL# )[# )-j# )'y# )# )# )# )# ) 1# )p# )d# )# ),$ )D$ ))$ ).$ )۟=$ )5L$ )[$ )[ j$ )@y$ )d$ )cY$ )$ )$ )6-$ )t$ )`$ )$ )% )% )3w% )QH.% )*=% )1OL% )[% )\j% )Ay% )% )@% )-% )\% )G% )f% )% )ͱ% )& )Gh& )۞& )"q>& )LM& )G$\& )pk& )rz& )?& ) & )5& )f& )V& )& )%& )& )' )\' ) !' )61' )װA' ).P' )m_' )n' ))~' )(' )1' )ښ' )ښ' ),' )4( )xB( )P( )^( )cl( )H`z( )K+( )( )#( )d( )3( )c( )m( )4 ( )) )a) )M>) )K) ))9c) )?6y) )) )) )Hs) )) )%) )ש) ) t) )8* )5* )q** )h8* )rF* )T* )b* )6p* )S ~* )u[* )* )B* )* )#* )* )^F* )* )+ )S+ )r"+ )7?3+ )9+ )?+ )E+ )-K+ )3Q+ )7W+ )]+ )c+ )wi+ )ho+ )[u+ ){+ )+ )s+ )/+ )M+ );+ )К+ )-+ )T-+ )+ )- + ).M, ) , )~ , ), ), ), )%, )+, )1, )dQ7, )=, )C, )$I, )$O, )U, ) ):> )&> )C> ):^g> )t> )> )=> )R> )}> )> )7> )\m> ).> )O> )? )? )m"? )fk0? )D? )~P? )IZ? )Lg? )Qt? )? )ђ? )? )T? ) ? )%? )A? )? )U? )@ ) @ )`-@ );@ ) }H@ )U@ )b@ )Sp@ )R}@ )d=@ )@ )n@ )J@ )&@ )@ )i@ )i@ )9@ )+A )mA )-A )r(A )6A )̣CA )ޫPA )hF]A )0{A )cA )A )A )BA ))A )A )A )A )rA )B )+B )8B )FB ) RB )"/_B )mB )NyB )B )B )aB )B )@B )B )#k C ),C ):$C )2C )@C )@OC ).`C )fC )/lC )3rC )yxC )46C )g C )C )6C )C )C )C )|SC )C )HR D )D )(D )7D )ED ).SD ){5bD )[1qD )IeD ) D )=D )' D )hD )D )LD )hD )P#D )ZD )' E )"E ))E )37E )LEE )SWSE )aE )7oE )a}E )E )E )]-E )@E )QE )E )E );,E );E )P F )F );.%F )03F )AF )OF )&]F )kF )yF )HF )OF )u$F )F )F ) F )ciF )mF )F )arG )yG )^)$G )j2G )Y4@G ) NG )(\G )jG ):xG )GG )G )G )G )KG )GmG )eG )KG )H )"H ) #H )P1H )ܠ?H )arMH )![H )|oH )H )6H )CH )}H )[H )aH )gH )VrH )&I ) I )r#I )F3I ) CI )OSI )cI )ysI )lI )I )}I )5I )-I )cI ){I )I )$J )j2J ))1AJ )PJ )6_J )GzJ )s.J )J )>J )J )VJ )lJ ) J )"qK )\K )37K )VAK ) PK )"^K )'lK )WzK ) K )K )K )K )dK )K )bK )rK )K )L )L )"L )CCL )CPL )A]L )@jL )`6L )QL )nL )UhL )L )L )inL ) M ) M )>M )KM )0XM )LmeM )rM )@}M )zM ) hM )M )M )mDM )M )~QM )7M )M )$N )N )N )5(N )E25N )lBN )ION )*{N )N )"N ) N )E2N )5N )N )? O )%O ) $O )1O )rJO )^O )hO )UrO )<|O )O )HO )O )O )s O )=sO ) aO )jO )yvO )O )6P )P )} P )r-P ):P )jhGP )rTP )aP )pP ) $P )P )lvP ){P )]P )P )[P )̣P )P )Q )Q ).D/Q )=Q )KQ )YQ )gQ )auQ )-Q )|SQ )@$Q ):Q )Q )%Q )Q )!SQ ) Q )gMR )YR )R )!d+R )[9R )GR )72UR )cR )qR )MR )UR )ےR )R )R )R )R ):R )lR )zR )R S )S )-S );S )HS )CUS )@xbS ):3uS )^S ),S )ORS )S )ndS ).S )зS )S )*S )6S ) T )T ))T )=T )GT ):TT )YaT )4XnT )h{T )@T )<T )T )T )T )T )T )T )T )QU )U )_#U )=U )KGU )^QU )ppU )zU )U )U )*U )(U ) U )!-U )U )#U )jU ),V )~V )V )E+V )}8V )GUEV )RV )r`V )nV )"?|V )$V )V )HV ) V )4V )iV )V )W )xW )%#W )%1W )?W ){MW )9[W )iW )DwW )W )W )+W )W )6fW )y(W )tW )X )X )g(X )Ai5X )BX )jOX )PbX )0lX )RvX )D&X )X )(X )OX )fX ) X )X ))X )tX )X )2Y )%Y )ƽ*Y )K8Y )FY )X/TY )cubY )pY )>~Y )Y )/ Y )+Y )Y )ܯY )oY )1Y )[Y ) Z )UZ )@'Z )b4Z )VTNZ )hL[Z )1hZ )#uZ )Z )Z )Z )>Z )FZ )yZ )Z ); [ ) [ )[ )O*[ )7[ )D[ )Q[ ) ^[ )m[ )o[ )S[ )m[ )^=[ )[ )q[ )[ )`q\ )-\ )4 !\ )a.\ );\ )H\ )U\ )Ѻs\ )]\ ){\ )r\ )Z;\ )ܯ\ )v\ )\ )R(] )@] )] )3)] )[;] )@9H] )U] ){b] )Yp] ) (] )5] )g] )] )H] )] )ԑ] )-] )C] )^ )+%^ )13^ )Y@^ )fmM^ )Z^ ) g^ )t^ )=B^ )@^ )>^ )7^ )^ )"^ )^ )^ )*^ )^ )o_ )v_ )ܯ_ )-_ )[3_ )9_ ))?_ )E_ )K_ )DQ_ )DW_ )]_ )+c_ ) 8i_ )o_ )u_ )({_ )y_ )_ )_ )W_ )0_ )Zn_ )_ )Z2_ )p_ )t_ )$_ )_ )R` )P` )a!` )AN'` )-` ) 3` )9` )o?` )dE` )6K` )'Q` )yY` )c` ) m` )Sv` )}` )` )i` ){` )߃` )'` )-` )A` )` )` )5a )IMa )@+a )ria )$wa )wa )‘a )a )@a ) a )za )a )va )a )a )D b )J2b ) Tb )1 ab )@nb ){b )%b )b )T~b )&b )b )[5b )7#b )Sb )^ c )@c )7$c )A1c )#>c )tKc )@Xc )Jec )rc )zc )c )Q{c )I_c )*c )>5c )Nc )5c )(c )c )d )1d )Rd )+d )9d )bd )>yd )0d )d )/+d ) d )d )0d ) d );d ) e )0l e ),e )lz9e )`e )<oe )Y|e )e )e )ae )e )#e ){e )Se )e )e )e )Ge )e )e )f )f )7#f )_-f )_@f )Mf ) ff )ptf )kf )f )f )ܯf )\.f )f ),6f )f ) g )'g )C4g )J]g )?jg )Ixg )Ig )g )@g )Cg )Qg )g )g )ag )h )rh )@h ))(h )5h )Bh )uOh )Pg]h )zgh )th )oh )Sh )`h )h )h )h )&h )2h )|h )!i )ii )ii )4*i )nn7i ) ?Di )Qi )^i )vi ),i )i )]i )oi )3i )|$i ) j )j )Z;4j )6Mj )Zj ) gj )6uj )j )kj ).Xj )S,j )Bj )|rj )inj )j )rk )"k )/k )fk )6|k )1k ),k )k;k )k )] l )Z;l )./l )rCl )Ql )|$el ),sl )l )[l )l )rl )'!l )@ l )l )l ) m )u,m )Em ){Sm )/!am )0om )b1}m )@m )Am ).m )?m )e*m )m )n )*n )9n )^Gn )<Un )tcn )<qn )n )GUn )z"n )n )!#n )-n )n )n )en )o )[o ) o )*?o )B\o )X,fo )"to ){o )VTo )Fo )@o )o )o )0 o )_o )o )Ԇ p )lp )0:p )!Sp )d`p )*p )8&p )qp )? p );p )mp )}p )Np )lp )Dq )pq )B$q )~2q )[@q )Nq )]\q )VTjq )1xq )Lq )Ncq )q )8q )bq )?r )Qr )$r )0Gr )Ur )+cr )!qr )r )!r )r )2r )r )r )*r )r )r )& s )s )~'s )65s ) Cs )1Qs )_s )FCms )|s )W#s )s )w,s )x!s )<s )0s )45s ).Zs )ot )Mt )R!t )g0t )"?t ) ]t )lt )H{t )t )&t )^t )t )t )t )Kt )rt )FHu )u ) u )l/u )S4>u )'Mu )_\u )ku )xzu )u )yu )?u )#u )u )ӯu )u )Tuu )"Uv ) 6v )E@v )GuOv )(Yv )rv )HKv )3v )rv )cv )w )ow )A w )]&w ),w )C2w )i8w )C>w )Dw )!Jw )<Pw )UWw )^w )ew )Htlw )tw )9w )Z_w )$w )Nw )'w ).9w )00w )Pw )m'w )w )Zx )+x )1/} )=} )qK} )(Y} )?(g} )u} )} )} )} )} )]} )#} )} ) o} )} ) ~ )uO~ )5#~ )1~ )-?~ ) M~ )[~ )ai~ )w~ )--~ )~ )~ )i~ )~ )#~ )/~ )m"~ )~ )d ) )  )/ )TG )lYV )-e )t ) )C )B' )! )'1 ) )5 )nl )A ), )2]@ )0>N ) [ )h )iu )y ) ) )w ) ).À )vЀ )l݀ )% ) ) )H& )A- )P>; )//I )W )qe )s )uy )a@ )6 )V )X )sdǁ ) Ձ ) ) )x )= ) )x) )r7 )E )S )z)a )o )c|} ) )B )`H )^ )Ƃ )sՂ )a )`h )i )j ))! )$0 )}? )CN )] )Eyl )${ )8 ), )V )^ )Qƃ )Ճ ) )/ )m )U )a  )`/ )Ӵ> )^ )?m )5| )) ){ )` )w? )΄ )߄ )+ )f )6 ȅ )TՅ )x )) ) )0 )8h )ޅ ) )C ) )0Ά )܆ )q ) )^ ) )r )Y* )inE )GUR )Qk )> x )VT ) )ȇ )Շ )7 )Q )T )o )'# )Q0 )= )@K )jf )y )0ڈ )$ )J2 ) ) ) )_ )7! )0. ); )o] )j )w )P ) )N ) )1 )Љ )݉ )2 )J )( )]5 )&xH )U )b )^Wp ) )f )f )o )4 ) )5D )7 )PD )Z )f )u| )&x )6 ) ) )^WNj )E ) S )Z )" )' )B6 )C )QP )4] )zj )w ), ) )g ) )*ƌ )ӌ ) )+ )19 )@S )` ) m ){ ).7 )Mx )_5 ). ) )k͍ )wڍ )$ ) )e  )yC )| )JV\ )i )Ev ) ) )U )3 )X1 )Ŏ )<Ҏ )wߎ )Y' ) ) ) ) " )S/ ) = )H1J )pkW ) j )w )=s )s )ď )4+Ώ ) ) ) )e )pk )% )2 )? )L ) [ )Nw )e )k ) ) ) )9 )! )% )TQ; )ıH )TU )' )r )- )1U )' )ϑ )ݑ )3 )Z )4* ) )X# )JX1 )]O? )7M )+W[ )Ci )w )< ) ) )" )7 )<ڒ )! ) X ) ) )ȁ3 )B )Q )` ) o )h~ )`8 )] ) )N' )ɓ )ؓ ) )7 )1 ) )i# )l2@ )O )^ )Nm )e0| ) ) ) )6ǔ )֔ ) ). )( )mJ )! )g0 )W? )>Y )z )< ) )ŕ )Bҕ )vRߕ )o ) )C )y0 )" )#0 )y )y )' )o ) )* )u ) )է )^ז )Jz )\ )Z )d ); ) )/ )# )1 )= )J )lW )d ) )A )4 ) )0˗ )ח )H ) ) )  )d4$ )2 ) @ )N )b )p )N~ ) ): ) )ӹ )Ę )Ҙ )%| )v ) ) ) )9 < )(rH )3TY )W_ )Ge ) l )Wo )а ) )Ǚ )dԙ )Î )w ) )M )^ )" )[/ )ky< )mJ )W )d )Qq )~ ) )b" )H )% ) )$͚ )Uۚ ) )# )xo )H )1' )B5 ):4C ) Q )+_ )}m ){ ) ) I )`c ) ) ) ). )L5< )UJ )_)X )Ef )st ), ) I )h )+ )9 )1G )aU )c ) q )o )! )a )\ )@ )ŝ )ӝ )# ) )X ) )r )( )&6 ){tD ) R )` )| ) ) )P )m )G*Ԟ ) )0 )( ) )" )( )6 )D )jS )a )lo )} )Z )y ) ): )Ʒß )џ )4ߟ ) )Š )OԠ )r ) )d ))V )c )+q ) ) )u )Ρ ),ܡ )" )1 )F) )u )" )u0 )=> )L )Z )h )nVv )} )u ) )ڿ )Y )H )-6S )B )I@( )5 )r1N )0[ )Qt ){ ) ) )Mlȥ )ե )2 )( ) )M )  )" )^0 )k> )_L )~Z )Xh )v ) )  ) )0G )  )sʦ )kئ )) )E ) ) ) )r, )z: )J\H )DV )Oo )y ) )| ) ):1 ) ) )@٧ )  )Lm ) )A ). )S< )#J )X )f )^ )> )+ )1m )! )kͨ ) )l )) ):i ), ): )_[a ) o )"} ) ) ) )# )qé )Mѩ ) ߩ )h )è )Hp )J )RC% )D[3 )A )eO )n] )k )yy ) )d, ) )+ )6 )}jͪ )sZ ) P ) ),q' )"1 ) 2E ) S )(` )m )z )6 ) ), ) )+ ) _ȫ )ի )Q )Xd ) ) # ).s )5k# )I0 )|= )J )wW ))d )q )Dc ) )F0 )aì ) )W )- )+ )-ʭ )>ح )q ), ) 9 )F )! ):[Я ) N ), )S9 )F )CS )Xb` )|$m )@fz )@ )H ) )Z;3 )} )N )^q ) )A )Ŵ )˴ )0Ѵ )! )6[ )Uqe )T )% )VT )vζ )۶ )7 ) ){ )$5 )^, )&; )YJ )Pv )W )c )P )o )R )ķ )aѷ )o޷ )v )  ) ) )#& )M3 )7;@ )M )ܑ[ )~i )Bw ))= )] )p )S )/ )0ȸ ) ׸ )R )} )O% )V ) )! )k. )6; )H )_U )c )o )| )] )L" )P )H )ȹ )?ֹ ) )C )6 ) )VT1 )&x> )rK )j )1w ) )h ); )S̺ )?+ں )g ); )y0 )d )+ )s. )Q2< )#J )PX ) f )^t ) ) ) )%Ȼ )Ի ) )؜ )pX ) ) )1, ): )>H )V )Qd )Qr )P ) % )P )h )@ ):ǽ ) ͽ )YԽ )HZ ) )8z )  )3 )G" )T )i )\v )VT ) )< )۱ ) )Ͼ )Sݾ )Z; ) )# )( )^# ) 1 )? ) ) )3& )] )7 )Q )) ) % ):8 )k)E )y0R )_ )Cl )y )L )#m )  )@$ )a1 )M )/ ) ) )VT )8; )<H )VTo )?| )A )r ) ) )j' ): )aa )%~ ) )jG )7 ) )T ) ) )/ )*) )q, )gR9 ) S )el )z )5 ) ) )3& )] )  ) )m'd )+u ),{ )4 ) )_ )B )7 ) ) )E )/ )S )d ) . )< )J )^ )5 ) )& )} ) )8 ) )B  )`R )D( )5 )ȆB )#O ))\ )Go ) )) ) )" )VT ) )  )o` ) m ) )VT )r ) ) )G )R ),v ) ) )-) )w:6 )rD ));` ){m ) ) )5 )U )r )؀ )r )d )`R ) )' )Z5 )Q )b_ )^m )){ ) )ī )- )p )5 ) )W+ )x  )xA )L ),- )Y< )&K ) Z )Ƨi )%(x ) )aL )U ) )n< )w )Ȇ ) + )y0 )5" )I+ ): )#I )hY ):i )vy ) ). ) )) )* ) ) )j ) ) )z )], )G: )RH )V )d )jr )lp )6 )= ) )  )o ) )N ) ) ) )}  )Ҷ( )i` )!r )w ).} )4 )[ ) )b- ) ) )h )F} ) )5 )@ )Y ) ), )͍ ) {# )^- )B< )J )mHY )h )yw ); ) )~z ) )G ) )~ )A )@ )v ) )& )C6 )j1F )3V )f )"v ) )e )X ) ) )mO )^ )/ )v )+ ) )M) )!9 )I )pY )i ) *y )iK ) ) )o )J )\y ) ) ) )y )Z% )** )؄9 ) H )g )}t )VT )v )@ )mO )R )X )- )4 )J )# )E/ )|Z )S8) ) 6 )oC ))] )6l ) )'l )*k ) ) ) )H% )R ) )N )[ )VTh )vu ) )~ )M )|; )8 )- )_ )R )sZ ). ): )z )] )+ )M8 ))Q )} )[x )VT ) ) )J )7 )& )* )- )_ )R )sZ& )z3 )]@ ) +M )~f )7 )Ȇ )VT ) )~ )> ) )% )]2 )=? )L )LY )#m ))C )VT ) + )8 ) )y0> )7O )U )[ )\l )W| )U )A )5C )c ): )& )\ ) )r ) ) )l" )o( ). )%5 )$C )`~Q )_ )am )d| ) ) )o )" ) )I )I )) ) )p )֮ )w\ )G )F )3 ) )( " ) 0( )h. )5 ) $C )eQ )<_ ):m )g )f[ )  ) ) )c ) ) )R# )`~0 )= )rU )5"_ )n )| ) )= )#p ))+ )X ) ) )i ) )< )3 ). ). )3< )1u )w )I )m7 ) )+B ) )  )9 )}" )O )_ ) )( )"5 )OiB ) ^O )\ )i )qv ) )  ) )! ) ){ )z ) ) )a )aL" )_/ )@ )w )Q )* )L,7 ) E )T )7b )p )L"~ )\ )~ )Ά ) ) ): )߂ ) )L, ) )JO& )4 )VTB ) wQ )2` ) )t ) ) )5 ) )i )Ƥ ) )J )Y )> ) )  )< ) )K) )X5 )A )NO )@ ) )y )- ) ) ) )߂ )1 ) )b )B ( )`R6 )D )4R )Ȇ` )n )#| )" )^ )s )8F )K ) )w )p )R )v )F& ){d4 )bB )x P )Y^ )l ) z ) ) ) )M  )-? ) )B )k ) ){ )* )q: ){J )#Z )(j )z ) ) )) )pi ) ) )h6 )0 ) )y- ) < )@kK )#Z )*j )z ) )  )I# )  )7 ). )b )q )n- )r ):* ) 0: )3J )r'Z )ej )sz )U ) )F )̜ ) )s ) Z )I ) ) )2* ): )J )Z )Gj ) z )Ձ ) )y )' )f} )Z )5 )# )ѳ ): )$ )i$3 )C )uR )b )1r )E( ) ){ )3 ) )e ) v )e )8S )3= )/ )Cn? )N )S] )[l )V3{ )v )" ) m ) )ݝ ) )^ )s ) )VT& )>4 )-B )RP )z^ )]l )sZz )l| )/ ) )  ) + )~ )b )Z@ )8 )9 )/C )yE] )Zk )O&y )=% ) )# )^^ )l )@z )Q )/ ) )3 )> )U )y )u )] ) )fB ) ) )C ) ) )  ) )S ) )X )Nq )'' ) ) ) )</ )Z< )V )M )a\ ) ) )w+ )[ ) ) ). )=j )% )6 )ɞ< ){B )H )O )R] )j )w ) ) ) )/ )F ) )R )G )R )ز )bM )o,1 )W= )J ))1X )d )y ) )E ) )g ) ) )w& )w )d )_ )< ) ), ); )*J ).1Y )-h )w )\ ), )m" ) )aP )@ ) )t* )4% )#2 )Z? )m'L )d )kPp )Bz )< ) ) )h7 )  )k ) )W )) )37 )D )@ZR )h` )m )z )= ) )C ) )g ) )^E )|V ) ! ). ); )O*H )[ )dl )e6r )KPx )$u~ )- )k )r ) )_G ); ){b )y ) ) ) ) );% )y03 ):A )O )U"] )k )+y ) X )' ) ) ) )9 ) )^ )+' )% )8 )'% )/ )q= ) K )Y )Rg )]{ )s ) )Y ) )r )6 )K ) )p )L ) )*! )5C/ )ط= )(K )Y )z5g )ARu )KG )I )f )s ) ) ){ ) ) )` ) )d ):W+ )9 )9G )U )˙c )q ) ) )g )- )  ) )2 )۹ )_{ ), ) . )m< )Z )nd )r )  )w ) )@P ) ) )q )  ) ) ) )@ )%R( ) 6 )aD )R )w` )y ) )J ) ) )B )> )1 )  )A ) )'1 )> )K )4X )e )r )B> ) )ݪ ) )O ) ) )- )  )% )qj/ )9 )C )M ) )[ )-i )0w )s )T )E ) )~_ )@ )l2 )Y$ )' )' )i5 )XC )4*Q )E _ )Cm )U{ )  )r )) )b ) )Ҏ )9 ) ) )  )nd )J- )Л3 )9 )A )x )^ ) ' )5 )B )}O )\ )wei )v )  )V )e ) )) )l )& )v ) )e ) } )e ) )], )9 )eF )1S )` )bm )j`z )e ) ); )C )] ), )A: )jWI )"V )P&d )Cr )] ) )A )we )! ) )C )] ) )A )/  )): )t( )C6 )]D )R )A` )kTo )| )^% )C )] ) )A )  )h )f ) )K )& )! ) . ); )fH )^'U )>b )q ))~ )̥ )C )] ) )p )h )/1 )] ) )  )  ) &  )/14  )]B  )P  )B_  )l  )Iz  )/1  )]  )  )n  )we  )%  )O  )/1  )]  )  )c  )we"  )kT1  )>  )rL  )/1Z  )]h  )Xv  )*  )p  )kT  )w  )e  )/1  )]  )  )  )3  )[  )8  )TU+  )&8  ) E  )IR  )<_  )l  )L|y  )  )yK  )  )T  )  )  )  )!  )  )  )C  )X  )%-  )we<  )I  )W  )e  )s  )!  )  )  )C  )X  )%  )we  )&  )_  )%!  )X  )Y)  )7  )E  )T  )b  )p  )}  )m4  )(.  ),  )Zk  )  )  )}.  )Zk  )  ) ); ). )u = )ZkY )Un );{ ) )* ) ) )* )] )( ) )Zk  )qc )*% )4 )B )weP )e^ )*m )%){ )F ) )ُ )W ) )Y )G ) )M ) )) )" )0 )we> )L )*[ )/m )$az ) )*@ )F )k )q )`Z )I3 )5 )F )k )y )(# )0 )we= )J )!W )ed )vq )C~ )X )% )e ) ) )e )o )$ )6 ) )>  ) ):v' )Q4 )A )O )%2] )xk )f{ )! )0 ) )we )e ) ) ) )we ) )! )e# )v1 )C? )XM )%[ )ei )ew )_ )%! )x )uk )we ) )! )e )v )C )X )% )e. )%; )vI )W )e )!s ) )6x )C )X )% )we ) )_ )%! ) )  )= )) )f7 ) E )S )4a ) %o )} ) )d ) )|T ) ) )T  )b ) )+  )  )% )|3 )eA )dO )] )uk )ez )s )  )we ) )! )e ) )C )X )% )v )U! )/ )we= )K )!Y )eg )u )C )X )% )v )e )_ )%! )e )+5 )e ) )e )&+ )49 )weG )U )!c )eq )X )v )C )X )% )e )FE ) )we ) )!  )e )X' )v5 )CC )XQ )%_ )em )e{ )_ )%! ): ) )we ) )! )e )v )C )X )%# )e1 )e? )eM )[ )5i )5w ) ) ` )] )! ) )! )we ) )C )X )% )e )v- )_; )%!I )AW )ee )`"s )^3 ) ) )* )_' )6 )we ) ){ )bg )*, )_': )6H )weV )^e )r )ʦ )we ) )! )e )v )C )X )% )e )A  )e )`") )?6 )GE ) S )wea )o )!} )e )v )C )X )% )e )e )e )e )H~  )r' )4 )NB ) P )we^ )l )!z )e )v )C )X )% )e )e )_ )%! ) )e )# )|1 )we? )M )![ )/i )sw )C )X )% )v )e )b )Iw )C< )  )e  )9A  )  ).  )e<  )K  )BX  )f  )|t  )we  )  )!  )/  )s  )C  )X  )%  )v  )e! )_! )%!! )*! )8! )F! )wT! )b! )Jq! )! ).! )! )we! )! )J! )3! )R! )e! )!-" )B+" )"9" )EG" )U" )!c" )3q" )R" )C" )X" )%" )we" )e" )U"" )e" )v" )Yz" ) # )G# )j(# )uq6# )"D# )ER# )`# )!n# )3|# )R# )C# )X# )%# )we# )e# )_# )%!# )Yz# )$ )$ )Yz$$ )42$ )+h@$ )N$ )\$ ){$ )k$ )$$ )Yz$ )$ )5$ )Yz$ )̀$ )! % )% )(% )Q6% )YzD% )*S% )6`% )n% )*|% )we% )% )e% )v% )e% )K[% )x% )Yz% )we% )e& )j& )P$& )v2& )P& )Q]& )0!k& )Yzy& )*& )S3& )!& )E& )^& )& )we& )& )X& )H!' )Yz' )X!' )we/' )e=' ) K' )NBY' )*g' )vu' )' )e' )e' )L' )%y' )we' )e' )v' )e' )e( )e( )( ),( )I( )weW( )ef( )xs( )f( )( )we( )e( )9A( )v( )e( )J( )( )F) )we) )e.) )!<) )CJ) )W) )e) ) s) )F) )) )"J) )Yz) )we) )e) )v) )e) )e) )e* ).* )e* )** )#9* )zG* )eU* )c* )r* )* )V* )V* )j* )"* )'* )rB* )* ){y* )* )+ )5+ )we++ )e:+ )G+ );JV+ )Yzd+ )5r+ )J+ )+ )we+ )I:+ )+ )d+ ).+ )V , )|, )TJ%, )Yz3, )˴A, )weO, )e~, )z<, )9, ), )X, )], ), )i, ), )we - )n- )v'- )Yz5- )'C- )Q- )_- )m- )˴{- )o- )G- )- )m- )b- )`#- )Yz- )we . ). )*(. )w6. )D. )[?R. ).`. )n. )h|. ). )V. )e. )v. )s. )4. )s(. )o. )]. )/ )i/ )we%/ )%2/ )I/@/ )YzN/ )'\/ ) j/ )x/ )_/ )˴/ ) / )e/ )m/ )p/ )-/ )0 )rs0 )~0 )/*0 )70 )U!A0 )xM0 )i0 )u0 )K0 )/0 )0 )!0 )we0 )e0 )C0 )X0 )%0 )v0 )I1 )E1 )Į1 )e,1 )r491 )}4F1 )4S1 )4`1 )fm1 )\z1 )41 )B1 )m1 )d1 )41 )1 )1 ) 2 )U2 )*$2 )x02 )L2 )cX2 )xf2 )/s2 )2 )!2 )we2 )e2 )C2 )X2 )%2 )v2 )I2 )2 )e3 )Į3 )e3 )r4-3 )}4;3 )4I3 )4W3 )fe3 )\s3 )43 )B3 )m3 )d3 )e3 )43 )3 )3 )4 )8+4 )94 )/G4 )U4 )!c4 )"q4 )*4 )we4 )C4 )X4 )%4 )e4 )n4 )v4 )e4 )e4 ) 5 )w5 )|'5 ) 55 )/C5 )Q5 )!_5 )"m5 )*{5 )we5 )C5 )X5 )%5 )e5 )v5 )_5 )%!5 )n5 )e6 )6 )w$6 )h+16 )?6 )|L6 )weY6 )f6 )!s6 )/6 )s6 )C6 )X6 )%6 )v6 )e6 )b6 )Iw6 )C<6 ) 7 )e7 )9A7 )*7 )77 )eD7 )S7 )&_7 )6m7 )|{7 )we7 )7 )!7 )/7 )s7 )C7 )X7 )%7 )v7 )e8 )_8 )%!$8 )18 ) ?8 )/L8 )Y8 )!f8 ) s8 )we8 )C8 )X8 )%8 )e8 )v8 )I8 )8 )*8 )\8 )7&9 )9 )uP9 )=m,9 )M<99 )X<F9 )c<S9 ) `9 )4m9 )iz9 )Z9 )9 ) 9 )9 )W9 )9 )r9 )&9 )-9 )W9 )W : )?X: )#: )eX0: )X=: )!YJ: ),YW: )7Yd: )XYq: )|~: )K: )0: )(: ): )1: ) >: )b: )b: )b: )b; )c ; )c; )c'; )c4; ))dA; )BdN; )Md[; )i; )"u; ); ); ); ))"; ); )M<; ); ); )z; )X<; )k\< )< )W< ),< )9< )vFF< )S< )c<`< )+z< )< )!z< )W< )< )< )eX< )< )!Y< )4< ) < ) = )&= )[D= ) P= )a= ).g= )n= )= )ƶ= )_= )= )X= )-= ) = )= )&x= )w > )C> )P;> )1o> )8r> )> )7}> )> ) > )8> )r> )E> )}? ))? )#? )2? )A? )P? )`_? )n? )}? ) ? )6? )b? )'E? )U? );/? )x(? )e? )\@ ) @ )mJ"@ )1@ ) F@ )P@ )!a@ )|g@ )z@ )@@ )@ )@ )h@@ )r@ )@ )@ )1@ )@@ )A )jA )"A )g=A )#B )(B )kB )~B )PM C )C )<C )PC )K$C )9*C )'0C )6C )4+Y )P2Y )?Y ))CLY )qYY )7lfY )2sY ).Y )4Y )L,Y )Y )%Y )yY ) Y )[vY )Y ) Z ) Z ))Z )7Z )EZ ) GSZ )bZ )#~Z )%Z )QZ )7Z )Z )Z}[ )rb'[ )Q4[ )A[ ).N[ ) a[ )n[ ) K|[ ).[ ),[ )e[ )[ )[ )`s[ )Ȫ[ )B\ )"\ ) \ )+\ )8\ )V\ )ʫc\ )_p\ ) }\ )e\ )gr\ )\ )\ )v2\ )Yz\ )A\ )7\ )C] )"] )/] )=] )18I] )2V] )Yzc] )p] )7}] )"] )] )] )] );] )2o] )2] )Yz] )-^ )7^ )-^ )9^ )kF^ )B`^ )"m^ ) {^ )^ )2^ )Yz^ ) ^ )7^ )*^ )+^ );^ )_^ ) _ )_ ) &_ )33_ )Yz@_ )sM_ )7Z_ )ox_ )R_ )._ )#_ )g5_ )l5_ )$_ )Yz_ )r_ )we` )e` )v` )N+` )9` )eG` )U` )c` )e` )&L` )Yz` )we` )e` )` )v` )e` )e` )F{a )ma )ea )e*a ) 8a )1Fa )(Ta )ba ) pa )o-~a )ka )@-a )ea )a )Pa )Qa )2b ).#b )b )r+b )9b )Mb )[b )Qib )wb )Ub )b )b )b )b )Pb )b )b )c ),c )u>c )O0,c )ui:c )Hc )}6Vc )g>dc )rc )Yc )c )c )inc )-c )c )dc )c )&c )d )`Rd )Zi"d ) G0d )%>d )XZd )nhd )vd )Ed ).d ) d )d )d )Qd )&d )Vd )2d )e )Je ),e )u>-e );e )+jIe )ee )\se )$e )]e )Qe )e )te )e )ve )Le )̏e )o f )?f )'(f )6f )Df )Xf )rUff )tf )if )f )f )vf )Ef )f )f )f )f )[g )Kg )Qg ),g );g )oMIg )QWg )fg )Xtg )Qg )Ag )`"g )g )zg )g ),g )VTg )h )nh )h )+h )9h ))Gh )QVh )@eh )Qsh )Ch ))h )VTh )h )Ih )h )y@h )Tlh )nSh )i: i )pi )\(i )6i )Di )Ri )[`i )woi )~i )i )Vi )i )i )=i )Si ).i )i )o0j )uj )T#j )?2j )Aj )Pj )_j )Qnj )}j )=j )#j )ypj )j )ej )j ),4j )j )-k )k )"k )1k )pI@k )6Ok )m^k )OImk )H|k )k )k )wk )k ) k )x k );k )#k )l )Kl )&!l )&~0l )?l )Nl )]l ) 8ll ){l )l )l ):l )`l )l )Rl )l )-l )m )Am )c m )Y/m )n>m )Mm ).\m )km )~zm )m )m )bm )lm )Nm )m )K)m ).#m )n )n )qn )`.n ) =n )Ln )[n )>jn )yn )Hn )Hn )Dn )Dn )n )Xn )Yn )%n )o )Kao )@^!o )0o )"?o )@No )\]o )lo )!{o )o )o )!o )7~o )o )Qo ) o )go )p )Tp ) p )/p )x>p )xMp )65\p )kp )-zp ) p )1p )^lp )p )p )bp )Jp )`zp )q )0q )]Sq ).q )_+=q )4Lq )ވ[q )jq )yq )q ))Sq )y q )Eq )Dq )Aq )q )*,q )$$r )r )=r )--r ){3ev )lEtv )Dv )v ){v )v )v )v )v );=v )lv )w )ʅ#w )1w )a?w ):1Sw )6zw )+w )6w )@x )ZeBx )ix )\4x )mx )2Rx ) x )x )m4x )( y )y )&y )6x4y )XBy )%Py )^y )_ly )%!zy )y )y )=y )y )fy ) y )y )4y ) %y )z )z )d"z )0z )|T>z )Lz )Zz )T hz )bvz )z )+z ) z )z )|z )pz )z )Xz )%z )+5{ ){ )n { ),.{ )E$={ )HDK{ )Y{ )g{ )nu{ )]({ )(<{ ){ )a^g| )L| );| )=m| )| )-| )| ) } )J} ) W} )Gt} )u}# } )}} )fa}p^} )(} @} )h,}  ~ )%c~ ~ )X,~5~ )B~`^K~ )`!W~ `~ )l~ ~ )~ ~ )~~ )9~H^~ ) .~  )* i4 )$P@ +I )V t )#n0^ )*  )t  )L  ) )+^4 )@ ^ )?j  )8 t )Ȁ )~Հ^ހ )ȇ x )| X2 )> G ))T#r )*~  )E )> ]ȁ );ԁ P ) ;  )bt* 3 )H@#^ )FFk]t )= ( )} Ȃ )Ԃ ݂ )3 ). ) )X )P )]2 )h?]H ) T v )N ) ) )> )Ӄ ) )(H ) )3 )[? )8\ )8/s ) )UX )ϔ )zڄ ) )& )|L )Sr ) )Å ) )j )D5 )[ )s} ) )> )/p )І )%\ )Q! )0G )1Im )! )  ) ڇ )l4 )` & )D L )r ) ) )\߈ )io )  )!E ),a )- )w/ )#ډ ) ) )0 )90F )Vb )y )$ ) )i*Ɋ )0 ) )o96 )M[ )r ) )8 )g )-ҋ ) )A )W2 )0A )l )3 )U  )yʌ ) )1 )# )> )U )?hp )E ) ) )E׍ )S )_ ) )" )C )9+Y )t )a> ) ) )& )Ѭώ )% )  ) )Q0 )6Q )-m )* ){ )̏ )M ) )  ) )%' )ь0 )u9 )m!Q )4QY )lm )  ) )0 ) )GՐ )W )_ )c )@4 )K )>Tl ) ) ), )H )Б )e )PA ) )\f" )U5 )'H )_ )^ )*3 )˒ )?!ݒ )" ) ) ; )T ) ^ ,t +x + } ) +} +] +4 + )r + + )“ +Ɠ +˓ )2֓ +ړ +ߓ )" +8 +. )  )| K" )&/8 )E T )&a j )w )N )I* )&` )ɔؔ )& )  )N )I** )&7@ )M[we ,v +rz +n ,6LDw , +• +̕Zw֕ , + + + +_wvw  ,.1 +5 +: ,.C~w[wp0Mu wwʖ +Ζ +ז +ۖ +ww +  + + +#w-wJ +N +Sxk xx;x ,C +. +" ,C͗ +ї +fڗ +ޗ +  +l +X + + +q +U + + ,( +X, +L5 +9 +>x^ ,k +o +xxx + + +  +  +  + Ęxݘ +  + +Z +Ny ,  +$ +-6y76yP +T +] +a +j +n +y , + + +( +y ,ə +l͙ +d֙y , + + + + +  +6L)6L>6LS6Lh6L}6L6L6L6L՚6L6LCL ," +& +/ +3 +8yX ,e +A i +7 rz| ,L +u  +q  +  +  +  + OMśOMڛOMOMOMOM2OMGOM\OMqOMOM_M ,aĜ + Ȝ + ќ + ՜ + ޜ +  +  +  +  +'  +% TzTz)TzB +8 F +6 O +I S +G \ +I ` +G i +8 m +6 v +8 z +6  +Z  +X LPJM̝ tM M9zC ,tT +p X +h ] ,tfz~zL` 0ƞ={О={ +  +  +  +  +  +  +  + "K, ,= + A + J + N + SKkLDwLwwɟww3xz/xKD W dInKKKKԠK  ,L#_L8(K U~Ljd } LpL ԡ BLLL4ME[ )?z )x ) ) )x ) )Ȣ )ҢP ) ) )&  )#@2 )3E )R )e )&r{ )8 )3 ) )ʣ )&ף )0 )3 ) )/ )&<@E )R(a )3p )3} ) )m ) ) )UĤ )RѤ )$/ޤ )< ) )A# ),1 )? )Q ) ` )h )wu ) ) )  )d )ȥ0ҥ )&ߥ )H ) )S $ , : +) > + C )MX[ )&h`Xq )~P?@%@Ѧ1@\@@@7@P axtX ) ) )&ħ )ѧX )# , +|  +r  )!p/ )&<@E )R``tjt +  +  +  + ttĨ + Ȩ + Ѩ + ը + ܨtt t$t<tItVtctpu}uu)u5uAuMu˩Yuةeuru~uRK$p0 ),: ,-P + T + b +\ f +< t + x +  +8  +4  ) +V  +N  )+ +{  +u  )ªp/˪ )h ѪNpߪ )&. )x  ,T )  + $ + ) )4 + 8 + AoK ,dX + \ + e +i +ro| ,d +3 +- +Z +Xoƫ )&ӫ/ܫ )pMs ) +p +j )' ++ +4Ms>MsW +[ +d +h +q +u +~ + + +& +"Ms , +I +E +j +hŬds )&@/ )hr$ )/ +3 +z8 )C +G +PrZrs +w + + + + + + + +  + r ,˭ +$ϭ +"ح +=ܭ +;r^F ):$#$yF< I#T ,] )h +Ol +Mq )| +` +^FF ) +o +mĮ )Ϯ +Ӯ +~خF , ) + +  ) + +G5 ,> )I +M +R )] +a +fCG| , ):$#}G #˯}G ) + + ) + +G ,' )2 +6 +; )F +J +OGe ,n )y +%} +# ) +6 +4G ,* ):$°#˰ H # H ) +E +C$ )/ +V3 +T8HN ,=W ):$d#mKH #KH ) +e +cƱ )ѱ +vձ +tڱ^H ,P ):$#H'# 4#?HT )_ +c +h )s +w +|H ,c ):$#Hɲ7 ֲ#H ) + +  ) + +H4 ,v= )H +L +Q )\ +` +eH , ):$#%IO ų#г ,ٳ )3 + + ) + + )m  + + )  +$ +) )4 +)8 +'>JO )Ua )Rn )$/{ )< ) )A#JJҴ +:ִ +8ߴ +K +I +K +I +: +8 +:  +8 +\ +Z#go-goJgoTgorgo|goo ,D +n +jʵ +ε +ӵoopop  + + + +&op0opI +M +V +Z +eqo ,w + + + +q ,w +  +  +¶ +Ͷ4׶ , +0 +* , +P +N  +e +a + +% +) +2 +6 +? +:C +6L +ZP +XY +] +qf +j +s +7w +' + +{ + + +- +% +S +O +t +l +ŷ +η +ҷ +q@B4  +S +Q +b +`(f4A +{E +qN +R +\ ,i +nm +lv +}z +{ , + + + + , + +Ƹ +ʸ +Ը , + + + +77# +' +17; ,L +$P + Y7c ,p +>t +:}99 +\ +Z7ɹ +p͹ +lֹ +ڹ +7 + +  + +9" ,3 +7 +@ +D +M +Q + Z +(^ +&c"9 ,0 +: +8 +M +I ,@ʺ +rκ +n׺ +ۺ +: ,P +  + + +;=i;] +a +f;; + +;ͻi< + +< ,`" +&& +/ +U3 +O8<R,=\ ,pm +xq +pz +~ + ,p + + + + +O +M ,ļ +^ȼ +\Ѽ +yռ +w޼O=@ , + + ,)>=>r S=h~>G@ý=ؽq@8 cAh3== ,N +R +[ +_ +d ,q +u +~ +; +3 +c +_> , +} +y +ľ +ɾ ,Ҿ +־ +ݾ> >%2?6MA^0sv?} , + + +' +! ,A ,̿ +Hп +Dٿ +eݿ +a , + +~?  %ABBWmB~`@ , + +@ , + +CC + + ,B ,&' + + + 4 +0 8 +* = ,&JBT ,@e +Q i +M r +n v +j { ,@ +  + FB B=CC \B*\BG + K + T + X + b\Cl ,R} +  +  +! +! ,RC ,n +B! +>! +_! +[! ,n +! +|!C +! +!CC6 +!: +!C +"G +"P +"T +"ZDtvC CBDpdD D+(:DD ,U +"Y +"b +7"f +5"k ,x+E , +V" +N" , +" +z"D E6K(!kE+ ,< +"@ +"I +"M +"V +"Z +"c +#g +"lwE(4-4 5@!X7?i7W7o7U 88b9p^:P:)];Ay@Y@q@FH68H9):>NF;cs; ;H<i<=,@AWDl|EE$Fx?FI ,, +#0 +#9 +!#= +#B ,LIkIuI +1# +/# +@# +>#III +P# +N# +_# +]# I+I5IR +o#V +m#_ +~#c +|#mIII +# +# +# +#III +# +# +## +#-JLJVJs +#w +# +# +#JJJ +# +# +# +#J JJ3 + $7 + $@ +$D +$N*Jl*Jv*J +*$ +($ +9$ +7$7J7J7J +J$ +H$ +Y$ +W$DJ.DJ8DJU +j$Y +h$b +y$f +w$pQJQJQJ +$ +$ +$ +$^JvJvJ +$ +$$ +$( +$2JQJ[Jx +$| +$ +$ +$JJJ +$ +$ +$ +$JDp'_p?gpWpdpqp~pppppp qq%q2q?q q%rB%s`1sx?ssss33 32Ep/O^FgJJ ) , +% +% )/ )&/ )nn, +^%0 +\%9 +m%= +k%FnPni +|%m +z%yno o*o3/ )Z ,3 +%7 +%E +&I +%W +&[ +&` )|$k +O'o +C'~ +' +' )r +' +' )y +' +' ) +' +' ) M +( +( )% +a( +Q( )xL +( +( )  +( +( )> +(" +(' )2 + )6 +); )1F ++)J +))O ):1Z +@)^ +8)c )n +l)r +d)w )! )@4\ ){ ] )&`! )X )ʒ +) +) ,  )ʒ +) +)"rX7 )ʒB +)F +)L~Xa )ʒl +)p +)v , )ʒ +) +)X )ʒ +) +)X )ʒ +* +) , )ʒ +* + *@Y )ʒ& + ** +*0LYE )ʒP +6*T +4*Z ,Ac )ʒn +E*r +C*xY )ʒ +V* +R* )N )I*[ )ʒ +l* +j*` )ʒ  +{* +y*\+ )ʒ6 +*: +*@ ]U )ʒ` +*d +*nIXx , +* +*IXIX +* +*IXIX +* +* +* +*NXYX%YX= ++A ++J ++N ++W]XoXy ,  +"+ + +XX +1+ +/+XX +@+ +>+ +Q+ +M+XX&X> +h+B +f+K +w+O +u+XXpYz ,. ++ ++YY ++ ++YY ++ ++ ++ ++Y'Y''Y? ++C ++L ++P ++Y+Yq~Y{ ,Q ++ ++~Y~Y ++ ++~Y~Y +, +, +, +,YY(Y@ +0,D +.,M +?,Q +=,ZYrY| ,d +P, +L,Y ,t +i, +g,YY=Z ,  +x,  +v, +, +,#=Z- ,9 +,= +,F +,J +,S +,W +,`=Zj ,z +,~ +, +, +, +, +, , + - + -HZ[Z~Z , +$-  +"-~Z)Z?ZI ,Z +3-^ +1-g +D-k +@-tZ~ , +Z- +X- +i- +g- +z- +v-Z , +- +- +- +- +- +- , +- +-Z&Z=[G[d +-h +-q +-u +-z![I[I[ +. +. +. +. + . +. +/. +-. +E. +C.u[u[( +T., +R.5 +c.9 +a.D\N\k +r.o +p.y\\ +. +. +. +.\\ +. +. +. +.\\$ +.( +.2]< ,M +.Q +.V ,_ +.c +.l7]v7] +. +. +/ +/R] ,  +%/ +/ ,  +k/ +e/ +/ +/ +/ +/  +/ +/ +R0 +B0' +0+ +04 +18 +1J +1N +w1W +1[ +1d +:2h +,2w] ,7 +2 +2 +2 +2 +2 +2 +2 +2]^ ,J  +2 +2 + 3 +3%m^/ ,]@ +3D +3M ,nR^jw# , +23 +&3^^ +z3 +x3 +3 +3 +3 +3^ +3  +3^^6 +3: +3C +3G +3P +3T +3_^x +3| +3 +!4 +4 +X4 +P4 +4 +4 +4 +4^ +5 +4^^ +65 +45  +65 +45 +F5 +D5% +65) +452 +F56 +D5? +W5C +U5Oi_Y ,j +q5n +e5w +5{ +5 +5 +5 +6 +6u_O]m^F^`^^pPk%p/DpWparX p p,p .u_8 ,I +P6M +<6R ,q +6u +6 +#7 +6b , +d8 +`8 , +8 +~8 +8 +8 +9 +9 +u9 +s9c" ,#/ +93 +9< +9@ +9IcS ,#` +9d +9m +9q +9zc ,# +: + : +&: +$:cbb "c6c`cx  0 ud ,3 +L: +6:! ,3. +:2 +:D +;H +;Q ,y^ +<b +<k +G<o +1<x +<| +< +< +<d , +< +< += += , +'= +#= +F= +B= +k= +e=J J J 2J GJ \J uJ J J J J d] d5 +=9 +=B +=F +=Odedz , += += += += +)> +> +> +> +> +>d +H? +B?dd  +p? +n? +? +}?' +?+ +?4 +?8 +}?A +?E +?N +?R +?Yde , +? +? ,G    )3S!H X!mE" ""  "(; E#Zm w$o$X {& &"5( ?&TgHq' *( (xe @ n1>AH]g|'Lq  !6, @UE _tW ~ }'_ ' ,G8 +\@< +R@A ,GS +@W +@`*'j ,h{ +@ +@ ,h +@ +@ +A +AS''p *$B(Z(t#~ ,z +FA +@A ,z +vA +dA , +A +A +A +A + B +B +3B +-B +YB  +SB?#' +B+ +yB4?#>?#W +B[ +Bd +Bh +Bq +Bu +B~ +B +B +B +B +B +B5###`(5Y(V'k{C(r(8# , +B +BG$&7 '[%'|_ `~bcd'2dLQdpkdeeT'#CX h8} X `` +B +B +B +B` , +C +C ," +GC& +1C/ +C3 +C< +C@ +CI +(DM +DV +xDZ +vDc +Dg +Dp +Dt +D} +E +Ee`` +*E +(E , +9E +7Eaa  +HE +FE +WE +UE' +WE+ +UE1aIaS ,dan ,a , , +hE +fE +yE +wE acaca +E +Eca ,$, +E0 +E:aD ,4U +EY +Eb +Ef +Eka ,D +E +Ea +E +E ,T +E +EHb ,i +F +F +'F +%F +8F# +4F(_b=bJ[Qpez ,ye , +VF +TFe , +eF +cF , +zF +rFf f$ +F( +F6f@ ,Q +FU +F^ +Fb +Fgf{@f +F +Fa  , +G +G$ , + G +G , +9G +7G +KG# +GG, +mG0 +cG9 +G= +GF +GJ +GYq%c ,t +Gx +G ,  +H +H%% +H +H +'H +%H +'H +%H% , +8H  +6H ,4%2?#K$`p%p(%C%%%'%< OY%v&&d U&rXX@YYY<\-\E\]fjs! )+ , +UH +EH )  +H +H ) +;I" +#I5 )C@ +ID +II )S2\ )$bmp )&}`1 ) )&1 ) )&1 ) )& 2 ))8 )&E`2N )[j )&w2 )mm +I +I +I +I +I +I +I +Im , +J + J +OJ# +GJ, +J0 +}J5 ,B +JF +JO +JS +J\ +!K` +Ko^2y^2 +CK +AK +UK +SKz2 , +dK +bK +sK +qK , +K +K +K +K2 ," +K& +K02:2W +K[ +Kd +Kh +Km233 +K +K +K +K 3r22 2/2J01T2l 37 BL337 IW2  2+ h> 01H h3Y  l 01{ n n  +K  +K n n n  + L  +L  +L  +L  +(L  +&L  +7L  +5L n7 cnL  _ 2i 1~ h 2 1 1 2 1 { 2 2/ B 2L 42a ht 2~ ?2 53 `  ):a   +SL  +KL  )  )  +L  +|L  )C'  +L+  +L0  )N;  +L?  +LD  )N O_ m  )&z  M  )   )& `M  )   )& M  )   )& M  )& 5  )&B  NK  )X g  )&t `N}  )   )& N  )   )& N  )   )&  O ) / )&<`OE )Ra )&nOw )~~ +L +L +L +L +L +L +L  +LC C= +LA +LJ + MN + MXqbq +M +M +-M ++M+H"/$l9`Iavx  8z_&{>Vk { O (=Me.t )yz ,  +DM +:M ) )&@3 )AUAU +sM +qM  +M +M'@ N )X ,n +Mr +Mw ) +M +M )C +N + N ) )&3 )0 )&4 )( )&@4' )4 BTTL ,] +ENa +CNj +UNn +SNxdT , +fN +dN +vN +tNsT , +N +N +N +NT , +N +N  +N +NT$ ,5 +N9 +NB +NF +NPTZ ,k +No +Nx +N| +NT , + O + O +O +OT9R  k5Eso )'u@W +8O +*O )b +|O +xO +O +O +O +O ) +O +O )< +O +O )  +P +PW,WDW] )mh ,T~ ++P +!P ) +dP +^P ) +P +P +P +P +Q +P )$ +PQ +DQ )5 )& 4 )"X1 )&>4G )TPc )&p5y )H , )3 +Q +QsVsV +Q +Q +Q +Q +Q +Q )& @5 )!@0 )&=5F )S8abVk ,k| +Q +QV , +Q +Q ,V#'VVV>Sf5p5, 59l5#8pK5Uo )U ) )< ) )&` +R +Q ) +0R  +.R ) +ER +=R# )-6; )&H5Q )^pm )&z 6 )h )&`6 )` ,u )3 +gR +eR +wR +uR +R! +R* +R. +R9C ,eT +RX +Rcxp66  ) : )G )_ )l )y ) )& ) )& ) )&  ) / )3B )&O@X )et )& ) )& )x )PR  +R  +R  )  +R  +R  )z*  +S.  +S3  )->  +.SB  +*SG  )R  +PSV  +FS[  )f  +Sj  +}So  ,Ox  )3  +S  +S  )  )m  )  ) -S  )U  )R  )$/! )<! )#! )A#6!-S@!-SY! +T]! +Tf! +#Tj! +!Ts! +#Tw! +!T! +#T! +!T! +#T! +!T! +4T! +2T!R! ,?! +DT! +BT! +ST! +QT!S!S" )ew" , 4" +jT8" +`T=" )M" )f" +Tj" +Tx" +T|" +T" ))" +4U" +0U" )" +LU" +HU" )v" +U" +wU" )" " )&"" )"# 0# )3"# +U&# +U/# 09# 0R# +VV# +U_# +Vc# +Ul# +Vp# +Uw# , # )3# +V# +V#0#0# +LV# +JV# +kV# +iV# +kV# +iV# , # +|V# +zV$ +V $ +V$ )&!$*$ )7$F$ )&S$ \$ )i$s$~ $$ $$ )&$` $ )$$ )&% % )%*%;04%;0Q% +VU% +V_%1i% , v%1%1%1% +V% +V%1%1% +V% +V% +V% +V%11&a2>&B S&f& p&^ && & && & )A"& ,M& +V& +V' )' )!' ),' +/W0' +)W5' )1@' +dWD' +\WI' )<T' +WX' +Wf' +Wj' +Wo' )y'PI' )&'G' )'' )&'G' )'' ,' )3' +3X' ++X(!h(!h*( +fX.( +dX7( +fX;( +dXD( +fXH( +dXT( )&a( Hj( )w((ah( )3( +zX( +tX(ah(ah( +X( +X( +X( +X( +X( +X( )&)`H) ))-) )&:)HC) )P)_) )&l)Hu) ))) )&) I) )))() ,d) +X) +X) +X) +X) ,d* +X* +X * +Y* +Y*)'*Sg1*SgN* +.YR* +,Y[* +=Y_* +;Yh* +MYl* +KYu* +\Yy* +ZY* ,* ,* +|Y* +pY* +Y* +Y*g* ,* +Y* +Y* +Y* +Y*g+h(+hA+ +ZE+ +ZN+ +ZR+ +Z[+ +"Z_+ + Zh+ +1Zl+ +/Zt+)+*+(++pG+)+{ ,pG,)*,`:,)O,b,pGr,<*,8,pG,v*,h,pG,*,,pG -Wh@-QjM-(b-u-PI-)-x-F)--v)--).0. *(.;.PIE.Z*V.i.PIz. )80. ) . ). ).pG. )$. )&.E. )/8/ )&/F'/ )4/0C/ )&P/@FY/ )f/(u/ )&/F/ )/ / )&/F/ )// )&/G/ )/0 )&0@G0 )*050 )@0 ,p V0 +LZZ0 +>Z_0 )j0 +Zn0 +Zs0 )0 )0 )>0 +Z0 +Z0 )10 +Z0 +Z0 )<0 +[0 +Z0 +-[0 +[0 )0-0 )&1@-1 )1H&1 , /1 )3:1 +g[>1 +c[G1.Q1.j1 +[n1 +[w1 +[{1 +[1 +[1 +[1 )&1-1 )1@1F/1 )31 +[1 +[1F/1F/2 +[2 +[2 +["2 +[+2 +[/2 +[62,/k2/x2 22-2& 22-2 )D2 ,, 3 +[3 +[3 ))3 +\-3 +\23 )=3 +b\A3 +T\F3 )Q3 +\U3 +\Z3 );Ue3 +\i3 +\x3 +,]|3 +]3 )J3 +]3 +]3 )3733 ):3!R3 )&363 )3h3 )& 474 )"4`14 )&>4@7G4 )T4X^4 ,V g4 )3r4 +]v4 +]444 +]4 +]4 +]4 +]4 +]4 +]4444 )34 +]5 +]5 )5 +]5 +]5 )m&5 +^*5 +^/5 ):5 +7^>5 +3^C5 )N5 +Y^R5 +U^X54i5 )U{5 )R5 )$/5 )<5 )5 )A#54545 +y^5 +w^5 +^5 +^6 +^ 6 +^6 +^6 +^ 6 +^$6 +^-6 +^16 +^>6 )&K67T6 )a6Pk66 )36 +^6 +^6 )6 +^6 +^6 )m6 +^6 +^6 )6 +^6 +^6 )6 +^6 +^66 )U7 )R7 )$/"7 )<57 )C7 )A#V7`7y7 +_}7 +^7 +_7 +_7 +_7 +_7 +_7 +_7 +_7 +_7 +"_7 + _7 , 7 )37 +2_7 +0_7ڂ7ڂ 8 +C_8 +A_8 +T_8 +R_$8 +T_(8 +R_38=8 ,C N8 +e_R8 +c_[8 +t__8 +r_i8Vs8 ,i 8 +_8 +_8 ,y 8p88#8889ځ,9F9f9Q{9979 R9 979!R9/R :YR:3 2:7<:rRM:`:7v: )_#: ,: +_: +_: ): +_: +_: ): +>`: +0`: ): +`: +y`: );U: +`: +`: +a: +`; )J ; +Xa; +Va; ) ;91;:; ):@;YQN; )&[;8d; )q;; )&;@8; );; )&;8; );x; , ; )3; +ia; +ea; )< +a < +a< )m< +a< +a$< )/< +a3< +a8< )C< +aG< +aM<5^< )Up< )R}< )$/< )<< )< )A#<5<5< +b< +b< +"b< + b< +"b< + b= +"b = + b= +"b= + b"= +3b&= +1b3= )&@=8I= )V=p`=݀u= )3= +Cb= +Ab= )= +Sb= +Qb= )m= +db= +bb= )= +ub= +sb= )= +b= +b=݀= )U= )R > )$/> )<*> )8> )A#K>݀U>݀n> +br> +b{> +b> +b> +b> +b> +b> +b> +b> +b> +b> +b> > )3> +b> +b> > ? +b? +b? +b? +b%? +b)? +b4?>? ,O? +bS? +b\? + c`? +cj?pt?p? +&c? + c? , ???#?? @!@9@S@s@BQ@ @9@YQ@gQ@Q@3 A9AQ,A?A9IAQZAmA9A )A ,A +[cA +CcA )A +cA +cA )JA +dA + dA )MA +edA +_dA )-A +dA +dA ) B +d B +dB )KB +eB +e-B +8e1B + e6B )AB +eEB +eUB +fYB +f^B )lB )&yB@CB )BB )&BCB )BB )&BCB )BC )&CDC )%C4C )&AC@DJC )WCfC )&sCD|C )CC )&CDC )CC )&CEC )CC )& D@ED )D.D )&;DEDD )QD_D+iD+D +fD +fD +(fD +&fD+D+D +9fD +7fD +HfD +FfD+D ,D +[fE +Uf E +fE +~fE ,!E +f%E +f.E +f2E +f;E + g?E +fHE+RE ,_E +>gcE +Q ) KQ )UQ@cQ )&pQ@yQ )Q(Q )&Q@@Q )Q Q )Q ,~Q +7lQ +-lQ ) Q +tlQ +jlQ )tR +l R +lR )CR +l R +l%R )0R +m4R +m9R )DR +jmHR +`mMR )WRPBhR{vR )&R`AR )RHR )&RAR )R@R )&RAR )R8 S )&S B"S )/S0=S*GS ,XS +m\S +meS +miS +mnS*SCShSPBSOSvS TPB"T7T0JTPB`TuThTPBTT ),T ) T )tT )CT )U )UBU )&)UB2U )?UXJU )&WUB`U )mUPxU )ܛU ) U )tU )CU )U )U0AU )&U@U )VhV )&VA'V )4V`?V )EVgV +mkV +myV +m}V +mV )V )&VLV )VxV )&VLV )WpWW6W +m:W +mCW +nGW +mMWbWuWW5W )5W )W ) W )CW )tW ) X )',X )QX )XpX )}X )X )AX )!X )m X )vX )oX ).X )X )aX ) Y )Y )IY )SY-\Y )K.lY )%yY )&Y&Y )Y@Y ).Y )WY )LY )iY )&Y 'Z )Z8Z )g*Z ){=Z )&JZ`'SZ )`Z0oZ )|Z ) Z )Z ); Z )6Z )jZ )RZ )kZ )dZ )g [ )&['%[ )2[(A[ )&N['W[ )d[ s[ )&[ ([ )[[ )&[`([ )[[ )&[([ )[ \ )&\(\ ),\;\ )&H\ )Q\ )^\m\ )Zz\ ) \ )\ )\ )&\`)\ )\\ )\ )\ )& ])] )"]1] )>] )Q] )&^])g] )t]] )&] *] )]] )] )] )&]`*] )]^ )&^*^ )*^9^ )F^ )Y^ )f^ )y^ )&^*^ )^^ )&^ +^ )^^ )&^`+^ )__ )&_+%_ )2_A_ )&N_+W_ )d_s_ )&_ ,_ )__ )&_`,_ )__ )&_,_ )_` )&`,` )(`4` )?``a` +ne` + nt` +8nx` +2n` +_n` +Un` )` +n` +n` )m ` +n` +n` )C` +n` +n` )`` )` )a +na +n a7a )&Da&Ma )ZaHhalra ,a +na +na +oa +oa ,a:a ,a +=oa +;oa +Noa +Loa +doa +^oaObb2bCbTb )tsb )vb )b!b )&b"b )bPb )b )b@"c )&c"c )(ch7c )3Jc )&Wc"`c )mc`xc )&c#c )cXc )$c )c0#c )& d`#d )!dx,d )&9d#Bd )OdpZd )ud )d#d )&d$d )dd )&d@$d )dd )dGe )Qep$_e )&le$ue )ee )&e$e )ee )f )f% f )&-f@%6f )CfRf )_f )#mf )$,}f )&f%f )ff )&f%f )ff )&f&f )gg )&g@&%g )2g=g )q\g )D?jg )b|g )g ) g )Eg )g ,g +og +og +og +og +hpg +`pg )g +pg +p h +ph +ph )C!h +q%h +q*h )4hPBh )&OhXh )ehth )&hh )hh )&h h )hh )&h`h )h i )&i i )-ikKkXkekrkkxk&kPkDk(kbkll+l@lPlaltlPl )E l Ql + rl +rl )l +1rl ++rl )]l +Rrl +Jrl ,l )ʒl +rrl +prl?Q m )ʒm +rm +r mQ5m )ʒ@m +rDm +rNmcQXm ,im +rmm +rvmcQmcQm +rm +rmcQmcQm +rm +rm +rm +rmhQmsQnsQn +r!n +r*n +r.n +r7nwQKnQ^n )N}n )wn )n ).n )>n )nn )&nn )no )&o@o )*o5o )&BoKo )Xoco ) o )^Co )o )=o )o )M.o )op )&p p ))p(8p )Ep )Xp )&ep`np ){p p )&pp )pp )|p ,p +sp + sp )=p +Psq +Fsq )&q )'q )3=q +sAq +sFq )TQq +sUq +sZq )hq )&uq~q )q0q ,q ,q +sq +sq +.tq +"tq +tq +tqrr%r5rJr`Zrkr8|rrr rr )(5s )hBs )LspZs )&gsps )}sPs )&ss )sHs )&s s )s@s )&s`t )t8t )&%t ,;t +t?t +tDt )Tt )Kdt )vYst )~t +ut +tt +Vut +w +"vCw[ jw xw )w )w )w )w )wpw )&w@w )xp x )x ,},x +Vv0x +Lv5x )Ex )aPx +vTx +vYx )dx +vhx +vmx )x +vx +vx +#wx +wx )Cx +wx +wx )x +xx +wx )xPx )&x x )yxy ,y )"y +Ix&y +Gx+y )6y +[x:y +Wx@y= fy syyyPy )|y ,Wy +{xy +qxy )y )y +xy +xy )Oz +x z +xz )'z +y+z +x9z +Hy=z +:yBz )CMz +yQz +yVz )az +"zez +zjz )tzz )&zz )zz ,mz )z +izz +gzz )zz +{zz +wzz { {%{8{M{ )fX{ ,1n{ +zr{ +zw{ ){ )e2{ +z{ +z{ )N?{ +z{ +z{ ){ +%{{ +{{ +h{{ +Z{{ )C{ +{{ +{{ )| +D|| +8| | )|#| )&0|9| )F|P| ,GY| )d| +|h| +|m| )hx| +||| +||| ||H|| ) } )} )3} )=}K} )3X} )e} )mr} )} )} )U} )R} )$/} )<} )} )A#} )&}~ )~~ )&+~ 4~ )A~P~ )&]~` f~ )s~~~ )&~ ~ )~~ )5~ ,~ +|~ +|~ )g~ +}~ +|~ ) ~ +`}~ +X} +}  +} )' +} +}" )J- +~1 +}6 )A +1~E ++~T +V~X +N~] )Kh +~l +~q ) )V ) +~ +~ )@;P , ) + + ) +Z +LP , + +" +& +/P9 ,F +J +S +W +\$P )&: ) )&@:ǀ )Ԁ )&: ) )&":+ )8G )&T;] )jx P , + + + + , + + Pˁ ,܁ +) +' +; +7 , +f +`O%JPOPsPPQтc@;c*>@;H]cp@;Ãԃ )/  )- ).: )D0R )_ ) l )<y )u ) ){h )+ )/p )3΄ )ۄ )m ) ) )U )R" )$// )<> )L )A#c )&p`y )X )& )PDž )&ԅ݅ )H )&  )@+ )&8`A )N8] )&js )0 )& )( )&Ά ׆ )  )&`  )% )&2; )HW )&dm )z )&  ) )&ȇ`ч )އ )& ) )&,5 )BQ )&^ g )t )&` ) )1̈ ){و ) ) )  )$ )% )L2 )0(? )L )Y )Uf )pp )& ) )&ʼnΉ )ۉ )&@ )  )&)2 )?xN )3a )&nw )p )& )hŊ )3؊ )3 ) )m )  ) )U, )R9 )$/F )<U )c )A#u )&@ )` )n2͋ )׋  )&  ) )&$@ - ):I )&V _ )l{ )&  ) )& Ì )Ќߌ )&@  ) )& ' )4C )&P Y )fu )&  ) )&@  )ʍٍ )&  )  )& ! ).= )&J S )`o )&|@  ) )&  )Ďӎ )&  ) )& )(x7 )&D@M )Zpi )&v )h )& )`͏ )&ڏ )X )& @ )"P1 )&>G )THc )&py )@ )& )8ǐ )&Ԑ@ݐ )0 )& )(+ )&8A )N ] )&js ) )&@ ) )&Αב ) )&  )% )&2; )HW )&d@m )z )& ) )&Ȓђ )ޒ )& ) )&,@5 )BQ )&^g )t )& ) )&“˓ )ؓ )&@ )  )&&/ )<K )&Xa )ny )& ) )pϔ +Ӕ +ؔ ) + + )@G +ɀ +ŀ )J  + +ހ"? +C +L +P +Vv )Z$| ) + + ){D +2ŕ +.ʕ )@GՕ +Mٕ +Iޕ )J +d +b +x +v& +* +1 )u7Y +] +b )m +q +v ) +؁ +ԁ )@G + + )J +  +ݖ + + +- ++ )8 < +C@ +=E )P +gT +_Y )d +h +m )@Gx +| + )J + +LL +ɂė +ǂ͗ +؂ї +ւח; ) +# +( )3 +M7 +A< )@GG +K +P ) b[ +_ +d )Jo +s +x , + +C , +3 +1 +BŘ +@Ϙ٘ , +U +O + + + +  , + +# +' +0:S +W +` +d +le00 +% +#ř +4ə +2ҙ +C֙ +Aߙ33 +U +S +d +b( ,9 +s= +qF +J +S +W +\ ,e +i +r| , +Ņ +Åš +ԅƚ +҅Ϛ +Ӛ +ݚ + + + +) ,: +> +G +5K +3Pi )]@O› +Hƛ +B˛ )֛ +hڛ +dߛ )@G + + )J + + OO2 +6 +? +ņC +ÆL +ԆP +҆YOcO| + + + +fO )q ܜ + + ) +c +Y ){D + +  )@G + +! ) b, +0 +և5 )J@ +yD +sI ,e] +a +jwt ,u +, +( +B +@ , +S +Oĝ +ȝ +ѝ +lj՝ +ʼnڝ , + +݉ +e +[  +$ +ߊ- +1 +>[H[j +n +w +{ + ^^ +# +!Ş ,מ +4۞ +0 +U +M , + +| * +. +8B_ +c +l +p +z +ɋ +Nj +ً +׋Ɵ ,ן +۟ + +  +  )#`E + I +N )Y +@] +<b )m +[q +Wv )@G +t +r )J + +ɠ +͠ +֠ +ڠ + + + +nj +Ō  +֌$ +Ԍ+K )Qs +w +| ) +  + ) +$ +  )@G )J += +;ɡ5ӡ5 +Q +O +` +^  +o +m8!8: +> +G +K +Rr )x + + ) + +ڍ )¢ + Ƣ +ˢ )@G֢ +/ڢ ++ߢ )J +F +D ) b +c +Y +Ǝ +Ž) ,D: +܎> +ڎG +K +U_| +  + +l +j +{ +y + + +Տ +ӏ6ǣ6 + + + + ,Z + +$ +( +2 ,Z; + ? +HR ,sis +/ +- +> +<Ҥ +M֤ +Kߤ +\ +Z ,  +n +l/}EiV )_ )¥ )ۥ )T )< ) )T )<) )r7 )ND )I*S )Y<{ + +{ ) +  + )r +m +c + + ,# Ѧ +զ +ڦ )J +) +' ,  )3 +L +J==6 +a: +_C +vG +tP +vT +tZ5=r<| ,E  + + + + ,W  +ɒ +ǒ ,l Ƨ +ʧ +֒ӧ ,~ ܧ + + = = + +<<=F , W +[ +d +h +r5=| ,  +ғ +Γ + + ,  + + , Ҩn=ܨn= +] +[ +n +ln=n=1 +~5 +|> +B +Kn=Un=n +r +{ + +|= ,  +” +>>۩ +ڔߩ +ؔ> w>>% , 2 +6 +?>I , Z +^ + c>> )N )I*=Ȫ= +3 +1= ,  +K +C +v +r$=AC>K ,1 \ +` +i +m +vC> ,D  + + +ŕ + +ܕ +ڕC> ,T ͫ +ѫ +ګ +ޫ + + + ,T  +$ + N>)b>@;?J ,d [ +;_ +9h +Ll +Hu;? ,w  +c +a +t +p + +;? , ̬ +Ь +٬ +ݬ + +– + ,  +Ӗ +ϖF?(^?;=Q )w ) )A# )p )M;ޭ + + ) +H +B )r +k  +e )J + +# ). +2 +< )NI )I*W;l )ʒw +{ +; ,  + +; , ɮ +Зͮ +Η֮;; ,  +  +; , * +. +7;A , Q +U +Z , c +g + l;;; +( +& +7 +5¯<گ< ,  +F +D +W +S $<*2<4 , E +mI +kR +V +}[@<v; )+ ; + + )̰ +а +հ )i +֘ +И )J + + ) +  + +.  +(% )*0 +_4 +Y=);G ,] X +|\ +ze);o ,] { + +A;A; + +A;ɱ ,m ڱ +ޱ +{; ,  + +{;%{;7A;M )XP:z +љ~ +ř ) +  + )r +0 +* )J +L +J )ʲ +]β +[Ӳ )ݲ; )N )I*  )&;! ).8:M )ʒX +l\ +jfY:p ,  +{ +y~: ,  + +~:ͳ:׳ ,  + +: ,  + +:" ,- 2 +6 +; ,- D +ΚH +ʚM:g:q: + + + +::Ŵ ,= ִ +ڴ + + +: : ,M & +** +(3 +<7 +:<:Wt:o;; )O )i˵ )$ )i  )S )) )H )<)V )u ) ) ) )`9 ) )- 9# )2 )Q )` )j , +S +I ) + + )O + + ) +Λ +țη +ҷ + +p +L + +  )Y +1  +% )Tl  ):1+ +x/ +r4 )? +C +H )RPL[ )talo )&|I )P )& J )ĸHӸ )&`J )@ )&J )(87 )&DJM )Z0d6.y ) +  +  ) ++ +%6.6.ȹ +H̹ +Fչ +Zٹ +X +q +o + + + + 6. ,  +$ +- +מ1 +՞6K.S )&` Ki )v(. )ʒ + + )&`Kź )Һ  )&K )/# )ʒ. +2 += )&JKS )`o )&| L )kkͻk׻k + + +- ++kk1 +<5 +:> +KB +IMlW ,h +ll +Zq ,~ +Ο + + + +J +H +s +_ + +Ҡ,̼,lּ ,! +y +m ,! + +Wl&l?*Pa1r  ,C + + + ++Ƚ +^̽ +\ս +nٽ +l޽+ + ,S' ++ +{4 +8 += ,SO +S +\0f00000Ҿ0+  + + +8 +4&,? +XC +VL +gP +eZ,,s +w +y + +k, ,j +£ + ,j +ѣ +ϣȿ +̿ +ޣ޿ +  + +7 +5,  ,J&0T&0q +Fu +D~3030 +U +S?0R0-T-0%&0:*OX_*t~Q+,8,h;-0) >lHlk-u ,} +d +b +s +q- ,} + + + +- ,} + + + +- , +# +, +Ҥ0 +Ф9-C ,O +S +\ +` +i-s , + + + +J/ , +& +"J/ , +> +://  +Z +Xj7jOjnjkkklm0m?m4.6.C/X h(/}=/0E/g/` /0//DT/i y1D1m1PL ) )* )4QB )&OPX )ept )&@P )h )&P )` )&P )X ) , 5 +x9 +j> )I +åM +R )\P<j )&w < )x77 + +77 + +78/8%/8B +F +O/8Y/8r +!v +/8/8 +3 +1/8/8 +E +C78R8\8h8+ <OP<Z ) )  ) ) ) )> )&@> ) )&> )+: )G )Z )&g>p )} ) ) )Ң ) g ) )g ) )3  )&?" )/> )&K@?T )ap )&}? ) )&? ) )\N )E ) ) )* )4=> )&K@=T )am )U ) ) )  ) )H ) )U(  )|$& ):13 )@ )GM )W ` )m )3 )2 )y )* )ʒ )G )& ! ) )ʒ )ʒ0 )? )ʒO )Z | +[ +U )|$ + +z ) + + ):1 + + +Ϧ +ͦ + +ܦ )W9 )$ )/ +3 +8HY )&f<o )| )&< )~~ + + +. +,~~ +># +<, +O0 +M9~C~\ +_` +]i +pm +ny ,Q + +~ + + + + + + +ҧ +Χ)PN \ ,a& +* +3\Ho^zh ,ty +} + + +z , + + +- ++ +> +:z , +T +R +c +a +t +p  , + +EXbmCR ^57SHhxP )Bb6 + + +Ԩ +Ҩ ):1 + + )  + + ,  )ʒ +# +! , ! )ʒ, +20 +06 , ? )ʒJ +EN +?X6b ,[ s +cw +a6G7 ,k  +r +pG7G7 + +G7G7 + +! +% +*L7<X7FX7^ +b +k +ǩo +ũx\77 ,  +֩ +ԩ + +77(737 7 )9 )F )3S )]p=k )&x= ) )&= ) ) + + )  ++  +!! )xA, +d0 +^5 )x @ +D +~I )W )&dIm )zTp )4` )AE) )6 );(C )vP ) ] )$l )'w + + )i + + ) +> +8 ) +g +] ) + + ) + + )q0 +5 + )% +ά) +. )9 +o= +aB )M +Q +V )&&a +e +ԭj )u +@y +"~ ) +Ю + ) )ʻ )c ){. +C += )P  ,] + + +  +  ,p. +2 +; +? +دH +L +U +MY +Ab +f +k ,t +Űx +I    +ݰ +۰ + + + + +  + + + +F +D  , +V" +T, 6 O +eS +c^#h ,y +{} +s + + + + + +ر +  +  , +. +* +W +E + + + + +8 +2 +k +W  +ֳ +ȳ + + ' +۴+ +ϴ4 +8 +A +\E +JN +R +[ +ŵ_ +h +l +u , +< +: +O +KP# , +n +lP# , + +~T#T#  +$ +*#7H$L a(s$ U Y  , + +j  , + +  ' 1 ,B +ʶF +ȶO +ٶS +׶\ +ٶ` +׶i +m +v +z + , +  ++!+! ++ +) +: +8 +I +G +\ +V + + + + C!C!3 +7 +@C!JC!b +ŷf +÷oC!yC! +ַ +Էa!a! + +a!a! + +a! a!% + ) +6!@ ,'Q +U +^ +6b +2k +To +Px +q| +k + + ,' + +!! +Ǹ +Ÿ +ָ +Ը +ָ +Ը + + + + + +"& ,?7 +; +D +$H + M ,?V +<Z +:c +Mg +Ip +ot +k} + +"" + +"" + +"" +ǹ +Ź 8"*8"C +عG +ֹP8"Z8"s +w +8"8" + +" ,O +  +  + + + + +* +( +: +8  ,O +N +H%"/"L +nP +lY +}] +{f +j +s +w + + + + +!!"" ){% +Ӻ +ɺ )i + + )& +3* +// ): +S> +KC )N +R +~W )b +f +k )q0v +z +ػ ) +^ +@ ) + + ) +/ +! )&& +u +m )} + + ) + + ) ++ +  )$ +} +y )k, )`9 ){.D +H +M )P Y%c ,t +Ӿx +Ѿ + +&& , + +;& , + +Q&&& +! +* + . +7 +0; +.D +EH +=Q +U +^ +b +k'u' + +'' + +'' +ҿ +п4' 4'$ +( +14';4'T +X +a4'k4' + +&&&&''')'A+(U3(o )^ ) )f/ )$ )& )f/ )r ) ) )  ).' )GF )S )` )im )z ) ):% ) )i ) )U )0 )  )i )& )3 )@ )M )BZ )g )&t ), )c )r  ) ),{ )h )q0 ) ) )u ) ) )F]3 )@ )M )Z );(g )vt )  )V ) )@ ) )  )g );D )  ) )A3 )h ),{ )* )= )X )AEe )r );( )v )  )$ ) $ )i ){. ) ) )  % )f/3 )?> +B +H ) V ).a +;e +9p )v )f/ )? )  ). +J +H )x )f/ )?  )Sp6' )2 +Y6 +W@y6\ )g6 )d ) +s +g ) ) )s`M + + )  + + ):1  + +  , )ʒ* +'. +%4MI )ʒT +6X +4biMl ,o} +G +CMMMN#N:N )  )p? +eC +]H ):1S +W +\ ) g +k +p ,y )ʒ + + , )ʒ + + , )ʒ + + , + +<$N.Q= )HN_ )j +1n +#s )8~ +w +k ):1 + + )Ns + + , )ʒ ++ +NNN N"O/OD )c )ٸp ):1 )̐L )C +m +e );/ + + + + ):1 + + )Ns +  + +)  +')M3MP +CT +A]MgM +T +RMM +e +cM M +v +t + + + + M ,O$ +( +1 +5 +> +B +KMU ,Ob +f +o +s +| + + ,O + +M ,_ + +M ,_ + +MM  + + + + & +#* +!3M=MV +2Z +0c +Ag +?p +Ut +S}M +d +b +x +v + +M + +7M7M + +7M&7M? +C +L7MV7Mo +s +{0M ) ,  ):1 + + ) +0 +" )zG + +q ) +  + ) +  + )- +c +1# )z. +<2 +*B +F +V +Z +i + m +zgC@@ + + + + + +@@ + + +  + + +@)@B +F +O +S +\ +` +i +m +v@@ +" + @@ +3 +1 A A +D +B  +U +S +i +g& A0 AI +xM +vV +Z +c +g +p A + + + + + + A + + +<EE+ +M/ +K8EBE[ +^_ +\hErE +o +mEE + +~ + +SAwAC@0CkJCbCC$DE E4 R  )1d  )q  )I~  )6t  ) h;  )& ;  )   )Bw  )  )  )+  )D  )R  )/X 4~  )  +  +  +  + 4  ,K  +  +  +  + 4  ,K  +  +  +   + 4  ,K "  +&  +/  ++3  +)<  )zB 4d  +Ah  +9m  )x  +m|  +g  +  + J4  ,;  +  +  +  + J4  ,;  +  +  +  + J4  ,;   +  +"  +'&  +%2 e4< e4Z e4d e4} g4 g4  +7  +5 q4 |4 |4  +I  +G |4 |4  +X  +V( |42 |4K  +gO  +eY  )d $  +~  +t  )  +  +  +  +  )t  +  +  )  +  +  ,b  +/  ++ x% ,s +M +G +o! +i& ,/ +3 +< ,I +M +V ,g%q% + +% )Sw ) ) )A# )& )A#6 )U )zb )-o )| )  ) )> )S ) ) )&@S ) )3* )n53W +[ +` )k +2o +*t )z +g +[ )- + + ) + + ,"  )3 + + ) +9 +3 )m +` +Z ) + +  ) + +P3/ )UA )RN )$/[ )<n )| )A#P3P3 + + + + + + + + + + + + 3  ,  +" ++ +/ +53Q3k )%  ) )z )- ) ) )! )pT )&@T )   )h31 )b;? )M )!r )! )e1 )+ ) ) )4 )pS )&S )  )& )3 )@ )M )W0Qe )Jw )&`Q )@  )&Q )8  )&Q )0  )J )&) R2 )?( N )&[`Rd )q | )&R )  )&R )  )W )  )& )% )2 )? )NL )VSd ) 7s )&T )H  )z~ ) )PU )&T ) `  )&)T2 )?X J )&W U` )mP x )Z+ )s% )  ) )U )&U )p  )&V )'h G ) jMo +2s +,x )x +V +P ) )&`V )x ,H ) +x# +r( )x3 +7 +< )J )&WV` )m ww )f) + + )r + + + + )N )I*!*? +/C +-H)*a)k ,^| +> +<* ,n +P +N +_ +] *)*5* ) ,- +1 +l6 )rA +E +J )T[] ,f ):$w() , + +()() )&[ )  )N )I*{)#{)@ +D + N)X ,1i +!m +v +0z +. +B +@)) ,A +Z +R + +)5)(R)HGYk)nX)[[ )R* , ) + + +R +6 )r$ +( +- )8 +N< +4K +O +] +a +f )|l}u )P[ , )ʒ +$ + )N )I* )&X )  )N  )I* ,, +0 +9UOCUO` +d +jRO bO )& Y )  )&`Y  )    , $  ) /  +3  +=  )&J YS  )`  o  )N|  )I*  )& Y  )   )N  )I* N  ,:  +  +! + ! +!N*!N4!NQ! + U! + Z!Nr!N!N!yN!h!P[!N!N "N#"N;"NP" c"P[m"O" )&" Z" )" " )&"`Z" )" " )&"Z# )# # )&*#Z3# )@# O# )&\# [e# )r# # )N# )I*#|# ,# +# +#}#}# +0# +.# +?$ += $ +N$ +L$"}:$"}D$ ,U$ +fY$ +^b$ +f$ +k$;}$H}$ ,$ +$ +$ +$ +$M}$M}$ ,$ +$ +% +% + % ,% +% +% +#% +.%}8% ,JI% +"M% +R% ,J_% +xc% +nl% +p% +y% +}% +% +&% +"% +J% +:% +% +%%M%)~% ,l% +% +% +% + %I~& +&& +#&I~-&I~F& +eJ& +cS& +vW& +t`& +vd& +to&~~y& ,|&~&~& ,& +& +& ,&~&&#'~ ' ,' +' +('~2' ,>' +B' +K' +O' +V'}n' ~'~'~''M'M(O-( A(0XK(P\(!n(M( (0X(M(h!(O(@!(0X)O ) ,) +!) +*) +.) +3) ,<) +@) +I) +M) + T)|l)})?)N) )>N)O)#O *O*O-* @*P[J*5P_*hr*P[|*@P*P*h*P[*P*P+ +P[$+)Q5+!H+P[S+ )I n+ ){+ )+ )+ ))+ )f+ );U+ )+0X+ ):+ )&+W+ ), , )&#,@W,, )9, H, )3[, )&h,Wq, )~, , )&,W, ), , )&,X, ), , )[A,!- +&%- +"5- +A9- +=>- )I- +ZM- +XR-a- )@h- ,~- +u- +g- )- +- +- )- +F- +2- ).- +- +- )I- +- +- )$- +8- +0- )I4- +|- +h- )| . +. +. + . +u%. )*}0. + 4. + 9. )D. +'H. +#M. )79X. +G\. +=a. )l. +p. +xu. )C. )p. )4d. +. +. )&. +. +. )i. +O. +I. )q0. +. +p. ). +. +. )/ )[T / ,?/ )?q/ +*"/ +"(/ ,1/ )1g2 +!B2 +G2 ,P2 +0T2 +.]2 +Ia2 +Gj2 +hn2 +fy2-2 ,2 +~2 +|2 +2 +2 ,2 +2 +2 +2 +2 +2 +22 , 2 +3 + 3 + 3 +3 +3 +3 , (3 +,3 +53 +-93 ++B3L3e3 +Ai3 +?r3 +Pv3 +N333 +_3 +]33 ,3 +n3 +l33 ,/3 +3 +{44,4 +04 +:4D4 ,RU4 +Y4 +b4 +f4 +p4 ,Ry4 +}4 +4 +4 +444 +4 +4 + 4 + 4$4~45 ):5 )'G5 )|$k5 )u5-5 )&5 .5 )5 5 )!5 )5 )!5 ) 6 )ġ(6 )56 )!B6 )<P6 )o6 )|6 )I46 )t6 )6 )!6 )*6 )6 )I46 )M6 )7 )!7 ) 7 ):7 )SR7 )R`7 )n7 )7 )S7 )R7 )d7 )-7 )|$7 )!7 )`7 )(88 )T-878O8 +S8 +\8 +*`8 +(h8 )Lq8@8 )T8 +98 +78 )*8 +O8 +G8U8U8 +q8 +o8 +8 +~8 ).99 )T49 +89 +>9 )*H9 +L9 +U9_9w9 +{9 +9 +9 +9 )99 )9[9 )&9\9 ) : : )ʒ': )ʒ6: )JA:Pd: +h: +n: )dy: +}: +: ): +: +: +H: +B: );U: +f: +d: ): )&:`]: ): :;5";=; )tO; )^; )e;}; ); +z; +t; +; +; +; +; +; +; ); )&;@\; );@ < )&<\#< )0<8 ?< )&L<\U< )b<0 q< )&~<]< )<( <'<<B<<U< <g == )5= )lS= )]q= )= )i= )Y= )== )= )g= )*= )}> )*> )^*> )T)> )TO> )\> )1i> )q> )S> )4> )S> )4> )S> )S> )\0? )? )V!? ).? )oK )L )E" L )5L )AL )NL )HaL ) oL )}L )L )L )L )1L )UL )]L )uL )L )pL )R M )ZM )&M )8M )O7EM )W7RM )`M )fqM )j~M )wM ).M )TM )SM )M )HM )NM )S N )$N )z5N )TAN )SMN )hN )zN )N )N )LN )QN )N )ǚN )vN )MN )vN )eO )/O ) O )o)O )}BO )OO )XhO )uO )j O )/O ) O )XO )FO )vO )/O ) O )x P )/P ) 7P )$DP )QUP )*_P )AjP )ъqP )'P )SP )P )SP )P )SP )]P )P )iQ )S Q )-Q )wHQ )SUQ )GpQ )SQQ +Q +Q +*Q +$QQ@RIRI6R +H:R +FCR +WGR +UPR +hTR +f]R +haR +fjR +xnR +vwR +{R +R , R +R +R +R +R +R +R +R +R +aR +QRR ,!R +R +R +S +S5*S?S0RS0AhSySS0ASS +S +S +6S +$S +S +S +S +S +S +T +AT +3TT ,1,T +t0T +r9T +=T +BThTrTT +T +T +T +T +T +T +T +T`T +T +T +T +T`U ,A U + U + U +*U +$#UkIUdU +^hU +PqU +uU +~U +U + U +`U +VU +U +U +U +U#U ,U +$U +U +ZU +FU +U +U +U +V + V + V +FV +<V ,%V +)V +o.VDUVkxVVkVkV +V +V +V +V +V +VV +W + W +'W +W +lW +f7WAW ,RW +VW +_W +cW +lW +pW +yW +}W + W +<W +6W +\W +VW ,W +~W +vWW ,W +W +W +W +W +W +W +W +X +X + X ,X +X +"X,X ,$=X +AX +JX +NX +WX +[X +dX +"hX + qX +1uX +/zX ,$X +@X +>XPX ,7X +OX +MX +^X +\X +oX +mX +X +}X +X +X ,7X +X +Yj Y ,GY +Y +&Y +*Y +3Y +7Y +@Y +DY +MY +QY +VY ,G_Y +cY +pY/zY/Y + Y +Y +Y +Y +'Y +%Y/Y/Y +8Y +6Y +GY +EY +XY +VZ +XZ +VZ +hZ +fZ +y"Z +w.ZWZ +[Z +fZ ,WuZ +yZ +Z +Z +Z +Z +ZZ +/Z +-Z +AZ +?Z +UZ +QZ Z [$[=[ +kA[ +iK[3d[ +zh[ +xr[8|[ ,l[D[ [[[[ +[ +\ +\ + \ ,|\ +\ +(\2\ ,C\ +G\ +P\ +T\ +]\g\ ,t\ +x\ +\ +'\ +%\\ ,\ +9\ +7\ +I\ +G\\ +]\ +Y\%\ ,] +{] +w ] +] +] ,] +#] +,] ,5] +9] +B] ++F] +)R]<\]<u] +By] +@] +S] +O]<] +l] +j]<]<] +{] +y]<]<^ + ^ +^H ^H=^ +A^ +G^Hg^p^ +^ +^ +^ +^ +^ +^ + ^ + ^ +; ^ +5 ^ +b ^ +Z ^ + ^ +  _ + $_ + -_7_ ,D_ + H_ + Q_ + U_ + ^_ +% b_ +! k_ +D o_ +< x_ +u |_ +m _ + _ + _ + _ + _ ,_ + _ + _ +K _ +G _ +f _ +b _ + _ +} _ + _ + _ + _ + _ + _ + ` + ` + ` +A ` +; ` +b "` +Z +` + /` + 8` + <` + J`T` ,e` + i` + r` + v` + ``` + ` + ` + ` + `` +" ` + ` +? ` +9 ` +_ ` +[ aa8a +x r(vPr(vir +mr +wr2vrvr +r +r ,rvr +r +rvrvswv9svVsvcsvrs )'vs )`|s )s )s )#s )#s &s )ps * s * s ,\&s ' s )`s )'gs )`s )vt )$t )wt )St )cQ-t ){2t )ŕ@t )QEt )R^t )Ԗjt )Sxt )}t )Vt )u )Fu )x u )k.u )3u )u?u )Ku )Wu ) cu )vou ){u )u )]u )y )|y )2z )|z )zz )P+z )9z )Gz )(Uz )cz )qz )[iz )1z )jz )Dwz )z )s_z )>z )hz ){ )>{ )+Y4{ )hC{ )R{ )7a{ )wp{ )I_{ )?S{ ){ )S{ )<{ ).k{ )|9{ )c{ )B { ) | )d| ),$| )ZW3| )B| )AQ| )`| )ko| )$U~| )| )a| )I+| )d| )^| )Z| )| )5.| )} )} )Z#} )2} )FA} )P} )=K_} )pn} )Z}} )l} )x} )} )} )z[} )K} )Y~ ):`6~ )$R~ ))i`~ )n~ )IN~ )~ )~ )Y~ ):` ) ) ) )| )'  )- ); )o ). ) )K'ʀ )Eր ) )FI )D )4 )^@ )WN )W] ){ )bF )% )wȁ )ց ) )W ) )  ), )9 )tCF )^S )-<s )!q} )G )L )e )؂ )J )q ) )E  ) )) ) E8 )NG )ŸU )c )M@q )+ )W ) )C )& )Ń )_fӃ )t ) \ ) )f  ) )-' )K5 )3C )7| )  ) )B )ru )WuȄ )Hׄ )Jk )] )7 )R )# )2 )ƋA )P )z_ )an )B} )EH )N )v )_ )ȅ )Bׅ ) )*` ) )B< )P" )1 )9@ )%O )+^ )m ){| )P )1 ), ) ) zdž )ֆ ) ) ) )o! )A0 )? )rN )] )1Kl )Ϗ| ) ) ) ) )k̇ )G܇ ) ) )o  ) )c, )m< )JL )u\ )l )v| )U ) )] ) Lj )ֈ ) 7 )R ) )u )0! )2W0 )w? )YN )] )>l )({ ) ); ) )K ){Ɖ )fՉ )A ) )K )tU )F>  )/ )?> )vM )\ )l )n{ )# ) )v )Qc )Ɗ )bՊ )%d )[ )0= ) )}. )Jr= ) EL )}[ )+j )%Qy )_ )5 )= ) )ċ )Ӌ ) )~| )lX )p )ؕ )Y@- )7E< )-K )OZ )ai )\/x )C )5 )w< )z )aÌ )[PҌ );f )Q )O )? )7v )}, )T; )&J ))Y )5h )8w ) )Ou )= )y^ ) )hэ )- )L ) )"  )N ) + )f: )I )ވX )g )0v )( ) ) )q )F[ )L&Ў )Nߎ )  )` )=  )- )+ )\: )I ){ZX )jog )v )Z )F )`1 ) )} )9Џ )ߏ ) )5 )>  )Z )+ );: )I )X )g )v )q )|( )w ) )Ą )А )yߐ ) k ) )  ) )* )79 )H )W )f )1u ) )N  )hT )7 )6Б )gߑ )A )b )L  ) )* )U9 )H )"W )g )w )1 )< )+ )N )hĒ )XԒ ) )..  )/* )M )>[ )i )w )Ή )d )_Y )9 )E#˓ ):ٓ )b` ) ) )? )9! )x/ )1vW )Od )ew )1 ) )[ǔ )ΖՔ )  ). )\ )Y )d" )D10 )> )<L )#Z )h )v )U2 )}A )0 )G )3m˕ )ؕ )5 ) )* )W> )iwS )z` )" )E )Z )v) ) ˖ )yؖ )T ) )d )Z ) )1# )F/ )< )I )|pV )Rc )Lp ).} ) ) )p )— )З );ޗ ) )x  )= )q@# )a1 )> )K )qMX )[e )~Dt )8 ) ) )* )r )˜ )ɘ )֘ ); )< )7  )P )zM$ ) < )I )V )c )}!p )p )i )љ )V ) )zG ) ) )+ ):9 )G ))U )c )9q ) )a ) ) )˺ )[Ś )]Ӛ )d- ) ) )j  )  )~' );i5 )C )-1Q )|_ )Jm ))D{ )( )O" )SD ); )nț )p՛ )7H )B ); )  )Ү )'}; )G )8S )` )o )u| ) )oj )W ) )I ) )_ ) Ĝ )hʜ )М )֜ )Œܜ ) )= ) )  ), )! )ng )Q( )D )*[ )ya )?g )bvm )s )b8y ) ) ) ) ) ) )y )" ); )$ )G ) )Tǝ ) ͝ )vӝ )Fٝ )Eߝ ) ) )# ) )K )| ) ), )_9 )R )%_ )7z )`~ ) ) )  ) )5 )џ )% )V& )I3 )@ )cM )I% )" ) )֠ )Y )v );L8 )E )WR )> )> ) )2f )Ρ )(ݡ ) ) )  )p+ )$8 )F )uGS )a ) ), )4| )C ) )bբ ) )1 )- ) )% )L3 )A )SO )bo )Z;} ) ), )Z )j )?Wã )Aأ )֘ )zM )4|  )J- )7: ) G )T )U ) )b` ) ) )~Dä )Ф )ݤ )qM ): )¬ ) )c" )8d0 )y%= )Y )We )]r ) ) )gͥ )Fmӥ )8!٥ )o )P ) )A )<* )cF )xR )ed )q )Z~ ) )" ) )Ѧ )fަ )( )2c )Z ) )…, )d9 )hZU )7a )<m )z ) )å )Ÿͧ )ڧ )Y ) ) )N ) * )D )W )g )Sfm )s )?Uy ) ) )B? ) )K )e ) )S˨ )ب ) )M )& ) % )13 )t? )L )zGY )v)s )^ )  )- ).t )Qq )|nĩ )ѩ )L~ީ )[ )/ )|n  ) )/& )+H4 )sB ) dP )^ )k )/y )KX )͊ )U  ) ) d ) )̪ )zM٪ )7 )>' ) )2#' )B`5 )B ){TO )"i )_v )|2 )j )  ) )E )ʫ )׫ ) )p ); )>q! )QN/ )B )e` )l )uy )V )s )( ) )k )Ȭ )wQլ ) )<$ )uF0 )U`< )DM )1Y ){j )~@w ) )O )d ) )|ɭ ){U֭ )c ) )y ) )|! )8 )E )|R )_ ) l )e )B@ )0% )RA )( )rخ ) )2! )-  )G )4! )"Z- )9 )O )>l ) )J ) )A )ů )0Gѯ ) ) )T )57  )Kx# )0 )= ) J )X )7l ) x )r )e )i> ) E ) )=İ )pѰ )ް )T )al )ļ )d  ) : )PH )U )Oc )p )} )  )4| ):{ )h )} ) ͱ )Lڱ )o )I )% )3 )F )( )6 )C )P )<^ )k )Hx )p ), ) )  )̲ ) ڲ ) )5 ) )4C ) )%<) )S )` )n )?z )A, ) )yw ) ) ))ѳ )޳ ) ) )&2 )> )fL )Z )Kh )w )Q\ ): )I] ) ) )b )A )ô )Ѵ )7 ) )K  ){ )& )z4 )B )P )}_ )Gm )+{ )a )^ ) )B )7õ )h@ѵ )Uߵ ) )u )  )S )x' )&5 )C )Q ){_ )$vm )g{ ) )c )5 )O )= ) [϶ )ݶ ) )w )  )) )2g# ):O1 )L? )+M )][ )k;i ) w )% )  )$E )r )_x )}$ͷ )۷ ) )A ) ) )Q" )0 )-> )'L )Z )`h )sv )zW )4 )kf ) )  )ʸ ) 7ظ )5u )? )}= )5u! )^/ )= ):K )«Y )Gg )u )Q )E )S )_2̹ )|n۹ )5 ): ) ) )! ) / )A= )K )p[ )Bk )w{ ) )  ) ) )T˺ )4bں )w )G ) )! )K )Y )-h )Fw )|2 ) )+ )% )iʻ )ٻ )E )  ) )' )6 ) Z ):~d )Bs ) S )V ) )c )ٸ )Ǽ )ռ )~ )] ) )  )2 )) )c7 )JE )ne )r ) ) )b ) z )Ԓ ) ڽ )= )   )Y )a* )8 )W_ )ml )-y )D ) ) )L )ߌ )Ǿ )Ծ ) o ) )y ) )g )" );/ )6< )bI ).V )c )rp ) )W )R )ֿ ). )b )< )j* )XU7 )D )7Q )j )N~ ) )~ )g ) )Jr ) ) )P? )Ö ) )H )  )  )1& ) 3 )-@ )M )>Z )!g )t ) )! )3$ ) ) ) ) ) )u )  )w )% )3 )nO )] )k )y )K ) )r* ){ )aT )f )K )tU )  ){ )? )v! )/ )n= )K )Y )g )@_u ) )w )7v )b ) )  )7 )c ) )C )u ) )r{+ )u:9 )M )z[ ) h )u )Ӛ )U/ ) ) )z )# ) )+ ) ) )!Y ) )- )L; )DI )] )[Pg );ft ) ) ) ) )+h ) ) ) )Q ) )B ) )i>! )S/ )ѫC )8] )$ g )q ) ) ) )  ) )W )C )Z ) )  )d )#*$ )1 ) > )K )MX )}e )or ) )7 )Zj )T ) )fr ) )0 )9  )m )I' )5 )cC )Q )_ ) m )Q>{ ) )Q )E )%< )Z ) )ۋ )'  ) )7' )4 )zH )U )b )ߎo )= )T- )y{ )% ) ) ))x ) )  ) )X ) )1  )d.) )S7 )E )uS )a )\o )} )[D ) ) )YA ) )] ) ) )- )F )-! ). )k= )NJ )|d )uq )_~ )# ) ) ) )j ), )y ) )! )A& )3 )@ );M )EZ )g )t )D ) )4| )  )h )8 )J )G )+ )d** )x7 )tD )PQ )^ )k ) ) ) ) )g ) )E )   )JW )% )#3 )ͦ? )UQ )$e^ )k )/Cx ) )W )=b ) )H )?r ) ) )Z ) )zG- )v): )^H )U )^b ) o )A| )G )l ) )D )L )l ) )E ) )T ) ! )H )+yW )d )#q )~ )}v )к ) )"T ) )   )M )& )3 );@ )M )pZ )<g ) v )n ). )A )e ) )N )aU ) ) )) )X< )1I )xSc )p )j )k ) d ) )S ) ) )s ) ); ) )C )  )- )0: )G )ET )&a )n )| { )^ ) )d )  ) )i )] )߾ )CY" )/ )QF )7-S )j )Kgw ) )$ ) ) ) ) ) ) )) ) )K. )4 )ҝ: )X|@ ):G )W )9J] )c )(i )۠p )} )7 )xS )p )p )Y ) ) ) ) )* )7 )+D )~Q )b^ )ҡk ) ) )n )b> )k )s )s ) ) ) )i>, )C )P )] )׽w ) ) )X )  ) ) )h )S: )  ) )4| )}J )+ )8 )>E ) R )__ ){l )>"y )  ) )Ba )m )Dj )1 )9 ) )=* )C )m6 )':B )/X ){Td ) ) )g )L )ҿ )> )o2 )- ) )" )BZ0 )m= )W )Yd )q )~ )I )zG )R )Vc )Z. )" )g9 )CG )m} )g )\ ) ) ){T ) )W ) )+ )D 9 )!G )2?U )Zc )Kq )QP )g ) )M  )" )] )- ): )l )# );j1 )(T )c )n ) ) ) )=h ) ) ) )} )R  )V )M#' )B+5 )I )cGW )je )ys ) ) )[E )3m )* ) )/C )| )p ) ), ): )BH )HV )d )} ) )M- ) ) )X )U  ) )P# )˺1 )ّ? )@M )f[ )i )#ow )H )Nm ) ) )D )2 )| ). )gu ) )& )<B )\ )ku )i> )  )^- ) )Y )`" ) ){ )( )_$ )ɿ2 )@ )N )\ )j )x )I ) ) ) )F. ) )n ) )# )> )^Z ) R% )Dh4 )]C )0R )a )p ) )I )K8 )q" ) ) ) ) )% )  )$ )3 )rB )tQ )` )qo )~ )zG ) )_0 ) ) ) ) )d ) )k )S# )22 )yA )P )_ )}n )A ) ) ) )c )t )ף )5 )C )m )| ) ) )5D ) )D )[n )n )6 )ê )ߦ )2 ) )i )\ )e ) ) )w )p&" )e/ )]< )I )VV )+c )p )_ ~ )^ )B )q ) )Z )q ) )I )Z )%( )44 )q@ )"W )(d )q )[8~ ) )f )q )z" )h ) )  )@$ )U0 )B< )yI )V )ELc )'p )} ) )@ )L )x )1 )g )j )  )^ )8d% )o!2 )? )T` )m ) )V ) ) ) )z )| )z% )\B )N )(Z )g )u )? )m )} )0 ) )x ) )a )c ): )0 )C )( % )J )Y )g )oiu ) ) )W )& ) )N )P )  ) ) G )S )># )1 )\? )!M ) x[ )S1i );w )[ ) ) ) )* )Z ) )N ) ) ) )] )R- )G; )?PI )W )jf ) u )| ) ), )  )j  )m )ZV )ţ )L^  )# )v12 )eA ).P )u_ ) )yi )bN ) )} )= ) )8 )c )M )c+ )e )! )OI. )hHF )U )Uc )q )i )\ ) ) ) )ۛ )mk )"2 )2~ )3 )E  )A )Q' )5 )pC )0iQ )_ )Um )u{ )v9 ) )[X )W )9 )s )m )q )m )  )K )( )8 )G )V )Xe )Tt ) ) ) ) )$ )d )H )~ ) )z  ) )A( )\7 )F )U )d )s )f ){ )j )81 )X ) )y )j )K )! ))' ) )P  )| )$ )1 )X )r ) ) )c )Pn ) )^- ) )v+ )8 )E )R )_ )l )Y )} )i> )! )| )S )}  ) ) d# )i>0 ) ;= )W )Vd )i>q )~ ) ) ) )] )' )S_7 )= )C )IJ )T )dca )]n )>;{ ) )  ) )m ) ) ) )F )K )W )_ )S, )9S )v` )s ) )U )r ) ) @ )Q ) )0# )0 )nJ )` )gyl )& ) )\ ) ):2 ) )U )r )$p  ){ )2 )#E ) O )^ )k )czx )0 ) ) )|; )> ) )\ ) )W )`- )R )^` )z )7 )v? )< )zc ) )a )[ ) ) )d )u ) )'!( );n5 )B )U~ )C ) )a )4 )} ) )- ) )g ) )V )U ), )K9 )sG )|T )@b )m^o )| ) ) )Ö ) )Q )HY )  )V  )! )<. )< )J )OW )d )9q ){ )Uw ) ) )  )D; )| )( )= )I )y^ )j )~}w )% ) )l[ )} )& ) ) )/  ) )X) )V7 )hE )S )wa )co )?} ) ) ) )k )  ) )c ) )xR  ) )7) )8 )U )7d )bs ) ): )Z  )d )  ) )fV )XN ) )  ) d )' )6 )/E ).b )q ) ) )] ) ) )% )Vc )BF )k ) , )W% )t4 )ӤC )R )a ){ ) )4h ) ) )̶ )z ) )N )* )]7 )D )#R )4 )s ) ) )r ) )F )V ) )H )l )g )0 )" )T( ). ),4 )D )R ) ^ )k )Px )^ ) ) ))0 ) ) ^ )[ )q )( ) )8 )`E )S )a )o )! ) ) )2 )W ) ) )7 )D ) ) ) )6+ ): )?] )i )|y ) )q )Q )9 )5 )  ) )h )  )  )  )v(  )H5  )B  )O  )ћ\  )j  )Lw  )K  )  )O  )^C  )R  ),r  )   )  )$  )  )  )#  )Z%  )7r9  )3^G  )mU  )`c  )Bq  )  )W  )  )9  )r  )  )O$  )2  )L@  )HN  )a\  )j  )@Xx  )s  )t   )\  )r/  )l=  )K  )Y  )Bg  )^u  )  )!  )  )  )R  )  )^  )\  )  )$  )P  )  )P,  ):  )nH  )*VV  )d  )?r  )k  )  )G  )   )x  )N  )(  ) )] )W )s, )HS: )=H )6GV )+d )Ms ) ) ) ) ) )N ) ) )4< ) )S  ) )  ) )'F ) )Wu )i ) ) ) )w )D )pZ )#  )^ )'X% )g 3 )A )oO )h] ).k )yy )k )y~ ) ) )5 ) )݀ ) )1r )l )UkG )T )^l ).-y )]z )S )  )# )A ); ) )  )`  )v$ )72 )@ )N )H\ )#j )x ); ) )G ) )  )Kq )< )*; )"; )X )G  )Y  ). )K< ):9J )B9X )f )et )rx )H )K )@ ) )_^ ) ) ) ) )D! )N0 )Sl> )7L )4|Z ):#h )rv ) ) )0  )) )3 )[ )m ): )( )'- ); )(I )W )} )]B )" )8 )  )P )S )S )׶ ) )׌  ) )@% )gJ3 )nA )O )] )OOk )y ) ) )  )SZ ) )P ) c ) )c  )x )f4 )C )#M )_a )?o )| ) )5 )G )D )[* )~ )Y )w )' ) : )  ) )aS% )2 )X? )L )ůY )f )s )c )N )u )u  ), ) )i ), )I )0Y )* )fi )y  )H )U )Db )= ) )w. )JH )4|U )b )o )Ԉ| ){T ) ) ); ) )gO  )J" )mj# )# )=# )}# )# )=# )G# )."$ )'w% ) % ) Q% )% )|% )E% ) 7% )c& )/& )/C*& )a9& )9H& )%W& )of& )Wy& )& )& )vy& )“& )& )& )& )v7& )h ' )' )'' )=4' )XSA' )N' )f[' )Vh' )%v' )' )' )h' );' )<' ){' )]]' )-' )' )' )) ( )T( )~"( )/( )I<( )I( )2V( )c( )Qp( )~( )l( )( )9( )R( )m( )r( )߷( )( )O( ) ) )|2) ) 7&) )|K) )X) )e) );) )-) )() )) )˺) )4|) )SY) )+* )˺* )]* )+* )9* ) G* ).U* )c* )q* )R* ):* )* )* )* )* )G* )* )+ ) + )*+ )J7+ )-E+ )S+ )ia+ )o+ )i>}+ ) + )+ )T+ )x+ )<, ), )~, ), )I, )8, )- )Z- ) - )-- )q:- )k- )E- )- )|- );- )g- )- )k- )- )4|- )g. ). ). )B+. ):9. )AG. )U. )/ ),/ )U/ )0 )c0 )i> 0 )ͣ-0 ):0 )M0 )'Z0 )]g0 ),t0 )0 )0 )u0 )%1 )p,1 )3k91 ) F1 ) b1 ),1 )i1 )QN1 )|1 )dO2 )Lh\2 )|2 )j2 )2 )3 )3 ) 3 )/&43 )N3 )u3 )LU3 )zq3 ) d3 )3 )'}3 ) 3 )3 ),4 )'4 )^24 )z?4 )Y4 )r4 )c4 )Kb4 ). 4 )4 )U4 )4 )4 )4 )Vj5 )W){5 )D5 ).a5 )S5 )#5 )Xm5 ) d5 )5 )zM5 )5 ),5 )4|6 )s&6 )P46 )B6 )ŠP6 )d6 )&b6 )6 )%6 )6 )#6 )B6 )77 )|!7 ).7 )9;7 ) 7H7 )U7 )h7 )mx7 )\~7 )2N7 )m7 )?7 ){7 )7 )̠7 )9|7 )%8 )28 )X8 )%8 )c8 )8 ).>8 )8 )8 )C~!: )>1: )7: )=: )C: )J: )h{X: )e: )r: ): ): )Ș: )iG: )K: )f[: )-f: ): )f; )/C; )71; )?>; )K; )#~X; )e; )r; ); ); )z; ); ) 7; ); ); ) < )< )("< )0< ).>< )f[M< )B\< )p1k< )< )kY< )< ))l< )< )p< )?< )'K< )9= )= ))W= )|.= )u== ) ~L= )U;i= )gx= ) M= )= ) )R> )< > )DE0> )2@> )P> )V(f> )Ys> )> )'> )K> )> )> )> )> )> ){> )> )(J ? )? )U'? )_5? )iC? )Q? )_? )qm? ),{? )? )Ȥ? )? )M? )2Q? )/? )@ )xR@ )@ )>%@ )!a+@ )1@ )" 8@ )*I@ )O@ )TMU@ )k[@ )a@ )Ch@ )0v@ )@ )@ )@ ))@ )7@ )@ )@ )Z@ )*@ )rA )A ) A )8.A )=A )LA )?[A )qjA )TyA )A )FlA )A )EA ) A )A )A )^A ) A )NB )2B )k.B )=B )>KB ) YB )GAgB )xuB )&B ),]B )B )E)B )4B )B )RB )tB )0C )C )g(!C )t1C )IAC )QC )_C )ntmC )›{C )MC )|PC )C )C )UC )7C )C )(@C )|D )D )|5D )EBD )OD )x\D )iD )>vD )[[D )`D )XtD )OFD )\D )lD )sdD )D )YD )e=E )|2E )nB)E )ME )-WE )1sE )7E )E )%E )YE )E )E )F )|F )F ):*F )ݹ7F )DF ),gQF )d^F )kF )xF )O{F )cF )[F )RF )F )F )F )wF )'F )%G )2G )|LG )zGYG )<fG )sG )dG )VG )(G )G )G )O{G )cG )G )G )W )W )RW )xW )HDW )W )kW ):W )W ) X )X )k(X )zz6X ):ADX )GRX ) `X )nX )fX )0LX )ntX )mCX )6>X )mX )X )!.X ):Y );lY ) ,Y )&?Y )LY )YY )UfY )RsY )Y )iY ){Y )0Y )Y )Y )7Y )AZ )[Z )Z )QU)Z )=Z )GZ )QZ )[Z )y'iZ )wZ )Z )Z )|Z ).pZ )Z )Z )Z ).Z )a$[ )V [ ) 5[ )+C[ )hQ[ )X_[ )m[ )G{[ ) ~[ ):[ )[ )([ )%[ )[ )[ )P[ )[ )y \ )#\ )*\ )vt;\ )A\ )mG\ )\ )] )2] )?^ )^ )^ )?*^ )z7^ )NoD^ )Q^ )^^ );k^ )(x^ )׺^ )(^ )^ )m^ )G_ )c_ ) 8_ )l6_ )HC_ )HP_ )]_ )"j_ )xw_ )_ )8_ ):_ )U_ )_ )y_ )_ )m_ )~_ )=_ )F` )` ); ` )-` )@E` )R` )"k` ) ~` ) M` )u` )` ).klb )b )i>b )b );Zb )b )b ) db ) 7b )Rb ) c )c )c )B,c )r:c )Vc )dc )c;rc );Zc )c )wc )9c )|c )c )Zc )c )d )"d )o#d )389d )Cd )bOd )[d )<gd )sd )Mwd )d )Bd );d )*d )d ),Me )e )"e )D^0e )>e )Le )?Ze )zhe )ve )0e )e )e )He )Re )We )e )wpe )Re )&f )řf )f ){.f )?Jf )Xf )Mff ) tf )f )?f )-f )Af )=f )hf )!@f )of )ejf ) g )kg )l ,g ) k )/k )%$)k )~8k )fGk )Vk )q$ek )uk )>k )rk ) k )&k ) k )k )0k )5Mk )ol )$l )C3l ){Bl )hQl )`l )!pl )l )îl )l )g/l ) l )l )l )l )wm ) A m )W*m )4m )Cm )|Qm )/_m )mm )O{{m )m )m )cm )Bm )`Em )m )m )o )]\o )o )o )o )] o )-p )p )p )p )Hp )5q ) q )P q )Y-q )@:q )2Hq )bq )Ooq )mq )q )Mq )Cq )aq )q ))r )r )r )X *r )37r )Dr )UJQr )^r )%kr )Yxr )r )Gr )r )Qr )Jr )_r )Fr )[r )^r )sr )=s )s )es )Ds )Js )-s )s ) s )s )[s )?s )-s ) t )t )l)t )z6t )Dt )-Rt )`t )nt )|t ))t )Tt )Ct )-t )t )t )9t ))t )|t ),u )\Ou )-$u )2u )B@u )XNu )˔\u )|ku )xu )u )-u )u )u )Yu )/u )˂u )u )}u )>>v )> v )v )Q'v )34v )"Av )Nv )t[v )Sjv ),}wv )Ov )v )v ):Rv )v )v )nv )Bv )b%v ))w )!w )w )Q.w );w )HWw )New )sw )w )w )#Iw )[w )y0w )|+w )Vgw )w )Yw )}x )}(x )Vg5x )Dx )Sx )9ax ) ox )Xx )Xx )T'x )x )}x )x ))x )x )9x )) y )3y )X'y )X4y )[pAy )Ny )]y )) jy )!wy )y )oNy )*y )uy )(y )Py )`y )by )py )z )N z )j-z )+z ))9z )3Hz )ez )sz )2;z )Pz )z )z )Fz )[z )2;z ))z ){ ){ )0{ )+{ )3:{ )*W{ ) f{ )+#t{ ){ ){ ):R{ )0{ ){ )n{ )B{ )b%{ )){ )3| )"| )G| )Y*| ){8| );F| )V| )ɹc| )@q| )+#| )| )| ):R| )0| )| )n| )B| )b%| ))| )3 } )} )Q'} ){6} )C} )Q} ){_} ).m} ){} )} )GJ} )8} )Q} )} ){} )P< ~ )Q~ )|\(~ )6~ )FD~ )fR~ ) `~ ) n~ )}~ )Yh~ )9~ ){~ ))~ )3~ )X~ )\~ )^~ )Y~ )G )F& )3 )B ){P )_ )Qm )| ) ) ){ )X )Y ) ){ ) )) )3 )k& );3 )%A )XO ))] )k )3y )Y )G ) )8 ){ ))̀ )3ۀ )  )y )Y )# )0 )Q> ){L )XZ )`h )Rv )~o )a )_ )) )٭ )$ʁ )Q؁ ){ )T )) )3 ) )m, )X: )YH )V )Gd )Qs ) v ) )) )3 )Y )GƂ )QԂ )[ ) ) )H ))* )39 )OKF )BQU )<d ))r )3 )l )Y )G )8t )Jǃ )= )) )3 )Y )r )( )~6 )D )=S )|` )so ){} )) )3 )Y )G )QÄ )[ф )j+߄ )e )æ )  )˜ )& )s4 )C )Q )~_ )~m )} )" )& )&m ) )Å )CЅ )"߅ )> )) )3  ) )s' ){5 )bC )btQ )_ ))m )e )F )r )Ɇ )~ن )  )s ){ )^ )) )3M )gZ );h )vev ) )5, )Y )y )H ) .ʇ )؇ )Y )( ) ){ ), )- )cL; )I ))W )kf )t )i_ )) ) )= )3 )Ȉ )3ֈ )Y )w ) )j ), ){: ),H )V )cd )&r )> )) )3 ) )ɉ ))׉ ) )3 ) )U? )7 )+ )?9 )X )We )t ){ ), )) )5, )yE )3Ȋ )֊ )Y )  )qV ) ) ) * )9 )H )eW )i_e )Qs )[ )o/ )ml ) ) )+Nj )8Ջ )  )g ) )M  )Y )*)) )7 ){E ))S )^a )3o )Y} ) )Ȁ )e )Č )Ҍ )+ )" )  )o  )) )& )4 ){B )%P )^:^ )<l )"z )^ )c ) )s )Ѝ )ݍ ) ){ ) ) )$ )H3 )MA ),O )$] )1k )Oy )^ ) )X ) )/ )͎ )ێ )p )` )) )X )" ) 0 )3? )L )Z ){h )v )) )3 )^ ) )Rʏ ) ؏ )g )Ѹ )A )+ ) ] )8, )1: )H )YV )d ) Gr )` )+ )G )n )  ){ǐ ) Ր ) )H )$ )* )l' ),* )8 )`F )T )Xb )p )pf~ )= )} ) )ǧ )ő )4ӑ )Y )Mv )) ){  )) )H) )37 ),E )YS )r )z )|Y ){ )^ )) )gŒ )Ӓ )3 ) G )R )   ) ] )X' )Ѹ5 )8C )YQ )G` )m )Y{ ){ )) )V{ )+ )$( )Г )qݓ )# ){ )) )< )X% )3 )HA )|jO )F] )k )Cy )F )~ )3 )Y )3 )2:͔ )on۔ )a ) )5, ) )XR! )/ ){= )K )Y )g )iKu )X ) )) ) )3 )Yɕ ) )R )N )kW )  )+, )": ) H ))W )Ud )W,r ){ )% )Y )< ) )^Ɩ )iQԖ )3 ) )  ) ){* ) 8 )F )>U )$c )Aq )l' ), ) )) ) )Xŗ )qӗ )M ):B )8 )  )3 )Y' )45 )GC )QR )ΐ_ )m ){{ ), )! )) ) )A )>Ϙ )aMݘ )7 )T] )z )L )'# )B );O )] ),j )w ):R ) )) )n )B )b%ř )3ҙ )Yߙ )4s )4 )X ) )%# )$0 )<@ )B\F )JM )m )#y )  )J; )E )* ) )ǚ )Ӛ )3 )|n )x )-K )˕^ )t ) )O ) )d ) )pț )M )( )- )F ) ), )$; )J )Y )Wh )r=w )% )o ) ~ )\ )pWœ )ќ ) ) )t )Ӥ  )2" ), )&R= )oC )U )c )q )7 )tk ) ) )aӝ ) )# )ş )v )? )h )W7 )t ) e )vŸ )ȟ )j Ο )5՟ ) )  ) ) S& )l[3 )l@ )UM )Z )g )9t )ͣ ) )X ) ) )`  )SϠ )ܠ )C )O )ӟ )) )=6 )C )P )6] )hj )>w )y8 )? )Y )D )ǡ )ա ) )J )S )\  )e )Sx) ) F7 )E )&T )c )r ) )F )Y )  )j )̢ )Tۢ )b ) )b )' )96 )kE )svT )Ac )Br )4@ ),Z )P ) )? )"̣ )ۣ )$ ) )z )n\ )& )y5 )D )dS )&b )q )% )s )2 ) )= )^bˤ ) ڤ )7 ) )y )# )y% )/A4 )C )$R )a )Sp )[ ) ) )`g )Q )|ǥ )ե )( )F )\ )I ) ), )r; )J )YZ )Ej )/y )_ ) )T )L )Ħ )Ӧ ) )0 ) )X ) ). )m= )K )Y )2g )su )t )WH )  ) ) )ɧ )ק )bH )nL )‡ ) ) , )^, )); ))nJ )RY )h )jw )D )`( ) )U )¨ )Ѩ ) ) )4 )  ) )^+ )n: )I )X ) )WK )fX )e )Yr ) ) ) ): ), )ԧ )qͯ )گ ) )1S )j )H )#O ))o+ )ձ9 )G )UU )c )t,q ) )g )@X ) ( )] )ǰ )Yְ ) ) )4 ) )! )n0 )? )N )ƶ )u߶ ) )̞* )7 )i>D )7Q )+^ )q )F~ )t )v  )) ) )8 )η )ږ ) ) 9 )  )Y. ); )H )f )4s ) )Y ) ) ) )oӸ ). ){ )l ) )& )2 )f? )M )QdY ).f ){s )H ) )"S )3 )Ĺ )Lѹ )߹ ) ). ){ )Z ) )K= )\9I )V ) 9p )} )Y ) ) / ){ ) )˺ )) )Y )g ) )Y )A* )B!6 )1/C ){P )] )j )˓ )z )T ){ ) ))̻ )3ڻ )Y )L ) )G )_  )q. )QM )~u[ ){i ))w )3 ) )Y )G )Q )8˼ )Aټ )[ )e )$ ): )' )- )Q; )[I )W )Ze )s )s ) )i> )_̽ )oSڽ )O ) )  ) )& )i>4 )B ) P )E^ )y )O ) ) ) )v ); )J*۾ )i ), )ҍ ) ) 2! )i/ )E= )Q )-_ )m )Y{ )y* )< ) ) )P¿ )Oп )z߿ ) )0q )@%  )% )e3 )EA )oO ).\] )Fk )"z ) )i> )8V )H  )_ )E )t )J* )i ) )[ )"0 )> )`=R ) c )i )p )L~ ) ) ) )j )|& )hF )A ) )E ) )  )}/ )7K )1Y )yLg )u )| )  )ے )  )L ) )8( )i> )k )i> ) )q, )|: )cH )sV )hCd )kr )H ){ )f ) )M )G ) )@ )d )] )w ) )G, )Q; )J )Y )h|h )XIw )r )- )= )_ )j )V ), ) )y )0F  )Hi )*7+ )b: )sKI )X )g )80v )yL )6[ ) )  )e )s )>c ) )r ),  )I )* )͙9 )iPH )wW )f )u )# )] ), ) )b )GM )z ) )>d )  )8 )m) )8 )G )$V )e )Ut ) ) )?8 ) ) )˒ )FG )[ ) )   )GC )( )7 ) F )wU )d )'s )Z# ) )~ )# ) ) )Y ) )4j )  )Rr )\r' )Xo7 )aoG )V )uf )u )U )C ) ) ) ) ) )M ) )CR  )b )) )8 )sG )V )He )t ) )( )  )O ) )} )+ )a )D )  ) )M.( )7 )0JF )P U )Cd )nts ) )u )>- ){ )Z )sY )a ) ) )hF  )J ){' )6 )oE )4oT )c )8r )) )ET )' ), )"+ )/ )T )0 ) )X ) )t& )Z5 )`D )<S )b )!Lq )7% )y* )! )V )k] ) )o ) )B )|> )} ))_% )_4 )C )J9R ) a ) p ) )g )z )  )f )[ )d )ŭ )N ) )~ )$ )c3 )lB )Q )` )o )~ )' )U ) ) ) )t )v )H| )D )m )# )I2 )A )LP )I_ )n )} )x )/ )C )8k )e ) )M )j )o )C )" )1 )@ )O )^ )m )h| ) ); ) )  )n )- ).2  )d): )cp )k ) ) )h0 )< )zb )Ho )[| )y0 ) )  ) )ɚ )B )b% ) ) )Q ) )b$ )gI2 )@ )n>N )\ ) j )iax )$ ) ) )k7 )oH )| )[ ) )C ) ) ))  ). )< )ޝK )Y )g )Bu )b% )0 ) ) ) )M$ )n )X ) ) )&" )gT ) )υ )} ) )>) )a1 )rM )bn ) )i )K )| )2+ )/ )L )O_ )v ) ) )  )C )v )l )* )7F )XO )j ) r )" )Z )y )pr ) )# )[ )r + +$ )n/ +<3 +88 ) C +\G +TL )\ )l,^ )8 + + ) + + )n +  + ) + +$ ) 4 )M +9Q +)_ +c +{h )Ds +w +| )4 + + )q  + + ) + + )  +{ +wW ,#& ) ww + +& +* +3 +7 +> ,9&G )ͥR +V +[ ) f +j +t~ ,I& + + +  +P_h ) ,% +: +0 ) < +v +l + + )C ) + +  += +5 )! +d% +`* )45 +9 +yEN )X_f )#Vs^| )7P  ,& )  + + + + + + + + )#V ^ )7#H 1;W +%[ +#d +Ah +3q +u + + +X ,& + + + + + + + +S9U$i 1ڿ>VYS'f_puY'_ )Ӂ ) ) )  ) / )!9[ +_ +d )o + s + x ) +E  +=  )  +q  +m W ,% ) ̼̼ +  +  +   +  +  +  $:7oW{ )m ,% +  +  ) +  +  +C! +;! )< )/ +!3 +s!A +!E +!J )U +"Y +"^ )4i +0"m +"y )_ )#V@_ )7`  ,% )  +" +"RR  +" +" +" +"$ +"( +"4 )#VA_J )7WX e[o ,% +" +" +" +" +# +" ,% +# +# ,% +># +6#[[  +p# +n# +p# +n#$ +p#( +n#/J7ѻ]jYx'_7Yx'_ ) ) )  ) ( ) < )F h +#l +#q )| +# +# ) +# +# )  +$ + $׹ ,% ) LL +%$  +#$ +%$ +#$" +%$& +#$-G|׹ )D ,G% +>$ +4$ )`_ +z$ +p$  +$  +$ )5" )< +$@ +$N +A%R +9%W )b +h%f +d%k )4v +%z +}% )` )#V` )7p  ,p% )  +& +& +& +&$ +&( +&1 +&5 +&A )#VN@`W )7dh r| +)& +'& +E& +7& +& +& +& +& ,]% +& +& +&" +&+ +&/ +&8 +&< +&C7^JmQ'LӸrX8'`X8'` ) ) ) ) = ) Q )ջ[е} +& +& ) +' +' ) +I' +A' )  +u' +q' ,7% )  +'! +'* +'. +'7 +'; +'BT\g ) ,$ +' +' )m  +' +' +N(" +F(' ).6 )P +(T +z(Y )4d +(h +(t} )b )#Va )7  )#Va )7x  ,% +R) +N) +x)# +h), +)0 +)5 ,%G +*K + *Tsa ,$%n +5*r +/*{ +_* +]* +_* +]* +_* +]*QJq3p,X&%b/X@&Sbc )v ) ) )  )  ) +v* +n* ) +* +* )# +*' +*, ) E +*I +*U^ ,$g ) y   ++ ++ ++ ++ ++ ++dwET )` ,$v +-+z +#+ ) +i+ +_+ ++ ++ )' ) ++ ++ ) +, +, )4 +L, +8, ) @a )#V'`0 )7= L )#VYab )7o } ,$ +, +, +, +, +, +, ,$ +- +- ,$ +'- +- " +Y-& +W-/ +Y-3 +W-< +Y-@ +W-Gb"o+Ų8\XM&`@aj{X{x&@a )W ) ) )  )  ) 1 +p-5 +h-: )E +-I +-N )Y +-] +-b ) { +- +-Ұ ,$ ) LL + . + . + . + . + . + .EҰ} )V  +#. +. ) +Q. +I. ) +. +w. )k +. +. )p +.  +. ) ) +/- +.9ݯB ,~$K ) ]UgU +/ +/ +/ +/ +/ +/ݯ+> )>H j +-/n +%/s )~ +[/ +S/ ) +/ +/ )k +/ +/ )E +/ +/ +/ +/ )  +0 +0 ,k$ ) #n-nE +40I +20R +40V +20_ +40c +20j  )fm6 +K0: +C0? )EJ +w0N +q0S )^ +0b +0g ) w ) ) +0 +0 )4 +0 +0 ,O$ ) gg  +0 +0 +0 +0$ +0( +0/J  )a +1 +1 ) +=1  +51 ) +k1 +c1" )k- +11 +16 )EA +1E +1J ) c +1g +1s| ,?$ )  +2 +2 +2 +2 +2 +2H[.ex )c} +2 +2 ) +G2 +?2 ) +u2 +m2 ) +2 +2 )  +2 +2 ,/$$ ) 6@X +2\ +2e +2i +2r +2v +2}I\ )H} B +2F +2K )V +*3Z +"3_ )j +X3n +P3s )~ +3 +3 )  +3 +3| ,$ )  +3 +3 +3 +3 +3 +3D6Wk| ); +3 +3 ) + 4 +4 )  +;4  +34 )k +i4! +c4& )E1 +45 +4: ) S +4W +4cl ,$u )  +4 +4 +4 +4 +4 +4H[Uh )Ir +4 +4 ) +5 +5 ) +E5 +=5 ) +s5 +m5 )E +5 +5 )  +5  +5 ,#( ) :D\ +5` +5i +5m +5v +5z +5=P )8%G +5K +5P )[ +6_ +6d )o +F6s +>6x )k +t6 +n6 )E +6 +6 )  +6 +6r ,# )   +6  +6  +6  +6)  +6-  +64 8O K r   )   +6  +6  )  +"7  +7  )"  +P7&  +H75  +~79  +x7>  ) W  +7[  +7g tp  ,#y  )  Х Х  +7  +7  +7  +7  +7  +7 ( ;" [Y t   )   +7  +7  )  +7  +7  )  +*8  +"8  +X8  +R8  ) ,  +{80  +w8< jE  ,#N  ) ` j   +8  +8  +8  +8  +8  +8 9 L j2 @  )J l  +8p  +8u  )  +8  +8  )  +9  +8  +29  +,9  )   +U9  +Q9 u  ,#  )   +k9# +i9, +k90 +i99 +k9= +i9DD_Wu )Se +9 +z9 )H " +9& +9+ ) D +9H +9M )4X +9\ +9a )q ) ,# )  +: +: +: +: +: +:A TBx )W +: +: ) +M: +E: ) +{: +s: )k +: +: )E +: +:  ) $ +:( +:4W= ,#F ) Xšbšz +;~ +; +; +; +; +;0W&9 )Ce +);i +!;n )y +W;} +O; ) +; +}; +; +; )  +; +;U ,# ) ѠѠ +; +;% +;) +;2 +;6 +;=$X7U{ )4 +<  +; ) +1< +)<$ )/ +_<3 +W<8 )kC +<G +<L )EW +<[ +<` ) y +<} +<b ,p# ) ՟՟ +< +< +< +< +< +<(;Db{ ) + = += ) +;= +3= ) +i= +a= )k += += )E  += += ) , +=0 +=<gE ,`#N ) `՞j՞ +> += +> += +> +=-@g.A )yKm +>q +>v ) +E> +=> ) +s> +k> )k +> +> )E +> +> )  +> +>b ,P# ) ՝՝5 + ?9 +?B + ?F +?O + ?S +?Z(u;b )  +!?$ +?) )4 +O?8 +G?= )H +}?L +u?Q ) j +?n +?z] ,@# ) ܜܜ +? +? +? +? +? +?*=4]j} ) +? +? ) +@ +? ) +0@ +(@ )  +Z@ +V@m  ,0# ) '1I +p@M +n@V +p@Z +n@c +p@g +n@n:Mm )` К- +@1 +@6 )A +@E +@J )U +@Y +@^ ) w + A{ + A} , # )  +#A +!A +#A +!A +#A +!AJ ]A}w )! +:A +2A ) +hA +`A ) +A +A )  +A +A ,#" ) 4>V +AZ +Ac +Ag +Ap +At +A{ex )!? +AC +AH )S +BW +B\ )g +IBk +ABz +uB~ +oB )  +B +B ,# ) 11 +B +B +B  +B  +B  +B 2 g  ֙  )r   +B  +B  )  +B  +B  ) ! +!C ! +C! ) +! +KC/! +GC;!D! ,"M! ) _!<i!<! +aC! +_C! +aC! +_C! +aC! +_C!!!+">" )!H" j" +xCn" +pCs" )~" +C" +C" )" +C" +C" ) " +C" +C"͗" ,"" ) "L"L # +D# +D# +D# +D$# +D(# +D/#I#~#͗## )!#@# ++D# +#D# )$ +YD$ +QD $ )$ +D$ +D$ ) 8$ +D<$ +DH$Q$ ,"Z$ ) l$lv$l$ +D$ +D$ +D$ +D$ +D$ +D$$Ȗ%8% K% )^U%@w% +D{% +D% )% + E% +E% )% +:E% +2E% )E% +jE% +bE% ) % +E% +E%% ,"% )  &q&q+& +E/& +E8& +E<& +EE& +EI& +EP&ĕk&ו&&%& )Az&P' +E' +E#' ).' +E2' +E7' )B' +FF' +FK' )EV' +MFZ' +EF_' ) x' +wF|' +sF'' ,"' ) ''' +F' +F' +F' +F' +F' +F'Ԕ(C(~(+( )@(`( +F( +F( )( +F( +F( )( +G( +F( ) ) +*G) +&G)) ,"$) ) 6)@)X) +@G\) +>Ge) +@Gi) +>Gr) +@Gv) +>G})ߓ))*6* )@ *pB* +WGF* +OGK* )V* +GZ* +}G_* )j* +Gn* +Gs* ) * +G* +G*"* ,"* ) *** +G* +G* +G* +G* +G+ +G+!+V+"+F+ )++ + H+ +H+ )+ +8H+ +0H+ )+ +fH+ +^H+ ) , +H, +H&,-/, ,"8, ) J,T,l, +Hp, +Hy, +H}, +H, +H, +H,, ,--Q*- )b4-V- +HZ- +H_- )j- +Hn- +Hs- )~- +I- +I- ) - +CI- +?I-=- ,p"- ) --- +YI- +WI. +YI. +WI. +YI. +WI. 5.j.=.a. )<.. +pI. +hI. ). +I. +I. )/ +I/ +I / ) %/ +I)/ +I5/M>/ ,`"G/ ) Y/̏c/̏{/ + J/ + J/ + J/ + J/ + J/ + J//-/M&0q90 )C0e0 +#Ji0 +Jn0 )y0 +QJ}0 +IJ0 )0 +J0 +wJ0 +J0 +J0 ) 0 +J0 +J0e0 ,P"0 ) 011 +J1 +J%1 +J)1 +J21 +J61 +J=14X1G1e11 )ԃ12 +J 2 +J2 )2 ++K2 +#K$2 )/2 +YK32 +QK82 ) Q2 +KU2 +Ka2mj2 ,@"s2 ) 222 +K2 +K2 +K2 +K2 +K2 +K2:2M3mS3f3 )p33 +K3 +K3 )3 +K3 +K3 )3 + L3 +L3 ) 3 +6L3 +2L33 ,0"3 ) 4 4 24 +LL64 +JL?4 +LLC4 +JLL4 +LLP4 +JLW4Uq4h444 )35 ) 5 ))5 ):65 )C5 )DP5 )]5 )}t5 )`5 )=5 )45 )5g5 )V+5 )_5 )#V5e5 )75 6 ) 6 ) (6 )56 )<B6 )O6 )+a6 ) n6 )}6 )i<6 )kz6 )\6 ) h6 )6 )m#6 ) 6 ) 6 ) 7 )7 )#V+7 f47 )7A7 P7 )#V]7`ff7 )7s7 7 ) 7 ) 7 )7 )<7 )7 )+7 )i<7 )kz7 )\8 ) h8 ) 8 )m#68 )#VC8fL8 )7Y8 h8 ) u8 )8 )<8 )8 )+8 )i<8 )kz8 )\8 ) h8 )8 )m# 9 )#V9f9 )7,9 F9 )-S9 )f9 )?s9 )9 ) 9 )9 )<9 )9 )+9 )Q9 )ߊ9 )i<9 )kz: )\: ) h: )-: )m#F: )Q:s: +eLw: +[L|: ): +L: +L: )1: +L: +L: )y*: +M: +L: ): +5M: ++M: ,": ) : +eM: +[M: ): +M: +M: )<; +M ; +M; ); +N; +N$; )+/; +2N3; +.N9;J; )i<\; )kzi; )\v; ) h; ); )m#;;; +MN; +KN; +kN; +iN; +kN; +iN; +kN; +iN< +kN< +iN < +|N< +zN<8<SQ<~r< < )A=< )=< )<e< )#V=e = )7= &= )-= , C= +NG= +NL= )W= +O[= +O`= )${k= +ROo= +DOt= )= +O= +O= ) = +O= +O= )9= +*P= + P= )= )#V=@g= )7= = )#V=g> )7> >.9>6N>#d>Su>$> )̷>T> ) > +gP> +aP> +P> +P> +P> +P> +P? +P? )? )#V ?`b)? )76? E? )#VR?b[? )7h? w? )#V?b? )7? ? )#V? c? )7? ?T?c ?T @G @T)@L 3@TD@T d@ )~Fi@ T@ ) @ +P@ +P@ +Q@ +Q@ +;Q@ +3Q@ +aQ@ +[Q@ )@ )#V@c@ )7@ A )#VAc!A )7.A =A )#VJAdSA )7`A oA )#V|A@dA )7A A8TAX ATTAG AgTAL AyT BT *B )/BSFB ) QB +QUB +}QdB +QhB +QuB +QyB +QB +QB +QB )B )#VBdB )7B0 B )#VBdB )7B( C )#VCeC )7&C 5C )#VBC@eKC )7XC bCSwC? CSCG CSCL C TCT C ) D )4|D )1O&D )4D )saSD )4|`D ){D )GD )4|D )D ){TD )KD )4|D )@D )aD )lE ) E )UE )Ya4E )[TAE# ME )\E )4|iE )RvE )E )E )'E )E )E )tE )E )E )E )ة F )F ) 'F )2F )*BF )CPF )ժ^F )NlF )zF ) F )&F )?F )XF )qF )F )8F )4|F )RF ) G )>7G )%G ),3G )EAG )^PG )w_G )nG )}G )¨G )ۨG , G +GRG + RG +nSG +,SG +TG +TG +%UG +TG + VG +VG +OVG +3VG +VG +VH +WH +VH + XH +WH +X!H +X3H +qY7H +QY@HmSH@gH ,!tH +ZxH + ZHHH +RZH +PZH +RZH +PZH +RZH +PZHQH ,!H +fZH +`ZH +ZH +ZH ,!I +Z I +ZIÈI ,>!-I +Z1I +Z@I +[DI + [MI +'[QI +%[VIψxIVI0$IeII +9[I +7[I +g[I +e[I +x[I +v[I +[I +[I +[I +[J ,Q!J +[J +[ J +[$J +[.JLJVJnJ +[rJ +[{J +[J +[J +[J +[J +[J +[J +[J +[J + \J + \JυJ ,d!J +.\J +\J(J(K +\K +\K +\ K +\)K +\-K +\8KlQK +\UK +\^K +C]bK +/]kK +]oK +]xK +A^|K +-^K +^K +^KlKlKlK +-_K ++_K +>_K +<_K +>_K +<_K +>_K +<_L +>_L +<_L +O_L +M_ L*LFL +c_JL +]_TL ,t!YLՆqL ~L# L@L ,!L +_L +_L +_L +_LPL ,!L +_L +_L +`L + `L +6`L +4`M +G`M +E` Mm,MևEM +b`IM +V`RM +`VM +`_M +`cM +`lM +OapM +CayM +a}M +aMևMևMևM +aM +aM +aM +aM +aM +aM +aM +aM +aM +aN +bN +bN ,!!N + b%N +b.NlGN +TbKN +RbTN +bXN +}baN +beN +bnN +brN +b{N +bN +bN ,!N +bN +bN +bN +bNrNrNrN +bN +bN +cO + c O +cO + cO +cO + c$O +c(O + c1O +c5O +ccO ,!O +QcO +OcO +bcO +`cO O O-P PzU/PUIPUaPUvP&PgPWPWPWPXP%QgQ)Q +sc-Q +qc6Q@Q\Q +c`Q +ciQ +cmQ +cvQ +czQ +cQ Q<Q +cQ +cQ , "Q +cQ +cQ +cQ +cQ<R<R +d#R +d,R +2d0R +0d9R +2d=R +0dCRYWRńoRRRRdRS)SASYS }S S<SwSS SωT<-TKJTbTzTTNJT TT TUUUp$-Ug=U#UUU;UoU_UU %UgUUUVU.VU$UgVHVV$-Vg7VxVOVVdVo wVgVVVVVWV%VgV;WW WgWRWAWhWbW=XxW )|W )W )W )W )_&W )h W &W )3W *sW *LW ,kW 'W!W )pW )xX ) X )X )ikX )ߍ,X )%46X )[DX )IX )WX )*'\X )@]uX )X )^X )(X )X )P Y )Z`&Y )8Y )}}FY )a0KY )WY )cY )$oY ){Y )Y )Y )gY )EY )Y )+Y )Z1Y )}Y ) Y )GZ )Z )EZ )'Z )Z3Z )n?Z )ٜKZ )]WZ )cZ )VLoZ )4Z )SZ )L|Z )1Z )Z )Z )Z )jZ )CZ )a Z )MZ )y[ )[ ) j[ )y([ )mS4[ )@[ )7kL[ )X[ )] d[ )elp[ )Mq|[ )u[ )[ ){[ )[ )L[ )ў[ )4T[ )w\ )\ )t \ )C-\ )4T:\ )b\ )-sp\ )4T}\ )\ )Ny\ ):\ )u]\ )`\ )\ )X ] )`] )7] )?E] )S] )Wa] )$o] )}] )k] )3] )YJ] )4T] )] )]D] )] )O] )] )5 ^ ):-^ )d%^ )v54^ )9C^ )3Q^ ),=_^ )m^ )~{^ )^ )^ )^ )^ )^ )D^ )~^ )^ )|z_ )"/_ )]&_ ) 5_ )D_ )nS_ )=b_ )zq_ )_ )=_ ) f_ )y_ )L_ )=3_ )A=_ )Jn_ ) ^ ` )7` )^'` );6` )|E` )6T` )l(c` )Lr` )` )u` )` )Tc` )` )` )` )S` )`` )ka )7a )u&a )Tt5a )IlDa )!gSa )ba )yqa )Ta )a )Sa )a )na ):a )8Oa )ha ){ha )S~b )8b )H%b )44b )iCb )Tb )dG`b )eb )uob )}lb )Jzb )o b )Wc )_c ),Nc )e{c )uoc )Od )!nd )d )|d )d )d )d )o d )7e )Fe )oRe )D^e )fje )Lve )e )[e )Mme )e )e )-6 f )H3f ) @f )ǍRf ) `f )zf )cf )Tf )o f ) f )4Tf )Df )mf ) :f )g )g )6S(g )yvEg )qbg )%og )\|g )Xg )ag )Hcg )o g )Fg )g )Pg )lg )@g )(v h )?h )%h )3h )mAh )Oh )w]h )0kh )iyh )h )h )h )yh )Oh )'Ph )nEi )ùi )%i )}05i )IDi ).Si ))bi )=}qi )ki )3i )f i )i )bi )ti ) Yi )Ei )pi )Cj )bKj )5&j ) 5j )2oDj )Sj )?bj )qj )eoj )j )<:j )[j )Rj )6j )Aj )vj )}j )k )k )i~%k )4k )-dCk )Rk )Cak )ck )k )^k )ҁk )dk )/!k ) k )k ),Ok )1l )l )?'l ) 87l )RGl ) ~Wl )Kgl )wl )_l )l )l )rl )Cl )Ưl )l )+ l )2m )`m )_4m )kCm )LRm )Xam )2pm )e]m )*m )m )m ),cm )m )qm )tm )1m )qn )Dn )49$n )<&3n )OBn )Qn )kw`n )Bon )~n )On )`n ) =n )n )>n )n )xn )n )_o )&ko )>$o )3o )(sBo )+^Qo )nr`o )jtoo )i~o );o )o )8o )\o )Fo )jo )xvo )[p )0p )MV"p )ʣ1p )@p )Op ).^p )mp )s|p )ep )p )̱p )@p )Gp )p )Xp )M4p )zq )Dq ) !q )n:0q )?q )%qNq )Z]q )vlq ))"{q )Yq ) q )|q )Qq )_q )mq )4sq )0Dq )<r )Ur ) r )</r )l>r )|Mr )z\r )xkr )`zr )fr )ir )r )/hr )vr )r )r )r )es )+s )Ws )U.s )]4=s )hLs )Mn[s )Vjs )Nys )s )Q<s )ys )Is )s )ms )gs )<s )t )t )jt )}.t ).=t )PLt )6[t )jt )Ɨzt )t )=t )Kht ).t )_8t )t )t )Wt )u )΅u )qu ).u )@=u )gLu )>[u )>ju )|yu )88u )$u )u )u )u )u )< u )u )v ) v ) O/v )d_>v )Mv )9\v )$kv )IBzv )qv )Vv )bv )=v )+av )v )v )Mv )qRw )}w )@#w )v2w )EAw )T4Pw )Yd`w ) ow )yw )sw )w )pw )Iw )<]x )x )۞x )jf-x )Ix )wjWx )7ex )osx )v!x )Mx )b?x )6x )x )kx )Yx )wuy )~y )E=y )NSy )ܲay )Kuy )y )y )y )uy )}y )(y )y )~cy )`y )az )-z )Bz )љ,z ):z )Wz )2dz )MV{z )y[z )z )Zz )Zz )z )k{ )G%{ )g8{ )rF{ )M\{ )ci{ )_v{ )3{ )Q{ )g{ )5{ )$}{ )x{ )!{ )5G{ ){ )]{ )]| )П| )| ) +| )HG| )U| )8ec| )}9q| ) `| )| )<| )@| )ó| )}| )| ))T| )i| ))F} )#} )2} )B} )H} )N} )T} )o[} )h} )9} ):} )Q} )Y} )2T} )N} ).} )f} )Y} )h~ )/~ )3<~ )c~ )ebw~ ) ~ )YJ~ )~ )g~ )~ )6~ )L8~ )r~ )~ )f6 )  ) ) - )B&; )I )DiW )ke )xs ) )5G ) )WE )ߕ )\z )G )h} )% )MN )E  )z )Ni) )E7 )I8E )fZ )g )TKt )C )}9 ) ) )̀ )o ـ )4 ); ) )Ҋ )" ){2 )8 ):> )}LD )J )oP )KV )\ )b )h )mn )4t )nz ) )^ )w )9V )x ) )C:ց )t ) )I> ) )T )4  ) )jC )7 )[$ )** )0 )ُ6 )P< )9B ) lH )-N )T )Z )` )8f )yl )Gr )ɤx )N~ ) )C )O ) )0 )  )ô )\ )m )2  )9 )) )U ) )#; )G )d )l )b )SƄ )ӄ ))t )l )h] ) ) )e )T )P̅ ) م ).d )= )=' )5 )vC )`_b )qq )e ) ) ) )D̆ )چ )TJ ) ) )v$ ))2 )E@ )N )rj )(z )9} )Ix )\< )3 )kSȇ )և ) ) r )8 )  )v. )7A< )|J )9cX )m )z )2T )) )>Nˆ )2ψ ).7܈ )4T )Ba! )|& )o0 )> )K ))FX )}e )r ))T )7 )D ) )- )tʼn )m҉ )4T )c )7 ) )MR )b )h )hn )~ )K ) ), ) ):ۊ )  ) v ) )` )/ )h< )o O )Mf )=ws )q )r )` ) )Ҝ )='΋ )g )  )P` )  )_ )MU )Pb )o )f| )# ) )V )g )ٌ )] )gU )v )ST )` ). )6 )l>  )*- )N; )vE ),R )` )m ) )U )o )uB )$}ȍ )9ԍ )\ )YJ )r )m )K# )y0 )D= )K )Y )f )s ) )x{ ) )Yc )x{ )HKɎ )X׎ )et )M )] )x{ )d )l$ )"L+ )9 )etG )jT )a )2Tn )3{ )o ) Q )Uj )}oʏ )b׏ )_ )h )  )g );|% )(N8 ):E )GR )M_ )l ) ) )9 ) )WĐ )%א )wu ) )x )z )( )r5 )^B ))~P )] )[j ))w ) )Hő )oё ) )[~ )\ )A  )2 )X(& )Fu; )cH )_ )al )sy ))  ) )c ) )) Β )cے ) )-G )M )v )*@& )l3 )AJ ):W )n )-{ )h )[ )_J )/ )^gÓ )ϓ ) )9 )& )tN3 )@ )O )q@\ )Jh )ta )> )^ )2 )T ) ǔ )Ԕ )  ) )2 ) )̆ )vH& ),=3 )FA )|N )<[ )K.h )Su )<` )~ )T ); )(Nѕ )Zߕ ) )Y ) )  )(N! ))/ )4< )yI )YV )m1d )q )|~ )M )h )v )f )} )d.͖ )_ږ )  ): )x ) ) ) x: )H )"JV )\c ))q ) )4 )C )KD ) ): ). ) ) )> ),w ), )j8 ) E )S )` h )u )5G )M )ɘ )Z՘ )kw )<& )O )5G )?j )7% )Ck+ )1 )͹7 )Ur> )BL )Z )h )3 )<& )O ) )-d )z˙ )Eٙ )+ ) )gJ )v )_q! )l0 )~> )CL )&Z )@h ) v ) )8 ) )^ )  )n̚ )37ښ )y  )  )^ )Q )   )t. )< )BJ )X )hf ) t ) )7 ) )s )$x )Xț )+S֛ )v )l )8 )>h )  ) * )G8 )F )hU )kd )Er )[* )jA )ާ ) ) )ǜ )՜ )p ) )Rp )Q  )oc )F) )w7 )E )%S )a )2o )։} )I ); )։ ) Ɲ )ԝ )7 ) ) )  )D\ )G. )3T )Jc )r )_ )ۙ )F ) )ݱ )'ƞ )jAԞ ) ) )C ) )" )ù2 )WB )&R )\b )qq ) )I ) )*< )% ) )5y )H )g )`9 )xvG )GU )){c )1Es )G ) )4T )Ġ )Ӡ )J )ؔ )C )] )b, ): )H )dV ),d )r ) )e ) ) )Rf )ơ )>ԡ )N )B )) ) ` )5G* )rD )Q )W^ )æx )'H )N ) )^Ȣ )>֢ )? )`  )x )N$ )1 )ν> )K )X ) e ) r ) )c ) ) ) )_ )Gͣ )ڣ )q )^z ) )̆ )8d: )?G )][ )7u )^z )q ): )|ɤ )`֤ )T )3 )  ) )+^' )1 )y; )=E )\O )] )hj )z>w )Ѳ ) ) )K )ŵX )w2e )s )r+ ) )x )4* )Ħ )f%Ҧ ) ) )/  )<& )O& )t4 ){tB )P )]_^ )kwl )Oz )` )g ) )> ) )hΧ )Bܧ ) )ca ): )n )7" )U+0 )|> )L )Z );Kh )3v )z )C ) )  )9 )Zʨ )=7ب )G ) [ )h )) )" )z5 )? )HYI )W ) e )y )v ) )D )f ) )t<ͩ )FS۩ )F )bC )Z )v )GX! ). )A; )5GH )AyU ):b )o )G ))" )G  )4 )\ ),= )Ϫ ) )5 )K ) )I0 )4: )<T )g^ )i )cw )\S )6h )X^ )1 )=' )sū )ҫ )g߫ ), )U ) ) )! )3/ ){= ),`Y )g )xu ).9 )| )| ) )oLȬ ):֬ ) ) )3 )K )= )W* )q8 )/HT ):o )g} )Y ) )o )$ )3ȭ )խ )% ) ) )s ) # )x- )a7 )5mA )=K ) U )2h )@v )N ) )Be ) )?g )&zϮ )ݮ ) ) ) )j )ɴ# )E1 )i3? )M )A[ )<7} )F ) ) )y ) ):̯ )ٯ )} )%X ) )Ҋ )m) )j6 )+C )Em )66y )m{ )'D ) ) )<̰ )BѰ )Wް )4 )9 )F ) )(Z )LF )#m ))z )  )y )4 )F ) )ǰȱ )mtձ )S ). )Z )   ) )f4 ):@ )lM )Z )wg )t )G )h )Dcò )5Gв ) ޲ ) ) )u  )O )B@& ), )R2 )t8 )> ):E ).DR )GX` ) cs )q )6 )L )Q )W )Գ )h )) )YJ )r )m# )0 )h= )NJ )BW )Jd )Tq )5G~ )BF )a )VS )ȴ )մ )G ) )a )< ))  ))e ): )G )$ )l* ),H0 )r6 )t< )B )]H )N )T )5fZ )7` )g )xw )} ))- )sz )P )N= )_ )"J )eص )$ )X ) )NP )5@ )  )] ) )$ )b# )+ )K5 )[@? )H )T ) a ) n )Kd{ )‹ ) ) )_ ){ )  )X )5G# )0 ) = )M,J )lW );d )"Js ) )cz )XB˷ )Pط )5G )cX )` )M,  ) )}Z& )W9 )-}F )t^` )m ) )} )et ) ` )^ )ø )5Gи )Ƈݸ ) )  )M, ) ) )0+ )}8 )M E )v4R ):o_ )C]l )#Ky )m )2 )  )"J )ڹ )D{ )Dl ) )Nf  )`T- )D )zxQ )`Th )=xu )`T )֪ ){ )o )Wغ )  )q ) )I )6F )O, )2 )8 )M> )`7E )bU )M[ )Na ) g )n )*{ )3 )t^ ) ) )û )Qܻ ) )D? )i  )*) )6 )(vC ) @P )Mr] )j )4T )! ) )%=Ҽ )|߼ ) ) ) )5G )) ),=+ )]B )5 O )\ )Sv ) )5G )=e ) )2B )>Ľ )ĥҽ )7ܽ ) ) )) )N )* )+7 )=D ))(Q )n^ )k )-ix )N ) )p )ӭ ){ )j\ƾ )6Ӿ )QB )%t ) A  )f5 )7A ) {W )_c )= )& )w )bS¿ )1Ͽ )>ܿ )Z )Y )E )! )g/ ) < ) V )c )o p )} ) )YJ ) )-s )z )$ ) x< ) AJ )f )w )j ) )& )_ ) )c )T ) 2 )%M@ )hN )\>\ )9j )Ox )Z ) )- ).M )h )k )ny )C( )~ )O - ){; )q_ ) -n )D )9 )8e )  )Sy )5 ) )7$ ) )] )Y$ )j2 )u@ ):T )BJb )Ap )~ ) )(E )9G ) )s )W ).D )  ){ )5G) )7 )IE ) CS ) Ka )#Bo )w )r )x )* )  )e )Ga )(" )=[0 )> )L )jZ )Bh )v )݁ ) ) ) )" )? )՛ ) )y )> )% ).3 )O )j )| ),= )K )x )+ )f )_i )D )1  )7 % )n3 )(A )>O )2a] ) Yk )g=y )G ) ) )* )PX )y ) )v )S )j )< )g% )\4 )ZyC )*lR )|a )p )4 )e  )X  )4 )pi )5[ )r$ ) ) )m )2$ )|3 )J#B )>Q )'` )o )~ ) )YJ ) )| )43 )ٝ ) G )U )  ) )|# )^2 )ZA )P )U_ )n )} )B ):G ) )*@ )W )B ) )D ).`R ) | ) )X )A )E ) )F )Ӏ ) ! ) ) ) )|# )$  )˳ ) ),v )   )j9 )ی$ )qn1 )|u> )kK )+X )ebe )d\r )5 )g )m )d7 )E ) )Y )E ) )W  )Y, )m8 )D )P )Ag )qt )> )4 ) )# ) )i ) )WF )) )=A4 )xa@ )L )@Y )bf )Ps )o )* )Y )| )>S )֨ )e )w )D| )7 )' )t5 )hB )4TO )p )5G} )) )xb ){ ) )3 ) )+ )]7 )&T )` )m )kz ) )A> )F )$ )) )9E ) ) )p )s )Y7  )i| )+ )gI8 )3] )l ) z )z ) ): )c )ko )U ) ) i ) )P )mc )J )Bh )> )8 )H )B )+a$ )k2 )]@ )ZN )nZ\ )_j )%y )o ) )ϗ )cE )h )M )L )b ) )l! )8 )}G )!V )/e )t ) )z )8W )u )$ )Z )\ )m )$ )T )u )7) )6 )LC )K[ )/j )Wax )$ )z )j ) ); )_ ) )`} )~ )Д )D )ݢ  )BB. )\< ) J )׸X )Qzf )t ) ) ) 6 )$! )d )  ) )H ) )݅ ); )* ). )P= )M )\ )k )ez )_ )q ) ) \ )= )k )9u )K ) )C )  ). )B= )jL )[ )j ))Sy )D ) )vD )| )s} )ve )v )H )M| )#' )+7 )s= ) )4[  )H- )~: )DG )7n ) ) ) ) )Ȁ  )a )x& )O&4 )A )N )[ )/h )u )GX ) ) ),= )h ) )^ ) ), )et9 ),=F )S8S )em )bz ),= )(c )5G )} )(c )?l1 )C= )TnM )HS )}<Y )uM` )Νj )Ssw )Dl )8 ) )J )/ )yb ) ) ) ) )^ )? )n5 )B )I6i )Bv ) )o  )3+ )\ ) )? )z[ ) )r|: )Y-G )a )x )` ) ) ) ) )  )o  )3+ )\ ){% )s3 )OL )*j_ )NIi )Zx ) )@ )| )&# )1 )'9 )< )@ )D )8d )? )\H )"m )m{ )5G )94 )> ): )is ) )*q )Ji )V )S )  )7) ) 6 )hC )P )d] ). )D ) )` ) ) )b )dy ) )x )M! )?b/ )1< )<&I )OV )Qd )q )[A )l ) )4T )O\ )Ѳ )# ) )Sf )* )7M4 )C> )DK )Y )g )Wt ) ) ) )0 )E )wc ) N )8 )9 )D1E )<Z )Hf )ɏ| ) )Ɠ )m ) )i ) )n ) ) )&{, )D: )eH )zV )yd )r ) )s )) ) )E )z )9 )wJ )- )!t ) )]* )ɖ9 )3H ):W )gt )F3 )E ) )7 ) K )t )O0 ) )b ).W  )G )0( )et7 )F )'U )td )z )/ ) )(2 )k )& )B ) )-s )TH )& )v5 )cD )$S ),b ) q )# ) )g ) )^ )# ) )7 )Jy ){% )|6 )C )P )^ )l ))y )k )  ) k ) ) )b )A  )` )X ) )Q$ ))* )G )<T )d )j )*p )eHv )g| )w ) )H )K ) ) )W )4 )C ){ )$ )pl: )WF )S )` )m )R )]p )ka ), ) )2 )ſ )%W )B )cb  ) )1% )Y3 )FA )O )u] )0k )"y ): )? ) ) ) ) )S ) )9 )g' )o 5 ) B )iO )v1\ )i )+v ) )m )_ )c ) )0 )O )sd )X )D )] )) )K  )f- )9l; )\I )t W )ke )s )I )zl )& )Cp )oC )P ) )]9 )k )ԆV )šd )xfr )X& ))A )HL )q )9 )d )A )g )# )Ԇ} ) )] )3 )C ) )e )Ph )( ) )   )T> )% )i3 )A )@kO )[] )іl )z ) ) )a ) )> ) )Ve ) ) ) )0X# )qB )PP )3l^ )cl )z )^ ) )J )  )U )7 ) )y )* )ع )XX )# )1 ):? )_M )F[ )%3 )*A )O )] )k ).d )1 )`[ )u ) )!- )F; )gI )2jW )me )ds )K ) )( )y )- ), )y )R )= )+ )B  )_ )) )+V ) ~ )0N )H} )SC )Cm )qx ): ) ) h )( )5 )$B )P )wZ )Md )s )2 )- ) ),K )Z )A )9 )1: )J )T ):  )  )US) )87 )w8E )leS )Oa )*o )J} )O )5 )5 ) ) ){ ):K )e )%A )G )l )U )8e* )5GF )gUb )Np )X )~ )2 )) )]j )1 ) ) )J )r )=  )f- ): )a )n ) q} ) ) ) ) )LC )j )5 ) h )Z )^" )0 )> )"L )Z )h )v )N ) ) ); )X )R )C ) )O )g )i- ))[ )r, )8: )Ϙ] )l ) ) )>j )m )> )* )V )H )J )E )Mt )/ )f( )Ý5 )BB )6O )\ );i )9^v )² ) ) ) ) )  )f )9 ) )1O )0x )a0 )FAo )j!} )/ )f) )Du7 )zE )IS )I )_R )F )c] )= )Ќ )M )) ) )) )̠ )_ ) )5G )C9  )8e )w )t )%e  ):  )c;  ) !  )O2  );8  )y>  )i  )<  )  )R[  )_!  ).  )G;  )2H  ) tU  )a5n  ).D{  )p  )t  )m  )  )P  )  )f  )o  )  )0>$  )81  )<>  ).3K  )d_  )_l  )y  )n;  )0^  )  )w  )8  )#  )  )  )y  )9 ){: )} )Wk' )x5 )4TD )/P )\ )r`h )ŕt )': ) )f )n )W_ ) )s% ) ) ) )e] )yb )( )#5 )C )OYQ ))^ )gk )2x ) ) ) )9 )0y ) )`> )* ))7 )^fE )9S )a )ko )`} )>c )9 )jz ) )%F )  )6 )  )B& )g )C3 )J? )L )5V ) o )8e| )M )0y )\ )^{ ) ),= ) )%F )D` )  ) )!0+ )1 )7 )L> )K )o X )*e )hQr ) ) )( )G ) ) )9 )x )5 )c+ )9 ))G )wU )7$c )q )C )6 )B )g )B& ) )Ba )f[ ) th ),=u ) )$  ) )p )k ) )b@ )8 ) )t )T )| ) ) )w ) )W )  )u )by ) )| ) ` )Y )f )Cs )n )^ )^ )` )Q ). )' )} )2* ):8 )etY )4#f )s )P )r= )w )Zp ) )Ɛ )$  ):  ) )q# )I0 )= )BaJ )fW )Rd )dq )eb )r )0F )p  )& )- )J )etZ )-i )2Tw ) )w )) ); )[ )G )o )  )q7 )A )mZ )i ) )C )2 ) ) )I6 )2 )* )+? )} )j/ )V )7$ )L?* )01 )> )vK ).X ); )e ) )m# )1 )+? )<M )k );x )  )=  )  )\  )  )=  )P  )&]! )6! )y! )/9! )F! )HJS! )O`! )hm! )vz! )! )w! ).D! )3! )2>! )! )! )2" )j" )" )3" )B" )$ P" )2j" )Tx" )o " )M" )" )/q" )\" )r" )h" )" )}# )0%# )vf4# )SC# )~R# )3a# ) p# )B# )"O# )6# )# )#c# )9*# )ˊ# )# )8$ )x$ )S#$ )k2$ )+fA$ )kP$ )i_$ )Bn$ )6}$ )XI$ )Z$ )B$ )$ )"G$ )$ )$ )Yq% )3% )% )U% )vb% )Jfo% )$\|% )\% )e% )% )% )@P% )D% )I% ) % )% ) & )& )5^&& )M4& )V8B& )ѯP& )^& )&zl& )ECz& )ET& )׮& )^& )Va& )!& )B & )UU& )[& )& )0' )]B' )H' )M N' )pT' )\Z' )0ga' )tr' )Cx' ) T~' )6' )Խ' )D' )|' )5G' )GX' )E' )Ss' )|' )n' )j' )B ( )!( )*( ):9( )JH( )߿W( )f( )u( )"( )( )$( )( )~( )5G( )G( )N( )[C( )4) )3m) ))') )qX7) )A G) )W) )#f) )Ht) )"J) )A) )) )M) )&k) )) )r) )2) ).0) )\ * )J* )** )<:* )jqJ* )cZ* )1j* ) z* ) * )* )T* )n* )Z* )* )/* )}`* )W* )f + )?+ )8+ )/E+ )^+ )Gk+ )5Gx+ )+ )e+ )H+ )h+ )p+ )+ )aH+ )j+ )ؘ+ )t+ )9T, ), );., )g=, )]CR, )ͪv, ), ), )2, )_F, )l, ), )#a, )- )/,- )9- )eF- )N7S- )`- )m- )xz- )u- )- )W- )I- )Ϙ- )Ji- )B- ) - )- )6- )Œ . )q". )%N. ) [. )u. )YJ. ):. ),. )3t. )a. )q. ). )W. )I. )Ϙ. ) / )/ )+f/ )7/ )s/ )k/ )/ )/ )/ )/ )0/ )C</ )+0 )y0 ) 0 )*0 )0 )Y0 )0 )+f0 )u0 )00 )k1 )3t1 ) %1 )u?+1 )21 )@1 )N1 )o \1 )Rj1 )1 )& 1 )/q1 )g51 )1 ) 2 )`B2 )$2 )Ba12 )f2 )T!2 )e2 ) 2 )Bw2 )5a2 )V2 )$2 )@2 )W2 )2 )2 )q3 )a 3 )l3 )k 3 ).3 )!<3 )J3 )#Y3 )Yg3 )u-u3 )3 )]3 )3 )Q3 )_Q3 )Hp3 ) 3 )3 )3 )3 )53 )3 )o3 )3 )T3 ){k4 )R 4 )x,4 )(_ 4 )(.4 )oy<4 )wJ4 )Pg4 )™{4 ) R4 )4 )64 )U4 )'4 )O 4 ) 5 ) 5 )!5 )25 )i<5 )ZNK5 )"Y5 )3p5 )z5 )DŽ5 ):5 )5 )5 )5 )5 )ۋ5 )\5 )6 )W6 )5y6 )D+6 )Y@6 )9L6 )^6 );h6 )nr6 )A6 )16 )Ym6 )c86 )6 )K6 )Oc6 )K6 )96 )lM7 )sq7 )l7 )5.7 )=7 )a7 )n7 )i7 )=e7 )7 )5G7 )7 )q7 )R|7 )j7 )58 )eb8 )^*8 )68 )LZ@8 )+yM8 )2s8 )o 8 )s8 )9S8 )+8 )i8 )8 )`_8 )o8 )J 9 )9 )&9 )39 )@9 ))VM9 )VZ9 )-t9 )P9 )e9 )^9 )9 )`9 )+9 )/G9 ): )q: )2!: )1: )w~7: )Ύ=: )mC: )bIJ: )W: )d: )cq: )/~: ): ): ): )9: )6;: )*: )N6: ): )k: )ew; ) ; )v]"; )-0; )r>; )L; )gnZ; )c4h; )Nv; )0; ); )YJ; )m; )a; )l; )-u; ); ),Y; )z< )$ < )U< ),< )@@< )=CM< )Z< )h< )6v< )< )< ) < )q;< )< )< )< );!< )e< )= )c= )N= )B},= )s:= )H= )bV= )<d= ) r= )L= )C= )= )= )O= )= ).= )= )8= )A= )le > ) > ))(> )6> )D> )>+R> )`> ) n> )zT|> )C> )n> )9> )> )> )$ > )? )? )W)? )&7? )<E? )S? )a? )Îo? )E}? ) ? )D'? )7? ) ? )I? )? )}? )W? )A? ) @ )L@ )8:%@ )_>@ )PH@ )a@ )Dn@ )<{@ )@ )@ )y@ )7@ )~@ )g@ )n@ )#A )A )A )i*A )7A )zDA )EQA )^A )$7kA )}xA )3A )jAA )DiA )ASA )`A )A )3ZB ): B )B )RO ))bO )GrO )YO )ûO )kO )#O )O )O )O )eO )O ) P )^P )r*P ):P ),WP )NFuP )CP )P )uP )<P )JP )? P )LP )jP )PQ )tQ )/"Q )2Q ) BQ )tRQ )UbQ )vrQ )xQ )$Q )jbQ )3Q )9CQ ) NQ )=Q )Q ))R )R )"R )2R )JBR )lLRR )>^bR )ErR ) R )1R )/R )R )OR )tR )?R )R )bS )S )[!S )8(0S )uk?S )NS )xw]S )LlS )k{S )Q S )S )S )CS )qoS )gS )S )׿T )ST )$T )R;T )HEJT )YT )yhT )ewT )xT ){T )pT )T )zT )T )?T )ثT )CU )U )sAYX )(gX )uX )CY )LPY )ؚ]Y )(NjY )YwY )fY )?Y )C;Y )ZY ) Y )˨Y )(Y )p?Y )etZ )Z )k*Z )\7Z )xDZ )zZ )Z )RZ ) cZ )քZ )&}Z )%=Z )/Z )NZ )F[ )[ )B[ ):[ )#[ )k)[ )~0[ )@[ )LF[ )EL[ )3R[ )@X[ )7^[ )`d[ )ij[ )_p[ )v[ )|[ )}[ )c[ )[ )AM[ )[ ) `[ )3[ )+I \ )cU\ )D%\ )2\ )?\ )L\ )Y\ )VUf\ )Os\ )\ )\ )M\ )\ )bm\ )U\ )\ )ԣ\ )\ )ޣ\ )M] )] )] ))] )um6] )FC] )qP] )(]] )] )E] )N] );y] )|@^ )QJ^ )^ )+^ )>9^ );yG^ )|@U^ )c^ )r^ )^ )^ );y^ )|@^ )^ )^ )^ )L`^ )D^ );y^ )|@ _ )_ ))'_ )5_ ) D_ )cQ_ )X__ );ym_ )|@{_ )_ )e_ )g_ ) _ )_ )RW_ );y_ )|@_ )_ )z` )2{` )"` )0` )2=` )=J` )%>W` )"d` )q` )b~` )` )X'` )s` )` )` )[Y` )A` )a` )\` )Ta )ga )9#a )1a )l?a )Ma )z[a )Eia )a\xa )1?a )j7a )a )a )(a )a )La )a )|b )ub )Hx(b )'7b )TFb )bb )ѓob ) r~b )Tb )6b )b )b )eb )~db )>b )Tb )6b ) c )c )e*c )w8c )}Ec )Sc )!bc )Hoc )x~c )c )c )c )&c )7c )>ic )ac )\c )c ) d )9d )'d )l5d )Cd )UQd )E_d )a\md )~{d )ԣd )id )zd )Hd )d )d )d )EBd ) e )e )l&e )4e )/5Se ) R`e )}"ne )|e )de )e )Fe )e )Ue )ԣe )e )dhe )e ) nf )Xwf )%f )Y2f ) Af )Of ) n]f )iyf )5f )wf )f )ef )>f )Nf )qf )g )dg )$g )2g )mAg ) Ng )\g )qjg ) nxg )g )g?g )g )>Ug )pUg )g ) ng ) wg )!g )h )Lh ) h )g?.h )=h )Jh )mXh )fh )qth ) nh ) wh )!h )4h )rAh )uh )[h )h )h )dOh )e i ) X+i )8i )SFi )eTi ) nbi )ipi )~i )Ui )Mi )~i )^i )i ) i )xi )i )|i ) j ) |j )n'j )t4j )7Bj )Pj ).v^j )lj )zj )j )j )j )j )ij )j )yj )k ) nk )i$k )93k )>Ak )|Ok )X^k )kk )zk )wk ) nk )ik )k )ek )k )bk )k )k ) nl )i$l )52l )w@l )Nl )ll )Byl )l )el ) nl )il )l )l )l )nl )l )+m )m ) !m )/m )=m )ULm )AYm )Ugm )um )m )?m )m )m )m )m )m )im )xn )n )An ),n )b6:n )\Hn )Vn )Udn )9rn )n )ln )ԣn )~n )ޣn )in )J:n )n )An )n )b6 o )\o )w)o )7o )9Eo )So )lao )Uoo )ԣ}o )^o )o )xo )Ro )ޣo )H~o )`o )o )o ) p )p )&p )A4p )Bp )aPp )\^p )wlp )zp )9p )p )lp )Up )ԣp )Ep )a\p )?p ) gp )8q )Lq )"q )1q )Nq )Qi\q )8jq )xq )q )q ){q )VGq )q )tq )ܰq )Njq )Wq )ar )\r ){ r )VG.r )9z )QLz )v&Zz )_shz )|wz )Gz )nz )z )֡z )<z )z8z )~ z )z )Uz ){ )!{ )|.{ )`Z={ )KK{ )wY{ )g{ )_u{ )M{ ){ ){ ){ )a{ ){ ){ )F{ )| )$| )> | ).| )Le<| )J| )i| )cv| )B| )K| )w| )| ) w| )rG| )| )C\| )U| )-} )1b} )7} )P-} )K;} )J} )0<Y} )h} )nv} )ޣ} )} )z} )~} )} )} )} )I5} )P} )~ )~ )U~ )z-~ )"r:~ )HH~ )KV~ )d~ )r~ )~ )U~ )E~ )ٗ~ )Lv~ )~ )~ )~ )1~ )P  )! )* )#7 )HE )KS )ma )&7o )} )C ) )ɮ )XY )kV )E ) ) )K  )i )^' )5 )eD )UR )w` )n )d,| )Y ) )W )e )f€ )SЀ ) ހ )' )_ )  ) )% )73 )LOA )P )0] )Ƭk )Ky )i ) ) ) )́ )ہ )L ) )\ )] ).v! )k/ )I5= ))~K )vY )Ug )Eu )I )o )t )ԣ )_ )ʂ )K؂ )L ) )e ) )^ )p- )w; )vI )oW )e )es )i )w ) ) )w )cȃ );փ ) )U ) )f )K, )ĭ: )H )V )vd )r )I ) )L )k )e )\Ƅ )I5Ԅ )U )ԣ )( )j  )K )) )98 )eF )T )>b )|p )B~ ); ): )H ) )ą )UӅ )_ )[ )K )L  ) )( )6 ))D )pR )w` )in )| ) )e )J ) ))C† )I5І );ކ ) )U ) )ԣ )ޣ% )2 )[@ )KN )w\ )uXj )x )8 ) )< )T ) )Nk̇ )ڇ )S ) ) ) " )u< )I )V )c )wq )C~ )" ) )S# )= )Έ )wۈ )b6 )\ ) ) )9 )) )l6 )UC )5P )>H] )ޣk )y )ԣ ) | )+| )6| )A| )I͉ )dۉ )ep ) ) ) )! )38/ )3D= )GHY ) ) L )Y )w )a )\ˊ )ي ) )9 ) )l )U )- ); )EI )a\W )"e )s )] ) )^ )N )zF )_Nj )~Ջ )v ) )| )w  )b6 )\) )7 )kE )S )9a )o )l} )U )ԣ ) )ޣԌ )e ) )w )a  )\ )f' )k5 )C )9Q )_ )lm ){ )U )E )a\ )  )] )-Rύ )0L );S )CdZ )a )3h ) :o )7v )} ) )j8 ): )0j )M )Hɘ )՘ )s )8 )  )5u ) T  )L# )/ )F )R )u )0y ) )3ҙ )Ž )Y )SQ )u  ) )R& )UA )/qO )G] )Hl )z.{ )o  )9 )_ ) )qPƚ );՚ )Y )t ) )j )ec  )/ )> )$ M )$\ ),k )KS )3 )\ )l )R )5G› )fЛ )3 )g} )Y )s) )  ). ) 4 )=: )?F@ )-\ )>w )j )#o! )X) )l5 )ɋE )YPK )4yQ )2W )] )juc )i )o )&Ou )| )g )+ )K ) )a ) )/) )U )! )^ž )<Ȟ ) dϞ ) Q ) )e )]  )i- ): )aG )T )a )5n ){ )@ )e )m ) )-p )^ɟ )}'֟ )PE )$Y  )z )# )O0 )o = )9J )W )ud )=q )4~ )? ) )F )i )`Ϡ ){ݠ ) )" )+ ); )\# )H1 )1 ? )mN )] )l )P{ )XI )e )L )| )2ơ )^ա )vr )4 )ir )n! )0 )<~? )N )2B] )Cl )@{ )g )G )z ) )iƢ )8Yբ )a )> )o )kj )   )T./ )> )M )\ )}k )$z ) )ΰ )@ )0 )qţ )ԣ )R3 )0 ) )0k ) )A. )= )mlL )[ )^j )iy )2 )i )Rx ) \ ) )(Ϥ )ݤ ) ) )YM )" ) & )m5 )D )T )8d )ts )n ) )% )h )t )Nͥ )ܥ ) ) )e  )f )n - )7< )/VJ )X )5f )t )/ )tK )YI )8 ) )ΚȦ )}֦ )K )Q )d ) )v )+ )S: )I )]X )0]g )v ) )cq ) )fa ) ) Ч ),_ߧ )U )d )  ) )m* )e9 )CH )VW ) f )yu )n )b  )'C )? )Ĩ )oFԨ )o ) )M )r )j$ )w4 )tD )S ) Mb )Iq )t )JN )2T )1 ) ),ک )m[ )]/ )5  )fP )' )VL6 )OV )e )s ) ) )X )$Yʪ )Aڪ ) )\Z )+  )ļ )7<) )i8 ),_G )DV )9e )3t )O )C )G )O )] )}^ë )$ɫ )3ϫ )F/ի )F ) )o )Y  )U )X; )% ),, )v: )G )T )n )id{ )Yf ) )ar )v )L )Qɬ )֬ )O )I )F )ge )$$ )8J1 )=> ) )x )E )z, ):: ) G )dT )W{ )c ) )f )5 )һ )_ )K )` )  ) )U& )zS4 )_B )ԣP )I^ )[l )ޣ )^ )K ) )ü )c Ѽ )U߼ )ԣ )ޣ )  ) )% )3 )˿A )%O )o] ) k )+\y )h )+ )jh )  ) )ž ) )n  ) )n& )0S4 )B )`P ){^ )1l )+z )$ ) ),= ) )d )hcϾ )nݾ )' )$Y )о )/" )a0 )D> )L )Z ) >h )#v )zO ) )9 ) ),=¿ )nп )G^޿ )GY ) )J ), )b* ),=8 )F )nT )Jb )np )ш~ )X4 )aB )9P )6^ )` )t ) )\ ) )t ): )# )@ )Y )$Y ) )}7  ). )J< )AJ );X )1f )t )= )է ) )l )A ) )n )B )j )ff )1# )91 ),=? )aM )J[ )ni )nw )ш ) )_). )+X= )]L )L[ )bj )Yxy ); )] )t| ) )F )F ) )BH )iz )2 )ޯ )nO- )i< ) K ){Z ) Ri )hx ) )L )"* ) ) s ) ) )I )1 )J= ) )Z, )j; )SJ )CaY )jh )w )X )  )ܾ )S ))3 )% )t )D )G )-   )u )N+ )(: )I )\X )g ):v )4 ) ) )N )%J )i )= )g )hD )4  )8 )* )9 )H )pW )jf )&u ) ) )X ) )Q )C ){ )$d )d )n  ) )3+ )V: )J )Y )ah )Ew ) ) )[ )& )K1 )U )b )] )] )   )( )+ )b: )I )#TX )dg )3v )` )6Y )w )T )] )q )2 )&1 )V )y  ) )M* )I9 )zEH )W )cf )u )x )ԑ ) )~f )}p )! )a )H )N )  )P )[) )8 )G )F4V )nse )A_t )6 ) )Ru )z )] )[| ) )e )D )  )v )X( ):7 )F )PU )ld )ts )Z\ )b )ek )n' ) ) )=D )^= )y )m  )} )_' )56 )JE )LT )c )r ) ) ) )¸ )Ou ) )AX )7 ) ); )ss ) & )xQ5 ).D )S )b )pq )fa )) )8 )E ) ) )= )' ) )}* )&M )% ) 4 )MC )R )[a )p ){ )Y )} )hv )# )U ){ ) )0E )Y ) )$ )3 )B )VQ )y` )o )9 )m )L )( )Fy )~ )r )rT )}v ) )L) ) | )y  )dG )$T )a )|o )t} )V ) ) ) )l )J )E )a\ ) )=  )L )% )@=3 )LeA )_OO )p] )Qlk )-y )g ) 3 )K ). )  )Z# )Q ) ) )s )eT )4! )0 ))> )CL )Z )lh )|v ) )f ) )k )[= ),= )n )G^ ) ) )% )`_! )/ )oN )x )M* ),= )"J )u )l ) )= ) )GX )NE )ߜ ) )@ ) ) ), )+ )=@ Qo )'w{  )S Q  )  E  )F 0  )n# " , )X9B ) OX ))3en )%{ )t )ܾ )S )D )P#T )#P )G )- +4 )uAJ )W#Lu )*  ) )3 )8  )bG  )2r }  )&,5 )"pBK )Xpa )>tm  )x  Y  ){   ) )Qh  )@ 5 )A  _ )Hk t )5#J )$P )h@  )v;   )Q  )T+I )~dV0_ )Hk Xt ):  )  )2{ )W )Z 0  )tp m3 )ϒ? BH )?Us ) )As  )R + )Fq  )Ca#H )t )* H )\KT r )mI~  ) )1 )  )  i )p ( 1 )>G )=T] )ci r )a~ b )  )g9#@ )O#8 )  )  )ܤ )$- )3:hD )/S h\ )gm )s )Dy ) )s )I ) 9 )a{ )5 ) )72  )`` )Uh*@3 )o@`I )kV _ )lElu )k ) )p )F- )PM )[ ){ )I )D ). )J )l ) )d )"$ )i )D )G ): )` )/x )[ ) );s )PA )+ ),+ )L> )]NU )CWq )? )r )W6 )3d ) )B ){ )er0 )ObG )_ ))/w )ټ ) ) )1= )M ) )z& )_G )` )0Y} )Y )1 )w ) )9 ){ )n )_& )9 )2fU )!I )q ) ) )) )\ ) ),  )" )5 )3PL )(_ )! ) )O ) ) )qB )-W )/ )2G )RZ )'U )m ) * )  ) )+: )I  )})% )]F )'J] ) ) )2 )g )}' )uC )5V ) )< ) ) )u6 )9MN )I}t ) )U2 ) )<* )_ )Db )9 )O ) )z. )@ )O] )]z )D ) )i ) )7` ) )_~ ) )1 )) )A )Y )L )P ) )4 ) ) )k )Dz: )V )3r )z ) )~ ) ) ) ))8 )gP )V )P )Kk )Dr )Q: )6J )Z ) )r; )UW )o )a )uS ) )4 )an )38 '.#-3B L?YDl )jvv )F +Sd +Md )4 )a` )3@ %pJ/D`N[hu!3EW@ i{ f 4.;HR@_bt~|  )6bb*b7bDbQc^ ckcx%c1c=cIc_cmccc )~$ )' ,- )D +d +md )"% +d) +d9 +e= +dB )4P )a] f )3sH  ,- +0e + e +e +we +e +e ,- +e +e # +f' + f2<U + fY +f`vmKmg5 )$[ ,- )D +?f +-f )" +f +f +f +f )4( )a5`> )3KP YIc ,-t +4gx +$g +g +{g +g +g ,-I ,. +g +gI ,. +g +g[[ +h +hm>KHmcgo~5 )? ,. )D +h +h )" +Uh +Oh +|h +vh +h +h  )4. )a;D )3Qh ` )amv )3`  )a )3X  ,/ +h +h +i +h +Hi +@i ,/ ,&/) +i- +i6@ ,&/M +iQ +i\f +i +iGnKng6(fn=6Mpnjnn )p ,N )D +i +i )3 +(j +j  )" +wj +oj) +j- +j2 )4@ )aMV )3cp qH{ ,N +j +j +%k +k +hk +`k ,NH ,N +k +kH ,N +k +k HH- +k1 +k8WKaG|gHL"*2v~ J )vT ,6/j +kn +ks )D~ +=l +-l )" +l +l +l +l ) +l +l +m +l )4 ,L/ )u +Bm +2m )a )3$ 3 )a@ I )3Vx dIn ,a/ +m +m +m +m +2n +*n ,a/I ,/ +qn +onI ,/ +n +n^ ^  +n$  +n+ n@ KJ Vo[ gj nt  ,/  +n  +n n  ,/  +n  +n n n  +n  +n o 6 o) +o>  7O 8ol @o Ho  )@  ,w.  +n  +n  )D  +1o  +'o  )"  +wo  +oo  +o  +o  +o!  +o&  )4/  ,.8  )uC  +oG  +oR  )a_ h  )3u  I  ,.  +.p  +&p  +ip  +ap  +p  +p  ,. I  ,.  +p  +p I  ,.  +p  +p ]& ]?  + qC  +qJ m_ Ki 2nz g   ,.  +q  +q   ,.  +>q  +:q m m  +Yq  +Wq u }4 L na H6y "n  )5  ,W2  )D  +q  +fq  +8r  +*r  +r  +r  )"  +r  +r  +>s +.s )Ķ +s +s )m#% +s) +s. )48ЁB )GIuS )wZud )6_kut ,2} )M +St +Mt +|t +zt +t +t +t +tV )M +t +t VV- +t1 +t: +t> +tG +tK +tW )ad m )3z  )a` )3  )a )3  ,2 )W_#0,#07L )W_Y#0bz#0 )W_#0#0 )a )3 $ )a1 : )3G V )ac`l )3y  )a )3  )a )3  )a  )3  )a+`4 )3A P )a]f )3s  ,n2 +u + uOO +/u +-uyy +>u  +GH ,/3^GsGG ,A3GGG ,S3G GG) ,e3?GTGjGt ,w3GGG ,3GGG  ,3 G5GKGU ,3kGGG ,3 +9v +6vGN`` +Hv +Fv`2gHuRuo +Wvs +Uv|u| ,3 +fv +dv +uv +sv +v +v +v +vAuKuh +vl +vq(u(u ,3 +v +v0uLu ,3 +v +vQuC#4\Rmgx"s:8DG\uq ,ЁuuYuuX:u &,:ЁDvY l,Ёz# +8z#p'#pD# +czH# +_zQ# +|zU# +xz^#ph#p# +z# +z# +z# +z# +z# +z# +!{# +{# +1{# +/{# +@{# +>{# +O{# +M{# +^{# +\{# +o{# +k{# +{# +{$ +{ $ +{$ +{$ +{!$ +{%$ +{.$>q8$>qU$ +{Y$ +{c$cqm$cq$ +{$ +{$ +|$ +|$nq$q$q$ +|$ +|$ +$|$ +"|% +3| % +1|% +C|% +A|%q:%qD%qa% +S|e% +Q|o%qy%q% +e|% +c|% +t|% +r|%q%2r%2r% +|% +|& +|& +|&=r*&qF&)qd&Mq|&cq&q&q&q& r"'2rN'WrX'Wru' +|y' +|'lr'qr'qr' +|' +|'r'r'r( +|( +|(r9(r_( +|c( +|l(rv( ,"0( +|( +|( ,"0( +|( +|( +}( +}(r( ,20( +(}( +&}(r( ,B0( +:}( +8})r)r3) +L}7) +J}A)rK)rh) +[}l) +Y}u)r)r) +j}) +h})r) ,R0) +|}) +z})r) ,R0) +}) +}) +}) +})r *r**rL* +}P* +}U*rp*r*s*s*s*P*+s+Es+Es6+ +}:+ +}M+ +}Q+ +}Z+ +}^+ +}c+Jsu+Js+Js+Ys+P+cs+cs+rs,P ,s+,+sG,csU,Wrm,r,s, )V, ,(, )", +~, +}, +o~, +_~, +~, +~, )4, )a-~ - )3- $-i.- ,(?- +~C- +~I-a-y--a-- )r- )9- ). ). )?".kD. +~H. +~M. )Y. +2]. +*b. )m. +]q. +W{. )a. )e.k. ,*. +x. +v.9k.9k. +. +.9k /Ak/ ,+(/ +,/ +5/Ik?/ ,+P/ +T/ +]/Ikr/Lk/Ik/Zk/ ,(+/ +/ +/_k/P/_k/_k0 +0 +0_k%0_k>0 +B0 +K0_kU0_km0 +q0 +z0_k0_k0 +0 +0 + 0 + 0gk0gk0 ,8+0 +0 +1 +* 1 +(1}k.1}k81 ,H+I1 +BM1 +:V1 +mZ1 +i_1kx16k1 )P1 )1 )1 )a1 )e1 )u1 )X 2 )2 )Vt:2 )G2 )U2 )ab2 )eq2 )B2 )2 )2 )a2 )e2 )u2 )2o3 +3 + 3 )3 +3 +!3 )T,3 +Ҁ03 +̀?3 +C3 +H3 ,0Q3 )u\3 +`3 +f3 ,0o3 )uz3 + ~3 + 3>p3 )u3 +3 +3/p3>p3 )\4 )$Y 4 )4 )'4 )44 )A4 )nN4 )ш[4 )nh4 )4 )14 )a4 )e4 )a4 )e4 )4 ,N4 )D4 +D4 +24 )" 5 +5 +5 +Ё"5 +ȁ15 +55 +:5 )E5 +I5 +N5 )Hc5 )ap5 )e5DI5 ,O5 +45 +$5 +5 +}5 +5 +5 ,O5DI5 ,1O5 +5 +5DI5 ,1O6 + 6 +6MI!6MI>6 +B6 + H6g6Kq66g6I6 ,AO6 +6 +6I6 ,QO6 +/6 +-6 +A6 +?6I 7iI$7I<7IT7Il7I7I7I7I7I7I8J87J?8AJW8IJo8SJ}8 )>G8 ,sV8 )D8 +`8 +N8 )"8 +8 +8 +8 +8 )8 +>8 +28 )p8 +r8 +h8 )8 +9 +9 )4T9 +ل9 +τ9 )'9 + +9 + 09 );9 +*?9 +D9 )O9 +nS9 +db9 +f9 +k9 )v9 +z9 +9 )H9 )19 +Ѕ9 +9 )N9 +9 +9 )49 )a9 )e92h9 )u: +;: +7 : ,V: )u: +U": +Q-: )a::C: )3P: Z:Wo: )uz: +o~: +m:Bh: )u: +~: +|: ,V: )u: +: +: ,MW: )u: +: +:h: )u ; +; +; ,}W; )u(; +Æ,; +2; ,W;; )uF; +ԆJ; +ІP;+ie; )up; +t; +z; ,W; )u; +; +;i; )u; + ; +;g; ,V; +.; +; +}; +w; +; +< ,V <g< ,V(< +,< +5<g?< ,VL< +P< +[<ge<g< +< +<<K<-<g<g< ,V< +< + =g= ,V$= +)(= +'1= +;5= +9:=gS=h]= ,Vn= +Pr= +H{=h= ,V= +|= +p= += +=h= ,W= += +=h= ,W= +"= += +M= +G>h> ,W> +q> +k(> +,> +5> +9> +>> ,WG> +K> +T>h^> ,-Wo> +s> +|> +> +>h> ,-W> +"> + > +2> +0>h> ,-W> +A> +?> +R> +P> ,-W> +c> +_?F0LF )aYF`bF )3oF( zF )aFF )3F F )j0F ,'F +\F +JF ) F +F +F )HF +ԌF +ΌG )@ G + G +G )4Gp.GZ%K +<*K )@5K +Y9K +K>K )4HKІXKfK )asK|K )3Kx K )aKK )3Kp K ,'K )MK +K +KvKv L + L +L +ǎL +Ŏ#L +ǎ'L +Ŏ3L )a@L IL )3VLh eL )arL`{L )3L` L )aLL )3LX LLL +؎L +֎LMM ,'-M +1M +:M ,'?MWMGdM#8pMM>M_MMM,MN1NH^FN+YNІcNj^xN8-N^NPNІN^N,NІN )@N5O +!O +&O )2O +O6O +A;O )FO +JO +OO )4TZO +Ǐ^O +cO )nO +rO +wO )GYO +O +O )4O ,IO )uO + O +O!5O )uO +O +O;5O )uO +(P +& P )aP!P )3.P =P )aJP )e\Po5fP ,(IwP +9{P +5P +TP +NP +uP +oP ,(IP5P ,AIP +P +P +P +P +ѐP +ːP ,ZIP +P +P + Q + Q5Q ,vI%Q +!)Q +3Q5=Q ,INQ +3RQ +1[Q +B_Q +@hQ +QlQ +OqQ ,IzQ +b~Q +^Q +xQ +vQ ,IQ +Q +Q5Q +Q +Q5Q ,IQ +Q +R +БR +̑ R5#R59R5RR5tR5~R5R +R +R +R +R +R + R5RL6R ,IR +(S +& SZ6S ,I%S +9)S +52SZ6Y )IY +kMY +gRY )]Y +aY +fYM{Y )`:Y )HY )yjY ) yY )Y )jYMYMY +Z + Z +Z +Z +ŕZ +Õ%Z +)Z +2Z +ŕ6Z +Õ?Z +֕CZ +ԕJZ]pZzZ ,HiZ +Z +Z ,HiZ +Z +Z ,[iZ +;Z +5Z +cZ +aZ1Z ,niZ +vZ +pZ +Z +[1 [ ,ni[ +[ +%[ +Ζ)[ +̖.[:Q[F[[Fs[ +w[ +ޖ[F[F[ +[ +[ +[ +[F[F[ +[ +[ +&[ +$[F\F\ +6\ +4'\ +H+\ +F4\F>\FW\ +X[\ +Vd\ +jh\ +hx\\ ,i\ +|\ +x\ +\ +\ ,i\\\ ,i\ +\ +\] ,i] +Ɨ] +#]-] ,i=] +A] +J]T] ,ia] +6e] +.n] +cr] +]{]] ,i] +] +] +] +] +ט] +Ϙ] ,i] +] +]]] +#] +!] +3^ +1 ^^/^ +B3^ +@<^ +R@^ +PI^S^l^ +ap^ +_y^ +r}^ +p^^ +^ +^^^ ,i^ +^ +^^ ,i_ ,i_ +!_ +*_ +._ +7_ +';_ +D_ +hH_ +fQ_ +{U_ +u^_ +b_ +k_ +Ϛo_ +͚x_ +|_ +___ +_ + _ ,i_ + _ +__ +/_ +-_#` +@'` +<0` +W4` +U=` +fA` +dF`_`i`` +` +`` ,j` +` +` +` +` ,j` +` +` +՛` +ћ`` ,ja +a +a%a + )a +5a?a\a +`a +ia ++ma +)raʞaמaמa +:a +8a +Ia +Gaמaמa +Xa +Vb +gb +ebמ+bޞ5b ,/jFb +vJb +tSb +Wb +\bob4b +b +b +b +b +Мb +Μbbtbbc/cGcXcncxc ,?jc +c +c +Cc +7c ,?jc +c +c +c +͞c +Tc +Hc +c +c +ݟc +͟c +-c +c +c +ydPd ,kj"d +&d +/d +ʠ3d +Ơj +8 j +g$j +a)j ,j6j +:j +Cj +Gj +Pj +Tj +]j +aj +jjpwj j j +%j +#jpj ,kj +9j +5jpj ,kj +[j +Oj +j +kuk ,7kk +ȥ#k +,ku6k ,7kCk +Gk +Pk +$Tk +]kugk ,7ktk +Jxk +Dk +pk +jk +k +k ,7kk +Ŧk +kukuk +k +k +k +kukul +l +l +"l ++lu5luNl +"Rl + [l +3_l +1hlu}l +Dl +@llҟl ,Xkl +cl +_lڟllm +| m +zm +m +m7mOm-lm;mfm0`m ,hkm ,hkm +m +m +Χm +ȧm +m +m +m +n +En +Cn +hn +fn +n +u(n2nOn +Sn +\n +̨`n +ʨenwnМnМn +ۨn +٨n ,kn +n +n$n +n +ngo + o + "o +$&o +"/o +33o +18oRoxo +X|o +To +oo +mo +~o +|opo ooݵo]p$pזKpD`p`ppPpap\p8apkphapٶpX>p, qPq(q ;q,OqPYqnqa~qƷqaq )Tq ,Wq )"Jq +q +q )Ņq +άq +q ,Wr )u r +vr +r&k%r ,X6r +:r +sCr +Gr +ϳLr ,XYrFlfr-kpr ,*Xr +r +r +̷r +Ʒr ,*Xr +r +r-kr-kr +r +r?kr?k s +' s +%s?k,sHk6s ,AXGs +6Ks +4TsHk^sHk{s +Es +CsHksHks +Ts +Rs +es +asPks\ks\kt\kt\k&t +|*t +z3t +7t +@t`kXtckbt ,QXot +st +|tcktgkttkt ,aXt +t +ttkt ,aXt +Ըt +ʸttku ,{Xu + u +utk)u ,{X6u +9:u +1Cu +eGu +_PutkZu ,{Xgu +ku +tu +xu +u +ٹu +ѹu ,{Xu +u +utku ,Xu +$u +"u +4u +2utku ,Xu +Cu +Au +Su +Qvtkv ,Xv +b!v +`*v +s.v +q7v ,X@v +Dv +Mvohvlrv ,X~v +v +vlvkvkv +v +v +ͺv +˺vkvlUx>lrx +ovx +mx +x +xFlxx ,Xx +x +x +x +x ,Xx +μx +̼xx8X yl%yFl/y ,Y@y +Dy +ܼMyFlWy ,Ycy +gy +uyJly ,,Yy +Xy +PyJly ,,Yy +y +~y +y +yJly ,,Yy +ؽy +ҽy +y +y +&z +z ,,Yz +Rz +LzJl'zJlDz +qHz +oQz +Uz +^zJlhzJlz +z +z +z +zJlzJlz +z +z +z +zJlz +Ѿz +;zo{l{ ,CY+{ +/{ +4{lO{lY{ ,SYj{ + n{ +w{ +'{{ +#{ ,SY{ +D{ +@{<{X{O{{m{ ,hY{ +o{ +c| +| + | ,hY| +#| +,| +[0| +O9| +=| +F| +J| +S|Zm]|Zmz| +~| +| + | + | +| +| +4| +2|Zm| +F| +B|ym| +]| +[|m} +n} +j$} +(} +1}m;}mT} +X} +a} +e} +n}mx}m} +} +} +} +}m} +} +}m}m} +} +~ +0~ +. ~m.~m8~ ,YI~ +@M~ +>V~ +SZ~ +M_~m~~~ +t~ +r~~~ +~ +~~ +  + + +7A^h + + + +, ,Y + + + + ,Y + + \ W#mYq,!nÀ ,YԀ +5؀ ++ +r +h ,Y  +  +:o#n- ,Y> +B +K +O +T ,Y] +a +j +n +wn ,Y ++ +)n ,Y +: +8ȁ +Ḱ +Gсnnn* ,Z7 +k; +aDnNng +k +t +x + + +:o ,Z + +:o‚ ,Zς +ӂ +܂ + +?o ,+Z +3 +/?o ,+Z' +M+ +I4 +g8 +cA?oK ,+ZX +\ +e +i +r +v +{ ,+Z + +?o?o + + +Ń +΃?o؃?o +  +  + + ?o?o. ++2 +); +<? +:H?o] +Ma +Ir~| ,=Z +l +ho΄߄ ,ж'"h07xA ,MZR +V +_ +c +h ,MZu +y + +^ +\ +s +m + + + +ȅ +.̅ +"ޅy ,Z + +zy ,Z +! +* +. +7yA ,ZQ +U +^yh ,Zu +-y +) +G +Cy ,Z +c +_ + +{ +Ć +Ɇ ,Z҆ +ֆ +߆yy +  + + + y*yC +G +P +T +]ygy +  +  + +y +- +)foׇՆ ,Z +N +H݆xx: +r> +pG +K +Tx^xv +z + + +xx + +ƈ +ʈ +ӈ +׈ + + +xx + +"y, ,Z= +A +J +#N +Sypxx Չ9L )=J`Cu ,k ʊ,ފX ,xo6xoS +;W +9\ovoo +K +Io ,ZƋ +bʋ +XӋ +׋ +܋ ,Z + + + + + +  +* +" +V +L&Hp3p=pZ +^ +hHpr ,Z + +Hp ,Z + + + +Lpˌ , [ی +Cߌ +=Lp , [ +f +`  + +Lp# , [0 +4 += +A +J +N +S , [\ +` +iLpsLp += +; +M +KLpLp͍ +\э +Zڍ +lލ +jLpLp  +{ +y + +$Lp9 += +Fak ,"[w +{ +gpgp + +Ȏ +̎ +юrp ,Z  + + + +! ,Z. +"2 +8MX]Ϟrz|۞p#pʏpԏ ,2[ +Y += + + ,2[ +  +z + +" +& +/ +3 +p< +@ +I + M +V +6Z +2c +bg +Lp +t +} + +c +$ + + + + + + + + +ː +*ϐ + ݐju(upp+ +[/ +Y8 +n< +hE +I +Npep}p0q(;ˑڑ.s ,}[ + + t  t* +. +7 +; +@tcjmj + + + +ypגphU Es%sGHttuГ@VQuu %xV;uU~mrUĔ|ޔ Uˆ2GV\fx{ĕԕ V+V@O +B +KarU ,]\e +i +rar| ,]\ + + +E +?ar ,]\ +k +eǚ +˚ +Ԛ +ؚ +ݚ ,]\ + +ar ,w\ + + + + (ar2 ,w\? + C +L +0P +.Yarc ,w\p +At +?} +R +P ,w\ +e +aÛ͛ + +  ,\) +- +2r?_ mr ,\̜ +М +ٜr ,\ + + +( +" r ,\$ +f( +`1r; ,\H +L +U +Y +brl ,\y +} + + + +* +$ ,\ +S +Mrrٝ +rݝ +p + +rr + +# +' +0r:rS +W +` +d +mr + +ڇO ,\Ȟ +̞ +ўWrr + +  +$ +- +01 +,: +H> +DG ,\T +aX +]b ,]o +xs +v}!s!s + + + +)sȟrݟ rrr7}A ,]R +V +_ +c +h ,] +J +F + +z + + + + +# +Ġ +>Ƞ +8Ѡ +_ՠ +[ޠ1~1~ +{  +y߇߇: +> +HaR ,A]h +l +qff ,Q] + +fġ ,Q]ѡ +ա +ޡ +G +Ar ,f] +  +}r ,f]) +- +6 +: +CrM ,f]Z +^ +g ++k +%t +Qx +I} ,f] + +yr ,~] + + + +ȢrҢ ,~]ߢ + + + +r ,~] + + +! +* ,~]3 +7 +@K[e ,]q +u +zˆш ,] +C +?ֈֈ ,] +_ +Y ֈ ,]  +$ +|- +1 +:D ,]T +X +ak ,]x +| + += +9 ,] +W +S +q +mä +Ǥ +̤ ,]դ +٤ + ,] + +  + +! ,]. +2 +; +? +HR ,]_ +c +l +p +y ,] +& +"4 ,]ʥ +GΥ +Aӥ<PP +k  +i%]FmPmm +|q +zz +~ +zz ,] +æ +ȦP  + + + +% +) +2 +6 +? +C +Lfp + + + + +" +  + + + +ʧ +2Χ +0֧~ $DKmmYПѨިSN~N~ +B" +@,s~6 ,^G +TK +RT +hX +d]x~~~ ,^ + +~~ ,^ + +ʩ +Ω +ש~ ,#^ +* +$~ ,#^ +Q +K" +v& +r/~9 ,#^F +J +S +W +` +d +i ,#^r +v +~~ +  + + +~ʪ~ +( +& +8 +6~~  +G$ +E- +X1 +V:~O +iS +e\~ ,5^ + +oǫo + + + +oo  +$ +- +1 +:oD ,E^P +T + ] +*a +(f ,E^xa ,U^ +? +9 +b +\ ,U^ + + +ì +̬ +Ь +٬ +ݬ + +6 +. +` +Z + + Y.C0YM^YjV~f~|֭Z4%4:uD ,g^U +Y +b +f +k ,g^x +| +uu +3 +1uˮu%8$D5DuN ,|^_ +[c +Al +p +u ,|^~ +~ +b +' + + + + + z zٯ +rݯ +p + + + + z  z# +' +0 +4 +C"z]zg ,^x +| + + + ,^ ++ +! +k +cð +ǰ +ٰ +ݰ +zz  + + + +'z1zI +M +V + Z + e{o{ + + +* +( +; +7 +S +Q{ʱ{ +d +b6{ ,^ +v +t +! +&;{E{_'{~g{ ,^ + +g{ ,^ + +ʲ +β +ײp{ ,_ + +p{ ,_ + +" +& +/p{9 ,_F +2J +.S +NW +J` +jd +fi ,_r +v +p{p{ + + + +p{ʳp{ + + + +p{p{  +$ +- +1 +:p{O +S +\{w ,_g{1J%UQ,nM( ,͵׵P ,{) ,)_: +> +G +AK +;P ,A_Y +i] +_f +j +s +w + + + + +{ ,\_ + +ö|Ͷ| +. +, += +;||& +L* +J3 +[7 +YB;|L ,l_b +nf +hkH|l·q̷q + +qq + +& +* +1{K{mY|p| ,_ + + +Ÿ +ʸ ,_Ӹ +.׸ +$ +h +\ + + + +|(|E +I +S|]|z +~ + +" + || +1 +/ù +@ǹ +>ҹ4}ܹ ,_ +Q +M +w +m=}7ڄV|{||N}Ѻd}k( ,_9 += +F +J +O ,_X +\ +e +xi +tr +v + + + + +W˻W׻mvnz{)v3 ,_D +#H +Q +U +Z ,_g +k +t +Ix +C +} +g + + +" + +Y +S +| +z¼ +Ƽ +ϼ +4Ӽ +.ܼ +e +O + + +2 + + +vv7 +; +EvO ,?`` +d +m +q +v ,?` + + +' +#/ ,T` +G +A wֽ +fڽ +d:w ,d` +w +s + +?w/[HwRwo +s +| + +x? ,~`Ⱦ +̾ +վ +7پ +) +{ +y ,~`  + + + +% +_) +]2 +6 +y? +C +L +P +Y +] + f +Lj +Hs +rw +b + +ȂĿ ,`տ +ٿ + ,` + +  + +7A^ + b +ku +I +? + +{ ,` + + ,` + + +  + ,` +% +!  +A$ +=- +a1 +Y6 ,`? +C +LV ,`c +g +p +t +} ,` + + + + ,` + + + + ,` +  + {  ,` +*  +( '{1 ,`> +; B +9 K +P O +N Y ,ao ,a ,a ,a" ,"a*v ,2a  +n  +f {6Y ,Haf + j + s + w +  +  +  +  +  +  +  +  +  +  +  +  +   +  +  +$  +" % +4 ) +2 5B? ,XaP +H T +B ] +k a +e f ,Xao + s + | +  + QB +  + \ +  + wՂ.KsoS S%҃/҃L + P + Y +, ] +* f҃p҃ +?  +;  +[  +Y ҃ ,oa +n  +j  +  +  ,oa ,a +  +  +   +  ,a +  + ' + + + 4 +9 8 +3 A + E +| N + R + [ + _ + h + l + qԠRSxPSvvv,T5] 0SE8yO ,a` +E d +; m + q +w v ,a +  +  +  +  + + +Y +Q + + + + + + ,a* +. +7 +; + @ ,aI +0M +*V +OZ +Kcp ,a} +o +i) + +2 ,a + + + +:_+ +/ +8 +< +E_O_h +'l +%u +8y +6__ +J +H +[ +Y_ +o +k__ +  + + +uBـLـi +m +v +z + + + ,a + + ,b + + ,b + + ,b +  +*4Q[s +*w +( +9 +7 +H +F +Z +X*%yG_PрY , ,,@K\Xo ,#b +k +g + + ,#b + +[ɥ(T'z6@ ,:bQ +U +Z ,:bg +k +t +kx +O + + +* + +o +g + + + + +n +N + +q ,pb  +}  +{ ,b$ +( +2K +O +Yc ,bt +x + ,b + +ɡ ,b + + ѡ0-ѡF +J +T ,ba +e +o2 +  + m + +D ,b +3 +1 +G +CLL( +_, +]6TO +nS +l]og ,bx +}| +{w ,b + +wzw ,c +  +"01J +N +XΣb ,cs +w + ,&c + +ƣ ,6c + + +  +  ,Fc1 + 5 + >H ,VcY +] +f{' ,fc ++ +'/P/ +F +B ,yc +]" +[,E +lI +jSl +}p +yz ,c + + + +ɦɦ + +Ѧ  + +$ ,c5 +9 +BL ,c] +a +j  ,c + +P +  +. +02 +.<U +?Y +=c| +P +Lڧ ,c +g +e ,c +v +t +# +-F +J +Tm +q +{. ,c + + + +33 + +8  + +H4 +8 +>[SPcqxPymoQӣ/MeڧzPQHQ!Q8B ,cS +#W +\ ,ce +Li +@r +v +z + + + + ,d +  +  + + ++ +)$= +<A +8KZd +Sh +Qr^ +b +` +s +oQ  ,-d +" +' ,-d4 +8 +A +E +N ,Bd[ +_ +i/s ,Ud + +7 + +Q +$ + Q(R3ҩ= ,hdN +=R +9W ,hd` +Yd +Sm +q +xz +~ + + + +* +(pR*6 {v'y?CWTo\YRˇ )p )Ņ )4 )a )3 ' )_^. ,dD +gH +7M )4W e )ar{ )3 dd +: +8 +K +G +g +ao  ,d$ +( +- ,d6 +: +L +P +Y + ] +fp + + +. +, += +; +L +J +[ +Y +j +h# +y' +w0 +4 += +A +Fk  + + + + +'  +%  +8  +6  +J  +H " +[ & +Y /D +u H +k Q[x + | +  +  + )ӋJVt" 7,K[Ve ,dv + z +  ,d +! +! +U! +E! +! +! +! +!$" , e3 +!7 +!@ +"D +!I , eV +F"Z +:"c +"g +|"p +"t +"} +" +" +P# +F# +# +#ְܳ ,0e +# +#J ,Be +# +# +# +#  ,Be +# +#! +$% +$.;JT +8$X +2$bmw +W${ +U$ ,Te +j$ +d$ +$ +$ ,de +$ +$ +$ +$ +$ +$ +$ +$  +$ +$1;T +$X +$a +$e +$n + %r + %{ +% +% +,% +*% +<% +:%ܳܳ +L% +J%6ް)1>FPDex[j;ƳX. +]% +[%[,eϬv[ ,te +% +j% ,te +% +% +2& + & +& +& +' +& +' +' +' +'  +"( +( +( +z(% +)) +(2 +/)6 +-)H ,eU +L)Y +<)b +)f +)oy ,e +* + * +!* +* +5* +3* +F* +D* ,e +X* +V* ,e +o* +m* +* +*  ,e1 +*5 +*> +*B +*G ,eT + +X ++a +0+e +.+n +N+r +F+{ +y+ +w+ ++ ++ ++ ++ +, + , +f, +`, +, +,o] ,e +, +, +, +, ,e" +,& +,1 ,f> +,B +,K +Q-O +E-X]b ,fo +-s +-| +- +-] ,f +- +- +- +-e] ,f +- +- +- +-  ,f +- +-Iirw ,ò ,' ,.f4 +".8 +.B[ +F._ +D.i +U. +S.M +d. +b. ,>f +w. +q. +. +. +. +. ,>f + / +/ +A/ +9/ +q/! +e/* +/. +/7 ,^fJ ,sfS +/W +/_ό~+$W( =,GܱX[kTZuZoZ ,f# +/' +/, ,f5 +P09 +J0B +t0F +r0O +0S +0e +0i +0r +S1v +Q1 +|1 +p1 +1 +1 +2 +1 +2 +}2 +3 +2 +Y3 +C3 +3 +3 +3 +3*؎ +3# +3-؎F + 4J +4T ,fa +4e +4o +04 +.4 ,f +?4 +=44 +N4 +L4[ ,f +]4 +[4 +l4 +j4  ,f +|4 +z4! ,f. +42 +4; +4? +4HgR ,f_ +@5c +>5l +O5p +M5yg ,f +a5 +_5 +p5 +n5o[ ,f +5 +5 +5 +5 ,f +P0 +J0 ,g +5" +5,YE +5I +5Sl +5p +5z +5 +5 ,g +6 + 6" +66 +26 +Y6 +Q6"" +6 +6 +6# +6,"6"O +6S +6\ +6` +6i"~ +6 +6"" +6 +6 +6 +68F +7  +7: +7> +7G\r| ,/g +&7 +$7 +57 +37 +D7 +B7 +U7  +Q7ǔ(ݔ2ݔOݔYݔq +l7u +j7~ +{7 +y7 ,?g +7 +7 +7 +7 ,Og +7 +7 +7 +7 +7 +7 ,bg+ +7/ +78 +7< +7E +8I +8N ,bgW +%8[ +!8`' ,rg +<8 +:8 +K8 +I8 +\8 +Z8 ,rg +m8 +i8 +8 +8'  ,g +8  +8*K4 ,gE +8I +8R +8V +8[Pv/B[[ +8 +8 +8 +8q>l2Eګ , ,( =,Q[p ,[H[Ϭ ,g +8  +8 ,g- +91 +9: +?9> +99G +^9K +\9Tjak ,g| +q9 +m9 +9 +9 ,g +9 +9 +9 +9 +9 +9 +: + : ,g +3: +1:  ,g +I: +C:$ ,h1 +j:5 +h:> +z:B +x:K +:O +:X +:\ +:e +:i +:rxxx +: +: +: +: +: +: +: +: +: +: +: +: , +:0 +:5Vao + ;s + ;y#H\I;X.  9 +;= +;F \|f| ++; +);[3p\ j\2 AK ,h\ +D;` +:;e ,h +s; +o; +; +; +; +; +; +;ŭ +< +< ,9h* +0<. +*<7 +S<; +M<@ ,9hM +<Q +v<Z +<^ +<g +<k +<t +=x +< +>= +8= +_= +[= +}= +u= += +=O77 += += += += += += + > + >"7; +>? +>IY^ +4>b +2>mw ,Ph +C> +A> +T> +P>/ +l> +j>OO +{> +y>\6*S hִy8]\\֭\0֭: ,`hK +>O +>T ,`h] +>a +>j֭t ,h +? + ? ,h +4? +&?֭ +u? +o? +? +?֭֭ +? +? +?  +?֭֭6 +?: +?C +?G +?P֭e +?i +?r֭|֭ +@ +@ +.@ +,@^ ,h +>@ +<@^ ,h  +P@ +N@ +b@ +`@&^0 ,h< +r@@ +p@I +@M +@V^` ,hl +@p +@y +@} +@^ ,h +@ +@ +@ +@w ,h +@ +@ +@ +@ ,h# ,h0 +A4 +A=G ,hS +JAW + [  +MC_  +KCh  +eCl  +cCu  +eCy  +cC % %  )M  +xC  +tC % %  +C  +C  +C  +C  +C  +C : B7 KP dh p   / XZ   )  ,zd  +C  +C  )4   )a- @6  )3C  M ^ Qt   )7~   +C  +C  ):>  )P  )  )I  )I )=r )" )H2 )(.= +%DA +!DF )GYQ +DDU +G2 +RG6 +NG;km , +jG +hG0%r/rL +yGP +wGY +G] +Gfrpr +G +G +G +G +G +G ,M  +G  +G-! ,M2 +G6 +G? +GC +GH ,MQ +GU +G^ +Hb + HkFx ,M +-H +)H? +DH +BHP ,N +SH +QHU! +bH% +`H/ˑ9ˑV +qHZ +oH_ۑp0XX +H +~Hb ,%N +H +H +H +H ,%N +H +H +H +H' ,9N8 +H< +HF;P ,INa +He +Hn +Ir + Iw@"1 ,YN + I +III +8I  +6I%Y@PKg`po~FÌFߌ<Tߍi@GGG7HUEZ(HjҎpH8H)JFkiIďHIڏxI7OII J #0 HJ@ 6U pJe T ~ J  Ƒ !-!JC!(f!I!T!~!(K!!pK!"K#"ŒW"l"K|"m"" L""hL""3#“# );8# )E# )nR# )G>_# )Hw# )4## )a## )3# # )# )# )%# )# ),$ )$ ))"$ )/$ )<$ )SI$ )V$ ) c$ )4m${$ )a$ $ )3$$ )a$`$ )3$$ )a$ )e$ )u% )u%% )u8% )uK% )u^% )uq% )u% )u% )u% )a%% )3%% )a% )e% )u& )u"& )u5& )uH& )u[& )un& )u& )u& )u& )a&& )3&& )u& )u& )u' )a' (' )35' D' )aQ' )ed' )uw' )u' )u' )u' )u' )u' )a'`' )3' ( )0( ):>=( )HJ( ) W( )nd( )nq( )1~( )4(( )a( ( )3(0( )a(`( )3((( )a )) )3!) ,) )dNG) ):>T) )a) )y) )) )n) )J2,T_H,`R,`o, +OJs, +MJ|, +^J, +\J,`,`, +mJ, +kJ, +|J, +zJ,t`, ,L(, +J, +J, +J, +J, +J- +J- ,L(- +J- +J- + K- +K(- +$K,- + K5- +IK9- +9KB-t`L- ,](]- +Ka- +Kk- ,m(x- +K|- +K-`- +K- +K-`-`- +K- +K-`-`. ,}(. +K. +K#. +L'. +L,.`D.Ia].)ag.)a. +L. +L.6a.y`.`..0..a/a2/naG/T/0.g/ya/a/a/X./a/X./c/E_/- 0o_ 0-00_c0_0E`0 )Y0 )hc0 )n0 )1 )1 )1 ),1 )461D1 )aQ1 )ed1 )uw1 )a1 1 )31X1 )a1 )e1 )a1`1 )31P1 )u2 )!2 ).2 )H;2 ) H2 )nU2 )b2 )4l2 2 )a2`2 )32p2 )a22 )32h2 )a22 )33`3 )i+3 )83 )E3 )R3 )_3 )l3 )4v3`3 )a3 )e3 )u3 )a33 )333 )a34 )34#4 )M04 )e=4 ):J4 )W4 )e4 )`:w4 )H4 )yj4 ) y4 )4 )j4 )a4 4 )34x4 )u5 )5 )P)5 )H65 ) C5 )nP5 )]5 )4g5}5 )a55 )355 )a5 5 )355 )5 )6 )H6 ); )nK; )4U;c; )ap;@y; )3;; )a;; )3;; )a;; )3;; )"< )Ņ< )hc+< )8< )E< )nR< )3k< )Nx< )4<< )a<@< )3<< )a< )e< )a<< )3== )W!= )O0= )a==F= )3S=x= )yi= )Ņ= )= )7= )N= )?= )N> )> )V]*> )n7> )"WD> )4N>`\> )ai>r> )3>> )a>> )3>> )W> )> )? )n? )H? )P)? ) 6? )nC? )fP? )4Z?h? )au? ~? )3? ? )a?`? )3?? )4? )? )n? ) @ )"@ )/@ )<@ )I@ )V@ )nc@ )Qp@ )X~@ )a@ )e@ )[@ )@ )@ )@ )@ )@ )nA )aA )e A )w'A ,)=A +CLAA ++LFA )nRA +LVA +L[A )fA +LjA +LoA )zA +'M~A +MA )A +bMA +`MA )A +yMA +oMA )4A )aA )eA )aA A )3A( BB ,)%B +M)B +M3B=B ,)NB +MRB +M[B +M_B +MdB ,)mB +NqB +MzB +N~B +NBJB ,)B +>NB +8NB/B +[NB +YNB7B ,)B +xNB +hNB +NC +NCJ!Cg?C h\C{gfC ,*wC +O{C +OCgCgCC{gC2CgDgDg$D24DgID )[dD )qD )~D )D )hcD )nD )4DD )aDD )3D8D )aE )eE )W(E )O;E )aHEQE )3^E0iE )avE )eE )5EE )dE +"OE +OE )E +OOE +KOE ,%(E )E +hOE +fOF F )j)F3FLF +OPF +OUFlF}FFF )>F )nF )(.F ) F )HF )@G ) G ) &G )x3G )4=G0SG )a`GiG )3vGhG )aGG )3G`G )MG )aG@G )3GXG )a HH )3HP.H )a;HDH )3QHH\H )aiHrH )3H@H )oOH )ŅH )NH )4HУH )aHH )3H I )aI@I )3,Ix7I )aDIMI )3ZIpjI ){II )ŅI )NI )4II )aI@I )3II )aII )3JJ )Ul3J )Ņ@J )NMJ )4WJeJ )arJ{J )3JJ )aJ J )3JJ )aJ`J )3JJ )`K )Ņ K )-K )dFK )@SK )nmK );zK )\K )A*K )HK )NK ) K )K ))K )K )4KL )mmL )ofL )(L )a5L@>L )3KLZL )agL )ezL )aLL )3LL )aLL )3LL )aL )eL )a M )eM )a+M )e>M )aKMTM )3aMpM )a}M )eM )aM )eM )aM@M )3MM )aMM )3NN )h:,N )Ņ9N )HFN )SN )NlN )O )aKO`TO )3aOO )O )ŅO )5O )O )hcO )O )NO )aP )eP )/P )Ni ) Ki )Xi )nei )ri )i )i )1i )"pi )4ii )ai )ei )aii )3i j )Mj )e&j ):3j )@j )Nj )`:`j )Hmj )yjzj ) yj )j )jj )ajj )3jxj )j ,&j +OTj +CTk )n k +Tk +Tk )n!k +T%k +T*k )z6k +U:k +TIk +UMk +URk )I6]k +Uak +Ufk )4tk )ak`k )3kkk0)k )kl + Vl +V l )@l +9Vl +3V"l )E`.l +\V2l +XV7l )tCl +xVGl +tVLl )HWl +V[l +V`l ,(il )Mtl +Vxl +V}l )el +Wl +Vl ):l +Wl +Wl )l +n )G>n ) n +Xn +Xn )fo +>Y o +2Yo )no +Y o +Y%o )ш>o +YBo +YGo )Ro +YVo +Y[o )fo +Zjo +Zoo )GYzo +uZ~o +kZo +Zo +Zo )4oo )Jo )ao@o )3oo )aoo )3 pp )a(p1p )3>pMp )aZp )emp )azp )ep +p )Wp +@[p +:[p )Op +{[p +e[p +p +p +[p +[p +[p +[q +q +)q +[-q +[6q + \:q + \Cq +Xq +!\\q +\eq +oq +q +H\q +F\q +Y\q +W\q!+q )aqq )3qq )ar@r )3r+r )a8rAr )3NrXrmr )Wxr +k\|r +g\r )Or +\r +\rrr +\r +\r +\r +\r +\r +\r +\r +\r +\r +\rs ,Es +]s +]!s +]%s +]*s̈́Gs )aTs]s )3jsys )ass )3ss )as@s )3ss )ass )3ttP*t ,E)t +.]-t +,]7th*Ath*^t +@]bt +>]kt +O]ot +M]xt +^]|t +\]t +o]t +k]t +]t +]tm*t +]t +]t*t +]t +]t*t ,E u +]u +]u +]u +] u*>u+]u*gu*u +]u +]u*u*u + ^u +^u +%^u +!^u +?^u +;^u +[^u +U^u +z^u +v^u*v +^v +^&v*;v +^?v +^Jv+Tv ,Eev +^iv +^rv +^vv +^{v +vt+v)v ,Ev +_v + _v)v8 ww ,E&w +_*w +_3w +<_7w +8_a(e(((ć)чB ,,@pJ_ r,p ,̈pֈ7 ,p_1 D,Xpbw ,p Љ,p ,*p4I \,ppz6 ,p^Պ ,p`C+ȃU ) o\ ,hDr ++hv +!h +dh +^h )  +h +h +h +h )Hċ )݉ϋ +$iӋ +i؋ )B +xi +ri ) +i +i )GY  +i +i )1 +Tj# +Lj( )G&8 )4BRa#` )amv )3p ,D )W +j +j )O +j +jŒ!̌ ,Dٌ +j݌ +j + k + k! ,D  +k +k +,k +*k !C )aPY )3fhp># )W +Bk +#>#ԍ +k؍ +k +k +k>#># +k +k +k" +k+>#@ +kD +kM>#W>#t + lx + l +l +lT# )a Ŏ )3Ҏ` )a` )3X )a ) )36PE )aR[ )3hHv! ,D +.l +,l +El +Cl ,D +Ul +Sl!ɏ ,Dڏ +nlޏ +ll +~l +|l ,D +dh +^h ,D# +l' +l0 +l4 +l9O!zG"s"Ԑ"i##<#f1${$ %ۑ%jBǀ3 F,Zdy , 0Cϒ3 , [& 9,MX )b  +l +l )GY +m + m )< +.m +(m )4“ +UmƓ +Km˓ )1֓ +mړ +zmߓ )4  )W  )O +m +m# - F +mJ +mS +mW +m` j  +m +m +m +m  Ô  +n +n +n +n  )a(`1 )3>xL/ V ,Dg +#nk +!ny +2n} +0n ,D +En +?n +dn +^n3  +n• +}n̕ ,Dٕ +nݕ +n`  +n +n   3 +n7 +n@ U k u ,/D +n +n +n +n  ,BD +o +nÖ +oǖ +oЖ +)oԖ +%oݖ  ,UD +Ao +=o +Wo +Uo +ho +do ,UD# +o' +|o, R!e $!B )ڗ ) )M; ) )R$ ))1 )K )X )Je )4o} )a )3 )aŘ )3Ҙ )a@ )3 )W  )O3 )a@I )3Ve )ar{ )3 )u )u )aʙә )3 )u )a@ )3%4 )uC )aPY )3fq )8 )1 )N )4 )uњ )u )a )3 )u! )< )1I )NV )4c )+p )4z0 )u )u )u )uԛ )a` )3 )u )u$ ),0N +oR +oW )!c +og +ol )M;x +p| +p )_ +:p +2p ) +jp +`p )G^ +p +p )(Nʜ +pΜ +pӜ )ޜ +p +p## +q +q. ++q2 +)q@ +>qD +8qM +\qQ +XqVjs ):9ѝ )M;ޝ )_ ) )(N ) )+ )J )RW )Ad ))q )~ )< )'s ) )u )u͞ )u )M; ) ( )H5 )݉B )BO )ܛ\ )i )v )GY )4 )W )Oß )aПٟ )3 )a@ )3 )F ) ^ )Hk )݉x )B )ܛ ) )GY )G& )1Ơ )NӠ ) )4 )+ ) )4' )u: )uM )u` )us )u )u )W )O )aơϡ )3ܡ )a  )3 )a*`3 )3@O )ub )uu )u )u )W )O )aȢѢ )3ޢ )u )u  )o ,aO+ +|q/ +rq4 )@@ +qD +qI )E`U +qY +q^ )tj +rn +rs ) ~ +Lr +v ): +`v +\v ) +~v +zv )¤ +vƤ +vˤ ,OԤ )`:ߤ +v +v ,O )H  )yj +v +v ) y& +v* +v0 ,O9 )D +vH +vMOb )jm +wq +wwOp5LL ,Oǥ +w˥ +wԥ +3wإ +/w +3w +/w +Tw +Pw +Tw +Pw +uw  +qwL4 ,O= )H +wL +wQ )r\ +x` +xo +"ys +yx ,Q[ +c_ +ah +tl +rrQ(R ,P + +(RǪ ,PԪ +ت + + +6R ,P +*  +$6R ,P, +Q0 +K9 +v= +rF6RP ,P] +a +j +n +w +́{ +Ɓ ,P + +6R , Q +  + +« +˫6Rի , Q +( +& +8 +66R , Q +G +E  +X$ +V- , Q6 +i: +eCeRhnSr ,Q~ + +xSR ,*Q +ì +̬ +ԂЬ +̂լRJS,T$ ,DQ5 +9 +B + F + K ,DQT +X +a,Tk ,UQ| +7 +5 ,UQ +I +E ,hQ +b +` +s +q­,Ṱ ,hQح +ܭ + + +,T ,hQ  +  + + +# ,hQ, +ȃ0 +ƃ9,TC,T` +كd +׃m +q +w1TOT ,xQ + +OTǮ ,xQӮ + ׮ +  + +OT ,xQ +. +, +@ +>OT' ,xQ3 +P7 +N@ +bD +`MOTW ,xQd +rh +pq +u +uT ,Q + + + + ,QTTT +  +TT4 +ۄ8 +ӄFTPTl +p +yTT + + +1 +/TTٰ +Aݰ +? +Q +O +c +_ +{ +w TT4 +8 +A +E +NTXTq +u +~ + +TT +υ +ͅ + +ޅȱTݱ + +TU ,Q + + #"U5POPsGQRRѲ , qM3iNoPSKSK +)ų +'γ +;ҳ +9۳ +J߳ +HKK +_ +]K( ,wO9 +n= +lF +J +{TqM^ ,Oo +s +| + + ,O +Ɇ +ņMM´ +ƴ +ϴ + Ӵ + ٴM?O ?O) +- +6 +,: +*@J_J}JJ~KǵKԵKkqL/LGLeL}MSZUݶ )2 )n ) ) ), )N9 )R )` )"ph )4rq )a )e )W )Oķ )aѷqڷ )3 )W  )n )Ņ( )nC )P )H] ) j )4t )M )a  )3ø )aи`ٸ )3 )H  )n )H& ) 3 )@ )4Jж` )Ms )a` )3  )a )3ĹϹ )_^ֹ ,; +J +: ) + +  )H +) + )@+ +/ +4 )g? +C +H )S +/W +-\ ) g +Ck +Ap )bS{ +Z +X )d* +j +h )r= + +x )l + +v )z˺ +ϊϺ +Ժ )xߺ +9 +7 ) +U +G ) +  + ) + +$ )+/ +3 +8 )vC +G +`L )4Z )ag@op )3}p )ao )3h )a˻oԻ )3` )ap )3X" )a/@p8 )3EPT )aapj )3wH )ap )3@ )ażqμ )3ۼ8 )a@q )3 0 ,?  )+ +s/ +i9 )aFqO )3\(j|t ,? + + +׍ +Ӎ| ,? + +ý +ǽ +ν}߽@A  ,; +  + +A" +=' ,;0 +Y4 +W= +nA +fJ T ,<e +i +s} ,< + + +Վ +ю ,< + +ľ + + +! +'? +2C +0LVo +Cs +A ,,< +X +R ,,< +{ +uȿ!ҿ ,C<޿ + +! ,C< + +ُ + +!& ,C<2 +=6 +7? +cC +]L +P +U ,C<^ +b +k!u! + +ސ + +!! + + + + !!  + + +. +,$!9 +?= +;FAhKr ,Z< +[ +Y +m +kP ,j< + +z +͑ +Ñ ,j< +4  +* +t +n * ,<; +? +H +L +ޒU +OY +E^ ,<g +k +t +דx +͓ + +  +P +J + +| + + ,< + + +  + ,< +A += +h +^  +  +}+}@}U}j}}}}}}}};E^ +b +k +ٕo +וx +| + + + +1 +/ ,< +A +? +W +O*?Tm' ,=  + + +Ӗ +ɖ# ,=, +;0 +19 +z= +vFP ,*=a +e +n +r +ޗ{ +O +E ,*= + + +ט +͘ + +  +G +C +l +f + + ,P= +ϙ +˙ + +  ,e= + +" +:& +0/ +y3 +u<}Q}f}{}}}}}}}}$,B}a6k6 + + + + +š +66 + + + + ,= + + +* +"&;Pez" ,=3 +\7 +R@ +D +I ,=R +V +_ +Mc +Ilv ,= +o +e + + + + ,= +c +Y + + + +ܝ + + +< +6 +e +Y  ,= +  +) +ž- +2 ,=; +? +ߞH + L +U +IY +Eb ~w ~ ~ ~ ~ ~ ~ ~ ~# ~8 ~Jh~ +d +b +| +z + + + + +ԟ +ҟ  , > + +  +$ +7[L[a[v[[[[[[[ [n>H ,>Y +*] +"f +hj +`o ,>x +| + + + ,=> + + +b +X +ɡ + ,=> +  + +Q +G + + + +  + +ۢ +  +'1 ,c>B +CF +?O +fS +bX ,x>a +e +n +r +{ + +ޣ}}}}}} }}4}I}^}p ~ + + + + +) +# +L +J' +d+ +b0 ,>9 +t= +rF +J +]r 3EdOn ,> + + + + ,> +E += +{ +wO ,> + + + +ݥ +O +E ,> + +  +٦ +Ϧ + +& +K* +G3 +p7 +j@ +D +MOW ,>h +ԧl +Чu +y +~ ,? + + += +5 +s +o}}}}}}0}E}Z}o}}\}ff + + + + + +f'f@ +ݨD +ۨM +Q +V ,?_ +c +l +p +/DYk ,*? +@ +: +a +] ,*? +{ +w + + ,K? +ީ +ک  ,[?" +& +/ +3 +8 ,[?A +>E +2N X u +uy +s   + +   + +   + +% ,?+ +ê/ +8%B ,?O +S +\)f ,?r +Kv +G) ,? +e +a + +{) ,? + + + + +ӫ +ϫ ,? + +) )% +) + 2 +6 +?)I)a +-e ++n +=r +;{)) +L +J +\ +Z) +m +igS& ,?7 +; +D +H +MXg@}~  +ɬ +Ǭ0f|f| +۬ +٬%f|/f|L +P +Z}d} + +}P qAA 67|Kef|zX@|@|@| A>4}Wl}l?~} @ )6 )8 ) )Y ,, )" + + )  + +~! + % +* );5 +9 +> )I +M +R )] + a +p +Lt +6y )k +د +ү )  + + ) +D +4 ) + + )@ + +װ )n +# + )4v )a`v' )34x> ,,G )MR +nV +l_did +} +{ + + + +i ,=- )M + + )e +ı + ): + +  ) + + )( +?, +91 ,R-: )`:E +dI +bN ,v-W )Hd m )yjx +t| +r ) y + + ,- ) + + )j + +p5 5  ,d-- +²1 +: +߲> +۲G +߲K +۲T +X +a +e +n +!r +y ,, +> +< ,, +O +K +m +i +" +-7T +X +a +e +nx + + +Ƴ +ij +׳ +ճ + + + +(E + I +R +V +_ ++c +)miw , - +B +> +c +_ +~ +z , - + + + +ii + +  ,- +ϴ" +ʹ' ,-0 +޴4 +ܴ=G ,-T +X +] ,-f +j +s} ,-- + + ,-- +0 +. ,-- +A +? +P +N( +_, +]:D] +qa +om7w7 + +~9!)2[Tms9Tf J?gYmLm,v^m- )(;; )H ) U )ܤc )!n~ ) )  )  ). )( ,N + + ) + +޵ + + )@  + + )) +9# +5( )46 )aCL )3YgHq ,N +Q +OGH+H3HWH-QV )Gh )u )MV )0y )f )N ) )4 )a )3 )a% )32A )aN W )3do )a|` )3 )Sm )N )3 )< )N ) )n% )QH )qU )4_m )Wz )O )a )3 )an )n )U ,&  +l +^ )n  +$ +) )4 +8 += )H +L +Q )\ +&` +e )4s )a )e )a@ )35 ,' +R +P^ ,$' +f  +b + + ,$'' ++ +4 +8 +AN^g +߷k +ٷuq + +y ,7' + +  +< +8T\ *( )uC )NP )Ņ] )j ) )K )n ) )4 )a )e )u )a@  )3" )u1 ){LL )NY )Ņf )s )c ) ) )K )n )4 )a )e )a )e )u* )a7 @ )3MX )ug )q +X +P )@ + +~ )q + +9 )u +ɸ +Ǹ )u +ظ +ָ' ,2:8 +< +E[e + + ,B: + + +# +!" +2& +0/ +C3 +?8Q [ x   +Z +X +i +gTT +x +vT T# +' +0T:TR +V +_ +c +h\0HT  )$? ,T+ +ƹ/ +4 )@@ +D +I )T +X +] ) h +l +q ,Uz )u +ۺ +׺ ,U )u + +c ,U +* +&ccc +C +A#c9(dC ,!UT +[X +Sa +e +n +r +w ,!U + + + + +5 ++ + +e ,PU +ϼ +ͼe ,`U +޼ +ܼ  +  +e+ ,pU8 +< +EeOeh + l + u +y + + +daeee3 0P)r>X?Q[p0??zd ,U +3 +- +W +S +t +p ,U + +  +$ +- +1 +:zdD ,U[de ,Uv +ӽz +ѽ + +dd + +dd + + + +  +  +d-dHVYO~d ,U +% +#dd +4 +2dd +C +A +T  +Pd*e4eQe[es +kw +i +z +xe&e )vM )@ )n )  )S )( )42@ )aMV )3cr )a )3 )a  )3 )a )e )a`  )3$ )M8 )3S )@` )m )z )B ) )4Р )a )e )a )3 )M )d# ,R:9 += +B )@N +R +W )E`c +.g +(l )tx +\| +V )n + + )+ + + )H +ٿ +ɿ )4t )at )3 )a@t )3*9 )aFtO )3\k )axt )3/ z X>! ,5 t? zT >j  { > *{ : t )i ,3 +< + )n + + )  +$ +  )@# +D' +8, )q7 +~; +v@ )4J X )ae @n )3{   q )W + + )O + + q q + + + + q  q& +* +3 +#7 +!@ qU +7Y +3b ql q +T +R +d +b  )a  )3  )a   )3 " ,4+ )M6 +t: +rC 4M 4f +j +s +w + + +  ,!4 + +    ,14 + +  + + ! ,D4- +1 +: +> +G +K + T ^ ,W4n +'r +#{ += +; +N +J ,W4 +h +b    " q- wB :U ,wj : Pw :  )H ,U + + )@ + + )E` +  + )t +, +&$ )H/ +^3 +R8 )4B uP )a]  uf )3s 0 )a `u )3 ( kf kf + + + + kf kf + +# +' +.  , u  XP )0 ) )| ,i:1 +5 +: )@F +?J +7O )E`[ +r_ +ld )tp +t +y )n + + )+ + + )H +b +N )  + + )t + + )S + + ) +0 +( )4 s )a*  r3 )3@ hO )a\ `re )3r ` )a r )3 X )a r )3 P )a  s )3 H  ' )W2 +Y6 +U; )OF +|J +tS  ]  v +z + + +     + + + +   + +     + +# +' +-  P )a] `sf )3s @ )a s )3 8 ,: )M +& +$ Y  Y  +7 +5 +H +F +H +F  & ,:7 +Y; +WD  Y  o  y ,: +j +f + +~   ,: + + + + + +   ,: + + + + + + ,:' +,+ +&0  V  i _        &  G   0  I U{^ >~ u{ > { ? { X?  s {) X>< ,P sZ {o 0? s | ? )= ,8 +u +M )n +* + )  + +  )@ + +! ), +0 +5 )@ +kD +GI )T +X +] )nh +l +q )| +h +N )q + + )S +  + )  +7 +# )1 + + )4 Ў  )a   )3  / )a< E )3R a )an )e )a )e )a   )3  )a ` )3  )a  )3( 7 )aD M )3Z i )av   )3   )W +3 +/ )O +T +N   +v +t +  +  7 +; +D +H +Q f +j +s }  + + + +  )a ` )3 x )a  )3) p3 ,"9< )MG +K +T ^ w + { + + + + +   +. +* +J +H   +] +Y +y +w ' ,83 +7 +@ +D +I ,8[ e  + + + +   + + + +   + + / ,9* +. +7 +'; +@ 4`  ,   +Q +O +` +^   +o +m +~ +|  * ,29; +? +H R ,29_ +c +l +p +y  ,I9 +9 +1  ,I9 +h +` + +  ,I9 + + + + +  +  ,I9 +6 +0! + H +UL +SU +eY +cb l  +t +r + +   + + + +  + + & # ,`9/ +3 +8 S C] ,p9n +r +{ C ,p9 +" + +X +T G ,9 + + G ,9 + + + + G ,9 + +( +, +5 + 9 +> ,9G +&K +"T G^ G{ +> +< +N +L G G +] +[ +m +k G G +| +z + + G$ +( +1 {L V ,9b +f +k   ,9 + +    ,9 + + +  +  ,9 +!! +* +7. +57 +H; +DD N ,9^ +`b +\k +vo +tx +| + ,9 + +   , , + +  ,:  +$ +- +1 +6 W 8x m  , : +0 +, n    g, D e   ? P (y > ^y, => yS <i Ў~ y < Ў y : y =  z" 8=9 2zN >o oz < z : ) )N )n! )K! )߫1! )NI! )nV! )Kd! )il! 6! +T! +H! )! +! +! )! +! +! )! +0! +&! )+! +^! +\! )! +s! +k! , J" )u" +" +" )a," )e:" ,)JC" )uN" +R" +X" 7m" )ux" +|" +" 7" )u" +" +" 7" ,J" +" +" M7" M7# +# + # +# +# M7$# M7<# + @# + I# +M# +X# R7b# ,9Js# +0w# +(# R7# ,9J# +_# +W# +# +# [7# ,KJ# +# +# [7# ,KJ# +# +# +$ + $ [7$ ,KJ $ +4$$ +.-$ +Z1$ +T:$ +>$ +zC$ ,KJL$ +P$ +Y$ [7c$ ,eJt$ +x$ +$ +$ +$ [7$ ,eJ$ +$ +$ +$ +$ [7$ ,eJ$ +$ +$ +$ +$ ,eJ$ +"$ +%  8!% 7+% ,uJ7% +?;% +=@% 7T% q7^% q7% +N% +L% |7% 7% ,J% +]% +[% +l% +j% ,J% +}% +y% +% +& 7& +#& +-& 7B& +F& +N& &7f& 97~& 7& )3n& & +& +& )n& +K& +=& );& +& +& )d& +& +' )' +' +' )4!' p.' 8' ,5I' +M' +V' ++Z' +)_' ,5h' +<l' +8u' +Ty' +P' ' ,5' +j' +h' ' ,5' +y' +w' +' +' ' ( /( j9( ,5J( +N( +W( ja( ,5n( +r( +{( +( +( o( ,5( +2( +,( o( ,5( +Q( +K( +p( +j( o( ,5( +( +) +) +) +) +) ,5#) +') +0) o:) oW) +[) +d) + h) +q) o{) o) +/) +-) +?) +=) o) o) +N) +L) +_) +]) o* +p* +l * (* 2* ,6>* +B* +G* W* n* Q* ]* * * (;* p* )l+ ); + )d+ )4$+ .+ )H6+ @X+ +\+ +a+ )nm+ +q+ +v+ )1+ ++ ++ );+ ++ ++ )d+ +-+ +%+ _+ u+ + )rt+ !, +Q%, +K*, );5, +t9, +p>, )dI, +M, +R, i, ,  , O, , x3, )Ղ, )d, );- )3- )d"- );;- )K3V- )Ņd- ) Z- )- )Ņ- )a- )e- )u- )e- b- +- +- )Ņ . +. +. b!. ,bT2. +-6. ++;. ,bTD. +GH. +;Q. ,uTe. +si. +qr. b|. ,uT. +. +. +. +. b. ,uT. +. +. +. +. ,uT. b. b / +/ +/ +/ +!/ bD/ bN/ ,TZ/ +^/ +g/ bq/ ,T}/ +/ +/ + / + / b/ ,T/ +/ +/ +// +-/ b/ ,T/ +?/ +=/ +Q/ +O/ b0 ,T0 +a0 +_0 +s0 +q/0 c90 ,TJ0 +N0 +W0 +[0 +`0 ,Tj0 c0 c0 ,T0 +0 +0 c0 ,T0 +0 +0 c0 ,T0 +0 + 0 c1 ,T1 +01 +*!1 +O%1 +I.1 c81 ,TE1 +qI1 +kR1 +V1 +_1 +c1 +h1 ,Tq1 +u1 +~1 c1 c1 +1 +1 +1 +1 c1 c1 +1 + 1 +1 +1 c2 c2 +-#2 ++,2 +>02 +<92 cN2 +OR2 +K[2 Icv2 3c2 ,T2 +p2 +j2 =c2 )`x2 )Ņ2 )s2 a2 +2 +3 )N 3 +3 +3 )Ņ!3 +9%3 +-83 ,TA3 )ML3 +gP3 +cU3 )e`3 +d3 +}i3 ):t3 +x3 +}3 )3 +3 +3 )3 +3 +3 Ob3 )`:3 )H3 )yj3 ) y3 )4 )j4 Ob!4 Ob:4 +>4 +G4 +K4 +T4 + X4 + a4 +e4 +n4 + r4 + {4 +4 +4 b4 ,S4 +,4 +*4 ,S4 +F4 +:4 ,S4 +r4 +p4 b4 ,S4 +5 + 5 + 5 +5 b 5 ,S-5 +15 +:5 +>5 +G5 ,SW5 ba5 b~5 +5 +5 +5 +5 'b5 /b5 /b5 +5 +5 /b5 /b 6 + 6 +6 + 6 + #6 /b-6 /bE6 +I6 +R6 +.V6 +,_6 /bi6 /b6 +>6 +<6 +P6 +N6 /b6 /b6 +`6 +^6 +r6 +p6 [b6 ,T6 +6 +7 + 7 +7 ,T7 hb:7 hbD7 , TQ7 +U7 +^7 hbh7 , Tt7 +x7 +7 lb7 ,9T7 +7 +7 lb7 ,9T7 +97 +37 +X7 +R7 lb7 ,9T7 +z7 +t8 +8 +8 +8 +8 ,9T!8 +%8 +.8 lb88 lbU8 +Y8 +b8 +f8 +o8 lby8 lb8 +8 +8 +'8 +%8 lb8 lb8 +68 +48 +G8 +E8 lb8 +X9 +T 9 b&9 b09 ,RT<9 +y@9 +sE9 bV9 )q9 )Ņ~9 )9 )a9 )e9 )$9 )Ņ9 )9 )a9 )e9 )W_ : )U: b.: ):: +>: +N: +R: +`: +d: +i: )Dt: +x: + }: )4: )a: @y: )3: : )a: y: )3: : )a; y ; )3; (; "b2; "bO; +S; +Y; 1bn; .; 9b; Zb; .; yb; b; .< )m< '< )3< +37< ++G< +[K< +WP< );[< +z_< +rd< )o< +s< +x< )< +< +< )n< +< +< ) < +@< +8< )=< +p< +h< +< +< )< +< +< )5< +< += )4= )a%= `x.= )3;= J= )aW= x`= )3m= |= )a= x= )3= = ڗ= ,S= += += = = +> + > +0> +.> +?> +=$> +P(> +L1> ;> X> +g\> +ef> p> > +}> +{> +> +> +> +> > > +> +> >  ? +? +? !? 9? +=? +F? P? i? +m? +z? ? ? +? +? ? ? +? +? ? ? +O@ +G @ @ ,@ +{0@ +s9@ +=@ +F@ P@ h@ +l@ +u@ +y@ +@ +@ +@ +@ +@ @ @ +@ +@ +%@ +#@ @ @ +4A +2 A +DA +BA "A ;A +S?A +QHA +cLA +aUA jA +tnA +pwA ̘A ߘA ߘA ߘA +A +A +A +A  B $B I.B IKB +OB +YB cB B +B +B B B +B +B B B +B +B B C +C +C 7C 0FC PC mC +qC +vC C PC  C C OC C bD D O-D tED .gD D ܙD D D )"D ZD )D +*D +"E +fE +P E );E +E + E )+E +/E +4E )?E +CE +yHE )nSE +WE +\E ) gE +(kE +pE )={E +mE +aE +E +E )E +E +E )5E + E +E CZE ,RE +8E +6E ZE ZF +GF +E,F +X0F +T9F +n=F +lFF ZPF ZmF +qF +}{F ZF ,)RF +F +F +F +F ZF ZF ZG ZG ,9RG +#G +-G G[7G ,KRHG +LG +ZG +^G +gG +kG +tG +xG +G +6G +4G +FG +DG +FG +DG ,KRG +XG +TG L[G x[H [/H [9H ,aRJH +rNH +lWH [aH ,aRnH +rH +{H +H +H [H ,xRH [H ,xRH +H +H [H ,xRH +%H +H +KH +EI ,xR I +qI +kI ["I [?I +CI +QI [[I [tI +xI +I [I [I +I +I [I +I +I ]I \J ,RJ +J +J \2J [W `W +QW +MW `W `W ,S X +pX +lX `*X a^7X ^LX ^X OnX ^X _X X NX -_X O_X Y Y t_*Y `?Y QY aY `rY Y `OY )DY ,7Y +Y +Y )Y +=Y +3Y )Y +Y +vY )+Y +Y +Y )Z +=Z +1 Z )Z +Z +| Z )+Z +/Z +4Z )v?Z +/CZ +#HZ )4VZ )acZ vlZ )3yZ Z )aZ )eZ )aZ wZ )3Z Z )aZ @wZ )3Z  [ )a[ w"[ )3/[ >[ )aK[ )e^[ )ak[ wt[ )3[ [ )a[ x[ )3[ [  [  [ +h[ +f[ \ ,7\ +\ +x\ +"\ +'\ ,70\ +4\ +=\ G\ d\ +h\ +q\ {\ \ +\ +\ \ \ +\ +\ \ \ +)\ +'] 9 ] ,7] +?] +9'] 91] ,7>] +bB] +\K] =U] ,7a] +e] +n] =x] ,7] +] +] +] +] =] ,7] +] +] + ] +] +F] +@] ,7] +i] +c] =] =^ +^ +!^ +%^ +.^ =8^ =P^ +T^ +]^ +a^ +j^ =t^ =^ +^ +^ +^ +^ =^ +^ +^ ^ O _ _ 2_ +6_ +@_ J_ ,8[_ +__ +h_ +Gl_ +Aq_ ,8z_ +f~_ +b_ _ _ +}_ +{_ _ _ +_ +_ _  ` +` +` #` <` +@` +M` W` ,38d` +h` +q` {` ,38` +` +` ` ,D8` +` +` ` ,D8` +` +` +1` +-` ` ,D8` +La +H a +ga +ca +a +~"a ,D8+a +/a +8a Ba ^a +ba +ka +oa +xa a a +a +a +a +a a a +a +a +a +a b + b +b 10b @Ub _b ,U8pb +3tb +1}b +Jb +Fb b xb xb +`b +^b xb Pb xb xc +oc +mc x5c 0@c Mc ec zc c ;c c >xc c X;c cxd d ;d x4d Gd 8+Xd xmd d <d xd  yd d ;d )bue )n e )$Y3e )o @e )Me )ȁZe )7ge ) e )+e ,Qe +e +|e )ne +e +e )$Ye +fe +Be +2 e + e + e + e )o  f +  f + f )f + "f + 'f )ȁ3f +j 7f +^ q )$Ydq )o qq )q )4q q )aq  q )3q hq )hgq PFq +q +r )$Y r +ar +M r +$r +4r +8r +=r )o Ir +iMr +WRr )^r +br +lr ,Nr ,Nr +r +r +.r +,r {Gr Fr +?r +;s +V s +Ts %G/s )5s PVWs +m[s +c`s )nls +ps +us );s +s +s )ds +s +s ) Fs +s +s kVs Vs Vs )s U t +=t +3t )n!t +p%t +f*t );5t +9t +>t )dIt +Mt +Rt ) F]t +at +ft U}t Vt $Vt )9t `t + t +t )@t +Bt +:t )E`t +st +kt )tu +u + u )Hu +u + u ,()u )M4u +8u +=u )eHu +NLu +HQu ):\u +v`u +peu )pu +tu +yu )u +u +u u )`:u )Hu )yju ) yu )u )ju  v "v +&v +/v +3v + ,KK +H%O +<%X +%\ +%e ^:o ,)K +% +% ^: ,)K +% +% +#& +& ^: ,)K +I& +C& +o& +i& +& +& ,)K +& +& ^: ^:4 +&8 +&A +&E +&N ^:X ^:q +'u +'~ +' +' ^: ^: +!' +' +2' +0'Ȁ ^:݀ +C' +?' >  > ,@K +b' +^'$ >? ~:I ~:f +{'j +y's +'w +'| : : ,PK +' +'Ł +'Ɂ +'΁ ,PKׁ +(ہ +( +D( +<( : $>& q>> >a :k : +v( +t( +( +( : :΂ ;߂   R; R;- +(1 +(; r;E ,lKV +(Z +(c +(g +(l ,lKu +(y +( +) +) ; ,K +') +!) ;̃ +D)Ѓ +B)܃ ; ,K +U) +Q) +s) +o) ; ;, <6 <S +)W +)` +)d +)m +)q +)z +)~ +) = 3= ,K +) +)ʄ +)΄ +)ׄ +*ۄ +) ,K +* +* Y= ,K +<* +:* +Y*" +Q*+ +*/ +*4 ,K= +*A +*J +*N +*W u=a u=} +* +* l= ? ,K +* +*ƅ +*ʅ +*Ӆ ++ׅ ++܅ ,K +!+ ++ ? )> )>7 +0+; +.+D +B+H +@+M 6>n >x > +S+ +Q+ +e+ +c+ >Ȇ 8 8 9 ' E4  H 9` 9z K:  E Z:߇ : +;" c;< ;\ F<q  E c< =Ȉ  `E   = $ 0E1  ; W>a > :?  D g?Չ  D ? N -- ,A 0}K y` -t , 0}  - ,ϊ 0}ي χ - , 0} 5 -I ,] 0}g %x - , 0} )@Ƌ )dԋ )ދ ,j4 +~+ +t+ ) ++ ++ );m ++! ++& )=r6 )PF )H` +E,d +?,i )/y )4 { )a z )3  ӌ )Wތ +q, +g, )O +, +,  " +,& +,/ +-3 +-< F _ +-c +-l +)-p +'-u  )a  { )3 ʍ )a׍ `{ )3   " +;-& +9-/ +O-3 +M-< +_-@ +]-J T q +u-u +s-~ +- +- +E, +?,    h* tB n { sw - , { w֏ - , { w -+ ,? {J )Ge )dr )о ) ` ) ,N, +- +- )d +- +-Ґ +(.֐ +".ې ) #( ) +X. +T. );m )H% )g0 +t.4 +n.9 )3D +.H +.M )nX +.\ +.h q )4{ Pv )u )a )e )aɑ  vґ )3ߑ   ,d, +7/ +5/  ,v,1 +F/5 +D/? ?I ,,Z +W/^ +S/g +z/k +v/t +/x +/} ,, +/ +/ +/ +/ g ,, +0 +/Ȓ Pݒ +#0 +!0 | | +20 +00! +D0% +B0* C M ,,^ +S0b +Q0k +l0o +h0x +0| +0 ,, +0 +0 +0 +0  ʓ +0Γ +0ԓ  U U +0 +0" +0& +0/ +03 +0< + 1@ +1J d_ !w  ” -mӔ   , Pv ) ,+# +!1' +1, )d7 +]1; +S1K +1O +1T )a )l +1p +1u );m )H )t +1 +1 )D + 2 +1 )nȕ +^2̕ +R2ؕ @ )4 u )u )a )e, )a9 uB )3O ] g ,+x +2| +2 [ ,, +2 +2 +2 +2 +2 +2Ė ,,͖ +2і +2ږ +3ޖ +3 s s +&3 +$3 j1 ; X +53\ +33f p ,, +G3 +E3 +Y3 +W3 +h3 +f3 ,, +y3 +u3 +3 +3Ǘ ԗ ,*, +3 +3  +3 +3   ,:,/ +33 +3< +4@ +4E ] v _ _ +4 +4 +14 +/4 +@4 +>4Ę +O4Ș +M4Ҙ n  ;= J m[  o , u ) )d )uʙ ) )d )u )_ ,z'0 +f44 +\49 )nE +4I +4N )dZ +4^ +4c )Hs )P )  +5 +5 ) +U5 +Q5 ) +m5 +k5 )4ɚ zך )a  z )3  )a `z )3, 6 n   x,  ^Ǜ  ڛ , z ,^   ,0 z; )I )dV )c )p )" ) ) ) )aÜ )eҜ )aߜ )e )d& 01 )d +5 +|5$ )"/ +53 +5C +56G +16L )W +R6[ +J6` );k +{6o +u6t ) +6 +6 ) +6 +6 ) +6 +6 ) +6 +6ĝ )ϝ +"7ӝ +7؝ )4 y ,[G )W )O +\7 +V7 91$ ,[G1 +{75 +y7> +7B +7K 91U ,[Gb +7f +7o +7s +7| ,[G 91 91 +7 +7 +7Ğ +7ʞ `1 )a )e )a )e. )a; )eM 1W ,nGh +7l +7u ,nG~ +7 +7 1 1 +8 +7 1ڟ ++8ޟ +)8 1 1 ,G +=8 +;8&  20  2M +L8Q +J8[ B2e ,Gv +^8z +\8 B2 ,G +o8 +k8 +8 +8 G2 ,GΠ +8Ҡ +8۠ G2 ,G +8 +8 +8 +8 G2 ,G# +8' +80 +84 +8= +8A +8F ,GO +8S +8\ G2f G2 + 9 + 9 +9 +9 G2 G2 ++9 +)9ɡ +;9͡ +99֡ G2 G2 +J9 +H9 +[9 +Y9 G2( +l9, +h9= 2G 2` 2{ 2 ,G +9 +9 2 ,G +9 +9Ǣ +9ˢ +9Ԣ 2ޢ ,G +9 +9 2 ,G +9 +9 +9 +9( 22 ,G? +9C +9L + :P +:Y +:] +:b ,Gk +(:o +&:x 2 2 +7: +5: +G: +E: 2ã 2ܣ +V: +T: +f: +d: 2 2 +u: +s:& +:* +:3 2H +:L +:U X3r `2| ,G +: +: +: +: k2 2 m2 m2 +: +: 2 2< +:@ +:J 3T ,Ge +;i + ;r +(;v +$; +@; +<; ,G +Z; +T; +y; +s; 13 ,Gť +;ɥ +;ӥ "3 +; +; 3 ,H +; +; +;$ +;) 3B B3X 2p /2 |2 2 2Ѧ 3  (D y 3- E CR yd )=l  ) +; +; )" +:< + < +< +< )˧ +[=ϧ +W=ԧ )ߧ +v= +r= ) += += ) += += ) += +=+  9 )aF )eY )af )ey )a )e * * +=è +=̨ A +&> +"> = p p/ +?>3 +=>= G ,?X +Y>\ +O>e +>i +>n ,?w +>{ +>   +> +> © ک +>ީ +>   +> +>  9 +?= + ?J T , @a +%?e +?n x , @ +J? +B?  ,"@ +u? +o?  ,"@̪ +?Ъ +?٪ +?ݪ +?  ,"@ +? +? +@ +@ +-@ +'@ ,"@( +P@, +J@5 ? [ +o@_ +m@h +@l +}@u   +@ +@ +@ +@  ԫ +@ث +@ +@ +@  +@ +@ - R \ ,9@m +@q +@z  ,9@ +A + A +=A +7A  ,P@Ŭ +{Aɬ +uAҬ ܬ ,P@ +A +A +A +A  ,P@ +A +A' + B+ +B4 +3B8 +-B= ,P@F +VBJ +PBS ] z +uB~ +sB +B +B   +B +Bĭ +Bȭ +Bѭ ۭ  +B +B +B +B # +B' +B0 Q [ ,g@g +Bk +Bp   ,w@ +C +C  ,w@ʮ +Cή +C׮ +%Cۮ +#C  ,@ +=C +;C  ,@" +LC& +JC/ +[C3 +YC< F ,@S +kCW +iC` +{Cd +yCm +Cq +Cv ,@ +C +C   +C +C +Cį +Cͯ ׯ  +C +C +C +C  - +C1 +C: +C> +CG \ + D` +Di :  ,@  ư  +&D +$D   < <7 +5D; +3DE NO ,@` +ODd +EDm +Dq +Dv ,@ +D +D N N +D +D Nʱ N +D +D N N +D +D N( NA +EE + ER f\ ,@i +$Em +Ev f ,@ +IE +AE j ,@ +tE +nE jDz ,@Բ +Eز +E +E +E j ,@ +E +E +F +F +,F" +&F' ,@0 +OF4 +IF= jG jc +nFg +lFp +~Ft +|F} j j +F +F +F +F jó jܳ +F +F +F +F j +F +F 5 Z d ,@u +Fy +F  ,@ +G + G +N˾ + w/T )ӻ_ )dl )y )" ) p )d +R +R ) +'S +S )" )- +fS +bS ); +S +}S! ), +S0 +S5 )@ +SD +SI )T +SX +S^ )we s )a )e B B T ,k8 +T +T ,k8 +-T +'T T T* T4 TQ T[ Tx T T h ,8 +NT +HT h ,8 +qT +iT l ,8 +T +T l ,8& +T* +T3 +T7 +T@ lJ ,8V +UZ +Tc +$Ug +Up +HUt +BUy ,8 +iU +cU l l +U +U +U +U l l +U +U +U +U l l. +U2 +U; +U? +UH l] +Ua +Uj    ,8 +V +U  ,8 +#V +V +KV +EV  ,8 +V# +V, 6 ,8C +VG +VP +VT +V] g ,8t +Vx +V +W +W +)W +#W ,8 +HW +BW   +cW +aW +sW +qW   +W +W +W" +W+ 5 N +WR +W[ +W_ +Wh } +W +W   ,8 +W +W    +W +W / _ +t  H< Q )s pE +X +W )@ +7X +-X ) +lX +dX +X +X ) ( +X, +X< +X@ +XE ,iNJ );/U +XY +Xb El E +.Y +*Y +EY +CY +eY +aY +~Y +zY E E +Y +Y E E +Y +Y$ +Y( +Y2 F< FX +Y\ +Ye Fo F +Y +Y F  F  F +Z +Z E )61 )$Y> )@K )Y )|- )$Y )@ ) )N ) )B ) ); ) )" )a/ )e> )] )nj )1w ) )u )u )V )n ) )u )u) )`H )nU )t D )u )u )mg ) ) )a )e )@ ) )' )41 p? )aL @U )3b m )az )e )Ko )hc ) )u )u )LF )n$ )C DQ )u` )uo ) )$Y ) )u )u ) ) ) )4) p7 )aD M )3Z i )av  )3  )a @ )3  )a )e )# ) ) )4$ 2 )a? H )3U d )aq  z )3  )a ` )3  )a )e ) )n ) )" )_/ )o5= )aJ )eY )34t ) ) )_ )o5 )4  )a  )3 ( )a ` )3  $ )a1 : )3G R )a_ )en )z ) ) )F )a )e )u )u ) )n ), ): )aG )eV )?`  +Z +Z )n +HZ +@Z ) +Z +oZ )K  .  )u +Z +Z   )u +[ +[ f. )u9 +[= +[C X )uc +0[g +.[q {  +?[ +=[   +Q[ +O[   +c[ +a[  & +u[* +s[7 .A ,6N +[R +[[ .e ,6r +[v +[ 6 ,.6 +[ +[ 6 ,.6 +\ +\ +K\ +G\ 6 ,.6 +e\ +a\ +\ +{\ +\ +\ ,.6 +\ +\" 6, 6H +\L +\U +\Y +\b 6l 6 +\ +\ +] + ] 6 6 +] +] +-] ++] 6 +>] +:] Y 7 )Ab )$Yo )} )K  )u )u )u )u )v )hc ) ) )a" )e1 )s; ] +`]a +X]f )hcr +]v +]{ ) +] +] )K    )u + ^ +]  )u +O^ +M^ 6 )u +`^ +\^ P3 )u> +w^B +u^L V s +^w +^   +^ +^   +^ +^   +^ +^  ,>6) +^- +^6 @ ,>6M +^Q +^Z d ,Q6p +6_t +._}  ,Q6 +f_ +^_ +_ +_  ,Q6 +_ +_ +_ +_ +_ +_ ,Q6 +` + `  # +&`' +$`0 +6`4 +4`= G _ +E`c +C`l +U`p +S`y   +d` +b` +t` +r`  +` +` ) w )x- ): )G )4Q _ )al u )3 0 )a )e )j~ ) ) )4  )a  )3 8$ )a1 )eA )Y )nf )1s ) ) )a )e )w )n ) ) )a )e )L$ )1 )> )4H V )ac @l )3y @ )a )e )o ,M' +` +` ) +la +Ra )d +a +a ) +b +b )4 )a ) )36 pE )aR [ )3h hw )a  )3 ` )a ` )3 X )a  )3 P )a # )30 H: mO h r   8+   + \ + ]! 4 h+> (]S f 8+w O]   i]  ] + )G6 )n) )6 )D )aQ )e` )֠j  +[c +Sc )n +c +c ) +c +c )K    )u +d +c  )u +Jd +Hd# F8 )uC +[dG +WdM `b )um +rdq +pd{   +d +d   +d +d   +d +d  0 +d4 +dA K ,4X +d\ +de o ,4| +d +d  ,4 +1e +)e  ,4 +ae +Ye +e +e  ,4 +e +e +e +e +e +e ,4 + f# +f, 6 R +!fV +f_ +1fc +/fl v  +@f +>f +Pf +Nf   +_f +]f +of +mf  +f +|f 9' A )=L` )nm )1z ) ) )a )e ) 00 +f +f )n +g + g )1 +gg +Yg ) +g +g% ,#G. )u9 +h= +gC p0X )uc +Jhg +Hhm 0 )u +]h +Wh 0 )u +zh +xh B0 B0 +h +h B0 B0 +h +h( B02 B0J +hN +hW B0a B0z +h~ +h 0 ,3G +h +h 0 ,3G + i +i 0 ,GG +Oi +Ei 0 ,GG +i +}i +i +i' 01 ,GG= +iA +iJ +jN +iW +(j[ +j` ,GGi +\jm +Vjv 0 0 +wj +uj +j +j 0 0 +j +j +j +j 0 0 +j +j" +j& +j/ 0D +jH +jQ 0h  1 )X ); ) )u )u )u )u )}# )= )K )aX )eg )n6 ) ) ) ) )a )e )h# )> )+Y )f )$Ys ) ) ) )n )J ){ ) )4  )a ` )3  )a% . )3; F )aS \ )3i xt ),~ ,d' +j +j )n +4k +,k )n +lk +bk )P )H )  +k +k )4 0 )a ) )36 E )aR [ )3h r  r ]   , 0 ] 0," ,4 )hdF )nS )J` ){m )z )F. )] )= )1 )4 )+ )u )u )u0 )@E: ,CP +kT +kY )GYe +Sli +Gln )z +l~ +l )1 +l +l )N +zm +fm )4 ,C )u +m +m ,C )u +m +m ,C )u +$n + n # )W. +>n2 +8n7 )OB +inF +anO Y r +nv +n +n +n   +n +n +n +n  +n +n   +o +n +o# +o) M )aZ c )3p ~ . ,C +"o + o +1o +/o A . B )( ){ ) )W) )p8 )L )\ )l )| ) ) )  ) ) ) ) ) )+ )D )]! )v. )^@ ))M )^]Z )'l ){ ) ) ) ) ) ), )E )^ )w )U) )^]6 )9H )VW )EWf )]Wu )uW )W )W )W )W )W )X )D ) )^] ), )9 )F )4S )9e )St )7T )OT )gT )T )T )T )T )T ) )T )w )U/ ) V> )%VN )=V^ )UVn )mV~ )V )V ) )^] )Q )_R )wR )R )R )R/ )R? )RO )S[ )xi ){ )C )^] ) )nN )e ) )p )P )P )Q) )/Q8 )GQG )V )sQe )Qp )Q| ) )M )M )V )c )s )s )V )f )Y )Kj )+ ))F )ob )X~ ) )7 ) ) ) )j )  )j$ )1 )BwH ))Z ) q ))~ )J5 )) ) )J ); ) )i/ ); )hH )`$d )q )e ) )1 ) ). ) ){ )% )&A )W )]p ) )  ) )c ),= )  )s 0g ),= +Fo +>o )   +oo +go =g$ ,)5 +o9 +oB +oF +oK Ngh =g} ) ),= )  )D )G ) )G ) )G )E )w )4T )& )? ) L )e ) r )T )w )4T ) )I )G )w )4T )^ )w )4T4 )BlA ),=R )\ )f ) )) )o  ). )) ) )) Y +o  +o +p + p! +&p% +"p. +>p2 +:p; YE ,&V +UpZ +Spd ,&q +opu +ep Y +p +p Y ,& +p +p +p +p Y Y  + +p/ +p8 +p< +pF a +qe + qn +4qr +.q{ +Vq +Pq   +vq +rq +q +q +q +q +q +q   04 +q8 +qA 4Z +q^ +qd = P +#r +r T +Hr +Br ] ,( +mr +gr +r  +r +r +r& cB +rF +rO + sS +sa +se +sn cx c +3s +1s c  c +Ms +Is c +ks +is  c ,(' +zs+ +xs0 cA L c] /h  @ +s +s +s +s +t +t  ,) +?t +7t +gt +at ,) +t  +t # ; x/K c     0    / m  @/$ ~B f] +ta +tj +tn +t f f +t +t +u + u f f +u +u +-u ++u f  f$ + fS +]uW +Yu` f~ f p +u +wu +u +u +u +u  ,{) +v +u ,{)   5 3G \ t ~  f +%v +v f f +Ev +Av +]v +Yv f g g; gE g] +tva +rvj +vn +vw g ,(* +v +v +w +w +w +w +x +x +x +mx +y +x +y +vy +y +y +Vz  +Dz +z +z! uh. G +zK +zT ^ w +-{{ ++{ +>{ +<{ +>{ +<{ 5 5 +Q{ +M{ ,?* ` G #8 " : X rr    @ h p4 ! 9h&! Ph;! N! 0X! gh{! zh! h! h! +! 0! h! , " 0" h*" (4:" iK" 3u" p" +j{" +h{" +{{" +y{" " " +{" +{" +{" +{" " # +{# +{!# +{%# +{0# :# S# +{W# +{`# +{d# +{m# w# # +{# +{# +|# +|# #  i# +|# +|# +N|# +D|#  i$ ,O*$ +|$ +w|#$  i-$ ,O*:$ +|>$ +|G$ +|K$ +|T$  i^$ ,O*k$ +|o$ +|x$ +}|$ +|$ +}$ +}$ ,O*$ +F}$ +@}$  i$  i$ +a}$ +_}$ +q}$ +o}$  i$  i% +} % +~}% +}% +}"%  i,%  iE% +}I% +}R% +}V% +}_%  it% +}x% +}% ?i% 1i% `i% +}% +}% +A~% +7~% +u~% +q~% +~% +~& +~& +~& i& i6& +~:& +~D& iN& ,_*_& +~c& +~l& i& i& ,o*& +~& +~& i& ,*& +& +& i& i& i' j' ,*-' +1' +:' +$>' +"C' j\' )jf' )j' +3' +1' 9j' P' i' 2' i' 4' i( 4%( i=( )jJ( Rjd( j( +L( +@( +( +}( +( +( j( ,*( +( +( j( j( +( +) j) j#) ,*4) +8) +A) jK) ,*\) +`) +i) j~) j) j) j) ,*) +) +) j) 0) j) ,** +* + * +2 * +.%* j>* jS* 0c* j* j* k* +N* +F* k* ,[+* +y* +w* ,[+* ++ + + ++ ++ k#+ ,k+4+ +8+ +B+ kL+ ,{+]+ +ˀa+ +ɀj+ k+ k+ +݀+ +ۀ+ k+ k+ ++ ++ k+ k+ +, + , k, ,+!, + %, + ., k8, ,+E, +I, +R, +1V, +/[, k, k, k, +A, +?, k, k, Bl, Bl- +P- +N*- MlI- MlS- Mlq- \l- 0- al- al- +a- +]- ll- ll- +w. +u . ll. tl). ,+:. +>. +G. |lQ. ,+b. +f. +o. |l. l. |l. l. ,+. l. 0. l. l/ l'/ lE/ lO/ lg/ +k/ +t/ l~/ l/ +/ +/ +/ +/ l/ l/ ,+/ +ҁ/ +Ё/ +0 +߁0 l(0 l20 lO0 +S0 +\0 +`0 +e0 l0 il0 l0 l0 l0 00 l0 Bl1 ,.$1 +3(1 +%11 +|51 +p>1 +B1 +K1 U1 r1 +тv1 +ς1 1 ,'.1 +1 +1 +1 +1 1 ,7.1 +1 +1 ++1 +)1 +<1 +81 1 ,G. 2 +T2 +P2 +j2 +h&2 +{*2 +w/2 ,G.82 +<2 +A2 g2 ~2 2 ,W.2 +2 +2 +݃2 +ك2 ,2 2 m2 63 p3 po.3 +23 +;3 +0?3 +*H3 +RL3 +LU3 uo_3 ,/p3 +mt3 +k~3 o3 ,/3 +3 +}3 o3 ,/3 +3 +3 o3 ,/3 +3 +3 ,/3 +3 +3 o4 o"4 o?4 oI4 oa4 +ńe4 +Än4 +Ԅr4 +҄{4 o4 o4 ,/4 +4 +4 + 4 +4 o4 o4 o5 p*5 +(.5 +<5 F5 ,0W5 +Z[5 +Xd5 z5 5 5 +k5 +g5 +5 +5 5 ,05 +…5 +5 ,05 +5 +5 +#5 +5 6 ,06 +T6 +N&6 06 ,0<6 +{@6 +qN6 X6 ,0h6 +l6 +u6 6 ,06 +6 +ۆ6 +6 + 6 6 ,06 +66 +06 +\6 +V6 +6 +|6 ,06 +6 +6 7 ,07 +Ї7 +·7 +"7 +އ+7 57 ,0B7 +F7 +O7 +S7 +\7 f7 ,0s7 +w7 + 7 +7 +7 ,07 +07 +,7 7 7 ,17 +O7 +K7 7 8 8 +h#8 +f-8 78 T8 +zX8 +xa8 w8 8 +8 +8 8 ,18 +8 +8 8 8 +8 +8 9  9 +ʈ$9 +Ȉ-9 +ۈ19 +׈69 O9 Y9 v9 9 9 +9 +9 +9 +9 9 9 ,%19 +9 +9 : : ($: ,515: +!9: +B: +?F: +;K: 3i: : : n: ,E1: +W: +S: n: ,E1: +u: +k: r: ,U1; + ; +; r; ,U1,; +ɉ0; +É9; +=; +F; rP; ,U1]; +a; +j; +n; +w; +9{; +3; ,U1; +Y; +U; r; r; +o; +m; +; +}; r; r; +; +< + < +< r< r7< +;< +D< +H< +Q< rf< +ϊj< +ˊs< < < ,e1< +< +< < f< ,u1< +< += +x= +R= +1= + = +̌ = +Č)= +-= +6= + := + C= +#G= +P= +dT= +R]= +a= +j= +n= + w= = ,1= +p= +f= += += +Ԏ= +Ύ= += += +,= +$= ,1= +l= +\= = > +> +$> d.> dK> +ɏO> +Ǐ^> h> > +؏> +֏> (> ,1> +> +> +$> +> +[> +Q> +> +> +ɐ> +> +> +? ,1 ? +H ? +8? J ? J=? +A? +P? nZ? nw? +{? +? +? +? F? ,1? +ɑ? +ő? +? +ݑ? +? +? ? ,1? +!? +? +d? +X@ + @ +@ +ے@ +Ւ"@ +&@ +/@ +K3@ +?8@ ,2A@ +E@ +N@ X@ u@ +y@ +@ @ @ +@ + @  @ ,G2@ +@ +@ tA h8A 'A t:P ,%7KP +סOP +ӡXP +\P +aP ,%7jP +nP + wP +2{P +.P P ,:7P +RP +LP TP +qP +oP \P ,J7P +P +~P +P +Q dQ 3Q dLQ +PQ +YQ +]Q +fQ dpQ dQ +Q +Q +/Q +-Q dQ dQ +AQ +?Q +RQ +PQ dQ +hQ +bR d R d)R +-R +6R +:R +@R zcR mR ,\7~R +R +R +R +R +ϣR +ͣR ,\7R R R S +ߣS +ݣ"S +&S ++S JS BTS BqS +uS +~S +S +S +,S +(S PS ,l7S +BS +@S PS ,7S +QS +OS PS ,7S +`T +^T ,7T +qT +mT U2T `U U wU  U , V V x%V  8V ,LV [V 0 vV +ΤzV +¤V S V ,:V + V +V ,:V +1V ++V +OV +MV +tV +^V +V +إW +eW +aW +}W +yW +!W +*W S 4W , ;EW +IW +RW , ;[W +̦_W +ʦjW h tW h W +W +٦W  W +W +W { W  W  X +X +X  X ,;*X +2.X +(7X +p;X +j@X ,;IX +MX +VX  `X  }X +X +X  X  X +ħX +§X  X  X +֧X +ԧX  X   Y +Y +Y  &Y ,0;3Y +7Y +@Y  JY ,0;WY +#[Y +dY  nY ,G;zY +N~Y +HY  Y ,G;Y +qY +kY +Y +Y  Y ,G;Y +Y +Y +Y +ڨY +Y +Y ,G;Y +)Y +#Z  Z  -Z +H1Z +F:Z +X>Z +VGZ  QZ  iZ +gmZ +evZ +wzZ +uZ  Z  Z +Z +Z +Z +Z  Z +Z +Z  Z  $[  .[  K[ +éO[ +X[  b[  {[ +ҩ[ +Щ[ +[ +[  [  [ +[ +[  [  [ + [ + [ +[ +\   \  $\ +*(\ +(1\ +:5\ +8>\ +JB\ +HK\ +YO\ +WX\  b\  {\ +h\ +f\ +x\ +v\  \  \ +\ +\ +\ +\  \  \ +\ +] +] +]  $] +Ȫ(] +Ī:]  D] ,^;U] +Y] +b]  l] ,^;y] +}] +] +] +]  ] ,o;] +] +]  ] ,o;] +-] ++] +<] +:]  ] ,o;^ +L^ +J^ +\^ +Z^ +l ^ +j%^ ,o;.^ +{2^ +y;^  E^  b^ +f^ +o^ +s^ +|^  ^  ^ +^ +^ +^ +^  ^  ^ +ȫ^ +ƫ^ +٫^ +׫^   _ +_ +_  9_  C_ ,;P_  k_ , u_ , _ +_ +_ 7 _ A _ A _ +_ +_ S _ ,;` +0` +&` +k ` +e%` ,;.` +2` +;` S E` S b` +f` +o` S y` S ` +` +` S ` S ` +ά` +̬` S ` S ` +` +ެa g  a ,;a +a +%a g /a ,;l +NBl +LKl +^Ol +\Xl bl zl +m~l +kl +}l +{l l l +l +l +l +l l +l +l m 3m =m ,BNm +ɷRm +Ƿ[m +ط_m +ַhm rm m +m +m +m +m +m +m m m +m +m +#m +!m +2m +0m +Cn +?n ,n Cn Mn jn +Znn +Xwn +i{n +gn +xn +vn n n n +n +o + o +o !.o Eo ~Zo Bmo po ~o 0Bo po o hBo po !o ,B p +p +p !!p ,B.p +Ÿ2p +;p +?p +Hp !Rp ,Bbp +fp + op !yp ,Bp ++p +'p +Ep +Ap !p ,Bp +ap +]p +}p +yp +p +p ,Bp +p +p !p !q +˹q +ɹ$q +۹(q +ٹ1q !;q !Tq +Xq +aq +eq +nq !xq !q + q +q +q +q !q ++q +'q Jq |q ,Br +Hr +F r (r ,B5r +\9r +XBr +vFr +rOr +Sr +\r +`r +ir +ĺmr +vr ,Br hr ,Br +޺r +ںr +r +r +r +r +޺r +ںr +޺r +ںr +;r +7r r ,Cs +` s +Vs +s +s ,C*s +ڻ.s +л7s As ,*CRs +Vs + _s is ,*Cvs +2zs +,s s ,DCs +Us +Os s ,[Cs +xs +rs +s +s s ,rCs +s +s +s +t +  t +t ,Ct +0t +*&t 0t Lt +OPt +MYt +_]t +]ft pt t +nt +lt +~t +|t t t +t +t +t +t t +t +u u Au Ku ,C\u +ʽ`u +Ƚiu +ٽmu +׽vu u u +u +u +u +u +u +u u u +u +u +$u +"u +3v +1 v +Dv +@v :v Qv [v xv +[|v +Yv +mv +kv "v \v \v +|v +zv +v +v \v \w +w +w +#w +.w 8w Uw +Yw +bw +Ǿfw +žow yw w +־w +Ծw +w +w w w +w +w +w +w w x +x +x +!!x +,x ~6x ~Sx +0Wx +.`x +?dx +=rx +Nvx +Lx +^x +\x ~x x =x 8x hBx y \$y B7y My ^y 0Bqy |y y y  z z B~&z  9z ,Mz Wz j~lz  z ,z z ~z Az z  z ,{ { #{  6{ ,J{ T{  e{  x{ ,{ { +{ +p{ +l{ +{ +{ +{ +{ +̿{ +ƿ{ +{ +{ ,| +| +| , +7H KAR ,Kc +Kg +Ip +_t +[y PA &A  +B +K +O +Z lAd ,Lu +y + lA ,L + + +8 +4 uA ,L͊ +fъ +^ڊ uA ,L + + + + uA ,L" +& +/ +3 +< +$@ +E ,LN +NR +H[ uAe ,&Lv +iz +g +y +w uA ,&L + + + + uAˋ ,&L؋ +܋ + + + ,&L + + A# A- ,6L9 += +B A_ Ai ,FLz +~ +  +* +& ,FL +F +@ +g +a B Aٌ +݌ + B + + ,bL + +& +* +3 4B= ,bLJ +LN +JW +][ +[d 4Bn ,bL{ +o +m + +~ ,bL + + 4B 4Bҍ +֍ +ߍ + + 9B EB ,rL' ++ +4 EB> ,rLJ +N +W +[ +d EBn ,rLz +)~ +' +; +9 EB ,rL +K +I +] +[Ď EBΎ ,rLێ +mߎ +k + +} ,L + + + +! +% +. +2 +; +? +H Bb Bl B + + + + + + + + +! +Ə +1ʏ +/֏ j ,L +C +? +] +Y ,L +w +s! + ,L< +@ +I S ,L` +d +m w ,L + +  ,L + + + +   ,L + + + + 8 B _ +c +l +p +y +!} + ɑ ӑ  +1 +/ +C +A ͉# = ފb Šs F  ͉ ,L +R +P ܉Ғ 0 9 ,L +c +_ +} +y ,L +# +, X6 ,MG +K +T X^ ,Mk +o +x X ,"M + + X ,2M + + +Ó +ȓ ] ] ,BM +  +  + +# sC sM sj +,n +*w +>{ +< ~  Ɣ +Mʔ +KӔ +\ה +Z   +k +i +z +x S( SE +I +R +V +_ Si S + + + +  ĕ +ȕ +ѕ +Օ +ߕ  R  : ;R g x F  @˖ @  A A$ aBB Bh X}   ,  ŗ  ڗ ,     ,4 > ̈S Ai ~   ,  TĘ `Fܘ    , $ +5 FL  Cg +k +t +x +  +5 +/ +W +Q +t +p AC ,RMÙ +Ǚ +љ cCۙ ,bM + + + + hC IC5 ZCZ Cu +y + + + +  + +& +" C ,rMĚ +<Ț +:Қ Cܚ ,M +K +I +] +[ C C6 CY Ct +nx +j + + + +  D  DΛ +қ +ۛ +ߛ + + +  +, +( 8D ,M +B! +@+ ZD5 ,MF +QJ +OS +cW +a\ _Dw CD QD D͜ +tќ +p + + D + + D1 +5 +@ D[ +_ +o +s + D + + D +Ý +Ν  E +, +& +O +K +e +c .E7 +w; +sE MEZ +^ +i U + + + + + + + + Uƞ 0a + + +$ +  +? +; +Y +U +s +o" +& +O +S +X ap a aҟ `c c c# +' +2 fM +Q +Z +3^ +'g +xk +h~ f ,U + + + + +; +1 , V +jŠ +dΠ +Ҡ +۠ f ,-V + + f ,=V +# +, +0 +9 += +B ,=VK +O +X +\ +j ,MVw +{ + f + + f ,]Vš +3ɡ ++ҡ +c֡ +_ۡ g g f$ 2g= )< A )< G )18K )yQ )`nU )Ib &(h )m *"q *"u ,w ' )P )ٱ )*Ģ )Ң )jע ): ).B )T ) ) )`8 )|. ): )H )9M )[ )6'٣ )/bߣ )L0 )ߵ )? ) )i )( )4 )+@ )L )X )Ad )op );| )? )7x )! )% )M )$& )Nˤ )'פ ) ) )8 ) )' ) )ր2 )67 )wC ) O )[ )l )x ) )X ) ) )X ) )j̥ )إ )# )k )No ) )^ )v4 )^B )SN )[ )wYh )9s ) )2 ) )wY )%ݦ ) )wY ), )uD )FP )`] )Cbj )x ) )Cb ) )J )ͧ )ۧ )5 )  )k ) )! )wY/ )= )K )Y )wVg )=2u )` )= )  )v ))F )A˨ )٨ ) )x ) ) )E )- ); )?I )MW )Z.e ) )3> )& )~ )N )ͩ )-ܩ )P ) )= )ǣ( )?7 )/F )U )Hd )s )  )A+ ) )z ) )ͪ )f9ܪ )S ) )w )0 )' )Y6 )E ) T )Xc )Ar )/ )/ )pr ) )S )̫ )|۫ )_u )@Z )B )X )& )_ 5 )iFD )S )\b )q )i )CE )' )B ) )̬ ) )* )kF )T )#b )U} )2 )= ) ) )y/ )N3ڮ )d )u )  ) ! ) / )#c ) )  );n )ʯ )f֯ ) )A )i( )/4 )B )Q )OCw ) )b" )" )#ʰ )d )|d ) )# )2 )wY- )ԋ: )G )g )Bq )0~ ) ) )_,̱ )Q7ٱ )y_ )0 )& )d )# )Ѝ, ); )ZI )zW )e )rs ); )d ) )m ), ) Dz )ղ ) )v* )k  ) )t )X) )V7 )Np ) ) ) ? )~ )c )h:˳ )ڳ ) )m )  ) )c& )5 ) ]D )NS )b )q ) )"C )  ) )  )J˴ ),ڴ )Ѫ ), ) ) )JX% )w4 )C )rR )ba )p )M )x )C )d )/ )MMʵ )d )) )k` )^ )pe$ )a33 )B )$Q )` )p ) )aJ )D )mX )5 )ж )% ) )- ) ) )L0 )@ )wP )!` )p )- )a ) )T )\ʷ )}ٷ ) ) ) )# )]$ )3 )cB ) Q )@` )oo )3~ ) )7 )R ) )Nɸ )ظ )  )w ) )І )g2# )<2 )A )KP )` ) o )j~ )? ) )  )` )fɹ )ع )q )х )Q )HE" )X1 )Ѝ@ ) O )r^ )m ))?| )Z )z )E ) )=Ǻ )Cֺ )l ) ) ) )! )0 )? )N ) )pM )M\ ){Hk )%z )[ ) )ը ) )Dż )tԼ )5b )f )_i )9  )[h ). )= )AL )[ ))j )y ) ) )LB )ʥ )CmĽ )+ӽ )U )' )S )t )V ). )3= )L )[ )j )E y ) )x )> )V )ľ )Ӿ )w ) )i )h )2 ). )w= )L ) [ )j )y )o ) )K )J )IĿ ) Jӿ )u )D ) )% ) )N&- )< )"K )yZ )i ) )U )o ) )F )|6 ) ) )- )0 )dI )- )-< )K )0[ )3Xk )@x{ )F )r )N )CB )$ ) )Xu )3q ) A )O )xQ] )_k )1y ) ) )  )j ) ) )3 ) )g )n )Y# )dK )ڙX )k )ax )!O )r& ) ).S )  )u  ) ) )w$ )2 )@ )HdN )\ )'cj )xx ) )1 ) )} )@ )Z )^ )k )^2 )G )T ){ ) ) )p )T )d ) ) )W ) )B )w )% )32 )JP? )ǺL )ƜY )f )s )d )6$ )Q ) )e ) )a )E )i ) )' ) 4 ) A )EN )j[ )-j )(y )d ) )+ ) )o ) )+ )# )h )W ) )N )gU2 )>? )'gL )rY )hf ) )DA )d )Ġ ) ) )g )Kg ) ). )D< )pJ )X )f )}t ) )L# )7 ) )/ ) )t )1 )JP ) )N ) )* )P8 )wF )T )Fb )p )~ ),i ) )| )f )к ) )2 ) )d ) )0 )#< )H )t U ) d )q ) )ش ) )F )‘ )E ) )jS )  )- ) )= )}B ) )O )` )s )Z )  ) )F9 )qQ )~ W )] )c )-Zi )o )u )8M{ )oD )/ ); )p, ) )V )F )rk )q= )- ) ) ) )' ) )+ ) )% )r )ғ ) )v? )#" )/ )_H )lU )wp )Z} )$+ )Z ) ) )) )& )l )% )Y' )4 )̮A )@lw )_ ) ) ) )M )t, )'9 )F )_y )u ) )ܰ )Ma )o )Ef ) ) )q )1, ): )G )U )u )s )" )Q ) ) )9 )w )(t ) H ) )( )z6 )*D )3d )Ճr ) )s )K )6 )v ) )W )N )" )7" )w/ )C< )wYI )ҟ )!( ) )M )d )- )  )  )E )W )" )) ) )2" )pl/ )wYK )ҡW )8Dd )R*q )u ) ) )h )F ) )d )( )> )8 )"D )9V ),c )Cbp ) )h )# ) )- )o ) )Cb ) )1 )s8+ )G )s#S )%b_ )}l )ay ) )Z )d )m ) )  )% ) h )7 )b`J )ZZ )` )Yf )ml )r )Cy )߇~ )_; ) )+ )< )!/ ) )k )ޗ )m )L )w& )2 )_? )L )pf )t )BS )t ) )r ) ) )F ) )iv ) )#d )iv )' )\5 )C )Q )Q^ )ivl )n| ) )S )5  ) ){ )  )N )A ).n )\W )j )( )c5 )B )h\ )\i )yv ) )7U )g )] ) )  )d ) )A )_ )]" )75 )S )_ )l ) z ) )o )` )? ) )g )9: )> )# )/ )@ )yxL )_^ )k )@w )R9 ) ) ) ) )m )/! ) ) ) )/!, )9 )F )BPS )fT` )w ) )'l ) )  ) )D1 )h )V )% ) )! ):- )C )` ) )V ) )C )IK )Տ )c )% )d ) ) )% )$2 )2? )M )a ) m )w )P ) )Ѝ ) )u )= )BY ) ) ) )G )7U/ )= )>J )ڙX )ke )#r )7U )" ) )? )] )? )-  )& ) ) ) )2 ) )=+ )a8 )!E )4S )K` )3 m )ںz )s ) )R )_ )- ) )B )FM ) )d ){ )>H )f(U )c )o )>s| )f( ) )2 )f( )f! )f( )JP )  )' )2^3 )NA )7O )R] )JPl )զ} )0 ) )  ) )M ) )f( ). )A )7 )R ) )d )) )r7 )<E )Q0T )-b )rp ) ) )& ) )-8 ) )# )u )1 ) )x )~ )m* )C8 )-"F )!T )Wb )p )$~ ) ) )f& )0 ) ) ) )RD ) )p ) )%& )}4 )rB )!P )^ )jhl )a#z )G" ) )* ) )Kk )O ): )l ). ) )- )% )3 )nA )O )] )Wk )y ) ) ) )7 )C )} ) )O ) ) )-3$ )l2 )t@ )N )@\ )j )x )c ).A )y ) )% ); ) )% ) )*$ )l2 )d@ )P )` )p ) ) ) )7 ) ) ) ) )U )G )6A )nO )t^ )$m )y| )a )r )P )4 )xN )= ) )wY )! )0 )RT )4^ )m ){ ) ) ) )n )< ) ) )e ) )d )}f )# )I1 )? )` )9:m )az )JP )y )/ ) ) )P )U )+ )`& )?4 );[ )dbh )tu )T ) )~ ) )Z )! )2 )P )c ) ) )G )a )+ )8 )E )uR ) _ )l )d ); ) )C )u ) ); )6' )4 )XYA )AN )dg ){ )` ) ){ ) )X ) ) ) ) )X )u ) )S )(x# )>R0 )= )?J )W )d )dq )_~ )Pe )k ). )u )@ )p ); )z )K ): ) " )60 )+L )Z )(>h )7v )R ) )q ) )h )N )w ) )h ) )< ) ) , ): )WH )bV )d )r )8 ); )j )2 ) )S )m )$ )zM )" )T ) )`( )6 )}PJ )^X )Ahe )9:r )Y )u )C ))] ) )2 )k )r ) )N ) ) )#H* )8 )F )0MZ )Ld )q )\~ ) )L )JP ) )G ) )  ),4 )# )B )  ) )8, )@ )+Z )~Sd )n )V )B )G )+h )o )ʡ )X )S )` )? )s8 )'q! ). )g; )<H )U )b )t o )d} )A )ô )О ) )t )E )Nw ) )$ )$ )2 )m@ )Q/N )%\ )j )ۆx ) \ ) 2 )P ){ ) )\ ) )m )5 )A$ )C1 )E ) R )]0_ )Vl )y# )vt )g )l )dI ) )u )z )U )U ) ) )g )u# ))0 )= )J )W )4d )q )~ )lA )F) )É )C )O ) ) )t )G ) );( ), ){9 )S )` )m )^jz ); )O )XC )f )M ) )E )* )a )[" )qB/ )A< )ʍI )R.V )]c ) )j )" )$ )9 ) )- ) ) )q ) Y& )3 )@ )#M )= Z )9x )  )h1 )d )ű ) )] )Ih ) )JP )2" ). )V@ )M )Z )Ɉj )dp ) v )| )$ ) G ) )\ ); ) ) )R )M )5\ ) )F$ )9:1 )K )pX )f )s )n )pU )p )K ); )JP )F ) )@0 ) )] )% )2 )R? )ff )Ou )! )2 )d ) ) )d )) )( )) )\6 )JPD )Q )^ )r<k )x ) )R ) )u )' )V )JP ) )  )r<- ): ),^G )[Z )wg )_ ) ) ) ) )a )Н ) )JP ) )c.  ) )r<$ )1 )> )`K )wwX )S!e )hr )m )_ )R )Z ). )4 )R ) )= )N ),2 )ߣ? )YL )c )Ytp )Y ) )Y )J ) )) )>\ )! ) )0  )`- )}O; )@K )iQ )mW )F] ) d ).t )̒z )#% )2 ) ) )A )_ ) ) )' )AW )  )J, )": )G )T )ra )Kn )E{ ) )wY )3 )ʸ ) )^ )`  )` )# )JP0 )9:= )J )b`a )"n ){ )& )d )JP ) ) )\L ) ) )Ă ) ) )"/ )< )E.I );V )=c )#9p )I} )G )i )U ) )ѫ )? ) )9_ )D )oL  )Zq )K, )T )` )vv ) )^I )7 )ű ) ) ) )y )] )3 )@ )̤N )ӷ[ )u )+ )# )d )- ) )K ) )u ).@ )ͱW )Ke ) )ű ) )d )7 ) ). )|d )1 )#J )TX )hf )χt )E )>a )| )l ) );S )t )  )\ )=i )%N  )C@ )x 6 )WD )R )GJ` )bn ) ]| )I )0P ) ) )O; )\ )pu ); )@ ){  )Uj )' )6 )E )²T )4c )mwr )7 ){ )2 )  )ˀ )Ni )^ )5 )8 ) )l& )z5 )D )5S )Jb )wq )d ) ) ) )  )v )UA ) )P ) )  )% )^4 )C )K R )a )~p ) ) )O )OP ) )K )\ ) )% )dU )bc )# )] )  )J1 )ƌ ) )[ ) )=3 ) ) ) ):5 )e  ) )1 )E )/ )E( )T5 )`mB )O )\ )*<i )Ġv )3_ ) )g ) )D )N ) )  )N  )) )[5 ) A )lM )WY ) e )-| )o )?J )ۀ ) )n5 )  )Wi ) )O )9:. )?I )U )ya )n )P,{ )~ )m ); )\ ) ) ) ) )ű ) )D/ )`< )2J )hW )wYd )% )JP )9: )נ ) ) ) )*" )> )P`J )g )s ) )Y, )r ) )P )6 )P: )N ); )@ )# ) ) )w) )0= )QJ )p )  )2 )г )1 )F )¡ )m )Z ) ){ )%V  ) )- ); )XI )W )-e )hs )W )w )I )  ) )V )7d )1 )_ )J )E  )Q );L) )b7 )qE )S )^a )0o )la} ) ). ) ) )N ) )T ) ) )# )3 )I )xX )g )j$v ), ){ )ڳ )n ) )6 )^ )i )) ) )]  )}r- )@D: )G )T )'l )>{ ) ) ) )  ) )G )a )\ )µ )x ), )# )1 )? )M )Y#[ )i )w )f) ) )V ) )V3 )~ )! ) )7 )Ƿ! )! )G!! ).;0! )?! )N! )^! )m! )x|! )! )! )y+! )! )_! ),! )gk! )! )]" )" )!" )50" ) ?" )@N" )^]" )l" ){" )X" )" )*" )M" )H" )w" )" )[# )Q# )"# )S57# ),G# )pM# )>#$ )ܚ0$ )=$ ) J$ )%W$ )eD~$ )q*$ )r$ )$ )% )% )o(% )t6% )7D% )1Q% )+^% ),k% )}Dx% )d% )\% )+% )% )% )h% )% )`% )0& )=& )J& )W& )d& )~& )& )& )c& )JP& )`& )c& )IB' )MN' )^' )`Qd' ),Hj' )nq' ){' )' )N' )' )' )YR' )>' )c' )$' ),' )<' )( )`#( );0( )0G( )2T( ) {( )0,( )( )#( );( )(( ) ( )( ) ( )) )'wL) )+=Y) )2s) )x) )) )) )1) )) )) )x) )#) );* )(* )o4* )yB* )[* )in* )Qx* )H^* )* )y* )@w* )4* )f0* )* )* )^K* )_ + )d+ );$+ )h_V+ )4{+ )+ )JP+ )s+ )+ )\+ )4+ )f+ )c+ )5, )w[, ) , )#*, )E7, )/D, )hQ, )j^, )4ek, )O, ), )q/, )Jb, )p%, ), )%, )&u- )-- )? - )-- );- )@H- )7U- )Rb- )Wp- ) }- )]- )- )- )wY- )_- )- )4- ) ,. ). )6. )T@. )zMJ. )W. )e. )s. )[. ) . )P. )I/. ). ). )Ad. )/U. ). )3F/ )?R/ )?Hg/ )s/ )/ )/ )l/ )l/ )d/ )/ )/ )m 0 ).0 )$)0 ).v70 )E0 )S0 ) a0 )*o0 )}0 )?0 )0 )0 )0 )O0 )%0 )MF0 )KR0 )0 )Į 1 )&1 )Q51 )iD1 )mS1 )Fb1 )c1 )1 )N1 )1 )t1 )R1 )X1 )>1 )1 )2 )d2 )hP$2 )j?32 )B2 )GQ2 )8`2 )o2 )u2 )2 )+2 )p@2 ) 2 )72 )2 )3 )3 )"3 )13 )s@3 )ڡO3 )ڽ^3 )m3 )|3 )43 )3 )eD3 )3 )63 )Q%4 )Z4 )+4 )94 )G4 )9:T4 )a4 )8"n4 )j|4 )4 )4 )04 )%L4 )ib4 )e\4 )4 )5 )5 )M $5 )15 )dA5 )G5 )M5 )PS5 )M'Y5 )s_5 )o5 )'}5 )MS5 )e*5 )E5 )[5 )B5 )5 )v5 )6 )_6 ) .#6 )06 )=6 )DJ6 )BXc6 )p6 )b~6 )<6 )3 6 )@6 )6 )[6 )L6 )jc6 )[6 )W7 )]7 )7 ),7 )5:7 )^?H7 )4V7 ),Ge7 )l7 ){7 )7 )Q7 )׻7 )X7 )7 )?7 )&h8 )#8 )8 )G,8 )?98 )F8 )S8 )`8 )m8 )z8 )R8 )8 )?8 )l8 ) e8 )8 )8 )8 ):8 )XS8 )9g 9 )k9 )1%&9 )#49 )jB9 )P9 )Ed9 )ir9 )9 )9 )9 )9 )G9 )E9 )69 )3: )A: )fO: )7]: )Kk: )y: )P: )E: )c: )K: )g: ): )Z; )nh; )V`v; )A; )E; ); )r; )|h; )o; )b; ); )I; )< )< )j< )j,< ):< )qI< )W< )de< )gs< )1< )!< )< )%< )e< )< )i< )< )= )o= ) -= )=;= )¡I= )^ W= )e= )s= )ۏ= )h"= )= )D= )= )/= )s;= )= )= )> )> )> )a*> )O8> )7? )h;? )d+? )͎9? )QG? )? )1@? )^? )? )? ) @ )@ )%@ )i3@ )oA@ )JO@ )R]@ )1k@ )r9y@ )@ )f=@ )<@ )/.@ )s@ )@ )@ )@ )@ )A )<2A )OxA )*C )qC )!M~C )%C )PtC )sC )'C )6hC )LD )gD )E6D )+D )(5D )T?D )ND )\D )]=jD )xD )ΐD )e^D )4LD )#D )FD )CD )`YD )&GD )lD )XE )E ) E ).E )UI )fJ )J )LJ )(J )_5J )GBJ )9OJ )\J )iJ )vJ )|J )# J )bJ )fJ )0FJ )J )VJ )tJ ) K )KHK )3VK )>sK )̣L ) rL )dzL )Q,L )QrL )!XL )L )_gM ) N )IXN )rN )"N )dN )9:N )7N )N )"N )JPN )N )eN )űyO ):Q )eR )R )R )"R )( S )S )DS ) iS )THT )T )T )aT )U )]U )}!U ).U )CGU )TU )(cU )rU )lU )&U ){U )<U )gU )U )HU )IU ) V )V )$V )8V )aEV )+RV )_V )0lV )MyV )V )!EV )V )V ){V )V )(V )%V )V )W )tW )wYW ) )W ) 5W )AW )MW ){FZW )-gW )gtW )%yW )DaW )W )6W )0W )W )W )W )cW )X )cX )X )*X )9:7X )yDX )}QX )wX )X )dX )AX )tX )X )IX )Y )"Y ) Y ) F.Y )\ )21 \ )\ )\ )Q&\ )#3\ )@\ )mWM\ )tZ\ )g\ )9\ )\ )'\ )\ )A\ )5\ )\ )d] )] )" ] )ű.] )5<] )J] )<X] )f] )Wt] )Kg] )7^ )^ )ҟ^ )g3_ )@_ )M_ )Z_ )*!g_ )z_ )n_ )_ )_ ):K_ )iE_ )_ )5K` )ZY` )f` )s` ) ` )s` )b` )]` )` )}a )ʲa )a )6a )aa )d0b )=b )MJb )&mbb )|b )`b )zb )b )b )4b )c )Vc )I#c )s0c )n=c )`c )mc )*!c )Fc )N c )c )Qc )c )ҟc )gc )Wc )dd )Ġd )jpd )4d )d )d )d )d )d )f d )N e )Ee )s(e )"Fe )GTe )be )rPpe )~e )<$e )Ԭe )e )le )e )< f ))(f ),(4f )Af )uNf )[f )hf )uf )f )Lf )of )f )"f )of ) Cf )(g )g )#g )W-g )g )g )wg )g )dg ) g )}g )g )pJh )Ih )+h )8h )Eh )װRh )d`h )|h )h )Ah )h )zh )h )h )h )dh )L i )i )*!)i )}Ci )Qi )#mi )U{i )]i )oi )_i ) i )i )i )xi )e?i ) j )9Yj )+j )-:j )$1Ij )Xj )gj )evj )j )Tj ):j )j )j )Ѓj )oj )j ) k )أk ))k )~i8k )Gk )|CVk )kek )n^uk )Lk )k )k )4k )k )Zok )k )rk )c%l )l )6Nl )Q,l )p:l )Hl ),Vl )dl )`rl )l )Dl )l ) l )fl )Ml )Yl )l ))l )bl ) m )"m )(m )#6m )Dm )|m )Qm )km ) m )m )_m )xgm )qm )m )8m )?Cm )m )m )Uwm )JPm )\n )ZNn )p#n )n1n )@n )8Jn )LYn )4gn )vn )n )Qn )5n )n );n )4n )ѻn )n )n ) o )JPo )]'o )U5o ))MCo )eBSo )co )):so )ǘo ) o )m o )4o )o )Ro )o )Oo )o )p );p )Xp&p )A6p )>Fp ) Vp )fp )vp )Sp )kop )ƾp )Lp )$p )Qp ):p )Cp )Mp )m q )q ))q )!8q )1Gq )Vq )eq )-q )q )q )]q )JPq )Oq )fq )q )ߥq )br )$r )r )!,r )r9r )KFr )|YSr )^ `r )zr )yr )Ίr )Ar )r )r )wr )Os )ks ) s )b.s )ks )>xs )s )x )Dx )@Jx )HlQx )Xk_x )mx )3{x )fx )x )\x )G=x )x )x )x )0x )x )unx ) x )S x )y ) y )y ) y )"&y )-y )Y>y )ӧDy )w$Jy )<Qy )3_y )my )ײ{y )ky ) y )"y )Xy )Oy )%-y )8z )8 z )#z )?z )Lz )3Yz )dqz )~i{z )NUz )~4z )5&z )Zz )z )z ){z )z )) { ){ )>'{ )[@4{ )iA{ )dN{ )][{ )Oh{ )u{ )){ ){ ){ )>{ )b{ )'{ )z!{ )U{ ){ )^{ )| )| )N)| )B| )kgU| )b| )o| ) || )C~ )]~ )j~ )Gw~ )Ť~ )*!~ ) ~ )~ )}~ )~ )~ )~ )~ ) )) )(- )s; )ރI )ŤW ) e ),s )F ) ) ); ) )- )] ):E ) )c )[& )Q^2 )> )v2J )X )JP )W6 )0 )r )E )݀ )( )s )z )+ )# )u1 )? )GM )v[ )i )Gew )T )̜ ) ) )º ){ˁ )ف )K ). ) )! )/ )= )UK )9YY )g )u )9 ) )p_ ) )V )δӂ ) N ) )g )$J )Q# )v3 )|]C ) S )jc )_5s ) )q )qf ) ); )8˃ ).ۃ ) )  )ef )O6 )E )T )c )HHs )9 )" ) )Gj )4WÄ )ӄ )* )  ) )q )# )3 )sC )p6S )ɠc )As )M ) )tI ) )3Å )+Ӆ ) )% )R )S )`# )S3 )6C )?S )t>c )s )ȓ )p )J )x )+Æ )ӆ )* )29 )j )B )[ )- )?k< )"L )[ )@/k )M{ )m )h )$ )-Ƈ )և ) )) )| ) )( )7 )G )V )ze )t )u ) )PJ ) )\MΈ )F݈ )u ) ) )! )' )rH5 )nC )4Q )p_ )m )i{ ) )$ ).) )PW )أ )ω )U݉ ) ) )8: )D )"^ )l )z )k )' ) )Z )h )JPv ) ) )J )9^ )T )Qʋ )I؋ ) ) )~Œ )dҌ )^>، )>ތ ) )Q )E? ) ) )' )3G )f ) )l ) ) ) )* )7 )=| )i ) )7U ) )P )|ʏ )KG؏ )] ) ) )9 )E/ )5 )_; )A )HIX )Vf )_s )C ) )> )A )( )3ʐ )Gؐ ) ), ) ) )' )_: )DF )J\S )ta )/m )] )7 ) )BG )C% )Ñ ) ё )lߑ )D ), )R )d )% )3 )eB )toQ )` )o )1~ )\ ) )iϒ )e )' )JP )o. )o )w, )zj9 )F )ĠS )`k )1w ) ) )w )# )vΓ )Xۓ ) )Z  )0 )Ma0 )C> )RK )IY )g )*t )C )Z ) )ڸ )@Ȕ )-f֔ )` ) ) ) <# )0 )$= )oJ )A] )lm )xs )y )a )u ) )d )d ) )g/Ǖ )Zԕ ) ) ) ); ) )& )4 )HB )L#P )^ ) l )pz ) )Vm ) )/ )!? )9 Ζ )ܖ ) )s )_l ) )/& )0 )t> )*!L )͗Z ) h )| ) ) ) )n )d )xΗ )Hܗ )nG )  )R )1 )m3" )/0 )> )L ) Z )wh )v )| )A )H ) )BT )ʘ )-ؘ ) )JV )K )> ) ), ): )eH )#V )d )= r )S ); )g )" )Y )ƙ )hԙ )_ ) )! )*!/ )= ) [ )e )}7s ) ) )1 ) )ٌ )-#ǚ )z8՚ )t )} )Q )1 )+ )) )7 )E )TS )Fa )az )Z ): )͋ ) )ě )ޛ )Ku )t ) )g )}m2 )n)? )L )Y )$f )+&s ) ) )2  )C ) )AΜ )l )/ )X ) )0 ) ^: )FD )TN )in\ )]Bj )Y$x ) ) )y )B- )S̝ )JP )u )/k ) )S( )6 )*D )R )+Y` )In )| )t )d )o ) )ž )VО )ޞ )M )=. )2 )k )B. )w4 )7?: )2 )y ) )H )Ʀ ) )q' )3 )zC )ŃI )#O )r_ )NYk ) ) )\ ) )Cѡ )t ) )A. )u< )ڙJ )dWX )f )dt )Q ) )o )P )Ȣ )=ע )# )F )}a )1 )V" )1 )@ )O )^ )m )| )  )\ )*! )ڽ )ǣ )Xܣ )A ) ); )}) )JP )g, )A@ )ɵN )O\ ):j )d4y )w ). )!I )O )N= )Ӥ )ujg )s ) )V ) ) )c ) )v )-* ) V )' ).ʦ )Ц )֦ )ܦ )J ) )9 )SZ )3 ) )H ) )GW6 )D )m+R )_ )l )qy ) )  )x ) ) )Kǧ )ԧ ) )a )k ) )8 ). )H )U )xb )o )#| )1 ) )( ) ) )uʨ ) ) ) ) ) )a* )j8 )sF )|T )b )p )7!~ ) m )( ) ) )kɩ )ة )T )U )@ ) )n# )2 )aA )u` )Po )R~ ) ) )U ) )ɪ )ت )  ) )pi )] )7c# )2 )>A )P )D$_ )=n )z} )E )I )& ) )ȫ )׫ )? )T& )  )[ ) " )v?1 )@ )jO )%^ )m )| )k )q ) )^ )Ǭ )w֬ ) )q ) )x ) ),* )8 )RG )RV )A#e )t )K )-0 )E ) )8 )Э )[7߭ )- )  ) ) )/* )U9 ) H )-gW ) #g )HDv )Z ) ) )s ) )ʮ )Qخ ) ) ) ) )! )\, ): )1H )sV )` e )t )X ) )_ )K )9 )doί )~ݯ )f ) )! ),a )c( )ce7 )F )1U )yd )/s ) )-[ )H )* ) )#ΰ )Lް )J )' )P )! ). )> )'N )^ )%sn )~ ) )mT )Q )q )>Uɱ )Nر ) ) )% )^# )Q>3 )_C )VR );a )Sp ) ) )o- )q )ز )7 ) )4L )w$ )4 )VD )T )%c )ir ),a ) )1 )A ) )%ҳ )Iܳ )\V )Ԝ )h ) )A ):> )`O )( )5n5 )C )@S )UGY )_ )<f )t ) ) ) )d )fô ),д )Yݴ )r ) ) )}  )V )(+ )8 )eR )_ )l )QIy )u )R ) )d )A )Rʵ )ص ) )B ): )i7" )b) ) 7 )ID )Q )^ ))Fk )x ) )H )L# )z ) )Lƶ )QEӶ )? )s ) )] )J )! ). )H; )I )W )oe )s )F ) )` )s )  )]Ƿ )cշ )o )` )O )\9 ),a )!. )ce= )L )1[ )/j )y )-[ )H )c )D )Ÿ )ո )@ )n ) ) )'% )Q4 )dC )xR )/P )la ) g )rcm )Vs )iy )b )-m ) ) ) ) ) )q )û )ɻ )ϻ )$ջ )9ۻ ) ). ) )O ) )E ) )k] ) )T8 )R )_ )tl ):y )q ) )gq )} )" )Ǽ )\HԼ ) )o )w )Y4 ) )# )~31 )+A )GG )HM )S )lY )(_ )e )4k )Mq )w )M} )`[ ) ) )v )k )Z )# )Aý )Qн )uݽ )Z )v )Ť )# )7l1 )@<? )WM )d[ )i )3w ) X )T< ) )' )Q )̾ ) )7l ) ) )1- )a: ))$G )/T )@a ) n ){ ) ) )Ŀ )t ) )R )a ) )9' )45 )I )οV )3c )dq )H~ )w( )' ) )H )  )& ) )]] ) ) ) )^ )\ )f ) )wZ( )U5 )pB )O )\ )&i )lv ) )S ) )X ) ) )@  ) ) )O )P ) ) ) ) ) )t )TK )%R )I ) ) )t )TK )l% )4 )A )O )t] )TKk )ly )j )f ) )c )t )TK )l )Y: )f ) )Qd )b! )t/ )TK= )G K )Y )ag )v ) )[ )t )TK )l )Y ):v ) ) ) )Ȇ ) )4% )2 )Fc? )L )8Y )־f )|u ) )ƙ ) )b )3 )  )  ) )G  )Yl )f )&  )O+* )ɛ9 )vJF )#Db )p )S ~ ) )~ )֑ )T )v )r ) ) 9 )Z )# )w0 )Dn> )z L )[ )h )pw )z  ) )f )p ) )3 ) )J ) )T )Ts ) ), )9 )tH )\W )fe )pt )7 )Rg ) ). ) ' )q )H  )< ) )f ) '- )q; )qvI )\PW )pf )qs ) )i )[ )b )3 )qv )\P ) )G  )Yl )f )p )O+) )ɛ7 )F )SfS )H[a )o )$8} )e )E )ڒ )Q ): ) ) ) ) ) )) )7 )E )T )=a )ԛo )} ) ) )\ )Ĺ )5C ) )f ); ) ) ) )% )f3 )pA )YO )L] )k )y )U ) ) )> )  )f )p ) ) ) ) )5! )60 )*M )f[ )pj ) w )3 )h )f )p )^ ) ) ) ) ) 0 )f# )p2 ),? )z5L )}KY )4g )u ) 0 )u ) ) )f )p ) ) ) ) )r ) ), ); )sI )W )/e )=t )C ) ) )  )i )m )p )Q )b ); ))7 ) )f- )p< )cI )X )f )Ȭt ). )}K )f ) )E )Ķ )y1 ) ) )c" ){0 )q> ),L )eZ )Yi )pv )$Q ) )f )" )p ) ) ) )e )y1 ) )- )?; ){I )lW )ff )rs )BQ ) )l )ς )e )" )" ) )D] )[ ) )* )8 )F )hT )fb )pp )" ) ) )[T )q )f ) )r ){ )c )kx )u& )4 )LNB )P )9^ )l ){ )a )p ) )S )h )* )q ) )\n )s )u )9$ ) 2 )@ )hN )\ ) 0k ) y ) ) )p0 ) ) ) ) ) )0 )f )q )u! )p/ )= )K )[TY ){g )u )f )c ) ) )9 )4 ) )f )D ).r )(o ) )\+ )9 )\F )hS )pC` )3m )z )[ ) )G  )Yl )f )p )* ) ) )% )e )\% )h2 )b? )3L )Y )[f )s )G  )Yl )f )p )/ )O+ )ɛ ) ) ) ),O ) )f )pC* )37 )sD )zQ )^ )G k )Ylx ) ) ) )* )e )|X ) )^ )Vb ) ) ) )" )}G0 )> )fL )bZ )3h )sv )z ) )G  )Yl ) ) )O+ )ɛ )K2 )W )s )pC )3) )B6 )fC )P )G ] )Ylj )pw ) ) )] ) )e ){l )K )3 ) )Q+ )8 )AE )rR )}e ).r )l )T )p ) ): )d ) )  ) )^ )Y" )Va/ )d< ).JZ ) g )O+t )Y ) ) )d )S ) ) )V )f )p ) )̖) )27 )E )S )!a ) ) ) )f )p )# ) ) ) ) )* ) )( )!6 )A7D )nR ) ` )n )| )2< )r ) )/ )0 ) )u )G ) )d) )xR7 )<K )Y )g )Zu )u )Q ) )P )qq ) ) ) )+ ) )+* )c8 )XFF )T )?b )tp ):~ ) )@ )\ )d ) ) )' ) )Z )2d ) )+9 )G )+U )\c )cq )XF )C )qq ) )t )@ )& )x ) )׍ )\ ) )_- )+; )qI )VW )e )Kt ) ) ) )& )i )R )L ) ) )0 )4 )%# )Q1 )7l? )L[ )90i )w )A ) )f ) ) ) )? )R )u ) )P )qq ). )c< )J )f )"t ) )#S )@ )C ) )E ) )B, ); )lm ) ) )c, ): )KH )#V )~e )- )b )g ) ) )T ) )o( ) )p' )NA )P )#_ )0n )} ). ) )]_ ) ) ) ) ) ) ) )" )1 )g@ )O )^ )gm )3| ) )k )n ),j )7 ): ) )  ). )( )lM! )0 )d? )`N )j] )m )} )%[ )7 )B ) )A )q ) )^ )8 )? )# );2 )<A )P ) _ )$n )} )c )0 )fY )e )( )a ) ) ) ) ):" )A1 )?@ )[O )wu^ )Lm )Ò| )8 )N ): ) )+ )`t ) )% ) ) )! )0 )? )aN )] )Wl )Ϲ{ )z )s  ) )p )L ) )  )Ir )u )*` )w )F/ ) > )NM ).2\ );k )\z )V ) )K ).l )q ))_ ) ) )8 ) ) )M. )= )L )ѩ[ )j ) y )ہ )R )T ) ) )< )  )5 ) )Ư )' )- ) < )K )GZ )Fi )x )}W )= )u )j )n )f )?: )wE ) ) ): )6, )S8; )߷J ):Y )?h ) w )3 ){ )# )_ ) )v )] ) ) ) )  )x+ ): )[I )/X )g )v ) )+ ) ) )" )X ) )T ) )u )x@ )wpp ) ) )7 )9/ )vQ )Gr ) )]6 )T )v ) ) )Y )O )G  )Yl )0# )O+1 )ɛ? )M )H[ )i )Jw ) )e ):V ) )k )/ ) ) ). ) )" )'5 )W- )); )7I )pW )Ye )Bs ) )C )  )G  )Yl )dw )% ) ) )k )H ) )u, )G: )dI )8W )Me )Mas ) )m )J ): )>t )+ ) ) )XU )  )Ma )ߖ )  )XU )  )$ )k )"* )˨8 )F )ܨT )/b )@p ) ~ ) ) ) ) ) ) )XU )  )5 )ߖ )E( )Z' )P(6 )5D )XUR ) ` )$n )k| )" )E( )Z )P( )h )- ) )D )n )XU )  )5% )ߖ3 )"A )E(O )Z] )ek )P(y ); )) )X )[( )$6 )XU )  )$ )k# 6  ? )Qo ) )@ )v )6 ) 2 )M-X )Ny ) ): ) )q4 )U' )~b= )aXS )ye )$ ) ) ) ) )Yr )$- )%I )tR )B[ )d )m ) ): )R )@ )g )u )F! )GQ )$w )^ )) ) )5 )  )Y )x )s' )P= )gX )n ) )^ )S )0I ) )7p )Y+% )JA ) ] ) R} )f ) ) ) )3 )h )" ) )  )Q. ) bA )^ )df ,p| + + )4 + + ) ++ +  + + )Y  +! + )s) +v +p + + )K +  + ) + +$ )4 )9D )>O +-S +X ) dc +g +l )gw +{ + ) +@ +, ) + + )B  );  ݵ )^  ) U )*  )G" 1 )*> G )GT c )*p  y )G  ,q )xT + +   +N +L +_ +] +_ +] )* ` )G! 0 )*= F )GS b )*o x )G  )*  )G  )* ` )G  ,r )xT +r +n )Jf + +$ )q/ +3 +8 )fC +G +L )W +[ +a ,r )  ) ) ) )D* )?j , , + + + +  + +  + + ) +- + 6 + : +F rP ,p` +0d +.n x ,p +A += +] +W + + + + + +  , q +# +! +4 +0 +X +R +y +w 6 9Z Cd ,qt +x + + + + + + +  +A +; I ,Lq +o +m + +| + + + + ^! rC M ,\q] +a +j +&n +w +w{ +k + +  ,q + + + + +6 +4 +G +E   - +V1 +T6 ˸Y ĵc ,qs +gw +c + +} + + + + ͵ ,q + + + + + + +4 +2 ݵ  9 +E= +CF +VJ +TS +fW +d\   ,q + +s + + ,q + + +* +  +d +V + +  ,q +9  +7   , r. +Q2 +I;  E , rW +~[ +xd  n ,$r~ + +   ,$r + + + +   ,$r +  + +3 +- +Y +S ,$r +| +v     3 +7 +@ +D +M  W  p +t +} + +     + + + +   + + W   ,;r + +# %7 NA ,KrQ +'U +%^ +;b +7g S  ,[r +S +Q ,kr +i +c й + +   + +' ++ +0 > X x  ӷ ,{r + + ,r ط l #`   %) H `      / N zh ku   0c  1 b  U Xc  # 6 @ U ui s    0 f  e 8f  * = l ) ) ) ) )3 ) ,*o$ +( +- )B8 +< +L +P +U )*` +d +i )7y )s) )3 + +  +Z +P + + + + )d +M +9 ) + + ) +  + )B p* !8 )oE )S ,o\ )g +k +p )rV{ +M +? î ,o + + + + + + î ,o + + + + ˮ )*# , )G9 (H )*U ^ )Gk  z )*  )G  )* @ )G   ,Ao + + ,Ao  +  +   = +A +J c +5g +1m   ,Wo +N +L  ,jo +] +[ > ,zo +q +m + +  +  + ^- 7 ,oG +K +U g cq c + + h  ,o + + + + ,o +  +    ,o +%! +#* +5. +33 ,o< +Z@ +PK ۯU ,oe +Pi +Ln ,ow +p{ +n  ,o ,o + +}  ,o + + ,o + + % 70 \   ү )  Ȱ + ? bS p] 'r  b p X  b p  ! b$! pI! )tS! ,pi! +m! +r! )iC}! +! + ! +^! +\! )*! +! +m! )! +! +! )s)! )3! +q! +c! +! +" +B" + " )d" +" +)" +<-" +*2" )u=" +A" +F" )Q" +U" +Z" )e" +i" +n" )Bx" " i" )o" )" ,p" )" +k" +c" )rV" +" +" " ,p" +# + # + # +# + # + ## -# ,p:# +># +G# +,K# +*P# s# )*# # )G# `# )*# @# )G# X# )*# # )G# P $ )*$ $ )G,$ H6$ |K$ )V$ +DZ$ +<_$ )rVj$ +n$ +sw$ |$ |$ +$ +$ +$ +$ |$ |$ +$ +$ % )*% % )G*% @9% )*F% @O% )G\% 8k% )*x% % )G% 0% % ,p% +% +% ,p% + % + % % % +"& + & &"& +I&& +E,& "E& -O& ,.p\& +b`& +`l& kv& ,Ap& +q& +o& & ,Qp& +& +& +& +& +& +& ͳ& & ,cp' + ' +' &' 0' M' +Q' +[' z' ȱ' ,up' +' +' +' +' ,up' + ' +' ȱ' ,p' +9' +7' +I' +G' ,p' +' + ( |( ,p)( +b-( +`2( ,pB( |L( ,p\( +r`( +pj( ,pv( p( (  ( ) i:) qR) yj) ) ) ) +) )  * b* (* =* Q* be* o* * * b* * Q* * b* * + &+ b:+ D+ Y+ m+ b+ + + e+ )D+ ,n+ ++ ++ )Q+ +, +, +, +, )s)*, )Y :, )E, +I, +N, )Y, +7], +-b, )dm, +xq, +rv, )B, , )o, ), ,o, )xT, +, +, , , +, +, +, +- + - +- )*$- `-- )G:- pI- )*V- _- )Gl- h{- ,n- ,n- +- +- - - +- +- - +- +- . . ,n*. +$.. +":. D. ,nT. +3X. +1b. 2l. ,n|. +G. +C. +`. +\. +y. +u. . @. ,o. +. +. +. +. E. T/ T!/ +%/ +./ +2/ +7/ YT/ l/ +/ / / T/ 0 0 b/0 90 ʽJ0 xe\0 )f0 ,:l|0 +0 +0 +40 +0 )e0 +0 +0 )Y 0 +0 +0 )s)0 +>0 +:0 )n0 +]0 +Y0 )$60 +z0 +x1 + 1 +1 )K1 +1 +$1 )/1 +;31 +381 )C1 +|G1 +lL1 ) W1 +[1 +`1 )w%z1 +A~1 +91 )B1 `1 )C1 )*1 1 )G1 1 )*1  1 )G2 2 )*2 `%2 )G22 A2 )*N2 W2 )Gd2 n2 2 )xT2 +v2 +r2 2 2 +2 +2 +2 +2 +2 +2 ,gl2 )xT2 +2 +3 U3 U'3 ++3 +43 +83 +A3 +E3 +Q3 )*^3 g3 )Gt3 3 )*3  3 )G3 3 )*3 `3 )G3 3 )*3 3 )G 4 4 )*&4 /4 )G<4 K4 )*X4  a4 )Gn4 x|4 4 ,Ql4 +4 +4 +4 +4 +24 +,4 +S4 +Q4 ܢ4 |4 ,zl5 +g5 +c5 ,zl!5 +%5 +}.5 +25 +=5 ݣG5 ݣd5 +h5 +q5 ,lv5 5 l5 #`5 }5 ,l5 +5 +5 +5 +5 +5 +5 +15 +/5 6 -6 ;J6 Vb6 z6 6 У6 6 (6  7 7 0c17 `;7 8P7 bc7 `m7 T7 Xc7 `7 ~7 R7 b7 `7 8 8 c18 ݹF8 uY8 `c8 8 8 8 8 Q8 c8 ~8 d9  9 <9 )F9 @]9 )h9 +Fl9 +>|9 +v9 +l9 )9 +9 +9 )d9 +9 +9 +9 +9 )o9 )9 I9 ,l9 +4: +0: ,l: +J: +H: Z': ZD: +_H: +WQ: qj: +n: +t: m: x: ,l: +: +: x: x: +: +: : , m; +; +; ; , m,; +0; +9; C; ,mS; +W; +`; j; ,mw; +<{; +6; +[; +U; ; ,m; +}; +w; +; +; +; +; ,m; +; +; ; < + < +< + < + "< ,< E< +I< +R< +*V< +(_< i< < +9< +7< +J< +H< < +[< +W< < ԥ< ,0m< +x< +v< ٥ = = 3= +7= +@= +D= +I= ǥd= |= = )= = )= += += )L6= += += + = += )> +@ > +4  > )d> +q > +k (> + ,> + 6> )oC> )U> _> ,@mo> + s> + x> ,@m> + > + > /> /> + > + > F> + > + > B> M? ,Sm? +* ? +( %? M/? ML? +9 P? +7 Z? d? ,cmt? +Q x? +I ? ? ,cm? +x ? +r ? ? ,vm? + ? + ? ? ,vm? + ? + ? + ? + @  @ ,vm@ + @ + &@ + *@ + 3@ +; 7@ +5 <@ ,vmE@ +Z I@ +T R@ \@ y@ +u }@ +s @ + @ + @ @ @ + @ + @ + @ + @ @ @ + @ + A + A +  A "A + &A + /A ŦJA TA ,m`A + dA + iA }A A A + A + A + A + A A \A n B )B ,m)B +' -B + =B +t AB +Z FB )dQB + UB + ZB )s)jB )WzB )B +T B +R B )B +q B +a B )BB 0B )oB )B )*B B )GB  C )*C "C )G/C =C GC ,mWC + [C + `C ,miC + mC + vC C C +C + C 3C +.C +*C /C :C ,mC +GD +E D D ,m'D +V+D +T5D ?D ,mOD +jSD +f\D +`D +iD +mD +rD D ,D ,mD +D +D 1D էD էD +D +D ڧE #E ,n3E +7E +@E +TDE +JIE ,nVE +ZE +cE +gE +pE +tE +}E +:E +8E +eE +IE +E +E +7E ++E +E +yE +E +E +kE +YE >E ,+nF + F +F +F +"F +&F +/F +3F +8F [dF ,AnqF +2uF +*~F gF gF +iF +gF +zF +xF +zF +xF ,]nF +F +F F G + G +G +G +!G +%G +0G ҩ:G ,ynJG +NG +SG ,yn\G +`G +iG +/mG +'xG 3G 3G +WG +UG ,nG cG lG #`G G ,nH +iH +g H +H +}H +H +'H ++H +0H PH $jH LH lH H +H &H vI W bHW P`W uuW W bW  W W W hW )wW ,v X +X +X )v.X +.#X +$(X )73X +s7X +adX )koX +sX +xX )BX PX )*X `X )GX hX )*X X )GX `X )*Y  Y )GY X&Y )*3Y  a [a +&_a +%ha ra a +&a +&a a a +1&a +-&a +I&a +E&a a a  b +`&b +^&b +o&b +m&&b >b <Hb ,vXb +~&\b +|&eb +&ib +&nb Mb gb gb +&b +&b gb gb +&b +&b gb gc +&c +&$c +&(c +&-c oFc zPc zgc +&kc +&tc +'xc +'c ~c c ,/vc +'c +'c +:'c +8'c  c c ,rvd +O' d +I'd +s'd +q'd Cd Md ,v]d +'ad +'fd d d ,vd +'d +'d  d d d 0d h e Se -e @hGe ae ve ge 'e Ne e 0de ne hf f fs ps s +3s +3s +3s +3s s "s ,Bts +3s +3s +-4s +'4s +R4s +J4t +4 t +~4t ,Btt +4!t +4*t +4.t +47t +5;t +5Dt +15Ht +-5Qt +\5Ut +F5^t +5bt +5kt +5ot +5xt +86|t +,6t +6t +p6t +6t +6t +6t +6t +7t +7t t ,_tt +J7t +B7t +{7t +y7u +7u +7u +7u +7u 'Pu ,utcu vmu vu +7u +7u +7u +7u +7u +7u u u +7u +7u ,tu v lv #`!v +v ,t;v +7?v +7Hv +8Lv +8Uv +*8Yv +(8bv +98fv +78kv v ,tv +H8v +F8v ,tv +[8v +W8v +v8v +r8v +8v +8v +8v +8v 5v ,tw +8w +8w +8w +8w ,t#w +8'w +80w +84w +8=w + 9Aw + 9Fw =ew w +9w +9w w w ,tw +49w +09w x x )x +J9-x +H96x +Y9:x +W9Cx +Y9Gx +W9Px +j9Tx +h9]x +z9ax +x9jx +z9nx +x9ux x ,ux +9x +9x +9x +9x Jx ,ux +9x +9x +9x +9x ,1uy +9 y +9y +9y +9&y F;y FPy Fey Fzy Fy Fy Fy Fy Fy Fy Fz Y0z ROz _nz +9rz +9{z _z _z _z +:z +:z _z _{ _{ +(:#{ +&:,{ +7:0{ +5:9{ +7:={ +5:F{ +H:J{ +F:S{ +X:W{ +V:`{ +X:d{ +V:k{ m{ ,Mu{ +j:{ +f:{ +:{ +~:{ { ,`u{ +:{ +:{ +:{ +:{ ,pu{ +:| +:| +:| +:| 1| F| [| p| | | | | | | } !} E} d} +:h} +:q} } } ,u} +;} +:} } }  ~ +; ~ +;~ +';~ +%;#~ +';'~ +%;0~ +8;4~ +6;=~ +H;A~ +F;J~ +X;N~ +V;U~ {~ ,u~ +j;~ +f;~ +;~ +~;~ ~ ,u~ +;~ +;~ +;~ +;~ ,u~ +;~ +;~ +;~ +;  0 E Z o        / N +;R +;[ q   +< +; ܀   +< +< +'< +%< +'< +%<& +8<* +6<3 +H<7 +F<@ +X<D +V<K "m ~ g   Á    ]: a 0u = l Ђ J b    0c.  8 M Xc`  j N R b   0gك d u   hg0 A gR мl    ҄ # x ÿ g0 ѿJ p M   ΅ b  q  f' < S bg q   b  І f   # b7 A DV m b  y  χ b    2 I b] g v|  b  ƈ ݈ b  5 ' b; E aZ q b  k )͉ )Uډ )u ) ) )U& )v.3 )@ )wYM )a_ )r ) ) ) ) )uϊ )U܊ )v. )u ) ) )a" )5 )H )W )f ) ) )v. )u )B  )*ɋ ҋ )Gߋ  )b )' )v.4 )uA )BK U )*b k )Gx  )E ) )u )Ō )#Ҍ )B܌ 0 )* ` )G  )%3 )u@ )M )Z )Y g )s)t ) )Fq )K ) ) ) ΍ )w%ۍ ) )2 )j )B   )C* )*7 @ )GM `\ )*i  r )G X )* ` )G P )*͎ ֎ )G H )xT )*  )G( @7 )*D  M )GZ 8i )*v ` )G 0 )* Ï )GЏ (ߏ )S ) )9] ) )% )63 )C )N )xT[ )Jfh )qu )f ) )  ) ) )ː )D*ِ )?j )S ) )9] )) )6 )6D )؄T )_ )xTl )Jfy )q )f ) )  ) )͑ )ܑ )D* )?j )S ) )9]( ): )G )U ))e )Bp )xT} )Jf )q )f ) ) Ē )ђ )ޒ ) )D* )?j )S )( )9]5 )G )5T )Tb )[r )t} )xT )Jf )q )f ) ) ѓ )ޓ ) ) )D* )?j )*) 2 )G?  o ){  +n< +f< )K +< +< )bŔ +<ɔ +<Δ )qٔ +<ݔ +< )s) +< +< ,r )xT += += )Jf +c=" +_=' )q2 +=6 +|=; )fF +=J +=O )Z +=^ +=d ͺu )  ) ) ) )D*• )?jՕ ͺߕ ͺ += += += += += += +=# +=, +=0 +=9 +>= +>E d  ): , l +> +> ) +[> +O> )7lʖ +>Ζ +>Ӗ )e )s) )+ +> +> )3 +? +> )B% 3 )*@ `I )GV xe )*r { )G p )*  )G hė ,$lΗ )xTؗ +Q?ܗ +M? Ǡ Ǡ +n? +l? +? +}? +?$ +}?+ ^ k  b  J b˘ bۘ x  b 7 )H )D&` )} ) ) ) )d ) )oʙ )ܙ ) ) )o ) )3 )u? )L )qi )u ) )P )U )Ś )њ )Y  )B  )*# , )G9 H )*U  ^ )Gk z )* ` )G  )*  )G˛  ) ) ), )4: ))U )"b )o )} ) )" )Ĝ )֜ )" )d )p )" )d )- )? )"L )LZ )^e ) w )d ): ) )b #` )ҝ )ޝ ) )6 )& )Aq4 )\ )Aqw ) )JP )d )o ) )*Ξ )JPܞ )R ) ):87 )<4` ) )P )' )" ) )˟ )8؟ )n ) ) ) )$ )3 )G )W )g )3w )  )S )l )  )X )+Р )D )] )v ) ) )* )`9 )"F )S )8e )t )< )U )n ) ) )ѡ ) ) ) ) )M" ). )~1W )Pc )Jfp )~ ) ) ) ) )Еʢ )٢ ) ) ), )D ) )T- )U: )%H )cZ )]g )et )% ) )< )ks )"ȣ ) ڣ ) )2 ) )] )  )], ).8 )9sD )wYQ )&[ )s )2 )Y )9s )wY )& )̤ )] )9s )wY )` )9s( )wYA )kM )^ )&h )&r ) )" )# ) )"Х  +? +?   +?" +?+ +?/ +?4 M W n +?r +?{ +? +?   +@ +?Ȧ +'@̦ +!@զ +I@٦ +C@  9 ɸ A# ܸ8 FB S Nc ,lr +u@v +e@ +@ +@ +@ +@ +NA +DA +A +yA +A +A ,lͧ +Aѧ +Aۧ ܤ +е )ߵ ){ )C )_ )G% )I* ):9 )H )bW )f )du ):e )o )9 )* ) )϶ )?޶ ) )G ) )f ) ) ))e8 )G )`V )Qe )t )/ ) )W )P )0 )Mη )ݷ ) ) )K )@g' )8k4 )Jb )jv ) ) )p( )Ѹ ) )~ )` )c )  )M )+ )97 )=D )N\Q )^ )k )x )I )# )- )7]̹ )ڹ )r )~ )n )! ),- )g<9 )eF )S )ҧ` )~ ) ): ) )uȺ )5 )< ) ) ) " )/ )ђ< )I )wX )1g )# ) )5 )ؼ )_ ) ) )~Ի )5 )c ) )ڒ )a )H- )qt: )QG )vT ) )1L )# )μ )ܼ ) )  )t )v )|" )lP0 )/~> )FL )$|Z )gh )sv ), )A )k )̤ ) ))ʽ ) ؽ )N\ ) )Z )K )Ͳ )\, ): )H )V )d )r )v ). )`} ))t )h )i ), )z ) )% )# )7 ):RC )ZlP )Go] )k )x )Go ) )ɿ ) )y ) ),) )oD )( R )RG ) ) ),9 )H= )# )g ); ) ) ),* )Bj )y ) | )  ):t ) )6 ) ) ) ) )N> )d )J+q )s ), )# )q ) )bA )k )S: ) )Aq ), )(& )5 )FC )Q )_ )8m )~{ )# )  )z )6 )  ) ); ){3 ) )l )q )# )b1 )Zj )7y ) )I )x )] )D ), ) )$z ):) )y  )p )/ )Ai> )ZM )\ )5k )z )BN )^) )o )I )V )l6 ) )(6 )~ )̘ )d )f|. )= )L )6[ )j )By ) ) )r ) )>Y )q ) )l ) )r )[=- )< )-K )Z )j )z )U ),P )d ) )$ )B  ){ ) ) ) )X* ): )J )*Z )j )[y )n ) )_ )i )4y ) )  )> ); )͟ )=- )< )K ) KZ )}i )x )} )A ) ) )M ) ) ) )Н ) )=< ) , ); ) J )Z )Ƹi )xx )N ) ) )l )L ) ) ) )0 )P )Y+ )(: )QI )OX )$g )Jv )@g )E )@ ) )H ) )^ )? ) )P ) )S* )'9 )H )MW )pf )u )I )~ )v )Y )Z ) )> ) )< ) )  )@) )z8 )i~G )YV )Se )t )U )S ) )& )u )T )9o )Ct )v ){ )u )( )`7 )F )VU )2d )[s ) )D ).M )g ) { )= )a )0 )& )g )" )f( )'7 )F )jU )d )s )  ) )H )%c )y| )z ) ) ) ) )3 )v}( )\ 7 )F )5U )`d )s )8} )d )V )U )T )PU ) )XP ) ). )9 )Q/' )6 )+E )iT )c )^ )b ) ) )Q )@ )6 ) ) )# )T )' )76 )E );U )~de )Wu ) )l )Z )%M ) )k  )܂ )~ )a; )1I )n]W ).le )s ) ) )" )w )| )٩ )= ) )F )]| )x# )@ )M )Ʈ` )v )[ )u/ )` )!_ )j% )v ) )f ) )' )5 )~qC )Q )Np_ )m ){ )< )( )^ )q )N )  ) )x )W )~ )# ):/ )5 )`R; )PA )$G )ZM )]_S )Y )37_ )e )-k )_Mq )w )?} )%m )> ),g )1 ) )R )3 ) ) ) ){f )z )" )Y )O )y9! )AE' )5- )3 )b9 )S~? )GyE )GK ) 7Q )W )] ) c )F#i )o )u ){ )X )> )u ) )vJ )+ )Q )l )z ).y ) )_4& )g ) )8 ) D ).a )y ) )m ) ) )y )Ml| ) ) ) )s )ԏ ) ) ) )'$ )2 )߯@ )m_ )O}n )s} )~ ) )| ); )-& ) ) )z )! )/ )= )K )tg )Cw ) )ˁ )|S )  )6 ) )3 ) )} ) )+ )gW9 )ôG )U )j )yw )ڒ ) ) ).y )MO )e ) ) 1# )٩- ); )#H )wU ) b )o )ђ} )%} ) )"2 ) ) ))z )e )V )O )W3 )O )_ )qe )uk ){ )8  )# )1 )~ ){ )+ ) )]6 )Go ), )\v9 ),L )<c ),p )}} )Ƭ )Go ) ) )B ) )E, )o )g )n )R )F_ )#l )y ) ) )7 )Lu ) )l )f ) )e ) )# )O ) )E+ )a9 )C )0GP )8^ )k )J ) )}{ )XX ) )þ ) l ) )~ )j )5_! )q. )); )EI )|W ) d )q ) ) )| )Rq ) )l )h ) )< )R ) ) )" )_) )(7 )E )R )_ )ڒl )yy ){ )ec )w ) )p ) )\v ) )= )# )pa6 )2C )ÈP )<] )j )# ) )1~ )2 )w )A )Ʈ )p )ſ )  )& )}3 )m@ )&N )`[ )uh )qDu )~ ) )̩ )  ) )k ) )K )C$ )9 )F )| ] )םj )/w )) ) ) )|  )) ) )|  )F\ )0` ) )$ )y1 )ڃH )(#U )l ).;y )u ) ) )  )' ) ) )  )q$ )1 )A> )M )VZ )qf )/p~ )- )x )\y ) ) )- )< ) )By ) ) ),]$ )1 )(? )L )HY ) Hf )oes ) ) )  )R )pa ) ) ) )Y ), )pa )- ): )pG )jT )Jb )o )| )9 )u ) ); ) )(H )n )* ) )  )u ) )8 )F )^T ) la )G7o )} )L )7Y )х )# )~ )H )X1 )" ) )ɀ )X1* )%6 )<C )X1Q )*f )X1s )N\ )+ ) )]j )M )A ) )N\ ) )|# )) )/ )A5 )3< )J )X1X )D8f )y )A ) ) )r )o )= )%F ): )Ɋ )v )z )ȧ. )< )J )fBX )f )c,t )h )W ) ) )S )V{ )RO )+ )* )} ) )- )|, )P: )i/H ):V )%d )Qr ) )O )! )~ ) )N ) )( )  )} )u )3, )/+( )@6 )+D )S ) yb )[p )D )h )( )s )6 )l )Z )| ) )\ ) d ) )4#' )'5 )sC )"AQ )b!_ )4ym );{ )c ) ); )'= )W )B} ) )C  )l ) )Ɉ, )LR ) a )|p )~ )F ) ) )a )3 )h )# )ۺ )? )R )Y% )70 )@ )BP )` )ȫo ) )` )H )eS )@ )k ){ )ԉ )= )n6 )OD )\R )z` )qZp ) ) )e )^ ) )v^ ) )' )6 )~) ) 7 )E )RS )Ga )o )z} )r ) )# )s ) ):U )9 ) )qD )n )N\' )_A )N )[ )wv )\ )a )C )zm )N )~ )ho )O )h" );/ )l< )I )JV ))c )<p ) } )q ) )j )& )m ) )  ) )J ) ) )r8 )~E )Y ):Os )J ) ) )ô ) )e )y )# ) )l% ))/ )9 )C )YM )[ )h )u )U ) ) ) ) _ )? )^ ) )$ ) ) )# )Wk )r- )x< )8I )V )Kc ){q )F )q )  )D ) )@ ) )" )H )A )$ )"2 )@ )N )\ )Mj )x )Н );u )v )  ) ) ) )6 )p )# ) )G )E. )< )<J )X )^f )$zt )- )kY )% )% )Y )E )| )\ )j )mu )qD ) )i2 )< )aiF )vT )<b )Jv )} ) )Y ) ) )S ) ) )Y )Z ) )h ):+ )W8 )N\E )ڱR )R_ ) l ) )> ), )L ) ) ) ) ){ )q_ )V )"- )M7 )USQ )Wu[ )'e )Ns )d ) )l )J )B )~ ) )5u )9G )8 ) ) )# )y+ )9 )U )m c )uq ),Q )- ) )- )B ) )  )8 ). )k  ) )Nh& );4 )\P )~k ) y )!i ) ){ )? )y )b! ) ) )2: )S  )K, )) )L3 )Az= )TG )k Q )d )}r )a ) )f ) )t ) ) )# ) ) ) ) )6- )YL; )W2I )W )[Oy )[ ) ) )q )R ) )41 ) ) )  ) )t% )Lx2 )F? )[i )Nu ) )Y )l )' )3 ) )g )SM )1~ )" )7 ) )^M )Ӹ\ )Oj )E ) c )N\ )ؖ ) )F )p )Wj )5h ) ): )!G )E Z )h )u )n ) ) )N\ ) )8 ) )F ) ) )? ) )* )Έ+ ){8 )5lE )^R )#` )`8n )A"| )^ )[  ) ): )  ) )e ) )* )eA )N )ee )kq )} ) )lh )* ) ): )  )v[ )ݎ )S  )h )8 )| )s8. )v4 ) .: )<@ )G )$T )ya )n )| ) )0 )Jc ) )U )+ )$ ) )8 )UV( )+5 )B )e] )=u ) ) ) ) ) ) )N\ )qD ) )l )+( )5 ) O )#\ )N\i )av ) )X ) ) )| ) ) ) ) )7 )F ) )\C* )7 )5D )vQ )$a^ )k )x )H ) )k )3| )4X )~ )PW )( )| )0 )< )TX )Bk )ð )- ) )P )0 )i ) )4 )T ) )/ )C< ),I )#V )]p )} )h  ) ) ):8 )˰ )PW )(V )ðc )F{ )# )B ) ):8 )q ) ), )` )6v  ). )Q< )0J )PX )v )ZG )` )>v )Ʀ ) )vC ) )< )  )r}- )cG< )a )!s )r ) ) ): ) )? ) )К )i )w ) )Q" )0 )> )L )qZ )hZh )w )^ )~ )g ) ) )Ǻ )N\ )c )d] )! )D/ )W= )V )d ) )_E )< ) ) ) ) )k  ) )& )X4 )B )#P )0^ )yl )z )! )  ) ) )Ă )m ) )H )~ )6 )O )] )._k )# ) )ߢ )v )Z )GK ) ) )' )   )U )o( )Ai6 )=TD )4\R )` )n )tE| )h ) )+ ) ) )Cx )s ) )  ) )  ){, ); )ZJ )<Y ),)h )zw )v )j )? )  )" )z ) ) % )>  )IU )+ )#: )I )X )g )v )r )BL ) )#\ )D )L) )" ) )Λ )L ) )%* )9 )H )t} )S\ ) )dV )@h )̾ ) )#! )n! ),G! )<V! )g! )4;m! )s! )W&y! )ȇ! )h! )7=! )! )~! )@! )5?! )(! )! ):! )D! )! )EQ! )! )1{! )ˮ " )צ" )EF#" )0" )k=" )J" )tX" )_{" )O" )Z" )X" )!" )Z" )X" )&h" )!" )z# )N# ) # )y71# )}># )UK# )zX# )D&p# )i?# ) # )v# )# )[# )qD# );# )K $ )&$ )#$ )50$ )ޏ=$ ){J$ )*EW$ )6iq$ )$ ) $ )$ )`$ )ð$ )$ ) P$ )$ )$ )u % )e% )j.:% )N\G% )qD]% )8o% )"% )k% )|% )% )% )l% ) & ) (& )"4& )5A& )bO& )u\& )\i& )@v& )D& )yZ& )& )& )& )[& )|& )& )&& )]& )%' )(4' )o<B' )P' )i;^' )ORl' )Fz' ){' )f' )' )' )=b' )' )Z' )(' ) ' ) ( )6( )u(( )6( )D( )UR( )`( )d n( )b|( )mq( );( )( )aU( )P( )I]( )W( )o( )K( )Ú) )j) )>$) )m2) )A) )8P) )sh) )w) )Z) )) )`) )) )) )) )) )&* )/* )* )P--* ) <* )a* ) o* )|* )&* )@* )j* )&* )2* )* )* )* )O* )* ) + )#+ ) I2+ )*@+ ) N+ )@\+ )j+ )x+ )S+ )n+ )+ )O+ )+ )~+ )p+ )O+ )/+ ), )+,, )c , )²., )w2<, )HJ, )X, ){f, )P=t, )., )D*, ), )", ), ), )S, )SE, ), )- )- ) $- )u3- )VB- )Q- )4`- )vo- )Rk~- )- )6 )K6 )"X6 )e6 )>r6 );:6 )}6 )s6 )V6 )6 )r6 )~6 )k 7 )>27 )N@7 )N\Z7 )*zg7 )t7 ))7 )7 )7 )^7 )Ҥ7 )g7 )7 )r,7 )R"7 )>97 )u8 )H8 )jr"8 )a8 )>n8 )$9{8 )No8 )V.8 )8 ).8 )8 ) 78 )P8 )<8 )8 )!K8 )A 9 )9 ) d'9 )49 )YB9 )O9 )\9 )eo9 )Wk|9 )U9 )>9 )-59 )9 )"9 )`9 )kY: ): ): )"*: ),h7: )>D: )Q: )8`: )|: ): )wq: )ha: )}: )6 : )J ; )S; )o*; )?; )K; )X; )z; )#; ); ); )t{; )'8; )-; )Ń; ); )ġ < ) < )&< )E4< )B< )`P< )^< )l< )[z< ).< )Q< ),^< )\< )< )< )V< )< )$z = )uR= )6= )yE= )ZT= )Ic= )B}r= )^= )*= )I= ) = )= )~= )l\= )jJ= )= ) > ) C> )&> )_C> )UR> )a> )tKp> )> )A> )> ) > )> )i> )<> )> )n? )? ) $? )3? )>B? )!(\? )O}? )? )@? )7.? )9? )? )? )) ? )qD @ )@ ) +%@ )yx3@ )z|@ )N @ )]:@ )W@ )o@ )h@ )@ )> @ )@ )d@ )@ )&@ )n&@ )A )] A )0A )sA ) %A )03A )@_?A )j3LA )=YA );hfA )MA )A )<A )"A )KA )7A )ûA )d%A ) B )dB )g&B )&p4B )GBB )4PB )KdB )rB )gB )XB )pB )B )B )iB )B )B )=B )^JB )= C )RC )K>C )3JC )ZC )`C )fC ) emC )C )C )RuC ),C )rC )C )JC ) 'C ) D ).D )$#D )0D )=D )dKD )IXD )eD )?rrD )D )D )D );D )K_D )tD )`yD ).D ),D )rxD )E )FE )U(E )η6E )MDE )RE )l`E )'nE )8Q|E )E )E )E ) tF )AF )YW!F )/F )K=F )vQKF )YF )WgF )uuF )F )G )G )l,G )L:G )jHG )yVG )&dG )urG )NG )!G )mG )TG )9 G )G )TG )xG )G )G ) H )#H ) )H )7H )"EH )ӁSH ).aH )s}H )" H )1H )H )H )[}H )H ))H )FH ) I )gI ))I )w7I )P+EI )%TI )ObI )pI )8~I )EI )LI )͖I )N&I )I )~I )mI )[I )0AJ )EJ )#J )NJ )0J )VK )5KcK )kqK )UK )K )K )K )K )wK )8K )L )^L );"L )C0L )'>L )GLL ) GZL )7hL )vL )L ) L )L )$L )L )=FL )fSM )N )7(O )Y5O )MO )ZO )sO )0O )buO )O )O )Y@O )tO )1O )`O )bP );yP )G!P )&/P )P=P )jKP )WYP )~gP )RuP )ߊP )eP )RP )?P )dP )}P )}P )P )aP )DQ )Q )Q ){+Q ){9Q )GQ )2UQ )nQ )^xQ )rQ )#Q )\Q )Q )fQ )rQ )N\Q )fQ )hR )R )R ).y-R );R )wIR )>KWR )49eR )~R )^R )!~R )WR )tR )R )R )R )wS )uS )*S )c8S )FS )TS )giS )|xS )S ) S )S )S )S )wS )zS )buT )T )T )*T )D8T )>FT )BTT )bT )pT )~T )*T )T )0ST )cT )E;T )9T )-T )bT )eT )G U )ߘU )&U )4U )>WU )GfU )JU )hU )wU )U )U )fEU )sgU )\U )U )U )~V )IV )"V )/V )tXVV );ScV )pV )F}V )V ) V )iV )(V )RV )tV )QV )V ),bV )W )*W )vWiW )=wW )kIW )W#X )z1X ) ?X )]MX )v]X )ldX )X )HlY )7Z )yZ )VZ )Z )Z )qDZ )Z )Z )Z )N\Z )}[ )r[ )ð[ )] )r^ )^ )m^ )+_ )0,_ )2_ )8_ )v_ )S` )` )a )na )(a )È5a )4yBa )pOa )Mha )ua ) a )a )aza )x$a )"a )a )Xta )Ab )'b )Tb ) +b )8b )yEb ))Yb )nfb )4sb )xb )wb ):b )b )Pb )b )b )^b )5b ) ~b )~ c )hc )!c )T/c )e>c )Jc )oVc )Dbc )?nc )Q{c )6c )`tc )Dc )mc )]c )@c )c )c )c )c )pd )"d )S/d ) =d )ȗKd )qDXd )=ed )4yrd )d )kd )#d )1~d )vd )d%d )Te )k&e )3e )Ae )QOe )k]e )ke )ye )7qe )e )Ve )ve )e[e )`+e )|e )ge )Ae )tf )S/f )ߊ;f ) Hf )+Rf )Pkf )rxf )Vf )vf ) lf )f ):f )f )f )e[f )f )>g )h )I'h );-h )3h ):h )Gh ),Th )ah )cnh )!{h )h )Ch )h )h )h )1~h )F i )i )q%i ) 3i )Ai )ðOi )?]i )vki )ayi )|i )|i )ti )Aj )j )j )RtTk )pak )nk ){k ))k )ok )|k )k )k )Vk )Pk ))k )Ill )kfzl )l )4l )@l )]l )l )w m )m )_m )m )m )ôm )nm )#Qn )-^n )yYkn )zn )n )mn )n )nn )o )>o )i)o )b7o )HTDo )5Qo )K|^o )o )o ))o )CRo )o )߫o )]o ) o )p )Rt p )'dp )r'p )p )}p )~p )p )7p )Gp )q )q )q )ڒ-q )2;q )Iq )gq )Suq )q )v\q )q )"-q )q )q )zr )r )=z )v~Lz )Zz )|iz )+sz )Xz )=z )z )az )]z )z ) z )z )>z ){ )'{ )&{ )4{ )N\B{ )ÈP{ )a^{ )Yl{ )GM|{ ){ )aD{ ){ )){ ){ )>{ ){ )^{ )σ| )| )!| )e/| )C?| )}O| )K_| )Io| )| )| )|| )| )#}| )| )| )-| )0| )t } )} )'} ){5} )C} )!R} )Oa} );p} )3} )} )L!} )} )} )È} )N\} )} )}s~ )~ )|!~ )..~ )^;~ )H~ )U~ )Gb~ )o~ )e|~ )u~ )~ )=~ )~ )b~ )~ )Y ).y )[- )y; )I )oW )7$ )AI ) )s )| ) ) )ܰ )_ )! )p )-# )>0 )Ҥ= )XJ )@W ) d )Nq )~ )| )AÀ )Ѐ ) ) )5 )>G ) )h+ )}8 )!E )pR )-_ )>l )@y )  )| ) )R ) )* )%37 )D )!Q ) J^ )k )x ) )X  )) )I ), )9 )|F )_S ) J` ) ) ) )U ) ) )b )M )  ) )Rth )x=v )  )* )1 ) )D )J@ )VĄ )h˄ )&܄ ) )c )r )y )-y )| )= )*- )< ))iJ )GX )g );q ) )Y )` )9| )n) ) ) ) ){ )ą )ʅ )pх ) f ) )]- )F )d ) ) )~- )J )!^ )-dh )s| )6 )  )C ), ) )| )= )# )w )a. )i>< )B/F )Th )/x ).~ )= )Cz )  ) )̇ )_Kه )Jw ) ) )[ )| )2' )4 )BA )JIN )s[ )h )**u ) )% )U ) )r )Έ ) )t )p ) )! ) ) ) )7 )M) ))7 )F )T )4yb )p )~ ) ) ) ) )1ҋ ) )} )M ) )} )R& )4 )MC )Z#R )q )6 )i )P )jz )6pČ )x Ќ )|j܌ )y )W< ) )N\7 )`@D )~R )a\ )Qk ) )0 ) )f )4 )N͍ )Tۍ ) )kS )# ) )}r! )֋/ ) = )=K )Y )g ) u ) ) ) ) )ˎ )*َ )W ) a )fe ) )9 )^- )= )kM )|] )cm )0} )Y )J ) u )iU )L͏ )܈ݏ )i ) )x )Z? )- )>= )sK )IY )5g )u )7 )g )k )s )[ ) ) ) )S )Պ- )*= )M ),x] )=cm )u} )3 ) ) )M )͑ )ݑ ) )y@ )  )L )X- )= )TM )l] )m )4} )y ) )^ )_ )l͒ )`"ݒ ) )J ) I ) )k- )= )(VM )] )m )} )3 )kC )x ), )Zȓ )!ד )y )+ ) )8 )Y% ){4 )BuC )a )p ) )w )1 ) )Ĕ )?Ӕ )G ), )H )Y ) ){. )= )U[ )1j )MYy ) )q )= ) ))ŕ )ӕ )S )! )- )@ )  )>' )5 )|C )?2Q )Yc_ )|m ){ ) a )H ) )'C )q )ܹ )d )1& )y4 )/B )vP )| ) | )N\" )1 )> )UL )djZ ) h )]v ) U )  )  )qn )E~ )H )X )߷ )0 )EJ )4& ) )ę )R, )s9 )_ )z ) ) ) )x ֚ ) )( )5 )B )paO )\ )Ӣi )[v )R )j )g ) )C̜ )ٜ )G ) )c ) ) )P( )G2 )B )H )kN )T )iT[ )2h )= )˝ )͓ٝ )( )S )$ )1 ) )f' )b4 );A )N )[ )/h )Vzu ) )I  )O )F )Y )NÞ )О )ݞ )c ) ) \ )l ) )m ) ) ) )VŸ )^П )h!ߟ ) ) ) )V )9$ )3 )K@ )N )\ )Vj )9x )s )1 ) ) ) )V̠ )9ڠ )D )1 ) )q )p ). )V< )^J )X )-f )u )n )g ) )V )9 )ɡ )у֡ ) )y( ) ) )Y )>$ )1 )mp> )K )BX )e )t )n )' ) )N )8 )Ǣ )բ ) )^ )z )1 )O )ԗ) )7 )oE )8S )a )o )} )^ )z )1 ), )4ã )Ιң )Uߣ )O )2 )( )#& )b4 )dA )q N )\ )i )x ) ) ) ) )DCǤ )Tf֤ ) ) ) )DC# )qI2 )|@ )#N )j )w )| ) ) ) )} )ͥ )|ۥ )1 ); ) )Ӡ )y )- )< )f`I )8V ):c )mp )-?} )@ )I )߀ ) )кæ )Ц )ݦ ) ) )к ) )# )/2 )GA )1O );^ )Bk )y )v )o )8 )1 ) )ͧ )^ۧ )z ); ) )4 )Ι! )/ )O= )-wK )i ) )t )} )7 )/ )\ͨ )u )Q` )w )g )N# )81 )? )`\M )[ )^i )zw )1 ); )"w )O ) )˩ )%~٩ )&1 ){ ) )w )g )o. )8< )J )`\X )f )^t )z )1 ); )4 )Ι )ɪ )s֪ )g ) )]B )U )"Q )* )J{I )YV )3'e )s ) ) ) )# )O' )ȫ )׫ )G )k' ) ) i )1 );* )I )6~V )ٙd )r ) ) )a )~ )N )!Ƭ )1Ԭ ) )a ) ) ) )1( );6 )eD )-R )` )n )?| )O )Y )d ) )1­ );Э )ޭ )O )Y )c )? )@% )3B )1P );_ )l )A{ )~ )1 ); )L )® )OѮ )>ޮ ) )9 )1 );' )H54 )u?A )VN )\ )j )9y )  )ǽ ) )1 ); )ͯ )Oۯ )Y )c ) )m )! )V0 )+> )L )Z )sHi )$Ow ) )  ) )uw )a{ )Q̰ )ڰ ) )E ):A )z% )1" );1 )p> )M )[ )i )hw )V )1 )ı ) ) ) )~% )62 )d@ )M )dv[ )g )? ) )l )S )N )8ò )1в );ݲ ) )^ )z ) )Z )g+ )8 )OE )R )_ )l )y )  )Jr )o )} ) )|dz )J}Գ ) )\ )/% )D1 )? )SM )o[ )8i )1w ); ) )^ )z ) )+˴ )ٴ )4 )Ι )C> ) )ؚ )s- )Xm; )FI ),W )e ) s ) ) )S )S )N )8ǵ )1յ ) ); ) )^ )z )7 )OE )S )Yr )Os )r )S )o )8 )ƢŶ )Ӷ )1 ) )^ )z ); )' )45 )ΙC ){,Q )ؚ` ):dm )z ) )1 )N )8 ); )ȷ )շ )^ )z )O ) ) )xG$ )1 )1> )NK )8X );e )r ) )^ )z )O )\ )Fи )i1޸ ) )N )8 ); )$ )2 )^@ )zN )O\ )k )_7y )Y )c ) )¹ )Ϲ )*%ݹ )i1 ) )o )8 );# )1 )? )^M )z[ )Oi )Yw )4 )Ι )d )>1 ) )1˺ )ٺ )N )8 ); ) ) )^- )z; )OJ )oW )e )1s ) )o )8 ); ) )ǻ )^ջ )z )O )Y )4 )Ι )) )Y7 )D )dQ )N^ )8k ){x )g ) )^ )z )1 );Ƽ )3Լ ) )O )Z )%[ )$ )11 )N> )8K )SX )9e )r )^ )z ) )O )Y )o )vͽ )dڽ )Y )L )Zo )J )m )* )wz6 )9D )SQ )N^ )8k )Mx )1 ) )^ )z ); )ƾ )(Ծ ) ) )Jr )4z )1W )T" )S/ )o< )8I )MV )1c )p )^} )z ); ) )4 )Ι )˿ )Oٿ )j )E )E ); )l )O* )7 )4IE )L\ )1f )t )|R ) ):6 ) )\ ) )k ) )xh ){ )b9 )i, )~8 )[J )RT )).^ )n )| )Mz )P )W6 )^ )Hq ) ) ) ),} ) ){ );) )IM ) Z ):wz )s ) )N\ ) 8 )} ) )hx ) ) )zm )" ), )ı9 ).y_ ),l )8y )d ) )[ )( )m ) )] ) ) )#4 )b!, )g9 )F )` )s )s )zm ) )% )2F )m )- )c} )K ). ) )$ )b* )21 )> )#K )qX )ce )r )& )} )  )U )6E )| )k ) )G ), ) ) )(~% )&3 )'{A )TzO )l9] ) Jk )?y ) ) )ў ) z )| )9 ) )@ )) ) ) ) ' )ӄ4 )A )NO )]|] )#k )y )B )R ) ) )|; )g= )  ) ){ )7 ) )U! )O/ )j= )SK )Y )`g )u )( ) )bb ); )H ) ) ) )6s ), ) )( )'+ )E9 )TG )w+U )ec )#q )8 ) ) ){ )) ) )G )  )A )}, )}: ):H )V )#d )+r )B )B} )g )v] )! )ӵ )9 )ƒ )b )_ )UR )m% )ɏ/ )tH ) U )b )o ) )ς )B} ) ),u )N{ )2 )& )m )t- )"/ )2+ )(8 )_E )COR )_ )yy )h )̤ )d ) )  )Gj )uR )  )-| )?M )?-# )4(1 )? )L[ )6i )w )N\ )_ )y )C )^ ){ ) )ġ )Xe ) )X' )B}5 )#C )|Q )T_ );m ){ ) ) )7 )< )J )| )g )7J )< )$ ) ) )p )? )% ) )/ )} )S, )k ){e ) , )k8 )M )|Y )| )v )C )L )c ) )mc )m )# ) - )8H )|V )\d )@s )>H ), )Q )m ); )b ) )T ) )X )˥ )' )6 )IE ))T )c ) r )d )L )$ )) )2 )N\ )ht )y )V ) )/D )=$ )a5 )N8; )ZTA )[G )Gc )~ )cx ) ). )b4 )ͱ: )~y@ )F )L )R )23X )!b^ )h0e )7u ){ ) )g ) )4 )C )f )= ) )S ) )Pc ) )4 )6 ) )h$ )S1 )> )#K ){X )e )#Wr )ġ ) ) )7 ) )B ) ) ) ) )=# ),' );4 )A )1N )5[ )zh )Tu )! ) ) ) ) ) ) ) ) ) )4 ))) )z8 )1G )V ) e )(t ) )_ ) )K )/ )T )" )G ) )n )@) )8 )G )zV )e )>t ) ) ) )w )Qi )^p ){ )) ) )*- )H )e( )d#7 )@F )/U ) d )s ) ) )W/ ) )  )y )vJ ) )x ). ) )' )y6 )PE )T )c ) r )" )# ) ) )H )  )"5 )  ) ) ), )Z  ). )9> )PN )] )l )m{ )lA ) )  )$ ) )9 ) ) )wt )+ )O! )"g/ )F= )eK )Y )g )u )] ) ) ) ) ) ) ) )o; ) ) )E )6. )Ț= )"lL ) [ )1j ) }y ) )9 ) )* )m )p" )r )i )|; )B )  )#- )fg< )BK )Z ){i )+y )X )3V )F0 ) ))! ) )! ) )  ) )) )8 )7`G )]V )!e )wat )ڒ )  )i )K ),k )H )& )b )% )_ )=#; )J )6X )hf ) )i ) )W )$ ), )  ) )  )^w )m, ); );J )yY )=#h )J} ) )tb )$ ) ){ )L )H )Y[ ) )| ) )K )R )!" )F )H ), )9 )zT )5ra )sn )}6{ )? )W ) )# ) )b )Q ) )1s ) ) )rT$ )p1 )=> )K )#Y )yg )u ) )  )tM )& )zA ) ) ) ) )} )Q )# )0 )G= ),J )W )d )cXq )P~ ) } ) ) )i )U )  )P )T )3 )! )) )\ )UR, )C: )'H )V )d )ir ) )| )ll )I )C )m )* )r )i )|; )  )#$ )fg3 )BB )p"Q )@P` )p ) ) )| ) )! ) )] )[ ) )` )q ) )p ) )$ )%* )z0 )a< )[F )V )Y$\ )b )h )n )t )z ) ) ) ) ) )[ ) )B ) )qi ) )_ )4 ) )S )׾ )y )Ҍ )g )y )> )$ )Y* )g0 )6 )#< )]B )I )hV )c )Lp )r} )E ) g )4 )M ) )y )nF )c ) )  )$ )Xd2 )F@ )N )/\ )$j )=#y )e )y ) ) ) ) ) )y" )v/ )gB )O )] )`j )^~w ) )3{ )q )l )J ){ )k ) )m )q )sU7 )aD )4Q )^ )l )y )q ) )̜ ) )% )1 ); ) )E )  )O" )'0 )'> )Y] )k )y )1 ); ), ) )O )Y ) )> )c )m )  )RA! ){/ ))= )K )>Y )`Fg )u ) ) )f )f )E )& )  )d )# )mo" )0 )> )L )A@[ )i )w )f ) )aq )  ) ) ) ),I )Cp ) )V0 )W, )A: )H )ӎV )4d )"x ): ) )E ) ) )# )k^ )%G )e ) )f )E& )]4 ) B )P )~^ )el )z ) )4 ) )4 )Cp )Q ) )J ) )E! )/ ):= )hK )+rY )g ){ )0 ) )f )aq )  )4 ) )4 )h )Cp )Q" )O0 )~> )eL )Z ):h )Rv )̆ )W )/ )h ) ){ )# ) )} ) )$ ) 2 )F )T ) lb )Cp )~ )# ) )V ) ) ) ) )$ )y )W* )98 ) F )T )\b )tp ) )|~ ) ) )^ )E )  ) )~ )e )Cp ) )5 )-C )W )_h )An )Nu ) )mQ ) )5 )ȴ )={ ) )h$ )*q ) )V )1% )+3 )-YA )O )] )l )z )V )+ ) )y )o ) )n ) )_ ) )a1# )1 )60? )|M )\ )k )y )> )* ) )P ) ) )g ) ) )̯ ) )S. )p< )1J )8X )%f )Hgu )6 )m )k )(U )D )h )H ) )p )ہ ) )l) )8 )G )[V )F[e )\t )W )ڲ )Qy ) )ǎ ) ) )K ) )W )v1 )`( )D7 )F )ҬU )d )s )3 )K ),T ) )h )/ )fe )o )Ux )8 )  )' )N6 )E )GbT )c ) r )EZ ) ), )p: ) ) )% )k )+' )` )vz )\& )5 )D )S )-b )B(q )u ) ) )3 )T )H )$ )x| )x )A ) )% )4 ).8C )1R )]Ya )p )r )a )k )X )a )^g ) ) )ܝ )v  )5 )' )j6 )7BE )JT )c )Er )A )J  )) )- )_ )p )9 )e )Ur )1 ) )& )5 )D )S )b ) Lq )J )g ) ) )m )C )Z )t ) );4 ) )% )p.4 )C )R ){a )f(p ) )  )~ )1c ) )4 ) )7z )~ )} ) )s$ )3 )B )lQ )` )o )С~ ) Z ) < ) )h )# )  ) )y ) )bk )O# )2 )BA )P )_ )Yn )Ԁ} ) ) ) )H ){ )^ )_ ) )  ) )R" )1 )N@ )O )^ )m )| ) )ES ) )Ӷ )c )LH )` )) )e| )9 )wD! ) Q0 )t? )XN )$] )(l )B{ ) )E ) ) )= )% ) )Gk ))  )  )i  )/  )d>  )M  )>\  )ϳk  )Ϲz  )  )  )E  )  )  )J4  )  )G  ))  )e~  ))  )_7  )E  )Y  )  )~  )  )  )H  )Do  ){  ):  )F  )f@  )q   )  )   )[(  )$+  )9  )^G  )zU  )E:c  )4q  )Ι  )  )T  )Č  )  )ƀ  )s  )Rb  )ܪ  )iy  )K9  )G  )y'  )5  )C  )i+Q  )?_  )cm  )3{  )A  )E~  )e  )M  )t  )  ),  )^  )z  )r ). )% )n3 )xB )P )^^ )ml )6z ){ )[ )D )l )ڂy ) ) )k ) ) ) )9G ) )4y ) )| ):x! )1~/ )%$< )I )Y|V )!d )8 ) ) )Ʈ )] )Յ )H~ ) )މ" )Y|/ )7< )PI )#V )kSc )p )} )_ ))  ) ) )A )^ )Fv )/Z )x ). )H )V )ec ):p )} ) ) )3 )~ )B} )j  )4 )z' )5 ))oC )1Q )os_ ) m )+4 )X )B} )j )4 )z ) ))o  )1 )os% ) 3 )+4O )P )  )x )_ )m )Ǡ )% ) Q )wD ),/ )92 )N )9] )Vy )m )Ǡ )% ) Q )wD )v ) )9 ) )9 )i1 )? )mM )#[ )~i )Qw )9 )4a )4 )9 )6 ) )m#` )`' )07 )= )D )2Q@Z ))g p )} ) ) ) )ݵ )w` ) W@  )   )x-6 )Q>CL ):fYb )ox )e )+` )@ )  ) ) )A ) ) )1$ );2 )A )gNW )"dm )z )x )n )|` )p@ )C  ) N )J$ - )r: 2` i )v ) ) )lk )D@ )iN1   )* 0) )}6/? )/JLU )1bk )m )h )^* ) )? ) )D )W )o ) ): )2 )W )z )  )U+ ) G )_ )}h )p )$ )K )! )o )P )  )z3 )I )sg )p} ) )y )N )n )0n )YnB )jK )2g ) ) )n )- )v  )c  )3&  )>  )V  )r  )  )   )  )  )$! )@! )f! )! )K! )0! )9D! )<! )" )#R/" )QB" )C^" )Nz" )" )G" ) z" )" )" )" )|v# )ţ.# ){7# )?# )v]Q# )m# )o# ) # )2## )!{# +PH# +FH###$$$+$ )1$ T$ +HX$ +yHf$ +Hj$ +Hs$=}$ ,k$ +H$ +H$ +H$ +H$ +I$ +I$ +I$ +I$b$$ )G$ ,F$ )!{$ +/I% +'I% )M% )w#%@,% )y9%H% )wU%^% )yk%u% ,[~% )%#`%%`% %#`%%%%&&z*&:&K&zX&& )V& & +`I& +ZI& ) & +I& +I& +I& +I& )qD& +I& +I& )' +J' +I ' )S' +?J' +9J ' ) /' ,z8' )J'|T' ,ze' +^Ji' +XJn' ,zw' +|J{' +zJ''b'n'' )E'0( +J( +J( ) &( +J*( +J;( +J?( +JD( )P( +JT( +JY( )Se( +Ki( +Ks( )([(( )x(( +?K( +9K( ) ( +bK( +^K) +K) +yK ) )) +K) +K) ,z() )4) +K8) +K>)[) r)}) )5!)) +K) +K) ) ) +L) + L) +,L) +&L) )) +NL) +HL) )S) +|L* +tL * )*8*]C* )#M*p* +Lt* +Ly* ) * +L* +L* +L* +L* )* + M* +M* )S* +7M* +/M* )**! + )+`*+ )15+ +kM9+ +_M>+ ) I+ +MM+ +M^+ +Mb+ +Mg+ )qDr+ +Nv+ +N{+ )>+ +*N+ +N+ +}N+ +qN+ )S+ +N+ +N+ ) + +N+ +N+ )+ +5O+ +%O+ )&+ +nO, +lO, ){0, +}O, +{O!, )3,=, ,yN, +OR, +O\,f, ,zw, +O{, +O, ,z, +O, +O,E,,,--Z/-zG-_-w- - )$-- )1- +O- +O- ) - +O- +O- +P- + P- )>- +4P- +.P. +`P. +ZP. ).>.I. )>S.0j. )1u. +Py. +P~. ) . +P. +P. +P. +P. )>. +P. +P. +Q. +Q. ).V/ / )Z/./ )19/ +CQ=/ +;QB/ ) M/ +mQQ/ +iQb/ +Qf/ +Qk/ )qDv/ +Qz/ +Q/ )>/ +Q/ +Q/ +R/ + R/ )u~/ +^R/ +DR/ )#/ +R/ +R/ +S/ +R/ +S/ +{S/ ) 0 ,:0 )> #0 )Va/0 +S30 +S80I0 )cT0i0 )u0 +Sy0 +S~0 )b0 +T0 +S000 +tT0 +rT0 +T0 +T0 +T0 +T001 +T1 +T1 +T1 +T131 +T71 +T@1J1g1 +Tk1 +Tt1 + Ux1 + U~11 ,P1 )B`1 +#U1 +U1 )s1 +OU1 +GU1 )1 +U1 +{U1 )Y1 +U1 +U1 )2 +U 2 +U2 2 )~22 )*?2 )L2 )_2 )I3m2 )$x222 +V2 +V2 +(V2 +&V2 +9V2 +7V2 +(V2 +&V2 +9V2 +7V2 +JV2 +HV2 )|"3 )3 ,g3 )B`%3 +`V)3 +XV23<3U3 +VY3 +Vb3 +Vf3 +Vo3 +Vs3 +Vz3 ,w3 )B`3 +V3 +V3 )s3 +W3 +V3 )3 +3W3 ++W3 )Y3 +fW3 +^W3 )3 +W3 +W33 )~4 )*4 ))4 )<4 )I3J4 )$x]4g44 +W4 +W4 +W4 +W4 +W4 +W4 +W4 +W4 +W4 +W4 +W4 +W44 ,*4 +X4 +X4X5X!5 +X%5 +X/595V5 ++XZ5 +)Xc5 +=Xg5 +;Xl55H5X5g55 )(5P6 )16 +RX6 +JX6 ) #6 +zX'6 +vX86 +X<6 +XA6 )>M6 +XQ6 +Xa6 +Xe6 +Xj6 )#v6 + Yz6 +Y6 )6 )|"6 )6r6 )B`6 )s6 )6 )Y7 )7r"7 )~47 )*A7 )N7 )a7 )I3o7 )$x7r7r7 +/Y7 +-Y7 +@Y7 +>Y7 +@Y7 +>Y7 +@Y7 +>Y7 +/Y7 +-Y7 +QY7 +OY7f8 ,x8 +aY8 +_Y8)8F8 +pYJ8 +nYS8 +YW8 +Y\8q8r8 )c88 )18 +Y8 +Y8 ) 8 +Y8 +Y8 +Y8 +Y8 )qD8 + Z8 +Z8 )>9 ++Z9 +#Z9 +fZ9 +^Z!9 )v-9 +Z19 +Z69 )#B9 +[F9 +[U9 +W[Y9 +A[i9 +[m9 +[w9 )9 ,9 ), 9 )Da9 +\9 +\99 )>9"9 )9 +'\9 +\9 )b: +i\: +O\:":"3: +\7: +\@: +\D: +\M: +\Q: +\Z:"d:"}: +\: +\: +]: + ]:": +&]: +]:":": +P]: +N]: +a]: +_]:8; ,; )B`+; +w]/; +o]4; )s@; +]D; +]I; )U; +]Y; +]^; )Yj; + ^n; +^s; ); +?^; +7^;D; )~; )*; ); ); )I3; )$x;D<D< +m^ < +k^)< +|^-< +z^6< +^:< +^C< +|^G< +z^P< +^T< +^]< +^a< +^n< )|"{< )< ,τ< )B`< +^< +^<<< +^< +^< +^< +^< +^< +^< ,߄< )B`= +_ = +_= )s= +T_!= +L_&= )2= +_6= +_;= )YG= +_K= +_P= )\= +_`= +_e=v= )~= )*= )= )= )I3= )$x=== +`= +`> +)` > +'`> +)`> +'` > +:`$> +8`-> +)`1> +'`:> +K`>> +I`J>T> ,e> +[`i> +Y`s>}>> +m`> +k`>>> +`> +}`> +`> +`>>x?1?I?W? )ra?x? )1? +`? +`? ) ? +`? +`? +`? +`? )>? +a? +a? +Sa? +Ka? )#? +a? +a@ )@ )|"%@ )3@ ,4x<@ )B`J@ )sU@ )`@ )Yk@ )y@@ )~@ )*@ )@ )@ )I3@ )$x@@ A +aA +aA +aA +a'A +a+A +a4A +a8A +aAA +aEA +aNA +aRA +a^AhA ,$xyA +a}A +aA~A ,DxA +aA +aA +aA +aAAA ) $A B )1B +bB +aB ) "B +1b&B +-b7B +Qb;B +Ib@B )qDKB +{bOB +wbTB )>`B +bdB +btB +bxB +b}B )B +"cB +cB )#B +cB +cB +cB +cB +GdB +?dB )B , B ) B )`C +wdC +sd C)C )%)CR>C )JC +dNC +dSC )b_C +dcC +dlCRvCRC +8eC +6eC +JeC +HeC +[eC +YeCRCRC +meC +keC +~eC +|eCRD +e D +eDRDRH>+H +h/H +h8H +iI +i!I +i1I +i5I +i:I )#FI +iJI +iaI )tI )|"I )I ,dxI )B`I )sI )I )YI )II )~I )*J )J )%J )I33J )$xFJPJiJ +jmJ + jvJ + jzJ +jJ + jJ +jJ + jJ +jJ +jJ + jJ +1jJ +/jJJ ,TxJ +AjJ +?jJNJ ,txJ +PjK +Nj K +bjK +`jKS)K>K )N HKP_K )1jK +wjnK +ojsK ) ~K +jK +jK +jK +jK )qDK +jK +jK )>K + kK +kK +FkK +>kK )K +kK +xkK )#K +kK +k L +kL +k!L +l%L +l/L )=L ,rFL )v TL )``L +DldL +@liLYzL )١LL )L +`lL +\lL )bL +lL +xlLLL +lL +lL +lL +lM +l M +lMM5M +l9M +lBM +lFM +lOMdM +mhM +mqM{MM +-mM ++mM +=mM +;mMMM )B`M +OmM +KmM )sN +imN +em N )N +mN +m!N )Y-N +m1N +m6N )BN +mFN +mKN\N )~nN )*{N )N )N )I3N )$xNNN +mN +mN +mN +mN +mN +mO +m O +mO +mO +m O + n$O + n1O )|">O )LO ,UO )B`aO +neO +nnOxOO ++nO +)nO +;nO +9nO ++nO +)nO ,O )B`O +LnO +JnO )sO +[nO +YnO )O +lnO +jnO )Y P +}nP +{nP )P +n#P +n(P9P )~KP )*XP )eP )xP )I3P )$xPPP +nP +nP +nP +nP +nP +nP +nP +nP +nP +nP +nQ +n QYQ ,b(Q +n,Q +n6Q@Q]Q +naQ +nkQ&uQ&Q +oQ +oQ +oQ +oQ1QQQ ROR )$R;R )1FR +)oJR +!oOR ) ZR +Qo^R +MooR +nosR +hoxR )>R +oR +oR +oR +oR )#R +oR +oR )R )|"R )R S )B`S )s$S )/S )Y:S )HSYS )~kS )*xS )S )S )I3S )$xSSS +pS + pS +pS +pS +pS +pT +pT +pT +pT + pT +0p!T +.p-T7T ,xHT +@pLT +>pVT`T ,xqT +OpuT +Mp~T +apT +_pTTT )PT ,4T )1T +|pT +npT ) T +pT +pT +qT +qU )qDU +qU +qU )>#U +q'U +q7U +'r;U +rPU )k`U )xU U )MU )UU )B`UUU +rU +rU +rU +rV +rV +rV )wV!'V )y4VCV )wPV "YV )yfVuV )wV`"V )yVV7 V ,KV +rV +rV V ,[V +rV +rV ,[V +rW +r W, %W/W ,n@W +rDW +rMW +rQW +rZW +s^W +sgW +(skW +&spWW WW WW WW XXx,XPXeXwuXAXeXwX )X )1X ) Y )>Y )-Y ) 7YpNY )1YY +Cs]Y +7sbY ) mY +zsqY +vsY +sY +sY )qDY +sY +sY )>Y +tY +sY +NtY +BtY )YY ,:z Z +t Z +tZ ,:zZ +tZ +t)Z@Z[ZkZyZ )4Z ,xZ )1Z +tZ +tZ ) Z +uZ + uZ +AuZ +7uZ )>Z +uZ +vuZ +uZ +uZ )z[ +7v[ +'v [ )[ + w[ +v[ )M([!6[ )I[ )wV[ !_[ )yl[{[ )w[`![ )y[[ ,x[ )B`[ +Lw[ +>w[ )s[ +w[ +w[ )[ +w[ +w[ )Y[ +w\ +w\ )\ +w\ +w\f+\ )~=\ )*J\ )W\ )j\ )I3x\ )$x\f\f\ +w\ +w\ +w\ +w\ +w\ +w\ +w\ +w\ +w\ +w\ +x\ + x\ ]i#]!C] )M] ,xX] )1c] +)xg] +xl] ) w] +jx{] +`x] +x] +x] )>] +x] +x] +By] +6y] )] +y] +y] )z] +y] +y] )M] ^ )^ )w ^ )^ )y6^E^ )wR^ [^ )yh^r^S^^;^i^ ^ )^ ,z^ )1_ +y _ +y_ ) _ +#z_ +z._ +ez2_ +[z7_ )>C_ +zG_ +zW_ +z[_ +z`_ )0p_ )2_ )X_ +I{_ +?{_ )<_ +{_ +{_ +{_ +{_ +|_ +{_ )M_#__ ) ` )w`""` )y/`9` ,*zB` )B`N` +j|R` +f|[`e`~` +|` +|` +|` +|` +|` +|` )w`"` )y`` )w` #` )y` a )wa`#"a )y/a=a\Ga\da +|ha +|naaaaIaaSbb(n-b#7bLbXn`b#jbbnb#bbnb#b )3bpb )1b +|b +|c )  c +|c +|"c +|&c +|+c )R7c + };c + }@c )>Lc + }Pc +}`c +L}dc +F}nc )|ccc )̆cc )1c +w}c +q}c ) c +}c +}c +}c +}c )> d +} d +}d +~!d +}+d )9dXdcd )եmd ,Mzxd )1d +5~d +'~d ) d +w~d +q~d +~d +~d )qDd +~d +~d )>d +(d +d +d +{e )Me )"e )w/e@ 8e )yEeSe]e ,bzne +re +we ,bze%e*e_eeee f )MF*fAf )1Lf + Pf +Uf ) `f +)df +%uf +Fyf +@~f )>f +hf +bf +f +f )fff )f ,uzf )1g +ǀg + g ) g + g +-g +?1g +/6g )qDAg +Eg +Jg )>Vg +Zg +jg +ng + g )Mg )g )wgg )yggGg ,zg +tg +lg ,z he"hj1hLh\hihGzh h )hh )1h +h +h ) h +h +h +؂h +҂h )>h +h + i +&i + i )&iEi2Pi )Ziqi )1|i +Qi +Ki ) i +qi +mi +i +i )>i +i +i +܃i +փi )i7 j!j )UNj`5j )1@j +Dj +Ij ) Tj +'Xj +#ij +Dmj +>rj )>~j +fj +`j +j +j )jj,j )j j )1k +k + k ) k +݄k +ل-k +1k +6k )>Bk +Fk +Vk +HZk +Bdk )rkGk,k )"k`k )1k +sk +mk ) k +k +k +k +k )>l +҅ l +̅l +l +(l )6lUl,`l )jll )1l ++l +#l ) l +Sl +Ol +pl +jl )>l +l +l +ʆl +†l )lm9,m ) X6mMm )1Xm +\m +am ) lm +'pm +#m +Dm +>m )>m +hm +`m +m +m )mm9m )(n n )1$n +Ӈ(n +ˇ-n ) 8n +bn +<fn +4vn +rzn +jn )nGn9n )In`n )1n +n +n ) o +ňo +o +o +܈"o )>.o +2o +Bo +0Fo +*Po )^o}o2o ) oo )1o +[o +Uo ) o +{o +wo +o +o )>o +o +p + p +p )"pAp2Lp )Vpmp )1xp +|p + p ) p +;p +7p +Xp +Rp )>p +|p +tp +p +p )pq9q )/"q 9q )1Dq +Hq +ߊMq ) Xq +\q +mq +"qq +vq )>q +Dq +>q +pq +jq )qOq=q )Yqpq )1r + r +r ) r + r +1r +؋5r +ҋ:r )>Fr +Jr +Zr +&^r + cr )=or +Osr +K}r )rrHr )rr )1r +ir +cr ) r +r + s +s +s )>s +Ȍ#s +Œ3s +7s +As )OsnsHys )6ss )rs +s +s +8s +4s +Ss +Ost )Qt@6t )rAt +nEt +jVt +Zt +kt +ot +tYt )}tt )rt +t +t +ڍt +֍u + u +u&Mu )L<Wupnu )ryu +}u + u ++u +'u +Fu +Buu )Ѩu ,v )r v +uv +]!v +N%v +6v +W:v +?v )Jv +Nv +ؒSv )K^v +!bv +rv +vv +t{v )v )yv +ɓv +œv +9v +v )Mvv )vv )wv`v )yw( w ,!w )w +N#w +J(w )H=w )wJwSw )y`w nwxww +iw +ew +w +w +w +w+wwx4-xQ:xHmNx^x )wkxtx )yxx x ,x +x +x +x +x +̕x +ʕx xx , y +ޕy +ڕy +y +'y ++y +0y ,9y +P=y +@Fy +Jy +Sy`yjy ,ć|y#y#y +ږy +ʖy ,ԇy +!y +yyy zz.zBzbLz ,]z +Uaz +Ejz +nz +sz ,z +z +zz ,#z +=z +9z +Sz +Qz +bz +`zz{ ,6{ +v{ +p { +${ +){ ,62{ +6{ +?{ +ߘC{ +٘L{ +P{ +Y{f{p{ ,N{ +7{ +5{{{{ +F{ +D{{ +^{ +V| ,^ | +| +|'%| ,p6| +:| +C| +ϙG| +əL|,d|||?||,|,| +| +| +| +| + | + |<}#} ,4} + 8} +A} +CE} +=J} ,S} +fW} +``} +d} +m} +̚q} +šz}}} ,} +} +}} } } + } + }~ +#~ +!~ ,.~ +K2~ +G<~iF~ ,ƈW~ +e[~ +_d~ +h~ +m~n~~X~~~ ,~ +~ +~ +˛~ +ś~ , + + + +  +>  +4) 6@ ,Q +nU +l^t~ +} +{ + + ,  + +   +֜ +Ԝ +# +((=Ti~|0QHm0ƀ׀QHm0 ," +& +/ +h3 +T8 ,N +םR +ϝ[ +_ +h +l +u +3y +1 ,a +F +B +_ +] +n +l ,q + +|  + + ,q +؞# +̞.8 ,I +M +V +.Z +,c +Ug +Sp +dt +byHjӂ~+'@o:JP_proσ@x xx*;QHHm\kuu , + +s +ȟ + , + +Ʉ ,ȉڄ +Eބ +A +^ +\ +m +k; L]rQHma&Ѕڅ ,؉ + +{ + +ݠ ,؉ + +j$ +( +1 +D5 +:> +B +xK +O +X +\ +ڢe +Di +<r +uv +s + + +ޣ +֣ + +  +_ +W + +͆iچ ,7 + + +4 +2 +C +A>H ,GY +X] +Rf +j +zo ,Gx +| + ,c + + +  + +& + ɇӇ ,x +G +C +c +] + + ,x + + ,) +¦- +6 ,? +_C +]NX ,e +qi +or +v +~ + +ӈ , + + +§ +! +ڧ% +ا. +ڧ2 +ا8P ,Ɗ] +a +jt + + + + + +Ӊ,݉ ,֊ +, +* ,I%#`1<O[g[hӊy  y .CyV f{~ /Hj ֋op 8y0 :Ob liwҌ ܌F(z )po< LSaQnHm / RӍ m "3xlF Uq_ ,p +Dt +<} +z +p , + + +  +  + +̎֎ ,3 +. +* +G +E +V +T /9 ,CJ +jN +dW +[ +` ,Ci +m +t;Sԏ~ x. >OHjb slp Q͐Hm 8xx #]8xK [|p@o o ̑X֑ ,_ + + +8 +0 ,_ ,. +f2 +b; +|? +zH +L +Qv , + + + + + +ْ , +ͪ +ɪ + + +  +  +,  +( +K +G#8 +j< +fEOh +l +u +y + + + + + + + + +}˓&ޓ_Q Hm(9QFHmZis , + + + +ݫ , ,͋˔ +ϔ +ؔ +!ܔ + +0 +. ,݋  +B$ +>- +a1 +]: +> +~G +K +T +X +a>{>> +ݬ +۬ + + +ݬ +۬ŕ +ݬɕ +۬ҕ +ݬ֕ +۬ߕ + + , + +   +/  ++  ,- +J1 +H: +J> +HG +[K +YT +mX +ka +me +kn +~r +|w , + + , + + +ŭ +í ,ȖV:Q'Hm;E]Z&mwQHm— ,ӗ +߭ח +խ +$ + , +R +P/ +a3 +_< +p@ +nFcT{iʘez p%`z8pD\v<Iә~X-K+XmQzHmzŚ ))Ϛ , + + + + + + )w) )5 +*9 +$> )HN )MXf )ws| )y0 ,ԃ )B` +O +M؛ +aܛ +_ +a +_ +a +_ ( +v, +p5 +9 +B +F +KqE{ , + +E , +ȯ +ƯÜE͜ , ޜ +ٯ +ׯJ , +  +|/<JMQZHmn )٤ )̝ )5ٝ )Mp )w )y@ )w,@5 )yB8M )3W ,}n +r + +@ +6 )H )Ǡ +{ +s )MP̞ڞ )w )yx  )w" )y/p> )wK T )yahp )w}` )y` ,5~ )B` + +ɟ + + + + + +  )w" )y/X> )wKT )yaPk ,E~t )B` + + )s + + ) +( +& )Y +9à +7Ƞ )Ԡ +Iؠ +Gݠ ,U~ )~ +Y +W )*  ) )) )I37 )$xJTm +iq +gz +y~ +w + + +i +g +i +g + + )w̡ ա )yHE , ~  + + +DZ +ñ% +ݱ) +۱.JU , ~l , ~u +y + +@ +> +O +MŢ +^ɢ +\΢#p$P4Ipp\Pf{8pPoPϣ*~PRk)Hm=PGnXpkP ) )HĤ )Ѥ )zޤ )7 )( )2 )Ǡ) )X6 )XC )VP )<] )j )Mt  )1N )w )yƥ )wӥܥ )y )w )y* )w7@@ )yM\ )wir )y )w )y )w֦ͦ )y )w@ )y$ )w1: )yGV )wcl )yy )w  )y )wǧ@ Ч )yݧ )w  )y )B`1 )B`D )wQ Z )ygv )w  )y )w@  )y˨֨ )w  )y )? )HL )ze )Ǡr ) )M  )w  )yHɩ )w֩ ߩ )y@ )w`  )y8- )w: C )yP0_ )wl u )y( )w  )y ê )wЪ` ٪ )y )w   )y# )w0 9 )yFg )Ԑs , +w +m )Ǡ + + ) + + )(ǫ +O˫ +IЫ )2ܫ +y +q )V + + )< +  + ) +  +. +Z2 +B7 )l7C +ԴG +ȴL )MV%g u )w# )y )w# )yʬ٬ )w $ )yx  )w`$! )y.p8 ,ֆA )B`M +Q +ZJ dJ  +# +! +2 +0 +2 +0S  ,­ )B`έ +Cҭ +Aۭm m  +R +P +a +_ +a  +_&r E )wR$[ )yhhw )w$ )y` )w % )y̮Xۮ )w`% )yP   ,' +r+ +p4 , 9 Q^#`j " ^  ׯ e ~%(=PwP%Zo%m%Ӱ%%"E-Zxlm%wI%ű )mϱ ,} + + +Ƶ + )H )z  +$ +2 +k6 +i; )ǠG +K +zP )MZh )wu@ ~ )y )w  )y̲ )wٲ  )y )w  )y!0 )w=@F )ySb )wox )y )w )yųϳ ,} + + +˶ +Ƕ + +߶(2 ,}C +G +P + T +] +a +fǴoڴHj"7poJZ/ooS~ĵwٵQHm@o(3 )G_ )Hl )zy )~7 )y )Ǡ )M )wŶζ )y۶ )w@ )y  )w)2 )y?N )w[d )yq )w )y )w@ȷ )yշ )w )y )w( )y5U )\_ ,}v +2z +( +f +` )H + + )MPϸ )wܸ  )y  ,} + +( +η, +ʷ5 +9 +>a MQHmP ){ , + + ) +; +3 )k+ )l7 +n; +h@ )L +P +U )`a +e +j )v +Pz +F )M , )B`O O ƺ +ʺ +Ӻ +׺ + + + )w* )y@" )w/*8 )yE8T )wa+j )yw0 )w@+ )y( )wŻ+λ )yۻ  )w+ )y  )w),2 )y?I Vk w{vܼ uv&;PvKi~vIxvŽ )+Ͻ ,x + + )k + +ҹ  +w +Y +# +( )z4 +W8 +5= )~7M )yY +] +b )(n +ur +kw )2 + + )Ǡ + +ּ )V +~ +j )<¾ +ƾ +ٽ˾ )׾ +۾ + ) +L +6 )M0* )1N& )w3%< )yIX )we&n )y{ )w@& )y )wɿ&ҿ )y߿ )w& )y  )w-'6 )yCR )w_@'h )yu )w' )y )w' )y )w( )y  )w'@(0 )y=L )wY(b )yoxy ,y )B` + + +þ + +Ҿ +о +Ҿ +о ,y )B` + +&C +G +P +T +] +a +g ,&y )B` + +>> +K +I +[ +Y +K +I ,6y )B` +r +j  )s + + )* +. +3 )Y? +'C +H )T +X +] ,Kyb )~n +r +w ,oy )*  ) + + ) +) +% ,y )I3 +A +?, )$x +Q +O ,l-l<wF ,]yS +eW +a` +d +m +q +z +~ + + + + + )w( )yp )w) )yh  )w@) )y,`; )wH)Q )y^Xm )wz) )yP )w* )yH ,y + + + + +6  +4 +E +C3)= ,yN +VR +R[ +q_ +mh +l +u +y +~5 ,y + + ,y#` ,y- +1 +: +> +G +K +T +(X +&]}'-L:Okb0*{0*hk0*Aj 0*\,k?0*Ozdjw0*Hj0*m0* 0*(9=8lP0*ZUoxl0*tpm0*m 0*%:M0*W{0*9~0*_ j 0*6 )uU )9b )p )z )Ǡ ):^ )H )M0 )w)2 )y?N )w[d )yq| )w )y )\ )2 )& )#  )|" )) )8 )L )$k )2x )& )# )|" ) ) ) )  )2 )" )#H )|"U )h )w ) )  )H )(Z )M )w` )y )w#, )y9D )wQZ )yg )B ,9} +A +7 +} +s )H ) + + )&N + +  +' + )  +$ +) )M3A )wN W )yds )w` )y ,_} )d  + + ) + + )w )y  ,O}% +T) +P2 +o6 +k? +C +Hn;x ,r} + + + + + +;; + + + + + + ,} + +;;3 +7 +@ +%D +#M +4Q +2VKxZ-QHmQ&u)Q6HmJZ )~ )H )M )w )y0 )w@ )y( )B` )s) )6 )YC )Q )~c )*p )} ) )I3 )$x ) )b )w )y  )& )H3 )M=K )wXa )ynH} )w  )y@ )B` )s ) )Y ) )~ )* ) ), )I3: )$xL )wY`b )yo8z )r ,z +L +B + + )H )MP )w )yX# )B`/ +3 +<F_ +c +l +p +y +} + )w  )yP ,z +  + +_ +M ,z + + + + +L +B% ,{2 +~6 +v; ,{D +H +Q +U +^h ,8{y +} + +@ +< ,T{ +_ +[ + +z + +(AVk !6Kdytt + +$t.tE +I +T^ ,u{o +s +| + +  ,u{ +J +D +z +r ,{ + + + + + + ,{ +0 +* +^ +X  +  + + +# +' +0 +4 +=G ,{X +\ +e +9i +5n ,{w +Z{ +V +{ +w-BWl~ + + + + + +( +, +5 +9 +> ,{G +'K +%T +AX +5k,AS r| ,{ + +~ + + ,{ +> +4 +} +y , | + + + + +S +I , |  + + + +' ++ +4 +K8 +GA +oE +iN +R +[e ,I|v +z + + + ,c| + +  +0 +,6K`u +K +I  +c  +a +y +q#-F +J +S +W +\ ,|e +i +r +v +  5J_q%F ,| + +  +` +V ,| + + + +F ,| +) +  +t +j + +" ,|+ +/ +8 +c< +YE +I +R +V +_ +c +l +7p ++yF ,| +s +o + + ,| + + + +&;Ti~KUU + +' ++ +4 +8 +AUKUd +Eh +Cq +]u +[z ,} +m +k + +{======)=>=S=h=}=P ,)} + + + + + + n/Q<HmPPZk&~P )IB ,~ + + )H +X +4 + +_ )( +` + )t + +{ )2 +( +" )55& +r* +J/ )&; +7? +D )VP +T +Y )B}e +i +n )z +~ + +H +@ )4 + + ) +K + )̭ +. + )]. )ڟ + +e )  +  +r ) )v<+ +/ +? +C +H )ԮT +X +] )MgPy )1N )w )y ) +  + )b +o +;! +=% +;. +O2 +M; +^? +\HRk +po +nx +| +} )w )y )w  )y )w` )y+5 ,~> )B`J +N +Wa~ + + + + + + ,~ )B` + + + +  + + + +#= ,~F )B`R +V +[ )sg +k +p )| + + )Y +S +A ) + + , )~ )* ) ) )I3 )$x" ,/ +3 +< +@ +I +(M +$V +Z +c +(g +$p +Et +A})>Se )w )y )w )y )w & )y3B )wO`X )yeo_ )B` +f +`__ + + + + + + )w )y  ,  ){, +0 +5FJ )B`V +Z +cFmF + + + + + + )w )yxx +  + +7 +5#x-xD +JH +FQ +fU +d_xi ,r +yv +u + + ,BO0sG ,GP )\ +` +j )ww  )y )w` )y00 + + +& +$000 +94 +5= +XA +VK0U ,^ +kb +gk +o +t ,R , + + + + +7 +- , +r +j + + + + + + +  + +A +? +P# +N, +0 +}9 += +F ,S +W +` +d +i , + + +G +A , +t +r + + + + ,  + + + +& +* +/ ,8 +< +EO ,3\ +` +i +m +v +z +tsGQ(Hm<pFeWspSvs%N6`sG ,hP )T\ +` +e )q +:u +6 )w )yqQHm'P1T )waj )yw )w  )y ,! )A +^ +P ,` ) / + +  + + +7" +-' ,0 )B`< +s@ +iE )sQ +U +Z )f +j +o )Y{ +# + ) +\ +R , )~ + + )* ) ) )I3 )$x s ,΂! +% +. +2 +; +? +H +L +U +Y +b +;f +7oooooooooo0oEoWq , )B` +^ +V )s + + ) + + )Y + + ) +& +   , )~ +M" +K' ,0 )*= F )R +]V +[[ )g +ok +kq ,.z )I3 + +< )$x + +<l@t ,  +  + + +  +$ +- +1 +: + > +G +)K +%Ro ,>x )B` +H +D )s +e +a ) + + )Y + + ) + + ,S )~ )*  ) )) )I37 )$xJT ,Sa +e +n +r +{ +! + +! + +! + +@ +<yyyyyy1yFy[ypyy )w` )y8(!=xtM7b N )} +] +[  ) +l +j":Y )wfo )y| , ) +{ +y )w )y t )w   )y * ,3 )? +C +H )bT +X +c )wp`y )yx )w )yp ,W )R  + + )` + + )w )yh- )w: C )yP`^QhQ + + ++ +) +: +8QQ +I +G +X +V +g +e ,~ +w +u QQ/ +3 +< +@ +I +M +R^tlZ ,' + + + + + + +  +}7 +; +I +*M +(V +BZ +@h +ll +Pq + + ,7#` ,F. +2 +; + ? +H +5L +/U +VY +T^ ,Y +j +f + + + + ,n + + + +  +  +  ,n  +  +"  ,/  +73  +3<  ,E  +I  +T ^ w  +{  +  +  +  +  +     ,  +  +  +  +  +  +) 3  ,C  +!G  +P  +?T  +;]  +Ya  +Uf  ,o  +us  +q|  ,΀  +  +  ,  +  +    +  +  +  +  +  + # 1? `I  ,Z  +%^  +#g  +6k  +4t  +Ex  +C `  ,  +T  +R  +c  +a  +r  +p  ,.  +  + `  ,D  +  +  +  +  +  + h0 xW a  ,gr  +v  +  +  +  +  +   ,w  +  +  +  +  +"  +   ,  +2  +0   ,  +E  +A  +]  +[  +l!  +j& J q  {  ,  +~  +z  +  +  +  +  +  + . 7  ,  + + + + +  +%YKUr + v +  +, +* +? +; +^ +\ ,ʁ +q +m + + ,ʁ + + 3 +7 +@ +D +NXo +s +| + + ,ځ + + +5 +3 ,ځx , +J +D ,  +j  +h*5RjGdF %Q2HmFPP8eQrHmPD!{t%:QGHm[PezQHmPQHmPu+&@SP]mrPrxl-P7kLPr_Pi~sr-QHmPM-`u=UU`mQHmPU )Ct )H ) )9 )V )  )1 )A ) )| )M p& )9 )wFO )y\(k )x )/@ )w )y  )w@ )y )  )* +{ +w! )zm, +0 +@ +D +I^ )j +n +t  ) + + + + + +  +, +&`"@R5\5zAKKW )*0 +L +H )* +g +c  )1~ + +~!EG#`S )s5Z ,q +u + + + )Mp, )w@, )y0up, )/ ,k +7# +'( )M2,@ )wM,V )yc8mmu, )ͻ , + +y + +  ) )M$-2 )w? -H )yUHd )wq`-z )y@ exw-}-8 )$J )W )Yd )K~ )= ) ) )XH + + )o +$ +  ) +? +; )2& +X* +V/N$i )o0 +u +e )2 + + )H + + ): + + += +; +X +R )e5  +w  +s  )  +#  +(  ,X1  )=  +A  +F  )@R  +V  +\  ,Be  )B`q  +& u  + ~      +I   +G   +Z   +X   +I   +G   ,,  )B`  +o   +i   )s  +   +   )! +  ! + ! )Y! + ! + #! )/! + 3! + 8!"I! )~[! )*h! )u! )! )I3! )$x!"!"! +@ ! +> ! +W ! +U ! +W ! +U ! +h ! +f " +W " +U  " +y " +w "Q'" ,8" + <" + E" + I" + N" ,W" + [" + d" + h" + o""`""#`" )" ):" )N# )#p;# + ?# + D# )VO# +@ S# +6 X# )oc# +u g# +m l# )w# + {# + # )2# + # + # )# + # + # )# + # + # ):~# += # +/ # +} # +u # ,# )B`# + $ + $ )s$ + $ + $ )&$ +( *$ +$ /$ )Y;$ +F ?$ +B D$ )P$ +d T$ +` Y$j$ )~|$ )*$ )$ )$ )I3$ )$x$$$ + $ +~ $ + $ + % +  % + % + % + !% + %% + .% + 2% + :% ,υC% )O% + S% + X% )?d% + h% + n% ,߅w% )B`% + % + % )s% +7% +1% )% +`% +Z% )Y% +% +% )% +% +%% )~& )*& )& )0& )I3>& )$xQ&[&t& +x& +& +& +& +& +& +& +& +& +& +& +& ,& )& +& + & ) @& +,& +*& ,& )B` ' +E' +A' )s' +o#' +k(' )4' +8' +=' )YI' +M' +R' )^' +b' +g'x' )~' )*' )' )' )I3' )$x''' +' +( + ( +( +( +"( +&( +/( +3( +<( +@( +L(-V( ,g( +#k( +t( +;x( +7( +S( +O( +}( +y( ,( +( +(y(()J);)d) )΄}) )V) )) )2) )() )|) )M)-) )) )B) )* )w*-* )y**9* )wF* .O* )y\*xg* )[s* )* )&* )w*`.* )y*p* )w*.* )y*h* )w+. + )y+`&+ )w3+ /<+ )yI+XT+ )wa+`/j+ )yw+P+ ):+ )4+ )Y+ )PD++ ++ ++, ), +, +,6, )P, )aV,pw, +{, +,t, ), + , +,}, )s,`, )(, +E, +?- +g- +a- +- +)- +-- +2- )M@- )wM-V- )yc-r- )w-- )y-- )w-@- )y-- )w-- )y-.x.e".7.mA.V.r`.q.z. ). )>. )4. ). ),s. )'. )3/ )%/ )/2/ )@/ )_/ )l/ )/ )ߦ/ ) J/ )fq/ )i/ ) 0 )!0 )*0 )70 )#E0 )b0 )o0 )#|0 )70 ) 0 )0 )#0 )0 )0 )0 )H0 )j0 ) 1 )#1 )h+1 );F1 )]1 )x1 )1 )̪1 )1#`1 )w1 )1 )1 )@2 )#2 )~12 )tY2 )~t2 )+ 2 )N\2 )#2 )|"2 )2 )vc2 )N\2 )K2 )N\2 )33 )N\3 )2%3 )373 )M3 )_3 )o3 )i{3 )73 )3 )I33 )$x3 );3 )3 )qD3 )94 )&4 )sBB4 )&>k4 )ק4 )4 )4 )4 )o4 )4 )&4 )5 )75 )P,5 )Y<5 )rL5 )y\5 )l5 )x5 )5 )05 )5 )5 )o5 )7C5 ){5 )5 )5 )!6 ):6 )S$6 )l86 )H6 )X6 )h6 )\{t6 )6 )6 )6 )6 )6 )6 )6 )6 )7 ), 7 )E7 )=m*7 )77 )D7 )7CV7 )eye7 )t7 )7 ) 7 )"7 );7 )T7 )m7 )7 )7 )X8 )8 )08 )?8 )N8 )]8 )ŕl8 )ݕ|8 )8 ) 8 )%8 )=8 )U8 )!8 )(8 )9 )o9 )c;9 ),9 )99 )K9 )XZ9 )ߒi9 )x9 )9 )'9 )?9 )W9 )o9 )9 )` 9 )9 )d : )_: )w$: )4: )D: )T: )הd: )p: )}: ) : ): ): ): )': )?: )W; )o; )#; )3; )?; )ϑM; )h; )yYt; ); )c;; ); )s; ); )K; ); ); )< )0< )H< )'< )t3< );< )D< )T< )9a< )P s< )<< )/< )< )< )<< )< )i< )= )= )M+= )8= )S= )i`= ){= )i= )v= )?= )i= )= )i= )K> ) !> )-> ),:> )T> )a> )M{> )>@> +> +> +> +>b>b> +? + ? +? +? +? +1?L? +(P? +Y? +[]? +Qf?p? ,e~? +? +?? ,e~? +? +? +? +?? ,e~? +? +? +? + ? +,? +$? ,e~@ +S@ +M@@5@ +n9@ +lB@ +~F@ +|O@Y@r@ +v@ +@ +@ +@@@ +@ +@ +@ +@@ +@ +@AA ,u~-A +1A +:A +D>A +<GA +KA +qTA +XA +aA +eA +nA +NrA +H{AA +iA +gAA@qAA +xA +vABpB0B +4B +9BFVBqeB ,~rB +vB +B +B +B +B +BHBHB +B +BXBpBBC +,C +* C8CCC [C1pCqCHCqCC rC@CdCq DDq-DKD`DTDDhqD )D )D ))D ))D ) {D )]D )QPD )%0D &bBD )D *S9D *,9D ,D 'ME )m#E )/E );E ) IE )NNE ) \E )fE )tE )8yE )E ) E )E )E )E )bE )wE )1NF )#TF )AfF )]tF )PQyF )w F )F )bF )0F )'F )LF )pF )F )66F )F )TG ) G )k[G )G )s(G ) 4G )@G ).LG )XG )_dG )FpG )y6|G )G )2G );G )_G )_&G )G )VG )eG )yG )cG )KH )OH )H ) )H )U5H )qAH )nMH ):YH )4nH )a/|H )7H )a/H )\H )H )H )yKH )kH )`*H )I ) I )&5I )CI )PI )gyI )I )I )>I )I )FI )vI )f0I )kJ )cJ )J )da-J )];J )*IJ )WJ )eJ )sJ )J ) J ) J )J )J )܋J )>J )oJ )J )*K )BK )/K )+K )O9K )SGK )UK )eOrK )K )$K )K )i K )$K )K )3K )<K )K )JL )J'L )6L )REL )_TL )j,cL )pKrL )L ) L )L )L )DL )yL )L )L )L )#KM )SM )%&M )X5M )_DM )SM )t7bM ),qM )M )M )M )#cM )!M )M )UM )M )M )5N )fN )%N )4N )%RCN )g(RN )?aN )#pN )N )N )UN )CN )AN ),N )aN )(N )$O )8O )MO )ZO )O )O )R O )O )O )O )%O )+O )5O )O )ݘP ) P )+"P )8+P )M8P )sEP )RP )C`P )|P )gP )@P )P )P )4P )P ) )P )P )7Q )Q )"0Q ):Q )GQ )yO[Q )xQ )Q )_Q )!Q )Q )Q )YQ )Q )EQ )R )>R )3R )c'CR )l0IR ){OR )UR )O\R )IiR )R )R )`)R ) R )R )R )JR )R )R )S )5S ))BS )iS )|S )OS )cS )"S )K!S )ӉS )ٜS )8S )\S )S )T )MT )$T )%2T )@T )]NT ) \T )-jT )xT ){T ) T )T )T )fVT )MT )T )`T )PT )IU )U )V U )^.U )e>E~c )vc ) c )%Tc )>c )6c )jc )_c )'Wc )Ud )|d )"#d )62d )}Ad )Pd )(_d )ϩnd )}d )=d )d ).d ),d )d )cd )'d )d )Je )e )$"e )1e )@e )Oe )ͺ^e )%me )|e )Xe )o$e )Ce )e )Ze )we )ޮe )Fe )Pf )f )!f )0f )!?f ) Nf )ڥ]f )42lf )0*{f )f ).f )>f )f )Ɲf )f ) 4f )|f )g )lFg )!g )Һ0g )?g )Ng )M"]g )\+lg )NW{g )g )g )<]g )ug )g )Eg )Qg )eWg )h )IUh )l!h )?0h )%?h )Nh )]h )lh )V{h )"h )h )}h )2h )h )h )h )2h )rEi ),i )0i ) ?i )Ni ) ]i )0li ){i )Gi )aci )ii )#i )V[i )xi )4i )Ii )6Cj )j )/#j ) A3j )յBj )#Qj )`j )pj )yj )j )-j )cj ) j )0k )k )!k )*/k )=k )Yk )3gk )(uk )k ).Vk )Ck )k )Ck )rk )k )k )l )6$l )NHl ).M^l )ll )l )تl ) l )l )l )$l )%\l )el )l )l ) m )1m )@)m ),7m )fCEm )^m )Wkm )/Wxm )wm )9m ).m )m )m )m ) m )Km )m )im )m )m )Ln )<n ) n )+n )n )wn )%n )#+n )e91n )G 7n )YX=n )Tn )Jen )n )n )n )n ){n )4=n ) n )[n )Yn )dn )n )yAn )n )n )Xn )Sn )In )O@n ))bn ){o ) o )o )Bo )qo )"o )(o );.o )_5o ) ?Bo )>Oo )\o )io )vo )o )=o )fo )o )lo )C9p ) Fp )yQp )p )3 q ).`Tq )aq ):nq ) {q )jcq )(q )c&r ) 3r )E@r )DMr )Zr )sr )r )r )r )Zr )ir )r ) s )s )KP's )`6s )-Vs )fs ): ss )s )s )s )s )X`s )s )4s )is )t )l t ):0t )m@t )JPt )w`t )nt )|t )-t )@t )R#t )\Pt )X`t )t )t )+t )@u ) u )-u )[u )̠hu )fuu )u )u )u )u )u )hSu )u )u ) v )Yv )&v )T3v )@v )dMv )DZv )`*hv )ouv )v )Xv )"v )v )v )w )ZT w )Ew )!w );w )Hw )Uw );Kbw ) ~w )w )w )w )(w )| ))L| )V| ):} )Y} )2} )%T?} )]L} );OY} )%g} )z} )} )+} )d} )}} )} )} )iY} ) } )IU~ ) ~ )~ );K\~ )}h~ )It~ )~ )~ )a~ )F~ )*2~ )$~ )~ )~ ) )F ) )U( )? )L )Y )Up )} ) )q )M )A ) )3 )l  ) ) )u )* )7A )'M )PY )e )q ) )xN )Ȁ )8Հ ) )& )Ѥ )O  )! )- ).9 )rE )[ )pOh )u ) )$ ) )  ) )ǁ )܋ԁ ) ) ) )8  )] )$ )> )K )W?X )>r ) )E ) ) ) )>‚ )Ђ )݂ )J )W )8 )~V )6 ), )9 )F )S )` )Tn ){ ) )k^ ) ) ) )cHۃ )W  ) ); ) )lF  )- )): )G )T )a ) ) ) ) ) )̈́ )ل ) ) )  ) ) $ )P;G )G`j )Cv )' )` ) )  ) )Tƅ )̅ )D҅ )8؅ )3߅ )Q ) )  )% )`3 )A )P )N^ )}[l )gz )(: )$* );` ) )8† )yц )߆ ) ) )  ) )% )3 )A )P )_ )km )9{ ) ) ) )L )OZ ) h ))v ) )) ) ) ) )ʉ )X؉ )5 ) )U )! ) ), )O )Y )g )u ) ) ) )  )C )Cϊ ) ). )1 )! )?/ ) = )}K )Y )S g )u ) )Z )Z ) )Ë )Ӌ )_ ) ) )Y1 )u. )< )J )cY ) )݈ )@ )hZ )X= )، ) ) ) )c )5 )RC )W )_ )cn ) )! ) ) )>Ǎ )GՍ )X )tJ )"+ )  )N )) )7 )E )]S )a )<o )wD} )+ ) ) ) Ď )ގ ){ )Y) )* )آ5 )B )0O )e,b )2p )kQ )/5 )$Z )`, )Rˏ )n ؏ ) )l ) )  )n )7& )[3 )̗@ )"M )Z )>g )^t )ac )X )C* ) )a@Ӑ )kQ )J ) )X )ac. )*U )b )o )| ) ) ) $ )?U )Kʑ )Oԑ )3_ޑ )+ )Ю )# )܍ ) )u* )q7 )DD )Q )^ )ok )Fx ) ) )O ) ) )jȒ )ג )I )0? ) );#  )]% )d3 )A )=O )d] )Zk )4K ) ) )` ) )&N͓ )ۓ ) ))/ )' )` )V! )U/ )Ќ= )2K )Y )eg )Hu )ź ) ) )# ) )Zɔ ),ה ) )`\ )O )͉ )C )V+ )H/9 )G )U )Wc )~#q ) ) )qQ ) ) )r6͕ )>Eו )eR ) ) ) )2 )- ); )I )RW )e );s )+ ) )ϩ ) )W )%@Ɩ )Ӗ )  ) )H )' )J0 )=) )3 )*= ).K )܋Y )bg ){ )< )l )P )Ɲȗ )Sҗ ) ) ) )1 )# )( )5 )B )O ))\ )8i )`v ) )D )- )o ) )Ƙ )&Ԙ )1 )ϳ )   ) )( )QC )Q )_ )9m ){ ) ) ) )18 ) )ϙ )& ) )% )-" )@0 )&D )R )_ )Ul )p ) ) ) ) )j#Ě )`6Κ )]ؚ )V[ )y )ђ )  ) )N% )2 )d8? )L )^ )k )x )W ) )3 )! ) )ƛ )ӛ )& ) )V  )g )Z# )N1 )> )><K )RX )Tg )Lt )> )z ) )-T );Wœ )mP )! ) ) )۠, )!? )K )P )K] )`j )]w )2 ) )Ɋ )ŝ ) - ) )P ) )-  ) - )K: )|UG ) T )έa )n )X{ ) ) ) )"; )̞ )ٞ )\ )g )V )U5 )-B ) O )] )i )^v )/ )< )Ǘ )W )G6 )8џ ))ݟ ) ) )z  ) )* )7 )cQ )^ )7l )y )= )C  ) )r )9 ) Ǡ )Lՠ )z )QV )Z )V )g+ )8 )E )l )V{ )X ) )q ) )ɡ ) )  )6" )ؗ/ ) X< ) J )CW )dd )}q )~ )߭ ) )O )8 ) < ) )   )Y )#P& )}3 )̪@ )M )C` )]Ym )= )ּ ) )T )£ )ϣ )"ܣ ) )  ) )& )d )}* )]7 )D )IQ )^ )tk )Ex ) )+ )  ). ) )yɤ )פ )9 )M )" )8 ))E )[#R )f[i )Ov )[# ) )[# ) )*Bɥ )e֥ )2 )N  ) )]& ).3 )A )Q );W )] )pc )j )z )3 );( ) )[ )V ) )= )oȦ )oۦ )  )j )7 )$2 )>@ )VM )gZ )Yg )Lt )+_ ) ) )@ )Õͧ ){" ) )+ )+ )۔( ) 5 )B )܋O )8f ).s )B ) ) )  )4 )l@Ψ ),ۨ ) )P ) )l@  )Z )4 )A )N )@[ )h ) _u ) )R% )I ) ): )5é )(%Щ ) ݩ ) ) )Җ )$ )(1 );Y )Ie ){ )M ) ) )\ͪ )y ) )nj )LE )8! )L8 )E )AS )` )zz )0 ) ) ) )cȫ )` ) ) )E );\ )(j ); )\ )zŬ )٬ ) )M )  )V )5 )N )9\ ) j )Ex ) )J. ) ) )X٭ )9 ) ). )k2 )/ )e8 )F )T )[ w )a )5 )c )@̮ ):ڮ )-= )կ )מ ) )-  )T. )KS< )'J )oX )pl )6z ) )8 )A )V )ү ) )m )1 )Ǘ )>$ )F2 ) A )O )] )ܞk )Jy ) ) )N )*̰ )' )* )r )A. )%\8 )F )]T )0b )p )V~ )Xc ) )Ӳ )o )ı )Cұ )Œ ) )> )  ) )ܙ; )I );Ke ) )zY )܋ )T )Uײ )F ) )9 ) )& )eN9 )G )d.U )c ) q )G )M )̴ )7 )\ )ų ) ӳ )J ) ^ ) )L  ) )5* )9 )H )ιW )f )u ) )3 )y ) ) )sPϴ )w ) )K  )> )) )8 )9G )V )~Ne )(?t ) )լ )D )c )C* )ε )ݵ )U )r; )!  ) )J( )7 )ǘF )U )Nd )7s )| )W0 )ƶ )ж )߶ ) )ǵ ) )( )X )Jf ) ): )B )S ) )· )Pȷ )E)η )Է )ڷ ) )E+ )W )= )1 )C ) ) )L+ )8 )>E )R )_ )l )y ) )  )h )Nĸ )qѸ )@޸ )6 ) )@  )6' )3 )? ):UK )W )gc )wz )4 )7 ) )9  ).ȹ )gֹ )&` ) )'5 ), )uG )S )!_ )C>l )>y )  )rY )O ) )3 Ⱥ )[ֺ )P )ܯ )\ )Y )- )_: )`*H )JU )b )& )  ) ) )׻ ) )  )u  )>< )ʮH )j e )q )Y} )/ )' )، ) )f )̼ )ټ ) ) )s )w  )) )6' )B; )H )m )| )+ )% )] ) )½ )н )'޽ ) )J ) ) );* )O8 )8F )<T )'b )Pp ):~ )1 ) )e ) ),dľ )6Ҿ ) )s )[ )Z  )j )t,& )o4 )qB )&P )9^ )l )z )DX ) )= ) ) ο )Fݿ ) )9 )R5 )  )o10 )8$F )$U ) d )`s )k ) ){2 )G4 )) )f )u )# )& ) )+ )%* )>7 )D )?Q )QHi )x ) )ƴ )  ) )0# )R )p4 ) )7 ) ) )3  ). )< )J )24X )^f )gt )D )_ ) ) )^  )v ) )j- ) ) ) )x) )`- )< )yK )X[ )j )y ) ) )( ) )|. )A )8' )- )TK )0 )V )- )< )2K )Z )>i )rx ) )% ). )  ) )6 ) ) )oN )h )4 )D )J )  )- ) : )G )`#T )c{ ) )' )+ )X  )P )% )U3 )QA )AN )G[ )'h )5u ) )W )0 )- )܋ )  )> ) )Z, )$9 )F )܋S ) ` )z )  )܋ )3 )  )a )3 )> )J )"Z )` )Uf )0m )w )I ) ) )Z )ߧ )W ) ) ) )= )B$ ) )kQ+ )CB )]VO )v )@  ) ) ) )ѝ ) )G )  )Z  )#F )`S )m ) ) )p% ) )> ) )|% ) ) )ѝ )\<. )A< )| U )8h )$Er )& )  ) ), ) ) ) )5 ) )0 )a@ )kQ )P )/u )# )  )/c )i )_ ) ) )[ )! )\  ) )_$ )s1 )8> )K )&X )e ) )P )U ) )a ) )Q )@ )?   )9 ):' )5 )nB )`O )\ )j )ĥw ) )X )" ) ) ) )- )  ) )0 ): )VD )Q )"_ );m )z ){` ) )# ) )b ) ) )Z )ܓ? )AAK )D` )- l )  )C' )b ) ) )" )0 )5; )Ǹ )" )~ 0 )> )mXL )}Z )h )v )[ )B )D ) )fB ). ) ) ) )* )ڻ )=M. )T= )͉L )3 [ )x )/( )$ )¤ ) )+ )A ) )' )`? ) )L7 )I3, ); )xJ )<Y )bh ) )6 )(  ) ) ) )Z ) )  )` )* )FC9 ) H )0W )z(f )7u )E )S )c )" ) )  )t )@$ )Z2 )@ )M )-Z )g )u )8 )# ) )t )) )4^ ) ) )O ) )) )9 )(? )(E )/K )=Q )ÈW )Xg )u ) )} )B ) )s )[. )4 ) )L )> )ӏ( )^F5 )<B )'[ )h )v ) )<+ )"2 ) )R ) )6 )_ ) )k  )4 )ǟ$ )2 )@ )QN )m] )X )B )8 ) )t< ), ) )  ) )  ) )͍$ )a1 )> )5K )3X )pe ) r )@. )= )6 )e )9Y )0 ) ) )< )+I )'Y ) ) ), )k: )H )M\ )j )#x ) )+O ) )< )! ) )+ )9 )G )޼U )Hc )Lq )f )S ) )gG )Z ) )R )` )Nn )P| )+ )h ) ) )F# )PP )~ )mL ) ) ) )3$ )2 )LA )=O )] )Rk )SMy ) )4  )m )3 )K ) ) )% ), )6T% )c3 )A )`O )I] )Mk )Iy )! ) )5 ) ) )l )' )6 )K )F )  )" )MN0 )"1 ) )# )u1 )? ) )/ ) )$ ) )_ )e\ ) )+ )9 ) G )U )Gc )*q ) )0 ): ) ) ) ) ) ) ) )"* ) )" )ߵi )v ) )U )< ) )X )  ) )u3 )# )- )7 )=F )T )Ub )Bp )~ )Q )WF ) ) )@/ ) )M ) )'M )k  )N )3& )4 )B )P )1^ )HOl )'z )h )K ) )S )YQ ) )޹ )x )f )@ )  )T5 )`,C )@-R )} ` )fn )| )' ) ) ) )c ) ) b ) )  )3 )1,@ )HMO );] )lk )ݑy )n )E )T )θ )X )C )* )! ) )R )]O+ )9 )cG )U )"c )?Cq )uR ) ) )G )K )  ) )" ) ) )V  ). )1= )V )70e )G-o ) ) )Y ) a )f )i; )) )" )6 ) ) ) ),  )- ): )iG )m.T )a )*n ){ )  )P )P ) )* )L ) )P )@ )N )ik )) )^ ) )_$ )j ):w )! )@_ ) )$P )Nj )w )| ) )}9 )M ) )  )Z )@ )\q )Q )h )1 ) )x! )+ )  ) )4Z ) )  )[ )C )> )V  )! )& )? )ǗL )[ )qj )Hy )X )5 )? )* )\ )< )N ) ) ) )/ )< )FI )V )c )p )} ) ) )O ) L ) ) )~ )3 ) ) ) )  )+, )8 )D )ĚQ )^ )\k )x ) )& ) ) )6 ) )8 ) )E )U )$ )! ). )X=; )!H )>m )z ) )] )N )^F ) )] ) )7 )}# )]1 )-? )"M )[ )5i ) w )Ӊ )#. ) )ٜ )M ) )K! )P )@/ )" )\& )N? )@L )NY )Ng );u )  ) )܋ )  )#. )  )ͼ )e ) ) ) )& )װ )( )>;5 )jB )O ))Z\ )C )m )$ )> )] ) ) ) )" ) )\# )1 )Ӊ? )M )ٜ[ )i )K!w ) )YE ) )B( )5 )܋B )O )\ )o )| )- )YE )> ) )! )@ )N )V[ )-h ) )' ) )% )> ) q )~ )> ) ) )$ )~)1 )wW> )bV )Sp )\W ) )ݚ ) )Q )k )O  ) )֧$ )1 )i/T )~a ){ )$ )T )  ) )" ) )B )'= )9 ) )) ) ) )] ) )H ) ) ) )ֹ )  ): )oUH )7RV ) d )Zr )ߜ ) ), ) )U: )0 ) )( )05 )B )O )\ )4"i )v )e ) ) )e )A, ) )> )  )  )ZH  )AaU  )fo  )>|  )  )  )!  )  )  )O  )>  )  ))  )  )"  )K1=  )ǗJ  )g  )bt  )-N  )x  )  )7  )  )"  )  )  )!  )!  ).  )f<  )gJ  )eX  );f  )t  ))  )9  )F:  )P  )  )   )Z  )7  )  )~K  )4(  )!7  )ybF  )U  )gd  )s  )mD  )  )  )  )4"  )  )-  )f*  )\  )  )rC&  )6  )F  )L'V  )lf  )v  ){  )  )  )  )d  )D  )  )  )B  )H  ) )% )?3 )ԓA )O )] )k )y )G )Ja )~W )k )N ) ) M )[ )& )( )= )=MO )U )-[ )a )g )?n )L )S* )‡ ) )* )  )T )  )W ) )Xa )  )4d ):  )  )[( )+7 )F )U )Ԏd ) s )K )` )O )k )Vx )  )4 ) )c )6 )? ) ) )4 )I )3 )@d )! )ݝ; )X=J )-7_ )O ) ) )f ) )c )P ) )$, )9 )>F )>TS )T4` )m )Yz )' )  )h  )|P ) ) )! ) )B )H )!  )[ )/ )*[ )h )> )c ) )q ) )@ )T )h  )|P ) ) )B )H )+ )D )l )4" )> )8D ) )= ) )Q )? )- ) * )!7 ) ) )> ) )  ) )- ), )I\2 )S8 )II )U3Y )$ ) )- )̔ ) ) )v1 )i! )  )p )? ) )D )  ) )P&  )އ. )@< )J )yQY ):4g )u )Z ) ) )/- ) ) )!^ )  )9 )] )N )  )r ) )  )= )R!  )& ):  )8. )<< )J )8&g )p{ )DY ) ): ) ) ) )w )އ  )@ )1 )f*; )J ) W )Va )~$n )6~ ); )K )j )( ) ) )9L ) )Q )TA ) )  )- ): )?G )T ) Xa )Rn ){ )Q ) )R ) )Z ) )t )q  )#S  ) )' ) )  )܋  )#"  )/  )=  )gL  )Z  )!h  )8v  )ō  )   )L^  )Aa  )#  )  )  )8  )! )! )! )c,! )>:! )Y8I! ) X! )w! )! )q! )<! )?!! ){! )! )! )# ! )M! ) " ) 8" )E" )#BS" )]" )l" )" )$" )" ){" )H" )q" )0" )" )" )# )4"# )"# ) 0# )6># ) L# )GcZ# )h# )jv# )# )# )M# )# )M# )f# )# )f# ) $ )~K$ )K $ )m>.$ )4.>$ )N$ )Q^$ )2n$ )~$ )2$ )$ )&$ )b$ )$ )JX$ )b$ )$ )% )% ).% )x>% )L% )Z% )h% )XHv% )%% )PO% )&D% )% )y% )Aa% )=?% )Ib& ),& )-.& )>& )N& )U^& )En& )~& )/& )^& )& )V& ))& )2 & )E& )ZC& )I ' )' )0].' )>' )N' ) ^' )Cn' )~' )B' )*+' )' )S' )Y"' )á' )8' )M' );( )}( )ֶ.( )p>( )+N( )&^( )n( )9~( )( )g( )@( )/( )m( )^( )( )( )) )͟) )&) )5) )cD) )b) )Iq) )!) )) )) )>) )N) )) )<) )) ) * )w* )* ).* )=* )5:[* )j* )9y* )w* )8* ) * )Gc* )* )>* )* )h * )* )B + )H+ )&+ )4+ )B+ )KP+ )^+ )l+ )z+ )f+ )*+ )0+ )]+ )G=+ )s , )#, )`%, )3, )(A, )ӉO, )ٜ- )}<- ) !- )܋0- )=- )(K- )cEY- )c%g- )t>u- )7- ) - )H- )?m. )'}. )k?. )`. )^. )V. )}. )t. ) . )*. )g_*/ )7/ )M]/ )=/ )X/ )/ )/ )Q/ ) / )&1 )M831 )a@1 )>M1 ) Z1 )Bg1 )t1 )ӈ1 )\R1 )1 )O1 )31 )1 )z1 ){1 )1 )X/1 )G1 )!V2 )d2 )Bq2 )o~2 )2 ) 2 )&2 )2 )޴2 )2 )z2 )O2 )2 )23 ) 3 ) 3 ))'3 )GT43 )3A3 )N3 )0[3 )\h3 )=u3 )3 )d 3 )3 )3 )G4 )#4 )14 )?4 )FM4 ) [4 )#j4 )?w4 )NL4 )4 )F4 )4 )/4 )')4 )P4 )4 )F4 )5 )5 )  5 )yL-5 )E;5 )I5 )FW5 )e5 )s5 ) 5 )E5 )%5 )H5 )5 )F5 )G"5 )<5 )&5 )E6 )bT 6 )6 ))6 )F76 )E6 )]T6 )'[a6 ) n6 )F{6 )6 )m6 )g6 )6 )D7 )BS7 )`7 )\m7 )Wz7 )7 )7 )n7 )`7 ) 7 )7 )!7 )7 )7 ) 8 )8 ) #8 )w@18 )?8 )G"M8 )Z[8 )i8 )w8 )U(8 )v8 ) >8 ))8 )C8 )8 )ߨ8 )\9 )9 )L"9 )O09 )W?9 )\9 )j9 )mx9 )9 )9 )eU9 )9 )9 )9 )M9 )m9 ) : ): )@%: )q2: )@: )mN: )<]: )0j: )Dx: )m: )<: ): ): )7: ): ): ) : )r': )/; )ED; )m ; ) .; ) <; )J; )ܸX; )bf; )<t; ); )O; )); )3; )g; )^; ) ; ); ); ))< )3< )=< )f:*< )9< )+V< ) d< )s< )< ) < )Ld< ) < )< )0< )< ))< )< )= )`= ) ,= );= )4H= )RU= )1b= )@p= )f~= )`= )= )%= )m= ) = )= )= ))= )3= )= > )> )G'> )Q5> )YD> ):R> )[`> )n> )}> )<> )> )> )> )%> ):> )A> )z> )> )  ? )@? )(? ) 6? )E? ) R? )%a? )mo? )}? )NC? )1? ) ? )? )? )? )@ ) @ )@ )'@ ) 4@ )A@ )G"N@ )Z[@ )h@ )u@ )Q@ )aM@ )<@ );@ )@ )@ )-@ )@ ))@ )@ ) A )N A )(*A )8A )yFA )PTA )bA ){A )wA )A ) A )A )A )@A )hA )@A )VA )B )1B )U"B )M$1B ) ?B )MB )[B )iB )/wB )PB )]B )CB )0B )]B )c$B )B )ϣB )C ) 0C )*LC )YC ) fC )]sC )C )wC )C ) C )C )e,C )C )C )FC )fD )"D )/D )GRF )wG )G )!G )/G )c=G ) WKG )dG )@HnG )^}G )aG )G )]G )G )DG )G )G )NG )wG )H )CH )!H )=/H )I=H )KH )aYH )5gH )ZuH )H )-H )-AH )TH )H ) H )<H )=H )H )I )I )8VI )d+I )t9I )GI )hUI )AcI )qI )(I )FI )!I )AI )I )9I )I )iI )I )FI )l" J )J )*'J )[5J )GDJ )tJ )J )J )SJ )bJ )J )B8J )OJ )J ) J ) K )lK )(K )6K )DK )MRK )`K )SnK )AF|K )ƏK )БK ))K )#K )2K )K )CK )pK )[ L )%L )%L )?L )LL )YL )ufL )L )L )L )L )JL )L )`L )}L )L )L )M )˜M )/M )VM ) cM )pM )}M )1M )HM )3 M ).M )`M )5M )DM )M )[M )N )N )0-N ) AN )KN )!UN )mb_N )_]N )N )N )mXN )+N )OcN )mDN )N )N )eO )O )1#O )1O )?O )MSO )_(aO )oO )~O )O )O )O )vCP )QP ) WKQ )[Q )aQ )ֱhQ )Q )Q )QYQ )Q ):Q )?Q )BQ )Q )Q )YR )1R );2R )NfR )yR )ZR )ޟR )R )MR )vR )R )R )DR )e S )S )r*)S )o8S )GS )VS )KeS )btS )S )mS )S )S )mDS )S )`S )S )S ) T )0T )z((T )=T )GT )ƻXT )^T )pT ) ~T )zT )T )T )T )NT )2T )؉ U )V )V )/V )BV )JV )fV )oV )V )>V )BV )V )EV )']W )Z&W )'4W )AW )"NW )r[W ) hW )uW )ΚW )2 W )W )"W )mXW )3W ) &W )cW )}W ),W )X )2*X )]7X )DX )H]QX )^X )hkX ) xX )q&X )tBX )fX )0X )AX )X )<X )<X )'<X )a Y )aY )a(Y )a6Y )DY )\ZRY ) Z`Y )oY )^5~Y )Y )Y )rCY )DY )#Y )`Y ),Y )_Y )HZ )Z )#Z )dBZ )#>QZ )`Z )oZ )Q~Z )8Z )Z )-Z )gZ )Z )BZ )Z )<Z )Z;[ )D[ )#[ )$2[ )aA[ )߷P[ )_[ )n[ )}[ )_=[ )b[ )5[ )[ )4[ ).[ )>[ )[ )f\ )\ )"\ )1\ )d@\ )RO\ )^\ ) m\ )6|\ )\ )a\ )M\ )I\ )}a\ )?\ )\ )j\ )\ )W ] )] ))] )8] )4G] )V] )e] )#u] )] )b] )K] )[] ),] )] )l] )] )o] ) ^ )l^ )8*^ )N9^ )I^ )/X^ )Lf^ )t^ )e^ )^ )ʓ^ )'^ )^ )S^ )W^ )'^ )^ )M_ ),_ )o_ )_d*_ )FC8_ )G_ )cV_ )Ve_ )֟t_ )>_ )t_ )_ )ͫ_ )E_ )M_ )_ )_ )|C_ )\ ` )` )(` )Z7` ) F` )-U` )*d` )s` )I` )` )` )\` )` )d3` )` )%` )HAa )Ba ) a )^0a )Q]@a )Pa )`a )oa )~a )Pa )ݏa )a )a )a )Xa )4a )ab )Wb ).%b )J4b ).Cb )Rb )H]rb )cb )Sb )rb )ōb ):>b )2b )WFb )c )wc )j&c )6c )l)Ec )!Tc )|Ccc )Vrc )hc )c )H]c )2c )c )Vc )c ):c )vc )" c )c )"c )Y d )>d ) %d )5d )R^;d )Ad )Hd )Vd )cd )pd )Q_d ):d )Yd )d )6d )}d )d )Gd )6Nd )Xd ); e )Ue )D3e )Vb@e )XMe )_Ze )TBge )t#te )e )e )e )9e )V7e )ve )e )lAe )#f )r f )>f )Oc%f )G2f )?f )Lf )>Yf )ff )sf )%f )f ),f )Wf ):f ) 'f )r^f )1 f )Kf )f )g )g ):g )F*g )18g )' Fg )Tg )2bg )% pg )G2~g )g )+g )g )g )g )]g )0g )g )|Ch )h )h )-h )Zl )Dl ).Jl )Pl )cVl ); \l )bl )t/hl )ol )|l )l ),l ) l )l )8l )l )l )yOl )ym )Am )m )5-m );m ) 8Im )$Wm )Wem ) sm )m )/m )H]m ).m )ym )܋m )m )n )#,n )܋9n )Fn )Sn )Mfn )sn )in )#n )n )`n )n )xn ) n )}n )Do )Jo )]#o )Z0o )x=o )oI[o )"ho )U(uo )]o )3o )[o )xo ),o );o )o )Op )B p )'p )a5p )mCp )Qp ) _p )mp ){p )p )p ))p )p )p )3p )}p )mp )  q )q )&q )4q ))Bq )3Pq )E^q ) Elq )=zq )Gq )I(q )Cq )1q )Uq )<q )kq )~q )q )[r )5r )Cr )܋Qr )_r )mr )g{r )r ) r )r )Er )܋r ) r )3r )r ) s )2s )H(s )&6s )Ds )Z Rs )_`s )ns )|s )s )s )s )&s )s )Ks )Ws )]s );t )0t )wt )O*t )yQ8t ) Gt )Ut )2ct )rt )t )/t )yt )ۺt )t )t )5t )Kt )(at )t u )%!u )܋)u )7u )DEu )Su )au )Tou )}u )u )u )3u )tu )u )-u )*u )bv )+v )D5v )XU,v );v )Iv )\Wv )kv )A_yv ) v )Yv )Bv )Ov )Cv ),v )B%v )>v )#w )w )8"w ))0w );>w )Lw )܋[w ).jw )܋xw )7w )8w )>w ) w ) w )|w )Kw )Qw ) x )kx )x )U-x )O;x )XIx )Wx )Lex )tx )x );x )Rx )tx )HRx )x )x )Wx )x ) y )y )ӕ(y )7y )Fy ):@Uy )dy )sy );y )y )y )y )yXy )>y )>y )y ),y ) z )lz )'z )6z )HEz );9Tz )cz )rz )z )^z )z )SSz )[z )!z ) z )=&z ).\z ){ )M{ )&{ )5{ )D{ ),1S{ )b{ )!q{ )v{ )d{ )"6{ )F<{ )%{ ){ )pS{ )_{ ){ )L:| )| )%| )4| )c"C| )R| )a| )p| )b1| )| )| )a| )S| )7| )b| )| )l| )6} )} )Ş$} )3} )ڳB} )+,Q} )X`} )o} )~} )>} )>} )} )J} )} )O} )Z} )/Q} )^~ )71~ )ӡ&~ )5~ )D~ )#S~ )Qb~ )]Dq~ )3~ )Ɛ~ )~ )~ )*~ )4~ )x~ )T~ )~ )? ) )% )`4 )5C )?R )Aa )p )3 )V ) )c ) ) )  )p )KF ) )  )m$ )3 ) B )/Q )` )-o )~ )m )a ) )U )Kɀ )E؀ )$ )R )ݩ ) )x# )2 ) "A )GP )^_ ) n )} ) ) )/! )i )Oȁ )vׁ )na )/ )w )0@ )" );1 )@ )4O )D^ )Wm )| ) ) )- )O )ǂ )ւ )> )B ). )C )! )0 )'? )N )] )ȷl )0/{ )< )2 )g )W- )Qƃ )Ճ ) )  ) )M )L  )/ )$0> )TM )\ )_k )t z )< ) )E ).U )ń );Ԅ )Z )( ) ) )^ )b. )<= )yL )b[ )Oj )y ) ) )8 )- )są )Ӆ )S )Q ) )45 )B( )#6 )޲D )dFX )A )@ )p )  )tG )n )> ) )ׇ )%$ )W ) )+  ) )W) )}7 )G"E )ZS )WNa )U(o )v} )a ) )m ) )È )$Vш )~4߈ )$U ) )>  ) )% )3 )aA )IO )(] )3Bk )χy ) )v )ܸ )G )s  )#CΉ )Z܉ )G" )Z )5 )S )@# )B%1 )i@ )N )\\ )j )x )? )Ɋ )  )jj ) )& ) )N9ˋ ) ) ) )J )V: )IB )GY ))p )|v )Q| ) )m= )0nj )͌ ,΍ +Q +E )0 + + )q  + + )H$ )/ +3 +@ +QD +EI )T +X +] )%h +l +q )4{3& )՘ )G )ō`2΍ )'ۍ )2 )'  ,  )/E+ +,/ +*8&A&Z +<^ +:g +<k +:t +<x +: )2 )'$& ,͎ +Lю +Jێ& , +` +\ + +{ &'&'F('O('l +p +y +} +3'5'5'Ǐ +ˏ +ԏ +؏ +ݏ@'2&&/G'<Q}d3~V 3X|Ԑ3 )T , + +# )9. +*2 +B +uF +cK ))V +Z +_ )Ho )<z +~ + +9 +- ) + + )% + + )4Ƒ3Ց`% )՘ )G )@3 )'&5 )B3K )'Xb ,k )/Ev +1z +//%/% +A +? +A +? +AÒ +?ϒ )ܒ3 )'~$  , +Q +O&%/ ,> +eB +aK +O +T"%l%%% + + + +%ړ%% + +  + +%+$C`%b%o|3AєV 3]X|37 )= ,4S +W +\ )g +2k +&p ){ + +l )H ) + + +} +g )ĕ +ȕ +͕ )%ؕ +0ܕ +" )45j# )՘ )G( )5 4> )'KZ )g`4p )'} )4 )' ,v– )/E͖ +tі +rږA#A# + +  +  + + +& )34< )'IW"` ,Ko +s +})# ,[ + + + +4#×#ۗ$## + +' ++ +0#I#R#o +s +| +% +##"j#ј$ޘv|5$9V L5VkX|~5X|5љ ) ֙ ,ߌ +> +2 ) + +z )H )  +$ +) )%3 +7 += )wD+!M )4W5eV!s )՘~ )G )@5 )' )˚5Ԛ )' ,$ )/E +O  +K  !!* +g . +e 7 +g ; +e D +g H +e T )`5i )'u  , +w  +u K! , + Û + ̛ + Л + ՛V!!-0!9!T + X + a + e + j""" +  +  +! +!Ü"ޜ!! "&'"3H(|[5k"X|5IV 5 )L ,Ȍ +(! +! )H +i! +[! )% )y/ +!3 +!8 )4B08P )\@7e )'q( )7 )' F  )/Eʞ +"Ξ +!Ӟ )2ݞ +" +" )Ͷ +"" + " )  +3" +1"  ) +C" +A"F 0 )ʢ@ ) K )V )"g )0<s )P>F F  +S" +Q" +c" +a" +c"Ÿ +a"˟ +t"ϟ +r"؟ +S"ܟ +Q" +t" +r"  )/E +" +" )2# +"' +", )Ͷ6 +": +"? ) I +"M +"R )\ +"` +"e v )ʢ )  ) )" )0< )P>ʠ Ӡ  +" +" +" +" +" +" +" +" +"" +"+ +"/ +"< )/EG )2R )Ͷ] ) h )t )ʢ )  ) )" )0< )P>ǡ )ӡ7ܡ )' )8  )'"Z @ Mb{u08E ʢ08ԢV 08|> )V2E ,Z + #^ +"c )Hm +s#q +c#v ) +# +# +# +# ) +$ +$ ) +*$ + $ã )4ͣ7ۣ| ) 6 )' H) )4L3 +Z$7 +V$< )<,F +|$J +v$S\s +$w +$ +$ +$ +$ +$ +$ +$ɤ +$ͤ +$֤ +$ڤ +$ + % +%- +'%1 +%%: +8%> +6%D2c ,l )/Ev +J%z +F% )2 +i% +e% )Ͷ +% +% )  +% +% )¥ +%ƥ +%˥Pܥ )ʢ )  ) )" )0< )P>0P9PP +%T +%] +%a +%j +&n +&w +%{ +% +& +& +& +& )`6 )'æ@Ҧ )՘ݦ )G )6 )'8 )*63 )'?0M|V|q +(&u +&& +:& +8& +L& +J&ԧt| "7E J7U2jV 7Ip{7eͨH{7 )u ) ) )h- ): )H )MW )Qh )u )Ϧ )& )K ) )- )ȩ ) թ ) )՘ )G )] )  )5 )MK ) Z )g )t )A )X> )J )g )G )~Hɪ )Hת )H )H )H )| )I% )0 )=I@ )VIN )J\ ))Jj )BJx )[J ) )J )J )X )J˫ )ګ ) ) )X> )E )F" )F0 )G> )GM )5G\ )NGk )9z )zG )G )3 )3 &:L )Қ *C *_C , 'Ȭ ) )5 )>l ) )f, )G" );, )rs: )o? )M )R )uj )v )x )hA ) ) )- )4' )5 )/: )F )xR )^ )cj )Pv )* ) ) ) )r )2Ů )̮ )9Ѯ )ݮ ) )= )Y )%@  ) ) % )e1 )= )I )U )mh )m )yy )= ) )&m );4 ) ): )ͯ )l)ٯ ) )- ) )Cg  )4 )! )rp- )79 )QN )W\ )q )W )i: )h )a )K) )Ű ) Ӱ ) )a ) )o# )a0 )Y )  ) )6 )  )ȁ )fDZ )\ձ ) )B )a )?  )"< )v ) )7 )E )D}S )a )o )~ ) )f )i )6 )Ų )oӲ )  ) )d )b  )- )' )T5 ),-R )Sa )jp ) ) ) ) ) )ʳ )Nٳ ) ) ) )۩% )n>4 ). C )B)R )a )1p )fs ) )F )| )Ō )gʴ )ٴ )( )1 ) ) )6>$ )3 )B )x Q )` )io )n~ )A ) )u ) )8ɵ )ص ); ) ) ) )/# )2 )A )ZnP )V_ )Bn )} )$ )f{ )mj )@ɶ )ֶ )m )' )- )r: )7a )s ) )5 )g )E ) ) )˷ )׷ )u )S ) )  )r )% )>}2 )@ )\ )j ) x )d ) )If )N )ɸ )aָ )V ) )j )e )ۿ' )@-; )oX )~ )> )C )֡ )1 )7 )̹ )%ٹ )_ )g )>} )$ )b* )Ǧ0 )6 )= )J )dd )q ) ~ )} )@ ){ )( )ʺ )t׺ )Ӗ )̻ )q# )>}J ) ] )O-k )By ) ) )f )z ) )ͻ )ݧۻ )ə )uw )O )z ),! )D</ )= ) K )Y )g )Su ) ) )4 )P+ ) )ɼ ).׼ ),( ) ) )Q= )} )c+ )ޟ@ )M )q )N} )< )  )y )| )ƽ )Pҽ ) ߽ ) )n6 )1 ) )n6" )l"X )/ ) )) )N )%Ӿ )} )  )l"= )/J )u )b0 )>}P )y] )Dj )nw )t )N )K )z )W{ )W   )=, )8 )[ )~ ) )& )& )m ) )4 ) )  )>}: )G )U )b )o )]| )l; )D )N ) ) )8 )  )$ )7 )2/  )>} )&& )#4 )oB )3P ))^ )Vl )z )= )^ )r, )ΰ ) )p< ) ) )x' )u6 )E )T )c )fr )f ) )ն )Q )- ) )L )ó )& )]/  ) )ԫ' )mh6 )RE )CT )>c )zr )7n ) n ), )q )| ) ) ) ) ) )s )& ),5 )D )S )1q )` )K )R? )( )s; )| )׊ ) , )9 )L  )0 )Y) )n9 )dI )`0Y )$i )]y ) )? )@  ) ) )n )p )r )A ) & )r5 )=~D )ajS )b )q )R~ ) ) ) ) ) )]g )  )@h )u )= )+% )ы4 )C )ұR )a )hp )k )[ )d ) ) )_ )t ) )" )9 )Q ) % )4 )13C )?R )Aa )jp ) )j ) )  ) ) )  ) ) )@ )p# )2 )A )=P )m%_ )Ҩn )B} ),2 ) ) ) ) )K5 )z )Æ )ѳ ) )" )‰1 )@ )O )`^ )\em )_| )h )! ) )B ) )A )( )1 ) ) ),! )0 )? )N )] )6l ){ ); )  ) ) ) )& )z )Z ) ) )S|  )/ )F> )oM ) \ )k )z ) )a )z )s )` )k )q )& )i ) )&  )H/ )> ), M )r5\ )ߦl ){ ); ) )2 )z ) )5 ) )L3 ) ) )  )/ )l> )1M )\ )k )yz )Zt ) ). )2 )i ) )% )X  ) )  )A/ )U> )M )\ )'k )Bz ) )H )y9 )\ )U )ҩ )D# )f ) )! )ߒ# )2 )1A )Q )` ) )x  )B )N )r ) )= )k  ) )w: )H )<V )d )M4r )~ )\j )# )i )V ) )= )- )P) )*? )M )$a )o )p} ) )X )[ )t: ) )! )L )  ) )   )  )#& )? )L )S5Y )jl )u}y )P )t )d )>} ) )@ )o ) ) ) )n )G  )& )7, )B2 )8 )!> )D )J )}P )}V )\ )` b )@h )n )Dt )2z )G )d ) ) ) )g )! )6 ) )Z )h ) )5 )e! ). )m; )# )[ )@/M )Y )v )> )z ) )[ )#B )( )1 )[ )% ) % ) ) )M )ޡ )u* )8 )F )T )s )e ). ) ) )2f ) )  )) ) )$ )>3 )qA )O )] )Ԥy )f ) ) ) )j ) ) )d  )  )   )#.. )>< )'J )X )f ), { )< )@ )q )~ )e ) )a )/ ) p4 )> )S1L )>}Y )_f )1s )7 ) )Q )k ) )q )  ) )a )P ) ) )] )m )a2s )|my )F )J )>} ) ) ) )r ) ) ) ) )n6: )d)G )NZ )?q )~ )& )  ) )n6 ) ) )" ) )E  )uw ) ' )>` )8m )>}z )Eo )@/ ) ) ) )- ) )1t )  )t )  )< )& )+ )8 )TF )P )] )wk )x )m )  ) ) ) ) ) )B )5 )! ). )r,; )$H )V )bd )q )=~ ) ) )b )= ) )8 ) )X )? )W  ) )ϯ) )A/ )6 )D )XR )w_ )7l )@y )f )L ) )x )ʴ ) )r{ )d)  ) )# )i50 )-C ))P )4] )?j )7w )>} ),2 )k< )- ) )‹ )= )   )B )i' )3 )@ )7M )X[ )L3h )vu )̚ ) ) ) ) ) ) )  )& )e# )0 )DE )R )Ni )v )\h )3 ) ) )N )3 ) )N )Cq )Є  )!# )0 )= )T )a )x ) )k )# )r )z ) ) ) )D,  )0 )= )ŹJ )WX )=e )-q )3y )k ) )z )ʐ )7- )#i )Ug )Y )  )Q )" )3/ )i< )J )W )d )fq );~ ) ) )o )o )- )K ){g ) ) ) )-* )q8 )E )R )y_ )%m )4z ){ ) ){ )T )j )) )2 ) ) )< )t  )A )% )'C )Q )_ )l )z )& )-{ ) )e )>} )$l )H )l ) )H| )1' )l5 )A )2N )l\ )q )l~ )S ) )> )# )ұ )+ )ы )S )'( )2. )п4 )%: )[@ )tjG )U )lc )Pq )f )+ )ы ) ), )9 )C )y )  )>  ) )u* )9 )NG )U ),c )}q )4 ) )K ) ) ) ) ) ) )  )@  ) )) )%7 )<E )S )>a )yo )} )j )3 )m )W ) )~ )le )2) )27 )  )ɪ )E{% )3 )A )wO )n^ )ͭm ){ ) )c )> ) )- )^ )a  ) ) )< ) )}$ )ݴ2 )O@ )jN )\ )3j )x ): ) ) ): ) )*k ) ) )' )^ )## )7 )] ) l )b{ )4 ) ) ) ) ) )c )>} )8 )  ) )2+ ); )Y>K )![ )k )z ) )  )m )n ){ )e ) )8 )& )'@ ) N )g\ )Άj )By )t ) )a ) ) )E ) )Ó )E! )/ )'= )6K )y(Y ) g )u )| )< ) )>} ):t ) ) )$ )o  )̚ ) )S, )F )S ) ` )` z )? ) )  ))  )Q )2/ )  )B8 )$ & )03 )@ )hM )Z )Og )Hmt ) ) ).: )t ) ) )  )ʂ )B )7 )  ) )r ; )2/H )\ )qv )7 )B )  ) )5 ) )f )>}  ) )13( )Z)2 )< )=F ) P )^ )ik )kx ) ) ){ )$ )l ) ) ) ) )~s )- )>} )L! )0 )? )L )HY )f )t )^< )At )t ) )h )8 )) ) )   )+ )ы' )+5 )C )Q )_ )ұm )k{ )[ )3 ) j ) )_ )} ) ) ) )E ) )# )1 )!? )M ):[ )Ui )fw )'# ) )> )l )< )6 )6 )1 )#} )8/ )̚ )" )5 )m%? )/0I )‰W )e )my )fi ) )!h )M )/ ) )p )T )s ) )` )m! )6 . )B; )SH )LgU )}b )Go )@ )\e ) )_ ) )i )[A )0 ) ) )z )z0 ): )T )C^ ).h )klv )L )* )  ) ) )U  ) )S ) )i )  )0 )>}  )f. )< )X )f )at )ҟ )| )/ )R ) ) )V ) )f )  ) )') )k7 )S )$ln )| ) ) ); )! )f )3 ) ) )4~ ) )K" )", )6 );@ )y9J )T )of )Ms ) )| ) ) ) ){ ) ) )5 )! )< )^ )׉! )>z. ); )oH )i )4v ) )8 )r, )) ) )u0 )Ӏ )p* )6 )| )ö )42" )_5/ )4.Y )e )9 ) )+~ ) ) ) ) ) )k< ) )J~ )g  )2 ) Y )qf )s ) )  )A )) )3 )3 ) ) )6 )s )k )  )y, )_9 )>}F )R;S )` )4n )3 )A )S ) ) )6= ) ) )t )m )& ); )B G )FyT )g )t )[ ) )̚ )B )5 ) )η )Q ) )u ) )ˮ )S, ): )[ ){4h )8u )4 ) ) ) )V )5 )6 ) )M  )f!  ).  )>}l  )z  )N  )t  )R6  )S  )$  )  )  )  )  )  )  )y  )jV  )sc  )Sp  ) 8}  )-  )  )  )  )  ){7  )  )  )  )2  )X&  )3  )Vi@  )M  )SZ  )g  )/t  )  )  )6<  )   )  )  )  )%  )or  )O   )@  )~  ))  )g-  );  )zd  )*sz  )P  )3k  )J  )  )9  )H-  )  )2  )  )!  )B"-  )]:  )a  ),p  )}  ):u  )  )  )D  )߯  )Pj  )܃  )}v  )Cj  ).  )  )1  ):9  )4 )f ) )+, )+? )L )d )\r )Ce )xk )4 ) )7 )* )= )w )a  )}" )r/ )?X )!e ) s ) } )q )S )̚ )i ) ) )" ) )>}  )S )i# )} 0 ) = )J )U.X )b )} o )8| )q )+ )g )u )N )}= )Qk ) ) )  ) )% )2 )? )KL )kY )sq )ѓ ) )Q )F( ) )r{ ); ) )R;/ )H )U )jb ){%p )m )* )y )! ) ) )  )N )>} ) )B* )I?_ )ou ) ) )= ) )Q )R; )' )>}; )I )r{] )k )y ) ) )G )Q )% )w ) )" )" ); )PI )YW )ce )s ) )4 ) ) ) ) )i  )B ) . )u< )gJ ) X ){f )t )  )2 )#1 ) ) )  ) )p ). )" )J )Vr4 )Q )[ )i )tw )6 )& )S )! )y~ )| )b )R ) ) ) . )+pG ) T ){ ) )t: ). )D< ) )9 )4 )B )N )ُ  )g )% )#3 )oA )O )6] )`k )y )v )H ) ) ) )7 )i )2 )37 )[fE )/S )na )io )Nw} )1, )S )3 ) )d ) )8q ) );p  )b; )% )3 )A )|<O )] )e*l )Ί{ ) )v )u ) ) )Y )w ) )D ) )t  ):./ )eM )e\ )u)k )z )i )& )© )( )J, )@ )>} ) )$ )B )  ). )?= )3L )[ )S|j )zy )( )! )u )9 )+ )^ )T )M )H& )0 )0? )I )ђb )gvt ) )>} )ܮ ) ) )" ):v ) )" )g.( ). )4 ): )?@ ) G )&6N )U )\ )#d )۠p )W| ) ) ) ) ) ) )  )2 )= )  )Q,  )-  ):  )mM  )Z  )g  )m  )  )  ),3  )  )  )O  )  )  )jt  )! )$! )2! )>@! )"N! )zq! )̚! )! )! )^! )p! )! ) ! )7! )! )'f" )$" )92" )N.@" )N" )R;\" )7j" )" )" ) " ) " )a" )" )S" )̚# )# )3# )4\# )~i# )|# )6# )# )# )l# )8# )# ))# )j$ )l $ )$ )M'$ )4$ );jA$ )їN$ )[$ )h$ )u$ )d$ )$ )Uq$ )׆$ )Z}$ ) $ )$ )T% )%% )% )+% )9% )G% )}U% )c% )q% )`{% )z% )% ))% )% )-% )o% )% )o% )z& )& )B& )-& );& )bI& )W& )8e& )s& )8 & )& )Cr& ).& ) & )& )E& )v6& )!p& ) ' )' )U(' )97' )F' )U' )k' )z' )' )' )' )' )' )' )( )( )( )3)( )6( )C( )P( )]( )fj( )Pw( )s( )( )h( )t( )}'( )8( )( )( )( ) ) )) )J0&) )4) )yB) )P) )^) )l) )z) )) )6) )Q) )r) )<) )) )) )>) )c) )p* )* )"* ) 0* )7 >* )L* )QZ* )i* )( x* )l* )R* )* )* )l* )e* )Α* )ފ* )+ )&+ )K+ )ą-+ )<+ )>K+ )&)Z+ )~i+ )؁x+ )f+ )+ )6o+ )V+ )n+ )+ )u+ )Z+ )P+ )>i, )Px-, )V<, )auK, )[, );,j, )ܬy, ), )x, )>, )Nz- )g- )Z~- )ϡ- )- )- )ť- ))>. )K. )6e. )Nr. ). )3. ). )!. )$t. )z. ). )>}. )m. ) / ) / )i)/ )6/ )6C/ )P/ )Q/ )w/ )X/ )i/ )</ )/ )/ )i/ )ig/ )S 0 )$0 )ig70 )#0 )q0 )f0 )0 )30 )0 )O}0 )'0 )P0 )0 )81 )b1 )1 )P,1 ) :1 )SD1 )IP1 )\1 )w1 )2/1 )M1 )41 )l1 )1 )41 )N1 ) 2 )z2 )@+2 )3'82 )D2 )8f2 )2 )9?2 )ۨ2 )+2 )2 ) 2 ) 3 ) 3 )4-3 ),:3 )NG3 )T3 )zk3 )3 )3 )3 )k3 )b%3 )3 )R3 )3 )4 )A4 )}4 )54 )B4 )mO4 )]4 )r j4 )2/w4 )4 )4 )p4 )S4 )A5 )5 )*>5 )Y+5 )95 )kG5 )FU5 ):b5 )o5 )t=|5 )5 ) r5 )|5 )5 )5 )5 ). 6 )_6 )U#6 )06 )=6 )|/J6 )sW6 )e6 );r6 )?6 )̞6 )6 )+6 )ы6 )6 )06 )p6 )6 )6 )a 7 )L7 )$7 )17 )d7 )rvn7 )7 )u7 )7 )7 )7 )7 )7 )?7 )_7 )7 )28 )0A#8 )B08 ))=8 )K8 )p8 )N!8 )$8 )8 )a8 )8 )F8 )w%9 )>}39 )B9 )P9 )^9 )l9 )z9 )9 )79 )69 )i9 )¸9 )9 )9 )"9 )$9 ): )t": )0": )!0: )>: )'L: ) Z: ) w: )*: )L: )f: ): ): ): )v: ).: ) ; ); )!*; ))9; )GH; )xW; )$f; )u; )f; )X; ); )sx; )#; )M; )ڰ; ); )C < )q< )(< )7< )>T< )od< )s< )< )T#< )< )< )*< )*< )T%< )1< )= ):= )F= )kb= )o= ) |= )8= )6x= )̚= ) = )|= )Aw= )> )!> )X2> )8> )^>> )<D> )J> )P> )h-V> ) t> )z> )> )> )s> )> )> )e> )7> )B> )C> )> )> )(? )j#? )*-? )E? )Q? )*g? )s? )l? )}&? )? )j? )Q? )r? )? ) ? )]? ). @ )0@ )p(@ )6@ )E>D@ ) R@ )`@ )n@ )||@ )xs@ )@ )@ )@ )7@ )"@ )c@ )@ )A )A )j4A )AA )%TA )NbA )oA )k|A )y@A )A )A )A )>A )A )A )A ))A ) A )W7 B )$B )&B )x3B )^@B )'MB )E7ZB )hB )vB )B )B )9B )+B )dB )B )B ),B )B )C )HC )r$C )C )C )ˉC )"C )˅C )afC )C )1C )0C )&D )9D )ĕD )D )D ),D )D )`D )D )eD ) E )E ).(E )6E )3*DE )RE )z`E )mnE )+|E )PE )E );E )>}E )slE )+E ):E )E )E )=F ))%F )4F )BF )gPF )oF )=2}F )BF )F )F )\(F )f+F )6(F )_F )F );F )% G )fG )&G )-4G )BG ))PG )^G )^lG )lzG ),G )_H )mH )>}{H )}H )jH )ޡH )H ) I )I=I )܎KI )SYI ):gI )uI )I )NI )I )sI ).'I ) I )!I )I )<I )J )^J )&J )+J )9J )aGJ )gUJ )nJ )FJ );zL )L )L )L )[L )# M ) M )6FM )9SM )`M )mM ){M )M )9M )o|M )gM )YpM )ńM )M )ūM )v&M )dN )-N )6N )*N )~8N )HFN )*TN )bN )|,pN )~N )N )kN )N )ehN )-N )?N )N ))N )nO )1O ) /O )%O )/O )9O )]GO ) UO )SqO )1tO )$ O ) O )DO )eO )qO )O )=O )ZO ))P )tB$P )>a )=a )+a )PFa )Pa )]a )ka )dya )̚a )a )a )6a )4a )>}a )k<a )w, b )}&+b )0Eb )D<Rb )q_b );mb ){b )D<b ) b )b )b )b )<b )fb ) b )ob )zc )uwc ),#c )}|k ). k )5k ))Ak )k )5k ) l )xl )X:l )G/Gl )Tl )bl )ιol )Y|l )l )_l ) l )ǘl )`}l ) 2l ) m )m ) vm )+m )"8m )aEm )oRm ) m ) m )m )n )yn )n )<+n )X;n )Jn )@Xn )fn )Ltn )qn )r3n )/n ):n )8n )%zn )o )_k!o )]:o )Io )o )to )o )io )o )o )o )ʥo )(p ) p )p )(p )_5p ) Bp )Op )\p )!ip )N2vp )+p ))p )`p )6;p )5p )p )"p )pp )p )?Yq )eq )Isq )q )&q )pq )qq )jq )*q )q )&q ) q )r ) r ).r ))r )&7r ) Er ) Sr )br )?*or )r}r )r )&r ) r )Ґr )r )jr )Or )?'r )r )& s ) s )5%s )(3s )jBs )i2Os )h]s )ks )&ys ) s )-<s )J9s )Es )&&s )s )s )s )~s )/s ) t ) t )%t )2t )FAt )Nt )jt )qxt )Nt )"t )t )";t )t )yt )Et )Gt )t )!u )u ) u )5.u );u )Ju )Yu )!gu )uu )u )5u )bu )-u )u )4u )@1u )au )h?u )v ) v )#.v ):} )L} ) [} )%h} )Nw} )} )%o} )\#} )} )} )0} )Q} )j ~ )~ )1%~ )3~ )-<B~ )3O~ )y]~ )&k~ )y~ )-<~ ){~ )-~ )~ )~ )B~ ) ~ )~ )oi~ )g ) )# )1 )ؙ? )#M )![ )0i ) w ) )} )F ) )J ) ) )# )6j )A )" )0 ) O )W&\ )9j )x ) )  ) )n ) )C4̀ )1ڀ )u ) ) )# )1 )? )M )%[ ) i )w ) )  ) )X )p )ˁ )ځ )W4 )1 ) )+ )5# )9 @ )OZ )g )t ) ) ) ) )ڭ )V:Ђ )(܂ )  ) )ï )a ) ) + )8 ) E )ΫR )_ )c~l )y )+ )2 )! )3 )> )I̓ )ۃ )Dz )F ) )ٗ )}! ):/ )5= )mK )tY )#wu ) ) )N )ʄ )ïׄ )a )u ) )  )  )Ϋ% ) 2 )? )M )"+Z )5g )Ft ) ); )h )ȅ )Յ )<  )n )>} ){ )t% )fB )0O )+\ )i )yv )G )>} ) ) )ǘņ )߆ ) )N  )~ )% ){3 )A )O )< ^ );m )| ). )jq )- )ofLJ )Vև ) )P) )ez )Ű )A! )0 )i? )N )$] )zz ) ) ) ) ) ň ) Ԉ )E; ) )# ) )! )1 )A )Q )sa )Mw )? )e )6 )>} )lʼn )҉ )R~߉ )I ). )  ) )' )،5 )vC )wQ )m_ )am )I{ ) )p )  )¡ )*j )ϊ )݊ )? )5 ) ), )־# )*1 )9? )M )M[ ) )* ) )M  )% ) )mċ )Ջ ) ۋ )d ) ) ) )ׄ )S )m )3, )?: )H )BW )a )sp )~ )  ) ) )l )Ɍ )(، )x? )w- )A )w> )w" )S0 )4> )L )Z )'j )xz ) )=  ). ) )'ɍ )A׍ ) )  ) ) ) )- );= )M )P] )+m ):} )? ))| )e6 )  )*͎ )ݎ )r ) )Q0 )Ь )H:# ),l1 )/@ )IO )8^ )m )| )] )} )6 )4Ώ )Sۏ ) )V )A )b )3 )) )#6 )BC ) (P )] )Bj )Dw ){ ) ) )ِ ){ )$ )e  ) )UB) ).7 )pE )! )$ )6 )E2 ) )qÑ )7Б )ݑ ) ) )C. ) ) )F+ )8 )wE )mR )_ )::l ) )v ) )6ؒ )B ) ) )  )  )2& )3 )C.@ )M )Z )wg )mt ) )q )} )  )6 )`$% )q2 )V? ) L )Y )f )ys )u )U )ú  )A )6' )4 )A ) N ) r ) ): )j1 )x ) )6 )N )͕ )8 )-m ){ ) 1 )rA )m )Ƽ{ )  )q ) )q ) )-Ö )ɖ )Ж ) ) )$ ) ) ) )d )}$ )*2 )@/A )zO ):] )8l )"v )Wy )  )B ) )< )k ) )I< )Ro× )ɗ )Osϗ )J֗ ) )  ) )]x ) )a )$ )2 )O )c )b7m ):y ) )| )ԕ )P ) )d )} )>} ) # )ķ2 )? )(O )qU )[ )ia )Nh )x )~ ) )= ) ) )Qu ) )Q  )=% )2 )+X )5 )6 )i ) )o/Ϛ )ܚ )! )1 )7 )= )bD )k )x ) )) )- )/ )a! )-Ɯ )]Ӝ )b ):{ )&v )I )?6 )zw! ). ); )ўH )0U )"b )z )f )| ) )0 )͝ )gڝ ) ) ) )-ȟ )}՟ ) ) )B )0 )[$ )7 ) E ){R )x _ )ףl )z )k ) )z )Kq ).Š )aӠ )I ) ) ) )% )$2 )@ )L ) a )m )Z )9 ) ) )H )c )̡ )yڡ )s ) )Ƀ ) )l}! )0 )? )TN )N] )o )o )  )lʢ )Sע )h ) ) )`  )= ) % )) = )2I )aS )` )e )N )6 )' ) )wǣ )ԣ ) ) h ) )+ )H9 )qF )3S )4` )m )b> ) ) ))  )hϤ )Rܤ )9 )s )b= )+ )/ )޲? )E )K )Q )X )e )>}r )Fx )'7 ) ) )c )W )Υ )ܥ )a )D< )  )  )z" )$40 )> )L )AZ )/h )v )ʣ )  )M )B )D5 )eզ )l'ߦ )d ) )[ )< )ǘ )$%, ): )N )+[ )Sh )tv )# )>} ) )' ) )@ʧ )Hا )68 )-z )  ):! )0 ), ): )H )V )d )r ) )b4 ) ) ) )ƨ )Ԩ )j )G ) )o  )! )s( ).6 )kD )ŨR )` )&n )0| ) ) )9 ) ) )v )ǘ ) )- )7 )E )_-S )a )2o )d} )e ) ) ) )uwê )vѪ )~ߪ ){ )l )n  )J  )G% )B3 )L );V )o )39| ) ) ) )` )ʫ )׫ ) )* ) )} )o+ )8 )>E )R )J_ )ol )y )z )f )cǬ )Ԭ )h ){ )- )y  ) )u  )>. )a< )NJ )X ):f ) ) )5 )S )M )ƭ )AЭ ); ) )¸ )6$ )l2 )B@ )$N )\ )>}j ){x )$ )Pe ) )e )|6Į )Ү ) )m )Nh )( )  )x )K )D5 )f̰ )*Ұ )ٰ )A )e )o7 ) )]! )11 )1"= )S )4_ )[t )b ) )w,ױ ) ) )} ) )<* )8 )>}F ) T )io ){} )u )+  )ۂ )N )aDz )~ֲ ) )D )Q )$ )^! )$0 )? )vN )] )ol )ǘ{ ) )* )y ) )ɳ )Tϳ ) )S ) )f ) )- )\,; )_ )fz ) ) ) t* )0 )l(6 )< )B )MH )N )"T )Z )&a ); )8 ) )E ) )̶ )`ٶ )e )w )~ )  )q )6' )4 )A )[N ){[ ) h ) ) ) )Ji );· )NϷ ) ܷ )w )! )" ) ) )t7 )"E ){S )ra )o ),@} )5@ )>@ )V@ )v )z8ø )+8Ѹ ) ) )/ )Ǣ  )# ) %+ )G: )?I )mjX )g )}v ) ) ) )=¹ )%ѹ ) )/ ) )  ) )+ ): )aI )X )g )v )À )s ) )x ) )8kк )kߺ )S ) )NA  ) )* )9 )ݳH ))W )gf )1u ) ) )p )B )j0 )ϻ )Q޻ )" ) )@  )+ )Q() )@7 )E )S )wa )o )5} )[ )[ ) ) )Ǽ )@ּ )X ) )# )) )# )J 2 )tA )P )a_ )n )} ) )­ ), )y )Gɽ ))׽ ) )w )L )p )F )+ )19 )6G )U )c )q )  ) )C )T# )6e )Ǿ )م־ )} )  ) ) ) ! )40 )*? )'yN )9] )#l ){ )" ) )68 )v ) ƿ )տ )X )' )¸ ) )]:! )1 )A )sQ )a )U!q )a )n ) ); )ν )s ) ) )o )l  )x )@+ ): )I )g )?v ) ) ) ) )[ ); )^B )x{ ) )j+ )T: )W )v&g )>w ) ) )B )  ) )# )5 )  )f ); )v% )e/ )E9 ) J )FP )zpV )p\ )b )X n )7{ ) )} )u )< )Kl )~ ) ) )l )= )  ) )r" )6/ )< )SI )V ),c )6p )E} )2 )% )@ )6 )m ) ), )Ē )>} )f ) )* )X )h )y!n )t )~{ ) )B ) ) ) )6 )ޡ )  )z )n )j   ) )Y% )2 )<? )L )(Y )%f )\s ) ) )Jp ) )} )ou )B ) ) )Q )  ) )0' )5 )jD )vyS )<b )#q )9 )" ) )68 )  ) )X )' ) )b )4 ) ' )Mr7 )ݖG )aW )ng )w )o )| )! ) )i )C )g )% )} )k ) )N )b8 )| ): )j  )t )O ) )! )4' )- )4 )'D )=J )P )-BV )h\ )gb )'qh )&n )u ) ); ); ) ) ); )p )ߍ )ӈ ) ) )>B ) )% )j )u ) )A )cm )C )! )|/ )JJ )xX )@-f )}ot )&! )[r ) )̘ ) ) )&5 )6 )I )a| ); )2p* )}o8 )iR )k )[qw )J ) ) )C )1 ) ) ){ )& ) ).( )B )iO )\ )xi )ǘw )۪ )X ) ) )j )A )< )? ) )ّ ) 4  )K. )x< )mJ )X )f )6t ) )9 )f ) )  ) ) ) )k  )p )o# )@+/ )= )Sr )K );" ) ) ) )W ) 4 )z ) )j ) )$ );32 )@ )N )k\ )qj )x ) )B )8 )  )" ).e )]+ )G )+ )y )" )~0 )-> )P)L )Z )h )x ) ) )y ) ) )c ) ) ) ) )vA( )8 )cH ) X )qth )x )/ )Ѳ ) )' ) )- )N$ )+n )n )?* )U9 )@H )_X )14h )/x ) )} )% ) )fn ) )f ) ) ) )( )t#8 )H )$X );h )ex )޸ ) )n ) ) )  ), )1 ) )) )U( )+8 )uH )X )ޓh )>x ) )E )@ )Q ) )Ds ) ! )d ) )< )w! )x1 )!@ )|P ) )m );A )% ) ) )V )i  )f )# )uw6 )C )Q )^ ),k )'?y ) ) ) )] )ͩ ) )-< )8 )  )'+ )g8 )E )-<R )s` )9m )z )  )_@ ) )w ) )  ) )u ) )! )$ ) 2 )+Q )_ )m ){ )  ) ) )! )+ )>% )I% )5 )? ) )} )/# )_1 )? )M )}[ )ji )Sw )H )? )i )1 )} ) ) )( )# )h#1 )? )M )[ )gi )w )5 ) )$ )a )h )* )i ) ) )  )>} )% )9 )%G )iU )1c )q ) )a ) ) )] ) ) )> ) );  )n )ϸ& ){4 )vB )5P )^ )mr )z ) )  ) )t )@/ ) )"0 ) ) )f )a|, )}o: ) V )d )r )m )) )? )| ) )i ) )5% ) ) )V  ) );) )7 )XE )|a )qo )1o )  )A )b  ) )[3 ) ) ); )Ĕ  )x )% )'(3 )8A )6O ) ] )k )9z )= ) )8 )~i ) )E )  ) )6 )G );# )S1 )? ) M )$x[ )ij )y )i )/ ) )6 ) ) )k ) ) ) )  ). )z< )mJ )6X )Wf )it )ػ ) )k )/ ). )0 )7 )b )5 )I  ) )O( )r7 )F )U )K d )s )ѵ ) ) )@ )3 )6 )oz )s ) )   )y )' )96 )9E )'T )c )ir ) )є ) ) )+1 ): )V )- ) )}: )v )ld& )5 )hD )VmS )"b )$q ) ) )Kv )u ) ) )In )[1 )N> ) )f )% )4 )=C )'R )Oa ) p )% ) )ܼ ) )u )0 ) )A ) )l ) )g$ ){3 )=B )Q ) ` )weo )T~ )e )  ) ) )( ) )| ) ). )bp )g& )95 )D )S )Rb )q )$ )h )m )k )f ) )߱ ) )2 ) ) )% )4 )]?C )R )a )yp ) )" )n )L )Z ). ) ) ) )j& )f )$ )3 )TB )oQ )` )6|o ) ~ ) )Jt )G@ )  )3 ) )< )O )0 )  )|# )2 )A )P )&_ )(=n )} ) ) ) ) )n )t ) )@ )d ) )A " )׋1 )@ )O )^ )+$m )5| )n )o ) )j ), ) )t )s )" ) )! )0 )? )2N )9] )il ){ ) )sn )M )i )$  ) )2} )\ )P )  )*  )*/ )d> )M )"\ )k )z ) ) )' )) ) 3 ) ) ) 9 ) ) )t )=. )@= )L )q[ )Aj )y ) ) ) ) )  ) ) )0 ). )T )) )"7 )GE )S )&g )" )  ) ) )V )} ) ) )6 ) ) )y ) )6* )i8 )F ) T )Ϋb )#,p )~ )0 )? ) )k ) ) )C4 ) )3 ),h  ) )4& )4 )B )P )(^ )l )K"z )d )3i )2 )  )I ) )1# )z )  )Ϋ ) )1$ ) 2 )@ )O )0] ){dk )y )G ) )6 )X )Yy )- ) )* ) )1 )v ):D )W )w )Ѻ ) ) )+g* +i&" +e&' )'(1 +&5 +&: )%C +&G +&L )U +&Y +&^ )i +'m +'r )5} +"' +' ) +O' +K' ) +e' +c' )5 +v' +r' )$ +' +' )+ +' +' ) +' +'  +(  +( +=(  +9(& ,o/ )\: +^(> +X(C )#N +(R +(]+f ,_w +({ +(+ +( +( + + +( +([+[+ +( +(  +( +([+/ +(3 +(>r+Gr+c +(g +(pr+ +) +)~+~+ +#) +!) +2) +0)~+ +D) +B) )@ ,H +j) +T)! )%+ +)/ +)4 )p> +8*B +,*G )qkV )*p +s*t +m*y ) )̚ +* +* )$ ++ ++ )( ++ +|+ )+ ++ ++ )) ++ ++ ) ++ ++ )H ) a )&8/ )v;J )V8_ )vkz ) 9 )v) )) +!, +, )  +\, +P,)) +,  +, +, +,  +,$ +,-)6)O +,S +,\ +,` +,e) )`9 )v )9 )v )9 )v  )$ :- )v9xH )T`:] )vipx ): )vh ): )v` ) ; )vX )`; )v)P7)@)[ +,_ +,h +,l +,u + -y + -)) +!- +- +2- +0- +s* +m* +H- +F- +\- +Z- " +o-& +k-/8P +-T +-`)i) +- +- +- +-) +- +-.. +- +-))$*Vs***}*}h~+~;Pe#}8~@app)AVfM{Ho )̇P(  +-  +-  )̤)  )*8  )B  +'.F  +#.K  ) U  +E.Y  +=.^  )h  +h.l  +d.q ( (  ) `'  +.  +.  )̤  )*  )%  +.  +.  )  +.  +.  )(  +.,  +.1  )>};  +/?  +/I  )uU  )g 'p  ,8  +,/  +*/ ' '  +>/  +(O  ) l  )r  )  )/  )+  )/  )]8  )/`  )  )/  )  )q  )>}  )  )q  )>}  )r{  )/  )q,  )K:  )A  )R  )>}_  )q n  )&|  )S  )>}  )u  )  );  )S  )&  )y+ ) ) )+ )9 ) J )W )d )r )w ); ) ) )q ) ) )` )` &V )x *M *M , ' )`< )#H )JT )Rb )g )u )y| )Q )V )T )O )S )] )V )Y ) )b )oh )ݖz ) ) ) )V ) )Ý )[ )G ) ) )t )1Q )  ) )$ )d0 ) < )H )\T )` )Cl )%x ) ) )@L ) )SW ) ) )K )  ){ ) )| ) )O  )Ib, )E8 ) D )ZiP )N\ )Zh )<} ) ) ) ) ) )c ) ){ ) )f )c )D )KNR )c_ )_ )g )^ )H )x )_ )IE ) )& )  )c. ) < )WJ )^X )f )΍t )[ ) )W ) )~ )E )G )H ) ) ) ) ){, )R: )WH ) )w$ )fU2 )@ )N )\ )yj )x )` )v ) ) ) )P )  ) )& ) )4 )  ). )¦< )J )IX )mf )>}{ )n ) ) ) )m )V ) )_  )L[  )Ԛ+  )S8  )]CE  )[h  )+t  )  )  )  )Ҍ  )  )  )   )  )xY  )"  )! )xY.! )+A! )O! )H]! )k! )y! )! )! )CD! )H! )[! )K " )" )/\%" )p8" )G" )U" )c" )q" )" )" )[" )m" )" )Z" )j" )" )X" )" ) # )i# ) '# )5# )$sC# )|# )# )pd# )/b# )# )f# )6# )# )# )E$ )l$ )#$ )2$ )A$ )P$ )m_$ )͐n$ )}$ )$ )p$ )_$ )G$ ) `$ )$ )$ )W$ )L% )`L% )"% )1% ){@% )O% )^% )Wm% )k|% )r% )% )cb% ))% )q% )v% ) % )k& )*& )]!& )0& )?& )N& )h]& )l& )~|& )H& )& )g& )Д& )& ) & )& )4& ) ' )' ),' )pb<' )njL' )L\' )$il' )Q|' )' )' )' )\' )H' )' )' )/\( )( )c!( )}0( )!?( )җN( )E]( )'l( )F{( )ZS( )( )( )i( )w( )( )( )+G( )j) )n) )C ) )/) )7>) )JM) )R\) )l) ){) )z) )k) ),) )) ) ) )) )) )FI) )`* )qI* )f.* )t=* )4wL* )w[* )Rj* )y* )* )* )}* )0* )j* )* )/* )i* )+ ) + )w+ )-+ )t<+ )K+ ) Z+ )>gi+ )dx+ )ې+ )+ )+ )g+ )+ )d+ )+ )D+ )%_+ )t, );, ),, );, )J, )zY, )Kh, )w, ), ):, )~, ), ))u, ), )g, ), )C, )R - )M- )+- ):- )iI- )X- )g- )fv- ) - )p- )4Z- )_- )`- )- )- )- ):- ) . ). )X+. )2:. )YI. )X. )Pg. )Kv. )Ӈ. )Tu. )'. ). )%. ). ) . )8. ). ) / ) / )+/ )}:/ )I/ ) X/ )%g/ ) v/ )/ )/ )/ )2p/ )J/ )f/ )/ )/ )9/ )R 0 )0 ) *0 )m90 )GH0 )%W0 )cf0 )u0 )0 )[0 )M0 )0 )cc0 )0 )0 )0 )) 1 )r1 )*1 )F91 )NH1 )<W1 ):g1 )Ew1 )1 )1 )zp1 )21 ) e1 )1 )t1 )0o2 )2 )W32 )lH2 )V2 )ob2 )o2 )G2 )2 )R2 )M2 ) 2 )k2 )~2 )E2 )2 )N2 )[2 )3 )23 )c 3 )!~3 )3 )Ah3 )f[%3 )S+3 )313 )73 )ũ=3 )ѹC3 )9I3 )nO3 )ICU3 )2[3 );wa3 )g3 )2Fn3 ){3 )H3 ))w3 )w3 ))3 )R3 )3 )3 )n3 )c 4 )b4 )%4 )mq24 )Kp4 )t}4 )\J4 )]4 )4 ) 4 )K4 )G4 )s4 )[4 ):4 )5 )*Q 5 )^,5 )ų95 )/ F5 )S5 )f5 )s5 )5 )5 )5 )5 )n5 )5 )o5 )5 )6 )6 ).6 )A;6 )W6 )c6 )o6 )fU|6 )6 )6 )L6 )CD6 )b 7 )CH7 )d7 )Zr7 )7 )7 )[7 )7 )b8 )C8 )8 )ϭ8 )[9 )%9 )u29 )K?9 )QM9 )9 )u9 )W9 )EY9 )*9 )29 )Aj: )#: )CF: )R: )o`: )oo: )$L: ): )Q: ): )r: )[; )`e; )=; )*; )27; )D; )#R; )'`; )n; )4w}; ); )w; ); )QP; ); )?; )S< )`< )1< )?< )AM< )C[< ) i< )p\y< )H< )< ))< )< )< )= )= ))= )hr== )eK= )Y= )g= )v= )= )= )= )= )= )3= )5= )= )b= )s> )]> )(> ) 5> )7IH> ) U> )Kb> )> )> )t? )? )Xa? )? )X? )u? ) @ )@ )O@ )@ )@ )@ )@ ))@ )A )A )>A )SQA )9_A )mA ){A )A )DA )A )_A )h]A )DA )B )B )_B ),B ) KB )ZB )hB )vB )B )<B )?EB )B )uB )B )7IB )}B )o C ) C )9C ).GC )UC )cC )lqC )WC )ǖC )C )=C )ysC )C )[C )CDD )ԸD )cD )O|VD )_N[D )CeD )rD )[D )MD )D )D )D )D )D )}tD )E )kE )%E )+E ) 9E )[FE )SE )`E )1mE )q{E )E ) E )E )?E )E )RE )5E )pE )rE )rE ) E )`F )F )€F )*)F )6F )sDF )դQF ) ^F )kF )hyF )vF ))F )F )F )F )vF )F )F )F )G )G )n!G ).G )cQ )HjQ )xQ )KQ )۪Q )EQ )Q )iQ )wQ ))Q )Q )R )\R )"R )0R )>R )݂MR )\R )wjR ) xR )mR )R )R )AR )jR )R )ŰR )RR )&R )S )hS )r"S )0S )>S ) LS )rZS )8hS )vS )S )WS )S )W )NW )^W )nW )A~W )W )W )qW )uW )LW )LW )X )DX )+X ):X )iIX )cX )RqX )EX )dX )X )NSX )w`X )cX )X )pdX )ЪY )'Y )Hq6Y )~sDY )RY )`Y ) nY );|Y )Y )iY )XeY )rY )Y )[Y )RY ) Y )Y )wZ )J(Z ) x5Z )Z{BZ )OZ )`riZ )qvZ )Z )HZ )^Z )BaZ )Z )Z )kZ )"[ )m/[ )<[ )I[ ). V[ )1c[ )Ƅp[ )|}[ )v[ )K[ )[ )[ )[ )R[ )[ )[ )[ )`[ ) \ )n\ )&\ )ΰ3\ )R^\ )k\ )\ )*a\ )n\ )\ )\ )W\ )7\ )$] )E] )[-] )A] ) K] )U] )_] )i] )ts] )i] )] )I] )] )T] )Y] )] )d] )] )|d] )^ )4^ )Q^ ).*^ )[7^ )D^ )sS^ )̯b^ )o^ )|^ )w^ )^ )^ )R^ )R^ )^ )+G^ )'^ )_ ) _ )e._ )<_ )iJ_ )X_ )\f_ )wt_ )_ )_ )j_ )n_ )S _ )H_ )7_ )J_ )x[_ )` )!u` )h` )*` )28` )F` )T` );b` )p` ) ~` )n` )E` )` )` )` )1K` )` )e` )Z` )Ra )Za )+a ) x8a )Ea )Xa )/ba )la )gza )ca )a )Ga )a )Fa )0a )|a )a )wa )q b ) b )d*b )7b )Db ) Qb )i^b )kb )Exb )b )Rb )b )Db )صb )wb )-b )Gb )Lb )c ) c )_*c )4c )XSc )|]c )wc )wc )^c )Jc )pc )Kc )hc )kc )Ac )Zc )gc )d )d )-hd )E(d )5d )[Cd )EQd )k__d )?{d )nd )d )2}d )Zd );d )ud )d )d )e )`e )bE"e )?0e )>e )Le ).JZe )pve )Je )e )e )e )Fe )|e )Ee )2 e )O f )af )\%f )2f )Ef )FOf )Yf )cf )mf )twf ))Nf )f )Zf )aZf )f )f )pf )Xf )f )~f )? g )g )^%g )ƃ2g )g?g )%XLg )jYg )zfg )|g )g )Vg )g )[g )g )_g )E g )A h )lh )+h )c9h )]Eh )RRh )dh )yh )Gh )Wh ) h )h )eh )h ) xh )h )}ti )i )!i )l.i );i )Hi )Ui )bi )oi )}i )i )uri )i )i )0 i )_i )i ) i )Hi )dj )$  j )^j ))j )HCj )Pj )]j ) jj ) wj )j )j )aj )j )\j )j )ek );m!k ) .k );k )E Hk )_Vk )ck )pk )nk )_ k )#k )ck )k )Dk )k )[2l )@l )/Ml )SZl )gl )ul )l )l )Ill )<l )hl )l )l )`l )Am )0R)m )6m )pCm )Pm )Il]m )ejm )mwm )Mm )m )m )Xwm )m )i m )m )Z{m )Gn )nn ) n )-n )::n )Gn )IlTn )kan )~nn )Vd{n )Rn )n )n )Pn )*n )~n )[\n )%n )LFn )o )*o )}Q@o )ϊLo )Ibo )too )7|o )o )o )7o )4o )7o )o ).o )tp )'p )L6p )ACp )SPp )]p )}kp )\{p )p )Hp )ap )Tp )Hp )Pp )p )p )p )) p )Ep )p )/p )/q )֒q )%*q ) h8q )CZq )Ihq )) uq )_q )q )Xq )q )q )cq )q )Pq )Sr )rv+r )9r )Cr )OPr )]r ) xjr )Gwr )r )r )r )`kr )[r )r )|r )]r )ls )s )s )^(s )]5s )Bs )\s )zis )fFvs )pSs )s )s )Is )&s )(s )7os )s )s )s )+t )ht )@]t )R7t )VqLt )Yt )(t )t )ɗt )`Yt )Gt )Yt )t )?u )ʓu )H(u )=6u )݁Iu )`u )Wmu ){u ),u ),nu )u )u )[u )ͷu )u )T%v )KN;v )oGv )mv )dv )v )(v )v )yv )[w )Yw )`Y#w )1w )`e?w )=]w )rvw )*w )fw )w )Uw )w )w )9|w )x )3x )fx )+x )9x )\^Gx )/`x )ѳnx )|x ) x )x )Tx )x )x )jSy )>y )jy )Y,y )oj:y )EHy )' Vy ) dy )ry )y )y )ھy )jNy )y )y )$y )Py )]z )!z )/z )R=z )HLz ){Zz )iz )dwz )@\z )Yz )kz )z )Bz )z )z )N { )x{ )eA{ )U{ )_{ )cm{ )y{{ ):{ )ww{ )" { ){ )`{ )m{ )BF{ )S{ ){ )N| )U| )H#| )1| )\?| )Tb| )p| )| )h| )| )G| )t | ) | )E } )|} )|'} )BH5} )?UC} )_} )Ám} ){} )} )} )} )O} )qo} )N} )} )r} )} )~ )~ )&#~ )2~ )hA~ )P~ )r_~ )Sn~ )7t}~ )$|~ )6~ )~ )~ )~ )~ )R~ )~ )TD )a" )1 )o@ )`HO )^^ ),m )| ) )  )[ )g ) ) ) ) )C )Z  )! )4Z0 )? )aN )rv] )Sl ){ )b )? )F ) )NJ )S ) )ݒ  )bt )lp- )T? )S )[ )) )r )ʁ )ہ ){T )9c ) )  ) )I )۷ )v  ) )u )  )' )/ );~< )cI )V )c )cp )%} ) )  ){ ) ) )Ĝ ) ) ) )  )e )+ )8 )GE )R )l )y )Ȫ ) ) ) )Ń )Ӄ )C ) x )i ) )H- ): )[G )f )s )= )_ )y )DŽ )"Մ ) )y )` )  )A )) )7 )EE )S )Ma )Wo )fU} ) )# )~Å )υ )JT܅ ) )[ ) ){ ) x, )9 )`YF )S )l ){y ) ) ) ) )[dž )Ն ) )t ) )G  ) )) )ǘ9 )OwI )' )4 )žA ) )h ) ) ) )k )Ȉ )rՈ )n )E ) )- )\A )N )&[ )h )u )'\ )F ) )݉ ) ) )o )Z ) ))+ ) 8 )E )hR )3_ )1l )Qy )I )P ) )H )Ŋ )jъ )dފ )O )JT ) ) )oj$ )E2 )v@ )WN )M\ )#j ) )‹ )Hϋ )E ܋ ) ) ) )R )}+ ): )HfI )X )g )Ju )O| )؍ ) )G )W )v  )e} )t, )`9 )JF )WUS )` )im ) ) )@  )A" ) f> )~ )D ) )H )" )G/ )< )cI )AV )c )[q ) )R )E )Ð )А )ݐ )W ). )[ ) )Ҍ+ )v9 )S )a )} )2k )v )xY ) )Ñ )Aґ )t )z )= )O )k, )-E; )=J )UY )h )LXw ) ) ) )'H )Tm’ )mђ )N ); ) u  )  )* )`9 )H )W )Cf )u )A )H ) )2 )!œ )Փ ) ) ) )  )- )X; )zI )ڱW )Je ) hs )* ) ) ) )YP )_ )%Δ )۔ )  )lw )% )1 )? )jM )[ )i )1gw )" ) ) )"O )j~ )"˕ )Hٕ )G )u ) )  )r )d- )H; )gI )(W )e )hs )2d ) )a– )Ȗ )'Ζ )dԖ )Ieۖ ) )e )C ) )e )  )b )' )5 )eC )Q )G_ )n )x ) )Ǩ ) ) )— )ї )w ) ) )  ) )+ )~9 )G )E U )Bac )w~q )e )V ) ) )v ) ј )) ) ) )  ) )-|& ) 4 )D )T )d )it )  ) ) )G )ę )dԙ ) ) )P )+ )  )[, ): )JH )hsW )f ) u ) ) ) )̾ )Hؚ )E  ) ) )n  ) )M& ) 3 )+@ )M );Z )g )t ) )a )X )i )k̛ ) )Y )tu )CD$ )2 )A@ )/N )\ )D )٩ )H )  )͜ )Oڜ ) ) ) )+ ) )( )^5 ) hB )HO )\ )1gi )v ) ) )Ԅȝ )I՝ )H ) )  ) )P# )0 ){ = )+J )W )d )^q )~ )1g ) )O )q ) " )H/ )8< )OI )-V )]c )p )x} ) ) )i )$ ),1 )H> )K )X )]e )` ) )Md )XƠ )gӠ )Md )X ) )g )   )2, )8 )AO )\ )i )Rv ) ). ) xá )wޡ ) )Ƃ )< ) ) )* )7 )DQ )_ )Xm ){ )j ) ): )Ģ )ŢѢ )ߢ ) )c ) )' ) x= )O )n ) )\ )  )Hӣ )iߣ ) )m )~ )D  )6. )H; )HKH )uU )b )Xo )H| )u ). ) ) )@e )Ѥ )Oޤ )d )1[ )  ). )< )J )-vX ),f )t )Ok ) )u )Z )NY )YΥ )ܥ ) ) )r ){ )" )WM0 )}X> )QL )Z )h )v ) )hd )A ) ) )ofʦ )Pئ )q ) ) )G ) )uN. )E )T )c )r ) ) ) )Xr )ŧ ) ۧ ) )T )je ) )< )J )W )od )uq )v~ ) )a] )zE )r ) )̨ )i٨ ) )D )Ź  ) )ko) )N7 )uE )S )a )o )W} ) )q )& ) )é )7ѩ )nߩ )k ), )   )  )<% )3 )YNA )O ){] )k )y ); )& ) )- )Jª )xѪ ) ) ) ) )Wo )h, ); )J )Y )tch )w ) ) ) )_ )E« )ѫ )M )Z )s )  )T ){+ ): )GY )Vh )Aw )S ) ) )g )ɬ )٬ )p߬ )» )]F­ )7\ϭ )/ܭ )< )T )-* )6y )f )  )_ ) ) Ȯ )֮ ) )wR ) )  )[ )$ )> )EK )Gd )q )H~ )d ) );ί )Gۯ )F ) )-l )F$ ) ) )u )F )i  )X )&[ )˰ )ϊذ ) ) )c )H  ) )c( )2 ) > )J )]e )r )o )  )K )ʱ )ݱ ) ) )X )8 )& )y2 )T ) )D )r )ʲ )ֲ )D ) ) ) )P( )5 )B )XY )u ) ) )ל )$ )S^ȳ )]ճ )܍ ) )1 )  )p# )0 )EL= )K )RX )e ) )˴ )iش )p ) ) )Ap  )2 )ߜ& )4 )HA )nN ) |\ )ڦi )v )i ) )` ) )] )Ƶ )cٵ ) ) ) )q3 )T= )W )Sa )k )~gx ) )S )1 )  ) )ʶ )k )4 )g )  )9 )*OA )V )b )w ) ); )U÷ )[ѷ ) )N )i )0s  ) )/& )‰4 )B )=HP )^ )l )z ) ) ) )j )= )bθ )Ջܸ )a ) )\v )$ ){3 )EB )Q )cn )} ) )_ )H ) )ȹ )v׹ )R )D ) ) )" )1 )@ )AVO )^ ){ ) ) ) )3P )ƺ )rպ ) )KN )S )  )J/ )Ô> )/M )/\ )k )z )  )T )ػ )) )u ):  ) )( )V6 ) xC )`P )Z] )2Uk ) ) )м )~ּ )ܼ̀ ) )t )* )  )g )3a )@. )4 )x: )@ )F )DL )s\ )j )v )s ) )' )/ )ʽ ) ) )= ) )lK )=* )7 )uP )r] )k )Ny ) ) )] )k  )Zž )Ӿ )s )^ ) )  )Z )Q' )5 )C )^R )eu ) )B ) ) ) )XIѿ )޿ )k ) )  )I )}& )3 )@ )M )Z )?g )t )~ )Җ )1 ) ) )v )V ) ) ) ) ) )! )^/ )(= )8Q )_ )m )Բ{ ) ) ) )\ )Q )o  )H. )g< )`wJ ){cX )Ef )t )4  )P ) )_ )s )oG )U )4c )Cq )i )c )D )ɶ )" ) ) ) ) )X )-L  )= )D' )ߠ6 )D )[R )J` )n )W| ) )Ӣ )p )) ) ) ) )  )  )k( )-v6 )?D )R )Au` )n )s| ) )& )c )P ) )m ) )D ) )һ  ) )% ) )  )[ )[& )qI4 )> )J ) ) g )l )- ) )G )  ). )< )&RJ )X )f )Zst )$ ) )b )V )\ )[m )e ) )E )̄ ) ) )p^ )k ) )n ) )f )Z )rs )^ )  )Q )" ), )PZ; )I )NW )|be ).s )P )6 )mC ) ) ) )z\ ) ) )Tj )  ) )t) )7 )jE )FS )a )jo )Qg} )M )M )m  ) )Rn )Gt )c ) ) ) )R* )8 )G )OU )CDc )q ) )> ) )F )` )@ ) ) )J\ )R( )5 )D )R )-m` )5Mn )[ )؟ )t )7s )Z ) )4e ) )S )s  )  ). )إ< )iJ )X )Cf )t )| )a ) )o ) )L )O\ )b )< )K  )^# )W 2 )HK )Z )d ):`x )[ )M ) ) ) )t )Z ) )a )I )t )6f )׭" )/ )< )I )V )c )p )} )a )$ )k )D )|S )$v ) )Ԋ% )3 ))P ) )^ ) )H  ) ) )TR{ ) ) ) )% )P )  )b )C ) )m )o )j )  ) )' )F4 )XA )\N )ʏ[ )Mh )7O| )X ) )z ) )H )NK )ٌ ) ^ )" )~ ) )O} ), )8 )W}D )gR )ca )2m )Yy )D ) )U )Zt ) ) )W )q )C )_ )h )HF )WS )Z{` )[ )3 )  )- ) ) 8 )U )Uc ) ) ) ) )w ) c ) ) ) )v )7[5 ){ C )<M )Z )JTg )O|t ) )8 )R ){- )> )D )J )oP )nW )t ) ) )ys )?t ) ) )  ) )e )  )W' )` )Ij ) ) )r )P ) )  )NV ) ) )T& )h4 )OB )/Q )?Pb )h )An )t )o{ )ya )Ԏ ) )6 )  )  )C ) )p ) )s ) ) )! ))W2 )8 )͉> )ܴD )J )P )V )~] )Mn )mt )Qz )ؙ )H ) )* )+V ) )q ) )E ) ) ) ) W, )ѿJ )~T )s^ )Qk ) )C ) )[ ) ) ) ) )R )@ ): ) )y$ )eK )]X )~e )r ) )K )> ) ) )n )(Y )gT )A ) )kU )s ) )|( )3 5 )B )Z )g )Z )" )  )Tm )F )W )+ )G ) )p )v )f ) ) )  )wI )% )3 )A )O )bok )py ). )p ) )۳ )Li )H ) )j )sE  ) )*( )8 )N ) X )PJd )Op )| ) ) ) ) )' )T| )5 )Jp )) )p7 )XE )S )1Ia )o )Ҍ} )2 )  )  ) )*P )} )D ) )2 )   )c )C% )3 )C )+_ )~Wm )8{ )2k )k ) )w )Q ) ) ) )?d ) )! )@1 )A )Q )a )q )g )[ )Tk )^| )R )3 )m| ) ) )K  )$ )) )&9 )~LV ) t ) )! ) )˜ ) )} ) )$  )q )F )L! )^f1 )~A )`Q )a )q ) )g ) )i ) ) ) )xM )M ) )%! )1 )mA )% Q )1a )\q ) )N )t )| )cq )< ) )P ) )k ))  )Q/ )> )~M )we\ )k )Uz ) )E_ )Z )K )Z )V )P ) )BQ )u# )~9 )͡H )kW )9bf )Ϟu )˱ )5 )b )V ) ) )i )G )  )p )5 )D? )I )W )He )Zs )+ ) ) )1g )^ )Go ) )Z ) ) )O  )2k )e) );> )\x )X )  ) ) )&K )2 )E )W ) ) )G )! )e )T )7 )X ) )i$ )1g2 )e ) )O ) )H" )( )fh/ )S< )I )9V )  )R )[ )L ) - ); )I )%g ),t )Y ) )Jj )y )p ) ) )> )/ )< )O )\ )l )6r )x )jH~ ) )F )Y )} )E ) )v ) )X )O )/ )"! ): )}G )T )g )ds )q ) )  )z ) )/] )[ )ʥ )! ) )d  )'r )c( )u6 )CD )aR )4` )C[o )P~ )7 ) )_ )mM )V )z ) )h% )2 )$G? )AbL ) Y )f )s ){ ) ) )"d )ա )CD ) ) ) ) )U" )/ )] )Fk )x ) ) )T )2  )  )Ƞ ) )s ) ) )9G* )7 )P ):R] )j )lw ) ) ) )} )p ) ) )[ )V ) ) )`l ) )ĭ ))) )7 )}E )yS )`a )I|o )} )  ) ) ) ) )`i )8 )] )6 )  )  )w0 )3: )nI )S )a] )9k )vy ) ) ) )s ) )u ) )[ ) )  )# )% )33 )A )WO )h] )k )y )Z_ ) )- ) )w )- )3n )  ) )ܣ ) )(! )|]/ )= )LK )Y )g )uu )Q ) )I )\ )o ) )D ). )+ )6 ) )P@ )TN )v\ )2j )l ) ) ) ) ) )bC )ID ) ). )H )fU ), )\: )H )_KV )(Md )Or )k )d )1c )M )+ ) ) )` )J^  ) )H% )52 )L )_ )l )[y )3h )j ) )e )T )U ) )W )E )_" )/ )GG< )YI )O] )vg )q ){ ) )L )p )E )` )w )g )n )  )  )!  )+  )U  )zc  )q  )  )  )  )m  )H  )[  )xY  )A  ) D  )  )D  )v  )-  )c;  )J  )F[  )Ea  )ְg  ){V  )  )   )TE'  )-  )l4  )T  )xD`  )p  )'pv  )|  )  )  )*  )  )  )v  )  )2  )E  )[  )Zi  )w  )  )   )[  )J  )-h  )xY  )`  )  )` ) )" )ޞ1 )@ )jO )^ )Am )ȇ| )m )M ) ) )mM )v )/ )/ )W  )5v )Hv$ )* )j< )J )X )El )z )@ ) ) )ב ) )\ ) )q )E ) )E )_R ) ). ) )ۨ )] ) ) )\ ) ) )Z ) )- )ǫ ) )n )F  )E& )Ӆ, )r2 )9 )a )o )} )~s ) ) ) )^D )U ) )W ) ) )  ) )r& )Y3 )=@ )eY )s ) )G )d ) ) )"U ), )x )Ҧ ) )qR )`{ )R+ )I9 )[G )0U )9c )Bq )Z ) ) ) )  ) )v )' ) ) )k ))! )H0 )? )1jN )1] )hl )$ ) )f )p )\ ) )Ǝ ) ) ) )l  ){/ )Ϡ> )M )q^\ )(tk )z )fV )Hr )I ) ) )p )? ) ) ) ) ). )^= )L ))w[ )[~j )Ny ) )  )Q )d ) ) ) )@ ) )" ) ){* )U8 )BF )T )ub )ϼq ) ) )Y )Ι )~ ) ) )\ ) )  )$S )' )%f6 )bE ))T )^c )+r )@ )W )j )t )K ) ) )O )k )~~ )?  )l ), )p: )H )V );ld )r )J )C )b )c )Z )y )e ) )f ) ){ )V% )m4 )C )EgR )}a )$p ) ) )h )+ )w ) ) )z ) ) ) )DR( )8 )2H )lX )h )qx ) )\ )Q )> )\ )l )vK )V )ys )9 )  )> )M )] )!m )| ) ) )d )J )fY ) )wI )3 ). )6> )N )^ ) n )c~ )! ) ) )p  ) )E )d )ZT ) ) )b! )#' )N- )3 )Lc9 )cO )[_ )Ve )k )\r ) ) )t ) )~ )H )> )I| ) )^ )t  )  )<  ))  )6  )C  )P  )]  )j  )hw  )w  )N  )v_  )  )S  )d  )  )  )  )! )l! )P! ),! )I;! )HWJ! )hY! )h! )mw! )}! )$! )! )h! )+! )w! )! )Eg! )! ) " )" )P." )t>" )lN" )^" )qn" )l}" )Z" )" )&o" )>q" )Ҍ" )?K" ) # )# )%# )܇2# )?# )`L# )Y# )f# )s# )8# )o# ) # )# )# )# )K# )X# )P# )_p$ )[$ )E$ ),$ ):$ )vf& )H*& )f0& ) 6& )~<& )hB& )JH& )1N& )Z& )& )2S& )& )/H& )m& )& )& )2& )o& )$ ' ):' )$' )ފ1' ),>' ).K' )AX' )8e' ) r' )B' )I' )s' )q' )L' )q' )' )N' )ml' )VU( )a( )io( )}( )e( )?O( )XO( )H( )( )( )e( )f( )`( ) ) )B) )%) )e3) )fA) )O) )^) )k) )fPy) )) )e) )f) )rn) )) )r) )ě) )) )) )e* )* ) !* )a/* )r>* ) K* )QGY* )g* )eu* )f* )b* )* )* )* )* )* )ϣ* )* )* ) + )+ )5!+ ).+ )=+ )J+ )f+ )LPt+ )-+ )+ ){+ )]+ )+ )W+ )!e+ ) + )s+ )+ )$, )TQ+, )49, )ZG, )U, )gc, )6r, )2^, ), )9k, ))}, )Gm, ) , )h, )8- )|- ) - )9k,- ).`;- )JI- )X- )e- )s- )9k- ) - )- )- )9k- ) - )- )- )K- )w- )c . ). )-*. )7. )EE. )9kS. )a. )o. )$}. )Es. ). ) . ).. ). )8. )B. )-. )ʧ. ) / )$/ ).%/ )83/ )BA/ )LP/ )]/ )-l/ )|/ )/ )$/ )[/ )/ )0D/ )/ )$/ )/ ). 0 )80 )lk%0 )O40 )Q0 )_0 )$n0 ){0 )9 0 )l0 )0 )p0 )0 )L0 )Y0 )9k0 )0 )$1 ).1 )8"1 )B01 )L>1 )sL1 )VZ1 )`h1 )Pw1 )31 )j1 )O1 )b1 )a`1 )N1 )N1 )1 )1 )2 )ԝ2 )!2 )a02 )=2 )L2 )[2 )i2 )$x2 )2 )r2 )9k2 )o2 )[2 )l2 )2 )B 3 )}3 )&3 )j33 )@3 )M3 )TZ3 )g3 )st3 )3 )Y3 )$3 ).3 )s3 )3 ) 3 )3 )X3 )y{3 ) 4 )4 )p 4 )6T04 )64 )J<4 )X4 )Zh4 )n4 )vt4 )Wz4 )o4 )&4 )4 ),4 )G4 )c4 )d4 )*4 )4 )4 )G4 )F4 )qO4 )P4 )w4 )4 )}4 )4 ))5 )5 )"5 )Q5 )k5 )f 5 )i&5 )f,5 )*25 )85 )p>5 )D5 )K5 )X5 ),e5 )Kr5 )t5 )X5 )u5 )|5 )p5 )5 )M5 )5 )P5 ) 6 ) v6 )p%6 )36 ) A6 )O6 ) ]6 )BZk6 )dz6 )N6 )M6 )G6 )c6 )6 )Q!7 )œ.7 )G;7 )EH7 )U7 )fUh7 )"qu7 )/7 )7 )7 )27 )7 )37 )`7 )77 )7 8 )|8 )b%8 )I28 )3?8 )]8 )j8 ) w8 )b8 )8 )C8 )38 )R8 )c8 )9k8 )U8 )9 )$9 ).9 ),9 ) :9 )8H9 )V9 )d9 )B9 )}f9 )9k9 )9 )$9 )9 ).9 )89 )B9 ): ) : )L: )V+: )9: )V[G: )@U: )oc: )q: ): )[: )`I: )j: )O: )h: )G: )X; ) ; )Ө; )[,; ):; )BN; )\; )Gj; )bx; )?; )mu; )~; ); ); )h; )Ѷ; ) ; )B< )Rb< )/< )nL-< );< )YI< )W< ){e< )Js< )< )< )< )< )< )8g< )< )'< )< )= )Ҍ= )b#= )BZ1= )M?= )]u[= )i= )muw= )ȟ= )0= )= )Z= )= )G= )= )= )X= )mu> )}> )Rb > )/.> )Ѷ<> )rJ> )Zf> )t> )M> )k> )> )=> )> ) > )w> )c> )M> )r? )? )'*? )i8? )HG? )8ic? )~q? )? )? )H? )k? )? )6? )N`? )? )U? )G? ) @ )G@ )F6@ )D@ )HR@ )`@ )n@ ))J|@ )@ )@ )ړ@ )t@ )@ )r@ )K@ )B@ )x@ )A )}A );&A )H5A )DA ):SA )bA )AqA )׆A )'A )JA )A )ˬA )PA )GA )A )A )8B )B )%B )4B )LCB )RB )aB )VXpB )nQB )B )B )VB )B )^B )B )qB )B )zHC )7C )r$C )3C )BC ) QC )l`C )|oC )k~C )C )C )TC )%CC )C )GC )KC )C )D )D ) #D )T2D )`AD )lPD )_D )LnD ) }D )|D )9D )D )D )KD )D );D )?D )pE )ܗE )"E )j1E )k@E )"mOE )} ^E )mE )v|E )E )KE )E )E )YE )E )nE )E )!]F )ȼF )C!F )0F )?F )IOF )X_F )hnF ) ~F )F )F )NF )F )]F )nF )p}F )vF )G )]G )j#G )PL2G )?JAG )hPG )_G )nG )r}G ) G )ǕG )_G )G )mgG )hG )G )G )YWH )H )D"H )"k1H ))@H )OH )ņ^H )imH )1|H )+H )*H )H )H )wH )߈H )dMH )SH )ZI )PI )c!I )R0I )K?I )XNI ) ]I )lI ){I )sI )Z I )dI )lI )^I )aI )I )I )]J )UJ ) J )ԏ/J )>J )MJ )L\J )8gkJ )1zJ )J )ԁJ )J )J )iJ )J )`J )ʽJ )K ) K )CMK )M.K )=K )҂LK )q[K )jK )uyK )K )K )SK )6K )K )JK )=K )K )mL )1rL )L )L-L )oXOX(oX )xX+X )1[X +/X +/X )X +/X +/X )X +/X +/X+X )|X0,X )1[Y +/ Y +/Y )Y +0Y +0,Y +;00Y +705Y )?Y +S0CY +O0IY ,NY )[Y )eY +k0iY +g0sYG,|Y ,Y +0Y +0Y +0Y +0Y +0Y +0Y +0Y +0YG,Y ,Y +0Y +0Y +0Y +0Y ,YG,ZG,%Z +0)Z +02Z +06Z +0Z` )Zh` )Vcv` )*` )!` )t` )7L` )ފ` )i` ) ` )` )q` )Xa )Da )&a )F,a )8a:a )`Ia )GXa )6fa )Pta )Za )Eha )lda )qa )ga );a )Qa )a )0a )\b ).b )hg,b )Jn;b )CJb )`Yb )`nhb )bwb )mvb )tkb )_b )Q>b )Sb )Qb )dAb )[b )crc )Hc )x.,c )/;c )%"Jc )2UYc ){Yhc )&wc )0c )c )a?c )~c )dc )Ic )dc ):c )[c )x d )rd )w2+d ):d )*Id )Xd )lgd )=Bvd )7d )fd )+d )2d )<d )uJd )+d )Âd )[pd ){ e ) e )'_*e )']9e )DSHe )|We )%ge )^Rse )F|e )e )je )e )%> f )}$f ) '2f )oaf )F|f )f )Obg )Vg )&g )Xg )6g )sSg )ySg )%> h )6Jh )SYh )0eh )dcqh )3h )3h )h ))ch )i5h )&h )A.h )fi )%>i )p)i )i6i )1Ci )HPi )mpi )}zi )Mi )Bi )ei )o_i )ai )BKi )si )܇ j ))yj )%>&j )75j )hDj )Rj )bq`j )Snj )||j )_j )&j )2j )|j )vj )(1j )j )ij )xj )k )`lk )$k )D2k )5@k )Cyk )5jk )-k ),k )rdk ).k )Ok )dk )WOk )Rl )@Ml )G l )hT/l )ρ>l )/cMl )2\l )1Fkl )Tzl )l )qbl )pBl ),l )Y+l )G@l )l )%l )m )m )m )\.m );=m )hLm )?j[m )lVjm )cym )n5m )hZm ),m )m )4m )7m )7m )on )1[n )҉n )v?-n )r )0r )r )J}r )@r )B=r ) s ){s )w*s )[[9s )gHs )Ws )6/fs )-us )?Fs )is )Xes )J/s )KAs )-s )Cs )Rs )F*s )_6 t )Xt )5f)t )8t ) pGt )a^Vt )~et )]tt )%\t )Vt )<t )Qt )6t )nt )iIt )օt ),nt )WZ u )?^u )d(u )2g7u )0Fu )}Uu )sMdu )jsu )=Vu )\u )=&u )`bu ),u )uu )Gqu )%Yu )su ).{ v )@v )%(v )S7v )vFv )$WUv )i!dv )}sv )Av )6v )Rv )Av )mv )qv )Bv )?v )hv ) w )^w )b(w )<7w )VFw )YUw )Vdw )sw )YTw ){w )ow ) 4w )w ).w )Ew )(mw )PIw )" x )ux )\S'x )D6x )UEx )fCTx )o}cx )rrx )Yx )Wx )ujx )bx )-x )Sx )}x )x )b y )Q5y )R'y )~G6y )vEy )[ATy )|dy )Cty )3ty ){y )>4y ):Zy ).y )UEy )x6y )p3y )sz )Ԋ:z )cHz )}!Vz )Udz )birz ){qz )+z )@z )evz )npz )Pz )z )'z ){ )|{ )@I{ )cD{ )QQ{ )2Pd{ )Iz{ )sW{ ) { )J{ )-5{ ).{ )\{ )D{ )oT| );n| ) | )|@.| )@<| )]J| )wPX| )uf| ){t| )r| )|| )(| )| ).| )H| )h} )C} )i0} )j=} )Ad} )-v} )>l} )P6} )k} )2e} )#} )*} )\} )o} )fG} )T} )?c~ )#~ )a!~ )l.~ )8S;~ )a5H~ )=U~ )&b~ )dp~ )iX~ )+~ ){~ )~ );~ )~ )"~ )L~ )&= )N ) )5) )}6 )]UE )4T )&q )o )t )? )f )]P )d )  )A )p )BR )5 )& )~ )2( )k5 )6B )Ko ),_| )& )> )QĀ )ފҀ )Fm )l )X ),%  )y )c>& )@4 )7B )_$P )A^ )nl )Nz ), )e )>s ):7 )P )a΁ )N܁ )W ) )3 )Z )oO" ).0 )f~> )LL )RZ )h ){v ) F )x< )& )M )5# )͂ )&ۂ )3 )&d  )%> )$ )21 )$@ )~WM )+q )U )  )T{ )Z )7 )gƒ )[σ )U )e ) )|j )i`w )m )=  )9,= )l )% )V )i` ) )p )UW )i`d )}q )7}~ )T )S )= ).= )# )~D )d )D  )V* )9 )H )+W )t(v ) )&l )_L )I+ ) P )W_ۇ ) )^ )] )d )>0 )@ )yP )7` )Rjp )* )&Q ),O )s ){Ɉ )m׈ ) ) )2 )dI )K ){2 )Q? )5L )^ )  )P )0X ) )(ʼn )L҉ )jq )A )i  )Z ) m" )4/ )=m )P~ ) ) )R )5 )& )F`Ί )ۊ )! )S? )0Y )\" )E/ )K )`X )%>k )F3 )}K )} )q )E )ċ )A׋ )V] )Yh )_$ )Yj  )B )O )&\ )v i )m )" )M )3 )u )E5 )\ )LJ )Cuƌ )=Ԍ )a_ތ )v )5 )@ )h )Hr* )CJ> )1S )Ta )3m )#cz )ފ )P6 ) g )Q )ɍ )fy֍ )/ )7 ) P )]  );w )$p+ )79 ) F )$pS )݆a )-Vn )D| )F3 )_ )$p )OD )0K )(Î )*gЎ )Dގ )) ) )5 )6 )*^ )-, )US )F` )(m )&z )` )R )z )9 ) WΏ )ۏ ) )F3 ) )&% )2 )>? )L ) oZ )c0m )2P )q ) ) )@A )Oː )Oؐ )a ) )$ )58  )O )R[ )jg )cx )MQ )N )} )u )n )=Б )4ݑ )d` )B ) ) )*2 )4? )d`L )c )4p )d`} )>! ), )| )> )^vȒ )`ߒ )$4 )5 )4 )\ )x4 )o@ )a%L )EX )rUd )+dz ) )T )@ȓ )ZJՓ )@o )N+ ) )$ )V  )$T, )x%8 ) 3N )9[ )ch )u )L= )Q7 )n7 )W )xc )Pǔ )7Ք )#H )&@ );y )  )G )rX1 )g> )y{K ) We )is ) )Q )P )i5 ) W )^Õ )4+Е )Sݕ )$ )y ) )_ )E )j, )j9 )q+F )PS )փa )Tgn )D{ ) )# )S )b )0~Ζ )`ۖ )_c )#c )] )} )% )p+ )5B8 )&E ) R )A| )H )Y4 )2& )!L )H )1ʗ )gח )H )4 )H )a )y8 )[ )|g )nEu )U )r0 )a )1 )ǃ )M )-}Ø )0yɘ )И ),eޘ )H )T )6 )U$ )r02 )HA )O )y] )MUk )yy );q )y )e )? )k )7ϙ )Xݙ )` )F )8@ )M` )f# )zO1 )W@ )OO )L] )\]k )by )X? )B )@e )v )C )f͚ )sۚ ) )$ )Y )/ )m! )F/ )k= )ZK )'Y )bg )8u )% ),p )A )% )^ )>ɛ )d$כ )9  )lC ).a )E )f  )$[. )(U< )J )`lX ) qf )Yt )U )? )Q )& )F )8JȜ )<֜ )[ )> )R )]` )=k );? )]`I )VW )e )Ks )Z )D )`l )| ). )_ )Fs )7 )( )F )a, )/7: )fH )aV )fd )&r ) )E )7C )M )5jž )RҞ )d )@ )3u )4 )>+ )9 )$ H )*Dr ) )e )ӆ )z )S )O͟ )h۟ )- ) )?# )++ )i? )YG )-V )Tz )l )4 )5 )P )~ )ͅʠ )~ؠ )q )x0 )9. )_ )[ )&, )": )MH )RzV )|d )r )58 ); )a )%5š )4ҡ )pߡ )pq )) ).,) )t6 )^rI )1V )_} ) w ) )Yr ) )Ib )e@ˢ )[<آ )>P )v )Q )S  ) )#& )6m3 )fL@ )UM )+Z )g ) t )Zq )W ){ )_ƣ )gڣ )%, )  ) )'q; )dIH )hU )^b )6o )& )n ) )V )V> )Ĥ )(rΤ )0ܤ )m )r )Y )D )& ) }* ),S7 )[D )-Q )e^ )xNk )="x )p )& )_ )5 )9W )^ʥ )l{ץ ) 8 )ym )1  )" )#' )z5 )BC )Q ) m )Y{ )O )U )r0 )d )V` )HϦ )sݦ )nE )Z )V3 )D )# ) v1 )k? )&M )#e[ )6i )0w )_ )X )e )QT )X )MH˧ )٧ )2 )R ){| )e )s )Q- )>; )I )mW ))Ek )&x )e )58 )N )w )J} )܂ƨ )J/Ш )ڨ )- )C )K ){  )7P )a% )2 )p=? )oL )t_ )Rn )Zx )8 )B )P )a )vL )_ک )!+ )sM )%  )K< )Z1 )7; )*E )!O )9O\ )6i )>v )C )U, )/' )Z )@Ī )YΪ )wت ) )R )x6 )  )D )] )\&* )[Q7 )xD )LQ )%^ )Yk )Ax ) )B )#v )? )_/ ):%ƫ )kӫ )Oo )] )ۄ  )+ )# )1 )f> )7zK )X ))g )t )Z )~W )G ) )/¬ ) )UC )p, )k )&'+ )l> )k.J )NGO )_\ )e]i )>v )\ )E' ) )%jĭ )r )^ )R )> )8s )a, ){9 )7F )aS )/` )dm )z )M" )w )N )2 )a̮ )'Oڮ )S ) )Bt )Q  )# )K% )w7 )yL )qX )$e )RYx )6^ )F )= )58 )ފ̯ )P6ٯ ) g )-H )&2 )$b  )U )M# )C0 )a= )EK )X2l )y ) ) )+ )!Z )_c )P )  ) )'O  )WU )2 )Z? )&} )l )(x )## ) )a )|ͱ )[aڱ )1 )LK )0 )_c )-? )x, )/zg )"t )a ) ) )1 ). )]² )[ղ )C )z )7  )~d )) )D6 );C )xP )3] )aj )^w )4o )[a )1 ) )RM )-ų ) @ҳ )h߳ )} )! )q )< )y'! )e/ )= )_cK )ct ) " )(C ) )Z6 )mƴ )bݴ )J )m )Wi )m% )o1 )=|= )YJ )uq )ր )? )~# )PR )q\ )PƵ )_D̵ )ҵ )E,ص ) $ߵ ) )v )Mp )c )B  )Ԅ )6# )z0 )eF> )eFQ )GG^ )Kv )/ )E ) )Ԅ )+Ͷ )|ڶ ) ) )MX )i )?3 )!@ )mi )`7v )0r )0r )Z! )a )58 )P· ).Tٷ )O )e| )M1  )& )a' )5<4 ){A )rN )j[ )i ))s ){ ) )^ )_ ) )a#θ )_۸ )Έ ) )n )mD )w3 )b) )Lw6 )nC )aP )th] )L(j )c" )4 )p )z̹ )~ع )K )& )oj )]) )‡@ )NZY )Gf )s )X} )G> ) )% )#|ƺ )N )  )S )W4 )WK )pY )z )‡ )A )&Ȼ )]ֻ )& )W )A. )f$ )i5= )pyK ).Y )}}g )'$u )s )B )< )cȼ )yyּ ). )V= )u )) )F' )C )sQ )G_ )r`m )/c{ )3! )3 )  )҇ )T )l )3i )O ).Z ) )/ )1w& )"f5 )#D ) 6S );b )iSq )B )kk )U ) C )" )  )s ), )q ) { )% ) *4 )PAC ) ]R )a )d{p )& )/ )!} )ފ )Zq )K )lF )K )y )=& )yg )~$ )`73 )#B )NQ )[` )bxo )F~ )t ) C )T )] )56 )04 )<  )i )i" )XG )}MT )-a )wt )/ )- )w )Q )/ )  )g )Q )F )EQ  )s )Q) )d7 )[E )wh )58 )8 )Y ) ? )z )D{ )b )X )S )qf  )b )) )7 )1E )‡S )a )j )P )jq )k )i )o )a )58 )5A  )I) )LR )'_ )1^r )Z )0 )b )Q ) )at )iY ) )_ )7 )M )hK) )6 )6C )?LP )M] )pj )0.w ) d )F! )- )& )q )n )=J )[ )I7 )MW  )o. )H1< )MJ )6X )Of )%z )T[ )F )z )p ) ); )&i )Z  )k% )aK ) )e" )RL0 )W> )-L )Z )J_h )mrv ). )! )4 )Vy )> )h )Dž )  )z )dE )c )(K, )Bg; )IyJ )%w` )5o ) )i ) )E )  )` ); )R$ )r2 )c@ )SN )Ng] )pl )7{ )ii )g )k )L] )g )3 )/ )=p )cM )s )-! )o0 )K? ),N )t] ) +l )<{ )FD )g  )F )5 )y> )# ); )s )l )$! )w0 )#? )jO )^ )Bm )l )vT )O ).]o )| )U' )= )m )`\ )F? )iY3 ){V@ )ͅZ )Xg )Kt ) ) E )| )" )o )h )& )K )t )r )P )K* )Z7 )=D )(Iz )Wn )D )P )b )B )b )P ) )a )1 )* )q? )g )6 )DL )Z )t )& )P~ )(C )L ) ), )=\ )b  )L-. )[8 )zD )!nP )Ncj )_w )3 ) )C ),l )L )%> )W )%  )S )~+ )S7 )Y )Um )‰ )@ )pc )~Z )n )@ )#{ )L  )n- )%>: )WG )%^ )?zz )7T )a )M )?} )) )Tl )D )` ) Q )O )( )1w5 )B )tP ){] )_j )G )(` )m )a ) )? ). )E )W, ): )/H )U )=b )ňo )T| )! )k )RB )W )-k )?f )p~ )pz )! )+ )6 )" )j  )K^ )h[7 )7D )s4Q )Rd^ )??k )4x ) )M )` )pY )F3 ); )R )U )r0 )Q )+  )! )(% )Pm2 )iE )_R )Y_ )Ql )4 )# )Y )# )e )N3 )Pm )s@ )=`  ) )NP& )m5 )1O )V\ ) /i ):=v )C )&! )| )} )` )n^ )o )sG+ )t$] )&k )Gz )`\ )]G )X )f )c )Z )= )q )6 )]Y )a  )/' )K8 )p> )ypD )"tJ )zP )V )f )']t )> ):i )* )gW )S )5 )g )k )B )s )v )%h )2 )M{> )eK )}X )aze )o~ )E )h )cV )q )u )( ) )G )w )I )) )na+ )v9 )&G )7"U ) Yc )fq )j\ ) )N| ) )FE ):E )I[ ) )Iz )d )K )~l+ );d> )%>L )GVY )cf )s )0` )g )c )V ) a )vs )z )K )E )8 )G )G )$ )M* )>~7 )6D )]R )h` )Xn )mA| )b )S )r )cu )D )~^ )AT )M )q1 ); )V )T )m )~X  ) )&G& )f4 )lB )!P )3 )q] )S/ )7 ) - )  )h )Y )d )}- )#; )5I )3 )L )ʀ )yC )90 ).- )* )vZ8 )mF )T )[b )p )Y~ )% ) )Z )R )O )z )& )) )% )ch  )` )P' )b4C ){Q )Uk` )Wn )n| )] ) )Ȋ )I7 )C )~ )@ )~ )l  )P )sw( )^-6 )GD )jR )2` )wn )| )T )>] )Mi )w ))u )X )& )& )] ).= )gt( )Y6 )/i )1w )H ) ) O )m )c )i )" )~ )q )5 )t )y )}U- )S; )_I )d2W )X.e )^ds )p )k@ )EO ))N )H4 )i )Y )2 )jz8 ) @E )r )5 )) )Mv )1d )8k )L )K& )VP )! ), )dU )gB )} ) , )1@: )sH )OkV )'d )Nr ) )0 ) )Tv )3= )@ )N )$ ) )41 )=/  ) )* 3 )u= )MG )2Q )6[ )>-e )4Is ){ )a )" )Yr )r )Fl )m )^ )p )R )T* )gC )P )hh )6v )wi )h' )L )Nr ) )0 )KF )~ )i ) )z )J2 )L  )&B )^OP )l6^ )5l )z )!? )$. )l )%R ) )& )j )lR )0 )l )| )" )(<0 )c,> )@UL )3Z )|fh )=v )m' ), )QV ) )) ) u ) )t )r )|+& )d0 )m#: )@7D )Nn )-C )IC )_F )pg )) )yu )[$ )"f ) )=_1 )y= )Zu! )k< )ld )ju ),{ )- )Æ4 )2  )fl )XW )s|d )Zq )~ )R )F )|I )# )f< )# ). ){E )cw )v  )<, )iI: )iI )ZU )ra )m )z\y )z$ )-6 )ʇ )F )= )Fo )K? )R )x )T ),h )b# )V- )?: )vnH )U )58b )zo )R| )Z )L )& )> ) )} )1R! ),. )^; )xI )[W ),e )>ss )C )T )Cw )b )X )es )  ),% )_$ )N )l )7 )sC )#P )yZ )LNs ){ ) ) )#c )La )*X )P )ql )es )L )7 )|@ ) e0 )@d6 )O< )soC )Y1P )%>] )yj )2w )] ) )| )' )m )Z )> )0 )|-  )L!. )#< )^J )‡X )0f )Xt )N ),% )SW )l )N )e} )< )m|] )Fj )Pw )]W )57 )< )P )>s )e} )P$ )X )l )oKu )> ) )3s ). )IR ) ) o )Z ).A ),0 )Z )dI ); )&X  )pe  )kr  )O  )U  )P  )=  )$  )D  )t"  )&d/  )>S=  )cJJ  ),W  )Kd  )t  )MS  )57  )&  )  )`  )A  )#  )<  )m|  )z  )Dy-  )>  )q  )[  )dN  )]3  )03  )G  )D  )J&  )a,  )n2  )W8  )>  ))D  )ZJ  )LP  ):(V  )FY]  )[Xk  )5y  )6  )a  )^  )*  )Ղ  ).  )  )2%  )E8  )B  )\[  )yj  )pt  )     )[   )I\  * )'5 t> )'I IR )'] f )'q z )(  )A  )%( r )( G )(  ))  ))  )2)  )G)% p. )\)9 EB )q)M V )Ua j ))u ~ )*  )1* n )B C )U*  )j*  )*  )*   )* l )*) A2 )B= F )_HQ Z )tHe n )Hy  )3 j )H ? )H  )H  )w  )H  )I h  )I = " )x-  6 )IA J )IU ^ )Ii r )8x} f  )I ;  )J   )#J  )Mx  )J  )J d  )J  9  )J  & )J1 O )^Z c )9rk )*> &d ) *_ *_ '' ) ) )B )G ) ) ) ) ) )9 )  ) )O )\ )y1 )6 )D )JQ )X^ )_k )]x )ԋ ) )o ) ) )S ) )x ) )ʐ ) ) ) )Ֆ ) )) )6 )C )nP )] )Oj )3w ) )0 ) )` )B )_ )E ) ) )3 ) )Ǐ  )ԗ )% )1 )= )'I )Ԍe )eq )֍ ). )u ) ) ) )  )ő )V ) ) )' )% ) ) )' ) ) ) )W  )S )" )2( ). )c@ )aF )~L ){R )6X ):^ )d )j )p )~ )l ) )? ) ) )| )n ) ) )P )! ) )W ) )  )ǖ ) ) )% )nA )M\ )f )q )Ό ) ) ) )Ό )  )D  ' )3 " *K& *r* *. *2 *6 *: *> *B *F *!J *6N *QR *`V *vZ *e *j *o *t *y *~ * * * * * ** *1 *? *J *X *d *m *w * * * * * * * * * * * * *  * *  ** *1 *: *D *M# *S( *^- *i2 *w7 *< *A *F *K *P *U *Z *_ *d *i *n *s *x *} *+ *9 *M *V *c *l *x * * * * * * * * * * * * * * *& *. *9 *A *I *T *^  *h *p *| * *" *' *, *1 *6 *; *@ *E *J *O * T *Y **^ *=c *Mh *\m *jr *zw *| * * * * * * * * *  * *2 *G *N *^ *m *s *z * * * * * * * * * * * *  * * * *! * & *0+ *;0 *B5 *L: *]? *cD *jI *uN *S *X *] *b *g *l *q *v *{ * * * * * *  *  *  *"  *,  *7  *F  *U  *\  *e  *u  *  *  *  *  *  *  *  *  *  *  *  *  *  *  *  *+  *:  *? % *K * *Q / *Z 4 *b 9 *k > *t C * H * M * R * W * \ * a * f * k * p * u * z *  *  *  *  */  *:  *Q  *i  *s  *{  *  *  *  *  *  *  *  *  * B *B F *i J *~ N * R * V * Z * ^ * b * f * j *, n *B r *Y v *r * * * * * * * * * * *  * * *# *0 *5 *> *G *S *f *v * * * * * * * * * * *! *"& *++ *;0 *I5 *O: *c? *qD *zI *N *S *X *] *b *g *l *q *v *{ * * * * * * ** *6 *< *G *X *g *u * * * * * * * * * * * *% *3 *= *L *j *u * * * *% ** */ *4 *9 *> *C *H *M * R *W *\ **a *<f *Ck *Jp *Ru *Yz *d *q *y * * * * * * * * * * * * * *  * * *" *, *6 *? *G *N *Y *d *q * * * * * *$ *) *. *3 *8 *= *B * G *L *Q *&V *0[ *8` *Ae *Mj *To *^t *gy *m~ *v * * * * * * * * * * * * * * *! ** *4 *? *I *R *Z *f *l *z * * * * * * * *# *( *- *2 *7 **< *9A *AKBRy! *}! *! *! *! *! *! *'! *>! *T! *o! *! *! *! *! *! *! *! *! *! *&! *5! *B! *S! *a! *w! *! *! *! *" *" * " *" *" *" * " * %" **" *"/" *+4" *29" *8>" *BC" *IH" *TM" *`R" *lW" *t\" *a" *f" *k" *p" *u" *z" *" *" *" *" *" *" *" *" *" *" *#" *3" *>" *K" *W" *_" *k" *{" *" *" *" *" *" *" *" *" *# * # *  # *.# *7# *C# *K# *S$# *^)# *f.# *n3# *y8# *=# *B# *G# *L# *Q# *V# *[# *`# *e# *j# *o# *t# *y# *~# *$# *2# *@# *O# *b# *r# *# *# *# *# *# *# *# *# *# *# * # *'# *2# *B# *W# *l# *s# *# *# *$ *$ * $ *$ *$ *$ *$ *#$ *($ *-$ *2$ *7$ *<$ *A$ *F$ *#K$ *5P$ *EU$ *PZ$ *W_$ *ad$ *ri$ *xn$ *s$ *x$ *}$ *$ *$ *$ *$ *$ *$ *$ *$ *$ *$ *$ *$ *$ *$ * $ *'$ *5$ *<$ *F$ *Q$ *`$ *o$ *v$ *$ *$ *$ *% * % *% *% *% *% *"% *'% *,% *1% * 6% * ;% *! @% *3 E% *< J% *E O% *U T% *d Y% *l ^% *q c% *} h% * m% * r% * w% * |% * % * % * % * % * % * % * % *!% *!% *%!% *,!% *7!% *C!% *O!% *[!% *f!% *q!% *~!% *!% *!% *!% *!% *!% *!% *!% *!% *!& *!& * " & *"& *!"& *4"& *C"!& *X"&& *g"+& *v"5&Y'Z<p *" *"# * #' *#+ *,#/ *C#3 *Z#7 *u#; *#? *#C *#G *#K *#O *#Z *$_ *$$d *+$i *?$n *P$s *`$x *n$} *{$ *$ *$ *$ *$ *$ *$ *$ *$ *$ *$ *% *% *% *'% */% *8% *E% *J% *S% *\% *h% *{% *% *% *% *% *%  *% *% *% *% *&" *&' *%&, *7&1 *@&6 *P&; *^&@ *d&E *x&J *&O *&T *&Y *&^ *&c *&h *&m *&r *&w *&| *& *& *& * ' *' *' *'' *3' *?' *K' *Q' *\' *m' *|' *' *' *' *' *' *' *' *' *( *( *$( *1( *:( *H( *R(  *a( *( *( *(! *(& *(+ *(0 *(5 *(: *(? *(D *(I *)N * )S *)X *!)] **)b *4)g *F)l *M)q *T)v *\){ *g) *t) *|) *) *) *) *) *) *) *) *) *) *) *) *) * * ** ** ** *%* */* *9* *B* *J* *Q* *\* *g* *t* **  ** ** ** **  **% *** **/ **4 **9 **> **C *+H *+M *+R *)+W *3+\ *;+a *D+f *P+k *W+p *a+u *j+z *p+ *y+ *+ *+ *+ *+ *+ *+ *+ *+ *+ *+ *+ *, * , *, *, *%, *1, *7, *E, *U, *_, *j, *t, *}, *, *, *,  *, *, *, *, *,$ *,) *,. *,3 *-8 *-= *+-B *>-G *M-L *\-Q *k-[CA% *-E% *-I% *-M% * .Q% *.U% *2.Y% *I.]% *f.a% *.e% *.i% *.m% *.q% *.u% *.y% */% */% **/% *8/% *C/% *T/% *d/% *s/% */% */% */% */% */% */% */% */% */% */% */% *0% *0% *(0% *10% *:0% *A0% *F0& *Q0& *\0 & *j0& *r0& *z0& *0& *0$& *0)& *0.& *03& *08& *0=& *0B& *0G& *0L& *1Q& *1V& *"1[& *61`& *?1e& *L1j& *U1o& *a1t& *t1y& *1~& *1& *1& *1& *1& *1& *1& *1& *1& *1& *1& *1& *2& *2& *2& *2& *)2& *32& *=2& *E2& *Q2& *a2& *j2& *q2& *2& *2& *2' *2' *2 ' *2' *2' *2' *2' *2#' *2(' *3-' *"32' *137' *?3<' *O3A' *`3F' *q3K' *|3P' *3U' *3Z' *3_' *3d' *3i' *3n' *3s' *3x' *4}' *4' *#4' *34' *B4' *H4' *O4' *U4' *^4' *d4' *m4' *y4' *4' *4' *4' *4' *4' *4' *4' *4' *4' *4' *4' *5' * 5' *5' *5' *.5( *45 ( *;5( *F5( *K5( *X5( *^5"( *d5'( *k5,( *t51( *~56( *5;( *5@( *5E( *5J( *5O( *5T( *5Y( *5^( *5c( *5h( *5m( *5r( *6w( * 6|( *6( *+6( *26( *;6( *K6( *]6( *g6( *r6( *|6( *6( *6( *6( *6( *6( *6( *6( *6( *6( *6( *6( *7( * 7( *7( *%7( **7( *67( *<7) *E7) *M7 ) *V7) *_7) *k7) *q7!) *7&) *7+) *70) *75) *7:) *7?) *7D) *7I) *7N) *7S) *7X) *7]) *8b) *8g) *8l) *$8q) *28v) *>8{) *D8) *Y8) *d8) *{8) *8) *8) *8) *8) *8) *8) *8) *8) *8) *9) *9) *!9)Ho *9s *9w *9{ *9 *9 *9 *: *(: *?: *Z: *i: *: *: *: *: *: *: *:  *;Ǡ *;̠ *;Ѡ *%;֠ *3;۠ *;; *C; *H; *Q; *c; *s; *; *; *; *;  *; *; *; *;! *;& *<+ *<0 *<5 *0<: *@<? *K<D *W<I *_<N *k<S *{<X *<] *<b *<g *<l *<q *<v *<{ *< *< *< *< *< *< *= * = *= *&= *-= *;= *G= *S= *_=ơ *e=ˡ *p=С *=ա *=ڡ *=ߡ *= *= *= *= *= *= * > *> *->  *8> *E> *N> *\>  *f>% *u>* *>/ *>4 *>9 *>> *>C *>H *>M *>R *?W *?\ *?a *?f *'?k *-?p *6?u *B?z *K? *U? *g? *n? *u? *}? *? *? *? *? *? *? *? *? *?Ţ *?ʢ *?Ϣ *@Ԣ * @٢ *@ޢ *@ *$@ *1@ *7@ *=@ *D@ *M@ *W@ *a@  *j@ *r@ *y@ *@ *@$ *@) *@. *@3 *@8 *@= *@B *@G *@L *@Q *AV * A[ *A` *$Ae *6Aj *F *GF *TF *]F *iF *|F *F *Fó *Fȳ *Fͳ *Fҳ *F׳ *Fܳ *F *F *F *F *G * G *G *G *&G  *1G *;G *EG *MG *YG" *iG' *rG, *yG1 *G6 *G; *G@ *GE *GJ *GO *GT *GY *G^ *Gc *Hh *Hm **Hr *9Hw *GH| *WH *hH *yH *H *H *H *H *H *H *H *H *H *I *$I´ *+IǴ *;I̴ *JIѴ *PIִ *]I۴ *dI *jI *sI *yI *I *I *I *I *I *I  *I *I *I *I! *I& *I+ *I0 * J5 *J: *&J? *1JD *8JI *BJN *SJS *YJX *`J] *kJb *pJg *}Jl *Jq *Jv *J{ *J *J *J *J *J *J *J *J *J *J *K *K *K *K *'KƵ *2K˵ *AKе *PKյ *WKڵ *`Kߵ *pK *K *K *K *K *K *K *K *K  *K *K *K *K  *K% *K* * L/ *L4 *$L9 *0L> *7LC *BLH *NLM *ZLR *eLW *tL\ *}La *Lf *Lk *Lp *Lu *Lz *L *L *L *L *L *L *L *M *M *M *&M *2M *8M *MM *YMŶ *_Mʶ *jM϶ *MԶ *M޶`' *M *N *-N *=N *XN *nN *N *N *N *N *N  *N *O *O *0O$ *BO) *TO. *[O3 *fO8 *qO= *OB *OG *OL *OQ *OV *O[ *O` *Oe *Oj *Oo *Ot *Py * P~ *P *)P *7P *KP *QP *XP *jP *sP *{P *P *P *P *P *Pľ *Pɾ *Pξ *PӾ *Pؾ *Pݾ *Q *Q *Q *!Q *)Q *2Q *>Q *QQ *aQ  *lQ *xQ *Q *Q *Q# *Q( *Q- *Q2 *Q7 *Q< *QA *QF *QK *QP *RU *RZ *R_ *&Rd *5Ri *HRn *XRs *gRx *uR} *R *R *R *R *R *R *R *R *R * S *S *(S *=S *RSÿ *YSȿ *iSͿ *xSҿ *~S׿ *Sܿ *S *S *S *S *S *S *S *S *S  *S *S *S *T *T" *T' *T, *+T1 *=T6 *IT; *YT@ *dTE *kTJ *uTO *TT *TY *T^ *Tc *Th *Tm *Tr *Tw *T| *T *T *T *T *U * U *U *U *!U **U *2U *8U *>U *EU *OU *YU *bU *jU *qU *|U *U *U *U *U *U *U *U *U *U  *U *U * V *V! *&V& *1V+ *;V0 *CV5 *LV: *XV? *aVD *gVI *vVN *VS *VX *V] *Vb *Vg *Vl *Vq *Vv *V{ *V *V *V * W *W *!W *-W *4W *?W *KW *VW *\W *qW *|W *W *W *W *W+3 * X7 *4X; *IX? *dXC *zXG *XK *XO *XS *XW *X[ *Xf * Yk *Yp *&Yu *1Yz *?Y *GY *OY *XY *eY *jY *sY *yY *Y *Y *Y *Y *Y *Y *Y *Y *Y *Y *Z *Z *"Z *-Z *=Z *RZ *dZ *mZ *}Z *Z *Z  *Z *Z *Z *Z *Z$ *Z) *Z. *Z3 *Z8 *[= * [B * *'[L *3[Q *9[V *D[[ *U[` *d[e *r[j *[o *[t *[y *[~ *[ *[ *[ *[ *\ * \ *\ *"\ *0\ *:\ *I\ *g\ *r\ *\ *\ *\ *\ *\ *\ *\ *\ *\ *\ *\ *] *] *] *%]  *7] *>] *E] *M] *T]# *_]( *l]- *t]2 *|]7 *]< *]A *]F *]K *]P *]U *]Z *]_ *]d *]i *]n *]s *^x *^} *^ *#^ *+^ *2^ *=^ *H^ *U^ *d^ *n^ *u^ *^ *^ *^ *^ *^ *^ *^ *^ *^ *^ *^ *^ *_ * _ *_ *_ *&_ */_  *5_ *>_ *K_ *Z_ *l_" *u_I *_M *_Q *_U * `Y *`] *2`a *G`e *^`o *t`t *`y *`~ *` *` *` *` *` *` *` *` *` *` *` *a *a *a *!a *)a *.a *4a *=a *Ca *Sa ( 4 (8@L (Pd (h| ( ( (@ ( ( (D (H\ (` ( (\ (``t (x (  (L (P ( ( (  (pD (Hd (h  ( (  ( ( D (H  ( ($ ((< (@T (X| ( ( (p  ($ ((`| ( ($ (( | (0 ( (`4 (8 l (p   ( p ( $ ((  (  ( 4 (8 $L (P % ( P ( ( ( L (P ) (  (  ( P* ( ,< (@  + (  ( . ( $ ((/l (p+  (  (2 (  (2, (0 D (H3\ (`4 (4 (5 (5 (5 (6, (0p6D (H6 (7 (  (8 ( 84 (8 9L (P`9d (h9| (9 (: (P: ( ;$ ((;t (x`< (<$ ((?T (X t (x@ (  (LL (P`M (PN (N  (@OD (HO (` ( Q  (Q4 (8Rt (x- (R (` ( T ( )D (H Ul (p} ( (`U (DD (HU ( (@W (WT (X| (f (( (pjL (P*t (xPm (1 (n$ ((3D (H@o (3 (pt  (;K, (0ut (xv (WK (|T (XM (p (+Q< (@P (Q ($ ((R\ (`S ( T (T ( `d (h T (  ( ! (!\! (`!! (!! (!<" (@"" ("p" ("`# (#Pd# (h#@# (#@# ($ D$ (H$$ ($$ ($$% ((%Кl% (p%% (%% (&T& (X&& (&' ('T' (X'' ('' ('D( (H(( ((( ((<) (@)) ()) ()<* (@** (** (*4+ (8+ + (+ + (+ ,, (0,, (,BX, (,, (-гD- (H-Xl- (p-е- (-. (.X<. (@. . (.. (.X / (/T/ (X// (/ (h0 >mD> (h0H>> (h0>2m? (h0?? (h0 ?cm4? (h08?@d? (h0h?m? (h0?? (h0?m@ (h0@@<@ (h0@@ml@ (h0p@@ (h0@4n@ (h0@@A (h0AnrPFaFpFF GG>GCG}GGGG&G7GF HWHfKHw^HHHHHHHJJJJ*J;JLJ]Joooopopopopqq qq14Q(4f58695;7[D(4484;5<.@4T5u:44TB4cB4|f4o4o4~4;5;555>6>67%7?7]9q7777999)9;:N:s::;;;; <'<V<y,=,=,=,=PA_O=zO=@TA===<=d>~>zA>zA>zAv?(v?IAUBfArBA@@C ,B1 ,BR B^ Co B{ C B \B \B \C!\CC!CO!D`!Cn!D!C!C!C"C"D8"DW"+E"+E"kE"kE"kE#kE#I"#I2#IA#IQ#I`#Ip#I#I#I#I#I#I#J#J#J#J $J$J+$*J:$*JK$7JZ$7Jk$DJz$DJ$QJ$QJ$vJ$vJ$J$J$J$J%nP%3_%nn%n}%n%W%&>\-& &YP'['\'Y'*['Y(Xb(d8>>d>>d>I?dV?q?d?d?d?d?d?e?]@@@*'@U'A]'GA#wA7#A?#A?# B?#4B?#ZB?#B?#B?#B?#B?#B#B`B`C`%CHC'bC aCC5a D)D`yDaDaDD`DEya+E`:EaIEaXEaiE azE aEcaEcaEaEaEaEaEb FFHb(FNb9FHbWFefFf{FfFfFfFfFDfG !G$:G%LG+&nG$G(%G6&Gq%H%H%(H%9H%VHPmH1HPmH1YSgNYhg]Yhg}YgYgYgYgZhZh#Zh2ZhMZ.rZ Z.Z ZF/Z.Z [.[ .[//P[ h[.v[ [.[F/[F/[F/[P[Q\P7\Qc\P\Q\ځ\Q\P\Q-]X]Q]]]]]4]Q]4^Q^4%^Q8^4G^QZ^4i^Qz^4^4^4^^^^^__#_3_ڂD_ڂU_ڂf_u__V_p_+Q_p`+Q?`p``+Q``+Q`p`+Qa)a+QYa5ja5ya+Qa5a+Qa5a+Qa5a+Qa5b+Qb5#b54b5Db݀Tb݀eb݀vb݀b݀b݀b݀b݀b b b b c'cp\c +cc +cd +Adfd +{dd +dd +de<+9e,ee,ff+)f+:f+If+\f+if f+f f+f+f g+$g ?g+Qg+ag+rg1,g1,g,g,g,g g,g h,%h,Eh eh,}h h,h,h-h-h*-h i*-7i Ri*-di*-vi-i-i-i+ i-i+ i-j-"j+ Bj-Zj+ uj-j-j .j .jRj-kR8k-SkRk-ko:Oo:eo:o oo Kp ip pp p pq -q Fq eq q q qqqqqqqq r Q2r?QSrBQsr?QrBQr`QrcQrcQrcQrcQrsQrsQs:sQsvsssssC t/t0_tt0tttuWuvuu u vS 'v_ Wv |vvw vw v8 w$w8 sww8 wxC ;xJx\ \x\ |x xxG xG y .yIy yy z#z [zjz, |z, zpzz z &{N{i{{{+|E|}|| | |O|`}O=}`a}O}`}gP}}~wP~2~PW~Ps~`~O~`~UPP>`['P`PPPP P P P* P< PgP|`ppʀp %3Nep %ɕyف  %.D h  E  %lʂLقLN %; %;`4CCCV&050D0V3e3tƅՅ6I@Oi@OfONO %ޛOƆOՆOOO d  JzC %  %  % -wCwTȉf[[$^5Vʋڋ!`A`\`un %uȌ׌ %>I %R5a5p588 0ZGS %ʢdǎݎ m|֏66!0?N]o< <n== =*=M=b=w=<<ʒ=<> ==“=ӓ5=5=<=^n=on=n=n=n=n=Ô|=۔>>>4=L=w=C>C>C>ƕC>ݕC>C>C>C>%C><;?M;?d;?u;?;?;?;?Ö;?Ԗ;?;I;l;;;;;ї;;;;;);8;G<X<n2<2< ; ;ט ; ;X;/A;`A;} ; ;A;A;{;ҙP:P:1~:M:^:m:|P:~::::Ϛ:::::+:=:Tpjy*j**kϛ*ko-qjW-l2j[J/y.j̝*6.,N.I6.[6.r6.6.6.6.؞6../k.k=kLkml*ϟ,/K@-Vtl*l*z,l*ZlС$1**_+o+++0+9+Y,h,,,,,ãk,ң,k, k,8k,G&0V30e-t-----¤-Ӥ-----'J/?J/[/y7 ĥ7 77/8"/84/8F/8\  9HЦ)H~/~?~P~`~q~PNӧ\z zz.z?zUzdzuzz6ը767$636F37d6sG7G7G7G7X7ȩX7ש77,e?h !6j Ϭ p{!!!A Ѯ De!   N  ư ް     G W f |#####/c#X#P#T#9#lP#׳_#c#ܴP##][#l#Ƶ#(#=#P#oP#P#T#Y j ˶ ڶ    ,+!;+!Ja!]+!+!F!C!ƷC!׷C!a!a! a!!7!U!r!!!ȸ!׸!!!!"%"=8"N"p""""ȹ"ٹ8"8"8" ""+";"O"o"~"""""Ժ% %4%T%&[';&_g&O'0w'vw'&S&,j&~&8'Ծ%%&&;&&!&14'F&&''¿'ӿ'4'4'4'<KZy6t6`M`MM(M7MH`Mf2NxNNN,NnLLLM L*LDMUMfMwMMMMMMMMMMM %$M3MBMM %VMeMp %yMMM7M7M7M@ 1@d &AFA SAdFA =@{ @  A !wAz @@@@@@A#@4@E AV Aa %dj Ay A A %d A A %d %d %dA A A58FMGF]GFmGF^GrG^G^G^G^G^G$4^GD^GVGpGGGGGG G(G<KBZBiBzBBBBBBpCpCpCC C2CCCTCw6D 6D c6D @D1 cD m6D 6D 6DF(FGFr F F* iF F 3K?TzFf SH/ VFbFDDDDE EE/E?ENE_EpEEE44444 44,4B4n44J4J4J4J4J4(J48g4J|4Y|4h|4$$/%$$0%Nx%px%%x%%333h333P3:P3aP3P3P3P3P3P33 33Wy)**0!*?)Q*`*()(){)")1)C)[))|MS|M|ANOb}oNBOO%|VMUOUOXNNN N|1}@}O}g"}"}H}H}M}M}b}b}#}IMyI~M#P ~M'~K}zM}M)~)~'I~JMfI~wI~~~~~OOPP'B[vG%9}Z(HlG(P~d+iK]nG"b4/G=u==m=4EkKiCCCCCOO"1Ji---G-.BQ`o +:@P@rUWPPPIPgP{) +I@X@i@y@@ Eb7Bu```+`_a%#[####G#-kkk(m=]#2APP_PpPPPPjjjjjj //(/9/H/Y/i/z/0BVl{6(:J^k%|%%%% %,%C<T<mH|<<Hppp p< pc p p   & E v    L g      B c       # @ ` y  0 0 :%CDCbSuCX&5EWgyHk&6HXjz+EEoz z*z9zHWgy"j  b b 2 :2M s2   2 5;5G5$5B5Q5d8899: l<W<h<x<<<<PNPNPN PNwN8wNSQpQQQ`UD`U2DLUX\U\UUUUu(u9uOu_unu#v#v(vrvyv=];:%|%w!;`et1l1111[22H2v222\22+3Y333W334<4j444[445F5t555P556G6u666K66#7Q777;7Х77+8Y8|8L888939V9Wl9999T9 : :N:|::::0;š*;X;;;;7;Ѡ<2<`<<<<;<՟=<=j====@>՞>F>t>>>>; ?՝"?P?~??=?ܜ?@1@[@Mq@@К@К@КA]$A;AiAAAxAABJBvBBB1BB"CLCbC<yC C C CDL,D@ZD@D@DȖDlD@ E@;E@kE@EוEqEPEPFPNFPxFFF`F`G`+GAGXGpGpGpGG H9HgHH HHHIDIZIqIIII- J̏$JRJJJJGJJ,KZKKMKKK L7LhML fLLLM6MfMMMN3NNNlN}NNNRO4ORSOtOROORO. PR+PIPRhPTPTPTPTP TQ Tl@MlnlUlnl^lnl@mnmnCm@Omnm@mnm@m %n % nnn %$n %3n@@n %Jn %Pnn]n %in %rn@n@n^nnnnnnnnnnn@ om2o@KomxoQomo]omomomo@ pm/p@Hpmjp@wp % p % pmp % p % p@p % p % pmp % p % p@p@ q]q+qm?qKqmZqmqqt9rrrtrVrtr!st?s^stsss^uTt}tttVtvtVtVu0uO?uyNu']u5huuu:u:u uAuAuAu uAuAuAu vA!vm,v:vGIv`Xvugvvvvvvuvv(uvLuvv`#w`]wwwww`x`gxxsxxsIyysyysy zs,z?zppdzp}zFrzpzpzp"{q2{pA{3qP{q_{qp{q{^q{q{^q{q{>q{cq|cq|q%|q4|qD|qT|qf|qu|q|2r|2r|Wr|qr|r|+s|r|r}r)}r;}rM}r\}rk}r}}r}r}r}r}Es}Es}Es~`A~ap~w~a~~a~`~k3k^9kyk9kAkIkZk_k_k_k_k _kgk+gkC}kn}ko pӀp/p p p>pEIcDIсMIII5DIJDI %4 %4 %4DIȂ %5Ԃ %5ڂ %5DIDIMII0IBIaPggڃg?hsh9h2ڄ9h2j+IhoShggх2iFi<9hV9hpZIhShihhĆhՆh2iFi Pi/gD~g %8 %8 %8g‡ %8· %8ԇ߇ %8gg gg*g<gQ]h}]h]hňPӈPP]h#]hN]hr]h]h]h]hhh#h3hBhShdhrhhhhĊhՊhhh hi)i<SiTSilSiSiciciiċыiiiii&i5i@]0^Œ_ՌM^ +^Rl^Yߍ1^)v?T^Z@zM^vM^vȎvَ5P5!5ȏ$5Z6%6 !5$5)>5:o5Uo5vo555Ґ55 5"545C5R5c5y5555ё5555)L6:Z6RZ6jZ6Z6k6k66Ȓ6 060Md0}M޶0 #0<Wp0 vŔpvpM0MNMlMMMMƕMוM="޶<T޶d=w111ϖ1FFFF'F7FIFYFkF}Ǘ7dؘ$4CSbs™ܙК (lZi|К`[!0AXg֛ ,;מJמYמhמwޞޞ4œuќz+-Dy--<-Ubz-Kޟ.̛-PˠPؠ %c %cP %c %c />Qh-~̛-͡ݡ -*:՛Ke̢2XLXY %ce %cpX} %c %cƣ̘ң̘?UFhFSF>٤F((F& :p\pp00ɥuu%uKuquuƦuuuu#u4uEuSdҟ}ĵϧĵƙFi3ĵͨܨМ(g%4YpY^j*kϬ&kkw&kk&kk&kLk-kͷ-k?k-k(?k7HkFHkUHkfHk}\k\kcktkոtk tk:tkftktktkڹtkyk%tk5tkDtkTtkctkttktkyklkκkkΝk0ΝEkgΝ| l llǻ lӻ~ l~ l" l/~B la9lp>l>lΝΝϼFlFlYJlJlJlٽJlJl'JlSTlrJlJlJlJlJlJlҾJlTll l(l4ElTpm^mӿ^:m,^\:m^m:m^ZmZmam5ZmGam^}mom|^m^mmmmm^ m1mAmTmu,,,6!nSs!nnnnnn,n;nLnlnn:o:o:o0%04?oN?oh?o?o?o?oKo?o?o ?o?o,?o=?oN?o\Kom~xaxaxGa_$txay   /mx_ayyy00y.yHydyyy"yyyyy yy.y<"yOՆsxxxxxxyxxy$y<xoLocoo;p&pp+pWozpHpHpHpP#P3PDLpgLpLpLpLpLpVp>LpNLp]LpmLp|LpLpLpVpgpgp#ZppGsssavst t7scvsvsJZs%pWtJsnHtp`+tM\popp.s t tjjOXr'5H4lP}mmz#3CN~Us~is~~~~ PP+~R~w~~~~~ ~~)~9~H~Y~j~x~ooooo+o@acaɢɢ7aaԢԢuuu"4u\uku5kv(/vzvu;ks z z z z zzz,;{Ulz zzz z{+{<6{T{e{w6{6{g{g{g{0p{p{p{3p{Op{kp{z{p{p{p{p{p{p{p{ z{{B{j{{7|{{ {/|>|M|\|o;|qqq0p|p|/|ip|||||#|2|A|R4}x4}kkkyěkk$vvl?wJv~fw`w#`wZ:w}/:w5vfywyw3vv]vv/v/ v(v5/Hvgwx:w:www?8?U|?jj.`ɜMsȂ!J00 &Bb  + {< {Q {\ 0o v         % 5 I Bl B I B I _ ҃- ҃@ ҃\ ҃o ҃ ҃     : C C  V VF 8yb 6 8y 6  26 gy<6ZkyxрDy61P]p-22_6x6(_9_K_\_p_~6__ــ+:I[ll+po~qɡѡ2 Jm4DHD`To\~owΣ  ,'G/^m~Ѧ٦ 1@Qhڧw..8; H$Mƨ^k,ƨ=T^ckt/%Q>ҩZ +h4;dL~hrPًPӋP ً />M\kzًPً P( 9 K \ v ً P   V y!V!!!!$"$G"$" "$"$Q##9#ְ#J##J##Q$$J&$9$QX$qk$$$$$$$$$ %%-%=%M%ܳ^%%%4%&߫3& d&4&&Y'j'4'Ғ'(4#(R(4((4)0)ҒM)u)4) )4*"*6*G*Y*p****߫**߫ +]"+1+O+k+߫z++H+4+,]I,߫g,]~,,7,],],],]-4R-hm-߫-]-]-]-]-]-]-].#.8.zG.V.$e.Qx... %. %. %.. %. %. %/B/r///0*0Q0gf0u0000.1T13}11112؎q22ێ23)3Z333 3P3؎ 4ێ414@4 O4:^4[m4[}4[4g44z5A5gP5gb5gq5g5[5[5Y5]556œ76"D6Z68f66"6"6"6"6"66"6" 7I7'767E7V7m7ݔ|7ݔ77777778&8=8'L8']8'n8K8=8'8K8K8[8[8Ϭ97@9_9|r99999:4:J:k:x{:x:x:x:x:x:x:x:x:;e; ,;|E;t;ů;;ү;<1<T<<<<۴=?= `= ~=%=-=7=7=> >7>>5>\D>U>m>2|>O>֭>m?֭5?v?֭??֭?֭?֭?֭?֭@֭/@֭?@^Q@^c@^s@^@^@^@^@^@^@w@wAKAAAAAAB4BLB\BkB{BBBBBBBC/CNCfCyC%C%C%CCC&D7EDDE~F-FUF@vFFIFFÐFÐF׌GG1G AG SGEkGzGrGrGrGrGGG-G-G-H-HF.H-EHBTHPcHrHˑHXHHH;H,HH;I;!I9IIRIwI2_I_I`I_I_J_0J_AJT_PJ`_J`nJ`}J`Jt`Jt`Jt`Jt` K`%K`JK`Kt`K`K`K`K`L`L)aDLlLNgLLNgLJMNg(MEMNgcM_gzMMNgMMMJMMJNN,NJ?N\N2yN7NgN7NgO{g#OPOiOOO@OeO@OePFP|P)[PQ)[aQQ)[QR)[=RRR)[}RR)[RRRc:SNScS)S}ScS}Sc TTc5TPTPyTZTPTZTPTZUP5UZUPUZUPUZV:V]VyVVVW W=WZWuWWWW )W-X )EXsX*X XY)YG?Y *iYY*Y YYc*Z)?ZvZ3*Z Z)ZA[ +N[ |[$+[ [ +[ +[ + \ +"\ +/\ I\ +Z\ +l\\̈́\\\\\]]/]P*A]h*P]h*_]h*p]t*]h*]t*]*]*]*]* ^*&^*@^*\^*{^*^*^*^+^+_) _,_=_I_Z_&f_w___&_C____ ``.`E`0%j```@'```%``=a%oa`a&abj&*b<#ZkFpkT#kFk>#k>#k>#k>#k>#kFl>#l>#/l!Fl!Vl!ol!l!lll m /m Vmu m m m m m m n n $n/ 3n/ Fn7 en> n7 n> nc n n n o o *o Bo Xo io o o0o0p0;p0kp0pRp0p0q#,q#?q#]q#}qpJqqpJqqpJrrpJ-rMrJrJrrJ*sGs Kss KtK{t$KtKttK\uJyuupJ)vLCvLavLvLvLvOvOvOvOwOwL#wO4wLBwOUwLcwOvwLwOw0NxxM#yMyM zzMDzMzM<{a{M{{MJ|o|M||M}M#}M5}NO}N\} %<h} %<q}%N}%N} %<}P}}P~$~QB~Qp~Q~~R~Q(QBSPdPsGQGQQQQQQ&Q<QTdQuQ(R(R(R 00+6RR6Rw6R6R6Ŕ6R;R 6R6R)6R96RH6RY6Rj6Rx;RnSRՂR,T ,T mT8,TJ1Tc,Tt1T,T,T,T,TɃ,Tڃ,T,TOT OTOT/OTAOTQOTcOTsOTOTuTuTT܄TTT2TBTRTdT|TTTTTЅTTTTU*SK<SKKSK`KoKKqMqMʆqMކ`l`lMM?O-?OK r| |* m| |}0}; %3D [ k  g| Њ (}: V | ׋|  H K|H P|t||؍| % %| | %! B ZKo ֎"3DY|!!!>!d!!,!!!!!/!@!M,\KnK}Αۑ^^^ ^} ^5`}u ϒ}^^^&^0};^P{}}ؓ}Q^k }!/}BP}i}}•͕^ڕ%^2BX}Ԗ}'<h}{ϗ}&0};P{}}ؘ}6H6UJm66Йߙ}}"};g}z,}66Ú6666+6] ~mśm՛mm ~m; ~N[p ~Ɯm֜mmm ~ m K ~d ~ϝ ~%=f ~Þў ~ ~ 7 ~JV ~epm}ȟm՟+Q}iw}}?I}cp}ʡ}9}Ry}ʢ DS}gu}}У}} *MXeuOؤ}O(}3FOi}|OΥ}O&0};PO|}O}ڦO}fLfYzqffէO}O}O'}>Oa}t\}fffިffffAb|S4} ߩ  ?v    Ī%%L)f))))ԫ)4)).)>)M)])n){4S4}S4}ʬܬf|f|}r2m2m 2m׮2mR2m!Mï2mٯNE2mɰ2mN2m$[_2mod~ddNűNNN@Nerurròϲrrr"/r?Pndzس ,CidiiNiдߴ 1BQ`r7GؓHH G:GRHm0\0ֶ\\\'^D\S0g^s^e^ͷety=yYʸ@ٸ$3D[ j yTTTTǹccU(d^d˺8ܺ^d8(d+cDc\(dq(d»(deae[6(deмe߼eeeee4zdG8Xzdd8uzd8dzd8dԽddddd&d5dDdUdle{ezz/Fz]tzzڿz=vv%4Ecwvqvvqqq$q8qEvUqequ444(>Oi}v f f f- fC_\P\b\x\\\\/\U\{\\\\\ \\,\<\M\Z\m\\] ^^]^_^^^J\^Y_j______```5`O`f`x```I````P*`L`l````````!`0`A`R```q`x>fxxx>exxDx0Zxi 0*@9c9====!=G=jG=======GHg~2Mh%4KaxpxVVgV3 Vv  VE  V  V> )k V ) V ) V% )Z W  Y  Y  *W) )m ZW V EY *W<)tWWW X&P X` Xq}XYYYYY#Y/@YNa5Ym~ZZiZPFbPFPFPFjPFPFHG/{G@FW%GnPVPVzVkVPV>UqUUUU`C`t``Ow .ZWZzZL008W(081([h8(82(T8(8( 9Rm8~;S8Z~8(8(8   ! 1 H X  h x       ( !8! !0!G!^!n!x!(!!8!(!h8!8"A9-"A9l"A9y"P"P"P"E9"E9#E9.#E9T#E9|#E9#P9#E9#E9#E9#E9$E9$E9($E96$P9G$=`$a9r$a9$n9$n9$q9$q9 %9 %Z:I%Z:%Z:%0%0%0%^:%^:$&^:J&^:p&^:&^:&i:&^:&^:'^:'^:"'^:3'^:D'^:R'i:c' >|'~:'~:':':(:E(:w(:(:(R;(r;(;(r;(;(r;)r;);()r;E);V);t);)<)<)<)<)3=)3=*3=*3==*Y=H*#@Z*Y=*Y=*l=*y=*u=*?*#8*?+?"+?1+)>C+)>T+>f+>++Pw++Pw+',PwF,[,wr,,Pw,,Pw, --*-<-P-`-v----m-.m).E.mY.?u...m.)/m8/G/X/?g/k{/?/k/?/k/?/?/g/k0?$0S30|E0|T0_0#@m000000U0#80U0U 1d"1G1l^11l11l11C 2;>2l_2;2l22[2#@2[2[3j3w'3s63H3Z3i3z3333y333 4 4_&4#824_A4_P4ng44]44]44]585]V5*n5*50151661S61|6`16161362262#7*2]7`1|701701701701701701717181,81>81M8 2_8B2p8B28B2808G28G28G28G28G28G28S2 9G29G2,9G2<9G2K9G2\9G2m9G2{9S29292929P92929292 :2:2):28:2H:2W:2g:2v:2:2:2:2:`2:`2:m2:2;3);3A;3[;3z;3;3;%3;3;3;;<H<H\=Ow==R==>*'>A@>pZ>>>>>>?&?K?v????@.@Q@p@@@@@@@@@A>AKA0[A0kA0|AAAAB4BWBvBBBBBBBBBCC&C1C0>CMC\ClC|CCCCCCCCC DD'D6D<PDNDNDaDNDNDNEN%EfJEfuEjEjEjEjFj-FjPFtoFjFjFjFjFjFjFjFtFG=GJGPZGPjGP{GGGG H3HVHuHHHHHHHHHII%I0IP=ILI[IkI{IIIIIIIII JJ&J 8J2JJ2YJ2jJ2J2JRJ2JCJgJgJ -$KX-KX-Kq-#L-4L/JL.eL-L-Lq-LX-LX-MX-MX-'MX-8MX-HM-]M:-MQ-MX-M-M.M.M.M.M. N.N..0N..?NJ.]Np.Np.Np.!O.SOp.eOp.wOp.Op.O.O.O. P.PP.P.P.P.P.Q.QQ.pQ.Q.Q.Q.Q.Q.Q.Q.Q:/RT/R#/"R#/1Rh/CR/UR/dR/uR/R/R/R/R/R/R/Rp(SpgSSSSSTTT.TcOThrThTlTlTlUl%UlIUljUwUlUlUlUlUlUlUlUwV$VLVYV0gV0uV0VVVVW*WIWdWtWWWWWWWWWXpE8XpEmXpEXFXEXpEXE/YEFYEfYEYEYEYEYEYFYFZ FZIZZ Z [#[m1[@[R[d[v[[.[.[6 \6L\6f\6\6\6\@\6\6\6]6]6.]6?]6L]@a]]]^P^a^=x^S^^^^^^7_g_____`'`7`F`V`e`u````a\maa\bjb\b c\\ccc dKd\dMsdcdddddd2ebeeeee f "f2fAfQf`fpfff f00g00hg00g[0 h[0Khs0^h0{h0hB0hB0hB0hB0h0i0Pi0i0i0i0j0)j0]j0xj0j0j0j0j0j0j0j0jp k]5kpSk]mkpk]kk]k ;lTl l llQSm{mQmQmQ%n~?nTnjn}nnnnnnnoo#o.2o.Go0gpo0go=go=goYpY'pY?pYVpYppYpYpYpYppq5qWqwqqqqq0q4$rPIrTnrrcrrcrrcrc scsc4sc?sNsc`s lsc{scss@s@t@@thtttftftfufuf.uf=ufMuf^ufkufupupupv&vfFvf^vfuvgvgvpZw hwpw hwpw hxEx hxx hyMy hypy hypy hWzz hzz hz { h.{?{R{5k{p|{p{{{{{{{|| iO| i| i| i| i| i} i } iG}'ib} ir} i} i} i} i} i} i}'i}`iB~`iv~i~j~j~i~i~iij%j4)jMjjjjjjjjj3jOkzkkkk̀kހkkkk k2kBkQBlbllxlltl|lllÁlӁllll4dm}m҂,=Uk|ރpo1poSonpoooooƄoՄoo o)p[l3Å$U|7]ч 1?Pi{ˈ܈"(@(Xnvnrʉrrrr:rZzprrrrrrЊrފz@Futy@ut2@ut͌n $nFutez~qՎ-mʏdُ(%(\((ʐ((I(JnnʑFFF"eܒ8 L  R̕+:I\}00ɖ0ږ@dƗ֗&4C\\ɘ))Y)f0t0))љ)))9)]3x)))))ǚ)ؚ)3q$fқ.[Ҝ%DVmΝݝ (7FUf}2::Ğ:ޞ:::,:F:bD}:::::͟:ߟ:DOO5dbdƠw\ w'>Z~w>wġ!ء>>>3>@S>rW\\dעw} wd0dBdSdidwddУBB-PCPRPaPrP``Ϥ0  S 2b P[ u  f ~  S ͦ[ h   3 q   ŧ ק   $ O r     * I Y h x     ĩ ө  P    + ; K Z# i y     ɪ ת#    0 . = M ] m |     ɫ ګ   , A 1S lS b S S ϬS S g g Ck dk k k ͭk k u .k >k Mk ]k lk |k k u 0֮~0 ~3u~f~Jso~ư"װ^^r ^2F^m|˱P/P@gIJ/>N]nOijٳ3~ B'~G3X3j3{33~3˴3۴ccc c)f:FfYxfȵd~d$~8Xrܶ0O_n~ʷٷ$3D[jy!Ƹ!!PP!,!F!b!~!!,̹!ܹ!!! !!,!:,I|]hwhhhźhߺhh h*<hIa~~~ۻ~3Vy¼1P`o˽ڽ%4E\n}\\\\Ⱦ׾"1~@~O~_~q+++Ϳ, , ," ,:#,Q`,`,,`,`,`,`,2,h,y,,,,,,,`,,,,,@,w,,,,,,,,,)333:443!4!4 !48!4O14^14m84H4H4H4000H4H4@H4dH4H4H4M4H4H4 H4H4(H49H4JH4XM4g4Z4Z4p4;p4}p400p4p4p4p49p4]p4z4p4p4p4p4p4p4p4 z44F?k*?*PA(*ps@*@<@d*@*@*:%@L*c%@u*@@@@@AAAKA)&A:ALKA`KAxgAgAgAgAlAlA9lAF0T0guAuAuAuAuA%uAO{AjuAzuAuAuAuAuAuA{AAA+AGAhAAB4B* >>c &6QۯqO_---Fr!C]r}=]k/!l -E|e|||-#J&c-rkȱȱ!ȱ:ȱJȱc|s|`|`||8y&||%4H2a2z2@@TT 5| $_?HM2^k{]>=<R}BBZwUUU3Th||ݣ} }}2}G@wx5@Kx`Zqxx=\~ +:K\jyԥ MA qr i   M / F+ M: MR y      < [ v           ( M vu X v ? `U ~r  `  :/3H:Wk,է"vUqv>v"v;׻fOv8Wvv%vlWv>>>>3gMvjg{gvҩ ҩ0٩X3j4w+MLY,G///=LLL6HWXfnw0%0 %+[%0%j%9aHaWl}28Qs/Tt.Kf(AJ`$WF I ( M   @ !H/!3f!!!!R",;"U[",n"""#'D#e###@#H $c$'($'>$co$$$%%)% :% K% \%Rk%U|%%%%%&&2&J&a&p&&<&<&g&g&g&g&z'z';'P't''''@''@(T(@((@(S)k))+))*ӼS****&+{p+k+,B,{],,N,k,-%-T-h-------.%.6.H.^.m.|.+.E....Ӽ/Ӽ/Ӽ6/L/[/:l/:{/:/:/:///// 0050F0W0o00001.1Y1}111122.2>2M2^2o2}2222222 33'3:3M3^3t333336333".4"S4"4"445(25p]55596"6"6p67K7|7777v7v778+8:8I8s\85w858885858585 9@959K9Z9k9{99_9_9J9J9J9U9_:_):_8:_I:_Y:_k:::::::;;(;9;I;Y;k;;;;;;;<<(<9<I<Y<o<<<<<=ͺd=ͺ=ͺ=ͺ=ͺ=ͺ=ͺ>ͺ>B>\>>>>>ؠ?4?"R?Ǡo?Ǡ?Ǡ?????@(@J@v@@@@@AOAܤlAAߤAAAAܤB=BߤYBBBBBBC2CSCѺoCѺC C C C C&Cp D.Dp\DDpDDpDEp+EPE}EEEEEFAFVFnFFFFFFGӻGG0GFGUGdGsGGGGGGGGHQHH H H=H=I=I=0IKIaI I I I  JS@JS_J|}J|J0J0J0J<K<@KcKKKKKL-LOL}LLLL M8MlM`M`M`N`+N~NNkNk6OoO~OrOOOOOP5PaPP0P0P0P<Q<DQnQQQQR_R RSSSST uTTTTTTTU$UPUUUUV)V:VKVaVVVVW4WgWWWWWWXXX,X>XSXP{XPXPXfXf!Yr0YrAYrRYrbYfqYYYYY Z,ZgZZ;[X[ [\(\"j\;\"\"\"\"]"']"Q]"b]"x]D]D]D ^D@^Dn^D}^D^D^D^^^_U____`*`;`L`\`n``````aTaaaaaaa~a~b 2b Rb |b b b #ckccPHd xd dRdk9eRKeR\eRneReReReReRetftHft|ftftftftftgt%gRgcgggg+h^hhhhhh hh>i>iDibiiiij!j2jBjQjNcjNxjPjPjPjP kPGkPkkklPElPallllllmm.m>mPmjmmmmmmm nn,nTcw8G_'Й',, ,!Dg#͚  $#L?fi̛?o~ל  %i؝f47G`o77ٞ7 7/Veuɟu ,F_n6áTE[΢|fEvXnߣ]3`{Ѥ5DYnXXҥXߥX 'Hdæ3`rçۧ-,Eq[R{qRը CR/HWkRRRRXf9XFfg}Ϊ۪ -:LYkxʫ "1C2Pb>p>>>άެ>>>0<K\nƭ%;Sbq+®ٮ+++A+PbwEɯEگEJ)Af|E˰ ):JZjzEȱEޱEo$W1WAP_x N ޲N  5NPm dz % Ƴ ! 62[ zjմ NJ $J 3J Dm Sm bm s `ǵ`9lm̶ 3Twg~w Ϸ &< XoO O QO ^O Ź!xX0v("-(#MuľӾ>1L>\>seeƿt(wZw*B'R,fwswwww 7FW)r))))Bg~( VUp;;;;;;;;&;5;M`rj`jj 4`-M 0AN`mjtt! %D- %D3> %DKd{ %D %D %D1J_v):H[i| %Dj %D(BhjDDDD*D?k~D DD*D4?DTLYp1=LWDdzDFJaFn7~7777F*F^uF77777F FKdFUUU8UtFFFKU7UUFUQ7^UnUU@Y@a)>s8nIBLV/ Pb #p>P_q5T)5FSg_~__1F<F Fx8xKxgxzxxL0'0:0Y0l00R(R (8RULsR B^QR(3(Hu"*;D_oo2o82Totpopopo$p;o]s{oysosos os+o<sIo_yyyy'>yN^p7< *7IUyftyyyyyy"/yANy^Nm|BBQ,Q;QJQYQhQxQQQQZZZ Z+6Cm!6Wk8"@Zv&Q7QF`U`d`s`````#3F^m    777-@_r6Kxk|#`-M0h00r8@mV N N%@Yv00Q>Y x0'  J  [  p " " " " "A "X "i "z " Q Q k k k pA pv p p   > ~   ) G e       8a-Fp$-<-T-ao~--p!tF`h`ze@@bbb)\-TopEpapp3OjyH-R%b%b%bs&Rs&5&bs&-&=&M$&a&&('('5'5'0$+0$Wv0$0$$:$$$"F2/%B/%R~$f%%%%%%@"N3@"_N@"N"~"" N1"euA#A#")#)####&#? n  ! 6 P !h !x   K! " K! " ! !!"!")!N!jj!!j! !j"F "F #"F 4"F D"F T"F d"F u"F " " " " " " "  #9#t###5#N##$H$N+$>$[$i$}$5$N$$$$$$ %%(%9%K%PX%Nj%Pw%N%P%N%P%N%P%N%P%P&P&P)&|;&M&j&*&*&*&*' +#':+P'.+f'G+w'+''+''+':+(*>(*_(:+(G+(+(+( +([+([+([+)r+)r+$)~+3)~+E)~+k)))))*9*)T*t*)****E++)++3+9* ,",):,],)x,,),),),),),),) -)"-)3-)I-T- %]-p-|---)- %-)-)-3-.-P((.(F.(i.(.`'.'.'.'/'-/'?/'\/0.}/-//+/+/+/0,00,<0G,T0[,l0[,0G,0G,0G,0G,0G,0G,0G,0G, 1+01+Y1+1+1+ "2B`Rb\u\ooT* '2p=H X cn, ~ \   q#%8PHjXbm8}%:!/=/\Dx-<P 0@iSf:vmCCCH%5E[ctcy E.`>N^q   ##(#<#Y Y  (!@!P"c %tx%x%x%}%%&&+&(()2)B)T_)o)P*,* ++ +,,  , ,' &-1  < *-L -V + a -q .|  . / + 0 1 h 2  2    3# B3< J4L 4\ 6l 6 6 6 37 7 7  8 Y: t: : :. :> :N :^ );n A; _; ; ; ; ; ; < 2< i< q<$ <F <X <m < < = = 5= 5= E= |= > > =2 >E >U >e ?x ? ? ?  @  P M` MpiMMNO` P PP)QGQ R- )R0xR@RP-Sfv T)+TXTgTvTTTT  U}!`U+D7UADUU`l0VBVIVIVWX%XX XX/XBSYRZYeYuY/Z/Z/Z~ZZZZ] R]8]K]^^o^^D_u_x bx$b4ud?zudJ |dJ |dJ deHi*'{#?##``aaaa%ca5aEaUa_jHbzeeeff $E% Y%`%5`%NfY(eFg|(gg!hpj*l*",l-*D*T+kC,~--6.J/Pm1mD2z2z2n#3.@o93EoUoeoxqrMs44;55>6 781:A:Q;a<q=O=p==>v?A@'BABS=CoCD+ESEyFF0GZGGG+G>HQ^HdHwHHIJpt;KyvvWKw.L0wTw/vw9MD;xeWKWxxyeyy6Ly6Ly z;WKMzWOMbTzuzKK|M||"};}M}v}FN;NK}VMm)~}t~~~~*OOp+Q # p- P8 QD W j z  ڂ Q      R ` T !Մ!Q/!V?!R!e!(u!!3!P!D!_U!l!U!W "< "1" A"Q"a"̏q""""""q"l"L"<#1#!#1#A#ܜQ#՝a#՞q#՟#Ѡ#š####Х#$$ $0$@$P$l$I$U$L$$BX$$$ $г%X%%%8%H%S%X^%q%ڸ%L%%X%[%[%@%̼%%-xS-e-w-r---cm--cm-@-m-I-m.I..m(.8.H.X.m.mx.@.m.I.n.I.m.I..m..4n//4n'/7/@A/nM/IW/nb/Iq/n/I/n/n/uo/o/o/o/o0o0 p#0r30rC0rS0rc0n0sz00000011&161(F1nV1rf1v1@1ut11(1F12ut2=2utH2 X2c2to222'2*2m222 3%3:03OB3dT3yf3x33333G33(u30u34v4%"424E4X4k4v4Pw444444445'575S5)o5)5q5555j5o 66./66?6R6b6r6666666:6O7d77w&70;70K7\]7m7J7J7J77x77x797x7=8x848E8V8l8T8h8l8888 8 y8 9 #939J9a9q9C9G99999:!:3:C:S:^:zj:@ u:/{:J : : : : :S :S  ;S ; 1; H; _;( p;( ; ;S ;g ;k ; ;|; < <-<D<![<?k<<|<<|<<}<<}<= =}+=F=}Q=[=}f=u=}=6== ~== ~== ~=> ~ >>3>}>>Y>}d>n>}y>>}>>O>}>O>}>O>}?O?}?f+?A?4}L?\? u?4}?%?)?G?4}?|?|?|? @#@:@Q@h@x@@@@N@f@j@A*A:AMA#]A0hA~tAAAAAOAA$AKAB BL5B~ABVBhBzBBBB!B!B|BhBhCC~+CEC\CsCCCC CC;CIC{D.D(  D7 0D CD VD iDP!tDFD!D!D!DD0%D`D&D&E&ER&)E^&9E^&IE&\E&lE&|EE )EE=*E*E+EE)E FF-F=F,MFw,]F,pF,F,FX-F-FY.FY.F.F.Gw/Gw/$GP04G0HG0\G91oGi1G1GB2GG2GX2GX2G`2G2G2H3"H32H4EH4UH4eH84uH;4H?4H?4HZ4Hp4Hp4 I4I5)I-5BI-5[I-5wI-5I5I5I5I@6IT6IT6IT6I|6 J6J6*J7:JR7LJR7fJR7vJ7J7J08J(Jh8JA9JE9J=Jn9KZ:*K^:AK >QK:mKc;Kc;K;K3=KY=K?K?K*KVfNVf^VftVPgVVggVVggVgVgV9hVIhV]hW]h.Wh>WhNWeh^WhnWh~WhWhW2iW9iWiWiWjWkWjX&kXk+X-kBXHkRXckbXgk|XkkXkkXlXkXΝXlXlX YΝYFl-YJlDYlTYl^YiYmY^Y,YmY!nYY!nY!nYnZnZ:o,Z?o>Z~NZ\onZaZ\oZ\oZՆZxZoZZHp [Lp#[3[p^[~[.s[oTooooۯoop pp/p-Bp5Rpdpvpȱpȱpѱpmpqp@pprp۴ qq,BqMqI]qxq\qqq͵qqqи r%r 7yILyw^ywpyyyyyyyyzz zd+z;zNz Xzczvzz*zGz,z|zz`zjz{{){9{J{U{k{v{{{{{{{{{{|!|?|J|Y|d|v|||:||:||:||:}}U*}:}E}P}`}s};};}}w}}`}}g}q}~~!~o+~W6~F~V~f~v~p~~~@~~Q~~~(Z8Hi(0R(^ 4GZoπB QQ/QEQXhx 7ˁہ1<x"Eoa|oposĂoςsނo /?IyT^yi"zxʃ+Ճ. <J+;QhgxDЄ) )!t8HcYsY-ЅQ-CYl@vVr   ˆN׆3 ^ |  |   *N5 @L \ o  ŇՇ]bk$g7O_q<Lj^ E>br7uɉzى8HYXdykNJ׊`+4eDUR`Xkf]Ë΋ދ2n"7GQ\l=HɌԌj  K!"%!5@"@NLK"\)#wA#0$;$%/%ύ%ڍb%&&!9v'I)T`+p:+P':,,ˎ-֎+.symtab.strtab.shstrtab.rela.text.rela.text.unlikely.rela.exit.text.rela.init.text.rela.rodata.rela__mcount_loc.rodata.str1.1.rodata.str1.8.rela.smp_locks.rela__param.modinfo.rodata.cst2.rela.retpoline_sites.rela.return_sites.rela.call_sites.rela.ibt_endbr_seal.orc_unwind.rela.orc_unwind_ip.note.gnu.property.note.gnu.build-id.note.Linux.orc_header.rela__bug_table.rela__patchable_function_entries.codetag.alloc_tags.comment.note.GNU-stack.rela.data.rela.printk_index.rela.exit.data.rela.init.data.data..once.rela.static_call_sites.rela.gnu.linkonce.this_module.bss.rela.debug_aranges.rela.debug_info.debug_abbrev.rela.debug_line.rela.debug_frame.debug_str.debug_line_str.rela.debug_loclists.rela.debug_rnglists @E.@@P 0xwH+.&@ȁ1H?D:@3HOJ@p3H_= Z@3=H lHY g@XU4X#H y2e 2ςh@x4h H(  @4HH d!h!@4`H#@40*H+(<@(4hH (gT@-6 H|i4q*xK%@;6H9(&@Lh&$_&0k&|&w@7H$( @`8%H&pH50H5`6`6x @(-8 H+>@0:8X_H-^@8H/ ^@8H1^&^!@80H4>^@9@80H6X@dp b@d]@8H9vf<q@08!H;,fA@бYطH>(@iZ`fH@0-z0'^a&(1@ZHDX-@^HF-0eI  L/~Ȱ_