ELF>(\ @@KJDH@ H HHDDHPXHff.t1ATUHSHeL$%(Ld$IHHH$Hup<$MEGAtnAt$u5HM!uIA<$tW1HT$eH+%(ucH[]A\HM)uA<$uHE t"1|$ANITuHEuHJ3tf.AT UHSHHHĀeH%(HD$x1HHD$pH1fOH|$pH}|$pMEGAI"nHLHSD$<HHHAVHHAF<uAF< HHHtHD$$<tRN<uT$ HHUT$ HH=T$ HH%T$ HH L|$(HD$@HL$8E1LHHD$@HL$0E1LHH|$@HH#HHH|$PHHI|$@HH\fDHwp11DHwpi1fHwp91fHwp 1fAV11AUATUSH eH4%(Ht$Ht$fD$HHD$HD$HD$nH8D$HHxf.AWAV%AUATUSHeH%(H$H1HD$HD$HD$,HD$4ft$1LD$OHD$?HD$GD$>D$@Dt$ArŅADŽ$M$LA$H$t9ID$XI9t/ff.HQx€QHI9uADŽ$ID$XI9tQIt$XL6I9u.Bff.ff.ILM9tIFuHL`tH4$L1Ht$,HHD$,HD$4fD$H1H?MUE @ff.fAUAATUHSHG@HHu,HHDD HHEXHUXH9tbLeXI$ I9\$`tIHL9tFHuAD$AL$HD AD$H}@t'AuHHH THtHHHIt$HHtǃ HupHUhH( []A\A]IE@MHHIE@HHHChIUhǀ HChIupH(HLIE@HHIA1AA IE@HHHChIUhǀ HChIupH(HLHʾ.HHDD$HxHHEDD$H <HDD$L\$ HLL$HxHHELL$L\$ H <HDD$L\$ HLL$HxHHELL$L\$ H <.HHL LLH1`HAI9t'HHmHHLLLHD$eH+%(uH D[]A\A]A^I|$@HHID$@AHHI|$@HHH{@HHAC@MHUfD$8CBfD$>HHHD$HHD$ D$H%HD$0tKHt$ E1I HHLt$HHH|$HHD$ E1IHHLt$HHHD$(HuHIHu Ht$(HI@H81HHH$H)I8I8HHD$0HLt$(ADD$H|$LM@I1H|$0IxIHD$@IIIIIIID$A A<MfAAD$A4HD$ I AAH|$E1  IAD$LIH2H|$HLH|$0gH|$(Ht$ HI(AƇ0WH|$ HD$(HuH|$H렾HIHu sI@H81HHH$H)I8H1I8HLt$(ADD$H|$LM@MHHD$0 ZI HuDH|$HIxIE1IHHA? uHL $|$ 1ID$Ht+T$H|$HI lIxIXE1 JHIPHH4H@HHHIhH)IXI`HIpA?I1HT$iHxH0HHHt$hH)H1HH׹D$hfD$jIH<$D$pIHD$Ix1Lt$xHE1Ht$x LHIxIXE1JIPHIH4$4IH(ȍVHȍVHHȍVHHȍVH1V I@A@PILHL$`A<HLT$XHT$PHT$PLT$XHL$`Hй%HHH+ HE1ALH HHHH5IH<$Ht$hDt$pD$hD$jIxuLE1HLt$xAA IH|$yLIǀIHǀIfHD$~A A@ 8GIA 1HIHxHH1HHH)HHЁHIH<$D$xD$z$AƇ4 IA4 ffAL <AAƇ I AƇ A AA I HD$IxE HHHT$HH1LH|$yH<$D$xD$zA uIxHHf|$>xf|$8<uDD$>f-`fw5H|$HH|$HA<A1H|$yE1LLIHxLHLIHH)LLD$HIH<$D$xbD$z$1E1IH|$yLD$xHzHLHLHD$H)HIH<$$ALJ0 uIA0 1H\$LAA A91H|$yIHH\$E1E1D$x@1LIH8HHxHHH)HHЁHIH<$$M M E u%I114HHufPA !AA 1H9AƄ$ H=<IqH 4HD$PH<$Ht$hHD$xD$hD$pHT$PHL$A@ BBAA 1LAL AHHuB HL$B fAH B1tt<@9tD@aHHu1LLHt$HHKuIxHL$xE1HHHIxlLMt!LLHH LIA4 <@:AƇ4 @-AE1I H|$EHAPAjAE1EAI HAPjH|$pH|$pH f|$8{H|$HuH|$HH|$HtH|$HNH|$H5L0 HxDHDHAILJ$ AƇ, A0 11H|$yA LH<$D$xD$z*1A A 91Hi¸I HHHHH뾍HI$ 9H׸HLIVH!xxALJ @A ALJ @ƒA A 1Dd$8H\$HLILI9Li˸E1L A4 IMHxHk HHI$I$HxH?I$HE1 <HI$HxH,I$HE1 DHI$H1E1Ht$@I|$ID$hAD$\E\$H LHcILIH$HL$(E1E Dd$8HHH\$HL$HE A Dh L$LP Uf@fP DAPUD`fPHA?pH|$D$HI HHA E1I HEHE1LIHH|$yALJ8ǀ1IHxLHLH)HHHЁHIH<$D$x}$1A8HHH\$IH<$#HHH\$IH<$HxHH\$IHH<$H|$HD$HIH|$HIA8ALJ8HcL$L@LH-HL$1LID$xHL1LHHMHH¾HMHHHMHHHMHHHMHHHMHHHMHHHMHHHMHHHMHHHMHHHMHHHMHHHI|$@HHHT$LHŅZLff.fAUHATUSHHH8LHAI9tHHmLDL[]A\A]Sȃ}v ~f= v f 1HHHu HHHHÅt1H2I11Hy H[=1HH1HuuuuuuuuuuuuLSI Logic MegaRAID %s %d commands %d targs %d chans %d lunsinvalid partition on this disk on channel %d Contents of Mail Box Structure Statistical Information for this controller IO and error counters not compiled in driver. v2.00.4 (Release Date: Thu Feb 9 08:51:30 EST 2006) 438/466/467/471/493/518/520/531/532 Controller Supports 40 Logical Drives Controller capable of 64-bit memory addressing Controller using 64-bit memory addressing Controller is not using 64-bit memory addressing Logical Drives = %d, Channels = %d Controller Queue Depth = %d, Driver Queue Depth = %d 4megaraid: failed to create megaraid root 4megaraid: failed to register char device ABORTING cmd=%x invalid command Id %d, scb->state:%x, scsi cmd:%p scsi%d: scanning scsi channel %d for logical drives field "pthru->cdb" at drivers/scsi/megaraid.c:706memcpy: detected field-spanning write (size %zu) of single %s (size %zu) field "epthru->cdb" at drivers/scsi/megaraid.c:1038scsi%d: scanning scsi channel %d [P%d] for physical devices field "pthru->cdb" at drivers/scsi/megaraid.c:974memory not available for scsi inq. Channel:%2d Id:%2d State: OnlineChannel:%2d Id:%2d State: FailedChannel:%2d Id:%2d State: RebuildChannel:%2d Id:%2d State: Hot spareChannel:%2d Id:%2d State: Un-configured ANSI SCSI revision: %02xlogdrv delete on non-supporting F/W , check-consistency in progress%s %s: rejecting DMA map of vmalloc memory Product_info cmd failed with error: %d [%s:%s] detected %d logical drives Your card is a Dell PERC 2/SC RAID controller with firmware megaraid: 3.00 or 3.01. This driver is known to have corruption issues megaraid: with those firmware versions on this specific card. In order megaraid: to protect your data, please upgrade your firmware to version megaraid: 3.10 or later, available from the Dell Technical Support web megaraid: site at http://support.dell.com/us/en/filelib/download/index.asp?fileid=2940 Firmware H.01.07, H.01.08, and H.01.09 on 1M/2M controllers do not support 64 bit addressing. DISABLING 64 bit support. RAID: Can't allocate passthru Can't allocate extended passthru Cluster driver, initiator id:%d scsi%d:Found MegaRAID controller at 0x%lx, IRQ:%d MEGANITdrivers/scsi/megaraid.c Fw Command = 0x%02x Cmd Sequence = 0x%02x No of Sectors= %04d LBA = 0x%02x DTA = 0x%08x Logical Drive= 0x%02x No of SG Elmt= 0x%02x Busy = %01x Status = 0x%02x pend_cmds = %d %s Controller Type: 418/428/434 Base = %08lx, Irq = %d, Version =%s:%s, DRAM = %dMb support_ext_cdb = %d support_random_del = %d boot_ldrv_enabled = %d boot_ldrv = %d boot_pdrv_enabled = %d boot_pdrv_ch = %d boot_pdrv_tgt = %d quiescent = %d has_cluster = %d Module Parameters: max_cmd_per_lun = %d max_sectors_per_io = %d megaraidmegadev_legacyABORTINGRESETRESETTING %s[%x], fw owner %s-[%x], driver owner aborted cmd [%x] complete reset cmd [%x] complete invalid sg Adapter inquiry failed. inquiry failed Battery Status:[%d] Charge Done Module Missing Low Voltage Temperature High Pack Missing Charge In-progress Charge Fail Cycles ExceededRebuild Rate: [%d%%] . Vendor: Model: Rev: Type: %s CCS reservation reset failed reservation reset Delete LD-%d failedrejected passthru ./include/linux/thread_info.hmemory not available. 40LD read config failed. 8LD read config failed. Logical drive:%2d:, state: offlinestate: degradedstate: optimalstate: deletedstate: unknown, initialization in progressSpan depth:%3d, RAID level:%3d, Stripe size:%3d, Row size:%3d Read Policy: No read ahead, Read ahead, Adaptive, Write Policy: Write thru, Write back, Cache Policy: Cached IO Direct IO Blocked mailbox......!! pending commands!! hba%dfound 0x%4.04x:0x%4.04x mem region busy! could not map hba memory out of RAM Couldn't register IRQ %d! ./include/linux/dma-mapping.h%c%d%d.%d%dsupports extended CDBs 3.003.01H01.07H01.08H01.09channel[%d] is raid channel[%d] is scsi RAID: Can't allocate sglist &adapter->int_mtx&x->waitproc_mkdir failed configstatmailboxrebuild-ratebattery-statusdiskdrives-ch0diskdrives-ch1diskdrives-ch2diskdrives-ch3raiddrives-0-9raiddrives-10-19raiddrives-20-29raiddrives-30-394%s %s: 652cmd [%x, %x, %x] status:[%x] megaraid_legacyMegaRAIDproc_show_rebuild_rateproc_show_batteryproc_show_pdrv proc_show_rdrv mega_create_proc_entry mega_init_scbA K U mega_enum_raid_scsi&*mega_query_adapterU]mega_prepare_passthrumega_prepare_extpassthrumega_build_cmdmegaraid_abort_and_resetmegaraid_resetdgmegaraid_biosparam mega_cmd_donemegaraid_probe_oneO[atPissue_scb_block__megaraid_shutdownmega_internal_commandmega_do_del_logdrvmegadev_ioctl 2 megaraid_init~@? max_mbox_busy_waitmax_sectors_per_iomax_cmd_per_lunparm=max_mbox_busy_wait:Maximum wait for mailbox in microseconds if busy (default=MBOX_BUSY_WAIT=10)parmtype=max_mbox_busy_wait:ushortparm=max_sectors_per_io:Maximum number of sectors per I/O request (default=MAX_SECTORS_PER_IO=128)parmtype=max_sectors_per_io:ushortparm=max_cmd_per_lun:Maximum number of commands which can be issued to a single LUN (default=DEF_CMD_PER_LUN=63)parmtype=max_cmd_per_lun:uintversion=2.00.4license=GPLdescription=LSI Logic MegaRAID legacy driverauthor=sju@lsil.comsrcversion=20198B2DFC69110674D141Dalias=pci:v00008086d00001960sv*sd*bc*sc*i*alias=pci:v0000101Ed00009060sv*sd*bc*sc*i*alias=pci:v0000101Ed00009010sv*sd*bc*sc*i*depends=intree=Yname=megaraidretpoline=Yvermagic=6.13.0-rc1-MANJARO+ SMP preempt mod_unload  0 0     ( (  (08@80( @ (0( 0 (08`80( ` (0( 0 (0880(  (0880(  (0880(  (08HH80( (( (0H0( H (0H0( H (0880(  (0P (0880(  (0880(  (0( 000 (@( @ (0880( ( ( `P0( P0 ( 0GNUGNU9Ͽ&h"9ƔLinuxLinux]2X;,[%$       | `` ?megaraidX[++G+S[L[X"p["["["["int"X",["*[ks8dku8w } ks16ku16&ks325ku32ks64ku64X4 { $[$+$$1X$2X$H$I$X$]$^$_$`$a.L[[%<X& D&M&&& &#[&%&&&*+&4&=&B&Q"&U&^+&h5&nD&} N& X& X& X& X& X& X&r,& &&,& &N& &&& &"&J &J&J&O"JLd+4&&& d}(+Ws#H  G   " %   ̼(   0  8  @   H   H  H *H  H  H   H   HF@' '9'''P'h''G'G'';' @'X'z@Kkp'E 'X('X,';0' @8'@'A'B'XD' JH'P~mem'O@''+' X''a'f''p'z '.('0'X8'@'XH'XL'P'XX'`'Xh'p' m x'X'X'''X''X'X'c'' X'!c'"X'%'&"'9X':'?'A'D 'F 'P 'QX('T0t)L* * * L*D *&*&/*d Uval* A A *x (D *,d L+ + +   +/+ + A +  ( +x + ,,  -- -x - . .- ... ..X.+#,/ )fmt/G/G/G/X/G/G$ /0e8 0f+0gm 0hw 0um 0v50w5key0x8 r 0U 0V ( #0j )key0k| #0n )key0o| 16 17 18 481{ 1G1G1G1G$1X$1X$14Xkey19 (>X1=    81U 1Vmod1W 1XG1Y 1Z (1[ ,1\{ 0G 1uY1vY1w^1xX1yX  +XL}+ 2/21Xset23iget2527 ,>}        ,  O   (  0 8 !ĵ@ " H # P $ X %` &7h 'Pp (7x )s * + , - . /  0 6 1  2h 3  5 N 9 { ;  >s ?˸ @ 3!3% 3+ 3-3/ X5                    L0!   X+   &( *F-@ !R=XX  `B( X,!X0( 4)=8*XH++P,!X5 `6 d8 h: l; p< t=Xxlse?Q@Krt@=S~dlASBSFRVNIBJ+KXO\VXaV]aVN`"4P@dhXkX l+m nqV ovV(p 20q Xs`ubx dyUhzp{V+      U 5OE(NBPKmm?.h?.ptWx    +X X, X, X, X- X- X- X- X- X- X- X- X- X - X - X - X -"X -+o4Kpid q q+! !!(0@ XPXX "X%+(++ - X. X3 X4[N6N: (=+0>+8A X@D XHG+PH+XK"M`NNgMTYWYZY^rZk <m|ZpcE qE(t+8u+@KfsxZH{ZP~ZXZ`A^h ^p kHx kH kHK+ X^ ,NXGOL X  X f> -  V B( !8 ^@  H ^P P_X Z_` _h _p +x _ L X  X  X  X A QA  _   D  D "_ )6`    @`0  z@8  XX E`\ Z`` z@h  d`       !X "X # $+ & X ' X ( X N)d 3n` Cc D+ Ls` N+ R` SD( TD, Y+0 ] 8 ^ < _ @ ` D NadH dBX g` iA l` w x z+ } ~`  X X  c  +X``bsc X(X,?V0~rcud0`B@ D!HDGP}cx`B  "c cc  X >Nd !"=$"=N.d<cNF(@@/@!AUpad!! !+? @"(!!&!@)"@ 6 J"6!5key6"5/6?x"6A+6B}"6C"x""" 6="6>(J"3737375 8;7#8<8=58? X 58@ X$58A X(58B X+ G#+ 9B#9C&9D&59E& 59E&(Ms9E&,Mdpl9E&-Mp9E'&/59F&0Mavl9F&4Ml9F&5Md9F&6Mg9F%&759F+&8 9wQ$Mist9x&59y&59z&Mdpl9{& Mp9|& 9$9&9&9#9&9D9D 9Q$$ 9$99+$:+:+:+:+:+:+,: J%pte:$:"3%,: m%pmd:$:"V%#;%%;%%'%2;%/y%J;' %)pgd;'%2;'"%J;V %)p4d;V%2;V"%J;p &)pud;p%2;p"%2;"&'&4@*>=)sp>+)es> )ds>">$>&>+(>+0>.=8>+X>+`)cr2>+h>+p>+x>M=>+>X>D>+>+> <lfpu> %<@((*X*B*B*G#-*f*B*L****$$k**B*X**hhhh* X*X**XXX* X+X+* (+XXX+ X<+-+L+!A+ (=q+=zn&={n&=|n&=~ =  uX=-= = = (= .= /. = j.(= .0=n&8= (@=(H= (P= j.X= .`= .h= .p= .x= .= .= (= (= (= (= .= .= )0= H0=n&=n&=n&=n&= b0=n&=n&=n&=n&= |0=n& =n&(= 00=&8= 0P--.- (? -? 1- ..-%.%.*..?.?.D.F@@<j.Vv@<){@4..+o. .?...?..%..?.+...J%J%...m%m%. J%//+./m<)0Vt<?.< %( u <(<,<Yu0`<0u8<X<cuh<%\vp<+x<s< <av<72<d`<fv<t/H0/+.J%.0]0]0&&M0w0w0%%g00.%00Xr%0 (=0= 1=n&= .1= {=n& 11Dd 0)1)1  1u=w1cpu=&irq=Q+hmmu=+=0pt='31>X31           + 2+? ;- 2??'2-72+@  0Ac2AdGAeJAghAi Al (Q(C23B 3B >XC2  ,(C43C43valC DC!D C"DC#XC$43 D/C*[3C+&3C,#3 D3DD [3 E3EdE 53,C'3C(}C)2(93C.X, C174C2<4C3C4 C5+C6+74/(Co4C%2C/3C73 8C4C+fnC 4(A4 44o44t+t+t+ F5FXendFX G;75McsG=XMslG?XMwfeGAX GE5MssGGXMstiGIX5GKXMnmiGMX5GPX 5GSX05GVX8MlmGXX95G]X:5GdX</G5UcsG&UcsxGXG5/G)6UssG&UssxGXG75 Gg/7r15Gm+r14Gn+r13Go+r12Gp+bpGq+ bxGr+(r11Gu+0r10Gv+8r9Gw+@r8Gx+HaxGy+PcxGz+XdxG{+`siG|+hdiG}+pG+xipG+(5G+spG+(5 H W7H H W7)6 pI7cwdIDswdIDtwdIDfipID fcsIDfooIDfosIDI7IDlD7+LI*8ripI+XrdpI,XLI.Q8fipI/DfcsI0DfooI1DfosI2D /I)e8A7A8/0I@8IA8IB8D8+ nI$*9cwdI%&swdI&&twdI'&fopI(&(Q8I5DI6DI9*9 I<:9I>8e8D:9+DJ9+? IQ':cwdIRDswdISDtwdITDfipIUD fcsIVDfooIWDfosIXDIZ7I[ lI\ mI] nI^ ormI_ pI` qIa':xIbD/7 <:+XL:+#@I::I; XI< XI= :X:+F@@IO:`IP8IQL:IR:@ :a+@I^6;:I_\7oI`8:IaJ9oIb:@:Ic6; G;+F@@If;IhXIkXInXIqX)xfdItXIwXIzXIXIX`I:@@#I%<I XIXIX fpu@I<IXI+I<I<I; I;0`IG;@@G; J <J XJXL<+ = ! " #<G#.=+>=>=+C=H= K>=K?+K@+KADcpuKCD L8=L9= L<=L===/M<=M=XM>  M:,>M;=(=srcMA& dstMA &1><>/NR>N Nf>(<>NR>,O >O O"r>3- 333!3%3'3,3/f>3335393<3A3D3H3L3Q3U3YP !? (P?PXP P?P P@@ &@&@X? P#S@P$f>P%P' +@ Q z@Q  R)@R*72R+- osqR-_@ R/WSz@WSWS T!AT" XT&@ TD*ATDATDA TEQATEATE6A,TT ATYQATZ f>T[]A,U AUA+A+U8A (VAV - W$BW%"&W'W( 0WDEBWM#AWP(WW) X`BX XEB YBY `B4ZBZ+ZBZBB Z BZ B ZCZBZB3[\ \"C/\EC\f>\C \sC(#C\X\ (]0C]172]772osq]9_@];- ]<W]W]W]W]W] ^+0D^,- ^- XD X D_ _ D_ XD_4 `D`X`X`G`G`G aEaXaX4(a*E\ctaDa&*E D>Xb^E     c~Ec E~E d Ed (e Ee e e4 fF]f Bf * f FfB>Xg 9F 4@g'F]g(Eg) * g*F(g+?G0g, 8g- 9g. :g/ ; FFF9FF4@@h/?Gh0fh1Xh2 } seqh3*Ah4Fh5F h6p0h7 *8F (iGi "i+i GiD GGDGG jGjj jGG k+Hk,k- xlDHlDHlX`l+hmaxl+p+TH+ ,m kHsigmAmTHnRnSHwHnUnVHHoHo o o H,o'Io(o),o-FIo. o/o0 Ho1,o5wIo6o7o8 H, o<Io=o>o?o@oA,oSIoT moUoV, oYJoZ mo[ ,o^HJo_+o` oa /oJJoLoQ oWIo\IobJ, oEJoF(HJ,ogJoh_fdoi,omKonooopX  o%cKo*Ho2IU_rto9FIoBwIodJojJoqJL0p Kp p p p K 0p K(cKpKK p Kp!p" kH p%5Lp'Hp(+p.Hp0 kH p3OLsap4K q Lq .q +lenq +q  8r LrXrXrXrXrX r#X(r,X0 s)"Ms*Xs+F Ps8WMs9WMs:XHs;XLLgM+48sDM]sEdsFz@sGX04 t>NtKtZtptttendtNLNa+,u ,Nvaluu N,u ONvalu u 8N#SNU XV XW- PX[N    #0h5OiAjkN)cpulXmXnX oX(# |O+#O+ Dm@@4P X X X D D+ +(+0X8F@Q X X X X X  X( X0 X8 N@ XH XP NX N` Xh Xp Xx  X  X  X  X X X X X X X X X XF@.S|O` B! X(" X0# X8%@&P'Q(R)S, XX- X`. Xh/ Xp0 Nx1 X3 X6 7.S98S;8S=+lavgGO@Q3S#0KSLM+N+OX P$Q&SS(=S2]SS SSSm`  xC  Vpidpv7 Xv9 `Bv:Xv; f>v<inov=Xv? v@@vBS@H\rcuvCd`vDpyW"X+0D4wo}Ywp72uidwq ,Ngidwr ON ws ,Nwt ONwu ,Nwv ONww ,N wx ON$wy X(wz+0w{+8w|+@w}+Hw~+PwXwrZ`wrZhwrZpwrZxw w]w{wKwbV:#X}YkeyxrZx`BxݑVmx_ semxxC(xiPx X(`x XDhuidx ,Npgidx ONtxxx|x~x x+((=xnYwZZZZZnXy^A^y_`By` yayb ycyeS@ yh!8ykK@ynXyq`ysdyt!hywpyxXtyzڗx$yX$yXyXyy]y9Fy *ityߗy]y"Myhy y Xyhttyyyy AyXy XyXyXyXyXy[Ny+y+y+y'+y+ y+(y"+0y,+8y+@y+Hy"+Py,+Xy+`y+hyLpyyyy(y Xy2yyyy?.yz@yxC0Zu y^yf>y`ByS@y F^^^#z^zz^#@{P_{{ { X { ({*{,{-{0^U_ X|c_|d72|e |g |k f>|m܏|n(|o0|q(e8___K__# }6`}4}}(_;` U`+U`_`i`+`+M``H`+``u0{b{{{{Y {,{.{܏0{6@{(H{P{X{`{{+{z@{ Xhbdi{@ {:({h{p{{ hev{{X{X{X{c{X{f>{{{{(e{ehcdi{{hbb{{ {X{ {(e(`4h~ysc~zsj~|X~}kVOk~j(~DG0~+X~#k`cxccccc c c  $d!" 5$X H'd(Gkey) *d+ ,(-0. d8ext/d@"cc34 8dtp9d: ;D<D$dE5 ee#e#e(e ]e72e Xqer(esDG wqveHcpuwPe x f ff(len72H)fP pef++)f+9f+n@ggg ]f>@@ eH!+"+#$DG%(e&d 'g0(+8hcpu*@hssp+gH72$g+ `6g7f>8f:f(;+H<gP=X>\$g egfXsdag'ih i,iguxDiEgFiH Iz@(Jf>HKz@PL+pM+xN+O+P+Q+R+S+TU+Vz@W0DY \+]+^]e_gpg'i+9fg3/ai,:,:,"i#5$ % ,'i( ) ,+i, - /!j&ai*i.i /j(?iops9j(i/j4j 2sj4+6X7X >X~@j   >X~Hj    ~pj~qj~r~sjjL~(k~>j~+~Ok]~d~+v~dkAk(k4@~k~j~+~+~+ ~ (~,~k0\rcu~d8~lHdkj ~l~id~k'la+ ~Bl~GlBl (l- N" , 'mX& )xCldt*,m8.+@9z@H:h;;np= xC&|D~'m 6n+alt+++ +(08@HPX`hpx !1m6nFlL<\pn<^ <`X/  f   F tW    8( X0 X4 Y8  @(,P  p  x # $ < % < 'VQrr#<5t)ctx<6$tt#<=Tt<>lB<@N#(D<+H<+P<'+X<3+`<+hKbrk<+p<!+x<+<+<%+<0+<z<z@<z<@n<+h<f>p<{x<!<{<s<&{<+<+<< < <'l<72<(e<${<+<+<72< vkv+z+3Llz+z{ {{{+8{a+2< XJ{#p/{(T7{()pmd9 .0)pud; ]08(Y@E"&HF"&P)pteL .X)ptlP ?`T &hPX<:|      @ YYYYYW6W9W<WG 8|+22++ +(0L|+ |s|<}}}} i?}n+v}48_}`72a}b}5c 5d \rcued reff}0|?} "~#Znid&-+4+7`4R~S~U~XYZ Xc `B d0D(\rcuedHgXj`idmpptqGxru +~~~~}~4RTXUQAVЃWX Y80[=8_" ``Ԍha+pbx]d@(m"n\d_uv~~72 @S~end~G++ S(S0&S8tt>XE      NԀT Ze"&ـ 8{E{  p++LI I4Xa+/s4A%Ԁ, v +%xPXTՁ    ځՁ++ n߁p(0T)vma1/2 Z3 +4+5+ b>~:? J%:@ m%/~ /+ / ق/+++ 8{E{Xނ 8{E{++ +$/ L/+) G`/Q y/d`e d`/+c~ "&/+ "Ѓ# &'' ЃL&f> v@yA4UV&L3y4Dlen4D/2AU6X 1(y8 /i܄jk܄S@rs"tЃyudFx {8 | e } ~ ,N  ON X    !!  Ԍ( tW0  8 +@(֬H  YL  P  XDX  XD`  XDh Dp Dt Dx D| f>    ޝ  B D xC + + "  +  & &    0 @ H  P  T  X  \!` 5hN Vp 8[H  P (?X I` Sh  pM+'4@  -Ui }( 0 8 @ HMPkX`MF@ Ԍ   Y  +    ( !0 !8 @ "H +P +X +` h xCp     & #ز  $     6 s @ J " X  *(N `   D XD XD !D "T / Y 0 0 1  4 i 6X <z@  BG@ D" H F~P I72X L` O <d Reh Sp Z{x a b~rcu cd d(e fz@ k0N nf>@@ oH qf>X r`>X  X ##( P#XGP2 i#Z }n8 .. EFGԌHI ō Hmnt    ffHR ٌp ܏D eX  XXino)X dev* Y(+ Y,uid, ,N0gid- ON4. 8/dD@0dDP1dD`2dDp3X4X5D6D7X8X9D:D;D#,- f>/ Z0܏ 03h4Ő678 xa9܏  " $f>4@@-Őlru/h072  v2nrv3nsv4^E+ʐa+, +valX>X Z    W,NON ӑؑ+ӑxx4xl*\rcuxmdxn`Bxo LxvNxx&xy T/xugA*Uxx+ (xrxt+(NxxxG  xxx Ò+x  .rZ.3rZ xmxkeyxrZxvxƎxyxB/xx XDx XDL(xx+x+xxx . /(xxgAp x=xx b xZ:xÒAZd8  `BLl+0728"@uid ,NP72X `$9 h w+w `Bwgidw +ON:a+vw]wrcuwdsn@@hgfhh- cpuhiXhjXhkX 5hlX5hmX5hnX5hoX5hpXhrXhshthuXh{ * h|F(h} *0h~F8]hu@@gs*kF@+5L+? 8yy y! y"+y#Xy#X y$+(y$+0 y'(y(Xy)X y0]y1 y2 y3  yCxyD( yLyM!yNx 8yQڗyR ySxyT0D+ X+ G#+#- R!40S@]d 4` \rss Rh078S@@ X   fn ,>arg w+, 0b  D/|Sj|T|UՁv|W|X"y|Yd48|I˙q|Jioc|K_(HVj |\X0F{{ {N{c{m{+ {X({X,{`B0{X4{܏8{}H{ X{ X{ X{ X{X{f>`{d{bh{p{xKdev{({0{ 4{#8{-@{z@HKid{ h{+p{7x{{DG{(e{ {{{ A{!{"{#z@{&0{(f>4{)8{*]eH{-Kfq{2{3{5z@{6z@{7z@{= {>f>0{@4Ktd{D8N{Fd@{KS@P{Pz@h{R{S{U{V{W{[z@{] ˙, val, ҝval>      ,. *0 4 4k5X6k7{{+#0 p qs r  s  t  u  v&$((/ ) ,N / K ON ҝ P ğ X e(()   dD dD( dD8 sHɟ#Ц()"*+ ,0-z@@. f>`/ d0Ԍh1 p2 x3+4-, val >X6Ҡ  B/E UuidF ,NUgidG ONH D-(ޠJ H Ҡ Ҡ Ҡ Ҡ Ҡ  Ҡ( Ҡ0 XD8 XD@ H3z+ X(X, Ҡ0 Ҡ8@# z!% z3#@89:;<=+ >+(?+0@I8 Ԍ +ğ DԌD 0#XDE+FG H+I+ J+(K0N 98OW@QpHSIPN ğԌ ğ 448Ҡ% R8R> p84\#xYdZ[X\X]X^X _X(`X0aN8cN@dHeLfXPgXXhX`iNhjp#8XXXX XXX)ino  B( B0#*X*d:+# XXX XXXX#Xb (08@ HP Ԍfg ԌX Ԍ: ߧԌ ߧuƧ ԌDߧ Ԍ8  X xC 0 HKops! 8++%+b w֨: }ۨ:  ֨ # 0 S q      ( !0  :8  T@  mH  }P  X  `  h  >p  ]x v    ̬ I"&IN5 lslrX tWIv tWl stWXsClª !stWXXl 6:tW6&Tl? mlZY}lr  (+, -./ ((  tWll7 l >l%XlXXC vtWlb s6{s ̬0b : _: Xz !: o db F: !F:  VV8Kb : `: :  .:  XF@ Z [ \* ]H ^f `  b( dʹ0 e8 f@ h)H jP kQX m~` oh pκp r x s u2 vZ y} { }   B&0:DN#( ɯ s  >)pid  X /E)uid  ,N ,N  $# ,  + X X  X X  b Q: z@:  Xz  )o *d: +=: ,ɯ: -Xa+2 PF0      ` +#  z  V  V     (  V0  ̼8 @ H P X ` h :p  ̼x S S S S  {     ս  ս  ̼bɲIJβӲݲ6n)6* 6+ 6,b-. /+(0 09 Y4:tW8< @=f>D> H? P@XAz@`BCE Fz@H$IK ]Q;EOLi+Ly+$2  GXX#   y)pos  2  X  s ,s. OsG1 mmXr# {{{{ T ĵs Aݵsݵɵ sX+ s/ 78s# Ps< ssU sx s +s++++c `sX 6s`X YsYsC^c; sms xNbuf.      ( 0z@8opeX`jhp {ssXS ssX XƸ mXи 8X G%8% H8/ f8M .k 8e ʹ8 8Ϲ 8G )8e Q8eY. ~88XV K ɺfɺDX .Ӻ 8XX 28 Z8sXe7 }8se_   ܻܻû ܻ# .)mt EC + ==8.PX k    8zԌk8 8I 8̼Ԍ ԌGѼ Ԍ  :Ԍ+.! S? {Ԍ.X ԌG 8ğ սԌ~ ڽ %G :+ @@AGBCD EX(sdFV0GlB8$IX$JX$KX$LX$MX::bio56 Pޝ) ]B (h48 @H5PXX` hpr  t x~ w+B|rev+w V4V  VG\rbBns0X8< e>(v@idX` hp\rcudx opsg!q V#hb "$ % & (( 02 89@: H= 7P@PXA n`bl/ Udir5[ rknVs z@ z@@`h .x    @  A %\v r    . A7ݵ# P/< nU>X   0'(s) |* +,$ - ,>(s s AQAGA e/AmsAnAo&#XA0A1)A2 A3 A4 A5 (A7 0A9 8A; @A= HA?:Pss'" eEE), eh"O "mEstW s. s". s" :s"/#AjA A ? E.o EG ` f>: X 0tSu hvmw!rx*y z (Sh]jw2 | u }~*hbuf: .*+.:+?LK+ K  G >X    = "&!X"X 4MN 6PXRX TXL+/ (+++++ 40\rcu1d2lB3'a+ HIJK LM+N){ FW:@)pHGPX)busc`h p xz@C` Kmsi(8@XHXPX `hx ^ YKidDf> ?!!r# $h%r'#w)+ `, a- b. c/ d9 e< f :w;<\#  !"# $(%0&8'@(H)P*X+`,h-p.x/012345 PU.   PXl^    #Hxy f>zX|X}z@~0@F8wQ  Q !Q "Q #Q $Q %Q &Q 'Q (Q )Df> 0D @ @ A B C D E`9FPX(eS@$  X                X.XXXX)  >(KqosH0 +,Gid-./f> 0$(1DG02+X3 *`4 *h5 *p6 *x7 *8+9+:+;+<+dev=$> $? ^>5.C#)ops    X MNGOGP!rQ!rR!r T"(U@0V8W @X HY P[X\`^Yh_paxcd pmf^h  `aGbusbcd eGg h$j*(ku0m8n @oHp PqYXr`s!rht!rppmv^xw py ;;W' YwE `23G5!r6!r8@9 / ; D(< 0>8@(@AXHC rPpmE^Xh .*;*e??4 X;Ir;] 0XYGZ!r[@\ ^ pm`^(w+  A /BDEFGHIA=LA(FK /:@A/NO+P Q * 5. D#}Q}( i]Qu Gd (2Ed2FGmod2G ops2H!@2I 02J2K (  .n/2LUarg2M Ustr2NUarr2O; 2V2WX2X. 2\6max2^X2_Xnum2`hops2a!@2b62&2&40(}])}B+  +  X + "L+7 `'-O'.:mod'/ @'0Hmp'1TP'2XXO 8'5'6)'7 '9 ';  '<$('= 40 .Y G G $ 4 )PX'>c   m8'E)mod'F `'GamP'p'q'r's'tXlmtn'wc# ',' ,'X'.'.16?Za+kudgd >X-  #Ⱥ%YY a@% pid cls/pz .;*#XX+PX   PXC   #8 0#!|"PX1      PXB  PXOC  #cd&e2f4g )lidh M'Xcma @/Y0^ops1",dev456(7 8cmC3# {C{D {I {N{S e{A${Bi{C!%`  PXX/ \Xzn~zoՁzpXzu#lzw [zx [`zz [z{ [z~X8zf><z^@z(ePzepz"xa+22 Z HQ f> sCQ V(S@0g @jklenlwpmnwowpwqwrs t(w+w +4@V!+]&+@@+- H 48X=XBXG mapLTh 4@@]aS@ @mFsbqVwX | $wsF( 0X4 8 <>{mt    {t{u{vK{w{x{y{z{} X#{{ /{M{f{ v{ {({0{ v8{@{H{ vP{ X{+`{ Dh{bp{ x{q{  #H{e{:{ @{XD{&:H2{  X2{] X#{h{ij{jw{k+{l+{nX{oX{pX {qX${rX({sX,{tX0{uX4{vX8{wX<{xX@{yXD{zXH{{XL{|XP{}XT{~XX{X\{X`{Xd{Xh{Xl{Xp{Xt{Xx{X|{X{X{X{{{{X{X{X{X{t2{ Xq#P{:{:{ 6@{ 6HIa+I#,^0 : B J.O C T X(Xl0]8b@g HnPr X{` h p -x = RS^hnfqghmi k Pl tagn o$qX(tX,u 60biow8x@(K H6XX`XhXpxz|~ ( ref +(m V elv  X r(2#XXXP)rqsWW f><#)opsc)map X8 X< X@ XD XH LXPXT X `hz@pg#{ {{PX{/    MmX4 fbRvbk 6X+{ XbX 6 66+ +b6X .Db*0 bb)1 Igl bv66 6m>X   'getput   ( 0@8c@wHwPX`hpx &?S' QeRXidSXTeY Pfg^hXi<: ^^^ e e; e eG @eGX ceGE Gweh ^e| ^e^ ^eG eGGXXj e1 &^ ?eX+ S^DWj_=s>X  oh W+ (,\--.. //01 Lq+S+q hLbusMNNOXP Q:(F NN(68@Pp)ops  ~devX X S X""#(56z@)len7X )cap8 $b::6F` J1K)busLNMNO  P(Q;0SX8T<U>V@WBXXDY HZ I\&J]EP`OXa6`cDhd le mf ng xh p)pini qj&rkcxmEnXtv]y zX(|X-}X.~X/X0X1X2X3X4X5X6X7X8X9X:X;X<XX&OXXXildevKirqXT@XBX BX BX BX BX BXBXBXBXBXBXBXBXBXBXBXBXBXBXBXBXBXBX BX!BX"BX#BX$BX%BX&BX'BX(BX)BX*BX+BX,BX-BX.BX/BuF H f>LdPtt X@M& X`MXaM   - Kvpd & XPO    &   & D X`P &  &  ܏ &0  2 Kromr8  @ GH  +P #X @JEG     ( 0 8 @ H# P!rX!r`hTJd+Dt++ +#( &! 6"T#|$ 1S+ &N6N+ TNX; |NX43Y NXD#;<f>=2H X#8_Rakehk l  o (r 0 k6iW 6p6\ 6 6w 6 6 D6R m + X X   N X X  'sgl ( )X *X 3G>X        " ( 0 @  +>X,            >X` Y Y Y Y Y Y Y Y Y >X     )>XZK   /zm {|/ "=v yB, icq  +, seqX  F@6 V @L]e@N2SX[+a e)fqgm sVymX0  f>(?0 X`hXpXt x"":  PX&  @@70 9f>AF+m#n hXX PX    5  +#! )rq"#  )         .C3XH l] q  m  X X XXX -=2RB>X&         >XB           4a7\rcubdlencdn(gZhtilm oV0p Pr Ts f>Xt`upvrwtxvy+xz+}+idXXlunƀXƁXƃ XƅƆƇLƈLƉz@ƊƋyƌGƍGrevƎGƑ~ƒ~Ɠ~Ɣ~ƕ~ Ɩ~(Ɨ~0Ƙ~8ƚ@Ɯ\HƠXP$Ƨ X $ƭ X $Ƴ X $ƹ X $ƻ X $Ƽ X $ƽ X $ƾ X $ƿ X $ X $ X $ X $ X $ X ppr X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X $ X X\` dAhApx(eX    N N  (e   XXz@h! ){(F8!t!&!'!) !+f>0!, ?8!.z@@!0`!1p!2!!3X!5S@!6#s$!7"}$!9lB!:0D!<!> !@X!BX!DX!G!H+!QX!RX!SX!\X!e!g!h!i!j!k!lX!mX!nX!oX!p+!q+!z X!{ X!| X! X! X! X! X! X! X! X! X! X! X! X!e!e!X!X!!+ !+(!0!1Kirq!X4!7$8N!@N!0! !(!0N!){8ZFHOP QRldevS(TlBUXKidVX XX YX!\X"^X#`X$d (e ,kX0lX4o L8p<q @r){HPXB      7 6m X>DY  n(JK LM]e\rcuOdpQSZ+\]_`ab6degsdbjkm Xp Xu Xv Xwy}~+Xy +>X!$  uh!*I"!3X!W g"!a |"!c !dG !m"(!t"0!"8!g"@!g"H! "P! "X! "`! "h! "p! "x! "! "! #! #! (#!  A#! Q#!" j#!* Q#!4 #!; #!E #!N #!W#!X#!a$!g $!q2$!yG!!! !"!X$!X(!X,!+0!+8!@!D! X@ ! XA ! XC ! XD ! XE ! XF ! XG !XL!!rP!!rX!X` b"tb"YN"|"t&l" G"t" " X" "b"" " " " ""# " # #(## A#t+-#Q#tF# j# V# #tXo# ## # 66+# #t# #t.# $b"# $b" $ 2$t$PX!s$       I"x$ Z$cmd[ \ ]&lba^D_D`  a  b  3eT%fghid%j1ackk2d%+-}T%,Bn %o$p$qi%}%,Js %tDuDv %w%}%,< &5 Mars 5 5      cdb&  7# 2 3D4D8 &+ %,D (5 Mars 5 5 5 5        cdb,:   7# ;D<D@&,  8(XD(, h(DDD(, N)idxDN)D\D`cmdb"h Np Nxsgl^)c) Nh)Nm)N ^)+Ah(8(&(t( M*DD,:,:M*( x y z {D|&&& ]* ]*+O n*+x~) (`,D  &                               ! "  #" $# %$ &% '+m-,D.z*0m-,2 3 4 5 7 8 9}-;->-?-9@-aA-B-DM*E- }-+W -+&-+D-+' -+' -+&-+ -+2F`,JJ .K L M N OE`P&Q  R  S  TE` U V W Y [ \ i 2j-J4m R/n o pR/q$r,Db/+2s/JLu /v/w K /+J2xo/J{ /|.}b/~/L2/J F0/-   2/J z0  2S0JH 0DD 0z00+20J 1DD 1z01+20J 1        2+1H11101+21J 2121.2+21J 2    D2;2]2  2 2D[12+'22+J22N3   N3 2D.2^3+2 3J3  &)1D 3fca,:fcsk3#nD4DD)ui3D4&*.f T4+# 4X)irq     &  && )uidDJ  5)cmd    )lbaDD     24N5:OD4:PJ0J 6KmLDMD Q5XD(ZD,2[5#yz6Qz Q  z6& 6+ #6F86lcmdY6(T9D+ T9 N Y9(^90 N8)dev"6@$H%X&h(tx+)1, N.n*0 1 c93 @ Ah9Bh9EHIJKLMNQSV Z f>\x9^` b r)cz@ef0Di%%%r) x9+ 9+2j6#m9no 99S9+9^<9 S9+,9^=9 S):+ :^>): SS:+C:^?S: ZAz@ ZBX ZC ^Cd S:+:^C: S:+p:^D: ZF S>;+.;ZG>; ^Gd S~;+"n;^G~; S;+b;^H; ZK ZL>; ^Ld ^L~; S(<+d<^M(< ZX 9h<+ZYX< ZZ 9<+7]<Ze% T4<+Zq< 7t DZw 7 (I" A=+1= 1=T   e " =XXXGe1=ER  >XXXGFR!,>tC1GB>XCqb>;xy>G;w>L;v>GiCd>GeCW>Ge;^E ??G?D ;gC?N+Cd Nr?"&+R G?;R ?C ?.+GiC?X+G%R2@ZR86@ՁZR?R@ZR i@C @b"C@66+;@b"; @b"C`#@e Ab"   ;0A;Gi; v *AXe!  =At;SY YA@G?C̠ tAGGR!tAs$CA~+RZSAS~~G;6A;GiRB43R0B0B&e?HB6R#_B6e<rB6e! BtC BGec BS~~; BBBe!  BtCCX;v8CN+C+XC+C5#xC;8C;Gi; f CX%W%U;;C; C+;C+{{C+.D+CtXDXDZ+N;=tD{<eDCDXR56DN; D+; D+{ ;=DX8E{:{9;3]?EGi;4WE;Gi;S iE@;S {E@C ER Es;~ EGR*EE GC/FGiCVFGC 8F.Gi7G F =T0Q R =FU EU T0@HcHtG H G H  0H =U0T0Q R X FTHU T0EsHU EHU Q EHU T0 EU SH+ H I6#6t 9I^ MQM6%6t 9buf|DJ8^ RKO` m y"K  CX0K  CT<X08   CTDX0[L  CT X0L  CTJX0BLUvMLUv1BBMQF?MUsT BWMUs1|DrB|MUv_BMU}BMQ@1X}P6} 9 PQ PGic9SN3E"V"c"p"SN3E"V"c"p"O H S~O+  DU XAP#E !   B,PTs;JPUsTv;hPUsTv1X ?ET P+%|z6$6+idFt 9++&+&&  GirqGi GjoutxXvc>;XqXnXlXiXgXeXb_8R/& BUsTQ~_5SED AUsTQ7SO OH kS[ [H Sa aH SSr8E"rV"c"p"0Tt tH dT H _U3zl~~Z T! 6@U ZT U H U H 'V H [V H SV@  =AUT Q VP PH H|2WT"`"mH}WT"`"mH~WT"`"mpX*7DQ .DU~T QR X0jX  CT X0}Y.:FR^ ?U~Q0R X Y~\*!H%Z*7DQ .DTJQR X0HyZZHyZHyZHyZHy.[H[y0[1by0 \1bL'f]Se i u<  &\ EE" V"c"p"&U] EE"V"c"p"&^  <H ]*7DQ .DTQ~R X0qU^ H^  CTQ~X0 ;U~T`&o` &_ , 9&GX` H |_cv tIU` Vr?6`U ,EU Q~ ?U~<!`M*!W C?UQ~ R X2Y0_Yamz ?T~Q R2X0!3b/*<< I&Vb [E" V"c"p"&ihb jE"V"c"p" ;U~T~&:bc ? L Y f sT! K     !IJd     T!!"  O     !,[$e<à Ѓ ݃&e E"V"c"p" ;U~T~;EeU~T;feU~T?EeT ?eU~T7Q X0 ?U~T7Q X0A fT Q~ AT cf  CTJX0ȅgڅ*< &9g E" V"c"p"&g E" V"c"p" ;U~T~;iSi<  &=wh BE"  V"c"p"&Ph UE"V"c"p";hU~T~ xCT  xCT QPj^* kUT Q ŁNpׁ*< &p E"8V"c"p"&p E":V"c"p" ;U~T~V q8c~XuSt  <FqU}T >qU}T0QvR|>qU T QvR X|>6rU T QvR X|>urU T QvR X|>rU T QvR X|>rU T QvR X|>2sU T QvR X|>qsU T QvR X|>sU T QvR X|>sU T QvR X|>.tU T QvR X|>mtU T QvR X|>tU T QvR X| >U T QvR X| ?ET NZ ju`m >UT~Q~HBuUs5BuUs_BuUs1XAuU~T AvT~QR X0?E?vU~T ApvT~Q@R X0tAvU T BvT~Q@AvU~T R~X~?EwU~T rB*wUBDwU~BdwT~QAwU~T?EwU~T tAwU T AxU~T R~X~?E.xU~T ?E^xU~T Q~1|DBxT~YAxU~T ?ExU~T YAxU~T ?E!yU~T YAHyU~T YAoyU~T YAyU~T DyU~T DyU~T AzU~T  *AUE@06"9+mc606Ih)+Gscb c9cES{3E"V"c"p"_!O|33Bg{{       !o|++| H  |>}JVH}#/* ; XCU~T@Qv"n~#E !    0Nt>~l~"Em   &^  Us  -U}TiEU|VU}CUs WEU|5SE+50ހ&9-ch2 -tgt9 Nh) N9mc 56 @^Ł6^96^-Nmc` 5^S3bE"bV"c"p"zT^Q01X03!3!95$6y8 :?y9 $ yi  09,9mc 5d>;   H 09)+9scb c9++ 9pos  0!9$y 0|P|$9~$y ?;;9=>$?y@&A)1B 9iCքE J#6?ȅ 9 $ y9i d9 P c& &H  * *H 0 $ !9 $ y   @ +arg +mc *0 Gumc 0 h)  mPS6    PG__x   )1_   +Qg Xۇ    9__x   )1_ P    PG__x   )1_   +Qg X_ $    PG__x   )19 JUa DUPTvQ7* ;FQ* ^ k1X63@+ ~+arg+ 6+ +- 3~. mP/  0  _} } } } } g} X} } } z}  }  }      !S<     g    Ȍ          !9: JUa DUPTvQ7*= ;FQ* ^ k9R pJUa DU|TvQn1X@ >S6 %s+cmd 9X+arg L+Gret iEU  47UsTveU WEU 0   s-cmd 0X-arg C+ 9 6   h) h) N  N9mc 5 D 6dH w S    D9__x D 43ߐ   D9__x D 43   H &" Z2  2 H m                @u (i6u 86u 1s {EUE0% J% 99scb' c99i( dH A  A H K  K H  U  U H | ~6 ( 6 C66 66 + 9   c>;=   H @bUTTsQv xCT ?   : 99dir  ,:d      H S +@ #+m $+v - JUUQNR'@ #+m $+v - JUUQDRM@~ #X+m~ $+v~ - JUUQ:RC@p  +mp $+vp - JUUQ0R90 -m ! /9 <-end G N 9mc 5 . N  6 )1  D9i wc dS: wa w^    H   1@ ^+m %+v . 8(UUQ3@ +m %+v . 8(UUQ2@  +m %+v . 8(UUQ1@ +m %+v . 8(UUQ00 -m ! /9 < N . N  6 )1  9tgt  9i wr dS: wp wn    H  _ ?Ӛ-m%..9i@'+m$+v- 9 N 6@ XcXӛ H "8 *7DQ .DU~T QR X0kw B>UsT Q?k_w B>UsT Q<kǝw B>UsT QAk/w B>UsT Q=kw B>UsT QCkw B>UsT Q<̟ɰְ  CU~T Q|X0, |DU}k}w B>UsT Q<kw B>UsT Q@kMw B>UsT QH:kUvT@ހUv>UsT Qvy>ΡUsT:1X ?ET S+@x:ۥ+mx)+vx2z 9{ N| }6@Xc X H "8 *7DQ .DU~T QR X0ɰְ  CU~T Q|X0ʤ, |DU}k2w B>UsT QH:PUvT@ހhUv>UsT >UsT 1X ?ET @]+m]!+v]*_ 9`^9kbw B>UsT QO>ʦUsT >UsT >UsT >9UsT >^UsT >UsT >UsT >ͧUsT  >UsT @:Uǩ+m:!+v:*< 9kAw B>UsT Q,B<#E !   kNw B>UsT Q. >UsT @+m#+v, 9k~w B>UsT Q4kw B>UsT QAkOw B>UsT Q$kw B>UsT Q*(N#E !   k,w B>UsT QDkw B>UsT Q<k w B>UsT Q&kw B>UsT Q/kYw B>UsT Q1>~UsT >UsT >֮UsT Qv Rv >UsT > UsT >EUsT >jUsT >UsT >UsT >ٯUsT >UsT >#UsT >HUsT >mUsT >UsT  >UsT Qv?-NI60#XD?6?:!6@x6966_3޲gHj       !DU0DT 1|D6@1۵6%9+cmd@b"+aorIGposGscb c9c H . H SL  H  H ~">DJV UsQv?EcT ?ET ?ET ?ET  :UvT|xS+۵|W+cmdW"b"Y 9mcZ 5[cS:d dH ög gH kO lU}s4* & Y s""/Iʷ HuT"`"m @Uv}tiO DU}zUvTQ0xCT #θUvT0Q@?ET 1X@Cm+cmdC"b"E 9FP* &  s""/I HurT"`"m @Uv} #UsTUQ8/GTA6/!t1A 2 9 FU T QU#LR+?99scb c99i ?ĻĻ7ɻλ9i/-n*@69+scb.c9+buf843+lenB43Gsg9cmdb"GidxO{ڼOi@U|1R@0:"9^9~6~9+scb~*c9վq2  @UvE("48H T"`"mcԿo{H#/* ; XCUvT~Q}"1@?n-n9p-r r6696&)1676Dm)GsglGcmdb"h) PGc Gscb c9GicH H  H  H 1 H _.....g..... . .     !_66666g6O666q6 6 6     !>0cJVE,q#/ ; XCU|TsQ"W!q  @U|E("48H T"`"m{ 8  8>  P>JV Q}>JV Q}:U}TsAU} @1U~T0Q;R0X0AVT X~?EuT :U}Ts?ET ?ET  :U}Ts|8+irq868': 9;+< =D> ?@XvF+F+S`````*````` `8 `     !"!"!",!";!"J!IY!"^!"n!"~!"!"! DUAT.dT  F} J 1 =Q*UJj3^M [f  h D1* =*ij3)m I  s?""/If HuT"`"m @U}pq#E !    0qY>~l"8m*   &B  U~x -UTVU2U~Tv1X +-|;+irq6& 9+   X&++SA* 8      !"!"!",!";!"J!IY!%"^!"n!"~!"!"! DUAT.y0b0Tn!o!{!!!  ) * O0`* lb0Tn!o!{!!!y0_b0Tn!o!{!!!* j3M [f * I " sl""/I HuT"`"m @Uv} #E !    0!>~l"8m*   &o  Us( -UTVU2-UsT|QvR1X@696-Y9^9 XcS(g        !\ H , ! O!!,  DU R1Bn*j3*j3B  ~1* =*j3y02b0Tn!o!{!!!9y08b0Tn!o!{!!!*j3M* O0`* lb0Tn!o!{!!! y0b0Tn!o!{!!!y0wb0Tn!o!{!!!y06b 0Tn!o!{!!!  DU XA ?ET 0 9@J6J9+scbJ&c9LY9M^9GiNX_ZZZZZgZ_ZZZZ Z Z     !d3 A |R  DU y0wb0Tn!o!{!!!8y02b0Tn!o!{!!!?++99scb- c99pos.. 3 0m)9%9-scb5c9-cmdb" m)d ]      H 0h)"9-scb2c9-cmdIb" h)dE j J     H 0 c9 9-cmd 6b" @+ h)9scb  c9  P9segDLdS: 9buf .9sg % H  z    09-cmd9b"B9tgt0c9e9-cmd9b"9scb c9  |6t+cmdb"+Grc++  OF*    r  " *   <    - :O*  i"/ <!I~f"R"/*!< I&U V8Hr*  @UE("48H T"`"mI( E"V"c"p"9 2KXer* &^ E"V"c"p"&     &  0     !&X / <fJ KIX Y ,EU TQ R:1Xӻ UT}Q#4R#8 AT Xi"/* <!I~"O"/!< I&U& V8H*  @UE("48H T"`"m* *IJ)I OE"V"c"p"&] b o |  &       !&C  f I  ,EU TQ R@1XӻUT}Q#<R#@ AT Xdhf"/ <!I~"M"/!< I&U$ V8H*  @UE("48H T"`"m&Z+!_ k{    1HW$Jc$fo$ p$qj$> P&vB {E"V"c"p""Oq  j$E9$TJ$!K$iz"/ <!I~"R"/*!< I&U7 V8'H*  @UE("48H T"`"m"/* <!I~"O"/!< I&Un V8^H *  @UE("48H T"`"mI+# E"V"c"p"& E"V"c"p"&      (&5  6 [      !&C  _ lfz {I   ,EU TQ R: XTvI&~  E"V"c"p"@ Uv@ Uvӻ UT}Rӻ UT}Q#4R#8 AT >6 JVE5q #/ ; XCUTQv" #E !    0h >~lJ "Xm   &   U 0 -U~T VU~ -T~1V1X0w 0w1b"y 99scbz c9{|+out ++?jLj9D'97 N7ɻ7$7)17d>; 777xinqĻ7N: H KKKKK KKKK K K|OOOOO O\OOO O OU UH  ] ]H F0D'97+0b"N0->%   0! {!@t-dev!D#.cmdAb"DX.cmd8b"D.cmd5b"?-dev5A N0_-dev7CXD-gfp!Z?-dev:JN -dir(;+0xNg-devx>-ptrxIy -diry(y;+ |G| || | |=T.devT8'TI.lenU+?aa46a@0\\560 -sg 1D "&.sg 8Dk.irqX'-'D+'G.dev=z.mz7.szFG=8'82+00 0&0 ?00 0&=C .valCX'CBD;XJ';Jxret;XD y'&7 =' '&?-dev3>0-dev:;0pG-devp9;= '0D>'."&0^E^i&DWG'W>? -  - 3X - FG0 '  ' 0X ' CG ( %F D+9.to'+.n?+D+l.to'-.nA+0(-nDNZZ 0|.|D|PZ X0%X%< %0z0RzCZzX+= T.x T7X Z W ?@ ?T+ ++?9 ??v v7 ?0D(>-DC ?;+D>+;)V>C +l>;~>0ss6 %u 0jj8jV?4='7=>'2'K =c.new4'K=.new/'F=.new1'' Dj'jFxretl 7o7pDAH.newA@'B'CxretE=#w'#5m% &D''*'6xsz  ='&':+=*.ptr;.nN+' D&+b.xH+xy+=9 7;+7;+7;+7;+7;+? -v ? -i -v = A.v A.i AD ..v .? M-v ? r-i -v !? -v -i !0 -v !.= 3.v 37= &.i &1.v &>= .v 7.i >D *.v =. -p$-q?R%%%%% %B%B%B %B %B$ %3 %B %Q %` % q %B %B %B %B %B#E"#:$%&'(!%U,!%U;!%UJ!%UY!%U!n!%UB~!%UB!%UB!%UB %UB!%W!%W!%W!%W!%W "%WB"%WB'"%WB7"%WB %WB#:"%"%"%"%"% "%B"%B"%B #%B %BD3!5#'3<ϣ=ϑo#'ϑ2G'ϑ<'ϒX=^#.v^OJ'^Y=P#.vPJJ'PT=B#.vBIJ'BS=W$.toW4'WD'X'X"=Q9$'Q6'QFD\W$ xc^ =M$.valM5 7O$7O 7OD 7OD,,!"% 71 !$71 $71 %71 &%71 D 71 X=S%.ptr**7DQ .DT QR X0J` ,\Oiu* << < 6+*7DQ .DT<QR X0&΀+ πE"V"c"p" ,  CT<Q~X0 O,,1|D ,,1|D:,U|T zU|T}Q~&:- E"_ V"c"p"kj -w B>UvT Q2k 0* ȚkQ.w B>UvT Q:k.w B>UvT Q9k!/w B>UvT Q7k/w B>UvT Q5B>/UvT~Q8B>/UvT~Q@B>/UvT~ Q4y>0UvT:1,>>C0UvT >h0UvT  y>UvT:o 0  CT Q~X0!q 1ɰְ8  CT QX0 s 1,1|Dk( Y2w B>UvT Q#k 2w B>UvT QH:2U|Tހ2U|>&3UvT Q~>Z3UvT Q~Rs>3UvT Q~>3UvT Q~>3UvT Q~1X ?ET SJr <    ͏<ڏ~ <~<~ <~r9eI@K5 EE" V"c"p"IS5 X e&3* @ M Y3:Er D   :#E !   ~ ;"y <*<~ &Ђ; ՂE"V"c"p"z;U|T~Q0 ?ET Q~ H<I9o<  ,=Er D 0[2>>~l="Qm   &>  U| > -UT~D>U  VU&%? E"" V"c"p" ?*7DQ .DT} Q~R X~9 @JUaHw@* &j@ f   CU~TQ0 DU~TvQ fA  CTQ~X0  A,1|DB B*7DQ .DT<Q~R X09S BJUa DU}T~Q<c C*7DQ .DT Q~R X~9 `DJUaHw7D* &C f  CU~T~Q0 DU~T Q~&ZD _E" V"c"p" F".HwE* &E f  CU~T|Q1 8CUsT~Q| F". 8CU~#T}Q> F  CT<Q}X0  1G,1|D G  CQ~X0  G,1|D EH  CQ~X0V H  CT<Q}X0 Z H,1|Di eI  CT<Q}X0n I,1|DIUsT:IU|T~zIU|TvQ0$JUsTv$9JUsT~z]JU|TvQ}${JUsTv1X?EJT  ?ET XЖۖ<!< '<4 AM*O7DQ .DTQR X0kY Mw B>UsT Q;k Nw B>UsT Q?k; vNw B>UsT Q=k> Nw B>UsT Q?kI FOw B>UsT Q>kO Ow B>UsT Q<kS Pw B>UsT Q>kV rPw B>UsT Q;k Pw B>UsT QI_ EQO  CTQX0#b Rɰְ8  CT Q~X0 d DR,1|DkL Rw B>UsT Q<k# Sw B>UsT Q>k/ pSw B>UsT QOkD Sw B>UsT Q:kA (Tw B>UsT Q<k& Tw B>UsT Q>k Tw B>UsT Q>k UsT Q>k1 Uw B>UsT QLk  Vw B>UsT QHk tVw B>UsT QFk Vw B>UsT QH:VUTހWUz9WU~TQ0>dWUsT Q|y>WUsT:>WUsT >WUsT >WUsT >XUsT z:XU~TQ0z_XU~TQ01X ?ET ²H  5A : F ^  q q     Iint F ,  * +s8R+u8e+s16}+u16 +s32+u32+s64+u64P \    1F 2F Hc IP X ] ^P _ `:   <F  '   o   #SB  %{ & 4 = B h n' } 1  ;  ;  F  F   $1  XXX0xx : JKL Wx K  s \x2MH  5  G "V y  ( ;$0 t8 ]@ "H "H "H ~H "H "H "H "H$@    0  RP h  5 5 F @  E F 1/kp J  F( F, @0  E8 B@ BA BB FD  OH sP9mem T@ t   F 0 e j  t ~  ( 0 F8 @ FH FL P FX ` Fh p  x F F @$  F  F F $  F !$ "F % &r' 9F : ?0 A0 D } F  P  QF( TE$0N  ; cs =;sl ?;wfe A; Ex ss G;sti I; K;nmi M; P;  S;0 V;8lm X;9 ];: d;<  cs  csx ;    ss  ssx ;   g r15 mr14 nr13 or12 pbp q bx r(r11 u0r10 v8r9 w@r8 xHax yPcx zXdx {`si |hdi }p xip x  sp   B  C  D  E   E (s E ,dpl E -p E' / F 0avl F 4l F 5d F 6g F% 7 F+ 8  % %% )%/ :' pgd' )'"  @H? I!_0_0 48em f g h u vwkeyx\m  U V ? j keyk n keyo ;l<=? F @ F$A F(B F+$-@ (y0FF  4( F,!F0( 4)Y.8*FH+P,(X5 `6 d8 h: l; p< t=Fx6se?@@/rt@A9dlABBBFD%I2JKFODXD]D%`"w>@d]hFkF lm nD oD(p'0q Xs`ubx dy/Dhz0p{D 0 0  /D00 x=01(%2P/mmhpEx    F F, F, F, F- F- F- F- F- F- F- F- F- F - F - F - F -"F -30/pid * *( (00((000@>FPCFX 0"{F%v(v+ - ;. ;3 ;4<6=: (=0>8A ;@D ;HGPHXK:`%N;TGWGZG^Hk -mHp0 q1(t8u@/fsxHH{HP~HXI`Lh Lp 5x 5 58 ~FL o<F\4h9 ;  ; u1 2" TD p2( (8 L@  H MP  MX M` Mh Mp x M /: F  ;  ;  ; 4 <  M 0  '  ' "M )M  0  M0  18  FX N\ N` 1h 0  N      !F "F # $ & ; ' ; ( ; %) 3*N C$ D L/N N R?N S'( T', Y0 ] 8 ^ < _ @ ` D %aH d9X gIN i9 lSN w x z } ~XN  ; ;  $  FmNwNNN F(F,vD09rcu04@ D(H4POx4  " O OO  ; >% !"-$"-%.<(O%F-@@l$@@q-spes ds"$&(0-8X`cr2hpx-F' i-6fpu ,@F(  '$@@!d@&i@ , !c c B(,Gd0&d80XQdh%`dpxb ed' Njdb !  >!val   R!! ,>!!! !!  ^! !!R! ! " \ " ?? 2"R! " "2" F, #fmt555F55$O6,# 7 8 8#5555'F'F'4Fkey9 #("F=#   8U;$V0modW;$X5Y@$ Z ([ ,\#05u$v$w$xFyF,## :$ /$1Fset3Cget5\7 .$D&;$ 5 X {  -( -08!@" ߙH# P$ X%`&/h'Hp(/x)k*+,ٚ-ޚ./ 0 .1 2`3 5 9 ϛ; >k?@=$ !'% + -/  :' !key " ?h' A Bm' Cr' h'' =' >:' '  ;{' ! $0"c("d5"e."gL"i j"lo 5('# N# Np$(cwd$'swd$'twd$'fip$' fcs$'foo$'fos$'$($'l '($*(rip$+;rdp$,;$..)fip$/'fcs$0'foo$1'fos$2' $)B)((0$@d) $Ad) $Bd) 't) ;$$*cwd$% swd$& twd$' fop$( .)$5'$6'$9* $<*$>d)@B) '* '&*?$Q+cwd$R'swd$S'twd$T'fip$U' fcs$V'foo$W'fos$X'$Z($[l$\m$]n$^orm$_p$`q$a+x$b'! +@$:Q+$; ;$< ;$= Q+ ;a+$@@$O+&$Pt)$Q+$R+@ +3P@$^,$_9(-$`t)$a&*-$ba+@$c, ,E$@@$f,$hF$kF$n;$q;xfd$t;$wF$zF$F$F&$+@@$,$ ;$F$F Qfpu@$d-$F$$d-$d-$, $,0&$,@@,% -% ;%; :- - --- -&N&N&N'8.'92.'<2.'=2..(<Y. (=F (> (:.(;.7.src(A  dst(A .."F).  () /) /val) ')!' )"')#;)$ / ')*G/ )+&G/ ),#t/#*t/*uQ* L/)'/)(6)).%/).; )1/)20)3)4 )5)6 /()30 )%. )/y/ )7/8)`0)fn) t00\o0o030`0+>0+?+@+A'cpu+C'"F,0     - 1- 1  1. 01.0/ K1/ 0a1 0"0u1K1 0a11 11! 1"1 2)12*'2+2"osq2-01 2/0(3 23 3 0304P244P24P224 p24 P2424U24P2 52(5 25 5 25p2"F6 2 @6'q3(6(26)  6*3(6+406,86-96.:6/;2332q3@@7/470~71F72 6 seq73;743752 76077 83(8G48 x88 W48' R4R44G49499 94 4: 4:4 4 :84;4;  ;4<+5<,c<-cx=_5=_5=F`=hmax=p o5 > 5sig>4 >o5 ?RE ?S55 ?U ?V55A@5 @  @  @ 5@'"6@(o@){@-`6@.@/@0 5@1@56@6o@7{@8 5 @<6@=o@>{@?@@@A@S 7@T $@U@V @Y17@Z $@[ @^b7@_@` @a @J7 @L @Q @W6 @\ 7 @b17 @E7@Fb7@g7@h\_fd@i@m8@n@o@pF A @%|8 @*5 @2"6_rt@9`6 @B6 @d7 @j7 @q70A 8A A A A 80A 8|8 A8 8A  9A!0A" 5 A%N9A'5A(A.5A0 5 A3h9saA4 9 B 9B B lenB B B(C9C {D$9D% D'D( 0DD/:DM#9DPB(DWB)8E :E;E;E;E;E; E#;(E,;0F):F*;F+2PF8:F9:F:FHF;FL :;8FD;;(FEFF1FGF0 G>;GKGZGpGGGendG; :;3H!;H" F H&;HD;HD; HD;HE<HE; HE<HT L<HY<HZ u1 H[(<I o<valIZ I X<I <valI f I {<S<U ;V ;W2"7F[=    0hx=i;jk<cpulFm;n; o;( == ',@@w> ; ; ; ' ' (0F8$@@ ; ; ; ; ;  ;( ;0 ;8 1@ ;H ;P 1X 1` ;h ;p ;x  ;  ;  ;  ; ; ; ; ; ; ; ; ; ;$@qA=& 2! ;(" ;0# ;8%0@&qP'qQ(qR)qS, ;X- ;`. ;h/ ;p0 1x1 ;3 ;6 7qA9{A;{A=6avgG=@@ vA0KAL0MNOF P$Q&SA(A)]BBBBBB,`C&a2h ;i ; j ;(k ;0l ;8s 1@t ;HuFPFFFFFFFF&2X&2rqCACB)^CC(CBRrqCC<F <F <F<F:/DSTDBbCBs'qDqDTD? ~DD D CD'' D,EqRjS @ D Hp2P` h)px u10S DFpidpJ7>FJ9 4J:FJ; u1J<minoJ=;J?y J@]@JBSH.rcuJC`JDypE xSF K{FKFKZTSFLoGLp'uidLq o<gidLr < Ls o<Lt <Lu o<Lv <Lw o< Lx <$Ly F(Lzy0L{y8L|y@L}yHL~yPLqXLH`LHhLHpLHxL L}L iL8L}!}FGFkeyMHM4Moz!{M| semMS(M|PM X|`M huidM o<pgidM <tM{zxM|M~M M||M|G H H H H H;XN^LN_4N` NaNb Nc0NeS Nh(8Nk8@Nn]XNq`NsdNt(hNwpNxFtNzx'NF'NFNFN]N](N2N itNN4N:NƀhN N>FN=ttyNۀNN L<N;N ;N;N;N;N;N<NNNN'N N(N"0N,8N@NHN"PN,XN`NhN/:pNNNnNN FN NBNNNN1NS0IC NLNu1N4NSN^ L L L L M MXOcMOd'Oe Og Ok u1OmRjOn(Oo]0OqT8M M8 M M PMPcPKPWM M N N N %N ?N;; DN NN 5hN hN rN |NhQyNQzYQ|FQ}`[!ZQzZ(Q40QXQ#e[`N N O O O #ORNRNRNR!NR%NR'NR,NR/NR3NR5NR9NR<NRANRDNRHNRLNRQNRUNRYN3PShPSSSS PS!sS" }S$FHS'QS(5keyS) S*QS+ S,(S-0S. Q8extS/Q@w'3PhP S3 S8pQtpS9pQS: S;'S<'P * TRT'T TFT  T;T;inoT); devT* (T+ ,uidT, o<0gidT- <4T. r8T/K@T0KPT1K`T2KpT3;T4;T5'T6'T7;T8;T9'T:'T;' qRU#SU$u1U%0 U' R#VN#VN#VNW\SW 4XNTY Y"iSYS Yu1 YnSYSzSYFY(Z0TZ1'Z7'osqZ901Z;2"Z<0#ZN#ZN#ZN#ZN#ZN[+T[,2"[-0 \ TTTTT \T\'\0\TX]qU]rT]s4 wq]vUHcpu]wP Ux^U^^U^U(len^'H^UP^p #UU U \U;@_V_V_V_ (_u1@@_ (UH_!_"_#B_$4_%TU_& _'W0_(8=cpu_*@=ssp_+NWH 'V`_6W_7u1_8U_:U(_;H_<WP_=X_>\V_eNW_fFsda_gX_h"_iX WCx_DX_EW_FX_H _I1(_Ju1H_K1P_Lp_Mx_N_O_P_Q_R_S_TB_U_V1_WSF_Y _\_]_^T__NWp WXUSW`NaX a+ a+a" Ya#a$a%a'/Ya(a)a+SYa,a-a!Y a&X a* Y a./Y aYXopsaYSY YYa2Ya4a6Fa7F "FQ@Z   "FQH@Z   QpuZQqZQrQszZ uZQZQYQVQZ(QQ4QZZWZ@Q`[Q@ZQQQ Q B(Q,Q`[0.rcuQ8Q[HZYQ[QidQ j[[3Q[Q[ [(b\b2"b1b0b  c \c;c& $c)Sldtc*\8c.@c91Hc:hc;]pc= xcC |cD~ \d ]ddaltddd d(d0d\8d\@d\Hd\Pd\Xd\`d\hd\pd\xd\d \d!\\] cF\\]^ `FX^lruY0] d0 e0i>^ j  k(Rn^]hE^s (u^zpp{^|}~' ^^^_  ^4(Q0_>^n^^^8R_ F  : k_val)R_0M_N PF*J_BlruK0x_*W_X Yk_0@GL`I_UEV  _([ 0\ 4^85@Fj`_-j 0(m`noq r s t vF 5@l`j`-z 00}Ta~     (0 a05@|a`Ta- ,Da!L`!`@!a)a, b  u1   E  q(F0F4G8w@pP rp  x#Օ$ % 'ڕ!a5cctx6c c=Cc>AS@;(X`cYS(\cbht%w }$0c5cc-*daaX Gd6rb2Cc Ld Vd[dc`cd;cid Y@@ d : d0 mNZ@@h!d@S@PX`hppgd  x) 5 ?hELFS Z2"]'_au1pSr0$ (08;@u1DHP'X3`h/brkp!x%0hh@h]hu1pix( ib&i  ['T!i' dod h3 [h h iQ i i 5i3#e6N#e9N#ej gGMj gHj gIii 4j9j CjHjh,jh- u1h/ h0RjgAjigK ~g:j g@~ijgNj gO gP gQ r(g+Dkg,g-Bg.Bg/ ~jj 0pkqbr rs t u v $H(Dkji"ki#ki&ki'ki' kkkj(lju1j 4jBl8jljWl!(lk3{lk4'lenk4'k2lWl k6;k1l{lk8lkil kj0 kklS[krm ksx ktk8kukRmkTFkU<kVkkWmkXl kYq0k[q8k_"q`k`uhkapkbx(kdBllkmxkn].d_ukvlmm$x{q| }~ o< <F !e u(E0 8@H L rP X ` h'p't'x'|u1^ 'Sx0o  000 \?0$@$H P T X \@e`yh%Dp08@H P(X`h pm q-q'@kqkukukvk6vkJv k^v(k nv0k nv8k v@k vHk.wPkLwXkew`-qq$@u0 q r t(!0!8@"HPX`mhSp &!#:D$SXk 0 b b l vxF (%` '!'"/ 0 14 6F<1 B5@D"qHFxPI'XL`O dRUhS]pZ ixaxbx9rcucdTf1k0%nu1@@o0Hqu1Xr0`q"Fku umFuvv vmlu1vvF51vlvJvv;v^vmOvnvmcvvmqsvvmv lEvlFmlGulHlIvvvvwm)wmntm vm mwvGwGwB)w3wmewmuQw n"wn#nidn&n-n4n7mNnRxnSxnUxnX\nYnZ Fnc 4 ndSF(.rcuneHngXnj0`idnmpnptnq5xnrmnuxxxxwjwx'0o3xo4\yo60o7o8 Bxao9Rj  o4yo 0o" \o$u1@@o-\ylruo/xo0' 4yJ2ynrJ3nsJ4y0 ]y ayy3p yvalp; py"Fq y   y r1zrr r#sNteztjzt ez M MMlz.rcuMmMn4Mo BMvzMx My MuzzxM(MrA{MtzMK{MP{M5 A{A{zA M{{ M M {U{ { M{{{H{{HF{{{M{M{keyMHMK{4M| M08M2MA| M  M (M|MMMK{MP{M  (M| MzA|0 M|M0M =z* M|MU{| | |{u}u 4u[u0u'8ux@uidu o<Pu'Xu `u$>"hL}L 4LgidL } <}34L} L]rcuL}};@@7g~7h2"cpu7iF7jF7kF 7lF7mF7nF7oF7pF7rF7s7t7uF7{  7|3(7} 07~38(7M@@}2~"F7:M        >3@^ N9n?8NN N! \N"N#;N#; N$(N$0N'N(;N);N04N1 $N2 $N3 $NCONDNLwNM(NNwO8NQNR NSONTSF| ƀ >Fր ր  4  v)v(0wlwwwS(w `x .rssx )xq0x8xS@x Xy fny .argy  ez bz z { 'OSA OT0 OUy4OWb OXx8OY8OIqOJiocOKM!A O\F0 b | ҂val|Z || val|f |ނ} v}  }%7F}T^    "q~      . 0 $ 4"F.ۃ   45F679 * % /4`  o<  ҂  <  PF >`  rKK(K8 bHЁ()x*0+0 ,00-1@. u1`/ d0uh1bp2 rx34 { څval ÅGF  "F6(   BEbuidF o<gidG < H څD4JH ( ( ( ( (  (( (0 8 @HЇ0 F(F, (0 (8@ Ї!;$ЇGF        @89:;<=È >È(?È0@8uÈ܈u܈bȈXDEÈFG HÈIÈ JÈ(K0N щ8O@QHSPủ̉q(qڅ։q̉xYZ[;\;];^; _;(`;0a18c1@dHeLf;Pg;Xh;`i1hjp8FFFF FFFino  ( 0‹F‹ ҋ QFFF FFFFX66 Y(|08|@H6PQuGw6uF"TuTҋ;wubw ^u܈wuD8  F S 0 (H/ops!8  q( 8 H*wm}r mwk\Ǐ! : T (0 ѐ8 @ H P -XP`dh p x   ̏ba!E B:E&JJO ?bErFSYbErFFѐE~~֐B -kkPEy2dUB~~iBEؑؑbݑ bkkǏ*?MF5e]-*! &q*ޒIN  F ޒ $@Z`[[\~]^`؜ b(d0e78fZ@h}Hj7PkXmҝ`ohp"pr @xsmuvyў{}:S` j t ~  ( b 1pid>F0uid o<o< $ p FF FF r* 1 ;5 )Օ-*+., -])P^F    $0c  &c>ltΟ    ( 0 8@9HMP9XM`php x Ϡ  ) ) y  +& 05 ? INۃ ] g q { : :$)Bߘߘ5r;F pos r) Fr5brXb~oi:{b5~oi]kF bߘՙbՙڙ \bFb/qbHbߕ4kbrrMbpb ٚb$PINboi~F.boiIN~F QbQSV[ 3\brreb ϛbrbr~FrbrbrrFԛF =F$m[qmFB5ymqy`qqB؜mqmBݜmqm7qm#Zqm5<}qm_qmҝqmqmFmםGw'FQ@m~'cqc;;h EqrqmbFўqbm֞m0m05 Sm0? mt S qX7F   qΟuqӟqq u9u%Mu>fmfk RuvumϠu~ru5~rԠ q\)ux==B . LQmyt5[ "@@AA5B0CFD֪ E<(sdF90GAS8'IF'JF'KF'LF'MF *  . 'PPW     qq  ZU2_rev Z99  95.rb2ns0F8< >Y@id;` hp.rcux opsJ!T r9hEi y"$ % ɦ & ަ(( 02 ~89B@: H= P@3XA Q`E O dir d > Ukn9b 1 1@`0h x  ~  B@  BA %`dddUydn~oiɦoiަΦd~rdՙ3drQdr8"Fz  0'֧(V) ji* +, - .(z2ۧ 2"5"5" "mW "n "o&X"0"1 "2 ~"3 "4y "5 ("7 ө0"9 8"; ө@"= H"?PWW )F) LF3~jFQ)2EtbFr~~өbFr~rbFrةbF"N" l" #lF)SF)5~q`֪0 u1 X0t7u LvQw!Vx*yy z (۪7LFAN[(oot֧A`t~ttiyiC }~=buf  ? :/Ed}/xtix5ttd׬5׬>(E>F5modG;$opsH!I JKa ܬì\׬HLargM strNarrOVWFX \max^F_Fnum`qopsa!b$0(;();>2L t F v   :7` -  .mod /;$@ 0FHmp 1P 2{FX  8 5r 6  7  9  ; ͯ  <( = 0r5~ͯ;$5;$ү;$7F >   ,8 ELmod F;$& G7 J       _,P p q r sB tF6mtn w  1  1 F   6;"ܬy>e& o y#QNW/Q  "L Aϱ 1ϱ `   A 1 1  AG*71G 1G 1G  A"1 a M b L % Kint 1u8? #W   1 <!%',/359<ADHLQUYɲʲ˲  6 9 < GK 1 :@ 1T| 1.111-  g l - - - `J 9   % V9  `/V ,4p ,   : ; 9 I8  : ;9 I8 1BI~I !I : ;9 I84: ;9 I 41B ( 'I H}  : ; 9  : ; 9 I8 H}  : ;9 I k<1RBUX YW : ; 9 I1RBX YW I4:!;9 IB!I/ 4: ;9 I : ; 9 I8&I: ;9 I1RBX YW  : ; 9 I' !41" 1# : ;9 $ : ; 9 I k%.?: ;9 '<& 1U': ; 9 I( I8 ) : ;9 I8 * U+:!;9 IB, : ; 9 -: ;9 I.: ; 9 I/ : ; 9 0.: ;9 'I 1H}2: ;9 I34: ;9 I 4  : ; 9!5 : ; 9 I k 6:!;9 IB74: ; 9 I81RBUX YW 94:!;9 I: : ;9 I;.?: ; 9 '<<41=.: ; 9 ' !>>! I: ; 9!?.: ;9 ' @.:!;9 'I@zA IB C.?: ; 9 'I<D.: ; 9 'I E1RBX Y W F  : ;9!G4:!;9 IBH1RBUX Y W I 1J : ;9 K : ;9 I8L : ; 9 M : ; 9 I k N : ;9 I 8O1P> !I: ;9!Q : ;9 I k R.?: ;9 'I<S UT 1U : ; 9 IV I 8 W4: ; 9 I X :!;9 Y(Z4: ; 9 I[$ > \ : ; 9 I!8 ] : ; 9 I 8 ^4:!; 9!I _ ` : ;9 I 8 a!Ib : ;9 c4I4d4I4e.?: ;9 '<f 1Ug h : ; 9 I8ij1RBX Y W!k:!#; 9!Il : ;9 I 8 m  : ;9!n  : ; 9!o : ;9 I p : ;9 q1RBX Y W r 1s'It4: ; 9 I?<u : ; 9!v !: ; 9!w :!;9!x4: ; 9 Iy : ; 9 I!z  : ;9!{.?: ; 9 '<|.:!;9 'IU@z}5I~ : ;9 I 8!I/ : ;9 I :!;9! 1RBUX Y W .: ; 9 ' !.1@z : ;9! I8I .:!;9 '@z.?:!; 9!'< !: ;9! : ; 9  !: ; 9!4: ;9 I?<4:!;9 I4:!;!9!I!.?:!;9 'I !>! !I: ; 9!4:!; 9!I? < !: ; 9 <  : ;9  :!;9!.:!;9!'U@z :!;9!.:!;9!' !% U$ >  &4: ; 9 I?' : ; 9   : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ; 9  I 8 : ; 9 I (  : ; 9  : ; 9 I k : ; 9 4: ;9 I?5.?: ;9 'I<.?: ; 9 '<H}H}1X YW 411UX YW 1UX Y W 1UX YW I~.?: ;9 'I@z1X YW .: ;9 'I .1U@z.?<n.?<n: ;  : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 'I : ; 9 I8 < ( : ; 9 I : ; 9 I I&I!I/  : ; 9 I8 : ;9  I8  : ;9 I k : ; 9  : ; 9 4: ;9!I '  : ; 9! : ;9 I I : ;9 I8  : ; 9 I k  : ; 9  : ; 9 I k  : ; 9 I $ > ! I 8 ">! I: ; 9 #4: ; 9!I $  : ;9!% : ;9 I 8& : ;9 I 8 ' : ; 9 I k( : ; 9 I 8 ): ;9 I* : ;9 +:!; 9!I,  : ;9!- : ;9 I . : ; 9 I!8 / : ;9 I80 : ;9 14:!; 9!I!2'I3!I4 !: ; 9!5  : ;9!6 : ;9 I 8 7> !I: ;9!8 : ; 9 I!9 : ;9 I 8: : ;9 ;  : ; 9!< :!;9!I k = : ; 9 I8>I ? !: ;9!@ I8A : ; 9 B : ;9 IC : ; 9!D : ;9!E!I/F !: ; 9!G>! !I: ; 9!H% I$ > J K&L4: ; 9 I?M'N4: ; 9 I?<O : ; 9 P  : ;9 Q  : ;9 R<S : ;9 T : ; 9 U : ; 9 I 8V  : ; 9 W I X  : ;9 Y  : ;9 Z  : ;9 [  : ; 9 \ I 8] : ; 9 I ^> I: ;9 _( `4G: ; 9 a.?: ; 9 '<b.?: ; 9 'I<( 4: ;9!I $ > 4: ; 9!I &II!I/ 4:!; 9!I  : ; 9 I :!; 9!I!8 >! !I: ; 9  :!;9!I8 > !I: ;9!>! !I: ; 9! !!:!; 9! :!; 9!I8!% $ > : ; 9 I4: ; 9 I?> I: ;9  : ;9 ( [  PS/P/ISINP0  UUuUuou#uUUu?U?]U]VV v $U$vvUuS0\|\'v#'+U+ v<+Q+sv#!U"<!Q!sv#!U"D!Q!s$v#$(U) (v(v$v#$(U)J(v(v9U9SUSSQjVjQVV0 ? ?    s s s DUDSUSUSSUSUSUSU S U S~US~U~*UDTDVTVTVVTVTVTVTVTVT V T V T V!^!$V$%^%&V&*T P %_%3P3__P_S_S_S_V"_"#V#(_P ~ JP~~PHsHh~hsP~~P~>s>^~^s~~~x00^00q^^^~~^~Ps~~~Ps~~~?]y]]]]]] ] &]?\y\\\\\\ \ \#~$%~P>s>^~^s~~~ RrR0123456789PQp|r  PPQp|r} }V   V V V V   V * **P**V  (         !PPP~ ~  Z PPPU ~  Q   $#$(U) ((~T ~v~~"#"&U1J&Q&11 Rt r8% t r@% t rH% t0t 8 8  # #~O^ ^PE~~ ~%%nTnT  T PQ Q        ? ? ? P P ~~U^ ~~0P p *PKM0MrPrvpvPpP#U Q ~~v     v2 2 2v0 0 0 Z v   Q v~ ~ ~P P P PP P P P0 0 0 1/1 Z&/ZZ Q~qr" ~#^ 20#~^ ^R_P^___^? ? ?       ?4? ? ?7?@4 7@84  7@ 4  7 @ 8$~^ ^ R _P^___^P? ??$#$(U)J((&~^ ^ R _P^___^? ? ?       ~^ ^ R _ P ^___^__Q_ Q _ ?? ?      ~PPP^ ^ ^ R _ P ^___^ ~0~QPpr" pr"# pr"pr"r"pr"r"pq #0? ? ??       ~k^^R_P^___ ^Pk? ??B~~~"PY\\$Q$@qQSsSSSsv#U v< TQ| p U$<| Q $|$ p$U%D|$Q$%|%  U | T ~ 0 0 0 0 0 0$~g^^g?? ?D      S_s_% 9V\&P&VPV_~"U"Sv}vU1T1_T1Q1VQ P s v }U# S!P   B B8s  U +^ Q +V U +^ R +@ Q +V U ^ R @ Q V  1 1Ps s s NSVES tx T T(^(5T5<t^(P(>^ T t s  ]U]UUTUT B)U)VUV,T,\T\VmzV v"/vQ"7Q#V RboRRv!ivv! |Rv!ivv!PQRRv) |Rv)PQRR q3 |R q3UPV7PwP w 7w78w88w83U3TTTVUVTSTSPd~P~P~~d~~~8B8 8V8B8BB V8;B; ;V;B;BB V8P U P T V 7PP  778888\VnU>UT/S/>TQ9V9>QP S PU(UT(TQUQY]Y^U^U]U]c]QTQ^T^TUTcT)Q);S;^Q^xSxQSQScSEREUVU^R^mRmVRVRVcV?|F||c|@0R00@0V@''5R5A@ #P00 0V? '?'5Q5A  s;% S#Q0Js;%JTQ;%TVQPp;%:PU#U T #TU#U T #TU#U T #TU U T TUU T TUU T TUU T TUU T TCUCgSgsUsS/T/T"VIVVVP\\VVQ""] ^  Q   S S S S S S \]^ \]S S S CUCgSgsUsS/T/T>VIVPn\s\Q""] ^  Q   \]^ \]S &U&SUTT uVUS "U"OSOUUTUT5VUS v v v S "U"SUSTTVVUS S S S v v v S S S S S UdVdiUixVTcSciTixSK ` RZ ` K RZ K RZ K RZ K RZ  `  8"U"VU5T5ST.Q.P]P[Q[]Q \ P^\e\ P pP |xX|x_|x \X\_\QsUsvQv]U]vUU!V?V?YsYnVns|}vsP^,a^afPfk^s,=sV,=VVVV\$U$/T/mUsUFsFK}P,\,3P(sV(VVVV],U,FqfFTU,u,FqvFTU#'U'VUV+T+^T^+Q+@+R+SRS)U-2P2^UP]]] 0 ._.22k_U\~UU\T}S}~vx~TS+VVV1PPQV"V T "^VT^]VT^]1*PTUT]U]U]]TTTTTTTTQTQQQQTRTyVVVVVRVVVT0T@@P@@@0@@IRRT0T^^^^0Q^T0TP0T0T0:0BSSSSSSq }"# q }"# p }"# ~# }"# p }"# ~# }"# cQQQQ%Q%7Q T0TT T#TT0TT+>+ + + + >  8+>+ + + + >  80\0,\,S,\S1P6\!\\1PPR\^RRRq s#UQ}s#UQ}<U<UUuTu^T^^CTC^T^^jQjqRQQQQI0PgQQP 9P9cRcYRYRPP016R6fyRyRRR....    ........00RRR...   8882p t p,Q 4p,Y~ Y~ Y~ p ~#  p ~# PP)^_%_ ___S~ ~ ~ ^^_^M^px/7px P&P3AQAIPQ#Q#0~3>R>FQP/7P~ =U=UUuTuSTSSBTBSTSSh_____P 8P8gQgVQQPPV?VVV011;Q;ZvQQQQv....    ........00QQQv...   8888s8s t s# PEVVV s# PVs#  V s# Vs Vs Vs *SV&V VVV_s s s [SSRSJSS px(0pxP!P/;V;FPV-V-8Q8@VV P(0Ps 'U'VUVUV'T']T]T]^^SS\R\??        ?  8 UUV dPQPQPv#  p v# PP0v# 0 v#@v @ vv# \ PR\ v# P\v#  \ v#  v#   v#8v 8 v  'U'VUVUV'T'\T\T\^^SS 00]}]y???y   y   y???yBBB? B8v v v PQ1 v#   v#@v @ vU \ U \\3T3VTVT V T Vyv~Vv~VTVVP~~~ ~ ~ ~~~~~~~N~)S)7PSVTVTVT Vyv~Vv~VVV_ ___0]0 ] ] 0 ]]]01S 000P   Ns___ _ _ _______VVV V V VVVVyv~Vv~VVV   u[[]] ] ] ]]]]]yy y#yy#y#y#Qsr"#$Q$sr"#v# s"#Qsr"#p s"#v# s"#Qp s"#sr"# sr"# sr"# v# s"# sr"#sr"#sr"#sr"#sr"#sr"#+sr"# PP)0)+Q+5055p0T0p00Q0R0 0 0 00000000N00X00X0 X 0 X 0 X  XXX0X0X0XX+X+NN0_____VVVVVBQQ*PjXXXXXi_iVissG_GV;]YGY/Y Y1PPRYBBBBB B  ___]_]]]]]VVV]VgQ[[<<<]< <  TTv    ] v    ] v: ::]:v    ] e1 TT    ::    88e1@0@e1%1   _ _ V V s s sO_OV<]YHY0Y!Y1PPQY_ _ _]_] ] ]]]V V V]VQ Q[ [ D D D]D D  T T }    ] v    ] v@@ @]@v    ] e1 TT    @@    88e1@0@e1%1  d_dVdssM_MV:]QFQ/Q!Q1PPRQ'TVTP 1i1 1 1P vERR R  v  i_iVissF_FV:]QFQ/Q!Q1PPRQX_XVXs sO_OV<]YHY0Y!Y1PPQYBB B  BB B  TT    ::  [1 TT    ::    88[1;0;[1 1 << <  U55VU5R55VURV1;Pss sl_V\_ px T P)8S8LP)S)8Q8PSP    |8~U'S'/UT(V(/TQ*\*/QUSTVQ\1"PUVUUS0\|\0$v#$(U( v <(Q(sv#U<Qsv#UDQsUsVsU V%T%TUTu\uT \TQTY~YQ~ Q ~ Q ~P^^P^P__ _NQ*~ps"P~"R"SsSRSRSRSRSSS | +R+N |  "Q"&"#"U&   "Q"&& #"U&   "Q"&&  U \\SSP~~PQ~~PP _#"U&<  "Q"&& BB B#U<Q~R          V VV^^ ~OV V V V # U! !^ !_  # U! !_  V V UU[U3T3STSTSTST S T S TSTSTS[S\ \ \ \ \ \[\ P 'T?YP P P;VjVVPVV VVPV V P V P V P V   P V VVV>[VP~~~ P ]]]0000P ^ 0 P ^ 0 ^ 0 ^0P^0[0s0000 ] 0 _ 0 ] 0 _ 00[0e[eW00 0 0[0 0R @E$p $ &5$"t $ &5$"T  B B BB B B     B B BB B B0 0 0B 8 +] ] +^ ^     ^ ^    1 1   & #+ & #+   ^  1~#U^~ ~R  \!\~!~ P ~pxV| 1| 1 | 1| | | ]K\!\K~!~PP!VB!B B| 4P |  0 |  0 |  0[\]Q\ tx T T(3^3@T@Gt(^(3P3I^ T t |  ~-B B~# U }  T $ }  ~ Q $~$ #^^ #VV #__^^__00  1#+#+   ^ _ 0~#U  ^~ ~~#"U&< ~ "Q"&~& ]P~<~# U   T $   ~ Q $~$ ,^^ 'V'+T+,  V T,~T^^T~T00  t#+5~#+t#+   ^T~0BBB B &SS &^^ &\\^^\\11  0|#+|#+  ^\1~#U~#}T}>~# U!<!] ~ ~~#U p ^~ ~~#U t ^~~# U!<!] ~ ~~# U!<!] ~~USU S*T*pUpu_u~_~_~_ ~ _ ~ _ ~ _Qu\uQ\Q\Q\ Q \ Q \pRpuVuRVvRVRV R V R VPPP ~ ~^^^^p]]]]  ]\\  "Q"("#"U(   "Q"(( B B B#"U"Q"(( S S S S S S S S S #"U#"#~""#"U# #~" S S S S S S S S S S S S \D7%-2w  ?I  $)c   '+  ; ; &lq(/6))       9 '27^ !&M//     <B  R   /7; ,  ]-~   449@'',3X  08< -    ]0      449@'',3X 07; -  ~    !$(/:   #E    R   07; -  k 08< -  #6U   //4;""'.NG      : +7<[&+J((? 9 5   ""&&ks&   %9!!v !   [  ++      !K ! !  !  $#&   $"',*& !!! ((##            "',""$)$)*D  %%).$.v"'.1           %908=?@  & ~  )     =4= ! 3% $)oy 14 $'A  B BE!6 025 B ##5=$ %) &+7< 3:!! //3OR.JM_% 47>  ؉57Ƀ               9f p !(XX L'r[X f.X f<<f X[j bLJ.XM t/X.nXJ.XMv bJ jtJJ.XJ4~X/ gXX g<J= g XX kj ff  Y,<"_xJu">i ^z.]/=W?J&u  /  t]?WuK."^yJu">i vJ&u% j '#Wu#=xXWuK RXt K-  =X>Zt  3<P Szq< Y=M Y = KJ . X28^ tYu$  ut  u.X  tYu  uJ  utX  tYu  uJ  utX %gtJ .X"y>w <Z z I W Z < = = ths %#< .+JX<YgIN#!< O fit#s  KL9K / </ w..Xp "H>LpX8JY8J6J8<8<8J8J5J7J< Np  !Opp<X o  | f p<< q  "Lp<Xp<p< <p<" tsKKKKKKK o  | fLp<KY< XXp< <p< <p<p=X.t|,YI=.uJ Mg K<~J  sXN<J  s  <u tiX =M K K KX  .JpXJY~YpX ~Jf)J  wiq[t[J =M  IK su< J J ty )<J#   tY J+X//=. hX w ~rsuv Mg K<~t ttt u#ut  u<  w~zt )u<')~Bzt tBY e <f,t"t M Xt-|pt# =#eK|C t7x x }J~ Ygt K<~<|J K|hf u|otwUULMJtJ|* .[[Ut,XXLjTKt{J{ Y~t~[ K=M  Z Vu K K< }  | fS twt<<> h JzJ.. K m e   }7t}C ;[ X~yu < X u{UPzJKMJtt|* .[ZVt,~X~rZ{XfX|C t7xz t}J~ Ygt K<~<|tJ KvKGAo?|X X#|t |) < t )J ~  0m,~ tJs~  t's  <sJt  s>"|'c,~nt~ t.X}<.Y~X~C t7x x }J~ Ygt K<~<|tJ KvKKLv}X ~J7t}C ;z t}J~ Ygt K<~<|J K}Pt J tg-us= ;0s1 tg JtgP x X|X*f?*f{ t}J~ Ygt K<~<|J K qv~ tw/~vYGMJJ~* .ZT:Z[UM}X"qXtX           X|'XtX           X~~"XtX X          XY.<~XJ5y<vJ f&(x t x f.4p%xt hJXYv vt ?st JZc/  vd gv(b tIa JfJa[ =M  VK u u< `  | fKb JwYJ<t.<> h JJc f u<PYt JJ~"XJdZV"g  `LtHXOr. I S<X8JK~X s< st < m0go<go<go<go<go<go<<1~s f} VX Xo<</o=.OXo<gE I T<XJ j~X s< st < [PjO~s f ~ uX nXo<gtX s .l<pRzt JoNt<L=dU %EZL dX>d dXX dtXps n<~o<!o<Jo<XJ<Zi &;JfvJf0[0jX0`0!XYp pX ptX|s  sX  stX| Xn=Xn< .pXsXn<u Ju  J  J  J{ 0 .u. u$ 9$# ? Uw Z<Ys'X.i..iX>  +  k( .l=NJXJ}/tj0 j<0<J jtX iXtt .+JX5   }X<"j _yZ   G0 K-ug X   FK.i iX itXu  }Xf . ~X4f c  | c.. b  | .eJ X.\e ^zXZ "Y YZ w M(d zJKXX! tJKc<X b  |e XwYX<t<> h JJezk x8h tXj  jXX  j<  jtX< zJ^ -<g<+ Xp Xj jX jtXu  ~Xk  kXX  ktX<% iJ%Oh X  ~J<j  jXX  j<  jtX< _xJKQJx -.h<+ Xp   hXXj[]xZ "YOZ  JJu %<h< X  Z`h K hJX hJX ' JPj jX jtXv  Xvtj jX jtX. ~tXjX.IX6.U nPu   ~XXiX.I Yti iX itX.~Xk kX ktXv  iX.UXj jX jtXv XwXX X.#qJ1Ys/Z = yfX *Xrl< l<Jl<l<Jl<lXm<n oX  otX{s  sX   stXz ~X vXl<lX Jl< l=Xl<lXl<lXl<lXl<lXl<lXl=XX dZ YXl<iXm<X~Xm<" J f J $ J $ Js$YIKjJz IKL$(<=uKKKKw.+ +JKvy+ . +JML'!'JKvy' .!'JMKLv.  v.  Kvy  .vJ<  JP J.SXux} vt<~f x} XvJ ~f v. vy.  x} vtJ~f ix} vtJ~f x} vtf~f x} XvJ ~fX fJs  ,}Xf|;gv  X fwJ`XWc`bWZ ]  | f"dXcX]"eZ'mv tvXY< dtmv<Z  y[sɃj tYu$  ut  uXX  tYu  ut  utX  tYu  ut  utX %gtJ` `tX `tX` `tX `tX uXJoXX|$/1X Qzf I/Aok2K"XeX}+$tV>Z;YXX "w X< W W^ = = s Wx$Y28E/t s JsJ  [JJ 2p<<Z Z XXvtDx.`J0ft3 itXt2 cXYq JJrtX ] J{XXf.LHu uJ JutX :XJ.,. O]w)~f.LHu uJ JutX yX  <.(JX'J֬'J|   2tX  ~t B}Yy tWJ.~Jst}<ttX t<..X XvXX zJ/Xzw X} f M Y JZt fLtv,ZXX Z9w+YL:ZX =XX} su0r IKb<tuy .a_t t_Xt _ttt _ttt KsujpWgz, b, b<,3oyb, bJXxXY~uP"=YXX . =XXX su0r IKb<tvu s'(f.K vY~XX` `tX `tXXt`t JM~X~_} } tX} t<}>DJ@MGw"2>@pv2<y `}WtoX=} uX5o twJL (_yt . ~X t~<Z  ~X` `tX `tX}Xa.t~t.~< ~=;~J ~=;~J ~=;~J ~.~< }X~t X}~fXXPz.<Xf  <&}<i <! J!X <!< ZYZX/t  tXX t X0d< xb t tv\Ttv /e>eXzFYUvX d 't }vyv },f {y<x GYZ Z eu/ &kzg: <w<0>gyGYUvZ|egL twJvvXKw  11 I K-jJf-=J`.  }X [UM^ 4Y4W<u0Jg1Jv1$W&!W~Jm!I1+Jh1:Ju:X<X+J:X*Jfs~ t~ tX~X. |ttX|<X .         Xy t .zdBPMV,"..zgsKk4zJX    66666z.vzf x<3 GYZ Z X z.<wt)M&y. f<zXX?m 'Jy K'(/';(='sXJ<y< mt< mt X#?sp>m mtX< sm mt <sm mt mJX -j<X WxXYj& i"< ]t<<<! ^  |" J ]X"  ]J"XuW ]tt"gPyJ=>dK?Gg=IK@PzJzX ^ = u!{Z < <{t {eL>e"|HzXzXsX.<Y `.<Y `.< X |t{ /suhXnv  vrXtr <rt pL//ct ! c   u k" ^zX$Nh ~t t~X tB~Yy tWJ.stq<t <. #c#.YuY L  . r  gK< $N r         ___GFP_THISNODE_BITlineget_budgetlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEmsi_caphost_blockedscsi_dma_unmapdup_xol_addrshared_tagsgate_structcapture_controlnr_wakeupsstartput_budgetstart_brkbudget_mapstatic_key_modreq_flags_td_ino_softlimitxregs_stateWRITE_LIFE_LONGadapnodma_flagsuclamp_seFORTIFY_FUNC_kmemduptag_listreqsenselenpkruElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersrq_end_io_retzone_wplugs_lockbridged_releasestates_d_opmce_whole_pagestatsreadblk_mq_queue_datanetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_code__UNIQUE_ID_version595thread_nodemake_pgdproduct_infonr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesmega_get_boot_drvreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributessbitmap_wordpci_set_mastercached_rqscopy_from_userset_child_tidblk_unique_id_overrunmegaraid_abort_and_resetrestrict_linktmpfilercu_read_lock_nestingem_perf_statemin_nrtick_dep_masksbitmap_queueatomic_readfifo_timelist__UNIQUE_ID_description593_copy_from_userthrottle_disksi_errnoromlens_inode_lrusector_sizeatomic_setsrcu_size_stateblk_plugfcloop_id_chg_counterpdrv_state_newscsi_host_stateneed_tsof_noderefsmmap_compat_basewrite_idt_entrytrace_eventsenv_startDMA_FROM_DEVICEdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTeh_should_retry_cmdread_aheaddevfnregsslice_maxlast_switch_countpci_set_drvdataqsize_t__compiletime_assert_104filepfilesdevicesdqb_bhardlimit__mega_busywait_mboxliveatomic_write_unit_maxrun_listixolallow_restartbd_mappingsym_vvar_pagemodule_sect_attrslist_lockreturn_instancesoftirq_activatedSHOST_RECOVERYpdevzone_wplugs_workDID_BAD_INTRpci_power_tclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayflush_tlb_one_useradapter_tremoveunsigned intSUBMITTED_BY_SCSI_ERROR_HANDLERnum_ldrvgendiskspc_timelimits_instancesmake_pmddescseqcountremove_busoom_score_adjeh_entryd_seqbi_crypt_contextinit_requestia_vfsgidprot_capabilitiessize_tacpi_device_idptm_enabledcap_permittedTT_NATIVEtransfersizemega_allocate_inquiryclass_irqsave_is_conditionalserver_pick_taskregister_chrdevmega_passthrupgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxerror_statercu_tasks_holdouttarget_listno_64bit_msipasid_activatedpi_seldrv_state_newget_offset_ctxflush_tlb_info__compiletime_assert_127exit_requestfreeze_ucounti_ctime_nseccpuhp_deadneeds_fresets_remove_countsyscall_workdevice_physical_location_vertical_positionscsi_add_hostatomic_long_tcontroller_proc_dir_entryprealloc__init_swait_queue_headpfn_mkwritecallback_heads_vop__compiletime_assert_220perf_eventf_securityi_sb_listfutex_statevm_rcupgtables_bytestarget_destroyget_linkfmode_tSTARGET_RUNNINGcputime_atomicno_difpci_channel_state_thost_lockdrive_inserted_countrestoredelayed_callbi_iter__compiletime_assert_134__compiletime_assert_136max_nr_cid__compiletime_assert_137_statusmegaraid_resetmark_deadd_sibkernel_ulong_tscsi_dispositiondma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedhdr_typelimits_lockdl_dev_statedriver_vergsindexexpires_nexti_io_listemulatedf_epsrcu_barrier_seqmsi_locklinks_countscsi_cmd_privreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tdpc_rp_extensionspv_lazy_opspdrv_fmt_counterclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotify_rsvdnotes_attrs__s16dq_idgroup_exec_taskno_highmematomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodews_activetmf_in_progressfile_leasescsi_device_statemodelscan_objectspid_typewb_errcputimercopy_to_usertrace_recursionbv_lenmake_ptehotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdma_drain_bufrcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registeruioctl_tremove_proc_entrydev_pagemap_opss_stack_depthchange_queue_depthdata_vmmake_pud__s32entry_eiptaskstatsmega_ext_passthruhugetlb_usage__dummyratelimit_states_pins__param_str_max_mbox_busy_waitioport_resourcescsi_cmnd_submitterattr_entry_ptrstarget_dataget_next_child_nodeFAULT_FLAG_WRITEcompletedstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDwrite_ldt_entryp4d_valblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountinq_periph_qualpend_cmdsforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointsupported_eventsresvnr_wakeups_idleFORTIFY_FUNC_memsetio_cqres_attr_wcelf64_symdevice_blockedread_msr_safeproc_show_rdrv_10latch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listsgl64PROBE_FORCE_SYNCHRONOUSuse_192_bytes_for_3fBLK_UID_NAAp2pdmadesc_ptrsyscoreprot_guard_typepao_tmp____s64dqi_bgraceproc_show_rdrv_20__compiletime_assert_87__kernel_pid_t__compiletime_assert_88static_call_modmax_cmd_len_timerdma_map_opsma_external_lockdevice_physical_location_panelhost_resetuid_tatomic_subflush_requiredpcie_flags_regpdrv_infosum_block_runtimehctx_listpgmapmin_perf_statemega_support_ext_cdbproc_show_rdrv_30dq_opsdev_datarcu_tasks_nvcswcrypt_keyslotwritetypetabmax_user_sectorspci_dev_funcclass_read_lock_irqsave_is_conditionaldisk_array_8ldFORTIFY_FUNC_strlcatdma_pools_addr_lsbproc_show_rdrv_40devp__compiletime_assert_97i_generation_sigpoll__compiletime_assert_99procentmxcsrdevtd_rt_spc_hardlimitmagicbi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infomight_faultindexset_p4dstarget_sdev_userdriver_datathread_headlast_queue_full_time__bad_copy_fromend_iodev_pm_qosbi_sectormap_typeDID_REQUEUEf_oppids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationsmatch_driverclass_raw_spinlock_irq_is_conditionalportpercpu_size__phys_addr_nodebugldrv_propptm_granularityshost_groupsid_tabledq_sbmbox_tptm_rootgeomhost_norun_worksighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entrysdev___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimeproc_show_rebuild_ratenestedalloc_time_nsnr_forced_migrationsscsi_dma_mapseq_operationsnum_argsri_timerstack_canaryblksizesiblingscsi_device_typemnt_rootnamespacenext_scanf_radec_fault_bus_infoquota_writesrcu_barrier_cpu_cntiopl_warnrmdirinit_hctxpcie_link_statesockSCSI_EH_NOT_HANDLEDboot_ldrv_enabledbi_write_hinthash_lenget_policy__list_add_validtmf_work_qHRTIMER_RESTARTmegacmd_texternal_facing__msSDEV_QUIESCE__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionaluiocpvm_userfaultfd_ctxdevnodecpu_baseDID_SOFT_ERRORdevice_is_availabledquotdl_runtime__ret_do_oncenumbersbi_vcnttry_rc_10_first_softexpiresidt_bitscore_forceidle_sumkey_user_hugetlb_cgroup_rsvdscsi_doneskip_ms_page_3ffaultableio_comp_batchfileattr_getstate_mutexshutdowndq_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueptrace_messagepdrv_fmt_idnum_trace_eventsptm_cap_sys_privatealignment_offsetopen_mutexscan_finishedinit_fs_contexts_subtypeheaderfuncread_ldidmapperf_event_contextmax_cmds__seq_putstlbflush_unmap_batchsoftcrypto_kobject__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authdispatch_busySAM_STAT_INTERMEDIATE_CONDITION_METallowedvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksscsi_inq_dma_handlestart_stackwatcherskmalloc_cachesoffset_low__compiletime_assert_216m_out__compiletime_assert_218completionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobeoutb_penquiry3show_optionsdiskbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodepri_capcurr_nrsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_datahost_failedbsg_dev__mega_runpendqpud_valpasid_featuresscsi_target_stateget_dquots_raw_spin_unlock_irqrestorenum_orcsclass_task_lock_is_conditionalshow_rqFAULT_FLAG_MKWRITESTARGET_CREATED_REMOVEoom_reaper_timermemcmps_uuiddestroy_dquothost_eh_scheduledd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_ontarg_xfer_rsvd__warn_printksafe_haltvm_operations_structcnivcswbin_attrs_newrpm_autosuspendbio_alloc_cachebi_bdev__builtin_memcpyconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocessscsi_inqpi_waitersexp_hintd_childrenpgd_freedirty_foliois_softchip_set_valuecntsRPM_SUSPENDEDreclaim_stateload_gdtvma_numab_staterethooks__param_max_mbox_busy_waitnum_symtabwrite_inoded_fsdataRPM_SUSPENDING__param_max_sectors_per_iopgd_allocwbinvdnrpages_refcounti_crypt_infosaved_cap_spacelist_emptystats_sectorserror_remove_folioold_time32_tcore_kallsymslast_queue_ramp_upsrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2sg_reserved_sizebd_size_lockbackvmemmap_basestate_add_uevent_sentblock_cfg_accessi_hashresulthlist_nodesprintfio_uringmax_idget_debugregcore_occupationsimple_tagswritelftrace_timestampwriterwait_page_queuesched_remote_wakeupresumeirq_disablewake_qcmd_per_lunfileattr_setrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsproc_nameonlineruntime_resumedup_xol_workqueuestart_time_nsMEMORY_DEVICE_PCI_P2PDMAsdtrtotal_vmjobctls_time_maxnode_listdio_offset_alignmega_is_bios_enableddelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimelist_add_taili_mmapadp_span_8ldthaw_superldrv_state_counterd_lrusignal_structperf_event_mutexpri_enabledreset_doneconfig_signaturedisconnectcrcspgdval_tpage_linksetattr__bad_copy_toboot_pdrv_enabledf_mappingnoinstr_text_startprepareBLK_EH_RESET_TIMERbin_attrssas_ss_flagsf_modeki_completemega_adp_infovtime_statewakee_flipsset_aclScsi_Hostrom_attr_enabledset_fixmappids_activedriveris_vmalloc_addri_opskip_bus_pmldt_usr_semkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorescan_mutexrsvd1rsvd2credjump_entryno_write_samemax_host_blockedlist_lru_nodetagset_refcntsrcu_gp_seq_needed_expinterval_exppdrv_state_oldaddress_space_operationsRQ_END_IO_FREEspinlock_tscsi_add_host_with_dmaldrv_numshow_info__task_fpstateDID_RESET__ret_oncewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultlogdrv_40ldthis_idkstatfssiteskickDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpcislotpaccti_dentrydisk_eventsmegadev_unlocked_ioctlgrab_current_nsaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsys_dev_noticequeue_kobjfcloop_state_rsvdsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDshared_pendingpage_listmega_runpendqexpires___GFP_HARDWALL_BITset_ldtnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGvendor_idthreadparam_ops_uintsym_timens_pagesriov_configures_time_minbusn_ress_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalsecd_romd_weak_revalidatecmd_lenremoved__compiletime_assert_101show_pathPIDTYPE_TGID__bad_udelaypriv_flagsMQ_RQ_IDLEcurr_ret_depthac_utimebus_list_dummy_pkeysense_bufferTIMEOUT_ERRORiommu_mm_datamce_countswap_info_structhost_waitsequencewas_resetrt_spc_warnlimitnr_reserved_tagsac_flagcoredump_datatasksupthru_pidscsi_cmndaddress_spacemm_context_t__q_sizeis_probed__call_single_nodestartupof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatordma_alloc_coherentpanelclass_id__read_overflow2_fieldqueuecommand_may_blockinactive_timer_pkeyfilenames_export_opfront_padno_start_on_add__mptri_flctxstashedvm_page_prot__udelaytimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodepcidevnormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrs_wb_errptep_modify_prot_commitis_child_subreapercall_depthunicode_map__compiletime_assert_602graph_get_remote_endpointnum_descsskip_settle_delayskip_vpd_pagesproc_show_pdrv_ch2proc_show_pdrv_ch3__release_region__param_str_max_cmd_per_lunexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoirq_managedqueuecommandalloc_inodeexit_cmd_privuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidrseq_sigp4d_tdev_pm_domainlimit0limit1nr_zonesis_sourcephys_drvevent_workmigrate_modebio_poolwakeup_preparedparam_valpoweroff_lateftrace_callsitesd_hashldrv_opidis_confidentialdl_bwkobjfsyncmtd_infoi_flagsblk_crypto_keyslotblk_eh_timer_returnlimitsboot_ldrvkernel_siginfouprobes_statemanage_shutdownFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotuiocpm_messagemay_split__q_size_fieldmem_cgrouplast_update_timemega_del_logdrvrobust_list_headmultiple_queuescurrent_state__ubuf_iovecignored_posix_timerscountSCSI_RETURN_NOT_HANDLEDGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevelldrv_op_statusvpd_pg0__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventulongset_inforeqsenseareahlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesioctlshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_beginvdsommap_legacy_basemegaraid_cmd_privpipe_inode_infocur_bus_speedsecurebitsscsi_remove_hostpartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollscsi_host_statusbi_poolcompat_uptr_tuevent_opsrequest_irqsg_tablesizepref_windownumsectorspoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklistmegaraid_pci_driver___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITcur_statusclass_local_lock_is_conditionalwce_default_onsuspend_latewakeup__check_object_sizeeh_abort_listcg_listlink_bwctrlDID_BAD_TARGETsrcu_barrier_completionsdev_gendevsaved_config_spacedriver_flagssg_timeoutelementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapuse_16_for_rwwaitersuxferaddrsubdevicesessionidmega_adapinqarch_atomic_readdefault_lockbi_flags_sifieldsmega_internal_dev_inquiry_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_infoDMA_TO_DEVICEpadding1force_runtime_start_on_system_startllistunmap_limit_for_wsdebugfs_entrySDEV_EVT_LASTacs_capmax_ldrv_numelemnr_retriesbiotailsigval_tsectorsalimitundo_listKMALLOC_RANDOM_START_dev_warnmissedreport_zonesbi_idxquota_readproc_show_rdrvst_shndxcmd_flagsio_start_time_nsfreeparti_wb_frn_avg_timeswap_lockbd_fsfreeze_countfile_ref_ttypemembarrier_stateFORTIFY_FUNC_UNKNOWNIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type__mod_device_table__pci__megaraid_pci_tblmtimeserver_has_tasksvm_faultzone_wplugs_err_listrequest_threaded_irqoom_score_adj_minDID_OKkobj_uevent_envnotify_countersfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tint_statussiblingshotplug_slotfree_inquirypathudelayst_sizepagefault_disabled_incDID_TRANSPORT_MARGINALrmtpmemcpywait_sumnum_tracepointsupidexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalmega_print_inquiryconsumersshost_datakernfs_elem_symlinksglenmega_pdrv_infoclock_was_set_seqwrite_msrDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerbreserved_tagsunlinkSAM_STAT_BUSYnumstatusperiod_contrib__UNIQUE_ID_license594rcu_node_entrystart_scan_seqnr_ctxfsgidswap_rwneed_parent_lockrcu_syncproc_dir_entryvm_opsiopollunusedactive_queuespagesizeHCTX_TYPE_READdisk_names_blocksizevm_pgoffRQ_END_IO_NONESDEV_EVT_MODE_PARAMETER_CHANGE_REPORTEDSDEV_EVT_FIRSTauprobeno_uld_attachpto_val__numa_workupdate_timeptrace_dr7no_d1d2shost_dev_call_addrrescue_lockmax_segmentsloginuidcheckexpiryoptimistic_spin_queuecksum_pdl_defer_runningbi_bvec_doneroot_blkginlendma_h_bulkdatamega_support_random_del__kunmap_atomicwrite_config_count__lstate__compiletime_assert_84broken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsnr_mapsmod_namesdev_groupspdrvproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlsched_tagsrseq_lenjiffies_at_allocmodule_attribute__compiletime_assert_591pollfdmegadev_ioctlnr_wakeups_remoteSDEV_EVT_POWER_ON_RESET_OCCURREDSAM_STAT_INTERMEDIATEpci_busto_copyllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_aware__list_del_entry_validparavirt_patch_templateclass_spinlock_irqsave_is_conditionalrseq_csprimarynum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnon_compliant_barsldrv_state_old_pincount__compiletime_assert_98rq_timeoutmega_build_sglistDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headqueued_spin_lock_slowpathtgidmega_internal_commandwrite_protect_seqsilence_suspendltr_pathset_pgd_tidlast_statuss_inode_wblist_lockfrombd_holderlogdrv_8ldcmd_privend_code__UNIQUE_ID_max_cmd_per_luntype596__outbqspinlock__kmalloc_large_noproflru_geninsnfilldir_tmem_type__must_check_overflowdl_non_contendingdir_contexttracepoint_ptr_tutasksdev_stateinserted_drivesched_entityd_spc_hardlimitmq_freeze_wqmegaraid_remove_onelong unsigned intsleep_maxmmap_baserescue_workio_contextrevisionDID_IMM_RETRYquiesce_depthhctx_tablegpl_symsseq_showraw_mboxtlb_remove_tablearray_szswait_queue_headstart_context_switchcow_pagemega_hbassectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_f_raw_spin_lock_irqin_eventfddevicebi_integrityparam_ops_ushorts_shrinkhrtimer_restartUTASK_RUNNINGexit_mmapsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgpci_device_iduna_mbox64noderesetsdev_targetvm_lockno_cgroup_migrationnextevts_writers_key__countdma_free_attrsxcomp_bvcma_areadma_set_maskstatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockexpecting_lun_changeatomic_write_hw_maxl1d_flush_killi_versionuse_10_for_msDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimepdrv_fmt_rsvdstate_remove_uevent_sentinquiry3legacy_memfirst_minoria_sizein_hrtirqs_master_keysset_pmdprivate_bios_datamega_support_clusterwchar_addr_bndkernel_symbolmake_local_pdevsubsys_databi_statustv_secblk_integrity_checksumhostdata_addrpid_ttask_listftrace_sleeptimewrite_moderun_nodeblock_device_operationsnr_phys_segmentsma_rooturing_cmdnr_failed_migrations_affine__UNIQUE_ID___addressable_init_module603strcmpuser_cpus_ptrraid_inqpi_top_taskno_read_disc_infolist_del_initslotactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writeutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimehctx_typedisable_depthasync_scan_printki_sizedl_deadline_hugetlb_hwpoisonflush_tlb_kernelubuf__kernel_caddr_tksm_rmap_itemsnr_integrity_segmentsmegaraid_abort___GFP_HIGHMEM_BITmodulepthru_dma_hndlpcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespaceHCTX_TYPE_POLLget_currentvfsuid_traw_spinlockuse_10_for_rwtimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offmega_prepare_passthrudq_inusecachedqi_flagsmega_n_to_ml1sssriov_set_msix_vec_countkfreeread_posstatic_call_trampbtrace_seq_pp_mapping_padsa_maskmega_product_inforequest_queuedqi_dirty_listpthru_dma_handlemega_bufferpad1kmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenhaltstatic_rqscodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listsched_rt_mutexlocked_pendingscsi_build_sensereset_preparenr_deferredfown_structfeatures_lockeduna_mbox64_dmatracing_graph_pausequeue_numcache_flush_intervalpermSDEV_BLOCKlparamset_ptecompat_robust_listparavirt_callee_savebi_blkgnr_hw_queuesis_msi_managedktypelockrefin_dpm_listsrcu_struct_ptrsmm_structset_pudvlagi_uidmbox_inmega_build_cmdtablesDMA_BIDIRECTIONALbi_iocost_costspinlockpid_namespacesave_flmegaraid_isr_iomapped_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmfortify_memcpy_chkdebugfs_idSAM_STAT_CHECK_CONDITIONguest_permidle_notificationmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_diskrq_nextsp_offsetsrcu_cblist_invokingi_lockmax_targ_per_chand_nameSDEV_EVT_LUN_CHANGE_REPORTEDcpuhp_onlineget_ownershipfcloop_state0fcloop_state1ufdscrypt_ctxexe_filenr_scannedpcp_listpid_linksphys_drv_formatdwords_sysfs_nameMQ_RQ_IN_FLIGHTq_size_fieldrefcountnr_activevaddrrequestint_scbrw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipadp_deviceqc_dqblkretry_hwerrormmappedseqcount_raw_spinlockbd_holder_dirbroken_intx_maskingspankill_sbd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parameterseh_timed_outi_write_hintfxsaveprocess_keyringlist_op_pendingiotmo_cntDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrno_scsi2_lun_in_cdbclass_raw_spinlock_irqsave_try_is_conditional__ret_condshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igracemax_slack_shiftstarved_listclass_rwsem_write_try_is_conditionalthaw_noirqmega_ch_classpreempt_notifierssrcu_last_gp_endSAM_STAT_COMMAND_TERMINATEDmax_channels_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_lockDID_TRANSPORT_DISRUPTEDmax_mbox_busy_waitsegment_boundary_maskquiescentVTIME_IDLEstatic_keyscsi_timeout_actiondrive_insert_countcaddr_tsegments_magicdl_overrunresvdallocsubvendord_parentadaptertransparentpayloadac_minflti_sborig_nentsblk_mq_hw_ctxkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflinescsi_host_allocatomic_write_segments_maxatomic_openbio_end_io_tpv_irq_opsstart_prevent_timeboot_pdrv_chcondreadahead_controlblk_tracesubordinate__kernel_gid32_tbios_versionkernfs_open_filef_credMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesbd_dev__param_max_cmd_per_lunslave_destroyread_newsignalfd_wqhmmappto_tmp__modnameasync_put_workmknodpri_reqs_allocctxsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapscsi_sg_countdma_alias_maskwritepagessched_statisticsfree_local_pdevheadminorscompleted_list__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampsuper_operationsbi_cookiesplice_eofnoop_llseekcheck_copy_sizepdrv_fmt_valsam_statusutil_avgmegaraid_exit___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAnentsbd_holderspt_regsscb_listboot_pdrv_tgtpipe_bufsto_userKOBJ_NS_TYPE_NETctx_idmap_nruse_16_for_syncd_rt_spc_warnsq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockparam_counterbitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoats_capblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsFORTIFY_FUNC_memscan_cond_resched__compiletime_assert_358dev_flagsvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typebroken_parity_statusdiskseqmega_proc_dir_entrymsleepi_pagesatomic_write_hw_boundaryhlist_bl_headino_warnlimitfasyncu_charlegacy_ioi_rt_spc_warnlimitdoe_mbspage_fragwrite_byteschardomainunix_inflightmega_sglistholders_dirinit_cmd_privfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledgraph_get_port_parentmax_zone_append_sectorsSDEV_EVT_MAXBITS__restorefn_tclass_raw_spinlock_irq_try_is_conditionalissue_scbthread_shstktarg_xfer_idbio_slabd_alias__iovcpumaskslow_down_iologdrv_chanmq_hctxdumperwakeirq__ecxclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimes_rootsdma_data_directionproc_show_configd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflen__edisaved_trap_nr__this_module__edxbio_crypt_ctxmraid_ext_inquiryfreeze_fsuserfaultfd_ctxsigset_tcapacityno_report_opcodesrq_countrunningrseq_event_masks_rootra_pagesscsi_cmd_and_privTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_freebridge_d3parentspecial_vec__dummy2atimecopy_file_rangeinquirytask_cputime_atomiccommit_rqsmega_free_scbuser_definedkey_typedma_h_sgdataget_named_child_nodelaunder_foliocurr_targetnumberis_suspendeddma_lengthpagefault_disablehotplugnumldrvtimeout_workburstnumsgelementsraw_atomic_setetypeei_funcsmodule_kobjectactive_memcgFORTIFY_FUNC_strcatdef_flagsd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updatetarget_blockedvendorcap_bsetmegaraid_infomutex_lockopen_modearchdata_sourcepower_statedma_unmap_page_attrsSDEV_DELnr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasespcie_mpsss_bdev_filenuma_faultswork_qunregister_chrdevblist_flags_tlinux_binfmtpage_table_lock_sigfaultcksumcountersfree_ldtkasan_check_readname_linkcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typesriovpao_ID__policysharedwait_queue_entrydismissd_real_typelookahead_bandio_portseq_start__targetsmegaraid_queue_lckrq_qos_mutexzone_wplugs_wqraw_lockd_dnameget_dqblkwait_indexscsistatusscsi_levelmax_hang_timecpus_masksubdirstask_groupstarttimeiounmapmmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcecmin_sliceargs__poll_tfwnode_operationstarget_allocshow_devnamelogical_block_sizerun_delaytailspthrublk_flags_tlinenoSDEV_EVT_SOFT_THRESHOLD_REACHED_REPORTEDbi_io_vecbase_pfnhba_countget_inode_acl_addr_pkeymigrate_foliocustom_sliceaer_capoffset_highrdrv_statethread_keyringhosttkparam_arrayutimeDID_ABORTwait_for_completionsecurity_supportedstart_codelowmem_page_addressis_managedis_hardiorequest_cntfsbasecompatibleblk_status_tSHOST_CANCEL_RECOVERYclock_listattrsdynidseh_deadlinecpumask_tswregs_statedqb_isoftlimitldrv_op_counterdma_iommublk_mode_tload_sp0orig_ax__UNIQUE_ID_max_sectors_per_iotype598bd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkuioc_mimdDEVICE_REMOVABLEsoft_resetnr_cached_objectsia_mtimemega_allocate_scbtrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainbios_param_sigchldpending_listpi_offsetdiscard_granularityfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetmax_lunnext_cpucopy_overflowsoftirq_pendingbsg_devicetime64_tpthru_dma_addrmegaraid_initi_blocksnuma_faults_localityhas_child_subreaperrom_bar_overlappref_64_window__compiletime_assert_219i_acl___GFP_ZERO_BIToffset_middlewrite_newlazy_modepm_domaininstrument_atomic_read_writecpu_bitmapipi_liststatic_call_keyutil_estucountsBLK_UID_EUI64qc_stateset_rq_budget_tokenhandledsoftirq_next_timerkobject_namemax_active_zoneszone_wplugs_poolcheck_flagshandler__esiswp_entry_tbi_inline_vecs_mapcountdomain_tagpasid_requiredarch_atomic_sethang_detecteduuidchild_ns_typeqf_fmt_idnchannelss_vfs_rename_keyeventwrite_config_countersg_prot_tablesizeDID_PARITYset_performance_statephys_addr_tSHOST_CREATEDclass_preempt_is_conditionalcfg_sizeconsumers_cntmodule_memorypi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stamppdrv_formatcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delaydma_cleanupmaple_treeKMALLOC_DMAdentrylast_mergecpu_itimerpercpuget_unique_idlast_queue_full_countrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupsaved_end_ionr_threads__i_nlinkraw_atomic_submax_channelsload_tr_descpushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotma_flagsUSRQUOTAdelayed_workmq_listmanage_system_start_stophiwater_rsskretprobe_instancesshosthba_soft_staterangecpu_addrmega_cmd_done__ptrfutex_exit_mutexdq_hashpm_onlykernfs_iattrstag_alloc_policy___GFP_WRITE_BIT__sectord_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrxferaddrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsinb_pnvcswrsvd3rq_flagsKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERconst_pcpu_hotis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingmegadev_mutexquota_typestate_savedread_pmcirq_reroute_variantwrite_cr0self_exec_idwrite_cr2write_cr3write_cr4spin_lock_irqkernfs_opsfile_lock__register_chrdevMODULE_STATE_LIVEclearedclass_maskstopnr_migrationsa_opsreq_listxa_flagssingle_lunfreezebin_sizemap_busclosedisk_array_40lddev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITdata_sizemega_rundoneqnr_sectorsDID_PASSTHROUGHd_spc_timerjump_entriesasync_suspendmsi_device_dataalignpv_ops___GFP_COMP_BITBLK_EH_DONEset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapmax_commandsdq_dqblast_resetuidhash_nodesaved_tfblk_mq_queue_mapElf64_Xwordold_timespec32device_configurelock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkis_virtfnpercpu_refproc_show_pdrvmega_ldrv_infoproc_create_single_datahorizontal_positionmega_m_to_nioerr_cntpgd_valpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntactionthawD_REAL_METADATAget_nextdqblk__UNIQUE_ID_max_sectors_per_io599s_fs_infocrypto_profilefutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicfree_pcidquot_operationsmappingRPM_INVALIDgrploseq_writesupport_ext_cdbclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_filemax_device_blockeds_stateuser_sizetabledev_pm_opscdrom_device_infoleavescheduledFAULT_FLAG_TRIEDraw_atomic_readclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkkmalloc_typesriov_get_vf_total_msixn_io_portdispatch_wait_lockqstrnr_ia_rangesmax_user_discard_sectorsno_msi___GFP_ZEROTAGS_BITorig_pmdqueue_lockbug_blocked_mailboxshpc_managedacct_timexpdSHOST_DEL_RECOVERY__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fraginit_completionsrcu_gp_mutexmegaraid_pci_tbldatalennr_wakeups_affine_attemptsalt_lenSAM_STAT_TASK_ABORTEDcinblockextableexitrpm_autosuspend_delaydisk_arraykernel_param_opsbus_dma_regiondpc_capio_uring_cmddirtied_whenpdt_1f_for_no_lun__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headlist_is_headldrv_opcmdrcharfutex_pi_statekstat__kernel_uid32_tdispatchq_lock_cls_keyaccess_statesubsystem_deviceDEVICE_FIXEDpte_tdevice_driver__inbdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockwake_batchget_namefwnode_endpointpcivendoropt_sectorsepoll_watchesfcloop_state_counternstatusprealloc_pteprot_typeborkenSDEV_CANCELdqb_curspace_entrygp_statebitsetload_avgsched_dataaccesscstimepcie_capcompletion_cntcpuidcfs_rqmcontrollerrq_end_io_fn_uidprot_opst_spacesync_negmm_cid_next_scanns_typescan_startpciidmsix_enabledac_majfltpasid_enabledposix_cputimers_work_upperproc_mkdir_datamodule_param_attrsshort unsigned intbus_flagssame_target_siblingsi_mutex_dir_keymq_pollq_nodespc_warnlimit__compiletime_assert_217__tmpout_free_cmd_buffersubsysvids_encodinggpl_crcsorc_entrykeysinvalidate_io_bitmapdma_handleorig_ptepasid_capdqb_curinodesload__s8pci_get_drvdatainvalidate_lock_keydma_maskprealloc_mutexnanosleep__already_doneSTARGET_REMOVEeh_host_reset_handlersrcu_gp_seq_neededsbq_wait_statepscr_ret__dq_dqb_lock__kernel_ulong_tlogdrv_infovolnameio_minSAM_STAT_ACA_ACTIVEdl_period__param_str_max_sectors_per_iosym___kernel_vsyscallptep_modify_prot_starti_fsnotify_markswakeup_pathHCTX_MAX_TYPESdio_mem_alignbtime__u8is_roxlockm_inrlim_maxslave_dirDEVICE_PANEL_FRONTrestartscdblensupport_random_delruntime_deferred_listd_waitlocal_fwnodequeue_flagslist_lru_onedevice_physical_location_horizontal_positionruntime_autoseq_stoppci_dev_flags_ttarg_xferage_of_flash_copy_to_userkiocbNEEDS_RETRYbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidflagaer_statslogdrvs_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalqueue_rqsshrinker_idbio_setpte_valrootoom_reaper_listscsi_device_handlershutdown_presym_VDSO32_NOTE_MASKscsi_devicewdtrbpf_storagepci_enable_device__data_lenmq_mapno_callbacks__u16timers_activewait_countldrv_statealloc_hintsig_okalloc_p4d__SCT__cond_reschedrow_sizedelaysqf_ownerreadaheadkmalloc_cache_typestart_stop_pwr_condmutexpgd_tnr_cpus_allowedeh_abort_handlerdiscard_alignmentraw_spinlock_tkey_tagINIT_LIST_HEADgetgeofs_flagswordworkpgprotval_tkeytypefortify_memset_chksigpendingmq_freeze_depthfsindexshstkslave_configurereserved_tagssrcu_sspSDEV_CREATEDwake_irqmega_init_scb__page_1__page_2accounting_timestamp__sighandler_ts_bdevpending_events__u32ptracedtrc_reader_specialdevice_get_match_datapci_disable_deviceHPROBE_GONEmegaraid_to_scsi_cmd__UNIQUE_ID___addressable_cleanup_module604active_timequeueactioni_sequencepool_dataout_free_scb_listpci_vpdpci_read_config_worddisk_statsdqb_ihardlimitd_lockrefpfo_val__rpm_requestnum_bpf_raw_eventsaddrdevice_privatecompat_robust_list_head_perfsubsystem_vendori_dir_seqirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmauclamp_reqproc_show_pdrv_ch0change_cookieproc_show_pdrv_ch1dl_defer_armedwrite_infoshow_statsblock_devicekobj_ns_typedpc_rp_log_sizeimm_readyepthruBLK_INTEGRITY_CSUM_CRC64f_iocb_flagsiodone_cntpoweroffcmaj_fltvtimemath_emu_infoiowait_sumout_free_mboxf_path__u64journal_infooverride_onlyFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_truedisk_events_disable_depthweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufmegaraid_isr_memmappedmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacitydma_addressvm_startSAM_STAT_CONDITION_METtag_list_lockunused_hctx_lists_flagsget_rq_budget_tokencpumask_var_tfaultis_bios_enabledmigration_pendingalternative_gpt_sectornotify_page_enc_status_changeddl_densityfreeptr_tset_dbd_for_msread_dqblkintegritydq_flagsread_before_msnext_cpu_batchDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusepci_devp_sizememcg_datatracepoint_extldrvkprobes_text_startrunnable_avgdma_boundarys_time_grankernel_cap_tSUBMITTED_BY_SCSI_RESET_IOCTLnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiglobal_counterposix_cputimer_base___GFP_NOMEMALLOC_BITSDEV_EVT_MEDIA_CHANGEnum_kpin_execvehost_tagsettlb_flush_pendingpage_offset_baseRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversiontrace_levelboard_typeserialclass_releasealloc_lockno_report_lunss_dquotmax_hw_sectorsfolioqtagsprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblemmu_gatherpgoffADD_TO_MLQUEUEsyscall_user_dispatchrcu_tasks_exit_listmmio_basearchdataia_uid__list_del_entry_valid_or_reportio_delaychildrenwrite_gdt_entryrb_subtree_lastno_pm_callbackspmd_valbuild_idrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_padldrv_sizeremove_proc_subtreetailia_atimelasttlb_ubcbi_issuervalquota_format_typemsi_enabledseekstask_structbudget_tokenDID_ERRORrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memhost_self_blockedarch_spinlock_tsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometrymanufacturerdevcapsuppress_bind_attrsRPM_RESUMINGreg_offsetgsbaseSDEV_EVT_ALUA_STATE_CHANGE_REPORTEDdispatch_waits_quota_typesinternal_tag__preempt_count_addtarg_xfer_valf_llistmq_freeze_locktbasemega_inquiry3i_nlinksdev_devbranchwrite_begingroups__const_udelayxferlenerr_handlerno_vf_scanpi_blocked_onrebuild_rates_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscr__ret_gupkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_serverSCSI_EH_RESET_TIMERtrc_reader_nestingin_userestart_blockumode_t_dev_critshareFORTIFY_FUNC_strscpypagefault_disabledboot_pdrvsyscwil_prevget_name_prefixwlockedfreeze_superdma_types_inode_list_lockelevator_queueruntime_idlesweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgscsi_scan_hostntabdevice_typemaj_fltarch_rwlock_tctx_mapfw_versionSHOST_DELclock_basescsi_partsizecdevmy_qgroup_leadermkdirdma_free_coherentp4dval_tnextentsdma_directionreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_dataissue_scb_blockrelease_p4dblk_mq_req_flags_tmmap_locksysfs_lockrq_qosfsavekeyring_index_keySAM_STAT_GOODqrwlockoverflowFAST_IO_FAILSDEV_EVT_CAPACITY_CHANGE_REPORTEDfile_ra_stateuser_structon_rq__p_size_fieldfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDsgl_dma_addrprojiddrop_inodenum_trace_evalsnum_vffree_irqcylindersunsafe_warnllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblkpv_cpu_opsi_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeinit_namedram_sizeload_idtunfreeze_fsintervalclasslast_mm_ciduntrustedcpu_relaxmax_open_zonescookiebd_stampSTARGET_DELtargetstarved_entrya_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structsense_lencred_guard_mutexbusymajorpci_opssigcntcheck_object_sizehrtimer_cpu_baseresourcesseq_printfcb_headcheck_quota_fileFORTIFY_FUNC_memchrattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cachesense_alertclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsend_context_switchmegaraid_biosparamlist_lruusing_gplonly_symbolstarget_knsival_ptrtry_vpd_pages__ret_pui_opflagspcibusrobust_listsym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descs_incoredqsd_iputcompat_ioctlalloc_ldtlockdep_mapfiltercurr_ret_stackirqreturn_tlast_queue_full_depthdockdev_links_infoloff_tthread_pidout_host_putinquiry_mutexsrcu_gp_seqia_rangesno_command_memory_archst_valueclass_write_lock_irq_is_conditionalmega_baseportKOBJ_NS_TYPESpprevtrc_blkd_nodecallsmega_do_del_logdrveh_actioni_default_acleh_target_reset_handlers_uuid_lenioc_nodeof_node_reusedproc_show_mboxinsnlenbuf_dma_handleclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchldrv_opstatusasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_masknr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorspci_error_handlersWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__filler__list_addsaved_sigmaskd_timeentriesenter_mmapcpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namestarget_busys_mtdkparam_stringpowerma_lockcleanup_rqhas_clusterevent_flagssched_delayedbd_statsbi_sizesupported_modescsi_device_eventmega_free_sglmodule_state_dev_info__write_overflow_fieldmq_kobjlast_used_at__mutex_initxfer_segment_hihardirq_stack_ptrvm_endlast_queuednuma_migrate_retryuser_ns__stateread_msrfirstiommu_groupdispatch_fromdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctimeFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexi_private_dataflush_tlb_userElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupxol_areaparam_idtransporttrlockpcpu_hotrep_nopfl_owner_tadp_span_40ld_rescls_mskia_rangeeuidwaitbug_tabledirtied_time_whendma_drain_lensequential_io_avgdata_dma_hndlDID_BUS_BUSYnum_trace_bprintk_fmtqueue_ramp_up_periodload_tlsvm_policyraw_atomic_incperf_rdpmc_allowedrdevprivate_dataset_debugregDEVICE_PANEL_TOPsignumfscrypt_keyringxfer_segment_los_mountsuse_memdelayRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpout_unlockdev_set_drvdatabvec_iterctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenpme_supportdqb_btime_nr_pages_mappedutf8datascsi_host_putmm_usersbd_holder_lockmega_setup_mailboxs_ids_dentry_lrubp_offsetSHOST_RUNNINGblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimescb_tsymlinkoom_flag_origingeometry__uaDMA_NONEcounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqmega_create_proc_entrytrace_eval_mappdrv_statespan_depthdonekmsan_copy_to_userfscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliodebugfs_dirdriver_managed_dmaqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquota__UNIQUE_ID_max_mbox_busy_waittype600dl_timeri_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDretvalsysv_semanon_vma_namefileattrmega_busywait_mboxlong long unsigned intanon_nameopen_partitionsend_io_datablkcg_gqmap_queuesia_filesival_intnuma_preferred_niddma_need_draininstrument_atomic_write_hugetlb_cgroupdentry_operationschannelmemcg_nr_pages_over_highsignatured1_supportqueue_offsetarch_uprobeSAM_STAT_TASK_SET_FULL_Boolsleep_start__p_sizeioremapmin_fltwrite_config_rsvdHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatereverse_orderingi_linklistxattrmraid_inquiry_lowertrap_nrext_inqmax_queue_depthasync_probe_requested__list_add_valid_or_reportcompat_long_td3cold_allowedactive_countphys_bases_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagstotal_numa_faultssubopcodes_countdev_msi_infod_revalidatebus_groupswakeup_cntpmd_ts_opsysv_shminstrument_atomic_readdma_channellast_sector_bugdq_countutf8data_tableset_latency_tolerancedev_get_drvdata__func__resource_size_tnr_tagsfoliowake_entrysubsysidxa_headmegaraid_shutdownsuidscsi_sglisti_readcountmanage_runtime_start_stopmagic64blk_integritylocked_vmrb_leftseq_nextguess_capacitysym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_tmega_8_to_40ld__UNIQUE_ID_max_cmd_per_lun597class_rcu_is_conditionalbpf_local_storageupdate_io_bitmapclockid_tquota_syncdq_free__bd_flagsparent_exec_idignore_media_changeretrieskernfs_elem_dirsrcu_lock_countksm_merging_pagesfree_listautosleep_enabledptrace_entryblkg_listhost_scribblerecent_used_cpunum_jump_entriess_qcopatomic_tbv_pagealloc_tag_countershas_64bit_addr_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitbuffershort intmynodepart_tblpci_alloc_devvcpu_is_preemptedblk_mq_opsscatterlistbridge_ctltarg_xfer_counterclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablearch_atomic_incf_ownerreset_methodsbp_reggate_descVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invpad_untilDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerextra_lenprio_listatomic_write_hw_unit_max_flags_1_flags_2eh_device_reset_handlersbitmaplast_arrivalint_mtxprod_info_dma_handlesupported_speedsem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_databyteeh_eflagspoll_table_structwrite_msr_safedirect_IOSTARGET_CREATEDfree_pdevwait_queue_entry_televatormake_p4dcurrent_may_mountseqlock_tskip_ms_page_8bd_queuenuma_scan_offsetpcifun___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskvpd_pg80vpd_pg83vpd_pg89__ret_warn_onregfuncindex_key__keymemalloc_noioGRPQUOTApci_dynidsi_private_listarch_atomic_subia_validvertical_positionSUCCESSFORTIFY_FUNC_strncati_rcumegaraid_probe_onei_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BIT__read_overflowseq_putcpcie_bwctrl_dataactiveselect_no_atndqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsmbox_dmaDID_NO_CONNECTFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listno_read_capacity_16tagged_supportedreap_refDID_TIME_OUTxarray_start__flagsp_size_fieldfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atscsi_host_templatelast_sum_exec_runtimeiov_iteria_gidSDEV_OFFLINEattribute_groupprv_bios_dataMQ_RQ_COMPLETEcontextposix_timersdriver_exclusive_resourceselectorblkcg_polsMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasebi_nextdataxferlendefault_timer_slack_nskcsan_check_accessoffline_alreadysource_listepthru_dma_addrRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BIT__copy_overflowgroup_infovdso_imagembox64_tblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_size__eaxopcodepcie_cap_locksg_pagemce_kill_me__request_regionphysical_block_sizeuuid_teh_noresumeproperty_read_int_arraymega_get_ldrv_numSCSI_EH_DONE___GFP_UNUSED_BITatomic_write_hw_unit_minpv_lock_opscount_objectsnlog_driveserrorq_size_stimezone_device_dataSDEV_EVT_INQUIRY_CHANGE_REPORTEDnr_active_requests_shared_tagsint_waitqf_wb_errqueuelistphysfndefparamresid_lenfred_csq_lockdep_mapinquiry_lenfault_flagbattery_statuskprojid_tptracer_credtlb_genpv_mmu_opsstoreio_lock_cls_keySDEV_TRANSPORT_OFFLINEpage_mkwritekobjectaudit_ttydev_driver_stringirq_flagscmdidmce_ripvstatfsmegadev_fopstag_setats_enablednumab_stateremovablecan_queuenum_blksfeatureson_list__megaraid_shutdownkgid_ton_cpuFAULT_FLAG_VMA_LOCKdebug_dma_map_singlemega_prepare_extpassthrufregs_statedrop_nsalloc_pmdnum_ei_funcsrestore_sigmasksrcu_cblisteetlp_prefix_pathclass_groupsnuma_node__UNIQUE_ID_max_mbox_busy_wait601sgcntoffsetsi_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNstripe_szwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedcmndsysfs_registereddebugfs_mutexwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opserror_detectedsequential_iois_busmasterSHOST_CANCEL__compiletime_assert_100_large_mapcount__compiletime_assert_102__compiletime_assert_103sda_is_static__compiletime_assert_105__compiletime_assert_106__compiletime_assert_107__compiletime_assert_108__compiletime_assert_109formatftopenclaveshost_gendevnitioctl_tSDEV_CREATED_BLOCKbi_privateexit_hctxsp_regcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_list__compiletime_assert_110__compiletime_assert_111get_reserved_spacenon_seqstack_refcountinvalidate_lockbmap_raw_spin_unlock_irqkey_payloadtimer_rand_stated_reallink_stateexpiry_active__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126dqi_max_spc_limit__compiletime_assert_128__compiletime_assert_129mega_enum_raid_scsiIRQ_NONEexception_table_entryvirt_boundary_maskevent_countpreempt_countscmdfallocatembox_outi_spc_warnlimitbuddy_listcdl_enablei_ino_timelimitSDEV_RUNNINGrsvd4__compiletime_assert_130__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135pagefault_disabled_decmems_allowed__compiletime_assert_138__compiletime_assert_139__preempt_count_dec_and_testtlb_flush_batchedout_free_irq_ddebug_infoslave_allocdisk_array_dma_handleis_noirq_suspendedtracepoints_ptrsleaderload_gs_indextimewakee_flip_decay_tss_max_linksnr_wakeups_sync__compiletime_assert_140__compiletime_assert_141leftmega_sgl64kallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tatomic_incblocks__might_reschedenterflush_tlb_multi__raw_mboxvectorFORTIFY_FUNC_strncpyalloc_pte__devices__bi_cnttimer_listheadsdevice_dma_supportedd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_tdma_unmap_single_attrsorig_ret_vaddrpoweroff_noirqalloc_pudrenamevm_area_structrpm_statussb_writers__compiletime_assert_82__compiletime_assert_83ino_timelimit__compiletime_assert_85__compiletime_assert_86pci_bus_flags_tsplice_write__compiletime_assert_89msix_capi_rt_spc_timelimit_raw_spin_lock_irqsaverecon_staterom_base_regcss_setqf_nextcdl_supportedio_window_1kranges__compiletime_assert_90__compiletime_assert_91__compiletime_assert_92__compiletime_assert_93__compiletime_assert_94__compiletime_assert_95__compiletime_assert_96iommu_mmirq_enableats_stublk_features_tcutimeem_tableprot_flagspersonalityget_statepci_unregister_drivertask_sizes_inodes_addrbinfmtirq_domainnr_queuessigned charprioprivgetattrsched_infopdrv_state_counterd_fieldmaskqueued_spin_unlockquiesced_byuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signodma_map_page_attrsenabledi_rdevfixupsspin_unlock_irqfile_operationsqueue_rqKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsqueuetagmax_allowed_capacityi387d_ino_timerSAM_STAT_RESERVATION_CONFLICTavx512_timestampfuncsend_datadataxferaddrreadlsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssynckmap_atomicsetleasepinsmegaraid_queuemega_query_adapterpacct_structmust_resumezone_wplugs_hashoutlenlong intfile_lock_contextusagestack_attnmboxsiglockproc_show_statstatuserror_injection_entrycurrent_taskreal_addressac_stimesync_iofred_ss__ptr_puproperty_presentexpecting_cc_ua__kmalloc_index__write_overflownr_iosprintk_index_sizesymtabfree_disksg_tablert_mutex_waiterremount_fss_typeruntime_statusin_iowaitlun_in_cdbunregfuncegidkmsan_unpoison_memoryfreemem_and_returniomapiomem_resourceput_supersg_virtfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_doneis_thunderboltsuper_blockmark_dirtyeh_cmd_qnum_srcu_structsbdi_writebackkobj_completionpci_read_config_dwordSOFT_ERROR__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEfcloop_id0fcloop_id1VTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablesc_data_directionmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idproc_mkdirmax_cmd_per_lunmultifunctiondepthsnprintfwait_queue_func_tcnvcswnuma_next_scanrelease_pmdMIGRATE_SYNC_LIGHTnr_migrations_coldsysdatadma_addr_tshiftcheck_eventsssize_tiopl_emulmax_write_zeroes_sectorswork_structdesc_lenmega_free_inquiryflocktrack_queue_depthrsvdtask_io_accountingmremaphprobe__fortify_panictracepoint_funcmodem_statusargv__val_guentryfree_cached_objectsworkqueue_structprocdirmax_target_blockedmax_sectors_per_io__list_del_entrypr_opspi_lockcapable___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqmbox64event_listclass_spinlock_irq_try_is_conditionaloom_mmehandlerFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lrusrcuFORTIFY_FUNC_strcpyqueue_depthunderflowdirect_iogfp_maskpi_state_listrcu_segcblistout_disable_devicesubvolsubmitterusecspin_unlock_irqrestorefree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infomq_rq_statesrcu_structrlim_curnofaultdma_map_single_attrsmm_countdrv_groupsstack__unregister_chrdevscsi_data_bufferfunctionki_flagsbvec_poolbd_start_sect___GFP_IO_BITsrcu_have_cbs__uaddrd_in_lookup_hasheh_timeoutmax_sectorssgidboot_drvinitial_nsFREEZE_MAY_NESTscsi_transport_templatesdev_bflagsbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkmq_ctxHPROBE_CONSUMEDbpf_net_contextmegaraid_templateopc1release_pte__int128 unsignedpcountwake_indexfc_loop_presentrestore_noirqdma_pad_maskki_filpbitmap_tagsshm_clistcap_ambientdma_configureruntime_erroractive_modesg_nextatomic64_tanon_vmaHCTX_TYPE_DEFAULTrelease_pudPROBE_DEFAULT_STRATEGYDID_TRANSPORT_FAILFASTrlimread_folioout_iounmapnr_events__vpp_verifyiommubi_opfstore_trprivatezerost_infomap_countpdeath_signal__UNIQUE_ID_author592exit_signalsa_restorerbpf_run_ctxscsi_vpdtph_enabledsplice_pipehostdatashort_inquiryblk_mq_tag_setpasid_no_tlpspinlock_checkblk_independent_access_rangess_lock_key__pci_register_driversrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqadapter_infores_attrDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmods__val_puslotsSUBMITTED_BY_BLOCK_LAYERtqheadeh_bus_reset_handlers_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalproc_show_batteryremap_file_rangemin_shallow_depthnr_hangssym_vvar_startgid_twake_cpuchainedio_uring_taskabort_workseq_putstask_worksmemory_failurerb_root_cachedpagefault_enables_copdd_key_truekmalloc_array_noprofhres_activeproduct_namebpf_raw_eventsdma_alloc_attrsdq_dirtydl_deferround_robinbug_listunique_iddirect_completeldrv_state_idblk_mq_tagswbt_flagsxa_locklist_addfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countlockabletop_of_stackkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemadd_busshost_statelogdrv_parambd_nr_sectorsFAILEDtag_depthignore_childrenresourcerestore_earlystart_blkpdrv_state_idclock_mutexfs_supersqueue_stoppedvpd_pgb0vpd_pgb1vpd_pgb2vpd_pgb7notifydqb_bsoftlimitpendingmax_dev_sectorsno_vpd_sizef_task_work___GFP_NORETRY_BITiowait_countread_cr0read_cr2read_cr3prot_sdbset_read_onlymegadev_openthrotl_datadma_io_tlb_memstringread_countislogicalfix_capacityfutex_offsetlong long intmmio_always_onbdevatomic_flagssysvshmtimer_expiresout_release_regiontrace_evalsactive_basesmega_get_max_sglearly_initrcec_eacmd_sizemprotectsecurityxmm_spaceactivatefcloopid_pdrvidscsi_targetmsix_basef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structbroken_fuaQUEUED___GFP_FS_BITi_bytesdomain_datarelax_countdma_devtagset_freedlinelinkstart_timekernfs_nodedev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchreschedule_countvfsmountextable_basenoinstr_text_sizeattributesset_child_tid_overruntmpfilercu_read_lock_nestingtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugrefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tUTF8_NMAXfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqia_vfsgidsize_tcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workatomic_long_tpreallocclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicdelayed_callmax_nr_cid_statusd_sibbin_attributepercpu_counternuma_pages_migratedgsindexexpires_nexti_io_listf_epsrcu_barrier_seqreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tHRTIMER_BASE_BOOTTIMEclass_srcu_is_conditionalnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionHRTIMER_BASE_REALTIME_SOFTstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registers_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrstate_in_sysfstty_structUTASK_SSTEP_TRAPPEDbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollnr_wakeups_idleio_cqelf64_symlatch_tree_nodedestroy_work__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerma_external_lockuid_tflush_requiredsum_block_runtimepgmapdq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditional_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitnuma_groupdescriptionclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinei_inodyndbg_infoindexthread_headmap_typef_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_len__UNIQUE_ID_alias473__UNIQUE_ID_alias474__UNIQUE_ID_alias475HRTIMER_RESTARTMOD_MEM_NUM_TYPESsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxcpu_basedquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_events_sys_privateUTF8_NFDIinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifields__UNIQUE_ID_srcversion476rcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authHRTIMER_BASE_TAIvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherscompletionsw_reservedUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treequota_onvm_operations_structbin_attrs_newiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdatanrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupwake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlinedup_xol_worktotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramd_spc_softlimitreported_split_lockgfp_tseccomp_filterstimei_mmapthaw_superd_lrusignal_structperf_event_mutexcrcspgdval_tSB_FREEZE_WRITEsetattrf_mappingnoinstr_text_startbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activei_opldt_usr_semkobj_ns_type_operationsDQST_FREE_DQUOTSseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tis_dirty_writebacktrace_bprintk_fmt_startkstatfssitesptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutex_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupseqcount_spinlock_ti_wbclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedpagetrc_holdout_listget_inode_usagenormal_priodestroy_inoderelease_folioi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inameHRTIMER_BASE_MONOTONIC_SOFTi_mappinginblockrmidrseq_siglimit0limit1dqi_max_ino_limitmigrate_modeftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksd_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrDQST_SYNCSstack_vm_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalcg_listsrcu_barrier_completionrw_semaphoremnt_sb_ddebuginfofiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypeinit_modulemembarrier_statepage_poolinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_mempathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwrcu_syncvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstateueventlock_countrefcount_tplugsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttableslist_headtgidwrite_protect_seqcompat_robust_list_head_tids_inode_wblist_lockend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextgpl_symsseq_showswait_queue_headblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfds_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceobjcgnodeDQST_READSvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvstatic_prioshrinkerdl_yieldeddqi_formatexec_update_lockDQF_PRIVATEDQF_SYS_FILE_Bl1d_flush_killi_versionprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symboltv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskSB_FREEZE_PAGEFAULTactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlock__rcu_headmce_vaddrquota_offdq_inusedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmod_tree_nodef_sb_errwritepagecodegtimesigactionclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listktypelockrefsrcu_struct_ptrsmm_structvlagi_uidspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesvm_mmmod_mem_typedebugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipMOD_INIT_RODATAqc_dqblkmmappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCi_write_hintfxsaveprocess_keyringlist_op_pendingllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyioveci_private_lockVTIME_IDLEstatic_keys_magicdl_overrunDQST_ALLOC_DQUOTSd_parentpayloadac_minflti_sbd_sbcommPIDTYPE_PIDatomic_write_segments_maxatomic_openreadahead_control__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupblockedi_securitystats_lockD_REAL_DATApt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colorbitsiopriocap_inheritablegp_waitlookupDD_CLASS_TYPE_LEVEL_NAMESvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vec__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATElf64_Symd_automountparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcestack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkDQST_CACHE_HITScmaxrsstimer_slack_nspolicysharedd_real_typelookahead_bandseq_startraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamerun_delaytailslinenoget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseattrscpumask_tswregs_statedqb_isoftlimitorig_axsched_rt_entitytimerqueue_nodeil_weightmem_dqblknr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pause_sigchldreservedlatency_record_countcgroupsprev_scan_seq_DQST_DQSTAT_LASTrcu_usersoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockUTF8_NFDICFcpu_bitmapstatic_call_keyutil_estucountsMOD_RODATAqc_statesoftirq_next_timercheck_flagsswp_entry_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aMOD_INVALIDmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalautogroupnr_threads__i_nlinkpushdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magicfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsMOD_INIT_DATAnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_infoshared_pendingi_gidmin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idHRTIMER_MAX_CLOCK_BASESkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsxa_flagsbin_sizegrphid_spc_timerjump_entriesassoc_array_ptrsuper_block_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_array__UNIQUE_ID_depends472mnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpref_node_fork__int128dqi_privrss_statmems_allowed_seqrefcntD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxresult_maskdquot_operationsmappinggrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizescheduledclass_raw_spinlock_nested_is_conditionalworker_privateis_relqstrma_flagsfutex_stateHRTIMER_BASE_TAI_SOFTacct_timexpd__rcu_icq_cacheDQST_WRITESsizef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tdl_server_has_tasks_frunnable_sumreal_credepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgcstimecfs_rq_uidst_spacemm_cid_next_scanac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysMOD_TEXTdqb_curinodesload__s8invalidate_lock_keyprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_marksdio_mem_alignbtime__u8is_roxlockrlim_maxruntime_deferred_listd_waitlist_lru_oneseq_stopkiocbclass_rwsem_read_intr_is_conditionalfsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeshrinker_idrootoom_reaper_listsym_VDSO32_NOTE_MASKbpf_storage__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingfsindexshstksrcu_ssp__page_1__page_2__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEi_sequencedqb_ihardlimitd_lockrefnum_bpf_raw_eventsaddr_perfi_dir_seqkqidKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typef_iocb_flagscmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagshrtimer_base_typestart_boottimevm_starts_flagsiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listhrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendings_listdqb_rsvspaceversionserialalloc_locks_dquotfolioqprev_posseqcount_spinlocks_umountis_bin_visiblesyscall_user_dispatchrcu_tasks_exit_listia_uidchildrenrb_subtree_lastbuild_idvfork_donenanosleeprt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelayquotalenf_pipei_wb_frn_historylast_wakeenextarch_spinlock_ti_mtime_nsecmmlistutf8_normalizationset_dqblkreg_offsetgsbases_quota_typesf_llisti_nlinkwrite_beginpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedHRTIMER_BASE_BOOTTIME_SOFTfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tquota_enablesched_avgntabmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextprealloc_bufprojiddrop_inodenum_trace_evalsllseeknext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeunfreeze_fsintervallast_mm_cidcookietargeta_flagstrace_overrunsession_keyringfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributerestrict_linkMOD_DATAi_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackloff_tthread_pidsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringma_locksched_delayedmodule_statelast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimemigrate_from_cpusrcu_barrier_mutexi_private_dataElf64_Halfnsproxyxol_areacleanup_modulerlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_datasignumfscrypt_keyrings_mountsuse_memdelay__state_sizethread_structcached_requested_keyenvpctimereleasesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_datasysv_semanon_vma_namefileattrDQST_DROPSlong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionali_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_ts_iflagsmce_kflagstotal_numa_faultss_countd_revalidates_opsysv_shmdq_countutf8data_tablefoliowake_entryxa_headsuidi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_lockiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_t_flagsnotify_nextshort intmynodeclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_ownerbp_regVTIME_USERsa_flagstesti_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivaltrace_event_callis_guestpoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keyGRPQUOTAi_private_listia_validi_rcuHRTIMER_BASE_REALTIMEi_atime_secqc_type_statekey_serial_tsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsi_wb_listxarray_startfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectordefault_timer_slack_nssource_listswap_readahead_info__fpstateactive_refgroup_infovdso_imagefile__user_state_sizemce_kill_meuuid_tcount_objects_stimezone_device_dataf_wb_errdefparamfred_cskprojid_tptracer_credtlb_genstorekobjectaudit_ttymce_ripvstatfsnumab_statefeatureson_listkgid_ton_cpufregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisti_mmap_rwsemwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadd_realexpiry_activedqi_max_spc_limitexception_table_entryfallocateHRTIMER_BASE_MONOTONICi_spc_warnlimitbuddy_listi_ino_timelimitSB_FREEZE_FSi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infotracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevfs_structclockiduint32_targ_startblocksset_infofileattr_getvectortimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrrenamevm_area_structsb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextiommu_mmcutimepersonalityget_statetask_sizes_inodes_addrbinfmtsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filercu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataki_posexecute_only_pkeysetleasepacct_structlong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typein_iowaitunregfuncegiddq_hashput_superMOD_INIT_TEXTpushable_dl_tasksf_flagsf_inodemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infoTT_NONEVTIME_INACTIVEcancelled_write_bytessrcu_usagebitmapmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_cold__UNIQUE_ID_name470ssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenDQST_LOOKUPSclass_spinlock_irq_try_is_conditionaloom_mmsrcu_reader_flavortv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idsrcu_structrlim_curnofaultmm_countSB_FREEZE_COMPLETEstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infodatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountki_filpcap_ambientatomic64_tanon_vmarlimread_folionr_eventsprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keysrcu_gp_startopenit_real_incrmodert_prioritymm_lock_seq__UNIQUE_ID_intree471KMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksrb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionexit_statesysvsemMOD_RO_AFTER_INITDQF_ROOT_SQUASH_Bfs_supersSB_UNFROZENdqb_bsoftlimitpendingf_task_workiowait_countstringread_countfutex_offsetlong long intatomic_flagssysvshmtrace_evalsactive_basessecurityxmm_spacef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesclass_rwsem_read_intr_is_conditionalclass_mutex_is_conditionalclass_preempt_notrace_is_conditionalMOD_INIT_RODATAMOD_TEXTclass_srcu_is_conditional_nameclass_rcu_is_conditionalclass_migrate_is_conditionallong long unsigned intNR_KMALLOC_TYPESclass_rwsem_read_is_conditionallong long intsigned charPIDTYPE_SIDclass_preempt_is_conditionalElf32_Wordorc_headerPIDTYPE_TGIDlong intclass_raw_spinlock_irq_is_conditional_descclass_local_lock_nested_bh_is_conditionalHRTIMER_BASE_MONOTONIC_SOFT__UNIQUE_ID_retpoline471class_rwsem_read_try_is_conditionalUTF8_NFDIDQST_LOOKUPSclass_spinlock_irqsave_is_conditionalclass_spinlock_try_is_conditionalclass_local_lock_is_conditionalhrtimer_base_typeMOD_RO_AFTER_INITn_descsz__u8DQST_ALLOC_DQUOTSSB_FREEZE_FSKMALLOC_NORMALDQST_WRITESunsigned int__int128class_irqsave_is_conditionalHRTIMER_BASE_REALTIMElong unsigned int__u32HRTIMER_MAX_CLOCK_BASESclass_spinlock_irqsave_try_is_conditionalclass_spinlock_is_conditionalshort unsigned intHRTIMER_BASE_TAIclass_local_lock_irqsave_is_conditionalclass_read_lock_is_conditionalelf32_noteboolDQST_DROPSclass_local_lock_irq_is_conditionalMOD_RODATAKMALLOC_CGROUPclass_rwsem_write_is_conditionalclass_spinlock_irq_try_is_conditionalclass_spinlock_irq_is_conditionalclass_write_lock_is_conditionaln_typeMOD_DATAclass_write_lock_irqsave_is_conditionalHRTIMER_BASE_BOOTTIMEn_nameszSB_FREEZE_COMPLETESB_FREEZE_WRITEclass_raw_spinlock_nested_is_conditionalMOD_MEM_NUM_TYPESDQST_SYNCSDQST_FREE_DQUOTSmod_mem_typeHRTIMER_BASE_MONOTONICclass_mutex_intr_is_conditionalclass_task_lock_is_conditionalUTF8_NMAX_nhdrPIDTYPE_PGID_Boolunsigned charKMALLOC_RECLAIMHRTIMER_BASE_BOOTTIME_SOFTcurrent_stack_pointershort int_note_18_note_19utf8_normalizationKMALLOC_RANDOM_STARTDQST_CACHE_HITSclass_irq_is_conditionalDQF_PRIVATEPIDTYPE_PIDDQST_READSMOD_INIT_DATAclass_raw_spinlock_try_is_conditionalclass_raw_spinlock_irqsave_is_conditionalPIDTYPE_MAXcharGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackSB_FREEZE_PAGEFAULTUTF8_NFDICFclass_mutex_try_is_conditional_DQST_DQSTAT_LASTclass_write_lock_irq_is_conditionalKMALLOC_RANDOM_ENDMOD_INIT_TEXTclass_raw_spinlock_irqsave_try_is_conditionalpid_typeHRTIMER_BASE_REALTIME_SOFTKMALLOC_DMAclass_read_lock_irq_is_conditionalHRTIMER_BASE_TAI_SOFTSB_UNFROZENclass_raw_spinlock_is_conditionalkmalloc_cache_typeclass_read_lock_irqsave_is_conditionalclass_rwsem_write_try_is_conditionalDQF_SYS_FILE_Bclass_raw_spinlock_irq_try_is_conditionalDQF_ROOT_SQUASH_B__UNIQUE_ID_vermagic470__int128 unsignedMOD_INVALID/home/thomas/Documents/kernels/stagingdrivers/scsi/megaraid.c/home/thomas/Documents/kernels/stagingdrivers/scsi./arch/x86/include/asm./include/linux./include/scsi./include/linux/atomic./include/asm-generic./arch/x86/include/asm/shared./arch/x86/include/asm/vdso./include/uapi/asm-generic./include/uapi/linux./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/devicemegaraid.cparavirt.hmegaraid.cuaccess.hfortify-string.hlist.hdma-mapping.hscsi_cmnd.hseq_file.hatomic-instrumented.hatomic-arch-fallback.hatomic.hfs.hscatterlist.hmm.hio.hdelay.hio.hspinlock.hprocessor.hmegaraid.hpreempt.hhighmem-internal.hcurrent.hthread_info.hsched.hpci.hdevice.hslab.hinterrupt.hpage_64.hkobject.hcompletion.hscsi_host.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hmodule.hasm.hinit.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hbug.hstddef.hgfp_types.hstatic_call_types.hpreempt.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hparavirt_types.hprocessor.hcpumask_types.hatomic-long.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hwait.hosq_lock.hmutex_types.hmutex.hseqlock_types.hnodemask_types.htlbbatch.hmm_types_task.hrefcount_types.hkref.hrbtree_types.hrcupdate.hmaple_tree.hrwsem.hswait.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hpercpu-refcount.hshrinker.hdcache.hioport.hlist_bl.hlockref.hmount.hpath.hstat.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hblk_types.hkernfs.hkobject_ns.hdma-direction.hbvec.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hdevice.hfwnode.hmempool.hblkzoned.hsbitmap.hblk-mq.hdelay.hirqreturn.hscsi_proto.hscsi_status.hscsi.hscsi_device.hscsi_common.hproc_fs.hsprintf.hscsicam.hdev_printk.hstring.hspinlock_api_smp.hoverflow.hkernel.hinstrumented.hkmsan-checks.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/scsi/megaraid.mod.c/home/thomas/Documents/kernels/stagingdrivers/scsi./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/schedmegaraid.mod.cint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hirqflags.htypes.hshstk.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hquota.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hmegaraid.mod.c/home/thomas/Documents/kernels/stagingscripts/module-common.c/home/thomas/Documents/kernels/stagingscripts./include/uapi/asm-generic./include/linux./include/linux/sched./include/uapi/linux./arch/x86/include/asm./include/asm-genericmodule-common.cint-ll64.htypes.hirqflags.hpreempt.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hpid_types.hhrtimer_defs.hslab.hunicode.hquota.hquota.hfs.helf.hmodule.hasm.hmodule-common.cint-ll64.hGCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910x  TBF(<GFD D0m  AABE <GKD J  AABE ,xAF\ AE 4/BDD ]AB4ODD ABLKEA D(}  CBBE } CBB$c(TGBE B(A0D8G@ 8D0A(B BBBE ,JMA,UJMxA,JM AE $P7LGBB D(A0m (A BBBE <1GHA D( ABBdOHF E(A0C8D` 8A0A(B BBBE Y$`LGBB D(D0 (A BBBE \ZKBE B(G0A8F 8C0A(B BBBE $\ KBB B(D0A8D 8C0A(B BBBE $\bKEB H(A0A8G 8D0A(B BBBE $TGEB B(H0D8QHG8A0A(B BBB$I(m E L'KBB A(A0DHO 0C(A BBBE L:KBB A(A0DHO 0C(A BBBE \:GBB B(D0G8DU 8A0A(B BBBE 4vKFB A(A0DP<P 0D(A BBBE \GDG B(A0A8G 8C0A(B BBBE $[,>JKcA\GEB B(F0A8Jl 8A0A(B BBBE  ###LGBE A(D0 (A BBBE 4FAD0 AAE 0DQKBA A(D@ (A ABBE \(KBB B(A0A8G 8C0A(B BBBE <WH F{BS<mKJA A(L ABB    !"#$&()+-/124679:<>@BCDEF  6 (   x p/  c$ < Q Uf  )`)_ ).6 B)V`c6s  7}  + 1  i  Z| ` 111  b # $2 0%'J p':g (: . @. p. . .v `/6@6 '6@6[ 07>P) 4 7P @= h p=# =# =# 0> 0@^ A @AQ C(w W h166J m ,P,,,'04`,?L,W,b ,mPz,, ,`,,,0`,,,@,),4,?L,W@,bpo,z, ,`,,,@,,, ,@ , ,  , ,#@ ,.p ; ,F S ,^ k@ ,vp  ,  , ,P ` , ,+-"///) </I/V/ c/(p/0}/8/@/H/P/X/`/h/p/x///"/0/>/L/Z/h/v//////////// /(,/0:/8H/@V/Hd/Pr/X/`ee#(pc2#X((sqP(   6 -Q g m r y       `   p6 K `  w       P p  " $,  %D `'a (} . 0. `. . . P/  7. p7J 0=b `=z = =  >  @ A 0A C% pD pY m    # + G+ r+   *: S5k"t"}#4-6?Ph10T( 7(+ ?UfZq("1;CTft:BS`p ) &4;BJWcr%=Tcs|megaraid.cbuffer.92megaraid_biosparam.coldmega_proc_dir_entrymegaraid_pci_drivermegadev_fopsmajormega_cmd_done.coldmegaraid_isr_memmapped.cold__already_done.51__already_done.53__already_done.54megaraid_queue.coldmegaraid_isr_iomapped.coldmegaraid_reset.coldhba_countmcontrollerhba_soft_statemegadev_ioctl.isra.0.coldmegadev_mutex__megaraid_shutdown.coldmegaraid_probe_one.coldmegaraid_template__already_done.61__key.107__key.151__func__.161_entry.160__func__.159_entry.158__func__.157_entry.156__func__.155_entry.154__func__.153_entry.152__func__.150_entry.149_entry.148_entry.147__func__.146_entry.145_entry.144__func__.143_entry.142_entry.141_entry.140__func__.139_entry.138__func__.137_entry.136__func__.135_entry.134__func__.133_entry.132_entry.131_entry.130_entry.129__func__.128_entry.127_entry.126__func__.125_entry.124__func__.123_entry.122_entry.121_entry.120_entry.119__func__.118_entry.117_entry.116_entry.115_entry.114_entry.113_entry.112_entry.111_entry.110_entry.109_entry.108__func__.106_entry.105__func__.104_entry.103__func__.102_entry.101__func__.100_entry.99__func__.98_entry.97_entry.96__func__.95_entry.94_entry.93__UNIQUE_ID___addressable_cleanup_module604__UNIQUE_ID___addressable_init_module603_entry_ptr.0_entry_ptr.1_entry_ptr.2_entry_ptr.3_entry_ptr.4_entry_ptr.5_entry_ptr.6_entry_ptr.7_entry_ptr.8_entry_ptr.9_entry_ptr.10_entry_ptr.11_entry_ptr.12_entry_ptr.13_entry_ptr.15_entry_ptr.16_entry_ptr.17_entry_ptr.21_entry_ptr.22_entry_ptr.23_entry_ptr.24_entry_ptr.25_entry_ptr.26_entry_ptr.27_entry_ptr.28_entry_ptr.29_entry_ptr.30_entry_ptr.31_entry_ptr.33_entry_ptr.34_entry_ptr.35_entry_ptr.36_entry_ptr.37_entry_ptr.38_entry_ptr.41_entry_ptr.42_entry_ptr.43_entry_ptr.44_entry_ptr.47_entry_ptr.50_entry_ptr.52_entry_ptr.55_entry_ptr.56_entry_ptr.57_entry_ptr.60__UNIQUE_ID_max_mbox_busy_wait601__UNIQUE_ID_max_mbox_busy_waittype600__param_max_mbox_busy_wait__param_str_max_mbox_busy_wait__UNIQUE_ID_max_sectors_per_io599__UNIQUE_ID_max_sectors_per_iotype598__param_max_sectors_per_io__param_str_max_sectors_per_io__UNIQUE_ID_max_cmd_per_lun597__UNIQUE_ID_max_cmd_per_luntype596__param_max_cmd_per_lun__param_str_max_cmd_per_lun__UNIQUE_ID_version595__UNIQUE_ID_license594__UNIQUE_ID_description593__UNIQUE_ID_author592.LC86.LC4.LC100.LC137__pfx_slow_down_io__pfx_megadev_open__pfx_mega_n_to_m__pfx_mega_m_to_n__pfx_make_local_pdev__pfx___list_add__pfx_mega_free_sgl__pfx_megaraid_biosparam__pfx_mega_build_sglist__pfx_proc_show_mbox__pfx_proc_show_stat__pfx_proc_show_config__pfx_mega_free_scb__pfx_mega_cmd_done__pfx_issue_scb__pfx_megaraid_isr_memmapped__pfx_megaraid_queue__pfx_megaraid_isr_iomapped__pfx_mega_internal_command__pfx_mega_adapinq__pfx_proc_show_battery__pfx_proc_show_rebuild_rate__pfx_proc_show_pdrv.isra.0__pfx_proc_show_pdrv_ch0__pfx_proc_show_pdrv_ch1__pfx_proc_show_pdrv_ch2__pfx_proc_show_pdrv_ch3__pfx_megaraid_reset__pfx_megadev_ioctl.isra.0__pfx_megadev_unlocked_ioctl__pfx_proc_show_rdrv.isra.0__pfx_proc_show_rdrv_10__pfx_proc_show_rdrv_20__pfx_proc_show_rdrv_30__pfx_proc_show_rdrv_40__pfx_issue_scb_block__pfx___megaraid_shutdown__pfx_megaraid_shutdown__pfx_megaraid_remove_one__pfx_megaraid_probe_one__pfx_megaraid_abort_and_reset__pfx_megaraid_abort__pfx_megaraid_init__pfx_megaraid_exitmegaraid.mod.c__UNIQUE_ID_srcversion476__UNIQUE_ID_alias475__UNIQUE_ID_alias474__UNIQUE_ID_alias473__UNIQUE_ID_depends472__UNIQUE_ID_intree471__UNIQUE_ID_name470module-common.c__UNIQUE_ID_retpoline471__UNIQUE_ID_vermagic470_note_19_note_18orc_headerscsi_dma_mapfree_irqis_vmalloc_addr__check_object_size__list_add_valid_or_reportparam_ops_uint_copy_from_userpci_enable_deviceparam_ops_ushort__this_modulesnprintfcompletescsi_remove_host__SCT__preempt_schedule__init_swait_queue_headscsi_build_sensedma_unmap_page_attrs__pci_register_driveriounmap__stop_alloc_tagsmemcpyscsi_dma_unmapscsi_partsizekfreeremove_proc_subtree_raw_spin_lock_irqsave__pfx_megaraid_infopci_unregister_driver__release_region__fentry__dev_driver_string__start_alloc_tagspci_read_config_dworddma_map_page_attrs_raw_spin_lock_irq__get_user_8pci_alloc_dev__stack_chk_fail__kmalloc_large_noprof__put_user_4const_pcpu_hot_dev_infocapablepage_offset_base__pfx_init_modulescsi_host_putrequest_threaded_irqnoop_llseekproc_mkdir_datamutex_lock__put_user_1dma_alloc_attrsscsi_scan_hostpci_read_config_word_raw_spin_unlock_irqseq_putcphys_base__list_del_entry_valid_or_reportioremapscsi_device_type__mutex_init__fortify_panic_raw_spin_unlock_irqrestore__pfx_cleanup_moduleproc_mkdirioport_resource_dev_warn__mod_device_table__pci__megaraid_pci_tblpci_set_masterwait_for_completion__x86_return_thunk_copy_to_userstrcmppv_opssprintfvmemmap_base_dev_noticedma_free_attrsmutex_unlock__const_udelaysg_next__register_chrdevseq_writeremove_proc_entry__warn_printkseq_printf__SCT__cond_reschedpci_disable_devicescsi_donedma_set_mask_dev_critproc_create_single_datascsi_add_host_with_dmaiomem_resourcescsi_host_allocBUG_funcmsleep__request_region__unregister_chrdev5WQ X !s{ !WfW==ngrn__naW1=[=a`:EMP~;<rWNOVcW7nW p  9 R  i+ 0> CQ Vd iw |W    W" / H P f (n    0    I  8% 5 f: J O _ d t y          .  G   \   u! * 6 #> X P` z x      W uC ;e n N W1 ;   l zuB gFWiWbS6zFaeWSSDukM;zz>/Mu_QkdygQD%uuVxuuhM' 3 MSy h  h  & g a W S!!!]!!!"z""a#W.#m#S#;L$zX$j$$$W%%a5%W%%o% R&!& s)&;& C&U& ]&o& w&& && &&s&&P& f'' '#'a2' )7'B' BN'~u'W'(o.( 6(M(U(Pj( r(y(a( )(( B(~(W<)_)o)o1* 9**o0+++P+ ++ +++ ,,, ',8,E,sQ,wX, c,o, z,,s, @,, h,- -- '-R-s-}-P- &-- --P-a- )-- B-~.W'.E.WZ.u.W..W..W=/B/=a/W'0cZ0r0!<0 ! 00!<0 !@01:111P1!<1c2?222Sl3z3o4:4=@4J4Pr4o4=4o5:)5=5:5566P>6r6P66a66P77P57W=7 H7mY7 `7j77W8;8o8oR9 "Z99 99 99s: f:: w:&: ?:J: R:^: f:: :: :: :: :: :; ;:;];g;P; ;; +;; ;; ;< <!< :)<:< B<S< [<l< It<< << <<a< )< = B=~E=W\=u=W==W==W>1>W9?b?r???????? .@~@1@Wv@8@@@@aAWEAWACAJA AVBVBBB [BB!BRCCPD@Dq^DDDD[DDa $).38 @eS W ~ ~ 4 B G~Z h m~z l N  ~ l N & 2~K g3ly ~l N y 03 (QxX (y Fe ^7K ,P~hra m~2 Y~2 ~2 G~@ aA   z~QD  }QD & }+V0VDG 0 to ~iJ VVDv  ~$ )R 0 b ~  -  C H je j ~v P o` ,> o  8=  S  9 g  \ ,>> Gp 6 ,> `  ,> &W \p @u~,>Z,>,>st,> 8~Y D [A A  ~   " ''\ Cae,>6 .;eo6ovol!< !@ !  !  !(u ! ux ! E>,>b Xo~x ~ ~  *1!<O!V [^ !@ul        p'   0%" '9 .@ EW @.^ cu p.|  .  @=  p=  = /  = @% 1~ASpY!;_^DWW)4>I N|U!a pf]m t @{ H  ` ! ]!$ )0 5U> C  *!.8!<F!JT`?Xbp?f#p?t(~?-?2?74 (08@ HP X` hpxd #$4%t'(.D.t...`/477D=t===0>0@ A(DA0C8O!  B( 0 < QD T B P  Q T B   Q T B   Q$ T` h 0p | Q T X   Q T   Q T ( 0 < QD T . P  \ T C P  \ T 8( 0 < QD T``h p | _ T    _ T(   _$ T`(h 0p | _ T0   _ T   Q$ T@ H P \ Qd T    Q T    Q T ,   Q$ T@ FH P \ \d T@ p  \ T   b T  ( 0 < QD T` h p | Q T    Q T a   _$ T@ zH P \ Qd T    Q T0    _ T        Q$  T@  H  P  \  Qd  T        Q  T       Q  T @      Q$  T@  H  P  \  _d  T  .  p    Q  T  G     Q  T@  eH   P  \  \d  T  Y  p    Q  T      Q  T  m(  0  <  QD  T` ph  P p     P   ` @   I0 P .   `@pk07 p@? ( 0@8?HP X@`<p fD $(,b0m48<) @d DHLhPT=X"\~$`%d%h'l;)p&.tY.x.|.Y0i78[===>8?@qCD4r <q $(,0408Z<@D9HLL}PT;Xq\`Mdhlptx| /BUh{ . O m     $ 9 N c x         = _      B m $ ( ,0 0y48<@DHaLP5TX\E`ddhlpCtjx| .t$gR% f   !!"""#-###;$K$W$i$$$% 4%s%%%& (&$B&(\&,v&0&4&8&<&@&D'H'L"'P6'TM'Xt'\'`(d(h5(lL(pT(tq(xx(|((()^)w))8***q++++++,,&,7,D,P,b,y,,,,-&-Q-r-|----- --..D. R.$t.(.,.0.4.8-/<`/@/D&0H0L0PN1TY1X1\1`1d1h1l>2p2t2x[3|k33344?4I4q4445(5i5t5555 66=6q666667747G7Q7_777:8U88 8Y9999 :$:(>:,Q:0e:4:8:<:@:D:H;L9;P\;Tf;X;\;`;d;h<l(<pA<tZ<xs<|<<<<<<=D=T=t=====>0>?@ @0@u@@@@@ADAAAAABUBBBB CC;CCCKC C$C(C,C0D4?D8]D<D@DDHLPTFXl\y`dhl pt1x|P 6Og@*s(  G i u  _ $ ( , 0< 4R 8 < @ D= H5 L P T%X[\t`dYhlptx|Z &`:5ut=nw)t&Db  $0(@,R048<@MDeHLPTX(\4 rx $(,04b8c<d@fDkHLPTX\`dhlptx|CDIX`rvz[^`b gp $(,0`4d8e<g@iDkHmLrPTX\`dhlptx|  ' ( ) .        ] ^ ` b d i t         vwxz|~  $(,04a8b<d@fDhHmLPTX\`d h lptx|#JPkmoquvzd14579;=Bk p        """ """"" "$"(#, #0#4#8#<#@-#D $H $Lt$Pu$Tv$Xx$\z$`|$d~$h$l$p$t%x%| %;%=%?%@%A%E%%%%%%%%W'`'{'}''''''''''''((((((( ((1)2)3) 5)$7)(9),;)0@)4-8.<+.@0.D^.H`.L.P.T.X.\.`.d.h.l.p.tF/xP/|g/k/r/t/u/v/}/M0P0Q0S0U0W0Y0^0"3@37 7:7E7h7i7n7p77777777 8888 8888#= 0=$=(=,=0=4>8 ><7>@9>D>>H?>LC>P1?T2?X4?\6?`8?d=?h@l @p6@t7@x;@|@@@@@A,A0AKAMANAOASAkClCmCoCqCvCCCCCCCCCC|DDDDDDDD Dcp $(,048<@DHLPTX\`dhlp tTxZ|cp G W$* (0U64<\6@H6LT6X`d  (0`8@HpPX` hpx p Pp "$ %`'(.0.`...P/ 7p70= `=(=0=8 >@ @HAP0AXC`p  C@A0ALX  `   @  ( 0 8 @ @ H P X @` h @ p x         `       @  @   `  ( 0 8 `@ H P X `` D? PXL # (5 )' ) &' '. (JO (`b[ (e ('s (/x ( (Z: ( ( (M (" ( (W ( (O ( ({o (-u (lV (~ ($ (߃ (/ ( (\ (: (C (^ (Q (6  (  (# (5Q6 (z= (B (jN (Z (Wf ('r (CO~ ( (  ( ( ( (d (؟ ( ( ({[ (b (9 (I (F+ (7 (c C (O (d[ (V'g ( s (q ( (S ( (S ( (H (^ (% (9 (P# ( %0 (^= (|e (G r (^ ( (& (K@ (u (] ( (& (7* (X8 (YF (^T (b ("p (~ (/q (M ( (P (< (T (Q (a ( (u  ( (*( (Ȥ6 (D (m9R (b` (n ((| (y ( (  (o (J (ɂ ( ( ( (  (~. (?M (g\ (dk (Ez ( (M ( (@$ (B& ( (j (Ts (\ (i( ( (A. (= (sL (,U[ (j (Sy (fx ( ( (#+ ( (= ( ( (G (3 ( (- (+< (;K (UZ (i (x ( ( ( (~ (z (g ( (' (d ( (o* (T7 (e (Iy ( ( (uE (# (U (2 (c (y ( (R (i. (0: (G (T (a (fn (0{ (> ( (W (q ( (9 ( (59 ( (? (, (^9 ()F (SS (ns (} (I[ (" ( (3 ( (Y (= (] (X' (04 (2A (kP (/_ (| (" (= (B ( (` (] ($ (F ( (d (A1 ( (=% (,2 (? (1L (X~ (~ ( (P? (H (Y ( (U (  ( (Ͳ( (?6 (CD (4R (` (mFn (i| (] (Q (: ( (4 (b ( (^ (p ( (= (u$ (_2 (@ (N (Y\ (ej (ex ( (O ( ; ( (Y ( ( ( (\_ (zQ (;  (ȶ (B (E (! (' (o- (3 (;9 (7v? (_uE (-K (xQ (W (] (ic (xi (o (,u ({ () (R} (i (3 ( ( ( (1 (G ( (n ( ( (1# (?1 (,h? (-M (?[ (i (+w (U (0 (( ( (S (w ( ( (; (TM (1 (}J (Y ("h (I x (0 (9% (r_ ( (^ (} (XZ (R (?i ( ( (+- (O< (jK (Z (Ui (%Hx (3 ( (VC ($ (a (  (  ( (x (9 (o (, (m; (eJ (0Y (h (l w (M ( / (4 ( (J (v (m (A (}  (Y (&+ (: (J (ތZ (j (%z (T ( (k (ɽ ( (L ( (d (y  (L ( * (B': ( J (qY (w (H ( ( (e (ǒ ( ( (] (R (ߟ  (`W (+ (: (I (X (|g (kv (' (S (0N (t (^ (u (, () (8 (ì  ([ (* (: (AI (IX ()g (v (\ ( ( (~ (V (W ( (% (ͥ  (5 (4) (_8 (G (V (oe (;t (@ (( ( ( (D (t= ( (? (ٰ (w  ( (( (%7 ("F (PU (d (s (% (E (2# (J ( (" (2 (or ( (_  ( (}' (6 (zE (xT (xnc (z<r ($d (13 ( (T (  ($ (u (  (n ( (' (& (Z5 (wD (ZmS (wzb (q (D ( (ޫ ($ (r ( (n (rD ( (eh (0 ('o& (( 5 (D (FS (63b (Qeq (QF (# (? ( (B ( ( (~ ( (; (m (& (cn5 (D (iS (Zb (q (D. ( (\% (SO ( (tT (u (B (g (L ( (/J% ($4 (wC (rb (nq (T ( (t! (h (& ( ( (0 ( (QR! (%! (E%! (ϼ5! (nE! (wU! (e! (.t! (t! (Y#! (M! (2! (--! ( " (" (ov#" (y,0" (T" (?`" (l" (b+y" (V" (o" (" (q" (" (" (҂" (V" (" ( # (# (?)# (5H# (rU# (S3b# (Pgo# (Vg}# (?# (Z3# (\g$ (V$ (B)$ (?R$ (_$ (Fl$ ([y$ (`$ (o$ (k$ (Zn$ ( $ ($ (}$ ($ ($ (% (=R% (֘% ($((% (pK% ( n% (z% (-% (-% ( % (% (?3 & (H& ((& (05& (O& (#\& (яo& (T|& (& (& (& (K|& (:& (& (& (,%& (& (' (w ' (3w' (t'' (@#4' (A' (,N' (1[' (Ϧh' (u' (' (В' (u' (v' (h' (l' (' (' (#' (O' (G( (B( ( ( (Ŵ+( (v8( (@KE( (|( (( (O) (') (i 5) (JlC) (Q) (_) (m) (D) (g) (() (ga) () (a) () ()) (UT) (R+ (\_+ (Ul+ (%y+ (+ ("+ (S+ (V+ (+ (Q+ (+ (+ (K+ (gL+ ( , (, (w#, (0, ()w=, (J, (#W, ("d, (q, (~, (, (, (, (*, (, (, (T, (N, (^, (Z1- ( - (- (oz'- (4- (GUA- (N- (n\- ( j- (x- (E- (- (- (&I- (o- ( )- (c- (`. (5 +. (9E. (=U[. (o/ (4/ (VB/ (X0V/ (m$d/ (yr/ (L/ (Fi/ (`/ (/ (C/ (D/ ({/ (Wa/ (/ (/ (ئ 0 (0 (0 (90 (H0 (w0 (H0 (h+0 (B41 (Gi1 (x1 (x1 (,1 (1 (XF1 (~S1 (?1 (1 ('g1 ([1 (1 (1 (Ɍ1 (a1 (x1 (1 (^1 (a1 (1 (? 2 (l2 (Ŏ82 ( D2 (Q2 (u^2 (4k2 (*x2 (w2 (l2 (2 (D 2 (\`2 (2 ( 2 (e2 (K13 ( 3 (3 ('3 ( C3 (AO3 (r\3 (-i3 (Ov3 (3 (y3 (O3 (3 (>3 (?3 (,3 (4W4 (4 (֤4 (O*4 (84 (FK4 (){W4 (hc4 (p4 (}4 (4 (4 (<4 ($4 (t4 (5 (85 (`5 (ۗ|5 (5 (?5 (>5 (5 ( 5 (6 (*6 (_6 (l7 (07 (z=7 (J7 (G]7 (7 (7 (lo8 ('>{8 (8 (8 (o8 (m8 (9 (9 (K9 (l9 (9 (99 (9 (ri9 (g: (> : (=: (M: (L[: (}i: (5Mw: (Zn: (*: ( : (: (i: (: (/; (X; (; (V`); (H; (W; (}e; (|s; (}; ()@; (; (s; (3; (; (G; (b; (^ < (< (^7< (E< (8S< (a< (*o< (T}< (DV< (ѹ< (]c< (A1< (}< (< (< (w< (^ = (0:D= (t I= (gaS= (1`= (m= ( z= (l= (;Y= (P= (9G= (^= (u= (= (U/= (T>F> (S> (Ug> (b*|> (i> (-> (> (K> (||> (1> ()c> (> (uY> (? (s? (IG,? (=:? (GH? (V? (Bd? (%r? (? (? (<? ({? (? (Mi? (? (:? (? (M? (,@ (*9@ (F@ (^T@ (bg`@ (Dm@ ({@ (@ (Y@ (2@ (\@ (8@ (@ (c@ (|@ (.A (A (HXA (|+A (y)7A (DA (|RA (}/gA (|tA (A (/A (`A (A (A (cA (JbA (0A (nB (}B (B (g+B (8B (ײFB (SB (_aB (EmB (zB (WB (4B (j`B ({B (B (B (4B (B (B (%C (uC (-C (&9C (FC ( sYC (tfC (OyC (<C (5C (YC (2C (\C (SC (*C (C (ajC (Z D (/KD (#D (IO1D (>D (KD (HYD (neD (n0rD (OD (D (D (D (kD (]D (XD (0D (D (FYD (E (E (h0E (O@E (.\FE (.LE (ɪRE (y0XE (y_E (UdE (HqE (>E (%E (E (KE (cE (;E (̳E (&E (JmE (LE (,F (uF (F (IL-F (yV3F (:F (}GF (LUF (IbF (XoF (A1|F (aF (|F (#F (4lF (PF (F (?F (> G (IeG (%G (2G (nEG (RG (M_G (,lG (XyG (G (G (xG (G (G (r'G (k_G (G (˄H (H (H (5*H (lH (exH (H (2H (cH (]H (H (ԫH (˞H (>H (/H (uI (.II (,I (9I (VPI (/]I (ujI (I (/I (uI ( I ( I (lI (@I (`I (I (e. J ( 0!J (/.J (x;J (ұRJ (\^J (jJ (NvJ (lkJ (ÊJ ( J (|iJ (DJ (UJ (-K (K (K (r3K (!n?K (hKK (FWK (:,mK (zK (K (K (=K (R4K (4K (pK (K (K (5K (SL (BL ("L ((L (R6L (qPL (Y]L (jL (nL (\L (L (L (NL (L (qL (3L (TbL (?L (͐M (MM (#M (0M (Ih=M (SJM (hM (uM (kM (M (Q|M (M (M (ƢM (GM (M (M (QF-N (PN (N\N (0NjN (kxN ('N (N ((N (N (>[N (N (N (N (tN (|N (4jN (a O (kO (''O (S6O (MDO (RO (j`O (!nO (}O (O ("O (AO (1O ([5O (TrO (<O (PO (0CO ( P (P (E_&P ( p5P (d^DP (LYRP (/{`P (anP (A|P (P (P (P (JP (܍P ( P (P (P (rP (LQ (IQ (O$Q (f2Q (nt@Q (NQ (\Q (jQ (xQ (Q (FQ (Q (W~Q (8@Q (Q (_Q (OJQ ("Q (oOR (R (v#R (j1R (?R (MR (Q[R (siR (kwR (AR (+dR (XR (PR (OUR (;R (wR (R (eR (US (S (94S (U>S (:mLS (ZS (WhS (vvS (LS (S (2S ($S (&S (S (4S (T (QT (!T (3/T (1=T (KT (YT (gT (ewT (MT (JT ([T (T ({T (ыT (DT (T (/U (@ U (a .U ( =U (KhU (WvU (ZU (U (U (9fU (_U (U ("U (mU (V (R,V (^AV (rIV ("XV ()j|V (V ('/V (F1V (aV (5V (V (V (V ('V (#W (ZW (w W (.W (XfW (W (5W (59W (W (P0W ( /W (W (W ()$X ()1X (?XX (^eX (rX (CX (X (X ({CX (:X (`X ( X (cX (gX (UX (Y (Y (XY (k(Y (^5Y (BY ({OY (7\Y (piY (Y (?Y (Y (.Y ({Y (Y (գZ (T$Z (21Z (O~>Z (aKZ (dZ (xZ (Z (4Z (?Z (Z (ͥZ ('Z (HZ (Z (sZ (LZ (kZ (}[ (f[ (, [ ("-[ (`:[ (7]G[ (T[ (a[ (n[ (j{[ (r1[ (x (&Mx (\x (kx (zx (M2x (:x (;gx (Hx (x ( lx (vIx (x (Oy (y (".y (O=y (7Ly ([y (jy (Eyy (zy (y (θy (y ( &y (y (Yy (7y (CWz (TPz (z (Q-z (~ (=T~ (7s ( ( (3+ ([8 (VE (R ( 3_ (Xl (\y ( (# (d (  (" ( ( (u ( (w, (e9 (F (`Y (.e (q ( ( ( (# ( (& (t (e (~ǀ (/ (U]< (b (t (< (ʇ (v (> ( (2Á (+sɁ (aρ (1&ہ ( (7 (* (D8 (F (d (q (f} (aà (Pу (ރ (^ (| ( (5/ (EA (U_ (Y ( ( } (uĄ ('Є (+ (c ( ( (! (/ (= (TUK (vY (4g (ou ( (8) ([ (3 (_ (!υ (*݅ (P ( ( ( (x9# (1 (x ? (9M (V[ (i (Pw (X (o (" (r (~ (Wˆ ($ن (~ (/ ( (Z? (B (. ( = (U (Md (s (qV ( ( (o (H0Ƈ (և ( (b (u (# (H`) ()N (([ (ah (-u (3 (4 (E (b (W (0È (bЈ (i݈ (e (= (| (S (], (w-: (3H (CV (֜d (Ur ( (Q ( (0 ( (Ɖ ([ԉ (ae (! (L ( (? (,( (6 (ND (U R (` (9n ( ( ( j$ (q 1 (> (GK (OpX ( ( (. ( (>A̖ (S.ٖ ( ([ (ˁ (Is (, (9) ( f6 (kC ('P (+d^ (k ( y ( ( (^ (j (s (c͗ (h/ ( (s$ (. (p8 (%E (S (C` (m (5z (` ( () ( (m%ʘ (X=ט (oK (7 1 (ĺ= (R (l^ (}s ( (FR ( (̙ (Sۙ ( ( ( 1 (r (?! (yH/ (= (_K (TY (Jg (8`u (g (K ( ( (>s (o}ɚ (Jך ( (ͣ (A4 ( (8u. (}= ((L (ii (x ({ ( (W (f (Û (Kқ (1 ( (E (_ ( (L, (; (vJ (2Y (\v (`M ( (S (E ( (0М ( (G (lJ ( (* (S9 (H (W (ٱf (Ⱦu (1 (5y (Rӝ (]rߝ (W (o (_ (f (6 (6 ( (z+ (?7 (1D (Q (J^ (qU (] (Ԯ (Ѕ (7 (vɞ ((מ (: (a ( ( (93 (? (L (Y (8f (T (N ( (m ( (̫ʟ ( ؟ (0u ({R (ư (r ( (Ӄ, (ˮ: (H (V (rd (jr (Ly (r (7 (v (tƠ (̠ (NӠ (x ( ( (?. (dm; (H (`U (b ({o (U| (l ( (B ( (aV (Mˡ (ء ("S (R ( (Y ( (& (z4 (B (qP (F^ (l ( (Pj ( (r ( (QƢ (UԢ ( ( (-O (x{] (%k (5y (! ( ( (_ ( ( ͣ (ۣ (0 (-v ()X (k (\J (2' (! (ʤ (yuؤ ( ( (Zx (  (bt (z, ( : (uH (hdV ()`e (s ( (T ( (N (s ( bǥ (. (r (ߘ (*p (V (|; (I (CW (4e (uKs ( (k ( ( (/b (Ȧ (!֦ ([R ($ (+ ( (9 (i* (z8 (|F (T (֪, (Ir: (H (OV (d (= (ɨ (Mtר (t% (:* (tS& (4 (Y^B ("P (^ (Еl (z (E ( ("1 (v (Դ (wkΩ (qfܩ (D (+ ( $ ( (" (CO (^ (\ ( (h (ë (gЫ ( (. ( (s (+ (p, (B9 (gf (:1s ( (A (ڊ ( (Y ( (`̭ ( ڭ ( (^k (H ( ($ (C. ($< (J (kX (]f (t (7( (E (H (C= (|D (s\Ȯ (+֮ ( (( (% ( (& ' (1 (-; (",E (]2O (!Y (ITg (9u ( (O (C (4ʯ (د ( (} ( (he (Fj (7 (8D (;\ (j (w (( (WY ( (ǰ (հ (* (j (H (^& (24 (1B (gP ( A^ (#l (z (wd ( ( ( (e ('α (ܱ (ؼ (J (h: ( (j" ( .0 (> (?L (@Z ( h (mv (S ( ( (ϲ (޲ (; (> ( (t ($ (V1 (H> (_K (YX (ΰe (d]r ( (2 ($ (%m (XI (a (}ͳ (_ڳ (^X (v? (& ( ( (m)( (< (1F ( 4P (]z (I (JǴ (GP (͢s ( (w (O (1m ( (Vwd ( ( (}ͷ (SIڷ (5 (v (? (R (' (94 (9A (:Ǹ (~ (> (_ (Q (H (Y (4 _ (]e ( (Z+ (Ě (r; (H (uU (Mb (eo (P| (U ( (: ( ($Ͼ (KN޾ ( (F (h"$ (*1 (=> (uK (X ( Oe (qar (D ( (q (T ( (Uǿ (Կ ("L (1 (v ( (Ak (+;' (p6 (C (!jP (ǒ] (x (m (fB ( (4 (5 ( (e (u (Y ( (x/ (@< (\ (8hv (Q (} ( (Kw (Q ( (K (i ( ( ( (% ( * (8 (F (]T (Um ( ($ (R (@u (] (9 ( (@ ( (Y (@q (( (ߚ6 (%D (@XT ( 5d (Ct ( ( (_ (n (U) (? ( (+ ( ( ( (* (7 (uD (x[ ((g (:"t ( (R (} (: (_( ( (] ( (o (U (]@ ( N (0:\ (a (P ( (3 (3 (A; (a ( (  (x, ( q9 (F ( W (@ (? ( ($ (dL (Y (f (us (E (Dd (xU (> ( (J (b (# (0 (C (ݧP (] (hj ( ?w (E (I ( (! ( (` ( (} ( (a( (n5 (B (hO (\ (i (v ( (L (3 (e ( (? (!) (4 (_ (' (Gt5 ( D (oS (\b ( ( (P (  ( (5= (* ( (>M (  ( (W% ( +4 (C (u` (|`o (3~ ( (ܕ ( (V ($ (#= ( (D] (A\ ( (Y{' (\7 (9tG (l] (,5j (@qx (Z (.| (|( (1m (? (% (w (z (b (/  (D< (= (, (_: (3H (V (d (0r ( (?Z (z ( (@ (^& (Η ( ({ (q (" ($#( (#/ (x@ (F (@L (MR (nX (˙_ ( m ({ (W (v$ ( (l ( ( (` (g (ե (sx ( U (% (f4 (lC (xR (pa (p ( (< ( (M ( (Q< ( ( ( (P ( (kM% ($4 (B (kP (z^ (cl (:z (E (P (OV (f ("' (v ( ( (@ ( (( (*R8 (H ( V (Wd (\r (3I (o ( (01 ( (= ( (O ( (} (u, (M9 (F (cS (a` (m (#z (TS ($\ (\ ( ( (խ ( ( ( ( (@ (D (N (E3j (x (^ ( ( (^i (xq ('i (u ( (n! ( . ("; (H (EU (b (ko (| ( (W& (A\ (? (% (/ (a (s (C () (uC (YP (F] (j (nw (> (g ( (k ( ( (? (% (ܕ (  (.i (v (u ( ( ( ( ( (: (݆ ( ( ( Wx (O (u (ܕ (E ( ( (Z (" (. (&' ("4 (.P (c\ (&h (t ( (c (0Q (ܨ (5 (5 (Zt ( A ( () (3;5 (TC (^R (u^ (j (v (y ( (p2 (G (P (,? (3 (A (e (' (u7 (TD (59Q ( ( ( ( (k () (>G (/LU (4-b ()o (L (s ( (f (U (! (X ([ ( g (3) ( B (P (Z (Fg (Rt (0: (a ( (+ (P?: (K (rwQ (]W (,] (,d (]S (L (q (A1 (U2 ( (} ( (  (}# (Q (2 (Nl (!v (y (b (˩ (n ( ( ( (p/ (u (? (Ql (L0 (I (_c (2{ (! ( (X ( ( ([ (Q  ( (s ( (- (+ (N1 (Z7 (= (xmD (ɟR (M` (QBn (| (l (T (eb (L (x ( (# (H (s ( (ބ ( (V ( (m+ (a (Y (X1 (7 (\= (`D (|R (/` (An (Ez| (ğ ( ( (y (~ (c (0 (e (Z2 (M? (QBL (d (Vn (S} (r (\ (J ( ( ( (w (z (: (q (* (\l6 (/C (ZQ (EA] (0r (^~ (0 ( (d ( ( (wc ('0 (R (3 (j ( (y$ (3 (DB (Q (J` (o ( ( (Ϛ ( ( ( (W ([  (< (* ([7 (P?D (H\ (Ah (X"r (` ( (? (\ ( (L ( (%e (Zn! (. (f; (wI (l?W (d (q (o~ (` ( (w ( (H (l (b ( ( (v, (@9 (yL (O\ (ɖb (;h (0n (1u ( ( (I ( (7n (* (| (l (xO ( (|; (Q (# (*:1 (i? (uM (G[ (Vi (w (' (\' (> ( ([s (Y ( ( (k (+ (9| ( (- (3; (I (%}W (:k (x (k (e () ( ($ ( (ޑ (w ( ( ( ( (- (j; (cI (W (ye (Vs (d (2} (, ( ( (b (An ( (} (M (3 (a () ( 7 (E (ֳS (a (Do (-} ( (C (op (p (* (` (W ( (3 (hK, (?xJ (T (Tb (Xp ( f~ ( ( ( (3p ( (W ( (1m (q (| ( (] & (.4 (5B (P (B!i (us (W ( (c (5? (u (^ (W (. (pu (>! (U?. (; (&H (??U (b ($o (O| (UQ (9W (q (a ( (: ( ( ( (4) ((3 (ɨ= (K ("Y (.g (Cu (? (C (S (, ( (\ ( ( ( (F% (T3 (A (ЈO (] (k (Wy ( (_ ( ( ( (v ( ( (^ ( ( (<# (p) ( (˔h ( (w (H (8{ ((t (j# (0 (x= (J (^W (d (׺q (6F~ (m ( ( (o (\f ( ( (1 (b (9 ( (Y (Z2 (v? (WX (2k (x ( + ( (jY (Yp ( (q (? ( ( (Y (C (? ( (L (g (L ([ (j=( (5 (wB (_O ( (.] ( (f (f (3 ()G (L (e (ǒ ( (^+ (9 (G (rU (n-q (\ (x (f (G (r (: (u (k (5 (P (%b (mN. (b> (IT (cA^ (j ( v ( (- (- ( (0i ( (5: ( (\.! (\/ (\= (gK (BPY (Ag (gu (L (Ɋ ( ( (J (< (k (" ( (j ( (7 (u+ (b9 (OhI (e (s (J^ (!) (P (* (5 ( (6 (q (v (" (  (e' (Eg7 (DG (hW (eg (ƭw (] (3 (=) (?: ( (X (N: (s (R ( (I (/ (? ( \ (qz ( ( ($ ([ (| (e; (`o ( (2 (K} ( ' ($7 (aG (vW (Γg (w (b ( (Ձ (' ( ()l (U (  (v (~v (y' ( 7 (}G (DW (/g (w (lX ( (2 (5H (K/ (M ( ( (Po (( (Ma& (V5 (}D (<S (#b (q ( (E (N ( ( ( (. (  (~  (  () (<@ (`O (^ (S m (]| (p (  (  ( (Bb (> (K ( ( (.." (A ("K (V (rd (ur ( ( ( (? (% ( (S- (R (| ( (ܕ  (  (!)( (l6 (K ({ ( ( (@ ( ( (w ( ( ( ( ( (j (L ( (4  (  (/T( ('6 (%D (' (_ (-(, (n9 (dF (^S (f` (Mn (1 (_ ([ ( (:_ (G (+V (s (C (G (} ( ({Z ( (   (z~  (;)  (@/  (s5  (;  (A  (<G  (kM  (mqS  (Y  (*_  (e  (Jxk  (q  (Jw  (}  (Z  (  (A  (  (օ  (S  (  (  (  (J  (~.  (5  (f  (1  ( D  (S*  (h  ()  (9  (9.?  (WE  (U  (׻a  (Vw  (Y  (o  (4  (e  (@  (s  ([$  (2  (c@  (nN  (\  (j  (x  (z&  (_  (q  (b  (o  (?  (tC  (]  ( }  (B  (i'  (6  (|FE  (T  (Tc  (Wr  (V  (  (3  (  (  (   (4  (-4  (x  ((  (  ("  (a6  (tyD  (9R  (%`  (po  (P  (  (C  (Q  (  (  (] (hi (*y ( (  ( (h (# ( (w (T (^ ( ( ( (s (k (D (V ( (F (CD ({> ( c (* (L8 (F (F1S (S` (ZAm (?z ( ( ( (3 (u ( (w ( (is (w (  (N$" (:< (הI (V (c (?p (i} (9 ( ( (f (g (< (J9 ( ( (ȵ (5 (>, (G: (PH (LV (d (r (t ({ (o4 (0> (  ( (5 (> ( (ހ (( (m& (&5 ( T (ȷc (I%r (. ( (R (N (F (s (.e () (J= (` (9 (& (15 (՞D (S (10b (q (݇ (ZD (  (5 (Ư (2X ( ("P ( (9 (k (4% (5<4 ( C (R (ua (Z>p (H" ( ( I ( ( ( (' ( ( ( (H (2 (}3, (|; (G (M (#S (6Z (/h (Lu ( ( ( ( (F ( ( (z (Ԁ ( (A (- (x+ (E (R (_ (! l (y ( (q. ( (a (³ (i (% (T[ ( (  ( ([ (, (29 ( fF (QS (u` (=m (*:z (i (b (2 (  ( ( ( ( (J (y (  (]  (j#  ( 1  (?  (M  ([  (i  (dw  (  (n  (G  (*  (  (X  ("  (  (M&  (! (R+! (X;%! ([q4! (C! (R! (pa! (p! (! (%! (Nu! (! (p! ( ! (1! ()! (! (/ " ()" (+" (%F:" (#-8$ (?I$ (qO$ (U$ (?[$ (a$ (_g$ (ilm$ (}y$ ($ ($ (ɼ$ (q;$ (u$ (,$ (f$ ([$ (ZU% (5% (&C % (l-% (:% (s% (j% (Ƅ% (% (K% (% (P% ('% (W& (Zn& (+"& (,/& (:<& (nI& (V& (p& (}& (& (9& (f& (i& (X& (N& ( & (W ' ()' (-)' ()7' (+E' (,R' (:_' (nl' (y' (' (' (u' (f' (l' (' (9' (' (X' (N ( (( (+( (d9( (N( ([( (di( (zb( (a( (( ( K( (( (( (+E( (Of) ( ) () (j') (o4) (*A) (s) () ('x) (() (y) (\) (F) (?y) (%q) ( ) (I) ([ * (* (;&* (3* (@@* (NSo* (S{* (Y* (* (`* (* (3* (Fq* (ˬ* (l* (3* (+ (t+ ('+ (,+ ( :+ (HHH+ (XV+ (d+ (0r+ (+*+ (++ (1+ (-_+ (=N+ (v+ (jc+ (+ (!+ (+ ( , (, ( (, (6, (WD, (&WR, (Y,k, ('xy, (Y, (x, (, (T, (3, (h[, ((, (C, (, (;9- (u- (|"- (l1- (ک@- (rO- (^- (NS- (. (?y. (". (V0. (%q>. (yL. (Z. (#h. (v. (T. (\. (. (3. (bE. ( . (@J. ((. (-. (( / (C/ ((/ (u6/ (|D/ (lc/ (zz/ (ک/ (/ (B/ (/ (/ (/ (R0 ( P0 (jW0 (E*0 (280 (G0 (d^0 (:l0 (n{0 (X0 (0 ( 0 (L0 (0 (0 ( 1 (L1 ('61 (D1 (59R1 (6`1 (sn1 (l|1 (dO1 (1 (1 (1 (T1 (X1 (F+2 (T2 (X/2 (bIF2 (?T2 ( <b2 (p2 (~2 (}2 (t32 (S2 ([2 (2 (1F2 (w3 (S#3 ([13 (?3 (1F_3 (v3 (v3 (B3 (F3 (3 (d3 (Y3 (%E3 (4 (P(4 (j64 (LU4 (\c4 (A14 (f4 (4 (04 (b4 (4 (4 (+5 (ɼ5 (v$5 (B@5 (uN5 (,\5 (j5 (&Cx5 (l5 (5 (5 (5 ([5 (v5 (F5 (E5 (6 (6 (S$6 (N26 (<A6 (CP6 (^6 (l6 (h6 (:6 (M6 (qe6 (@6 (R+6 (6 (A1 7 (7 (L&7 (eT47 (+B7 (PP7 (jl7 (6z7 (*n7 (^7 (F17 (BS7 (7 (7 (7 (_7 (I7 (f 8 (y8 (\(8 ( 78 (ñF8 ({U8 (d8 (H4s8 (M(8 (\8 (_8 (8 (8 (4[8 (8 (c8 (JZ8 (zB 9 (W9 (.'9 (OA69 (ĻE9 (99 (9 (^K9 (َ9 (5O9 (g9 : (: /: (?C;: Y: (e: n: (v{:: (:: (12: : (k]: P: (I: ; (V; ; (&;D; ()Q; Z; (#f; (; (l; ; (z; ; ( [;; (; p; (b#; < (< e.< (:< C< (TkP<!@i< (tv<!@< (a<! < (^K< (߼< `< (\<! < (^ < (:=!= (= ()= B= (>~P= Z= (\@g= (;u=~= (O== (‰== (3= (= (`w > (m*-> (C> ({c> (z> (> (|> (-z> (> (# ? (gD? (s? (? (()? (? (@? (4a? (R9@ (G7@ (IS@ (j@ (@ (@ (@ (@ (@ (TA (/A (1m+A (;>A (ZA (OuA (I\A (A (A (B,A (B (56B (IB (`B (sB (fB (B ( 2B (>jB (:B (B (6C (&M9C (…YC (yC (C (kC (C (OC (/C (X<C (C (?(D (D (/D (b^D (uD (}D (RD (GMD (4D (e0D (D (!.D (aE (E ( d%E (۶-E ("@E (>XE (0jE (g|E (E (_E (bE (-E (PF (F (%:F (N_AF\FfFF $F $ F $%F $#F-F F9FFGF G (o G$G (_/G $E3G $;8G ( FG (TG ` ]G (WkGzG (G G (WGGGG $jG $hG $zG $xG $G $GH &H `1HRFH UHjjHptHHH HH HHH (LIAI (n$I $(I $-I (F18I $Y $CYL kY Y Y &>Y $Y $Y &>Y Y &PY $Y $Y $Y $Y $Y $Y $Y $Y *Z 4Z &fDZ $+HZ $)QZ $:UZ $8_Z iZ &vyZ $K}Z $IZ $^Z $\Z Z &Z $oZ $mZ $Z $Z Z &Z $Z $Z $Z $Z) [ &[ $[ $%[ $)[ $3[/ =[ &M[ $Q[ $Z[ $^[ $g[/ q[ &[ $[ $[ $ [ $[A [A [ &[ $[ $[ $+[ $)[A [ &[ $A[ $?\ $R\ $P\W "\ ,\ &=\ $hA\ $fF\ &S\ ${W\ $w`\ $d\ $v\ $z\ $\ $#\ $\ &\ $B\ $>\ \ \ $a\ $_\ $s\ $q\ $s\ $q\ &&] $] $]. ]. 1] $5] $>] $B] $K] $O] $Z] &9g] $k] $t] $x] $] ] &N] $] $] $] $] $] $] $] $] ] ^%^ $))^ $'2^ $;6^ $9?^ $MC^ $KL^ $rP^ $^Z^vd^ &at^ $x^ $^ $^ $^ $^ $^ $^ $^^^ ^ &t_ $_ $_ $G_ $A_ $m!_ $g*_ $._ $7_ $;_ $D_ &Q_ $U_ $^_ &k_ $!o_ $x_ $M|_ $E_ &_ $w_ $u__ &_ $_ $___ $_ $_` $` $`7`H`Y` t` ~` &` $` $` &` `& ` &` $` $a $a $a $a $a $("a $&+a $8/a $64aB ^a ha &ya $H}a $Fa &a $qa $Wa &%a $a $a a a $a $a $a $a $a $b &<b $b $ !b +b Db $.Hb $,Qb $@Ub $>^b $@bb $>ib: b &Lb $Qb $Ob $ab $_b $rb $pb $b $b $b $bp bp bp c $c $#c $'c $0c $4c $=c $Ac $Jc $Nc $Wc $[c $gc c $c $c $c $c $c $c $&c $$c $6c $4c c c c $Fd $D d $Vd $Td $Vd $T%d $g)d $e2d $w6d $u?d $Cd $Od Yd vd $zd $d $d $d $/d $-d &\d $@d $<d d d $[d $Yd $[d $Yd $[e $Ye %ed Fe ge|e8e_e ee e e` f*f ,f 6f &lGf $mKf $iTf $Xf $af $ef $nf $rf $wf ff &f $f $f &f $f $f &f $Wf $Sffg $rg $p"g $r&g $p/g $r3g $p>g &Kg $Og $Xgbg{g $g $g $g $g $g $ggg &g $g $g &g $h $ h $h h $\h &#h $'h $0h:hSh $Wh $`h $dh $mh $qh $|h &h $h $hhh $h $h $h $h $h $h^h?i .ie+i C@iJi &[i $ _i $ di &mi $&qi $i $qi $Ui $i $i $i $i $xi $ri $i $i &i $i $iij $j $j $j $j $j $*j &-7j $;j $DjNjgj $kj $tj $.xj $,j $.j $,jjj &@j $?j $=j &@j $hj $Nj $j $j &S k $k $k"k;k $?k $Hk $Lk $Uk $Yk $`kkk &fk $k $k &fk $@k $8k $vk $dkk &}k $k $k $k $k $l $ l $l $l:lDl &Ul $3Yl $/bl $Lfl $Jol $asl $[|l $l $l:lUl &l $l $l $l $l $l $l $l $lz(m2m &Cm $Gm $Pm $ Tm $ Ymvmsm Xm|mmmmmn#n-n &>n $- Bn $) Kn $N On $J Yncn &on $k sn $g |n $ n $ nn &n $ n $ n $ n $ n &n &n & oo2o $ 6o $ ?o &Do\o io!yoo &o $ o $ o &o $ !o $!o &-o $$!o $ !ooo $>!o $! p $!p $"FuEkuCuDubDuDuEu au v v6v z@vbv qv v v/vv0 v w w+wEwewww w-w ww0 x%x /xn Lx _xz lx x`x xyx@xx xy"y?y Iyfy py+y 'yyyy.y zWz (H&z#=z ([Hz $Y"Lz $O"[z $"_z $"dz (joz $"sz $"xz (z $"z $"z $"z $"z (z $0#z $,#z ( z & z (z2#z2#z $F#z $D#{ $W# { $U#{ $F#{ $D# {r#5{ (D{ (N{ (B/W{ (f{ (A5o{r#{ ({ (r{ (Y{ (*{ (ѵ{ ({r#{r#| $h#| $f#| $x#| $v#| $x#!| $v#*| $#.| $#7| $x#;| $v#D| $#H| $#U| (b| (eu| (| @ | (W|h|#|#| $#| $#|#| & | $#| $#} $# } $#}#} & )} $#-} $#6} $$:} $$C} $$G} $$P}#Z} & j} $7$n} $3$w} $O${} $K$} $h$} $d$} & } $$} $|$}#}#}#}#~ $$~ $$~#~#3~ $$7~ $$@~#J~#c~ $$g~ $$s~#}~#~ $$~ $$~#~#~ $$~ $$~#~#~# $$ $$! $$% $$. $%2 $%; $@%? $:%H & U $]%Y $Y%_@$yD$D$ $u% $s% $% $%P$2##\$n$K (=] ([ ( (j (1S (€ (nЀ (߀ (~=$ ([  $% $% (  $%$ $%8 & A (S$]$v $%z $% $% $% $% $%$ %Ɓ (N؁ ([ (P ( K ( (" (0 ([= (PJ ( K\ (k (z ( ([ (, ( ( Ȃ p ւ ( (  (W p (l5' ([4 (,A (Z (l (y (e (A0 (* ([ă (Pу ( Kރ ( ( (:E  ([ (P' ( K4 (B (Q (M_ ([l (y (P ( K (h (D (gɄ (؄ ( (] ([ (P ( K+ ( 5 PC (V (i (w  (W (  (WxɅ (&ۅ ([ (P ( K ( (% (R0R $%V $%e $&i $ &n (y $>&} $:& $V& $R& (/ $r& $n& (nm $& $& ([Ά &0׆ ( $& $& ( $& $& ( $& $&" (u- $&1 $&7L (W $'[ $'` (Do ( $' $' ( ( (· (u܇k ( $#' $!' ( $4' $0' (3 $L'7 $J'< (uG $^'K $Z'Qf (q $v'u $t'z (D ( $' $'ň (Ј $'Ԉ $'و ( $' $' ( $'  $' (u $' $')3 & D $'H $'Q $(U $'^ $(b $(g & $"( $( $?( $;( $j(ĉ $f(ɉ &҉ $(։ $(߉ $( $( (Yz / $(3 $(8 ('5C $(G $(L (nm] ([m (vx $()| $) (B $m) $g)0 ( $) $) (Ɋ $)͊ $)Ҋ (B/݊ $) $) ( $) $) (A5 $)  $)0 (1 (r> (YK (*^ (ѵl (00 $) $) $) $) $* $*ɋ $)͋ $)֋ $)ڋ $) $* $* &h ( $&* $$*  ( $6* $4*  (B/+ $G*/ $E*4 (? $X*C $V*H (A5S $h*W $f*\m ( (r (Y (* (ѵ (͌׌ $x* $v* $* $*  $* $* $x* $v*$ $x*( $v*1 $*5 $*A+K &@\ $*` $*i $*m $*v $*z $*5I &S $+ $+ˍ $&+ύ $"+؍ $S+܍ $O+ &S $p+ $l+ $+ $+OO- $+1 $+: $+> $+G $+K $+P_q (+07 ( $+ $+ $+Ď $+Ԏ $,؎ $, $:, $4,L7V78d7IT (Ff ( ([ ('5 (F ( (/Ώ (jۏ (Q (L (  (`= (n' ( 1 : (F (Y (f (s ( (u ( ( (Ґ (u (  (W  (, (: C (WQ` (o (| ( (B/ ( (A5 (Ñ (rБ (Yݑ (* (ѵ (  (. (9 $W,= $S,B (M $r,Q $n,Vj (| ([ (   (Œ Β (Wܒ (  (W () 2 (W@K (V &a ((l $,p $,u (l $, $, (%e $:- $(- ( $- $- ([ $- $-œ (Г $:.ԓ $*.ٓ (> $. $. (? $. $. (  ( & (W4>Rc"t@ ( (? (e ([ (͔ ( ה 0 ( ` (W& ( 1=Q $?/U $;/c $Z/g $V/l > (?= $u/ $q/ʕ $/Ε $/ӕ= (p= $/" $/0 $/4 $/9=Y (d@= $/ $/ $/ $/Y= (?ܖ ([ ( ( (T( (~5 (VB (fO (n\ (ki (Cv (&K ( (   (pA (o{ (ȗ ї (Wߗ ( ( 2 .) $0- $0; $20? $.0D._ (1jp. $M0 $I0 $h0 $d0. (˘@. $0 $0 $0 $0W.! (,.L $0P $0^ $0b $0g$. (z ([ (: (ƙ ("ә ( (f (n (ک (a  ( t7 (> ( H Q (pAX (o{d (r { (W ( (>B ("Ԛ (Sߚ0% $0 $0 $1 $1 ([% $91) $11. (? (fJ $b1N $\1S (nc ((n $1r $~1w (~& (  (pA& (  (Wʛ؛%% $1 $1  $1 $1%# & 0 $14 $1= $1A $1J $1N $1W $ 2[ $ 2`%&& $2 $2Ȝ $,2̜ $*2ќ-& s3&3&# $D2' $B20 $S24 $Q29G&P dM&nM& $k2 $i2 $z2 $x2a& ̝g&֝g& $2 $2 $2 $2 {&  4&>&[ $2_ $2h $2l $2q& &&Þ $2Ǟ $2О $2Ԟ $2ٞ& &&+ $3/ $38 $3< $3E $'3I $%3R&\&u $63y $43 $E3 $C3 $W3 $U3 $f3 $d3&џ&۟& $w3 $u3&&$&A $3E $3N $3R $3W'n f ' ' $3 $3 $3 $3 '֠ '''' $3 $3 $3" $3';'> )Nx%l% & R&ϡ''ܡR' B  (np'8 $4< $3J $'4N $#4S ([^ $C4b $?4g (x (f $^4 $X4 (n (Q( (  (pA:(ʢ (آ  (W''$ $~4( $x41 $45 $4>'H & U $4Y $4b $4f $4o $4s $4| $4 $4(:(ã:( $4 $4 $ 5 $ 5 $5 $5:(:(* $+5. $)57 $:5; $85D $L5H $J5Q $[5U $Y5ZQ(Q(Q( $l5 $j5Y(Ϥ}(٤}( ${5 $y5 $5 $5 (# )3'Q(i:( v( }((ѥ Bܥ ( $5  $5 $5 $5" ([- $51 $56 (PA $5E $5NX &i $6m $6v $6z $6p ˦ 9  R"0 i:4U _Gz Z mħ Χ  (] $86 $26- $X61 $T66 ([A $q6E $o6NX &i $6m $~6v $6z $6Ҩ $6֨ $6ߨ $6 $61 $65 $6AKh $6l $6u $6y $6~ ȩ (Wdө  $7 $ 7 $=7  $97 ([ $Y7 $U7&. 0 &A $t7E $p7N $7R $7W3 n@ @  $7 $7 $7 $7T ת ^ ^  $7 $7 $7# $7(r ?(T ^ { $7 $7 $7 $7  ǫ  $8 $8   $)8 $'8  * C $;8G $98S ] z $M8~ $K8 $\8 $Z8  G. Ŭ.  $t8 $r8 $8 $8B  ##P -P J $8N $8W $8[ $8`d wPr r  $8 $8 $8ĭ $8ɭ x   $8  $8) $8- $82 IZ u 0   I׮) 8>  f!S < Fh a k}     Я گ    $ ? .I d \n%  u   (ʰ (fװ ( (n (.  ( (n (u^- (n; (NF] ([h $9l $9q (n| $?9 $79 ( $d9 $`9 ( $9 $~9± (B/ͱ $9ѱ $9ֱ ( $9 $9 (A5 $9 $9 (! (r. (Y; (*N (ѵ\ (oy $9 $9 $: $: $: $: $: $:Ʋ $:ʲ $:Ӳ $:ײ $:߲>Q$ (/F ([Q $':U $!:e $L:i $F:y $u:} $k: $: $: (^ $: $: $: $: ( ̳ (ڳ  (W ( @ (W%/ &u8 (A0C $;G $ ;R (` i (Ww (  (Wô &eԴ $-;ش $+; & $@; $:; $e;# $_;(EZdy K q ~ (  &  $; $; ([& $;* $;? (J $<N $<S ( a (o x (W ( @ (WȶҶ * & $ $A<( $=<- & 6 $_<: $[<C & P $u<T $s<^/h/ $< $</; $<ŷ $<ϷVٷ &  $< $<V ];9gC &% Ulj2/ F ϸT , (kQ) $<- $<2 ([= $<A $<F (Q $=U $=^h &zy $!=} $= &z $5= $1= & $K= $I=ڹ $Z=޹ $X= $i= $g=$. &? $x=C $v=Las (g0к (F1ۺ $=ߺ $= (! ([ $=  $=w !-S (a ([ (G (f ( (Ի (H߻ ([ $= $= $ > $>) $5>- $1>= $S>A $K>P $>T $y>e (0p $>t $> $> $>ȼ &ۼ ( ([  (P- (S< (+fC Z ([e $>i $>y $9?} $/?  &  $f? $d?  ս $u?ٽ $s?   $?  $? $? $? 7 A Y $?] $?f $?j $?s   & $? $? þ ھ:  &, $? $? $? $??  &?& $@* $?3 $@7 $ @@ $'@D $%@M? W &Rg $6@k $4@t $G@x $C@ $]@ $[@ &R $n@ $j@G ¿W տr  (1x ([ (mI (A0 (A04 ( u: &E ([P $@T $@Y (d $@h $@m (x $A| $A (l $nA $XA (* $A $A $?B $;B $fB $XB (j $B $B (P $,C $C $C $C $C $C (+* $C. $C3 (ɼ> $DB $DP $ET $DY ( g (u ~ (W( (  (W  ( ` (W (  (W(2GG (R $tEV $rE[ (f $Ej $Eo (B/z $E~ $E ( $E $E (A5 $E $EG ( (r (Y (* (ѵ  (G&G? $EC $EL $EP $EY $E] $Ef $Ej $Es $Ew $E $E $E6 ( $ F $F ( $F $F (B/ $+F $)F ( $ $KB $KK $ LO $ LYRc &t $Lx $Loo $/L $-L $@L $>L $OL $ML $cL $aL-7OYv $tLz $rL $L $L $L $L $L $L $L $L $L $L  &( $L, $L1 &: $ M> $ MISpz!! $(M $&M $9M $5M! $OM $MM..! $^M% $\M..D:] $mMa $kMkBuB $|M $zMBF:JJ $M  $MJJ6 $M: $MCJMJf $Mj $Mv^ & $M $Mf &# $M $Mfo &3 $M $M &3 $M  $M $N $N $AN# $7N, &F9 $jN= $fNC^h $N $~N $N $Nf!J (U &Z1 $N5 $N: (E $NI $NN ([Y $O] $ Ob (o (lz $PO~ $FO ( $O $O ( ( $O $O (Gp $ P $P (§|" ( (e &  ( $9P $+P (( $P, $P1 (B/< $P@ $PE (P $PT $PY (A5d $5Qh $-Qm & r (} $kQ $gQ (r (Y (* (ѵ (Y! &,  $Q $Q $Q $Q  $Q $Q $Q $Q$ $Q( $Q1 $R5 $R>Sh}&F!P &pa $CRe $ARn $SRr $QR{! & $cR $aR $sR $qR!!!  &  $R$ $R. 8 &I $RM $RR &[ $R_ $Rh r & $R $R & $R $R!!!! & $R $R! $S% $S.!8 &I $SM $SV $+SZ $)Sd!n!!1!1!1!1!O! O!( $@S, $>S5 $OS9 $MSBO!LO!e $aSi $_Sr $pSv $nSO!O! $S $S $S $S!! $S $S $S $S! $S $S'!1!N $SR $S[!q! $S $S!! $S $S!!! !!4 $T8 $TA!K!c $Tg $Tp!z! $*T $(T! &A  $>T $:T! &Y  $VT $TT! ! &i  $iT$ $cT) &i 2 $T6 $T? $TC $TL $TP $TY & f $Tj $Tp$"|"|" $U $ U $!U $U" !."< (G0>^ ([i $V $:V  (+ $]V/ $YV4 (A5? $|VC $xVHW>Y (k (rx (Y (* (ѵ (W>W> $V $V $V $V $V $V $V $V $V $V $V! $V. (< E (WS0aK>k &| $V $V??? $V $V????1>;>X $V\ $Ve $ Wi $ Ws>}>>>>>>>??, $W0 $W9 $+W= $)WG?Q &b $@Wf $8Wk &t $nWx $jW????V? &$ $W $W $W $WV?  &4 $W  $W) $W- $W7`?A`?Z`?f? &D $W $W $W $Wf? &W $W $W $X $Xp? &g p?>x?Hx?ex?ox?z? &w $X $X &w $,X $&Xz? & $GX $EX & $\X $ZX?? ?R?\ &m $kXq $iXz $zX~ $xX? & $X $X $X $X???? &, $X0 $X9 $X= $XF?P &a $Xe $Xn $Xr $X|???? & $X $X $Y $ Y? &  $Y$ $Y- $/Y1 $-Y;?E?^?@@ $?Y $=Y@@ . (h  ([ (Sc#: ([E $[YI $OYY $Y] $Yb (+m $Yq $Yv (P $Y $Y $Z $Z ( $DZ $>Z ( $jZ $dZ (B/ $Z $Z ( $Z $Z (A5  $Z $Z& (8 (rE (YR (*e (ѵs ( $[ $[ $[ $[ $[ $[ $[ $[ $([ $&[ $9[ $7[! $I[% $G[.8Q $[[U $Y[^h $m[ $k[\\ $[ $}[ $[ $[ &% $[ $[ &5, $[0 $[9 $[= $[FP &Ea $[e $[n $[r $[| &U $[ $[ $ \ $\  &e $\  $\) $)\- $'\7AZ (  ([ (^ (A0 ( ([ (: (n+ (*8 ( B 0P (c (p (} (B/ ( (A5 ( (r (Y (* (ѵ (  ( `! (W/8: (eRL ([s (: (n (j (   ( ( ( (B/ ( (A5 ( (r'0 (Y= (*L (ѵZ (l (z  (W@ (bU ([ (5 (j (P (+ (>! (:. (n; (*H ( R | ( (1 (  (WH ( ( ( ( (B/ () (A57 (I (rW` (Ym (*| (ѵ ( ( ( ( ([ (: (* (m# ([= (^W (A0f (q &V| (t $A\ $7\ $\ $t\ ( $A] $%] $] $] ( (e& &m7 $^; $]@ &mI $^M $^V $^Z $^c $#_g $_p $}_t $a_} & $` $` & $/` $` $` $` $Qa $9a & $a $a $'b  $b $b $ub* $3c. $c7 $d; $dD $dH $dQ $eU $d^ $eb $eku & $f $f $f $f $-g $)g & $Eg $Cg $\g $Rg $g $g $g $g $g $g!+H $gL $gUk7u, $g $g $g $g & $g $g &( $g $gC &; $h $hC &N $.h $*h&C0 &^@ $HhD $DhI &^R $bhV $^h[Hw\\ $yh $wh $h $h`c &n $h $hcf6 $h: $hCMf $hj $hs $hw $h $h $h &~ $i $ i $Fi $>i $xi $pi $i $i $i $i &~ $i $i &  $i $i!: $$j> $"jG $5jK $3jT $5jX $3jc &p $Jjt $Dj} $qj $ij $j $j $j $j $k $k & $Kk $IkM & $]k $Yk $zk $vk $zk $vk  $k $k $k $k' $k+ $k5 &B $kF $kO $ lS $l] &f $"lj $ ls $2l $0lho (7A &R $FlV $Bl_ $`lc $\lh &q $zlu $vl &- $l $lyy $l $l $l $l $l $l &= $l! $l+5 &MB $lF $lOY &`j $ mn $ mw &p $'m $#m &p $Am $=m $Xm $Vm $gm $em% &2 $vm6 $tm?Tn~x & $m $m $m $m $m $m $n $n $.n $*n & $Kn $En $sn $kn % $n) $n2 $n6 $n? $nC $nN &[ $n_ $nh $nl $nu $-oy $%o $fo $^o $o $o & $o $o & $o $o $o $o $o $o $p $p $=p  $9p $^p $Zp  &- ${p1 $yp: $p> $pH &Q $pU $p^Ww $p{ $pW3yU (",I $pM $pV $pZ $pc $pg $pu $p $p $ q $q $q $q $'q $%q & $8q $4q)3 &&@ $RqD $NqMW &9h $lql $hqu &I $q $q &I $q $q $q $q $q $q# &Y0 $q4 $q=Rk &i} $q $qRR $q $qY & $r $rg & $r $rg &* $ r. $r7 &@ $4rD $.rOgYguggggv & $Vr $Tr & $kr $crvv $r" $r+ $r/ $r8 $r< $rG\f0:W $r[ $rd $rh $rq $ru $r $r $r  $s $r $s $s & $s $s! &. $0s2 $,s<$F &S $JsW $Fs`$j &"{ $ds $`s$ &2 $~s $zs &2 $s $s)>> $s $s $s  $sB,E6 &BC $sG $sPEeH &R $s $s $s $s &R $s $s &b $ t $ t , $t0 $t9 $-t= $+tK $x @ @  $Rx  $Px @ @,  $ax0  $_x9 @O PY Pr  $pxv  $nx  $x  $}x  $x  $x  $x  $x  &J  $x  $x     $x $x  $x $x 1K U r $ yv $y $y $yk  (i ( ([ (5 ( (" (e1 (,? ([M (^ ([j (6v (dN (P ( K (A (   ( ( (o (  ( # (W1`@ (M (Z (B/g (t (A5 ( (r (Y (* (ѵ ( ( ( (B/ ( (A5# (5 (rB (YO (*^ (ѵl ( ( ` (WX (  (WP ( ([ (x (# (mI5 (F@ (A0O ( a (F1| (c (<^ (  (Ę (} (u  ( (/8 (}E (` (T{ ( (} (l ( (} (l ( (r$- (Y: (*I (ѵW (h (p ( (h (n (L (, (n ( ( (L;; (pG (S (ul ( (A (K (u (W (Z ( (Z (W (U% (! (e2 (P ( a (Wm (Zz (I (Z (W (ͧ (L ( ( (RE (! (2 (0? (lQ (0d (bpu (3 (xh (: (u (r  (: (u (Un ( (f ( (A (h# (SI: (V (SIm (% (} ( (FY (\ (} ( (? ( (}  (#  (4a& (|8 (E (T (&ab ( ~y (! (P ( ( ( (e (8 ( (=w ( (  (. ( E (JW (~m (K ($ (^ ([  ( ( (^ (4P (M ( (M (b (%) (^7 (oo? ('W (^d (| (^ ( (% (^ (p (wG (M (% (^ ($ (%0 (^I (GU (g (Qp (x (_ ( (FY (j3 (ѵ ( (n (} (5 (O (_, (95 ( = (hc (cp (d| (p (d (c (p (g ( ( (z4 (N (ss (f (l| ( (( (p (=, (!R (}_ (ʏl (e~ ( ( ( ( ( (D  (+ (D (  (7  (P*  (i9  (L H  (W  (e g  ( w  (  (  (  (  ( V  (}  (ʏ  (e  (  (W! (! (#! ((2! (@A! (XP! (pd! (!t! (aH! (O! (L! (-! (u! (! (! (! (ο! ( " (" (-" (9" (G" (W" (}d" (ʏq" (" (" (" (~E" (" (" (" (>" (J" ( # (# (I)# (]7# (3?# (yK# (9W# (c# (6p# (o# (}# (# (}# (# (}# (# (SI# (1G$ ( $ (!$ (-$ (}:$ (X$ (kq$ (6i$ ($ (hD$ (]$ (Q$ (ȃ$ ($ (n$ (n% (n% (n#% (q;% (}G% (?T% (~Po% (}|% (h% (}%%%p& $.y& $(y& $Py!& $Jy*& $ry.& $ly7&}A&}]& $ya& $yj& $yn& $yw& $y{& $y& $y& $y&&&& $y& $y& $z& $z& $7z' $-z '' &x&' $iz*' $ez3' $z7' $z@' $zD' $zM' $zQ' $zV' n'!x' &' $z' $z' $z' $z' $z' $z' $z' $z'@'W' &' ${' $ {' $.{' $,{( $?{ ( $={( $N{( $L{(v>((Y( $e{]( $]{f( ${j( ${s( ${w( ${( $$|( $|( $V|( $N|( ${|( $y|( $|( $|( $|( $|( $I}( $C}(w-(V-)5-)@))@)<) $x}@) $r}I) $}M) $}V)@)`) & m) $}q) $}z) $}~) $}) $}) $}) $~) $})c)))) &$ ) $~) $~) $1~) $/~* $G~* $A~ * $h~* $f~*)C**M* &7 ^* $~~b* $x~p* $~t* $~}* $~* $~* &7 * $~* $~* $* $*** &[ * $/* $+* $L* $J* $a* $[+ $ + $+*;+ &n H+ $L+ $U+M+_+M+x+ $|+ $+ $+ $+ $+ $+++ & + $+ $+ $+ $+ $+ $+ $ + $ ++,+,+9, $=, $B,+T,-^,-{, $+, $),-,*,v+, & , $B, $:,=*,=*- $u- $s#- $'- $0- $4- $?-+I-+f- $j- $s- $w- $|-+- -+- & - $- $- $܀- $؀- & - $- $-+-+. $ . $ ". $&. $+.+B. V.+`.+}. $4. $2. $C. $A.,. .,.,. $[. $Y. $j. $h.+,/ &/-0/-M/ $Q/ $Z/ $^/ $c/-z/ &/+/,/<,/I,0U,0g,:0 D0~,_0i0,05-0 & 0 $0 $0 $ȁ0 $Ɓ0 $ځ0 $؁0 $0 $0V-0V-1V-1 $#1 $,1 $ 01 $91 $=1 $F1V-P1 & ]1 $-a1 $)j1 $Jn1 $Hw1 $\{1 $Z1 $k1 $i1w-1w-1w-1 $|1 $z1-1-1-2 $ 2 $)2 $-2 $22-I2^2-h2-2 $2 $2 $Â2 $2-2 )2)2|)2=*3'3,B3@[3,v3h3-33+-33-3-4 B4 &5 "4 $߂&4 $ق/4 $.34 $<4 $@4 $׃R4 $,V4 $$_4 $c4 $Ll4 $Rp4 $Jy4 $}4 ${4 $ʅ4 $4 $|4 $`454 $4 $4/4 $'4 $5/5/'5 $c+5 $a45 $c85 $aA5 $cE5 $aP50i5 $tm5 $rv5 $z5 $5 $5 $5 $5 $5|05 &K 5 $5 $5 $̇5 $Ƈ5 $5 $ 505 &^ 6 $$ 6 $6 $K6 $E#6 $r'6 $l06 $46 $=6 $ÈA6 $J6 &q S6 $W6 $`61j616 $ 6 $ 6 $ 6 $ 6 $6 $6 $ 6 $ 6 $ 6 $ 6 $.6 $,6y16 & 6 $@6 $<6 $Z7 $V 7 $t 7 $p7y1 7 & 07 $47 $=7 $A7 $J7 $N7 $S7 & \7 $ `7 $i7 & v7 $(z7 $$7 & 7 $7 $71717 $7 $7 $7 $7 $Ŋ7 $Ê7181(8128 & C8 $׊G8 $ӊU8 $Y8 $b8 $f8 $k8181818 $8 $81818 $%8 $#8 $48 $2 9 $E9 $C9 $\9 $Z&9&209 & A9 $oE9 $kN9 $R9 $W9 & `9 $d9 $m9 $΋q9 $̋z9 $ߋ~9 $݋9&29 & 9 $9 $9 $9 $9&29&29 $9 $9 $#9 $!9&2:&2: $3: $1(: $E,: $C8:C2B:C2_: $Uc: $Sl:C2v:C2: $g: $e:C2:C2: $y: $w:O2:O2: $: $;O2;Y2"; & 3; $7; $@; $D; $I; & [; $_; $܌h; &! u; $y; $;Y2;Y2; $$; $"; $$; $"; $$; $";2;; Y<2"<2?< $4C< $2M<2f< $Fj< $Dt<2~<2< $U< $S< $g< $e<2<2< $w< $u< $< $<2<2= $= $!= $%= $1= 3;= 3X= $\= $e= 3o= 3= $ʍ= $ȍ= 3=3=3= $ٍ= $׍= $= $= $= $= $.= $(> &4 > $K> $G>`37>d3A>d3^> $cb> $ak> $uo> $st>p3>C2>2> &D > $> $>x3>x3? $? $? $? $? $? $*?34? &T E? $I? $R? $ɎV? $Î_? $c? $l? $p? $u?3?3? &j ? $-? $)? $G? $C? $a? $]?3? &| @ ${@ $w@ $@ $@ $"@ $'@ &| 0@ $ˏ4@ $Ǐ=@ & J@ $N@ $W@ & `@ $9d@ $7o@3y@3@ $K@ $I@ $Z@ $X@ $i@ $g@ 4@4@%4A & A ${A $w$A $(A $1A $5A $>A $BA $GAD4kAD4uAD4A $ҐA $АAN4AS4A & A $A $A $A $A $A $A $8A $6Av4$B4.B & ?B $JCB $HLB $[PB $WYB $s]B $qbB4B4B & B $B $B $B $B $֑B $БB $B $B4C5C & "C $ &C $/C $)3C $!F $2GF $cKF $]TF $XF $]F5F5F & F $F $F $F $F $•F $F $ѕF $ϕF6F6F6G $G $$G66G(6@G & QG $UG $^G $bG $kG $)oG $'xG $8|G $6GB6Gl6Gl6G $IG $GGv6G6G & G $\H $X H $y H $wH $H $#H $'H $,H6JH6TH & eH $iH $rH $ϖvH $͖H $H $ޖH $H $H6H6H6H $H $H6H6I &I $I $#I $0'I $.0I $A4I $?=I $PAI $NFI 7jI 7tI &I $aI $_I7I/I0IS1I^1J3:Jn5^Jy5|J6JJ mJJJ7J $xJ $pJ $J $J $LK $4 K $ΘK $/K $I3K $?EK $IK $y[K $_K $hK $ԙlK $̙uK $yK $K $K $Ka;K>;K;K8K8K $9K $3K $ZK $XK8L &&L $mL $iL $L $(L $,L $5L $9L $>L?8lL &9yL $՚}L $њLb8Lb8L $L $L $L $L $L $L8L &IL $L $L $#M $ M $DM $BM8CMJ9MMJ9jM $VnM $TwM $e{M $cM^9M "M9M9M $}M ${M $M $M9M NV:NV::N $>N $GN $KN $PNj:gN {N:N:N $˛N $ɛN $ڛN $؛N:N N:N: O $O $O $O $ O:7O KO:UO:rO $vO $O $(O $&O:O O:O:O $@O $>O $OO $MO:P P:%P &\6P $g:P $eCP $vGP $tLP;cP wP;P;P $P $P $P $P;P P;P &lP $P $ Q $ԜQ $ҜQ $Q $"Q>;JQ>;TQ>;qQ $uQ $~Q $Q $Q $Q $Q>;Q &Q $+Q $'Q $HQ $FQ $ZQ $XQ $kQ $iQa;Ra;Ra;.R $|2R $z7Rk;IR;SR &dR $hR $qR $uR $zR;R R;R;R $R $R $ÝR $R;R + S;S;4S $۝8S $ٝAS $ES $JS;aSuS;S &S $S $S $S $S;S S<S &S $)S $'S $8S $6T<T -T<7T &HT $PLT $NUT $_YT $]^T-<uT :T2<T &T $wT $uT $T $TF<T TK<T &U $U $ U $U $U_<-U AUd<KUd<hU $ŞlU $ÞuU $ԞyU $Ҟ~Ux<U IU<U<U $U $U $U $U<U V<V<8V $Y ( CY ([Y (#gY (uY (HJzY (%Y (5Y (Y (BZ (!Z (Z ( 'Z (3Z (/?Z (?KZ (:WZ (6 cZ (7oZ ({Z (mCZ (CZ (AGZ (Z (3Z (Z (*Z (Z (7Z (Z ()6Z ([ (H[ (P/[ (N*[ (nD6[ (+B[ (B?N[ (aAZ[ (f[ (_r[ (~[ ([ (=4[ (8[ (=4[ (nG[ ([ (?)[ (+?[ ( \ (1\ (+%\ (?)2\ (/Z\ (g\ (?)t\ (W\ (\ (Z\ (` \ (\ (E\ (z\ (] (E#] (1] (?] (#M] (6[] (i] (4w] ( ] (J] (?)] (I] (G] (1] (a] (] (] (^ (f!^ (  ^ ( /^ (=^ (/K^ (Y^ (s(g^ ($u^ (1^ ('^ (^ (w^ (iA^ (^ (^ (A^ ('_ (x._ (!_ (-!0_ (.?_ (#N_ (6]_ (+l_ (M{_ (_ (_ (L_ (_ (5I_ (2_ ("?_ (` (` (!` (0` (?` (aN` (4]` (l` ({` (>` (>C` ( ` (A$` (I` ('` (k8` (2` (a (a ( a (kJ/a (,>a (hMa (G\a ('ka (za (a (a (; a (1a (Ba (0a (s;a (a (Ub (ob (b (<.b (>b (Jb ( <b (Bb (+b (r?b (eb (=b ( c (/8c ( <ec (Brc ("9d (]Xd (xd (Gd (d (d (d (ed (!!e (0e ( g (4)g ([8g (Hg (,g (@g ( h (h (HPh (c*_h (nh (~h ($h (?h (h ($h (h (1h ( h ( h (i (Ai (]#$i (3i (2Bi ("Qi (dB`i ("oi (~i ( i (i (i (Ii (i (i (i (@i (Vj (j (?(#j (m*2j (Aj (#Pj (_j (nj (}j (@j (j (j (Cj (0j (yj (Ij (k (Gk ("k (61k (E@@k (GPk (%`k (9pk (wk (k ('k (Bk (<k (9k (k (9k ($3l ( l (< l (0l (@l (Pl (VJ_l (*}l (l (l (l (4l (Z(l (,l (p+l (#l (N8m (W/m ( "m (y1m (|(@m (Om (*^m (cmm (|m (m ( m (om (Z%m (!m (m (m (m (&n (;6n (E+!n (0n ( @n (2<On (> ^n (mn (L3|n (On (Cn (In (cJn (n (2 n (<n (6o (V2o ( o (/o (>o (+Mo (0\o (Jko (zo (o (Qo (Ho ($=o (o (o (Co (:o ( 8p (p ('p (D.p (=p (Lp (@[p ()jp (%yp (p (vp (Gp (p (1p (p (p (%p (c&q (Jq (90q (-q (>3v (Jw (#w (\-w (*;w ()Iw (1Ww (ew (w (6w (0w (w (vDw (mw (w ({<w ( w (#x ((x (;x ( Qx (kx (?x (Q x (mx (x (x (x (x (i.x (yGx (y (y (!y (/y (5=y (;Ky (2Yy (o<gy (Qy (y (Jy (r y ((y (y (D)z (*z (P;z (BMz (l,`z (nz (M+zz (`%z (Dz ( z (z (./z (g z (z (m#z (z ( "z (+-{ ({ ({ ((,{ (9{ ($G{ (c{ (Wq{ (;{ ({ ({ ({ (H{ (R { (f{ ({ (\F{ (H| (u= | (| (*+| (H| (/Y| (4_| (e| (&k| (r| ($| (| (| (1| (| (| (| (>| (@| (+ } (@} (C F} (ZS} (z} (C} (+A} (J} (t-} (,} (7} ( } (8} (} ( ~ (~ (>'~ (5~ (!/C~ (Q~ (H_~ (%m~ (l3{~ (z~ (4~ ( "~ (J~ (~ (D~ ( @~ (~ (~ (B (@> (1 # (A1 (H? (:M ( [ (p (} (_  ( ( ( (t (T$ (e (^H ( ( ($ (WH (7Y (be (.;r ( ( (( (  (1 ( &̀ (mـ (<A ( N (GB ( ( (FI\ (`i (v (  (J (0Ƃ (A. ( ; (|=H (=U (b ({ ( (n ( (ƃ ($ԃ ( ( ({ (A (P. (M (] (T,j ( x ( (i ( (pI (τ (&݄ ($ ( ( (z9' (_7 (*G ( W (e (s (13 (; (- (A (pIʅ (\؅ (  (o  (;  ( (# (f (k (u (x ( (4 (  (1 (Ć (?) ( (N- ( (D (oU (C[ (ca (q ( ( (t  (> (· (ڇ (x ( ( (E" (:?/ (eB (Y ( f (=s (1 ( (E ( ( ((ƈ (>ӈ (* (fI (F& (3 (U@ (GB[ (l (Tr (?x (J5~ ( (" (  (q5 (  ( (6‰ (Љ ()݉ (( (v2 (  (Q* (8 ( D (Q#Q (J^ (x (N' (, (@ (@9 (H (Ȋ (}Պ (  (T7 (R0 ( (H (R0* (F8 (uE (S (a (n (R0| (P (  ( (X' ( (‹ (\Fϋ (܋ ( (r (: ("* (7 (dD (Q (:?k (x (: (E (S (y? (D (̌ (\Fٌ ( (C  (H (@# (:/1 (D (b (1n (J{ (p (k ( ()F (" (Cʍ (׍ (u (>& (2 (+> (#O ([ (+l (=y (5 (. ( ( ( ˎ (؎ ( (C (  ( ( # (C: (G ( T (a (#n (; ( (6 (  (dÏ (Bڏ ( (P (8  ( 0 (@# (/ (; (Y$Q (n@n ( ( (  (n/ (ǐ ([AӐ ( ( ( (W (^% (A2 (B? (qL (Z (n (z ( (# (/ ( ($  (fƑ (9ӑ (G (  ( ()( (S;" (S< ()J (W (e (Nr ( (S ( (o ( ( (8ϒ (Dܒ ( ( (/* (* ( (X* (C8 ('E (R (cH` (m (Fz (# ( > (  (# (Q#͓ (0ۓ (= ( (0 (` ( () (S ('` (n (z (~  (' ( (' (' (є ('ޔ ( " (9 (_I2 (<> (oL (Z (h ( "w (q (C (  (= ( 9 ( (Z% ('Õ (?ѕ ( ( (  (  (@& (SG4 (B (\9P (i1_ (SIm (%{ (V (6+ (1 (  (1 – (Ж (xޖ ({  ((' ( ( (s& ( 4 (B (#P (^ (Jl (n%z (/6 ( (5& (4 (xI (Η (Zܗ ( (GD ( (+ (H" (0 (A> (?L (EZ (Z0h (v ( (! ( (C ( (m̘ (\!ژ ( (G& (l ( (nA! (,/ (:1= (K (Y (g (Zu ( ( (  ( ( (Də (4י (  (k+ ( (   (e. (l< (* J (1X (f (,t (< (  (  (t3ʚ (ٚ (s ( (! (o (& ("- (G&; (I (FY (i (8y (  (c* (,I (% (?ɛ (a5؛ (3 ( ( ( (+I (W (%d (Fq (:~ (e ( (G (& (JϜ ( ( (?) (c (- (4Q (-[ (i (w ( (= (E (> (2 (˝ (ٝ ( ( ( ( (  (,:- (<; (<2[ (uh (u ( " (e ( ( 1 (1О (~ ( (4  (2  (- (9BT (97a (Fn (2{ (B (w" ( ( ( (Uɟ (>֟ ( (bG ( (d-  (  ($ (1 (J> (EK (1X (e (; (9B (' (zˠ (Eؠ (J (U1 (  (), (9 (F (_ (..s (C} (0? ( (H (V2 ( (- (Q͡ ( ڡ ( ( (< ( (W (( (%5 (B (O (JA\ (i (v (! ( ( (F; (` (-ɢ ( H ( ( (:  (! (F( (>D (R ( ` (n (| (>@ (  (  (4 (o£ (У (ޣ (D ( (;6 (E+ ($ (Q%2 (@ (nN (D\ (j (%x ( (% (N  (G (! (1̤ (U<ڤ (% (-4 (0 (( (E  (-. (*B (sO (?B\ (ui (v (7 ($= (B ( (g (G (ȥ ( ե (; ( ( " (h  ( (/# (46 (1E (aO (BY (g (/u (;J (  ( (\ ( Ŧ (y ( (G (& ( (& (3 (@ (DM (a (n ({ ( ( ( (7 (G (,Gç (ͧ (yڧ ( (: (; ( (8 ( ( (5 (B ( O (YE\ (:i (Q6v ( ( ( ( , (}/ (Ө (D (W (F (@ (' (:" (B/ (> (?K (e (r (  (C ( E (Aé (Vϩ ( (+, ( (- (! (O & ( 3 (@ (HM (.Z ($g (t (S* (2ª (Ϫ (;ܪ ( (f3 (! (U? (D (!* (R7 (%D (EQ (,^ (Vk (` (k ( " ( ( (sHɫ (p4ի (  ( (  (7 (8# (21/ (< (O (~\ (o (R| (u (J ( (N' (. ʬ ({֬ (R" (d (x  ( ( " (" (C (DP (F] (Dj (Wx (i (# ( (Dȭ (Eխ ( ( (  (@ (T (@,b (,8o (| (E ( " (< (! (! ( ˮ (cخ (# (m (8 ( :> (pK ( "X (nFe (Ar (! ( ( ( (F (:ӯ ( ($ (C (  ( (W' (f4 ( "A ( N (b/[ (!h (!u (G (  ( (L () (g=ð (а ()2ݰ (: (X ("& ( (#" (#K (a ()m (u ( (- ( ( Ŷ (Ѷ (* ( (G (0 ( = (J (2=X (k (? ( (; (\÷ (ٷ ( (&  (" (00 (9f (Gs ( ( ( ( (&ϸ (ݸ (& ( (J9" (0 (W=> (L (3Z (h (E (# (S9 ( (ɹ (5׹ ( ( (  (Z& ( "= (#L ( 7p (J (; (: (: (^ (Ⱥ (*ֺ (2 (+C (#C (D% ( (y%0 (> (L (8Z (<h ( v ({ (Q ( (z5ƻ (Ի ( (= ( " (U (= (* (8 (F ()_ (&m (b1 ( (1 (ؼ (c( (yG ( ( (>9 (vS (:Fl (/z (C (C ( (ƽ (zԽ (u ( ([@  (v (3( ( 6 ( D (]#R (` (n (| (G (q (J, (a) ()H¾ (vо (?߾ (- (J7 (P&  ( (J* (<9 (H (W (+f (u ( ( (A (R (nϿ (K?޿ (: ( (  ({ (U) (t@8 (>;G (V (e (<t (J (1 (  (m (%D (9 ( (' (> (  ( (( (5@7 (<8F ( U (4d (! (d ( (u (p ( ( * () ( ( + (8 (7K (X (e (7 ( ( (C (' (7 ( ( (3 (7 (>I ( (17? (uV (Sq (4} (J (: (; (" (2F (  (& (L" (ZG (A (e (G* (eF8 (I*W (d (1r (+ (?) (/ ( " (u (` (  (C ) (6 (yI (e (q (/" ( (|F (4 ( ( (> (X (* (  (  ( ( ' (J4 (0A (N (7$b (%o (/ ( (2 (. (  (f ( ( (/ ( (E! (/ (= (Q (_ (m (`:{ (F0 (yA ( (T) (9 (J (  (J (% (  (c (# (F1 (x? (2M ($[ (qi (%w (09 (H (#) (E ( (: (e ($ (  (p' (#9! (>77 (]F (j5V (E.l ({ (! ( ([ (% (5 (6 ( (X ( ($ ( ( ( 5 (B (/O (\ ((i (v (> (D (' ( (}" ( (- (B (6 (  (|8 (Q) (&7 (6E (S (a ((o (6} (jH ( () (H ( ( ("! (  (k (3  (# (L% (|'4 (1C (R ()a ('p (+ ( (5' ( (= (k0 (  (3 (n (/ (  (?% (54 (FC (R (Ga (Fp ( ( ( ( ( (3 (K (s (7 (t (*& (e@5 (D (4,Y (j (p (vF (S (4` (_m (-z ( ( (  ( (E1 (*> ( K (CY ( f (;s ( ((0 (( ( (  (4 (2 (/ (d  ( ( ( Q (.^ (k (/x (" (. (6" (/ ( ( " ( ( (b (A'n (: (  (4D (+5 ( (*> () (=  (F (> ( (" ( (4 (z: (O.' (|#A (9BN (-e (Dr (" (Z, (C  (e (0 ( (r (= ( (F0 (-i (Iv ( (# ( (. (" (: (C  (/ (e (0 (5 (:Q (_ (@!x (3 (= ( (, ( (H  (i (* (B (J7  ( (5' (;4 (9BA ( s (V  (- ( " (wJ ( (I ( (; ( ( (G, (9 (HF (S (d` (,m (}z ( ([+ (m& (J> (J: ( ( ( ( (* ( ( (B (( ($5 (B ([O (vB\ (;i ( w ( ( (, (Q ( ( (Z (C ( (( (~-  (?) () ( 6 (C ( v ( ( ( (% ( (~- ( (k  (I ( (-  (& (0J3 (`@ (zM ([ ( (; (< ( ! ( (/ (t  (S4 (B ( Q (r (^  ( (& (># (" ( (KH ( ( (;A ( ("  (0 (0 (P4! (:' (- (E= (oK (ZW (h)h (,n (t (2{ (4 (' (@+ ( (3 (7 (S( (?  ('; (D" (=/ (;:< (0U (b ((p (~ (2 (5 (m (B (  (8 (#I ( (! (7 (m (, (S: (&H (W (Ez ((< (I (G (; ( (B (#: ($ (* (, (i$ (e# (0 (B= (IJ (^ W ('d (($q (N~ (N! (3 (: (z  ( (F (  (  ( (m  (> (( (L) ((7 (WE (S (+#a (-@ (LE (5 ( ( ( ( ( (1 (7 (S (. ( (@ ('  (&  (, (' ( ( ( ( (u ( (( (3C (% (= (F (  ( (m  (@ (z ( ( (k ( (- (A+ (9 (?G (<U (fc (q ( (s (L (l: ( ( (? (( (! (& ( (U?( (+7 (E (/S (r (C (J ( ( (|> (@ (a> (, (; (7 (  (  ()+) (7 (7E (\?S ( a (o ({)} (Q@ (W5b (p (~ ( (< (n (4 ('  (g@ (8N ( \ (Gj (hx (. (4# () (f (= (1 ( ( 5 (9 ( ({ (  (. (< ($J (OX ( ( (} ( () ( (' (D: (` (EI (V (c ({6p (_$~ (f+ (H  (* ( ( ( ( ( (= ( (q (%4 (}+- (w; (I (?W ("e (@s (6 (s ( (z ( (@ ( ( (e? (  (OC ('B (F( (Z2 (< ( J (;X ( "t ( (2 (3 (t, (L ( (.0 (  (I (' (J' ()? (JM ()Z (Gg (  (|2 (I ( (L (> (CF (? (9 ( (+ ( (' (5 (C (EQ (a_ (ym (,{ ( (B (A (* ( ( (- (h< (B (h ( (# (51 (&? (/M (L[ (*i (w (D ( (85 ( (4 ( 3 ( (*% (L ( (E (. (J (` (0> (z (9L ( (z= (@ (k ( (5 (+ (,; (+L (R ( X (F  ( (, (5. (M<; (H (DU (4b (o (  ( ( ( ( (| (|7 (6 ( (  (?)  (, (K28 (D (P (Y] (mj (Gw ( (: (t/ ( ( (8 (, (Z( (" ( ( (. (, (u9 (:F (4S (x (C  ( (H (@ (= ( (H ( (8  (. (H< (l3J (X (f (\7t (C" (7 (3 (p (  (> ( (, (A (%4 (' (91 (J (;W (@d (@r (Q# (z! (r (/ (, (3 (v  (  ( (7% (n$  (4 (/ (' (e4 (9A (0N (<[ (Fh (< (} ($. ( (H (G ( (+ ( (! (G/ (*= (7K (Y ( g (u (, ( (?= (U (G<4 (A (/N ([ (uh ({ ( (l3 (?= (/ (I (, ( L (:Y (Df (a3s ( ( ( (:/ ( (Y| ( ( (  ( (/ ($1< (EEI ()Ja ({ (*E ( (c ( (NB (T$ ( () ! (5. (O ; (E4^ (k (u ( (]C (  ( ( (U (G< (: (9 (C (H1 ( ( ( ( (  ( (W  (E!  (<.  (  (I  (C  (!  (] '  (-  (4  (B  (P  (R^  ("l  (  (D  (B  (n  (F  (  (  (  (2  (i9A  (4t  (ZD   @  (5H    (    (  r  (  G  (  =  (H  Q  (g2Y  (jm  #xr  (Rw  ){  )  '  (eN  (R  (N  (!L  (M  (Q  (Q  (N  (wN  (L  (K  (yL  ()N  (6X  (SO  ({Q$  (Q2  ($R?  (2NL  (9LY  (7Kf  (Ks  (V  (IR  (lL  (nQ  (-L  (R  (RW  (nR  (P  (L  (W  (R  (V  (N  (nM  (O$  (O1  (HM>  (NK  ()OX  ( We  (Wr  ( P  (jV  (:P  (K  (9V  (Q  (K  (K  ( M  (J  (O  (W (uK (M (cO+ (O7 (LS (?Q_ (Mo (Qu (ON{ (bP (N (L (V (Q (0W (}N (tW (N (Q (V (Q (W (O (K (Q (1M (-V (^Q ( X (W (=R. (;M4 (XO: (UR@ (NF (RL (MR (PX (P^ (XVt (FWz (P (V (M (P (VL (HO (xP (M (*P (P (lK (1P (O (M (V (`R (\K  (P (HX/ (aL;J (hQT (K_ (L (Q (hQ (K (L (Q (X  (L! !&1 Fk{  `AAAA"A:@AdkAkAkAkAAAA-AFAUAh8B8B8B8BqBqBqBqBB%B7BHB[CxCCC0@P@"@2P@B@T@p@@@@C C/ SQD[C  1F ( D   D  Z [ ZP !@_ !@s Z C  b S S ^ S ^     - > P b t    o o o o +<M1 ^1 m1 ~1  1      , ; L _ p    ) ) / / / / A ,A BA SA i | _  $ C b t . .      *<Nsvvvv H n    " N x & & & )& 9& I r    / A Rp bp sp p p p p p p p    ' 7 G W h x    0 A \ n    Xsi'!r!yt!/@iAw 4MbUUUU . O l       !%!?!Q!o!!!.!.!.!.!S!!@!S!b "2"5A"5Z"#"#"#"#"2#1#b$G#2#X#2#i#r#y#r##r##r#########$# $#8$#P$#i$#$#$#$#$#$#$#$#$.$%$A%$^%.$v%D$%D$%$%$%$%&?&6W&s&&k&A&:&6&:''$'v5'oM'k_'ow'''''''((#(@(M( \( k((((())mn)m)0)0)0)0)0)0)0*0*0'*7*H*Y*i*y*****+*+*++I'+I5+ E+ T+Iq+I+I+O+O+O+07+07,07;,_7X,s,,,,-;-|----.;.^.".."./)@/=[/=v/=/=/p=/p=/@=/@=0.30.N0p.i0p.0@.0@.0.0.00%10%:1Z%c1%1%1%1%1%1%1% 2%2&-2&82 sE23&T23&_2 l2M&{2M&2 2g&2g&2 2&2&2 2&2&2 3&3&(3&73&F3&X3&g3&x3&3&3&3 f3 '3 '3 3''3''3 )4p'(4p'D4'_4 (4'4'4'4'4'4'4:( 5:(5:(,5:(;5:(M5:(\5:(m5Q(|5}(5}(5 )555566(6p96Y6r66666666677 >7 Z7+ u7. 7. 77@ 7@ 7 7^ 7^ 7(7 8 88 *8 <8 N8 ]8 h8 Gu8. 8. 8 #8P 8P 8P8r 8r 8x8 8 99@9e999999::(:M:v::::;.;A;f;;.;;%/;<*B<*`<*v<*</<?<V<<="=6=L=[=j=y==0=0= >6>T>>>>> :? g? v? ? ? ? ? ? ?: ?: @? @? (@? 7@? H@? ^@? o@? @ @@ A A HAoA AA -B@BLBgB BB C-C pCC6C CC UDDe DE _EuEGEGEGEGEGEGEGEGEG F6F6,F6=F6NF6_F6oF6F6F6F" F" F& F& F& F& F& G& !G& 8GvGGvVGvgGv~GGGGGGGGGH7HVHsHHHHH"IIFIYI"IIIRJ:JOJrJJJJJJ K3KRKgKzKKKKKKK LLR0LoALrPLdLuLLLLLLLMM )M!:M%PM%_M.nM=}MBMJMJMJM^MfMoMNsBNvkNNNN NN NO :OQOO!tOO-!OO ! P :PY!gPPY!PPY!PPY!Q6QY!YQlQa!QY!QQY!QQY!RRY!4RDR!TR!dR!tR!R R R!R R!R!S!S!,S!ASO!PSO!bSO!qSO!SO!SO!S!S!S!S!S!S!T!T!+T!?T!WT!jT!T"T"T"T"U|""U|"=U0>}U0>UK>UK>Ux?VW> VW>?VW>^VW>}VW>VW>VW>VW>VK>V?V>W>W?,W?AW?oW?{W(?WV?WV?WV?WV?Wf?Wf?Wf?Xf?Xz?-Xx?HXz?]X?lX?{X?X?X?X?X?X?X?Y?Y? Y?0Y?@Y@\YYYYZEZkZZZZ[[)[:[J[\[n[[\[\[[[[[[ \\*\B\`g\\`]B]]] ^{^^^^$_S_~__`0```,aRa`a "^la "^xa "^a "^a "^a "^a "^a "^a "^a "^a "^aa "^a(b~hbb4cvdddeeefff.gFg]g5ggggg7g7gCg7hC/hCIhCchCzh\h\hchhhhi2i|Gidi|yii|iiiij|%j6jKjIrjMj|jMj|jMk|kM;k|Lkw^kMjkw{kMkwkMkwkMkwkMkwkw lw#l3lGlal{lllylylllm(mBmYmhmwmm~mm~mm~ nn~/n~Lntnnnnn n o.oPogoooooooo pp,p>pLp_plp|pppRpWpppp qq(q9qSqmqqqqqqqYqRrYrg!rg5rgWrvlrvrvrvrrrrss s$1sKs$es$s$s$s>s>sEsss tt.t=tNthttttttttu*u=uZukuuFuJuJuJuJv-vJ9vJvJXvkvJxvvJvvJvvvv% w* w3wDwWwowwwwwwwxx2/x2Ax2Sx@bx@qxPxxWxZxxx y y /ypQypsypy}y}y}y}y z8zjzzzzz!z!z!z!{W/{W@{WO{Wf{({({(%|)W|f)||)|*|*J})y}@)}@)}@)}@)}@)~@)~)2~)H~)i~)~*~*~*~*+0*M*b**M+M++++ ++,-C=*v=*=*++ €+݀+I,++( 5+D+O \,k,v -- &5-Ɂ5-ہ5-5-V- V-V-.V-KV-]V-lV-}w----Ă-ς )`//`/˃0-p0/!@7S4y4˅/S}// (/Sd/u+0000|0͇|0! ! |0%1L1s11Ĉ1111/1Ay1[y1uy1y1y1y1 y1)y1\611Ɗ1؊1111&151F1Q!@]1p&2}&22ϋ22&2&2&2$&24&2F&2VC2hC2zC2O2Y2Y2ˌ2Y2%Y252G2V2h2x2222 3ˍ 3ڍ3N3 3/3LN3dd3vd3x3x33ʎ333.3H3b3|333̏33:U6L3[3j3|%4%4%4%4ӐD4S4S4S49S4K4\4t444ב44 5*5X5y555Ғ55e6w 5 5 565ד6555575Q5k555655%595d5555Õ5ҕ56(6(6*(69(6Jl6]6z6666Ж6666616B6Q6b 7y77M7Ϙ7J8D88ՙ889:8[8n888š8֚b8b88$8E8WJ9fJ9q "~99 V:V: ̛:ۛ: ::  :):4 A:P:[ h:w: ;; ;՜;;>;>;>;,>;I>;[>;l>;}a;;; ;ĝ;ϝ +ܝ;;;; *<9<D Q<`<k :x2<2< K<K< ƞd<՞d< I<< <#<. ;<J<U ) " 0@f "X "e   1,AT>iy!W   -! @! S! fv v&6FVfvR^$^4oGW`bn,),<7O7_7oc|MMw.>yNaq~':JZjRY\\vv  #3CEScsJJ(;K[ fq     !!V!  Y!" - Y!7 B !Z !j ! " "# # # # .$ $ % ' @)% )8 )\ *o M+ v+ =* + 5- V- .    V  & ]6 `/A L |0_ 1r 1 y1 y1 y1 1 1 &2  &2 Y2 " Y25 N3E x3U 3k 3} 3 3 3 %4 S4 4 4 5 5& 58  5J 65] 5o 5 5 5 5 5 (6 6 66 7'8:b8J8]:m;>;;;<<2<K<K>W>?%V?5V?Ef?Xf?hp?xz?z???????0@P@!@4@DSATAg8BzqBBCC 4SJ,? Q g w   ) / / A A   ' :d Ou bvuz z   & V &V = Mp ] m .ATg~U}.DW.g.{" )?& )f* )s. )2 )6 ): )> )B )F )J )+N )@R )OV )jZ )e )j )o )t )y )~ ) ) ) ) ) ) ), )5 ): )H )M )R )Z )_ )j )v ) ) ) ) ) ) ) ) ) ) ) )  ) )  ) )# )1# )9( )A- )J2 )P7 )W< )iA )yF )K )P )U )Z )_ )d )i )n )s )x )} ) )) )5 )H )X )c )t ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) )% )6 )E )L )W )e  )m )} ) ) )" )' ), )1 )6 ); )@ )E )J ) O )T )#Y )/^ )5c )Ch )Vm )fr )uw )| ) ) ) ) ) ) ) ) ) )# )* )9 )? )F )L )U )[ )d )p )y ) ) ) ) ) ) ) ) )  ) ) ) )! )'& )2+ );0 )D5 )N: )X? )`D )gI )nN )wS )X )] )b )g )l )q )v ){ ) ) ) ) )  )  )!  ),  )6  )>  )G  )M  )Y  )b  )o  )  )  )  )  )  )  )  )  )  )  )  )  )  )  )  )  )  )*  )5 % )? * )H / )P 4 )\ 9 )i > )w C )~ H ) M ) R ) W ) \ ) a ) f ) k ) p ) u ) z )  )  )"  )1 a΂ ) ) ) ) )  )  ) )  )7  )R  )a " )w ' ) , ) 1 ) 6 ) ; ) @ ) E ) J ) O ) T ) Y ) ^ ) c ) h ) m ) r )# w ). | ); )G )O )[ )k )} ) ) ) ) ) ) ) ) „ ) DŽ )̄ )ф )&ք )1ۄ )9 )A )K )S )_ )o )x ) ) ) ) ) ) )! )& )+ )0 ) 5 ): ),? ):D )JI )[N )lS )wX )] )b )g )l )q )v ){ ) ) ) ) ). )= )C )P )W )] )f )r ){ ) )ƅ )˅ )Ѕ )Յ )څ )߅ ) ) ) ) ) ) ) )  )' )1 )B )H )O )\% )b* )h/ )q4 ){9 )> )C )H )M )R )W )\ )a )f )k )p )u )z )  ) )( )/ )8 )H )O )Y )d )n )v ) ) ) )ņ )ʆ )φ )Ԇ )ن )ކ ) ). )U )] )x ) ) )! )+ )0 )5 ): )? )D )I )#N )+S )6X )>] )Eb )Rg )Yl )eq )tv ){{ ) ) ) ) ) ) ) ) , 4 ,80T ,Xl ,p , , , pT ,X , , ,\ ,` , ,  , ,, ,0 | , , $ ,(L ,P , ,$ ,(` , ,  ,4 ,8# ,$ ,0% ,p'T ,X( ,. ,@. ,p. ,. ,.L ,P ,`/ , , 07D ,H 7 , @= , p= , = , = , 0>T ,X 0@ ,  , A , @A , Cl ,p   , .symtab.strtab.shstrtab.rela.text.rela.altinstr_replacement.rela.text.unlikely.rela.init.text.rela.exit.text.rela.altinstructions.rodata.str1.8.rela__mcount_loc.rodata.str1.1.rela.smp_locks.rela.rodata.modinfo.rela__param.rodata.cst2.rela.return_sites.rela.call_sites.orc_unwind.rela.orc_unwind_ip.note.gnu.property.note.gnu.build-id.note.Linux.orc_header.rela__bug_table.rela__patchable_function_entries.codetag.alloc_tags.rela.data.rela.exit.data.rela.init.data.rela.printk_index.data..once.rela.static_call_sites.rela.gnu.linkonce.this_module.bss.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.rela.debug_rnglists.rela.debug_line.debug_str.debug_line_str.comment.note.GNU-stack.rela.debug_frame @D @.H+E<&@ HF`EA@ HZP`U@ (Hj0aGe@H zxau@@H 2 bc k@@H2l`u @HHu @H@@x@+ H@-hHv`@h1@,H֐2 0+@](H?ء@R$e<0qll}@pH$ph@ 8H&DX` @XH)`@H+h@H-ph@08H/اܧ@h`H2+@&@ȑ0H4ED O*J@H7[n_i@y 0H:q~@ H<r@ pH>v@( 'H@0TX0mh07}T}} @O HFx&I7 `(Y