ELF>I@@QPATIHUHSHH=t)HHH.HHH=u[H]A\fUSwOHHH}HtHHػH8tH[]H(1USwCHHH}tHH[]H AWA׉AVEAUATIUHSHHGpL؃BAL$GAD;AEfCAECAEfCAECAE ЉCAEfCAECfCC DsHE0Ht]ID$0S D@DffAfC6AD$FEIAD$IH[]A\A]A^A_A7 0C 뭉DD$ T$D$DD$ T$1L$89r AUAATAUHSH~0HHt HE0EDHH[E1]A\A]D@AWAVAUATUSH(HAHA MIIHIE1IE] H9r!A`H(D[]A\A]A^A_UH)H¸HсL9IGH)H9HGHEH HHHeeLADH+HH HH$MtAA9HLLT$ DD$HL$LL$LL$LT$ eLDD$AHL$H$HHrfIHyLHHITHTH)H)HADe I]IAI)HuitAtATfT뢃HLL$AE I)EDD$L$L$DD$HLL$DtE1UAATTBf.w1Ht.HHttHxt􃏰  ff.ATUSHHLH-HLHtL%HǃHLeHH1H[]A\fSHHHtHHHBHHHHHH"HH[DHpt'Hxt2Ht=HhtHHwXHxHLJpuHHLJxuHhHLJuHLJhHwXHSE11HHH HHHHGHGH{`HHHCHHCHHCP[fAWLAVAUATUHSHt$}EHELeAL0I9upIL0I9tUAVI^tr3uz x.AF4ftLf;Et\DuH1HH](HLHt$HH[]A\A]A^A_뢉pHCHH[]A\A]A^A_UHSHHtOHt Ht_[];wD|HHHDȃ@H5HSX[]vH߾[]6C[]ff.UHoSTHuh1CfKfsHHt7Iٹr1IH@PHZHt[]H1[] ff.fUHoSH_HH=H[]Ht;SH{Ct[CH߃fC[AULn8ATLf`UHLSHHLlL[]A\A]ff.AWAVAUATIUSHH~peL %(LL$@IvSIHtF@ALEEwD$ Hu^ LWHAGMLIEIGHDITHTHSHH)AI)݃r1ɉ΃I|5H<29r LWHK"Ht[1ɀ=)HHLD$ HLL$LT$HD$ LD$ LL$LT$HD$1HLL$LD$LT$EgLl$H\$LL$AEAGHADATfTIAUAWHATTff.AVAUATUHS9Lm`HHALHEL0H9u\~lIL0H9tEAVI^tJ u> xLDuH1H[L]A\A]A^믾HHHf.ff.fAUATLb(ULHSHHCtSpLDCFAEfA.tdA6t7H@H1L[]A\A]f;EuÃIuHttuf}u'vVItPAM ft~ftFuHHL[]A\A]  <A}% $A}&(Iu(H-:f.f.@UHoSHOH9HPLXHL`LhLpHxHQHcr(HHPHcr,ILXHcr0IL`Hcr4ILhHcr8ILpHcRAG^HߍPAG\AW>fC AIxHHf L$fAM MoI_AGX HD$AO@IG0fAGDAEAGhAGE11ɺ IHHILJIIIIH L[]A\A]A^A_HAE,IuLHmHD$H9E1 DsfAtEJ|@ufS` sA}$ATff.ff.ff.ff.ff.AFfD9ADEfA9DEJ|@u1AVfD9DfSAE(1Ou9USHHHoHtHH\C; tHuH[] USHoHHEf fEHSC@R )HL@HC<uf}tTf}tUfE1HH{ tHS HC(HBHHHHC H"HC(H[]fE1fE1 [AVAUIպ ATIH=UH SHHtMLhMl$Mt$HHhLLtI\$L3LkI]H}Et1P xH[]A\A]A^H[]A\A]A^DG<uTSW8Hс O8t [HGt@K1[DATUHoSHHH\HAHS<1HEt []A\[H]A\yfUSHHwr~pvJHHt=h1@t@u/H{\H[]@t11@[]Fv@␐AWAVAUIATIUHSHJpLAG AW Ew  A Ʃ@AAGffuA?"u PLHA t$}F/wHAD$4A H@\H5H}F/wTfK^AG Lk\C\IEH9'AtK8@HLm0E1HD[]A\A]A^A_HC\AO I8K\tAD$8AfK^AG C\AwLfHHPDAGfft(f9.A HC\HH[fCDH}F/[IAfAGAD$0A   < HH$A H$fLHAHHEF(CCX% CX}pHBJ J ȉCLBJ J ȉCPCHC@fCDBffCBC8% K8B EC8CHAD$0A  eAUIATUHSH9~(u[H}0u]HE0I]MeI9tLHCHt HtHsHLutHI9uHE0[]A\A] H}0t 1fAWAVAHwAUATUSH0HGHt$(HD$H95HA1H5H$9HD$H@L$LMLI]IMH1HAHVH9uZHHx HH HWH9BH;h0uE IHEtE;|$PuM\$L\$AD$LLAL$<I$L\$t@A AD$8t A AD$8%LL\$ AD$8ID$\HD$4LD$L\$ AD$L[Ht$HLI$H|$1LLLHHHD;pLHB HJ H H9t H;j01AELfAE$5!@jHH\$(HD$H9H0[]A\A]A^A_USHtHHCHBHHHkHH"HCH}Et~.H[]H}H}HH[]H[]fATLgUSH_I9tPHHL9tCHSHsHHuH}HHH9tHHH9u[]A\[1]A\ff.UHH=SHH}HH9tHHH9u[]ff.@AWAVAUATUSHHw%H[]A\A]A^A_Vp#HHMELo(D}"De EEfAfA IEDH ;AEf}IEMEI9t HxW 9r W"9 HI9u H[]A\A]A^A_p#LIEeAEHO(AA AEA HH D;Am"fHAHH9t HxW 9r W"9HH9uHHߺ[]A\A]A^A_B2H[]A\A]A^A_HHߺ-[]A\A]A^A_-HH߾[]A\A]A^A_kIHsH@AE ffA9FBu^AE"AVDff9tfuEE;fLu?AF8t%AF8ANAF8 LHLHHL[]A\A]A^A_z $ $I‹M@A;JH fE;bBfAt fE;rDL$L$HIFxp/0HHBHHBHHBU fPUfP UP ARDffPARLA;RHH L1@pHވPARdL$ʉPAR8ʉP#ILLL$HL[]A\A]A^A_?L7Am f&I@@AN)ARP31@hUHoSHHDCCA@DC@HH[]AWAVAAUAATUSHHf9ff|t$@LAH= IH]DL$AHXfDp  DHA)ЃA=~AAA A)G|fE|$"H AA HHID$HAE 1Ҿ@fAD$$AH<@I$H10I $H 1fQHQHQAHQ5H;rAD$HLHHtLI|$AD$tSE1HL[]A\A]A^A_I<$I|$LI|$I<$L@ATUSH@G;0#G<C>C^Lc\PC\S>MuSL1ukK8[]A\C<u@CH5@HHu@HQSL1t1H¸HtKL{PK8@sLffzpDCPvRHAD@@pLfHfx@ @@ @H{0m 몸AWAVAUATIUHSH~pMt E$Eu*HH1[]A\A]A^A_LAE AU Eu  A %t>AUfI\$IL$H9tHCf;P rf9P"s,HH9utAEffuI\$HtEGC^Lk\A@DC\C>@SXKL{PsLfDCPfA|$pI$AfHfD@@pLH fP Lfx@@@ @H{0 K8H0HHH[]A\A]A^A_  7  HE1A<$g{=L{\t AD$ H߉D$CD$#HLHEAHߋkTC<uH@CH5L@Hu@HrHHL HLc H1ӁLLLLR@H1H}p#HH~S8oxH"f9H S8CA? HaFH@L1Le(Lm0HHxp"}pH H1HH@H@@~pv HHW fzQLfPQPQfPQPQfPQfPQfP@Q I @  ʁшp H EF(FFAFGI$@@ 1   E1K>8H7ff.fAWIAVIAUMATEUSHH$HL$?HH8HÁ@H8ApIUEu E E u CHyЉʉCLH$LHLLk\HHD$SPHALs0CTEC=U E  E ‰SX[fC`s@fA9sRILLuqECXSXurHHL[]A\A]A^A_}uIo8HILLtHtHHH߉E1떁c8C<f@CDH5@HH*@H 6L1wHjATLXUSH@LCuZk ucLHkHLHHS1H[LLۉL[L]A\L%Ctڿ HkHHxp#vHHBHHBSKfHfPSffPSffP CSHSf~p%HAfAfPHD@MPHfH1"@)@@ @DH@LCKk@\H5Hڿ@Hv@L%\+L La1LL ff.@Ou0USHGDHHoHt Hw<C tHuH{[] USH_HHH߉[]f.H(HeH%(HD$ 1H$HD$HD$ D$HD$HH HHHʺHHf HfHHt1HT$ eH+%(uH(H=fDH=H=f.DHt1HLJ1@AWHAVAUIATMUSHH6HL A  \@xpH1LHtH9r HHH}HAHHEHD H)1HEfD}fEHUE$HHEHH HQHIHM HJHM(HJHM0HRE@HU8HH @LI-AWa[&Z@=|EOAGMo,AA AGIA HEI9I9BD$EKA>t$HH\tIH0xpHHPHHxHHH@kH)Hs1HLLL$HHHBHB HHBfrDHffB #LL$AypL$LHIfPDHPDffPHIO4LDHHH1HD$eH+%()H L[]A\A]A^A_AGAW AW =`HH륀xyu1ҾHgHhHH_HE1HHH9r HLp9BA׃LIMAUpIG1H9r IHHLLHHL1#HLHHD$w HT$HHD$jEAGAE1LIH>IhHp4HE1H9r IHPHzHHJD*HH)AL1HDzBHHHBHHHBAuSB4HHBHrHHPHHPHHPHHP HHP(P0HL1ɺ#HLHCH1ҾH'LHIAPEAD$EEA11H| afDuƇt@uSHƇHXH[f.f.DDwDB <U1SHHH(H8HH[H81]r LAAɃtAG,tfO0LJ1A tB AA A HHt Hff.fH=ff.AV(AUIATU SfHDHHh(HxHHHH@IH@ @,@L+E1fC01IfS6H HHC@HCpHCpCHCxǃLchHǃHLHHǃHuH[]A\A]A^IHImHMuHLLLH HtHLMeHHLe[]A\A]A^fDATAUHSHEHH}HH0H9uFfHH0H9t1D9c(uSHKt܍r1uC x$H[]A\1H[]A\1HH[]A\f.~pHHHr H?fztaJ(ft HiɃCH29H@sH@J"f΁tP9sLRbffv-9s)fP61ftfP61fAUATUHSHudHwH1H{Ct~%[]A\A]HtHH[]A\A][]A\A]L*IHAT$HHIEkff.fATAUHSHu[DH]A\HHxCt~'H[]A\HHH[]A\USHtG8CHkCtoP xYtǃ[]H5H@uӸCt1H뱾H똾HHtHHzff.AUATUSHL'HHtFLkCttP x^s(HjII$ILZHt []A\A]Ct5[L]A\A]L듾LHtHH[]A\A]ATUSHC8Ct[]A\LcCtrP xCH5H@uCt'LLHtHHmL놐AUATLgHUSHH/Do(Lfc0{tRH8D1HDH81HHHL1[]A\A]fAUATUSG,HL'tJt A$ u;u,{tC8C[]A\A]A$t{tC8CtfK6HHtmA$LkC@CP s(HIIA$LPI$ZHt+[]A\A]H߾[]A\A]HCt;[L]A\A]LZLHHuHH[]A\A]USHH/CtNvt=u1H[]tu@tfc0H߾[]Q[]H[]`H[]fDATUSH@H IċC89rH[]A\8C81HkLDCtwP xIH5HShL@t []A\Ct$[H]A\HHtHH[]A\H@AUATUSHL'{tC8CHHtbLkKA s(HIIA$LPI$ZHt[]A\A]H߾[]A\A]GH:Ct;[L]A\A]LgLUHtHH[]A\A]fDAUATUSHL'{tC8CHHtbLkKA s(HIIA$RLPI$ZHt[]A\A]H߾[]A\A]HCt;[L]A\A]LgLUHtHH[]A\A]fDATUHSHHtALcHLCtMHwH1LH{CtD~X[]A\HUpvHHt xu'w[HHtHH[]A\[]A\HS(HHHHpH$D9SDsSD@ t HiCH2D9C@ZC@RHff.@AUATUSL'HA$@{tC8CtHHtxLkKA xLs(HIIA$LPI$ZHt8[]A\A][]A\A]LH߾[]A\A]HCt)[L]A\A]LMHzHH[]A\A]ff.@ATUHSHHtALcHLCtQHwH1LH{Ct}[]A\HUpv9HHt,q3v#@uQ1q2{( q3 9t;HYHtHH[]A\[]A\HQ HH9S uHQ(HH9SuHHDUHoHSHHS0u9fS0St\txu:HH1[]H1[]H1[]HH1[]H1[]ff.@AUATUHSH2HImHtALcHLCtWHwH1LH{C[]A\A]H'UpHHH@<<HHK}pHH&@$9CDsCDIH9C {tC8CHCHH[]A\A][]A\A]1ADHHHH3HS(HH[HA1HFxAfH'AAVAUATUHSHeH%(H\$HH$HD$0HtALcHLCtqHwH1LH{CHD$eH+%(H[]A\A]A^H&C,EpvjLIt]A}уvHA} H9s:AFbff=v$9s fC6HfHf܉HH}uATLgUHoSHHCt|v:tauLWHH{Ct!~S[]A\t1uLMtHL[]A\LLL[]A\AWAVAUATUSHPVpeH%(H\$HHHD$0*HHEI<[<<HD$@EU U A$@?{pHLHHLhHLE-HL1D$DH}T$@EtE8ELH}EHHI;$qL1NTL1$&ILHH!}R IHD$@H $+EcfAfAA9ACL\$(D$DL$$D9AAHHT$HD$HHHT$ppL$$L\$(HBH9HHHD$H1L$MkfAL$HD$fDgLgGHL$D$HD$HHtHLLDLAAEHH?DD$$HLLDLDD$$AEAED)t$HD$EL$IID9t$kAEAA$AEAD$AE<7AAD$ uA룾a-T$@HT$@H߉D$D.HIAGHD$8HT$81L1*M/HD$@3BIHxp3HHPHr1HRIHHBIHHBAAfJfBA|$p3/I$HM'HD$@+fA{L$IHxp+L$HHHr1HLACBACBBPHL1ɺ#I$LLPM'HD$@IHxp3#HLhIU1IuHAEI$0H?LHL1ɺ#I$LL1ҾHH11ҾILiH-HT$@HHD$@A1H )H )11mE1EQE1HE1H#I<$I$AEI$AEI$AE I$AEI$AEI$AEgHLt$1H޺#LH $LHH 1E 1RfAWAVAUL ATUSHhH8L eL<%(L|$0IHHD$HD$ HD$(IGEwI(H$AAF$fA$vAHH߉D$H$Ht#HHtDLLIG@HtDLLII0HD$Dt$1I$8LD1I$8DLHt1HH@HILJ(HHA4AG5HHI0HD$A0,HD$0eH+%(H8[]A\A]A^A_I8AGDALJ\HD$I@HD$ IHHD$(I0HD$A02A HHukI<$HT$1HHuFLA0MI(LHI(t AVI(H߉EAG EHL A4PAPfP A`PAdPH$Ht%HHtLLIG@HtLLA0t6H|$LMI(LH|$|$vAPtHA$A\9s4AGA\LHAHI`LItIWIGHBHH"LIGA0H|$ HHHHtHRHtHD$LHD$HHH9uH3H|$MI(LH|$AGHfH HHHt1ff.fH=f.ATUSHHHHo0Hx8HHE HtH$HE1HPFH9x*HAHE HDщHHx8DH[]A\UHSHG0H8HHtqHxHH1HE11HǀH)1HHk(HfCnCHCHCHC H[]HeH@8USHHHH8HH-H(#H$HH9y, u׀ t΀ uf.USHo0HHUHEH9H}HHC0[]ff.fUHSHPHXH`H=8 HHHE0HEAA H HHCC0HCHCHCHHtK1[]HLJPHXWH`HDžXLHDž`޾뎅HCC uHcs,HHIHDc,롾J H?|[H]A\ff.AWAVAUATUHSDnpHLA#vjAF#DG1Ef"Dg3Ht.wnft$H(H HtHf{nHC@Au5K0{1tpH[]A\A]A^A_0E1E1C2AAAAumE1D AtA+C2HC@DH9t H9LHs(L[]A\A]A^A_AF,A-AɩHnAF3HC1[]A\A]A^A_E1AF(`HKE9HGKt0s=t>@9AAF$ȉCH9LD>LD9HyHH)H)HAF$ȉC9tttftHATIHUHSHC0 H{Ct|P xWH{xt-t#}pvmHxu?HCxLHH[H]1A\HHD| H벐AWAVIAULoATLAUInSHL$IVHLzH9HRuODAtZHH9tNIWLzH9HRtH:;tIWLzH9HRH2;uDAuIAWr HLLAW0 tELLBLIVHLzH9)HLH[]A\A]A^A_ LAW0IxHt IGxD$LAG2LxHL$HL$BHL$HL$)H0ff.@H0 ff.@AWAVAUE1ATUHSHHHHx@tHEHLh@IHAąPHEL A$ PI$8 HHLhpHEHsHLHLDCRCDȉCdHǃHǃHL HHHK0 HLHH{xHt HCxǃHt[{1ubDI$hDA C0HSHD[]A\A]A^A_A A AUATUHSHHIHC0 ,H{C2P HUpHvStUtHt x H_HHoLH[]1A\A] uHH[]A\A]6oHC0 uH{CCP HHPH3HHH[]A\A]HCpǃHHt x9BC0 ,HHIHDH{xHt HCxc0HC4C2r* H H1HAVAUATIUHHSHC0 BLkCP  HH1~p7HSHv HHHKHHHJHHHJHHHRHPH^8HCpfSlLDIff~pwHAE1D@IfxHHHfPL@)@@ @HHCxCP HǃAF u!1HH[]A\A]A^HCpHHt x9BC0 u,HHHH닾L^LLHeH@HHHuHHH@'L LH1AWAVAUATUSHHLpLgxIE t}t:MtLHCxc0HC4C2 H[]A\A]A^A_HG(AAH$HHg1~p'vHHAHHHAAL$ffHAL$Dp ffHDɉHHEEAfAf~p:HP2fD@PfH@)@@ @HCpHHt x9BHt$Ht$H<$ID,HHHtGHDH{HC@c0DkhCtlP x`H[]A\A]A^A_Lcx;L4$IeH@HLrI6HHH@LcxH[]A\A]A^A_ HHVFt ~HF(H@0H0Hff.AWAVAUATUHSHhHB(eH%(H\$`HH~pIYLDE,$At>HD$`eH+%(. HhH1[]A\A]A^A_HL$C0 L$ H{C}P A|$C0 AA8AHC0 V H{CP *HWc0HC2@HHD$`eH+%(% HhH[]A\A]A^A_~ HHZL$L$HMpH{xHt HCxc0HC4C2 1JHl$8H\$0 tHD$L9IIGHD$( 8 A‹LALH9K@tC0LD$TEHLHL$TE1LLD$XLL$L$AD9khuEDkhL{@L{@C0AC+C1Lc\K^APDC\S>HC0KXHS@HHC0S@HDCHD@HL$AHL$L$HL$EDHHK(HSpL$HCxH HtHD@HL$HL$MLHL$Hs(HSpL$HCxDKH6HL$XHt(D@@AQHQMXZL$IHLL$HK(HSpHCxH HtmD@HRIHAZHK(HSpHCxDH Ht=D@HjHAQIRHAHHjHAH_HS(HKxEL$HHSpHtfDAIAQHPAY^HK(HSpHCxH HHD@HAHHK(HSpHCxH HtxD@HUIRHAXAYC2HS(HKxEL$HHSpHtSDAIAQHPAXZAAHHHAHHdebug_loggingfc_disc_error-fc_disc_donefc_disc_gpn_ft_parsefc_disc_gpn_ft_resp fc_disc_restartfc_disc_gpn_id_respYkofc_disc_recv_rscn_reqVufc_disc_recv_reqfc_exch_recv_reqfc_seq_send_ack fc_exch_recv_seq_resp\fc_exch_send_ba_rjtIfc_exch_recv_abtsfc_exch_abts_respfc_exch_recv_blsfc_exch_recv2 ; Y fc_exch_mgr_alloc fc_exch_resetwfc_exch_rrq_resp?INfc_exch_rrqfc_exch_timeoutfc_exch_els_recfc_exch_findfc_exch_els_rrq fc_seq_ls_acc0fc_seq_ls_rjtPfc_seq_els_rsp_sendfc_exch_timer_cancelKfc_exch_timer_set_locked_dfc_exch_abort_lockedfc_seq_start_next_locked7fc_lport_timeoutW`fc_lport_ms_respfc_lport_enter_msfc_lport_scr_resp fc_lport_enter_scr+fc_lport_enter_fdmifc_lport_ns_respbjfc_lport_enter_nsJfc_lport_rport_callbackfc_lport_enter_dnsfc_lport_flogi_respfc_lport_enter_disabled$fc_lport_logo_resp~fc_lport_recvfc_lport_recv_rnid_reqfc_lport_recv_rlir_reqfc_lport_recv_echo_reqfc_lport_ptp_setupfc_lport_recv_flogi_req(16fc_lport_enter_logofc_linkdownUfc_linkup7fc_lport_error8fc_lport_disc_callbackfc_lport_enter_readyfc_lport_enter_flogi7fc_lport_set_port_idfc_lport_enter_resetfc_rport_recv_rtv_reqfc_rport_recv_rls_reqjfc_rport_recv_adisc_reqAfc_rport_recv_prlo_req2fc_rport_recv_prli_reqfc_rport_recv_els_reqfc_rport_recv_logo_reqw~fc_rport_recv_plogi_req@Dgjmyfc_rport_recv_flogi_reqbyfc_rport_logofffc_rport_loginfc_rport_adisc_respfc_rport_enter_adiscfc_rport_timeoutAfc_rport_enter_ready'fc_rport_error_retryfc_rport_rtv_resp,4fc_rport_enter_rtvofc_rport_prli_respksfc_rport_enter_prlifc_rport_plogi_resp  5:Bfc_rport_enter_plogifc_rport_login_completefc_rport_logo_respfc_rport_enter_logofc_rport_enter_deletefc_rport_errorkfc_rport_flogi_resp )fc_rport_enter_flogi>fc_rport_work $+9=SWw|fc_fcp_srr_error$$fc_fcp_rec_erroryyfc_fcp_rec_resp  fc_fcp_timeoutfc_setup_fcpfc_fcp_destroyfc_eh_host_resetfc_lun_reset?Gfc_eh_device_resetvzfc_fcp_pkt_abortfc_fcp_respfc_fcp_recoveryfc_fcp_recv_data88fc_fcp_send_abort  fc_fcp_send_dataeekkwwfc_fcp_can_queue_ramp_up|fc_io_compl  fc_fcp_frame_allocfc_fcp_complete_lockedfc_fcp_recv$$CCfc_queuecommand]drivers/scsi/libfc/fc_libfc.c&disc->disc_mutexdrivers/scsi/libfc/fc_disc.c./include/scsi/fc_frame.h./include/scsi/fc_frame.hdrivers/scsi/libfc/fc_exch.c&ep->resp_wqunknownlibfc_emfc_exch_workqueue%suncatsol dataunsol ctlsol ctl/replyunsol datadata descunsol cmdcmd statusELS reqELS repFC-4 ELS reqFC-4 ELS repBLS NOPBLS abortBLS remove connectionBLS acceptBLS rejectLC ACK_1LC ACK_0LC port rejectLC fabric rejectLC port busyLC fabric busy to data frameLC link credit resetLC endunknown%s v%s./include/scsi/fc_frame.hresponse timeoutrejectshort CT responseresponse not ELS or CTCT acceptresponse unknown errorresponse closedacceptresponse unknown ELSCT rejectresponse unknown CTdrivers/scsi/libfc/fc_frame.cunknown./include/scsi/fc_frame.h&lport->lp_mutexLOGORHBAdrivers/scsi/libfc/fc_lport.cdisabledFLOGIdNSRNN_IDRSNN_NNRSPN_IDRFT_IDRFF_IDFDMIRPADHBADPRTSCRReadyreset&rdata->rp_mutexUnknownerror./include/scsi/fc_frame.hPLOGIdrivers/scsi/libfc/fc_rport.cfc_rport_eq%sInitFLOGIPLOGI_WAITPRLIRTVReadyADISCDelete63drivers/scsi/libfc/fc_fcp.c./include/scsi/fc_frame.h&x->waitlibfc_fcp_pkt%s %s: parm=debug_logging:a bit mask of logging levelsparmtype=debug_logging:intlicense=GPL v2description=libfcauthor=Open-FCoE.orgsrcversion=3EB7492A2982146C9F7CDFCdepends=scsi_transport_fcintree=Yname=libfcretpoline=Yvermagic=6.13.0-rc1-MANJARO+ SMP preempt mod_unload 6host%u: disc: Discovery complete 6host%u: disc: Error %d, retries %d/%d 6host%u: disc: Restarting discovery 6host%u: disc: Received an RSCN event 6host%u: disc: Port address format for port (%6.6x) 6host%u: disc: Address format is (%d) 6host%u: disc: RSCN received: rediscovering 6host%u: disc: RSCN received: not rediscovering. redisc %d state %d in_prog %d 6host%u: disc: Received a bad RSCN frame 6host%u: disc: Received an unsupported request, the opcode is (%x) 6host%u: disc: GPN_ID accepted. WWPN changed. Port-id %6.6x wwpn %16.16llx 6host%u: disc: GPN_ID rejected reason %x exp %x 6host%u: disc: GPN_ID unexpected response code %x field "(char *)np + tlen" at drivers/scsi/libfc/fc_disc.c:406memcpy: detected field-spanning write (size %zu) of single %s (size %zu) 4libfc: Failed to allocate memory for the newly discovered port (%6.6x) 6host%u: disc: Partial buffer remains for discovery 6host%u: disc: Received a GPN_FT response 6host%u: disc: GPN_FT response too short, len %d 6host%u: disc: GPN_FT rejected reason %x exp %x (check zoning) 6host%u: disc: GPN_FT unexpected response code %x 6host%u: disc: GPN_FT unexpected frame - out of sequence? seq_cnt %x expected %x sof %x eof %x 3host%u: lport %6.6x: xid %d invalid CPU %d :6host%u: lport %6.6x: xid %x quarantined 6host%u: xid %4x: Drop ACK request, out of memory 6host%u: xid %4x: exch: drop LS_ACC, out of memory 6host%u: xid %4x: Exchange timer canceled 6host%u: xid %4x: Cannot process RRQ, frame error %d 6host%u: xid %4x: LS_RJT for RRQ 6host%u: xid %4x: unexpected response op %x for RRQ 6host%u: xid %4x: ep is completed already,hence skip calling the resp 6host%u: xid %4x: RRQ request from %x: xid %x rxid %x oxid %x 6host%u: lport %6.6x: REC request from %x: invalid rxid %x oxid %x 6host%u: lport %6.6x: REC request from %x: rxid %x oxid %x not found 6host%u: xid %4x: REC request from %x: rxid %x oxid %x 6host%u: xid %4x: Drop REC request, out of memory 6host%u: lport %6.6x: Invalid ELS CMD:%x 6host%u: xid %4x: f_ctl %6x seq %2x 6host%u: lport %6.6x: Invalid min_xid 0x:%x and max_xid 0x:%x 6host%u: xid %4x: exch: abort, time %d msecs 6host%u: xid %4x: exch: already completed esb %x state %x 6host%u: xid %4x: Exchange timer armed : %d msecs 6host%u: xid %4x: Exchange already queued 6libfc: Receiving frames for an lport that has not been initialized correctly 6host%u: lport %6.6x: Unable to find Exchange Manager Anchor,fc_ctl <0x%x>, xid <0x%x> 6host%u: xid %4x: BLS rctl %x - %s received 6host%u: xid %4x: exch: BLS rctl %x - %s 6host%u: xid %4x: Exchange timer canceled due to ABTS response 6host%u: xid %4x: exch: ABTS received 6host%u: xid %4x: Drop ABTS request, out of memory 6host%u: xid %4x: exch: ABTS rejected, exchange complete 6host%u: xid %4x: Drop BA_RJT request, out of memory 6host%u: lport %6.6x: exch/seq lookup failed: reject %x 6host%u: lport %6.6x: dropping invalid frame (eof %x)6host%u: xid %4x: Exchange timed out state %x 6host%u: xid %4x: exch: RRQ send failed BLS dedicated connection preemptedLC fabric busy to link control frame6host%d: Assigned Port ID %6.6x 6host%u: lport %6.6x: Entered READY from state %s 6host%u: lport %6.6x: dropping unexpected frame type %x 4libfc: Failed to setup lport 0x%x 6host%u: lport %6.6x: Entered RESET state from %s state 6host%u: lport %6.6x: Error %ld in state %s, retries %d 6host%u: lport %6.6x: Entered FLOGI state from %s state 6host%d: libfc: Link up on port (%6.6x) 6host%u: lport %6.6x: Entered LOGO state from %s state 6host%u: lport %6.6x: Entered SCR state from %s state 6host%u: lport %6.6x: Entered %s state from %s state 6host%u: lport %6.6x: Cmd=0x%x Len %d size %d 6host%u: lport %6.6x: Entered DNS state from %s state 6host%u: lport %6.6x: Entered FDMI state from %s state 6host%u: lport %6.6x: Received a LOGO %s 6host%u: lport %6.6x: Received a LOGO response, but in state %s 6host%u: lport %6.6x: Entered disabled state from %s state 6host%u: lport %6.6x: Received a FLOGI %s 6host%u: lport %6.6x: Received a FLOGI response, but in state %s 6host%u: lport %6.6x: FLOGI not accepted or bad response 6host%u: lport %6.6x: FLOGI bad response 6host%u: lport %6.6x: FLOGI bad mfs:%hu response, lport->mfs:%u 6host%d: libfc: Port (%6.6x) entered point-to-point mode 6host%u: lport %6.6x: Received a SCR %s 6host%u: lport %6.6x: Received a SCR response, but in state %s 6host%u: lport %6.6x: Received a ms %s 6host%u: lport %6.6x: Received a management server response, but in state %s 6host%u: lport %6.6x: Received a management server response, reason=%d explain=%d 6host%u: lport %6.6x: Error for FDMI-V2, fall back to FDMI-V1 6host%u: lport %6.6x: Received a %d event for port (%6.6x) 6host%u: lport %6.6x: Received an READY event on port (%6.6x) for the directory server, but the lport is not in the DNS or FDMI state, it's in the %d state6host%u: lport %6.6x: timeout for FDMI-V2 RHBA,fall back to FDMI-V1 6host%u: lport %6.6x: Skipping lport state %s to SCR 6host%u: lport %6.6x: Received a ns %s 6host%u: lport %6.6x: Received a name server response, but in state %s 6host%u: lport %6.6x: Discovery succeeded 3host%d: libfc: Discovery failed for port (%6.6x) 6host%u: lport %6.6x: Received FLOGI request while in state %s 4host%d: libfc: Received FLOGI from port with same WWPN %16.16llx 6host%u: lport %6.6x: FLOGI from port WWPN %16.16llx 6host%u: lport %6.6x: Received ECHO request while in state %s 6host%u: lport %6.6x: Received RLIR request while in state %s 6host%u: lport %6.6x: Received RNID request while in state %s 6host%d: libfc: Link down on port (%6.6x) 6host%u: rport %6.6x: Fabric bit set in FLOGI 6host%u: rport %6.6x: Received a LOGO %s 6host%u: rport %6.6x: Port is Ready 6host%u: rport %6.6x: Port sending LOGO from %s state 6host%u: rport %6.6x: Delete port 6host%u: rport %6.6x: Remove port 6host%u: rport %6.6x: Port in Delete state, not removing 6host%u: rport %6.6x: PLOGI suppressed for incompatible role 6host%u: rport %6.6x: Port entered PLOGI state from %s state 6host%u: rport %6.6x: %s frame alloc failed 6host%u: rport %6.6x: Error %d in state %s, retries %d 6host%u: rport %6.6x: Error %d in state %s, retrying 6host%u: rport %6.6x: Port entered RTV state from %s state 6host%u: rport %6.6x: sending ADISC from %s state 6host%u: rport %6.6x: Received a RTV %s 6host%u: rport %6.6x: Received a RTV response, but in state %s 6host%u: rport %6.6x: Entered FLOGI state from %s state 6host%u: rport %6.6x: Received a ADISC response 6host%u: rport %6.6x: Received a ADISC resp but in state %s 6host%u: rport %6.6x: ADISC error or mismatch 6host%u: rport %6.6x: ADISC OK 6host%u: rport %6.6x: port already started 6host%u: rport %6.6x: ADISC port 6host%u: rport %6.6x: Restart deleted port 6host%u: rport %6.6x: Login to port 6host%u: rport %6.6x: Login in progress, state %s 6host%u: rport %6.6x: Received a FLOGI %s 6host%u: rport %6.6x: Received a FLOGI response, but in state %s 6host%u: rport %6.6x: FLOGI ELS rejected, reason %x expl %x 6host%u: rport %6.6x: FLOGI ELS invalid opcode %x 6host%u: rport %6.6x: FLOGI failed, no login 6host%u: rport %6.6x: Bad FLOGI response 6host%u: rport %6.6x: Received a PRLI %s 6host%u: rport %6.6x: Received a PRLI response, but in state %s 6host%u: rport %6.6x: PRLI spp_flags = 0x%x spp_type 0x%x 6host%u: rport %6.6x: PRLI bad response 6host%u: rport %6.6x: PRLI ELS rejected, reason %x expl %x 6host%u: rport %6.6x: Port entered PRLI state from %s state 6host%u: rport %6.6x: Received a PLOGI %s 6host%u: rport %6.6x: Received a PLOGI response, but in state %s 6host%u: rport %6.6x: PLOGI bad response 6host%u: rport %6.6x: PLOGI ELS rejected, reason %x expl %x 6host%u: rport %6.6x: Port timeout, state %s 6host%u: rport %6.6x: Received FLOGI request 6host%u: rport %6.6x: Received FLOGI in %s state 6host%u: rport %6.6x: Received PLOGI request 6host%u: rport %6.6x: Received PLOGI too short 6host%u: rport %6.6x: Received PLOGI in INIT state 6host%u: rport %6.6x: Received PLOGI in PLOGI_WAIT state 6host%u: rport %6.6x: Received PLOGI in PLOGI state 6host%u: rport %6.6x: Received PLOGI in logged-in state %d - ignored for now 6host%u: rport %6.6x: Received PLOGI for incompatible role 6host%u: rport %6.6x: Received LOGO request while in state %s 6host%u: rport %6.6x: Received LOGO from non-logged-in port 6host%u: rport %6.6x: Received ELS 0x%02x from non-logged-in port 6host%u: rport %6.6x: Reject ELS PRLI while in state %s 6host%u: rport %6.6x: Reject ELS 0x%02x while in state %s 6host%u: rport %6.6x: Received PRLI request while in state %s 6host%u: rport %6.6x: PRLI rspp type %x active %x passive %x 6host%u: rport %6.6x: Received PRLO request while in state %s 6host%u: rport %6.6x: Received ADISC request 6host%u: rport %6.6x: Received RLS request while in state %s 6host%u: rport %6.6x: Received RTV request 6host%u: rport %6.6x: Received PLOGI in state %s - send busy 6host%u: rport %6.6x: work event %u 6host%u: rport %6.6x: No rport! 6host%u: rport %6.6x: Failed to add the rport 6host%u: rport %6.6x: rport already allocated 6host%u: rport %6.6x: callback ev %d 6host%u: rport %6.6x: lld callback ev %d 6host%u: rport %6.6x: work restart 6host%u: rport %6.6x: work delete 6host%u: rport %6.6x: work reopen 6host%u: scsi: Resetting host libfc: Host reset failed, port (%6.6x) is not ready. libfc: Host reset succeeded on port (%6.6x) 3libfc: Leaked SCSI packets when destroying port (%6.6x) libfc: queue full, reducing can_queue to %d. field "fsp->cdb_cmd.fc_cdb" at drivers/scsi/libfc/fc_fcp.c:1140memcpy: detected field-spanning write (size %zu) of single %s (size %zu) libfc: increased can_queue to %d. 6host%u: fcp: %6.6x: xid %04x-%04x: Returning DID_ERROR to scsi-ml due to FC_ERROR 6host%u: fcp: %6.6x: Returning DID_ERROR to scsi-ml due to FC_ERROR 6host%u: fcp: %6.6x: xid %04x-%04x: Returning DID_ERROR to scsi-ml due to FC_DATA_UNDRUN (trans) 6host%u: fcp: %6.6x: Returning DID_ERROR to scsi-ml due to FC_DATA_UNDRUN (trans) 6host%u: fcp: %6.6x: xid %04x-%04x: Returning DID_ERROR to scsi-ml due to FC_DATA_UNDRUN (scsi) 6host%u: fcp: %6.6x: Returning DID_ERROR to scsi-ml due to FC_DATA_UNDRUN (scsi) 6host%u: fcp: %6.6x: xid %04x-%04x: Returning DID_ERROR to scsi-ml due to FC_DATA_OVRRUN 6host%u: fcp: %6.6x: Returning DID_ERROR to scsi-ml due to FC_DATA_OVRRUN 6host%u: fcp: %6.6x: xid %04x-%04x: Returning DID_TIME_OUT to scsi-ml due to FC_CMD_ABORTED 6host%u: fcp: %6.6x: Returning DID_TIME_OUT to scsi-ml due to FC_CMD_ABORTED 6host%u: fcp: %6.6x: xid %04x-%04x: Returning DID_ERROR to scsi-ml due to FC_CMD_ABORTED 6host%u: fcp: %6.6x: Returning DID_ERROR to scsi-ml due to FC_CMD_ABORTED 6host%u: fcp: %6.6x: xid %04x-%04x: Returning DID_RESET to scsi-ml due to FC_CMD_RESET 6host%u: fcp: %6.6x: Returning DID_RESET to scsi-ml due to FC_CMD_RESET 6host%u: fcp: %6.6x: xid %04x-%04x: Returning DID_SOFT_ERROR to scsi-ml due to FC_TRANS_RESET 6host%u: fcp: %6.6x: Returning DID_SOFT_ERROR to scsi-ml due to FC_TRANS_RESET 6host%u: fcp: %6.6x: xid %04x-%04x: Returning DID_NO_CONNECT to scsi-ml due to FC_HRD_ERROR 6host%u: fcp: %6.6x: Returning DID_NO_CONNECT to scsi-ml due to FC_HRD_ERROR 6host%u: fcp: %6.6x: xid %04x-%04x: Returning DID_PARITY to scsi-ml due to FC_CRC_ERROR 6host%u: fcp: %6.6x: Returning DID_PARITY to scsi-ml due to FC_CRC_ERROR 6host%u: fcp: %6.6x: xid %04x-%04x: Returning DID_TIME_OUT to scsi-ml due to FC_TIMED_OUT 6host%u: fcp: %6.6x: Returning DID_TIME_OUT to scsi-ml due to FC_TIMED_OUT 6host%u: fcp: %6.6x: xid %04x-%04x: Returning DID_ERROR to scsi-ml due to unknown error 6host%u: fcp: %6.6x: Returning DID_ERROR to scsi-ml due to unknown error 6host%u: fcp: %6.6x: xid %04x-%04x: data underrun, xfer %zx data %x 6host%u: fcp: %6.6x: data underrun, xfer %zx data %x libfc: Could not allocate frame, reducing can_queue to %d. 6host%u: fcp: %6.6x: xid %04x-%04x: abort already pending 6host%u: fcp: %6.6x: xid %04x-%04x: start recovery code %x 6host%u: fcp: %6.6x: start recovery code %x 6host%u: fcp: %6.6x: xid %04x-%04x: pkt abort state %x 6host%u: fcp: %6.6x: pkt abort state %x 6host%u: fcp: %6.6x: xid %04x-%04x: failed to send abort 6host%u: fcp: %6.6x: failed to send abort 6host%u: fcp: %6.6x: xid %04x-%04x: target abort cmd completed 6host%u: fcp: %6.6x: target abort cmd completed 6host%u: fcp: %6.6x: xid %04x-%04x: target abort cmd failed 6host%u: fcp: %6.6x: target abort cmd failed 6host%u: fcp: %6.6x: xid %04x-%04x: target abort cmd passed 6host%u: fcp: %6.6x: target abort cmd passed 6host%u: fcp: %6.6x: xid %04x-%04x: fcp timeout, resetting timer delay %d 6host%u: fcp: %6.6x: fcp timeout, resetting timer delay %d 6host%u: fcp: %6.6x: xid %04x-%04x: fcp timeout, delay %d flags %x state %x 6host%u: fcp: %6.6x: fcp timeout, delay %d flags %x state %x 6host%u: fcp: %6.6x: xid %04x-%04x: tgt %6.6x queue busy retry 6host%u: fcp: %6.6x: tgt %6.6x queue busy retry 6host%u: fcp: %6.6x: xid %04x-%04x: tgt %6.6x xfer len %zx data underrun len %x, data len %x 6host%u: fcp: %6.6x: tgt %6.6x xfer len %zx data underrun len %x, data len %x 6host%u: fcp: %6.6x: xid %04x-%04x: tgt %6.6x xfer len %zx greater than expected, len %x, data len %x 6host%u: fcp: %6.6x: tgt %6.6x xfer len %zx greater than expected, len %x, data len %x 6host%u: fcp: %6.6x: xid %04x-%04x: short FCP response. flags 0x%x len %u respl %u snsl %u 6host%u: fcp: %6.6x: short FCP response. flags 0x%x len %u respl %u snsl %u 6host%u: scsi: Resetting rport (%6.6x) 4libfc: could not allocate scsi_pkt 6host%u: scsi: lun reset failed 6host%u: scsi: lun reset to lun %u completed 6host%u: fcp: %6.6x: xid %04x-%04x: SRR timeout, retries %d 6host%u: fcp: %6.6x: SRR timeout, retries %d 6host%u: fcp: %6.6x: xid %04x-%04x: SRR error, exchange closed 6host%u: fcp: %6.6x: SRR error, exchange closed 6host%u: fcp: %6.6x: xid %04x-%04x: lport state %d, ignoring r_ctl %x 6host%u: fcp: %6.6x: lport state %d, ignoring r_ctl %x 6host%u: fcp: %6.6x: xid %04x-%04x: command aborted, ignoring r_ctl %x 6host%u: fcp: %6.6x: command aborted, ignoring r_ctl %x 6host%u: fcp: %6.6x: xid %04x-%04x: xfer-ready past end. seq_blen %zx offset %zx 6host%u: fcp: %6.6x: xfer-ready past end. seq_blen %zx offset %zx 6host%u: fcp: %6.6x: xid %04x-%04x: xfer-ready non-contiguous. seq_blen %zx offset %zx 6host%u: fcp: %6.6x: xfer-ready non-contiguous. seq_blen %zx offset %zx 6host%u: fcp: %6.6x: xid %04x-%04x: fsp=%p:lso:blen=%zx lso_max=0x%x t_blen=%zx 6host%u: fcp: %6.6x: fsp=%p:lso:blen=%zx lso_max=0x%x t_blen=%zx 6host%u: fcp: %6.6x: xid %04x-%04x: DDP I/O in fc_fcp_recv_data set ERROR 6host%u: fcp: %6.6x: DDP I/O in fc_fcp_recv_data set ERROR 6host%u: fcp: %6.6x: xid %04x-%04x: data received past end. len %zx offset %zx data_len %x 6host%u: fcp: %6.6x: data received past end. len %zx offset %zx data_len %x 4libfc: CRC error on data frame for port (%6.6x) 6host%u: fcp: %6.6x: xid %04x-%04x: complete out-of-order sequence 6host%u: fcp: %6.6x: complete out-of-order sequence 6host%u: fcp: %6.6x: xid %04x-%04x: unexpected frame. r_ctl %x 6host%u: fcp: %6.6x: unexpected frame. r_ctl %x 6host%u: fcp: %6.6x: xid %04x-%04x: REC %p fid %6.6x exchange closed 6host%u: fcp: %6.6x: REC %p fid %6.6x exchange closed 6host%u: fcp: %6.6x: xid %04x-%04x: REC %p fid %6.6x error unexpected error %d 6host%u: fcp: %6.6x: REC %p fid %6.6x error unexpected error %d 6host%u: fcp: %6.6x: xid %04x-%04x: REC %p fid %6.6x exchange timeout retry %d/%d 6host%u: fcp: %6.6x: REC %p fid %6.6x exchange timeout retry %d/%d 6host%u: fcp: %6.6x: xid %04x-%04x: device %x invalid REC reject %d/%d 6host%u: fcp: %6.6x: device %x invalid REC reject %d/%d 6host%u: fcp: %6.6x: xid %04x-%04x: device does not support REC 6host%u: fcp: %6.6x: device does not support REC 6host%u: fcp: %6.6x: xid %04x-%04x: device %x REC reject %d/%d 6host%u: fcp: %6.6x: device %x REC reject %d/%d 3libfc: Unable to allocate SRB cache, module load failed!6host%u: fcp: %6.6x: abort already pending   (08H80( H (  (08`80( `  (08@80( @80(   (  (0880( 80(  (0( 0( 0( 0 (08`80( ` (0( 0 ( ( ( ( ( (0( 0 (  (08p80( p ( ( ( (08@80( @80( @ (080( 80(  ( (  (080( 80(  (08X80( XX (0( 0( 0   (08@80( @ ( ( (08h80(    (08H80( H80( H80( H80( H80( H80( H80( H80( H (08@80( @   (08@80( @80( @80( @ (08H80( H  00 (08H80( H80( H (08H80( H  (0(      (0( 0( 0( 0 (080( 80( 8 (0( 0 (0( 0 (0( 0 (080( 8 (           (0( 0( 0    (0( 0( 0 (    ( ( ( ( ( ( ( ( ( ( (      (08X80( X (0( 0(       ( ( ( (     (0( ( (     ( ( ( (0( ( ( (       (0( ( ( (  (0( ( ( (      (0( ( ( ( (      ( ( ( ( (0H0( H ( ( ( ( (  (0( 0( 0( 0    (0880(  (08p80( p (   (08P80( P80( P    (8( 8 (0( 0( 0 ( ( ( (0( ( ( (   (080( 80( 80( 8    (08H80( H (08@80( @ ( ( ( ( (0( 0 (08H80( H80( H80( H (0880( 80( 80(    00 (08@80( @ (  ( (  ( @0`(@80( 80( ( hHPH80( H@ @H H 0(  0 0 ( X( ( ( ( (H(0 p  P8080( (0( 8@HP8@HP8@8@HP80( 8@8@80( @( ( (08 ( (0( (0( (0( 00GNUGNUçV& *H} AE'ޖLinuxLinuxfc_lport_notifier_headfc_fill_hdrfc_fill_reply_hdrfc_lport_iteratefc_fc4_register_providerfc_fc4_deregister_providerfc_disc_configfc_disc_initfc_cpu_maskfc_seq_sendfc_seq_start_nextfc_seq_set_respfc_exch_donefc_seq_els_rsp_sendfc_seq_assignfc_seq_releasefc_exch_mgr_resetfc_exch_seq_sendfc_exch_update_statsfc_exch_mgr_addfc_exch_mgr_delfc_exch_mgr_list_clonefc_exch_mgr_allocfc_exch_mgr_freefc_exch_recvfc_exch_initfc_elsct_sendfc_elsct_initfc_frame_crc_check_fc_frame_allocfc_frame_alloc_fillfc_get_host_port_statefc_get_host_speedfc_get_host_statsfc_fabric_loginfc_linkupfc_linkdownfc_fabric_logofffc_lport_destroyfc_set_mfsfc_lport_set_local_idfc_lport_recvfc_lport_resetfc_lport_logo_respfc_lport_flogi_respfc_lport_configfc_lport_initfc_lport_bsg_requestfc_rport_lookupfc_rport_createfc_rport_destroyfc_set_rport_loss_tmofc_rport_loginfc_rport_logofffc_rport_recv_reqfc_rport_flush_queuefc_rport_terminate_iofc_queuecommandfc_eh_abortfc_eh_device_resetfc_eh_host_resetfc_slave_allocfc_fcp_destroyfc_fcp_initlibfc_vport_createfc_vport_id_lookupfc_vport_setlink]2X;,[%$ Z       %       B I ?    y                  ?      0            I  t         /    - b  ;  ? GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910libfcL=< <2<Cg,s<- <6{ <6,L<+ +G +XG<Q<] x< < < < int ] ,< *<Is8lIu8Is16Iu16)Is328Iu32Is64Iu64|] ~<+1]2]HIX]^_`Q<<%'),<] Go #<%&*+4=B]]h8nG} Q [ [ [ ] ] [! ! Q  C CCHC Q] + ]+W8UH  G   "   o(  0 v8 @  H  H  H H  H  H  H  H'@  PhGG" ']x9*kp, ](],"0 '8@AB]D 1HP]mem6@+ ]GLV`  (i0]8i@]H]LeP]Xj`]hop ] x]] y]]]Ni ]!N"]%&"9]:?AD F P Q](T0E, ,; ))[ 8val   o ; ,[ ,    +  {    o  gg  " o   "  ]+, fmtGGG]GG$e( f+g] hg u] v8w8 keyx( b U V  j keykl n keyol 6 7 8 8f GGGG]]4] key9 ( ]=  8U V modW XGY Z ([ ,\f 0G uDvDwIx]y]  +] Qh + /1] set3` get5y7 6hO     t( t0N8!g@" H# P$ X%`&h'p(x)*4+\,-.\/ 0 1 >2 3 .5 9 ; K>?n@  !8 key"8?A+BC"  mod " =H>i ! %  +  - / ]3     @! x! Q)V+,0  X"      [ +  i   )(  *'-@" X""6"]"]" i "[;(" ],"!]0"( 4")68"*]H"++P",X"X"5 `"6 d"8 h": l"; p"< t"=]x?se"?J@*rt"@L]dl"AL"BL"F*O("I;"J+"K]"O4O"X9O"]9O("`"I@"d"h]"k] "l+"m "nIO "oNO("p!(0"q iX"s`"ub"x d"yNh"zp"{XO"+""" "" "" " "N""" "H""=((";P*mm"&h"&p"LPx" " " " "+"]" ]," ]," ]," ]-" ]-" ]-" ]-" ]-" ]-" ]-" ]-" ]-" ] -" ] -" ] -" ] -""] -"+"-*pid" " "+"X"" X""""X"("0"@"PP"PX" ""P"%&"(&"+ i"- [". ["3 ["45G"6G": ("=+0">+8"A [@"D [H"G+P"H+X"KE`("NAF"TZR"WZR"ZZR"^IS"k _5"mSS"p= "q=("t+8"u+@*fs"x]SH"{gSP"~qSX"S`"Wh" Wp" @x" @" @"D"+" "]""W" G"]"?")E" [ " [ "/7 ""  "N ";( "X"8 "W@ " iH "!XP "XX "X` "*Yh "4Yp "+x "9Y "kE "] " [ " [ " [ ": "L: " "Z " " G " G ""Z ")Z "  " Z0 " x98 " ]X "Z\ "Z` "x9h " "[ " " " "  "!] ""] "# "$+ "& [ "' [ "( [ (")] "3 [ "CN "D+ "L[ "N+ "R[ "SG( "TG, "Y+0 "] 8 "^ < "_ @ "` D ("a]H "d ;X "g)[ "i: "l3[ "w "x "z+ "} "~8[ " [" [" " "N""" " "+"]" ]"J]"_"` "]("],"O0]rcu"]0"[;@" D"X"H"?P" `x"[;" i" "`" #`"-`"i" " [" "">("]" "!"]6"$"]6(".]"<7`("FG%@@@ x")8pad !x" " +? @ "]""}&"@})"@)#)#)# $;>#$<$=+$? ] +$@ ]$+$A ](+$B ]+ %B#%C)%D)+%E) +%E)(;s%E),;dpl%E)-;p%E')/+%F)0;avl%F)4;l%F)5;d%F)6;g%F%)7+%F+)8&+&+&+&+&+!& I$ pte&#&"2$!& l$ pmd&$&"U$'%$'%%&$6'%/x$-'' $pgd''$6''"$-'p $pud'p$6'p"$6'$%@(HB%(I+/bmm0( 4(+8%'@@)&)5sp)+es) ds)")$)&)+()+0)58)+X)+`cr2)+h)+p)+x)6)+)])G)+)+) 75?fpu) 4@&X"& (* &* (&'@@(&/Et@(y@$I$l$&@((/@r(&( $_r (((,(r0(r8(X(rh(%sp(+x(Pq( i(s(N(([(s(Uq$ +!( +* ;&!(*?>( &N( ++ _('@A@,*,#@,$4!,&5,: /75,<+5,=+5,>+5,@6,AQ96,BQ9 6,ED86,G 6,H+6,Kx96,MX"6,N6,OS6,Q6,T6,US6,VQ96,WX"7,X7,^+7,d+7,e+ 7(,i@@7,t@7,y]`7,{+h7,}]p7,]t7,+x7,}7,+=,;}=,~x>(,@?,$T?,Y?,nA,΃A 0-c=+-dG-e$-gB-i `-le +(*). ).  ]/+!(/+/+ val/ G/!G /"G/#[/$+ G/*+/+&&,/,#S, 0&,00 + 1S,1a1 8+,!/',/(/)\++/.[! /1,/2,/3/4 /5+/6+ ,(/-/%+//X,/7, 8/?-/+ fn/ S-,N-N--?-E2+E2+ 3-3[ end3[ 4;-;cs4=[;sl4?[;wfe4A[ 4Ef.;ss4G[;sti4I[+4K[;nmi4M[+4P[ +4S[0+4V[8;lm4X[9+4][:+4d[<4.8cs4)8csx4[4-4.8ss4)8ssx4[4- 4g/ r154m+ r144n+ r134o+ r124p+ bp4q+ bx4r+( r114u+0 r104v+8 r94w+@ r84x+H ax4y+P cx4z+X dx4{+` si4|+h di4}+p4+x ip4+f.4+ sp4+. 5 /5 5 /. p6v0 cwd6G swd6G twd6G fip6G fcs6G foo6G fos6G6v06Gl G0 +,6*0 rip6+[ rdp6,[,6.0 fip6/G fcs60G foo61G fos62G 6)00006@16A16B1 G.1 + 36$1 cwd6%) swd6&) twd6') fop6()065G66G691 6<16>1p0 G1 + G1 +? 6Q2 cwd6RG swd6SG twd6TG fip6UG fcs6VG foo6WG fos6XG6Zv06[l6\m6]n6^o rm6_p6`q6a2x6bG/ 2 + [2 +@6:36; [6< [6= 3 [+3 +'@@6Oi36P.16Q26Ri3@ x34+@6^36_/16`.16a116b+3@6c3 3h+'@@6f46h]6k]6n[6q[xfd6t[6w]6z]6]6]6x3@@646 [6]6] fpu@6256]6+62562564 64063@@3 7 _57 [7[ Qo5 + Q5 +? 858 8! 8" 8#5 [5 + Q5h+ >#5 + 66 + 6 6 9>]69?+9@+9AG cpu9CG :8x6:96 :<6:=6x6;<6;=];>  ;:6;;x66 src;A) dst;A )67i<7< </77<7!= R7= =";7)>)>)>)>!)>%)>')>,)>//7)>3)>5)>9)><)>A)>D)>H)>L)>Q)>U)>Y ?u8?8 ?8?8?#8u88@ !8 (@8@]@ i@8@ @99$9$9]i8 @#Q9@$/7@%@' )9 A x9A  B)9B*N(B+"  osqB-]9 B/7Cɷx97Cʷ7C˷ D!9D" ]D&9 DD%:DD9DD : DEL:DE9DE1:!DT |:DYL:DZ /7D[X:!E :E: +: +E8: (F:F & G$ ;G%$G'G( 0GD@;GM#:GP(GW) H[;H H@; I;I [;J;J+J;J;; J ;J ; J;J;J;)K~L L" <L><L/7L< Ll<<L]Lii (M0<M1N(M7N( osqM9]9M;" M<7M7M7M7M7M N+$=N," N- OL=O]O<P P =P L=P ]Q= R=R = = S =S (T )>T T T UR>%U ;U 4 U m>U; ]V >@V'?%V()>V) 4 V*?(V+?0V,8V-9V.:V/;m>??>?@@W/?W0W1]W2  seqW3%:W4?W5R> W60W7 48? (X?X X+X ?XG ???? Y!@YY Y&@ !@ Z+S@Z,Z- x[@[@[]`[+h max[+p +@ + \@\ [\ [\!] @ sig]:]@^R~^SA@^U^V2AAq_]A_ _ i_ 7A!_'A_(_)!_-A_._/_0 ]A_1!_5A_6_7_8 ]A! _<GB_=_>_?_@_A!_SxB_T X_Ui_Vi! _YB_Z X_[ !_^B__+_` _a _JC_L_Q _WGB_\xB_bB! _E0C_FiB!_gTC_h _fd_i!_mC_ni_o_p] q _%C_*iA_2A8_rt_9A_BA_dC_j0C_qTC,0` %D` ` ` ` C 0` 9DC`%D auDav nsawy uidax Gay az a{JED ` D`!`" @ `%E`' A`(+`.&A`0 @ `3)E sa`4D b kEb  b + lenb +b  8c Ec[c[c[c[c[ c#[(c,[0 d)Ed*[d+R> Pd81Fd91Fd:]Hd;]L EAF +8dDwF%dE]dFx9dG]0 e>FeKeZepeee endeF QF4+!f G valff F!f )G valf f G"SnG"U ["V ["W" .]"[G0"hH"i9"j"knGcpu"l]"m["n[ "o[( "VH"+""""H"+" G@@@"I" [" [" [" G" G"+ "+("+0"]8'@"J" [" [" [" [" [ " [(" [0" [8" Q@" [H" [P" QX" Q`" [h" [p" [x"  ["  ["  ["  [" [" [" [" [" [" [" [" [" ['@" L"VH" ;"! [("" [0"# [8"%@"&P"'Q"(R")S", [X"- [`". [h"/ [p"0 Qx"1 ["3 ["6 "7 L"9L";L"=+?avg"GH@J L0"KL"L"M+"N+"O] "P$"Q&"SL(L6"]LLLLL@"`N"a;"h ["i [ "j [("k [0"l [8"s Q@"t [H"u]P"]"]"]"]"]"]"]"]">X">rq"=N"L"N"L6"^%N*NX"9NLirq9N"N"] "] "]"]-"N"""""N^b"N^s"G"O"ONg"  O%O /O BNIO +-(!( SO@LPdq< d@ D H;P+` +h)\p+x R/7q< i]Orpidpg7Pg9 [;g:]g; /7g<N inog=[g?} g@@gBQ9H0rcugC]`gDpQP P +$=hoURhpN( uidhq G gidhr )G hs Ght )Ghu Ghv )Ghw G hx )G$hy ](hz0h{8h|@h}Hh~PhXhIS`hIShhISphISxh ihvhyhDh{/VPURrkeyiISi[;i/i{ semiq<(iPi iX`i L=h uidi Gp gidi )Gtixi|i~i i+Yi_R NS XS bS lS Hj Sj! [;j"Ij#Ij$Ij%x j&5(j'I0j(I8j)%J@vS3Xk^Wk_[;k` kakb kckeQ9 khX"8kkD@knXkq`ksdktX"hkwpkx]tkzxk]k]k]kk%k>k 4 itkkukEkhk kPk=ttykk&k |:k[k [k[k[k[k[k5Gk+k+k+k'+k+ k+(k"+0k,+8k+@k+Hk"+Pk,+Xk+`k+hkkEpkk+kk=k ]kGkkkk&kx9kq<0S> kWk/7k[;kQ9k W W Wl!XllW@mXm}m }m [ m (m*m,m-m0&X X Xnc*YndN(ne ng nk /7nmdnn(no0nqa8X /Y9D3PoZoPo [;poZxooo o o ooooo"o(o.o/o0o9 o:(o;Z0o>8(oA]@>Y Z pZp+ppZ Z Z + Z Z [ +[ +wF $[ .[ S@H[ +3@q ]0cssqbN idqXjqOU@_Y@qqq/7 qa(q+HqPqOVXqqq.Nq.Nq.NHq)Zq.Zq.Zq+q qJ](qJ]0q8q(CZHqPq9X`qHZq xqyq7XZH[0qJ]q q ]q /Y ]>0m_mmmm m,m.md0m@m(HmPmiXm]`mm+mx9m ]=bdim m(mhmpmm =evmm]m]m]mNm]m/7mmmmam5b=cdimm=bbmm m[m m m((O]hry`rzgr|]r}7i/hrPh(r?0r+Xr#` (` 2`K` t`titit t `t!t" +t$] Ht',at(G keyt) t*,at+i t,i(t-i0t. 1a8 extt/6a@'K``t3 t8a tpt9at: it;Gt<G`18u aaaaa uauN(uua Xvq0bvravs? wqvv5bH cpuvwP 0b8vzobv{a0rcuv|] wqv5b0 xwbwwbwb( lenwN(HwbPwp obb + +b + c +3@xcxcxcx %x/7@@x tbHx!+x"+x#x$?x%ajx&] x'Sd0x(+8=cpux*@=sspx+dH N(c + `x6Sdx7/7x8bx:b(x;+Hx<SdPx=Xx>\c xedxf] sdaxgexh xieXd>xxDexESdxFexH xIx9(xJ/7HxKx9PxL+pxM+xxN+xO+xP+xQ+xR+xS+xTxU+xVx9xW$=xY x\+x]+x^ax_dp Sde +cd)yz3ff.f.f+i3f z6hfz7fz8.fz9 0zAfzBq<zC.f({f{2{2!{"f{#8{${%!{'g{({)!{++g{,{-{!Yg{&f{*f{.g {gf ops{g+g gg {2g{4+{6]{7] ]r@g ]rHh rpKhrqgrrrsPh Kh,ryhrgr+rh%r]r+FrhUhWyh@r7irhr+r+r+ r (r,r7i00rcur]8rhiHhYg rhir idr Aiwi4+ riri i (|i|" |Q|| !} wj}[}& })q< ldt}*|j8}.+@}9x9H}:ih};kp}= x}C)|}D~ wj ~ k~i~+ alt~+~+~+ ~+(~0~8~@~H~P~X~`~h~p~x~~ ~!jk}Fi,(\k(^ i(`](Xk8lru(Yk(d(e(il(j +(k+,((RElk(hLPk(s+ ,((ul(z+ pp({l(|+(}+(~N( l,(l(+,(l(]m( i ]ms ref 8$=HXh]l+p ops Zxi?lF((QmlElllJ(](m(]( -( mval(+6(m2(Mm(N i(P](Jn^lru(Km(W=n(X i(Ym2@(Gn(I+m(ULP(V + n(([ 0(\ 4(^+8A@(Fn=n1(j%2((m4o(n+(o+(q (r (s (t (v] A@(lSon1(z%20(}o(~+(+( i( i( i ( i(2 (o(+(+(A@(| pSoo1(%@(D/p/n/4o@/o6(+/p@ Kq B /7 p  ҾLP i (]0]4ZR8@P p  ix#$ R% R'/ApAp(5rqctx(6wq rq(=q(>g;(@F((Xq(Yq<((\r(b+(h+(t7(w (}$2(@r(+(+A(_rr1(](r(<@(+P(+X(+`(+h(+ppgd(  &x() (5 (?#x(E+(L](S (Z" (]N((_(a/7(pq<(r((+(+(+(+((+ (+((+0(+8(9@(/7D(+H(+P('+X(3+`(+h*brk(+p(!+x(+(+(%+(0+((x(8x@(Mx(k(+h(/7p(Wxx(X"(y(Pq(&y(+(+(( ( (wi(N((a(y(+(+(N(( ts +8x +3 iHx + Hx Rx3haJyaKJaLJ@aMJaNyaOaP GaQ )G nsaR'IaS+aV a^a_ISa`q<aeIS@agaHsetaihaj6alDamJanb@aqJ`\x y y +y4+(+y(-(/ /76( ]yp /uzۉ 7uz(pmd 9 &0pud ; (8@ E$H F$Ppte L &Xptl P7` T $h.](z @9999976797<7G %{N( h,uM{,vM{,w+` ]{ +O@,:|,+,7,b,:|8,V|,r|,r|8,|x,|,|,(*gen,)*seg,*,u80 V| + + + r| + + + +| + + +| + + + N(| + + +H,}seq,+,,,},%}( N%} + +;} + +,},f~seq,+,+,k~,~,,,O ,ef~,f~,h/7P,n+X,o+`,qN(h,s7p,u+,x]{,{|,Z(, {} ~ + + + ~ +,&~seq,(+,*[,,~ ,. /7 Z8~ + +  +'@,, /7,,, ,,,,,,,  + @,,, ,  + + +1,C,,C S +/.],'@,7,;b,<+ ,>+(,?+0,J8,M`,OZ(h,P!p,Q$x,V,W,X,c+,N(,+,+,+,+,G,+, |:,(,@,,x,+,/7(,@,+,+,7,+,+,],],, , (,@,,(`  + %{ + N(( + N(8 +,c,c,O ,, 8 + ,΃, /7,,+(,#,+,+, +, +, + `@4 + hD + Q9T + N(i +/ i 8܄+22++ +(0 ܄U< i4n+v8_`N(ab+c +d 0rcue] reff04>ӅӅ=map: N( +?0rcu] ((4+ "|#d nid&-+4+7 ]RMSkUkXYZ ]c [; d$=(0rcue]HgiXj` idmpptqGxrNuS+aaf|-MRIT]UL:VWWNX Y0[ď8_"``\ha+pbix%dȋBmn0d_uvippN( ]E NT ̈Zë$yyш]m++~,00 p-?4+Zp- ! t v +%_ 2( 0ۉvma 1& 2 d 3 + 4+ 5+  > ? I$ @ l$&)&+=&.`&+++Byyy]eyy++~+&ӊ&+iG&؊&[[&+N$7&+# "W# &'' W,/7 FȋJ݋/,34G len4G2݋6[ 1=8idjkdQ9rstWJu]'x{| }~ G )G] 55! \(LP0 i8+@aH {L P L=X L=` L=hGpGtGxG|/7 LGq<++)) _0@H P T X \p`h(]Op8pH P(X`h ip ԏ +'@ݔ ( 0 8 *@ HHՕPX `ԏ'@\ {+  v(!0!8@"H+P+X+`Nhq<p i&##<F$UZ<   Pq  ] B((` iGL=L=!G"/ 0 F14 6]<x9 BG@D"HFaPIN(XL`O RdR5bhSpZyxab]rcuc]dafx9k0(n/7@@oHq/7Xr` ]~N]~Iؔ]Gؔ=NN *N HN / EFNG\HIM Е mnt  NЕڕN Na dG ] ( [[ ino)[ dev* {(+ {, uid, G0 gid- )G4. 8/X=@0X=P1X=`2X=p3[4[5G6G7[8[9G:G;G,- /7/ d0id 034M678  xa9d % " $/7@@-M lru/0N( % g2x nrg3 nsg4x=  + R4+! val[ ]   '@@oobNo+ooooooooo*kno0o.No.N@oQxo)Xo)Zo)\o)^o$P`oRoRoo ooo$Ro (o@@o@oQHoQpo5Go"o#x9o&Q9o)a*psio,M*bpfo/2K o2Qo5#`o9R7@ ٛٛiYT 8TGi  i(i0ޛ st uQ9^ %;6X6/Pٛ ( set)0W8\@HP,ٛ F;krcu]|]%h pxh)p0dir.`W%;X.p)a)u6G)G6ٛ + ii(ilF0rcuim]in[;io ,ivjix)iy MiuF8xi+ (ir˟it+ji՟iڟiG ˟˟q iiii ߟ i +i&+IISINISП ii keyiISi՟FiƪiJi;i̠i L=i L=,(ii+i+i՟iڟi  (i2i̠2 iYii ƞ iviߟ2 v S  [;i+0N(8@ uid GPN(X `$. h hGh [;h gidh G )GV4+Fhvhkrcuh]3@@WgWh" cpuWi]Wj]Wk] +Wl]+Wm]+Wn]+Wo]+Wp]Wr]WsWtWu]W{ 4 W|?(W} 40W~?8%W@@U4`?@ + E +? 8kk k! k"+k#[k#[ k$+(k$+0 k'@k([k)[ k0uk1 k2 k3  kCkD@ kLkMX"kN 8kQkR kSkT$=  + P +  ! +@; +3)=/067 %IJQ R(U0V8^@fHkP%lpn_+q%oxq|rsu%vxyz{   (08@HPX`h pjx      ; B gX"0Q9%] ` 0rss gS0L8Q9@ X  ! fn 6 arg i 1 +! F b!1 GnSnTnUFnWnXJnY]8nI qnJ iocnK*Y^/ n\]0'mm im m m m+ m](m],m[;0m]4md8m Hm Xm Xm Xm Xm Xm/7`mdm_hmpm!x*devmH(m0m 4m 8m @mx9H*idm hm+pm xmm?mam mf mm :m!?m"m#x9m&0m(/74m)8m*aHm-p *fqm2z m3m5x9m6x9m7x9m= m>/70m@4*tdmD 8(mF]@mKQ9PmPx9hmRxmSmUNmVNmWNm[x9m]  ! ǭ val! valӭ  +!. B0 4+ 45]67 +  0pqPqr s t iu v)$ȸ(A G ǭc )G Pܯ] A  X=X=(X=8 PqHР()*+ ,0-x9@. /7`/ d0\h1$p2 x3+4E! val  ]6BE$8uidF G8gidG )GH DEJǰ Hȱ      ( 0 L=8 L=@ HK+ ](], 0 8i@ != K@89/:/;/</=C >C(?C0@a8/\Cܯ4\\\$HXDECF(G 8HCIC JC(K/0N Q8Oo@QHSaPfܯ(\8ܯ-LL=jjVLtxY|Z[[\[][^[ _[(`[0aQ8cQ@dHeLf[Pg[Xh[`iQhjp8]]]] ]]]ino  L( L0B]B |R + Ѷ]]] ]]]]Xz// ٷ(08@8HPѶ\\]Է\ԷR\$޷\\3\3O8  ] q< 0 H*ops!  + ȱ + =ȸ +w}  i G޻ . H z(0 ż8 ߼@ H P tX`h ɽp x. >W `$`e>+޻-/6 7 9 X ; ] < ]!= ]"> ]#? ]$@ ]%A ]&I ]'P/X(S0VW8W +8X@=wb[H\P_X`\a`b hc pd xLPq pLP`.LP>>C 3uPqLP]ul<MPqLP]]i@żLP@߼ʼd!!& (+t,-./ @[  LPyɽνLPPq)$ @>Pq3W!CGd]A1]Ҿ!Ҿ ׾&)[+  ] & 0'@Z[\]^ `' bO(dm0e8f@hHjPkXm!`oDhpqpr xsuvy {>}a:3i bdijl+m+op(q8rHs /7Xu \v8x`x+y+z+{+|+ +(+0V8h/Wl /7pxaa8 HVXPP_W    (,Pq R7pidP=uid GG $  +]] ]]  x9 [A )1*]+x6,,-t 4+6Pi'0e  e`v +   2K _( 0 o8/@HPX`hp ox  F_ x x o{z   -( 27 A KPN3)* @+ @,_-.Q /+(0 09 {4:LP8< @=/7D> iH? iP@XAx9`BCE Fx9HIK i%Qx_3` id[%; +0+8g;@]D]H]L]PN(X+`0wbh`dpx9q<Q9=devHo5H(?0NX   Q + Q +$6).VVG[][ pos 6 ]PqPq YPqGY] mNm}mm pgPqVScPq lPq]+Pq&PqPqPq4PqRPqRW 9+Pq++++a<`)[PqY]PqY)[]Pql< .PqCCPqH x8 buf8 8 8 8 8  8 (8 08x98 op8uX8`8zh8ip3PqPq]KPqPq]#dd]i Pd]sNN]GN5 'N ON,mNNTNrNGNN{!NN]?N?c&llG]IN v[[ NPq] Pq5>N%aN5CN fN mt >< +.]\2"K`7_Po\d\t\N \& CN\ F\G#ZZܯKx\fd } NvGi + @@AGBCD E2( sdF00Gg;8I]J]K]L]M]rbio  % 458 i@?HP[XI` Shpr  t Xx(-idr d]] O+;T rev+ O t00  0G0rb; ns0]8< >P@ id[` ihp0rcu]xt w opsA!K 0h<` p"$ % & (( 02 89@: H= P@*XA H`w< F ~8dir Y5 ~ L kn0PqC ix9 x9@`h x    @  A %s[[Lp[eCiuiCYiCiYCi[ c[*[&H[/ ]p 0'(M) * +, - 6(pUi U -+-G- -mM-n-o&X-0-1-2 -3 i-4o -5 (-7 0-9 8-; @-= H-?PMMB)`GULPjPq tPq PqPq&-D- b- b IGg ` /7 X 0t-u BvGw!Lx*oy z (-B7DQ=+eejVjtj> }~=buf  +  +? Q%h+ Zs%nj_nGjxjZ ] @/80= ops1"s dev4H56(78 n get put     ( 90a8@HPX`hpx.G`tBn'CH@pHGPXbus5`h ip ixx91 *msix(8@[H[PX `hx = {*idG/7 !!L# $%'#)+ `, a- b. c/ d9 e< fxx QR] idS]T8 Pfg=h]i2===C 9G%aG]i>G fG====G GG]] ))MiG=3`]Lt=e   + ]]  X]] ' sgl( )]*] y  + Gi ti LBDEFGHIiGt   $!]"]  ,A@yK :[@#NO+PQ @c/+skx, ?cb (m,X+hlen]p]t xz | 4~  w42y+end3y+4*5*6]7[;;4* 8. GpHp `THlxG[ (E[FG modG  opsH!7I 3JK~ y eL8argM i8strN8arrO2 VW]X  \- max^]_] num`S opsa!7bi-0(e%)e`;v +  +  ] & " Q +7 `-6. mod/ @0H mp1;P2PX 6 8567 9 ; < (= 0 @G G   .]>J@8EvmodF GI@Ppqirist]?mtnwJ  ]   B`vG +H Q [;adGa ~t  v Q +/ (+++++ 060rcu1]2g;36 E4+ HIJK LM+Ny (/7 get - put -  %-& i'(g; :M;<2  !"# $(%0&8'@(H)P*X+`,h-p.x/012345YHH.U.]l4Hxy /7z]|]}x9~0@ '8M   ! " # $ % & ' ( )G/7 $= @ @ A B C D E>P[aQ9  ]                ][[[[  (*qos0 +,G id-.//7 0(1?02+X3 4`4 4h5 4p6 4x7 48+9+:+;+<+ dev=H> ?  4H8 opsY   HH] MNGOGP!LQ!LR!L T(U0V8W @X HY P[X\`^+h_paxcd pmf0hH `aG busb5d eGg h$j(k0m8n @oHp Pq+Xr`s!Lht!Lp pmv0xw py+HM `23G5!L6!L89  ; (< 0>8@(e@A*HC DP pmE0X: *D/ 0XYGZ!L[\ $^ pm`0(I ]-    $ i^jk |m wHw )^HwG]]+.].]18x 0!" .]1.]B .]O1cd&e2f4 g lidh $E  [ icma    1)`z%z8 grp Q@HP+X:wHh80ac9: Q` ]M5N @P]R] T]AL L mCmD <mI LmN`mS`V emAmB mCx"%` []5 ]5 : D NOln(lolp]lu# lw lx `lz l{ l~]8l/7<lW@laPl5bplx] <4+Hi\dihxii H /7 l<i (Q90<\x  @jk lenl wpmnopqrs t(  +  +@!+%&+@@+" H 4O8]=]B]G mapLOTS@@]oaQ9 @m sbqw] | $ ws( 0]4 8 <T mm mtmmumvmwmxmymzm} ]mm mmm m6 m6(mO0m 8mr@mHm Pm Xm`m hmpm xmm 'y  x  Hmmm @m]Dm& H6m  ]6m] ]mhn mimjmk+ml+mn]mo]mp] mq]$mr](ms],mt]0mu]4mv]8mw]<mx]@my]Dmz]Hm{]Lm|]Pm}]Tm~]Xm]\m]`m]dm]hm]lm]pm]tm]xm]|m]m]m]mmmm]m]m]m]m6m{    ]iPm mm @@m @H  4+  , 0l: |B JO  T (X0]8b@g Hn>Pr SX{v` h p x      3f  qgh ink l tagn o$q](t],u @0 biow8x@HX[`[h[pxz|~Ix ref + // elvQ[i       f ]]]ooPrqs /7  k  u   xops map]8 ]< ]@ ]D ]H L]P]T iX`f hx9pd mm m .]mA]_m_6m]+]O_];hhm Tw+_@]n i __ (  '_)<,LA`Qpe5Kq ]  ]Zz {| /x6FQJ;!u icq u i +! seq]'@6n/@La@N2(SX[+a iefqgz m isy ] /7(80 Xf `f h]p]t xNN s.]&P@@79/7AF+ S]]  +f !Nrq" #$gngNS|nq}  } n  >ni]%Sn]Cvx ]]Xx ]{xC    +  + ]$3>h*k3]W *a ?c dG mS(t&0&8Ã*@Ä*HØ &PÙ &XÚ &`Û &hÜ &pø &x & & & F( V(  o( (" (* (4 (; (E (N &W)X)a3)g G)q`)yGÀÉÏ Ð"Õ]$Ú](Ü],â+0ä+8÷@úDÿ ]@  ]A  ]C  ]D  ]E  ]F  ]G ]L!LP!LX[`3'8&') +/70,78.x9@0`1p2X"3P5Q96#)7"P*9g;:$=< > @]B]D]GH+Q]R]S[\]eghijkl]m]n]o]p+q+z ]{ ]| ] ]É ]Ì ]Ï ]Ò ]Õ ]Ø ]Û ]Þ ]á ]ã ]è5bí5bò]õ]öù+ ú+(û0ü1*irqý]4e)8(x@(x0i H(0(y83(J*KqLMa0rcuO]pQSZ+\]_`abzdegz sdbjzk {m ]p ]u ]v ]w*}~+Ā]ć*ď p?)/GSDqq]iv3(g&hilm o0p Pr Ts /7Xt`upvrwtxvy+xz+}+ id]] lunŀ[Ł]Ń ]ŅiņŇQňQʼnx9Ŋŋ*ŌGōG revŎGő*Œ*œ*Ŕ*ŕ* Ŗ*(ŗ*0Ř*8Ś'@ŜU*HŠ]Pŧ ] ŭ ] ų ] Ź ] Ż ] ż ] Ž ] ž ] ſ ]  ]  ]  ]  ]  ] ppr ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ] ]\` d:h:pxa]    ( x( x a* i  i]]*x9a*X" y(X&&&q&&q&!&&q&''''HOF(PqQR?devSx(Tg;U]*idV] X] Y]!\]"^]#`]$d (e ,k]0l]4o Q8p*<q i@ryH&V('K(o(+[((t((q((](( ((q@&()C() )3)$)G)8)`)L).])k3`P*%%h%J+8@D H!L"P(] - (X) ]&* a*0rcub] lencd* * *.]B,+J+[,+ ?_+ + o+ + o+6]j+^devkt+p+2e+gh+Ad,+1s;tux6z6,{ 4|[2],+ h,h,],,6,+2,,W,2-3-G,D-]]i--32<i0i0x0     !"#$%), -- $D-(i-,.023468: x0V+ 0V+200W02031G041]]Y1~13-<Y4Y4h4     !"#$%)0 01 $41(Y1,.023468: h4V+ w4V+<4-~1 4V+@4 [;4 F4 5 +5inet L5 + 5#5 M|5N+O+P offQ immR+5 ]q5.]6      !".]~7      !.]%8      !"#$%&'()*+,-./0123456789:2PǷ9Ǹ ǹ Ǻ ǻ Ǽ ǿ  _5 , 0 4 8 < @ H LA:11P C: ?key/9 G8:  $ ( 0:  Pl<      ( , _50 @  D  H LP X \` h l:p tx # ' P*<+, - 4 8<9 : @<A B 2 7X=<< = > ? <D GPG9>H I J K OPQ R $S (T ,X0Y8Z @cpu[ D\ H`>a b c d e 2 _>9>g h Gk>l m nr ?s t z2?{ | G@q?>v w x y ?ǂ ǃ(DŽ0Dž 8GLj?lj NJ njP(Ǐq@?btfǐǑǒ Ǔ ǔ Ǚ ǚ Ǟ $G0ǡ@pidǢ fdǣ Ǥ ǥ ?bufǦǫ Ǭ ǭ Ǯ (DzAdz Ǵ ǶDAǷ Ǹ PǾmAǿ -A G A cnt -B  -CBpf    hB  -BCB G0Bcnt  $pid (C  -1o>1dž2?1Ǎ?W?1ǯq@1C ;DnDDDD$D#Eǁ7Fǂǃlj~FNJNjnjǍ F jt jf k1F2 3  G )FFHs?Hs@)sA)sB)sC)sD)sE)sF)sG)sH)sI)sJ)sK)sL)sM)sN)sO)sP6sQ~7lensRG sSGtagsTsU"p sV&(sW[0auxsYa8sZq@pH s I cntsGsGss sssiH7f7/  iI N ops #sI ] [; iInI>ILyD=ns'IxI I I I0%Jns'IyD Z(I a_JaGaGaG,@aJaJaG< *JJ +,aJaJaJ*J@aJ_JJ @aJJ J + J N(K +7 ]*K +@>7K9K@K0AK`DGKJ Ma KK +%K@sK?rcus]slq K +% L +%@T`L0seqX 9@[K^Ga`Ld[8%ipL@@ GpL + GL + +>ҢMңMҤҧx9Ҫ!M0ҭ58Ү[pү[xҲaҵҶMҹN=avgҺNxҽX" Ҿ?(ҿQ9P h lx9pMG[5[[LL GN + [N + + +.N + + 8obN kno0o+o?o%Oo ssoPo o o0o@ idoPo]To[Xo `oah%o:boPooPo ToTo To To T o T(o T0oT8oT@o UHo UPo UXo `o5Uho JUpo &xo &o &o ToooidooGoGoRo oo.To.To]%ObN PQ + (oD>QoE@oH[oJ[ oaQof*KogQomQ(ouQPo{Qxoo oQoooo .NR + R + '@oARoBToE]oH oK?rcuoL] oS@@oVoY o\]o_5obo5R>Q R4+olToro5os+@oy Ho|]Po]TssoPXo`oTpo`xo po3ToLToo o o ojToTo o o w[.TP.TRTQLTP.T8TjTP.T[QTTP.TQoTPTPTTPTTPTTPTTCPTUUU TUUU5UX"Z!UJUX"Z:U3@ JVN(%@@+@N(HN(P+XN(`N(h+p+x+%"@$ min%+ low&+'+ max(+)JVOU x V++++ /7 (x98aX 0Vi ](" 9, 0,/W.i0](1" , ],vW ?W cnt@ AdF Wakrcu]>W nr i W X + ]!*X 4X*X xX /7V?8+`+h+p qCX idqD refqE [; qNXqO ]qQ 3@qWmYqY ]q\'rYq]|Yq^Y%ql@@qp}@jqq@qrYqs!XH mY wY +Y + + (qYq[q atq[qvWFqYqkrcuq]@q$ZJqOU@JqOU@ $Z N(>Z + >Z YXZ + gZgZ4+XsCxZ}Z[Z[[[[[sDZZZiZZ s [maps _s qs qsF6[]([([|5 sIo[sJusKZsL[sMG-[>XsQ]sS]sT_sU _sV _sW_ sX _(sY _0sZ`8s\@`@s^`Hsac`Psd`Xsh _`si `hsj `psk `xsl `sm `sn `sq `sw asx1asyEasz _as|as fs fs Cfsafsfsfs fssfs fs&gs /g s Hg(szg0s g8sg@s&Hs"gPt[]]#E]@s_opssis_sis 5s Gs G s G$s[(sG0idsG4s I8s@sGDsGHsGLbtfsyhPsJ]Xs_5`sx9ps s /,is# s/Pis0s1s2s3s4 s5i]__]]___Pq______ii_i__i_`_`]F_@`_ii["`c`_Pq`]E``_ii[h``_i``_i[`i`_iG`i`_Pq`a_i`,a_,a+5aGEai6a_a_iCJaaaaaa_aibtfa Gdaa_aa'xs fs sGsG sGsGsGsGidsG sG$sG(sG,sG0sG4sG8sG<syh@s oHsiPsx9Xs>fxsos6s~7ssssssssssssss[sx9sos jsasGsosis"osososG(s k*opss ops oxsx9sos>fsvs[sGssos_5sxZsisTpsYp*btfsyhs^pscps&hp s. l<(s/G0s0G4s5G8*mods6 @s7GHs8 1P_`oXaf_af>f_G>f>fG$fafaGHffa[+fff_&fcf_PqfffiGf fffiGf g gi`f/g_[[gHgaa4gfgfgpgpgkg ug Mgg_lZi[g[gago[ ]s+h @99@999s6 syh btfsyhs s+hsGa sh btfsyhsGsG s I shs7hs~h 0sisGsGsgh h,i4+A sPis asrcu!]-s)is*as+/7s,6 s-s.]Q.]stj     99 9 9 9sjsjtjj>f`]jj>fjHsQks>fst+sVks is s 0s 1s i8sG@ Qks5ks6s7s8s9ks:k k + 'Xs)ls+ends+s )ls(sI s P Q:lh+A s^lsrcu]sa'slsissks hsixsi_:l-0sms[ks i s(smssmsx9s [;8sG<keys[@slHs>fxsmsmsm m m + m +^ls%ns)sss-sLnmaps_keysGsdns%n8snsisisiauxsiLn s0s1s)2sG4s0osGsibtfsyhsGns`obtfsyhs A s9os:asrcu;]0om o>fdn o oj_5o _o +XsTpsas  sy(s[0s[8s[@s[HsiPoj Fm7F]2s]ps]mps]p ~Fp4+^2s^ps^ps^p +5p4+s\pqpp p qs/qs/qs[ ?q?q +Dq s lqs>f q Iq{q4+.]s q-s qs s 5-s qs {qpids G5 ]*/7?[;B GcmdEFlpI(J0M1N2O3P G4Q G8R G<U @VTxHW GhX )lY )n\Jxp]x`?a b c Gde$=   + ]>      ]R5 ]d| ]߆ ߔƃߕ 9ۃۃ|3(9Jxg;5 idss )0 )2 )4 )6]8]<]@]Dx9Hah| ops>a G )rcu] ) 9 ƃ q[[[[[ [([0[8[@[H[P[X[`[h[p [x [ [ [ [[i:}qŇ  ( 50# O8+ 9@7mH@ }PG }XN `U h_ }ph }xŇG]iG) ]ʇ)Kz5GG OG:mT}r{x|}~߀߁ )߃߄i ߅x9(߆xH߇aX߉ ߐhf.]ߑC i + '  7    ۃG"y:y7ۃ, QL +@><<A<<<<EE] ŠŠEWEXEYx9E[E\E] X +X  XI +9XI  Xs +cXs t  X + K X[  X +݋X  X +/X tߊ K tx Ki  Š +NJ$} ӊ,} KJi KUi Ki Ki Ki i %i l `#bl 5#lz +ihfYK+aC 9aC ҍ9uu i]"W8*"Ua;Ia=`Y:YʕD{DGD')D4Gefhњ&њesp&GR&\&o5&&&&&\####×#5#QNan{R&&&&&\#####5#QNan{[ڠ[ڠ Й[ (3xb>LbMyҥ c$T{cGSbufc$iSlenc0Ssgd De+DeScrcf+&h &iGxeoffl &l&m io&{&{\f{o[#&+\fo&&&&&\# ###*#5#QNan{Rf[dv1djbdۡҞy٣ Q []ɟidӡ y ٣QgwxH$T~$Qsc$UvOELLǎ3=ڠerc5FDLL؎LΎLǎLTњMfpFʕNMp (Mv&Gz i]skb2lenD]tmp i5 NvB0TiB.$T$Msg8 z iΡC EΡB% z jC j8C jVN ;B /N TB 7N B 2B K5f N Mnew 4B KN Mnew 1B B 5f T j&B jF{ret l5# o# pT AgMnew A@B BB C{ret ET\5{c^ NM٣MvalM55#O#O5#OG5#OT ,,X"N5# 1 X"# 1 # 1 ,# 1 )># 1 G5# 1 [#ҥC#:C$C%C&C'C("Uˤ"U٤"U"U"UB "U:"U:'"U:6"U:5"U:P"W^"Wl"Wz"W"W5"W:"W:"W:ť"W:5"W:C:CC"$"2"@"N"5^":m":|":":5":fN+ +G+XGNQN]uNNNNint],N*N_s8i_u8|l_s16_u16+l+_s32?_u32lN_s64_u64lg]2 N+1]2]HIX]^_`QNN%'),<] N &#N%&*+4=B]]h?nN} ] g g g ] ]& & ]  &N NNS&N Qh+ hl{+W?fH  G   " 6  ( 0 8  @  H  H  H ;H  H  H  H  H,@ AnPQhGG ]82kp ](],0 8@AB]D HPmmem@+ ]5 2(0]8@]H]LP]X`]hp i x]] ]]]Z ]!Z"]%&O)9]:?AD F P  Q](T0< <B ++"b Kval $ $ v B ,b <    +"  $    v  ww  ) v   )  ]+, fmtGGG]GG$ "e4 f+gi hs ui v?w? keyx4 n U V  j keykx n keyox 6 7 8 8r GGGG]]4] key9 ( ]=  8UV modWXGY  Z ([ ,\r 0G uPvPwUx]y]  +] Qt+ / 1] set 3 get 5 7 @5tb     ( 0t8!@" H# P$ X%`&h'p(x)2*P+x,-.x/ 0 1 d2'3 J5 _9 ; >2?@ !!!% !+ !-!/ @" x" Qg+# $<$$  # d# # %;Lcs%=gLsl%?gLwfe%Ag %E2Lss%GgLsti%Ig4%KgLnmi%Mg4%Pg 4%Sg04%Vg8Llm%Xg94%]g:4%dg<"%_Kcs%+Kcsx%g%d"%Kss%+Kssx%g% %g r15%m+ r14%n+ r13%o+ r12%p+ bp%q+ bx%r+( r11%u+0 r10%v+8 r9%w+@ r8%x+H ax%y+P cx%z+X dx%{+` si%|+h di%}+p%+x ip%+2%+ sp%+_ &BJ&C+&D+4&E+ 4&E+(Ls&E+,Ldpl&E+-Lp&E'+/4&F+0Lavl&F+4Ll&F+5Ld&F+6Lg&F%+74&F++8'+'+'+'+'+&'  pte'J'"&'  pmd'V'"(%(%%zF(%/9(' pgd('nF('"9(p 5pud(pbF(p"F(OT@)H)I+=Fnpn0) 4)+8 *;*<!*=!4*? ] 4*@ ]$4*A ](4*B ]+,-@+ %+$7+]+]+  +;(+ ],+!]0+( 4+)58+*]H+++P+,%X+5 `+6 d+8 h+: l+; p+< t+=]xPse+?G@2rt+@Imdl+AI+BI+F#L/+I9+J++K]+O-L+X2L+]2L/+`"F@+d +h]+k] +l++m +nBL +oGL(+p)0+q X+s`+ub+x d+yKh+zp+{QL+++++ ++ ++ + +K+++ +E++8(/+9P2mm+='h+='p+EMx+ + + + +++]+ ],+ ],+ ],+ ]-+ ]-+ ]-+ ]-+ ]-+ ]-+ ]-+ ]-+ ]-+ ] -+ ] -+ ] -+ ] -+"] -+++62pid+ + +++%+ %+++%(+0+@+MP+MX+ +"N+% '+( '++ +- g+. g+3 g+4.D+6D+: (+=+0+>+8+A g@+D gH+G+P+H+X+KPB`/+NB+T|O+W|O+Z|O+^lP+k v3+mvP+p7 +q8(+t+8+u+@2fs+xPH+{PP+~PX+Q`+Th+ Up+ <x+ <+ <+t@+++ +]++ U+ C+]+Z;+@+ g + g +t8 +)  +K +o9( +%8 +U@ + H +DUP +UX +U` +MVh +WVp ++x +\V +A +] + g + g + g +; +C + +W + + N + N +"W +)W +  + W0 + 88 + ]X +X\ +X` +8h + +#X + + + +  +!] +"] +# +$+ +& g +' g +( g /+)h +3-X +CZ +D+ +L2X +N+ +RBX +SN( +TN, +Y+0 +] 8 +^ < +_ @ +` D /+ahH +dAX +gLX +iUA +lVX +w +x +z+ +} +~[X + g+ g+ + +Z+++ + +++]+,Z+mZ+\+%] +](+],+L0mrcu+h0+;@+ D+%H+;P+/]x+;+ + "9]+ F]+P]++ + g+ ++>/+h+ +!"4+$"4/+.h+<Z]/+F%@@ %+?,@@, ',3sp,+es, ds,",$,&,+(,+0,48,+X,+`cr2,+h,+p,+x,-4,+,],N,+,+, N3Pfpu, 2@'%' (- ='- )B',@@)i'=)u@)z@}'Q)(=$s)=') Cs )(),)s0)hs8)X)sh)%tp)+x)4r) )t))*)#X)t)9r5 . (. . ( / (/!? key/"?"/?)/A+/BJ)/CO) 0J)0J) mod00O))( /=u)/>( ]3)      +)+- ;"')-?* "')*+1 ]3*     *,@A@4m-4@4$!4&54: t854<+54=+54>+54@64A`64B` 64E)864G 64H+64K864M%64N64O864Q64T64U864V`64W%74X74^+74d+74e+ 7/4i@@74tz@74y]`74{+h74}]p74]t74+x74~74+=4 ~=4|x>/4@?4$9?4>?4SA4A 05c-5dG5eٕ5g5i 5l #(m- 6-6g end6g07 07  p8. cwd8N swd8N twd8N fip8N fcs8N foo8N fos8N8.8Nl N.+<8*. rip8+g rdp8,g<8.. fip8/N fcs80N foo81N fos82N "8)/$.$."08@4/8A4/8B4/ ND/+ A8$/ cwd8%+ swd8&+ twd8'+ fop8(+.85N86N89/ 8</8>4// N/+ N/+? 8Q0 cwd8RN swd8SN twd8TN fip8UN fcs8VN foo8WN fos8XN8Z.8[l8\m8]n8^o rm8_p8`q8a0x8bN( 0+ g0+@8:218; g8< g8= 21 gB1+,@@8O18PD/8Q08R1@ 1C+@8^18_ .>8`D/8a/>8bB1@8c1 1x+,@@8f28h]8k]8ng8qgxfd8tg8w]8z]8]8]81@@828 g8]8] fpu@8I38]8+8I38I382 82081@@1 9 v39 g9g Q3+ Q3+? :3: =:! p:" [:#3 g3+ Q3x+ 4+ 44+#4 (4 ;4;];];G;G;G0<0<0< =84=94 =<4==44"><5>=]>>  >:@5>;44 src>A+ dst>A +E5P5 ]?s5&(?5?5 val? N?!N ?"N?#g?$5 N"?*5?+&5?,#6 @6@_@ ?5&?'[6?(?)P55?.g& ?16?26?3?4 ?5+?6+ 6"(?6?%s5?/$6?7[6 8? 7?+ fn? 76776 7 A>f7A?+A@+AAN cpuACN B7BgBg(B7:ctB24B&7 f7 ]C7 D 8D 8  8 E /8E F J8F "G`8G Gt8J8G`8&H 8H H"8 I)8I*)*I+)  osqI-/8 I/ (J 9J J JKO9K+KO9KO99 K o9K O9 K9KT9KO9 L9*L 9L F L 9Lo9 ]M 9@M'o:*M(9M) F M*:(M+:0M,8M-9M.:M/;9~:~:9o:@@N/:N0͞N1]N2  seqN3CN4~:N59 N6מ0N7 F8: (OE;O &O+O U;ON P;P;;E; P;PP P; ;&Q ;Q; +;+Q8; R;R R;; S+ <S,S- xTb<Tb<T]`T+h maxT+p +r<+ U<U gU gU&V < sigV;V<WRWS<<WUWV<<X+=X X X =&X'[=X(X)&X-=X.X/X0 +=X1&X5=X6X7X8 +=& X<>X=X>X?X@XA&XSF>XT dXUXV& XYj>XZ dX[ &X^>X_+X` Xa "XJ>XLXQ XW>X\F>Xbj>& XE>XF>&Xg"?Xh _fdXi&XmS?XnXoXp]  X%?X*7=X2[=K_rtX9=XB=Xd>Xj>Xq"?<0Y ?Y Y Y Y S? 0Y @?Y? Zuo@Zv& nsZwjz uidZx CZy Zz Z{O@ Y @Y!Y" < Y%@Y'<Y(+Y.<Y0 < Y3@ saY4@ [ :A[ 2[ + len[ +[  (\UA\ "' ]$A]%O]']( 0]DA]M#:A]P(]W) 8^ (B^g^g^g^g^g ^#g(^,g0 _)PB_*g_+9 P_8B_9B_:]H_;]L (BB+8_DB*_Eh_F8_G]0 `>4C`K`Z`p``` end`4C QCCC+ a!^Ca" ]a&CC aDCaD^CaDjC aECaE^CaEC&aT CaYCaZ t8a[C&b C valbb C&b "D valb b  D+SgD+U g+V g+W) 6]+[D0+hE+i^C+j+kgDcpu+l]+mg+ng +og( +OE++++++zE+++ NQ@@+F+ g+ g+ g+ N+ N++ ++(++0+]8,@+G+ g+ g+ g+ g+ g + g(+ g0+ g8+ ]@+ gH+ gP+ ]X+ ]`+ gh+ gp+ gx+  g+  g+  g+  g+ g+ g+ g+ g+ g+ g+ g+ g+ g,@+I+OE+ 9+! g(+" g0+# g8+%@+&P+'Q+(R+)S+, gX+- g`+. gh+/ gp+0 ]x+1 g+3 g+6 +7I+9 I+; I+=+Pavg+GzE@G I0+KI+L+M++N++O] +P$+Q&+SI(IF+]IIIIIQ+`K+a9+h g+i g +j g(+k g0+l g8+s ]@+t gH+u]P+]+]+]+]+]+]+]+]+9X+9rq+6K+I+K+IF+^K#K%2KIyrq2K+K+] +] +]+]9+K+++++Knb+Kns+N+ L+ LKw+ LL (L ;KBL+*) LLQEMma v@ D Ho9P+` +h)p+x 9t8a VLpidpc7Mc9 ;c:]c; t8c<ͯ inoc=gc? c@ @cB`H:rcucCh`cDpJM &M+ dNd]d,bMeowOep)* uideq C gider "D es Cet "Deu Cev "Dew C ex "D$ey ](ezٻ0e{ٻ8e|ٻ@e}ٻHe~ٻPeXelP`elPhelPpelPxe e|ejzeo@e=\NwOkeyflPf;f=f semfa(fPf X`f h uidf Cp gidf "Dtf xf|f~f f+_fO qP {P P P Hg Qg! ;g"Ng#Ng$Ng% g&:(g'N0g(N8g)N@PAXh^Th_;h` hahb hche` hh%8hkt@@hn Xhq`hsdht%hhwphx]thzxh]h]h]h h *h9h F ithh\hPBhhh hMhRttyhh h Chgh ghghghghgh.Dh+h+h+h'+h+ h+(h"+0h,+8h+@h+Hh"+Ph,+Xh+`h+hhAphhhh$h ]h.hhhh='h8ha0!QU hUht8h;h`h T U UiDUiKiKU@jUj j  j g j (j*j,j-j0IU U XkcMVkd)*ke kg kk t8kmmkn(ko 0kqub8U RV@APlWlUl ;plWxlll l l lllll"&l(l.l/l0l9 l:(l;W0l>8/lAh@aV W mWmmmW W X+ X X (X +BX+B GX QX <kX+A@n,Z:cssnJS idn}]zn7Z@o^@nnnt8 nub(n+HnPn7[XnnnSnSnSHn_n_n_n+n nmZ(nmZ0n8n(+_HnPn!]`n0_n zxnzn7@_kX0nmZnn,Zn =^ 1ZU0j\jjjj" j,j.jm0j@j(HjPjXj`jj+j8j ]Rbdij j(jhjpjj Revjj]j]j]jZj]jt8jj jjubjcRcdij(jRbbj2j jgj  j(~(rZhoy%]ozho|]o}j=io4i(o;0o+Xo# j`\ *] 4]wp>>] K] U]0q0q0q0q!0q%0q'0q,0q/t80q30q50q90q<0qA0qD0qH0qL0qQ0qU0qYj^ r^rrr r ^r!r" 4r$] Hr'K_r(G keyr) r*K_r+ r,(r-0r. P_8 extr/U_@T)j^^r3 r8_ tpr9_r: r;Nr<N^@? s_s_ s_s_s#`__t !` (tS`t]t tS`t t_`d```]` t#`t$t8t%t' `Gu8GuGu ]la .a ;0vw w";a"wnawt8w@a waLaw]w (x0ax1)*x7)* osqx9/8x;) x<GxGxGxGxGx y+Tby,) y-z `bebpbpbub zbz)*zzTb ] !c+ ] WQc'@ X qc rub s; wq vcH cpu wP c8 zc {ub:rcu |h wq c0 !c x|@d||@d|Pd( len|)*H|`dP|p cPd+ +`d+ pd+A@}Je}Je}Je} *}t8@@} cH}!+}"+}#}$;}%ubz}&h }'e0}(+8Rcpu}*@Rssp}+ fH )*Ze+ `}6e}7t8}8Pd}:Pd(};+H}<eP}=X}>\Ze }e f}f] sda}g]g}h }ibgeUx}DMg}Ee}FMg}H }I8(}Jt8H}K8P}L+p}M+x}N+}O+}P+}Q+}R+}S+}T}U+}V8}WM}Y }\+}]+}^Qc}_ fp e]g+pdf0~"g00&"g#?$%&'g()&+h,-"!=h&g*g.g dhtg opsnhh dhih 2h4+6]7] ]o@h ]oHh op/ioqhoros4i /i<o]iosho+oi*oho+Voi$9ih]i@ojoho+o+o+ o (o,oj0:rcuoh8oLjHi=h oLjo ido %j[jC+ ovjo{j vj (j) ] & [kg& )a ldt*`k8.+@98H:h;olp= xC+|D!~ [k jl+ alt+++ +(08@HPX`hpx !ekjlFj<)\l)^ )`]")XlKlru)Y$l)d)e")il)j +)k+<()R)ml)hEMl)s+ <()usm)z+ pp){xm)|+)}+)~)* sm<)m)+<)m)An)  AnX ref8MHh]l+p ops xtmV()Qpn$l$)m$}m$m`)h")n)]) 9) nval)+F)n?)Mn)N )P]%)Jnnlru)K$n%)W!o)X )Yn?@)Go)I+n)UEM)V + n()[ 0)\ 4)^+8S@)Fo$!o>)jT?()mp)n+)o+)q )r )s )t )v] S@)l7p$o>)zT?0)}p)~+)+) ) )  ) (? )p)+)+)S@)|p$7p$p>)TQ)Dq=o=p@=pF)+qQ /r ) t8   EM  (]0]4|O8@P p  x#$ 9% 9' =%q%q)5Vrctx)6[r Vr)=r)>a)@4C()Xr)Ya()\r)b+)h+)t7)w )}$?)$s)+)+S)Cs$r>)h%)hs) q)qW )sPrb)9)+r sbtc h j3kGqj s(t0u8w@{H~PX` h(pAxst`rr)t)gcid)) c@@) t) 9 ))u))+) ,Z@@)y=t@)na@)+P)+X)+`)+h)+ppgd)  i'x)) )5 )?y)E+)L])S )Z) )])*)_)at8)pa)r))+)+)+)+))+ )+()+0)+8)^C@)t8D)+H)+P)'+X)3+`)+h2brk)+p)!+x)+)+)%+)0+) y)y@)1y)tl)+h)t8p);yx)%)jz)4r)&tz)+)+)) ) )[j))*)ub)~z)+)+))*) tt +y+3 j,y+ ,y 6yAhZJjzZKOZLO@ZMOZNjzZOZP CZQ "D nsZR9NZS+ZV Z^Z_lPZ`aZelP@ZgubHsetZiլhZj Zlo@ZmOZn`d@ZqO`@y oz yz +zC+)+z)-)/ t8F) ]zp/Z{7Z{(pmd9 s'0pud; (8@EOHFOPpteL n'XptlP]`T Bh6]){ @'''''G6G9G<GG  |)* h4u2|4v2|4w+` B|+b@4}4+474Pd4}84;}4W}4W}84m}x4}4}4(2gen4)2seg4*4_0 ;}+++ W}+++ +m}++ +}+++ )*}+++H4}seq4+444}4 ~( Z ~+ + ~++4~4Kseq4+4+4P4l444b 4eK4f4ht8P4n+X4o+`4q)*h4s7p4u+4xB|4{}4*4{~ l+++ |+4&seq4(+4*2X4, 4. t8 _++ +,@44 t8444 4444444 + @4݀4݀4 4 + ++14(44( 8+/6]4n,@47Ӄ4;Pd4<+ 4>+(4?+04JӃ84M`4O*h4P!p4Q$x4V4W4X4c+4)*4+4+4+4+4G4+4 C4/4@44x4+4t8/4@4+4+474+4+4]4]44 4 /4@44 ` + |+ )* + )*+4H4H4nb 4j4j z+ 44 t844+(44+4+4 +4 +4 + pn@+ M)+ `9+ )*N+/ N 8+22++ +(0 f˅< in+v8_`)*ab4c 4d :rcueh reff0Յ& v +%6]T ++ n ć|ć|||| E E | | || |ԇ+ ]4'' ]<4  ]Ji i  "BDEFYGhHI T O!]"] T ^c,- t8/ v0m<AȉÈK ":@i$"NO+PQ  (+_,-./ ȉ 0pȊq4rr s t u v+$A(_ҊQ cW=0sk x#1 Pcb  a(1X +hlen ]p ]t  x z  |  9~  | | | | | | |  |9 20end 30 4p- 5p- 6] 7; ;9Ҋ Qq+/ 034s678  xa9m idrm]] 7+T9< rev+ 7 \  G:rb9 ns0]8< >8@ idg` hkp:rcuhx\ _ ops)!3 h$ "$ =% [ & p(( 02 89@: H= P@ϑXA `_$ ." fKdirA fu x: buf:2: : : :  : (: 0:88 op:X:`:h:p  kn4rp 8 8@`h 2x    @  A %tp 8p8$[p8Bpp`2uu ϑx'ԑ ] 0'q() Ѕ* {+, - @5(fv f N ] : gg ino)g dev* (+ , uid, C0 gid- "D4. 8/<@0<P1<`2<p3g4g5N6N7g8g9N:N;N 5#5G5 "5mE5n5o&X505152 53 54$ 55 Q(57 ~059 Q85; ~@5= H5?ɖPEEԕ @@ϕAGBCD E( sdF0Ga8I]J]K]L]M]ޕԕfEMQ4r2)~4r2V4rɖ4rx'55 5 :Ζԕ2:ԕG ` t8 sX? 0tu vw!x*$y8 z \(-qϕ 8)RRWC"D=U }~ØRbufӘ 2Ø+ 2Ә+? Qx+ 2Kn--GF7FddaPi (Ǚ+++++ 0:rcu1h2a3 x C+ HhIhJK LM+Nz Ǚr,=m@pHGPiXbus`Uh p x8\ 2msi( 8@gHgPX #`h-x 7ZA 2idNt8 ѩ!!# $%'#)c+ `, a- b. c/ d9 e< fr(t8 get ɝ put ɝ  %ɝ& '(aA@@Ng͞Nh) cpuNi]Nj]Nk] 4Nl]4Nm]4Nn]4No]4Np]Nr]NsNtNu]N{ F N|~:(N} F0N~~:8*Nܞ@@ΝfFҞp:@+ :;<ey  !y"y#y $y(%y0&y8'y@(yH)yP*yX+y`,yh-yp.yx/y0y1y2y3y4y5yymjm~6U6]lHxRy t8z]|]}8~0W@ R,8   ! " # $ % & ' ( )Nt8 M @ @ A B C D E9Pgub`  ]                ]gggg  Х(2qosڥ0 +,G id-./t8 0(1;02+X3 F`4 Fh5 Fp6 Fx7 F8+9+:+;+<+ dev=m> ?  Хm? եPopsy `y  y`mPym]e MNGOGP!Q!R! T(UҨ0Vy8W @X HY P[yX\y`^h_ypayxcyd pmfh~m `aG busbdeGg h $j7(kF0my8n @oyHp PqXry`s!ht!p pmvxw pyPͨͨd=mרe `23G5!6!8Ҩ9 ; ֩(< 0>y8@(@AHC P pmEX2ͨѩѩƩͨ۩ͨRW 0XdYGZ![Ҩ\ ^ pm`( d ~+@ ~8- 8-G Z_ (0 sZt u`2 *9 X =ZN Ь( set0,81@ HsP<Z Vs${rcuh]Ь*լYh spxhE:dirլ`,*T9XdE6YЬJs RW^ x "#ԭ &ԭ'ԭ' ٭ԭ<t8 V`$ޭ2=<3V4N len4N"2q$26g 1V8q"ijk`rs&t`uhRȯT]UCVWͯXq Y0[8_"ʳ``ha+pbx*dm&n :d_uv,x{| }~ C "D] [[! (EM0 8+@H L P X ` hNpNtNxN|t8 ^Na++&++ o0@H P T X \`h/VLp8 H P(X`h pү +'@ų̷̷+ ?( O0 O8 d@ HP-XF`ų,@ +  (!!0!&8+@":H+P+X+`ͯhap &I#bl${   4r   &] (/A` N!N"/ "0 -14 26]<8 BG@D"ʳHFPI)*XL`O 9dRchS pZjzxaqbqmrcuchdubf8k0/nt8@@oHqt8Xr`ϳ ]̷ͯ]ȯqѷ]G+?ͯ0OͯDdͯT2ͯ2i EɸFͯGHIظظݸ  mnt ظ ͯɸ(( ͯFͯ2UttRmap; )*+?:rcuh ɹɹC+K "#v nid&-+4+7,ZRS U XYZ ]c ; dM(:rcuehHgXj` idmpptqGxrͯu+ι)* K " $t8@@-s lru/0)* K c2 nrc3 nsc47 + x»C+& ٻ valg» ]  = ,@@llJSl+lllllllll2knllSlS@lVxl+Xl+Zl+\l+^l$U`lVlWll lll$Wl /l@@l@lUHlUpl.Dl"l#8l&`l)ub2psil,R2bpfl/P l2Vl5#9]l9W=G + f.f:flK:rcufmhfn;fo <fvofx+fy X"fu$KKxf+ (frпft+ofڿf߿fG пп f ff   +f,1OlPOTlPտ ff keyflPfڿVfưf`f9"ff f <(ff+f+fڿf߿f 2 "(f8f$? f_ff ˾% f|f$8 | Y  ;j+0)*8&@ uid CP)*X `$5 h eMe ;e gide M "D\C+Ve|e{rcueh @+? 8hh h! h"+h#gh#g h$+(h$+0 h''h(gh)g h0\h1 h2 h3  hCwhD' hLhM%hNw 8hQhR hSwhTM + M+   ;"+A)$/06|7| *IJQ R(U0V8^@fHk"P*l|pnćq*oxq|rsu*vxyz{   (08@HPX`h pzx      " ) N%0`*h ` :rss N_038`@ X   fn @5 arg  |+& - b N"kSgkTkUVkWkX&`kYh8kI qkJ iockKMVE=g k\]0,jj jgj| j j+ j](j],j;0j]4jm8jHj Xj Xj Xj Xj2 Xjt8`jdj\hjpjx2devjm(j0j 4j< 8jF @j8H2idj hj+pjP xjj;jubj j jj ;j!j"j#8j&0j(t84j)8j*QcHj- 2fqj2 j3j58j68j78j= j>t80j@42tdjD 8/jFh@jK`PjP8hjR jSjUͯjVͯjWͯj[8j]  & val& val  &. )0 4 4j5]6j7 zz+  " C " "D PU]   <<(<8 4rHZг()&*+ ,0-8@. t8`/ d0h1p2 x3+4& 4 val  ]6cB"EKuidF CKgidG "DH 4 DoJ@ HA c c c c c  c( c0 8 @ H + ](], c0 c8@  ! @89:;<= >(?0@8UXDEFG HI J(K0N 8O@QHSPUUc4xYZ[g\g]g^g _g(`g0a]8c]@dHeLfgPggXhg`i]hjp8]]]] ]]]ino  ^( ^0] + J]]] ]]]]X// R(u08u@H/PJ(/]MM4ppWpzb8  ] a 0 !H2ops!1  !+ A1+ A+%wf}k  fpȊWu  (%0 >8 X@ qH P X`h p x'T d}OU+W-/6 7 9\ ; ] < ]!= ]"> ]#? ]$@ ]%A ]&I ]'P](S0V\8W +8X@Rwb[H\P_X`\a`b hc pd xp4rpp\EMzEMp 4rEM]ap%4rEM]]pR>EMR*XpCqpv]pvȊ\EMpppp p  'EMpEE4rOJ R,d4rY}Ȋ\i%d]S >h%! %LLXQ 2 ] L V,@Z[\;]Y^w` b(d0e8f@h:HjPkbXm`ohppr xs*uCvky{}S`Ai bdij l+m+op(q8rHs t8Xu \vy`x+y+z+{+|+ +(+0[8h\l t8pxQcQc8H[XUUo\    (R4r 8pidM7uid CC $  +]] ]] % 8 gS )>*h+4,R-  4C+FP,0  p+    ( 0 8@H PX `-hKp xdddd      05 ?SDN X] g qv5A)* R+ R,\-. /+(0 09 4:EM8< @=t8D> H? P@XA8`BCE F8HKIK *QrA` idg*9 +0+8a@]D]H]L]P)*X+`:wbh`mp8a`Rdevm3m(;0ͯX   Q2+ QB+$FOT||Gg] Bpos F ]4r4r284rG86Ȋ6]; jtj jj 4r|yu4r4r]+4rx'4r4r424rP4r7n4rns U+4r++++}[^LX4r8]4r8LX]4ra" J4r,_p4rO4r4r]d4r4r]] 6]ͯͯ]G6ͯ6Y@[w^ͯ2|ͯͯͯͯͯG:ͯbͯ?ͯͯ]gͯ(N]ͯ2  gg% C/kͯ4r]H4rp[ͯͯ[ͯ ͯ ?mt na +NN?6]||X #ͯ#( K '22dpͯP2iGU   ͯ6G K+Pbio։K wP *o 48 @H\PgX` hpr  t x* ?. Nmm JjGj ( E FG mod G ops H! I 5 J K oV2j" L"Karg M Kstr NOKarr O  VJ W] X2"J \ max ^] _] num `_ ops a! bT0(*)p9+  + < ]  ' < QQ+7 `-. mod/@0H mp1P2NX  8567 (9 K; ` <t(= 0#2QK#G-`GPtey6]>Q8EmodFGQPp5qrst]Pmtnw | |]22J Iop+5  Z_ ff_    ]-- -2 <A K2ͨRWb ijk m m2mG9]]+6]c6]8 90!ƅ" 6]1E6]Bi6]Ocd& e2Ef4ig lidh ߥ  g ycma( 2 < @/0 ops1"O dev4m56(78FF  0`<*B<8 grp @AH_P+XZZmFh8:ac9: ` ]E NT Ze7Ozz7An++<e<e -tC+"-$A?(0vma1x'2 v3 +4+5+ %>? @ x'3x'+Gx'8jx'+++Lzz]ozz+++x'x'+Gx' x'#X#X(x'+ZOAx'+- ]oMN RP]R] T]K  jCjD jI jNjS ejAKjB2jC%%#` wg]" ]   binioip]iu#iw tix t`iz ti{ ti~]8it8<iU@iubPicpi&x C+v Hj t8 aj o(`0  @jk lenl wpmn|o|p|q|rs t)( |)+ |9+@o!+*&+@@+) H 48]=]B]G mapLT_9@@]a` @m_ sbqow] | $ wsā_(Ć 0Č]4Ē 8ė < jm jtjujvdjwjxjyjzj} ]jj H jf j j j  j (j 0j 8j @jHj Pj XjD`j ]hj{pjxjj     # -Hj~jj @j]Dj&SH7Fj  ]Fj] ]jhjijjjk+jl+jn]jo]jp] jq]$jr](js],jt]0ju]4jv]8jw]<jx]@jy]Djz]Hj{]Lj|]Pj}]Tj~]Xj]\j]`j]dj]hj]lj]pj]tj]xj]|j]j]j]jjjj]j]j]j]jFj]PjSjj R@j RH bC+ b,w 0: B #J7O L T a(Xu0]8b@g HnPr X{`ŀ "hŇ pŌ 6xŒ Fř [lw   Af2  qgh ik wlN tagn o$q](t],u R0 biowK8xK@}HXłg`ŅghŇgpŊxőzŗ|Ř~śŜ şZ refŠ Ţ+= elvg;  7  A  K  ]]]Prqs`` t8U        ops| map]8 ]< ]@ ]D ]H L]P]T X` h8p f j$ j2 j2 6]jH f K6]M  \k  \  ]+ ] \]       + D\R]!2]\I{\($ b \O63/r ] J get put    "( ;0c8@HPX`hpx0IbvJ QR] idS]T Pfgh]i0ͨ";G'cG]@G hGG GG]] ++TI5b]Nvg  + ]]  j]] '  sgl( )]*] { ].:N2 P ]Z}"z{|2 "ūŬ&ŭ4VŶ`ŷ9Ÿ&ſ icq  +&; seq];.,@6=-@LQc@N *SX[+a efqg m soy ]łńņc ʼnt8(Ŏ`0Ŕ XŚ `Š hţ]pť]tū xŮ&Ű&ŲŹͯŻͯ@ 6]&-c@@7c9t8AF+ _]] h+ !rq"2 #P 7(L<a2 Qu2 f2 z62 ]] 2 ]]" 2 ] 6'F ;[p2 K2  |+ + ]$Uh*3]W !a !cdG m!(t+)0+)8ȃ!@Ȅ!HȘ ?)Pș ?)XȚ ?)`ț ?)hȜ ?)pȸ S)x q) S) ) * *  + +" *+* +4 C+; W+E z+N )W+X+a+g +q+yGȀȉȏ Ȑ"ȕ]$Ț](Ȝ],Ȣ+0Ȥ+8ȷ@ȺDȿ ]@  ]A  ]C  ]D  ]E  ]F  ]G ]L!P!Xg`6 ,86 &') +t80,]8.8@0`1p2%3N5`6#3,7",9a:M< > @]B]D]GH+Q]R]Sg\]eghijkl]m]n]o]p+q+z ]{ ]| ]Ȃ ]ȉ ]Ȍ ]ȏ ]Ȓ ]ȕ ]Ș ]ț ]Ȟ ]ȡ ]ȣ ]ȨcȭcȲ]ȵ]ȶȹ+ Ⱥ+(Ȼ0ȼ12irqȽ]4+8/r@/r0 m(0/z8; A(J!K"LMQc:rcuOhpQSZ+\]_`abdeFg߂ sdbjkm ]p ]u ]v ]wp-}~+ɀ]ɇp-ɏ !+!G!!""]"A(g+)hilm oo0p Pr Ts t8Xt`upvrwtxvy+xz+}+ id]] lunʀgʁ]ʃ ]ʅʆʇQʈQʉ8ʊʋp-ʌGʍG revʎGʑu-ʒu-ʓu-ʔu-ʕu- ʖu-(ʗu-0ʘu-8ʚ)@ʜ,Hʠ]Pʧ ] ʭ ] ʳ ] ʹ ] ʻ ] ʼ ] ʽ ] ʾ ] ʿ ]  ]  ]  ]  ]  ] ppr ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ] ]\` d;h;pxub]    / r/ r ub-   ]]-8,% z(!?)6 0)S)"D)l)"l)X))"v)))),HO*P"QRPdevSr(TaU]2idV] X] Y]!\]"^]#`]$d (e ,k]0l]4o Q8p-<q @rzH)*)*++*++*+"+C+]/+W+2 H+z+"R '\++p++2++6 ++6 +++6]3,A`,*d*dh*d-8@D H!L"P(] - +X8, ]&:- ap-:rcubh lencd%:- z- -6]B--""g- Q-+W ]s0      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg 0F ]% j0ndev k0 p+? e0 g͊ h͊0S d#1$0> s9 t u4% zH1 { F |g? o1 +  z1z1͊o1% 1$H1  +? 1  % 1 i$1? 2 E % 12 N$1% V2 ] ]% {2  % 2 E |?< {5 {5 | | | | | 5 | |  |  |  |  | | | | | | | | | | | | | | | | |  |! |" |# |$ |%  +1    212  $V2({2, . 0 2 E4 6 8 : |5g+ |5g+? 5  % 5 i$5? 6 E % !6 N$5% F6 ] ]% k6  % 6 E |9< k9 k9 | | | | | z9 | |  |  |  |  | | | | | | | | | | | | | | | | |  |! |" |# |$ |%  +5    6!6  $F6(k6, . 0 2 E4 6 8 : |z9g+ |9g+%< 9$2 6 |9g+Q 9  ; :   4C9 :+:ynet L,:+:-,: M:N|4O|4P| offQ immR=: ]q:6];      !"6]<      !6]%>      !"#$%&'()*+,-./0123456789:?Pͷ>͸ ͹ ͺ ͻ ͼ Ϳ  v3 , 0 4 8 < @ H LS?>>c U? Pkey=> W8?  $ ( 0%?  c~A      ( , v30 @  D  H LP X \` h l?p tx # ' c*A+, - 4 %8A9 : %@ BA B ? 7jBA< = > ? AD WPGKCH I J K OPQ R $S (T ,X0Y8Z @cpu[ D\ H%`Ca b c d e ? _CKCg h WkCl m n%rDs t %zDD{ | W@qDCv w x yD͂ ̓(̈́0ͅ 8W͈E͉ ͊ ͌c(͏EPbtf͐͑͒ ͓ ͔ ͙ ͚ ͞ $W0͡ Fpid͢ fdͣ ͤ ͥ Pbufͦͫ ͬ ͭ ͮ (%Ͳ1Fͳ ʹ %ͶVFͷ ͸ c;FͿ 9F W F cnt 9G  9UGpf    %zG  9GUG W0 Hcnt  $pid (%/H  9NH H S0ͼHͽ hVFF>FFGntcxzG>G/HW@ͱI F1Fͺ ͻ =NH%(I %MI  9I I (I 9I 9I 9I  9 J   9!5J" # ͶK$>h?>U?h?h~A$ B>]jB$C>oC>͆DD>͍DhE>ͯE>H MIIIII$J5J́IK͉͂̓K͍͊͋͌ K jt| jf| k"1K2 3 L )KKHp?Mp@+pA+pB+pC+pD+pE+pF+pG+pH+pI+pJ+pK+pL+pM+pN+pO+pP;pQ<lenpRN pSNtagpTpU"u pV '(pW_0auxpYf8pZu@uH pN cntpNpNpp pppnMGfG/  {N ͯ ops #N ] ; {NN N N N N0Nns9Njzo@ W(N Z2OZNZNZN<@ZVOZVOZN< NfO+<ZOZOZON"@ZO$2O$fO @ZOO O+ O )*O+GOOaO ]P+@U7P9P@P0AP`DGPJMub PP+%PQpPPrcuphpWv P+% P+%@THQ:seqX ^C@[P^NaHQdg8*iXQ@@ NXQ+ NnQ++UעRףRפק8ת!R0׭38׮gpׯgxײQc׵׶R׹RRavg׺Sx׽% ׾;(׿`P h l8pRNg3ggnQP NR+ gS++ +S++ 8lJS knll+l;l Tl sslUll l0l@ idlPl]TlgXl `lubh*lclUllUl YlYl Yl Yl Y l Y(l Y0lY8lY@lYHl ZPl ZXl `lZhl 2Zpl 'xl 'l 'l YlllidllGlGlWl llYlYl] TJS UU+ (lD&VlEr<lHglJg laVlfPlgUlmU(luUPl{Uxll lVllll SV+ V+ ,@lAWlB<lE]lH lKPrculLh lS=@@lVlY l\]l_3lb3V&V WC+llXlr3ls+@ly Hl|]Pl]TsslUXl`lXplxl lYl4Yll =l [l plRYlpYl l l _gYUYWY]4YUY YRYUYg9YpYUY]WYUYUuYYUYYUYYUYYpUYYYY YZYYZ%W Z2Z%W"ZA@ 2[)**@@+@)*H)*P+X)*`)*h+p+x+*"@$ min%+ low&+'+ max(+)2[7Z x [++++ t8 (88ubX 0[j ](" ^C, 0,\.j0](1) , ],^\ ?\ cnt@ AV \ub{rcuhU\ nr i \ p\+ ]!] ]] x}] t8[;8+`+h+p nC] idnD refnE ; nN]nO,ZnQ A@nWU^nY,Zn\'Z^n]d^n^i^*nl@@np~@znq@nrn^ns!]H U^ _^ +^++ (n^ngn atngn^\Vn^n{rcunh@n _`n7Z@`n7Z@  _ )*&_+ &_ ^@_+ O_O_C+]pC`_e_g_gggggpD_____ p _mapp dp vp vpF@5_]``: pIW`pJpK_pL_pMN`UXpQbpSbpTdpU dpV dpWd pX d(pY d0pZe8p\(e@p^eHpaKePpdeXph d`pi nehpj eppk expl epm epn epq epw epxfpy-fpz Gfp|fpjp kp +kpIkpgkpkp kppkp kp&kp l p 0l(pbl0p l8pl@p 'Hp"lP\`bb5JbQpmdopspnpdpp :p Np N p N$pg(pN0idpN4pN8p@pNDpNHpNLbtfpamPpmZXpv3`p8pp p =np# p/9np0p1p2p3p4 p5nbddbbrddd4rddddddddddedebKd(edg eKed4reb-enedgPeedseedgeedNeed4reedefdf=:fN-ffGfdp2fjfjfof~f~fmdyfybtftfLLffdff,xpjp pNpN pNpNpNpNidpN pN$pN(pN,pN0pN4pN8pN<pam@p otHpPp8Xp&kxpttp;p<ppppppppppppppgp8p~tp op~fpGptpp"tptptpN/p p2opsp tpp txp8ptp&kp|pgpNpptpv3p`_pp?upDu2btfpampIupNup&Su p. a(p/N0p0N4p5N82modp6@p7NHp8 PoJtXfkdfj&kdN&k&k#L kIkjfN0kgkjfg5Nkkdx'lkukd4rkkkNk kkkNkkk9]kldggk0ljfjflNlNlXlXlSl ]l 5lldT_gglgljflW` ]pm @''@'''p@5 pam btfpamppmpNtf pm btfpampNpN pN" pmpmpfm 0pnpNpNplm mnC+S p9np ubrcu!h9p)np*~fp+t8p,; p-p.b]6]p]o     '' ' ' 'pzopo]oo&keboo&koHp:pp&kp0p?pp p p 0p 1p 8pN@ :pp5pp6p7p8p9pp:p p+ ,Xpqp+endp+p qp/p p P Q#qx+S pHqrcuhpub,pqppppphpxpo#q90pqpDpp  p(prp&prp8p ;8pN<keypg@pqHp&kxprprpr r r+ r+Hqpsp+ppp9p6smappdkeypN%pNsps8pspppauxp6s p0p1p+2pN4ptpNpnbtfpampNspJtbtfpampS p9otp:ubrcu;htq yt&kNs t tzodt dt+Xp?upubp  pjz(pg0pg8pg@pgHpPtoKrIK]?p]up]Xup]u KuC+^?p^up^up^u =:uC+%p\u$\u$u u u%pvpvpg *v*v+/v p Wvp&ku 4vfvC+6]p v9p vp p :9p vp fvpidp NO,: ]*+w ]:w   ]Nw A۲xwwggNNv 3$hp]xN|:devrubxggNN$zdn&g'g(g)g*g li-g(.g0/g80g@1gH2gP3gX4g`5ghcn8gp9gx:g;g<g=g,ax{cNdNgNhxkglgmNnNo+wpNqNtw]xNyzmdev{r|Qc}ubH~Qchubހubށ޴9}޶g޷g޸g޹g޺g ޻g(޼g0޽g8޾g@޿gHgPgXg`ghgpgxgggggggggggggggzw %}&e'|(| )| *| + , Q ]-~''''''!'1'q'r'''''''9 WH~X H~ QX~+ y~z|{ć| Q} ] ~ ] |~+ ]V      !"#$%01234@APQRSTUVWX`abchiprxyz{|}~ ]ᶣ    ])*,-bGAH|I|J EOlP|Qć6]b41 Q Q Q|| E - ~0 E2 Q Q Q Q  Q Q  ] D߂ + |ć|ć|ć |  | !E#E$E%Q ]ك "( ;()-.1569 @6:skb AҊ ( D˄ E F Gf HN I+ J K L  M! Nk"b (08>}2tt!ݍ+{+!x{"ŐNgg]]] NNNNNNNN2mfsN++++]-~8(HQcXʐ˄ id+cnt+N,@=f>t8?;B NcmdE6 FlpI(J0M1N2O3P N4Q N8R N<U @VC}HW NhX +lY +n\9}p]x`;a b c NdeM {+ ]>      ]R ]d\ @w lpxyzub{ N8 ]̊  [A([9}a idsx +0 +2 +4 +6]8]<]@]D8HQch ops`ub N +rcuh + [ ̊ ggggg g(g0g8g@gHgPgXg`ghgp gx g g g ggVӍӍ̎5N5  h( 0# 8+ [@7H@ ʏPG ʏXN ߏ`U h_ ʏph ʏxӍ̎NӍ]؍N5+ ]N+:cc1SNNmNӍf؍ʏߏӍϏ {Ő|}~ + 8(X~HQcX e ڐ+]. . [uY /`G/ [zFP;[FlP;U;]G/\ a Qc| ͊-\ N Ցc+\ +d5W85U[;0[=G:<[!]iGq nӍq mӍ[t`;|ɒO\\\Nq`#)q5#I5\2mv\8v\?v||ړӍ~ړqG[u `[u `~a$!HǔO ; ii}". (UsT Q X ii(FUsQ@A$R0X0&U3T!~Sa1SDUU~Λa+!DW dBp7J<df Z7@t ;E  ;3   B D  W  ;P b m;}  ](UsT3(Us| ٘7-:o =EXo hEs  E   B7 7 !E E ! ;  7m Q   ;C * 5 B;   ] rGL(UsT0(U~ U}eUU#`(lUv8 ),3dpHO\8 F)0) fpӍ5jsp50jfp5EӍa6 !8!9!:!;^cp<^pn=!>goutxqsv.Y .Y .k .k .o .o XlE  |XLϞ ( 3?MK  [M  Xw MC  QY_  m z(U0TvQ2DJyldf Z7@] ;E  ;3   B X  F  YP  b mY}   r kT3DT r СU|U}U|Us 0U~IUsaUs yU~U|U~ɒU} ٢U|U} U|!U~ɒ9Usߓ^U R}ߓ}U (ߓU ~ X+ ۩jsp0jfpEӍa !^cp^fh۩!!]^len]!sΤ. . Hk!H !Y M# 5. . ϥ. . . . 3.  .  Xlh |DK [f¦g]stM X) MC  QY_  m z(U0TsQ2D&4  òH ϲܲ(ߓU Q X3X ( 3? U|AUveΨUQ#(UvT} UvTse%UQ#(CUvT}(ߓbU ߓU ߓU ߓU (ߓU ~-a1pb!}O! gUsUvkUU0x Ұax1jbufx=jlenxI!z^np{Ұ^bp|2!} !~ !^idsx!sHث!!H!B!HH!B!H4!!!!!H!H. !!H!}a!(UU TsQ ;      ST}Qs(SU|"Q0f. . . . H!!!!!OQOOOsO@OY       D  ' ]XTdtUTsAUT1ߓU (ߓU TsX~ X+װ~SaS0^fpUӍ!VerrlH!ZHZ YZ DV ]DaY  B(iUDUvT0R rX YskUUT0t( ,)(+3fp(BӍO*O++< @.- .-  X<+ ,[u*uCsk۳. . H!}#!7b ]DJdf Z7@ ;E  ;3   B D    ;P b m;}  ](UsT3(UsD- =EXo hEs  E   B7 y !E E ! ;  7m    ;C * 5 B;   ] rGL(UsT0ɸU~UsUTDe UU#(vɒe?UU(ߓU  Xk+ [ Bu"u U|U}kUT#`I k+-{ @J J  X{+ku/fpGӍopsJ J 7 BE  ( 3B?MK  [M  7 EC  Q;_  m zeU0Q2v_7   %H0<GR^jv7Y ( 3B?EK  [E 7d> ( 3B?"'3Mw    Y   r*+X:  i L Y(mT Q@7~  E   7In Y e qB}()U|TvQsi7} p MC  QY_  m z(U0TQ2pu7Λ r  BD  \d +B8Ds E- (;4 A KE   B7   Ey   ;}   ]UvT(T2D/d B(iUDU|R X Yv(U|7B OM\ i2 "vMv  iA MC  QY_  m z(U0Q27ui UT1QUT2Q0vU|8UT2Q0ߓU ߓ:U ߓYU ߓxU (ߓU Q0(ߓU  Uv(ߓU  X+IF 3+F3#fpFJӍ-HTrpI3TppJ8-KTlenL]-MTfmtNl-OTdpP-PM JV JV "Ju Ju @-w R-w pJ J ---J J J J @J J A XM+=7I3 +31-5-9@-98 )>@O 8 ) 81 #fp =Tcp (61 K#fp A#len Tpp 1 ۩#fp D@- @- 1 ۩#fp F1 #fp 7ӍI #fp 3Ӎ1 t Ӎ#dev t@#len tLTfp vӍ1 N##p $v8 C3skb ;-t _3skb .͊t 3skb "͊) <-18g#p82-: : x: ]8 %) ;) Gv8|.:)|D)|Pv@O]8%]q)<)@58z0)zCv)zX+8 .) .?) /+8 3wq @c)  ) +t -) 4pb) >1m J+mBO1>s+>)O+>6OI+++*O8C!3rCC81!3r1E)1M '83i"3r1)9 'oldt43r-IX#r/+7 '1!s#rC1!#rE+M 'I#i#r(+0 'Told1#i"#r1+9 'Told1],#r<,;8 &+O3m Jd8 +m3m Bd8?3v?&3old?. '3new?783i3v+1#i#v+1#v8P3v*3old2 '3new;8y3i"3v/83i"3v/83v!1ii#vi?#oldiG '#newiP@-k -k '-k -k 5-k iG-k nY-k s@-k x:Xq1[#i[6#v[C@-] 1#v=#O)#:)$)%)&)')(:5UH5UV5Ud5Ur5U5UZ5UZ5UZ5UZ@5UZ5W5W5W5W5W@5WZ$5WZ35WZB5WZ@5WZ1 r l#ptr rD1 A!#ptr A<1 4!#ptr 4=1 '#+ '0I^#v^O+^YIB#vBI+BS8j=)j8=)jV=I\+/Iv+7I+2+K@I#new4+KI#new1++@1jI+jFTretl@-o-p1A#newA@+B+CTretEI#+#5%@&I#ptr<+H+1,#p,;+,K]1(:#p(:+(J]  òϲܲD1;  CvՑDB?  ; 1 d  kU @QU#XDO- _Ml t |eAUUT2(ߓU X3S 7 7 BkUU(ߓU 7r\+2+M+^M\W\c{\\\\intc,\*\rs8oru8rs16ru16,rs32;ru32rs64ru64c;  \+1c2cHIX]^_`W\\%'),<c Js #\%&*+4=B]ch;nJ} T ^ ^ ^ c c c6 6 T  $L LLQ$LWf+. f 2+W;yH  M   "   ( 0 ^8  @  H  H  H H  H  H  H  H?@ \%P$hMM͖^ cc9Dkph c(c,^0 c8@ABcD mHP}memr@+ c $(0c8@cHcLPcX`chp j xcc ccc[ c!["c%&F*9c:?AD F P Qc(T0I IA ,,1a Wval 3 3 u !A ,a I      +1    3   !  u   !!  "* "u " # #* ### ##c#+,$ fmt$M$M$M$c$M$M$ 1%e5 %f+%gj %ht %uj %v;%w; key%x5 o %U %V ! %j key%ky %n key%oy &6 &7 &8 .8&s &M&M&M&M"&c"&c"&4c key&9 (/c&=  8&U&V mod&W&XM&Y  &Z (&[ ,&\s 0M &uQ&vQ&wV&xc&yc  +cWu+ '/'1c set'3 get'5'7 V6usn    Z( Z068!O@" hH# P$ X%`&h'p(x)*+:,b-g.:/ 0 1 $23 5 !9 N; {>?@ (!(% (+ (-(/ .@) x)W z+* +=++  * e* * ,;[cs,=^[sl,?^[wfe,A^ ,E3[ss,G^[sti,I^F,K^[nmi,M^F,P^ F,S^0F,V^8[lm,X^9F,]^:F,d^<1,`Wcs,,Wcsx,^,e1,Wss,,Wssx,^, ,g r15,m+ r14,n+ r13,o+ r12,p+ bp,q+ bx,r+( r11,u+0 r10,v+8 r9,w+@ r8,x+H ax,y+P cx,z+X dx,{+` si,|+h di,}+p,+x ip,+!3,+ sp,+!` -BK-C,-D,F-E, F-E,([s-E,,[dpl-E,-[p-E',/F-F,0[avl-F,4[l-F,5[d-F,6[g-F%,7F-F+,8.+.+.+.+.+6.  pte.K."6.  pmd.W."/%/%%{S/%/J/' pgd/'oS/'"J/p 6pud/pcS/p"S/PU.@0H0I+L.p!Xp00 40+8 1;1<"1="F1? c F1@ c$F1A c(F1B c++~+?3I0  D&      ^ +     ,(  *?-@4 D&4:84c4c4  4<(4 c,4!c04( 44)684*cH4++P4,D&X45 `46 d48 h4: l4; p4< t4=cx_se4?H@Drt4@#J}dl4AJ4BJ4F6MC4I0:4J+4Kc4O@M4XEM4]EMC4`"G@4d 4hc4kc 4l+4m 4nUM 4oZM(4p*04q X4s`4ub4x d4yLh4zp4{dM4+444 44 44 4 4L444 4F449(C40:PDmm44(h44(p4XNx4 4 4 4 4+4c4 c,4 c,4 c,4 c-4 c-4 c-4 c-4 c-4 c-4 c-4 c-4 c-4 c -4 c -4 c -4 c -4"c -4+47Dpid4 4 4+4D&4 D&444D&(404@4NP4NX4 4"+O4%'4('4+ 4- ^4. ^43 ^44?E46E4: (4=+04>+84A ^@4D ^H4G+P4H+X4KaC`C4NC4TP4WP4ZP4^Q4k 44mQ4p9 4q*9(4t+84u+@Dfs4xQH4{QP4~QX4/R`4Uh4 Vp4 =x4 =4 =4A4+4 4c44V4 E4c4p<4 B4 ^ 4 ^ 49 4*  4M 4:( 4D&8 4'V@ 4 H 4WVP 4VX 4V` 4`Wh 4jWp 4+x 4oW 4B 4c 4 ^ 4 ^ 4 ^ 4< 4D 4 4X 4 4 J 4 J 4"X 4)Y 4  4 Y0 4 98 4 cX 4Y\ 4,Y` 49h 4 46Y 4 4 4 4  4!c 4"c 4# 4$+ 4& ^ 4' ^ 4( ^ C4)f 43@Y 4C[ 4D+ 4LEY 4N+ 4RUY 4SJ( 4TJ, 4Y+0 4] 8 4^ < 4_ @ 4` D C4afH 4dBX 4g_Y 4ifB 4liY 4w 4x 4z+ 4} 4~nY 4 ^4 ^4 4 4[444 4 4+4c4A[4[4]4:^ 4c(4c,4#M0}rcu4f04<@4 D4D&H4<P4D^x4<4 4 "N^4 \^4f^44 4 ^4 44>C4f4 4!"54$"5C4.f4<p^C4F&@@1@ d&3Wpad !d&t&+? @ &!I&t&&t&@)&@&+?@@5'55sp5+es5 ds5"5$5&5+(5+05!585+X5+`cr25+h5+p5+x5@55+5c5J5+5+5 a4_fpu5 3@ (D&'/( (6 /(6 *(9(?@@0`(Lw@0k|@t(`0)L u04(0 !+u 0(0,0wu000Pu80X0uh0%zvp0+x0t0 0v0 +06Y0v0!t6 7 )7 7 ) 8 )8!; key8";18? *8A+8BA*8CF* 9A*9A* mod99F* *) 8=l*8>!)/c 3*     +*+6 ;(*6?+( ++: c<+     +?@A@=d.0=@=$!=&5=: 95=<+5==+5=>+5=@6=Aa6=Ba 6=E86=G 6=H+6=K96=MD&6=N6=O 6=Q6=T6=U 6=Va6=WD&7=X7=^+7=d+7=e+ 7C=i@@7=tb@7=yc`7={+h7=}cp7=ct7=+x7=7=+====dx>C=@?=$"?='?=<A=A 0>c.>dM>e>g>i ˗>lЗ !ٕ(d. c s( ?/?^ end?^A@ A@  pA/ cwdAJ swdAJ twdAJ fipAJ fcsAJ fooAJ fosAJA/AJlJ/+IA*/ ripA+^ rdpA,^IA.0 fipA/J fcsA0J fooA1J fosA2J 1A)%03/3/10A@G0AAG0ABG0JW0+ OA$0 cwdA%, swdA&, twdA', fopA(,!0A5JA6JA90 A<0 A>G0%0J0+J 1+? AQ1 cwdARJ swdASJ twdATJ fipAUJ fcsAVJ fooAWJ fosAXJAZ/A[lA\mA]nA^o rmA_pA`qAa1xAbJ)1+^ 2+@A:E2A; ^A< ^A= E2^U2+?@@AO20APW0AQ 2AR2@2P+@A^2A_/MA`W0Aa 1MAbU2@Ac23~+?@@Af3AhcAkcAn^Aq^xfdAt^AwcAzcAcAc0A2@@A3A ^AcAc fpu@A\4AcA+A\4A\4A3 A300A3@@3 B 4B ^B^W4+W4+? C4C C! &C" C#Ւ4^5+W5~+!5+1515+65;5. D5DcDcDMDMDMAEAEAE F85F95 F<5F=551G<6G=cG>  G:V6G;5!5 srcGA, dstGA ,[6 f6/cH66(H6H6 valH JH!J H"JH#^H$6 J1H*7H+&7H,#57 I57I`I ; 76H'q7H(H)f6!6H.^6 H17H27H3H4 H5+H6+71(H7H%6H/:7H7q7 8H!8H+ fnH 58!7 08087!8 J>|8J?+J@+JAJ cpuJCJ K8K^K^.(K8KctKE5K&8 |8/cL9 M 9M %9 9 N E9N O `9O 1Pv9P P9!`9Pv96Q 9Q Q"9 R)9R* +R+*  osqR-E9 R/ (S 0:S S S.Te:T+Te:Te:0: T :T e: T:Tj:Te:. U:=U 0:U 8 U :U:/cV ;.@V';=V(:V) 8 V*;(V+<0V,8V-9V.:V/; :;;;;.@@W/<W0W1cW2  seqW3DW4;W5: W60W7 88; (X[<X $X+X k<XJ f<f<<[< Y<YY Y<<6Z <Z<+<+Z8< [<[ [< \+1=\,\- x]s=]s=]c`]+h max]+p+=+ ^=^ ^^ ^^6_ = sig_<_=`R`S==`U`V>=a<>a a a >6a'l>a(a)6a->a. a/a0 <>a16a5>a6a7a8 <>6 a<&?a=a>a?a@aA6aSW?aT eaUaV6 aY{?aZ ea[ 6a^?a_+a` aa 1aJ?aLaQ aW&?a\W?ab{?6 aE@aF!?6ag3@ah _fdai6amd@anaoapc  a%@a*H>a2l>W_rta9>aB>ad?aj@aq3@I0b Ab b b b d@ 0b A!@bA cuAcv$ nscwR| uidcx Ecy cz c{Q%A b Ab!b" = b%Ab'=b(+b.>b0 = b3 B sab4A d KBd $d + lend +d  (efBe ( f$Bf%Pf'f( 0fDBfM#KBfP(fW) 8g 9Cg^g^g^g^g^ g#^(g,^0 h)aCh*^h+: Ph8Ch9Ch:cHh;cL9CC+.8hDC=hEfhF9hGc0. i>EDiKiZipiii endiEDWTDP+ j!oDj" cj&TD jDDjDoDjD{D jEDjEoDjED6jT DjYDjZ 9j[D6k E valkk D6k 3E valk k E4SxE4U ^4V ^4W* Ec4[E04hF4ioD4j4kxEcpu4lc4m^4n^ 4o^( 4`F4+4444F4+4 J`@@4G4 ^4 ^4 ^4 J4 J4+ 4+(4+04c8?@4H4 ^4 ^4 ^4 ^4 ^ 4 ^(4 ^04 ^84 T@4 ^H4 ^P4 TX4 T`4 ^h4 ^p4 ^x4  ^4  ^4  ^4  ^4 ^4 ^4 ^4 ^4 ^4 ^4 ^4 ^4 ^?@4J4`F04 0:4! ^(4" ^04# ^84%@4&P4'Q4(R4)S4, ^X4- ^`4. ^h4/ ^p40 Tx41 ^43 ^46 47J49J4;J4=+_avg4GF@HJ04KJ4L4M+4N+4Oc 4P$4Q&4SJ(#JS4]JJ JJJ`4`"L04a0:4h ^4i ^ 4j ^(4k ^04l ^84s T@4t ^H4ucP4c4c4c4c4c4c4c4c04;X04;rq4HL4J4"L4JS4^/L4L D&CLJrqCL4L4c 4c 4c4cJ4L44444Mb4Ls4J4M4MM4,M1M;MMLUM+**_M`XN(b h@ D H:P+` +h)Bp+x 9b iMpidpl7Nl9 <l:cl; 9l< inol=^l?a l@ @lBaHKrculCf`lDqp]N$O+ m+Omcm[cO.noPnp + uidnq E gidnr 3E ns Ent 3Enu Env 3Enw E nx 3E$ny c(nz0n{8n|@n}Hn~PnXnQ`nQhnQpnQxn n;nR|nAn@L0OPkeyoQo<oLLo? semob(oIPo X!n`o h uido Ep gido 3Etoxo|o~o o+!!oNPQQQQ Hp /Rp! <p"PPp#ZPp$dPp%\ p&;(p'nP0p(nP8p)P@QOXq^Uq_<q` qaqb qcqea qhD&8qkA@qn Xqq`qsdqtD&hqwpqxctqzx"qc"qcqcq q =q;q 8 itq q qaC qh q  qN qattyq q q D q^ q ^ q^ q^ q^ q^ q?E q+ q+ q+ q'+ q+  q+( q"+0 q,+8 q+@ q+H q"+P q,+X q+` q+h qBp q q qU q q c q q q q q4( q9 qb04Re qVq9q<qaqE UV"VrWVr r ,V@sVss s ^ s (s*s,s-s0\VV Xtc`Wtd +te tg tk 9tm(tnH(to 0tqc8VeWAOPuXuWu <puXxuxuu u u uu|uuu"$u(u.u/u0u9x u:x(u;X0u>8CuAf@tWX vYvsvKvWX Y'Y+'Y1Y;Y+UY+CZYdY1=~Y+O@wA[Kcssw U idw?_Јw[@`@ w w w9  wc( w+H wP w\X w w wT wT wTH w` w` w` w+ w  w[( w[0 w8w(`HwPw^`w`w bxwz|w7a~Y.0w[wڇwA[w L` F[e0s]ssss s,s.s(0s@s(HsCPsXs` s s+ s9 s cabdis  sҖ( s͖h sp s s aevs sc sc sc s[ sc s9 s s s sc sdacdis sabbs s  s^ s   s(D([.hxy:^xzjx|cx}lLlkxk(x<0x+Xx#l`]?^I^y>S^a^k^A* AAA!A%A'A,A/9A3A5A9A<AAADAHALAQAUAY2 _ z_zzz z `z!z" Fz$c Hz'~`z(M keyz) z*~`z+ z,(z-0z. `8 extz/`@K*__z3. z8` tpz9`z: z;Jz<J`I; {a{.a {.a{.a{#3aa.a| !Da (|a|c| |a| |aa aacDa |#a|$9|%|' aT}ɻT}ʻT}˻/clAb \b <A~ "jb1b9ob b!{bc (0c1 +7 + osq9E9;* <TTTTT +c,* - cc ccc c +c/cPd+/cWdQ@ Xqdrcs< wqvdH cpuwPd.8ze{cKrcu|f wqd0Ecqje @QUUUq!dq!dq!dq!dq!dq!dq!d x&f&f6f( len +HFfPpe6f++Ff+Vf+O@1g1g1g =9@@ eH!+"+#$< %c&f  'g0 (+8acpu*@assp+gH +Ag+ `6g7986f:6f(;+H<gP=X>\Ag egfc sdagDih iIigexD4iEgF4iH I9(J9HK9PL+pM+xN+O+P+Q+R+S+TU+V9WO Y  \+ ]+ ^d _gpgDi+VfgA1~i116"i#;$%6'i()6+i,-1!%j&~i*i.i Lj!\i opsVj!iLjQj 2j4+6c7c /cx@j/cxHj xpkxqjxrxskkIxEkx[jx+xlk=xfx+ixk3!k{Ek.@xlxjx+x+x+ x (x,xl0Krcuxf8x4lHk%j x4lx idx lClP+ x^lxcl^l (l* T 6 Cm^& )b ldt*Hm8.+@99H:h;Wnp= xC,|D"~Cm Rn+ alt+++ +(08@HPX`hpx !MmRnFlI0\n0^ 0`c10XnWlru0Y3hn0d0e10in0j +0k+I(0Ro!n0hXN!n0s+ I(0u[o0z+ pp0{`o0|+0}+0~ + [oI0|o0+I0o0)p0  )pA refڇ8OHbhcl+p ops ex!Joi(0QXp3n3o3eo3|ot0f10zp0c0 J0 pval0+S0zpN0Mp0N 0Pc40Jplru0K3p40W q0X 0YpN@0Gtq0I+!p0UXN0V + !p(0[ 00\ 40^+8b@0Fq3 qM0jUN(0mr0n+0o+0q 0r 0s 0t 0vc b@0lr3qM0zUN00}~r0~+0+0 0 0  0 (N 0r0+0+0b@0|r3r3~rM0U`0DrLtqLr@LrS0+r` t  9   XN  (c0c4P8@!vP p  x#$ % 'L s s05>tctx06Ct>t0=st0>Ab0@ED(0Xt0Yb(0\t0b+0h+0t=0w 0}$N0 u0+0+b0+u3tM0f40Pu0s0rj 0wu_rb00:0+st|ubuvc h j kq@ s(tY0uw8w@{H~PX`hpxuuvHtt0v0^cid00 w@@0 v0 J 0w00+0 A[@@0zLv@0b@0+P0+X0+`0+h0+ppgd0  `(x0) 05 0?z0E+0Lc0S 0Z* 0] +0_0a90pb0r00+0+0+0+00+ 0+(0+00+80oD@09D0+H0+P0'+X03+`0+hDbrk0+p0!+x0+0+0%+00+0z0{@0{0\n0+h09p0#{x0D&0R|0t0&\|0+0+00 0 0Cl0 +0c0f|0+0+0 +0 vv+{+3hl{+{{OhcJR|cKdQcLdQ@cMdQcNR|cOcP EcQ 3E nscROcS+cV  c^ c_Q c`b ceQ@ cgcHsetcih cj clA cmxQ cnFf@ cqQ`({W|a|+z|P+0+|0-0/ 9S0 c|p/B}!7B}(pmd9 j(0pud; )8!@EPHFPPpteL e(XptlP^`T ChEc0} @QQQQQT6T9T<TG } + h=u~=v~=w+`*~+s@==+===6f=8=#=?=?8=Ux=q=q=(Dgen=)Dseg=*=a0#+++?++++U+++q+++ ++++H=seq=+====([++++==3seq=+=+=8=T===s =e3=f=h9P=n+X=o+`=q +h=s=p=u+=x*~={=+=}T+++d+=&seq=(+=*EY=, =. 9`++с+?@=|= 9=== =======| + @=ł=ł=  =Ղ Ղ+ ++1== =  +/Ec=V?@=7=;6f=<+ =>+(=?+0=J8=M`=O+h=P!˅p=Q$Ѕx=V=W=X=c+= +=+=+=+=+=M=+= D=C=@=Յ=x=+=9C=@=+=+===+=+=c=c== = C=@==`˅+с}+  ++  ++=0=0=Vs =R=Rb+ == 9==+(==+=+= += += + V@+5+a"+ +7+/7 8+22++ +(0y<ʇ ՇՇڇ in+vs.8_n` +anbnFc Fd Krcuef reffՇ0/c     6  v +% c!c'c=c AM V6EcTlj̉lj++ qnщ++$+ L$ y Q1BЊDЊEՊFG#HaILy  P!c"c ڊ,a- 9/ h0(IA!~K 1:@$3f1N̋O+PQ  (+,-./ !! 0pqtr s Tt u v,$!(`cL2skxE!2 _cb (!?3X+hlencpct xz | f;~  !I;2K2end3K24&/5&/6c7<;;̋W'+/ 03u41678  xa9( idr(cc +j: rev+ Ώ.Ώ  ΏMKrb0: ns0c8< >!@ id^` h!pKrcufx  opsߐ! Ώhڐ "Ւ$ %  & &(( I02 89@: IH= lP@XA `ڐ1 Wdirӏ+ xCԑ bufC$C C C C  C (C 0C98 opCXC`ChCp  knΏt& 9 9@`h $x    @  A %zv ԑ  Ւ& &ڒ & && I$+ gbbgN o(q /c˓ 0''() * 1+O,Y - V6(˓y, EEJ6yT J c , ^^ ino)^ dev* (+ , uid, E0 gid- 3E4. 8/=@0=P1=`2=p3^4^5J6J7^8^9J:J;J >ٕ>M> 1>m>n>o&X>0>1>2 >3 >4ڗ >5 (>7 40>9 8>; 4@>= \H>?P ͖͖Җ @@AMBC͖D7 E( sdFΏ0GAb8"Ic"Jc"Kc"Lc"McҖ ͖ ˗͖yXN՗ t͖$ߗ 4t͖$ \t͖9 t͖o(a>> ͘>  ͖͘$ ͖MҘ `7 9Җ )X 0tu vw!x*ڙy z (< ͖. ЙЙՙ' ՙߙ ՙ E3Ee }i~iy abuf  $y+$+?W~+ Ϛ$ ՙԚ Mՙ ՙϚ (}+++++ .0Krcu1f2Ab3.›P+ HIJK LM+Nk| }(?Җ#@pHMP Xbus`)h p x9a0 Dmsi(8@^H^PX `hx  .| DidJ9 !!# @$%'#)7+ `, a- b. c/ d9 e< f(.(:9 get  put  EEJ %& '(Ab:O@@WgWh* cpuWicWjcWkc FWlcFWmcFWncFWocFWpcWrcWsWtWucW{ 8 W|;(W} 80W~;8=W@@y8;@+ :;<0  @!0"0#0 $0(%00&08'0@(0H)0P*0X+0`,0h-0p.0x/0001020304050ˠ 0#! @#5EUvEclHx y 9zc|c}9~0@ ?8N   ! " # $ % & ' ( )J9 O c@ @ A B C D E0;P^cam  c                cvEE^^^^r  (Dqos0 +c,M id-./9 0m(1<02+X3 8`4 8h5 8p6 8x7 88+9+:+;+<+ dev=#"> "? Nh #;wopsˠ0 0 @ @0 # 0#c MFNMOMP!Q!R! Tk(U0V08W @@X @HY @P[0X\0`^h_0pa0xc0d @ pmfh5 _#_f `faM busbdeMg h$j (k0m08n @@o0Hp @PqXr0`s!ht!p pmvxw @ py$dK p #F `2Z3M5!6!89 x ; (< @0>08@(Й@AHC P pmEX $ss_ Z}    0XYMZ![\ T^ @ pm`(5+@ F ii5 8M  (0n st ua:. D=0:.XL+Oi ( set08@ H+PDIi i+3ƭrcufcE.ʈ=h +pDxE.hŶKdir.`=Dj:X   +  Di0$ "i# &'' iI9 iگt3.LI34J len4J12.36^ 1O!8.1ivjkvars$tituf.RTcUDViWX. Y0[8_"``Tha+pbx=dگ!Tm$n Kd_uv{?x{| }~ E 3Ec ! T(XN0 8+@!GH L P X ` hJpJtJxJ|9 PJb++$u,, l0@H P T X \`hCiMp8H P(X`h p̴+'.@չ ( 0 8 "@ @HͺPX`̴?@T +  ^(!0!8@"H+P+X+`hbp & #$.$=BN   t  $c {(C` J  !J"/ 0 14 6c<9 BM@D"HFPI +XL`O dRdhS pZR|xa'b'}rcucfdcf9k0Cn9@@oHq9Xr`/cv cv . йcMйO ڹ   " $@$' EFGTHIR E Ⱥ mnt   ȺҺ Ye22amap< +B+?.xKrcufxP+ "ۻ#h nid&-+4+7A[.RSʼUʼXYZ cc < dO(KrcuefHgXj` idmpptqMxruϼ +żۻ +   " $9.@@-1 lru/Լ0 +  l2\ nrl3 nsl4\9 q+6P+6 val^/c ƽ  ?@@ux0u Uu+uuuuuuuuuDknuΏuTuT@uXxu,Xu,Zu,\u,^u$W`uXuqYuu| uxuxu$vYu Cu@@ux@uWHuWpu?Eu"u#9u&au)cDpsiu,TDbpfu/Q u2XXu5#N^u9{YT +o o,.ol Krcuomfon<oo Iov-ox,oy V1ouF3 Wxo+ (orot+!-oooM  ooo +o Q Q oLo keyoQoionoto0:1oo o I(oo+o+ooo $ 1(ooF3N ooo 4 o:o3:D  <hl+0 +8$@ uid EP +X `$6 h n n <n gidn 3EP+in;nrcunfSAU+? 8qq q! q"+q#^q#^ q$+(q$+0 q'q(^q)^ q0q1 q2 q3  qC6qD qL^qMD&qN^6 8qQqR qS6qTOc+N+ =+O)/067 =IJQ R(U0V8^@fHkP=lpn/q=oxq|rsu=vxyz{       ( 0 8 @ H P X ` h px       D&.0Qa=f .` Krss `08a@ X   fn V6 arg +6 b J1tS'tTtUljitWItX$ttYf.8tI qtJC ioctK`W!L' t\c0?sCs s- sB sL s+ sc(sc,s<0sc4s(8sڇHs Xs Xs Xs Xs Xs9`sds]hs͖pscxDdevs#(sE0s 4s 8s @s9HDids hs+ps xs͖s<scs s ss <s!s"s#9s&0s(94s)8s*dHs- Dfqs2 s3s59s69s79s= s>90s@4DtdsD 8CsFf@sKaPsP9hsRsSsUsVsWs[9s] IM6 n valW6 valz/ 6. 0 4 4*5c6*7S::+D?IN1z E n1 3E Pc !X!z  ==(=8 tHй()$*+ ,0-9@. 9`/ d0Th1]p2 x3+4~6 val /c6#B1E]WuidF EWgidG 3EH D~!/J H # # # # #  #( #0 8 @ H+ c(c, #0 #8@ !v@8O9h:h;h<h=| >|(?|0@8 hTT |m T]XDHE|FaG qH|I| J|(Kh0N 8O@QHSP aTM qf #v  xYZ[^\^]^^^ _^(`^0aT8cT@dHeLf^Pg^Xh^`iThjp8Pcccc cccino  P( P0{c{+  ccc ccccXhh (50S85@qHP T Tc T  0T]0 ST0: lTlPXOs8  c b 0 HDops! ++v+4w&}+ ?& ?0 TD5N g (0 8 @ 1H AP ZX}`h p x $=Y Pe+-/6 7 9^ "; c "< c!"= c""> c#"? c$"@ c%"A c&"I c'P^(S0Vh^8 W +8 X@awb[uH \P _X `\ a` b h c p d x 0t0r NXN: gXN0S ww|l tXNcb0 tXNcc0 DXND 0 10h A06 ZF }XN00_ 0 0 0 XN0 t D $t =)4ljcb Mf4!  4 _Y $ c ?@Z[\]^9`W b(d0e8f@hHjPk$XmQ`othppr xsuv-yP{n} Oiu bdijl+m+op(q8rHs 9Xu \v{` x+ y+ z+ {+ |+  +( +0 ]8 h ]l 9p x d d 8 ڇH ]X W W    G^z(t 9pidN8uid EE $ v +cc cc 4 9 ^b )M*f+5,- P+SP?0L  0LQ^+M   b{ ( 0 8h@HPX`h p x&&&& N v   cH)38O)* D+ D,]-C. /+(0 09 4:XN8< @=9D> H? P@XA9`BC͖E F9H!IK =Q(GO` id^=0: +0+8Ab@cDcHcLcP +X+`Kwbh ` (p 9 b aadev# 4 #( <0 XW+W+$S >>M^cCn pos S c t{ t$ tM c s6sss  Ot>; ghtbT tc+m to( t t t t 0t05 +bt++++?_ _Ytcl t_Yc tb  t !&t Nttc& {ttcS c c c M R 9 W$> R\   RM R $R QRc) oRoV RJc^y $ ^^  -tc PRt2 nRU Rs R  mt b + Ec> MT> bR {g  T T T  T'$ && NT$+ vTMS { Tż  ^M +bioK  M& =E !e48 @H2P^X` hpr  t xz* ;. JWs+vvW  <M< ('E'FM mod'G ops'H!'I 6'J 'K! A( $<1'LWarg'M Wstr'N!Warr'Oz 'V'Wc'X$ '\u max'^c'_c num'`` ops'a!'b&u.0(=)0:+  +  c ' W$+7 `-r.Җ mod/@0͖H mp1wP2+OXr 8567 9 ; 3 <G(= W0 $|$ M 3M# G8 WLEc>`8EmodF0G`Ppqrstc_mtnw O Oc$$TYEAƽ+`g` /c-d $Ts 6 ijk m  #$Y #M cc+Ec7Eca8  0!"Ec1EcB=EcOacd&e2f4=g lidh ›^cma @/w0| ops1" dev4#56(78aA.`=8 grp @H5P+X 00#.h8bKac9: `/cE NT Ze  P || )p++I;;.JP+1e.3N(0vma1o(2 h3 +4+5+ j4>? @  o( o(+ o( @o(+++" |Y|cE |w|++^ +o(| o(+ Mo( o(6Y 6Yo(+[ Po(+/cE.MN DPcRc Tc   sCsD ~sI sNsS esA!sBsCd&%` M^c1 Ycڊsrnzroljrpcru#[rw Jrx J`rz Jr{ Jr~c8r9<r,V@rcPrdpr$xڊP+ h  H@ 9 b@ E(a0V @jk lenl wpmnopqrs t(+.@5!+=&+@@+* H 48c=cBcG mapLT`.@@]aa @m% sbq5wc | $ wsʁ%(ʆ 0ʌc4ʒ 8ʗ </smS stsusv*swsxsyszs} css s,sEs Usx sx(s0s U8s@sHs UPs Xs `s #hsApsxsPs iHsDsҖs @scDs& HSs  cSs] csh siIsjVsk+sl+sncsocspc sqc$src(ssc,stc0suc4svc8swc<sxc@sycDszcHs{cLs|cPs}cTs~cXsc\sc`scdschsclscpsctscxsc|scscscsssscscscscsSSs    c`Ps sҖs D@s DH ( P+( ,= 0: B JO  T '(X;0]O8bh@g xHnPr X{`ˀ hˇ xpˌ x˒ ˙ !2 = G Of  qgChL ik Ml tagn o$qc(tc,u D0 biow 8x @!CHX˂^`˅^hˇ^pˊxˑz˗|˘~˛˜˟  refˠ ˢ+!eL elv^ Q     cccPrqs&& 9    opsB mapgc8 c< c@ cD cH LcPcT Xw` h9pg ss s Ecs , c E]1 U]J xc+Z c]c}   + ]Dc  $#]s A])(FK i]U ~n   4t/c ą getĆ putć Ĉ ĉċ  č(Ď 0Đ)8ĕL@Ę`Hę`PĚtXĜ`ğhġpĦxĩtīĬĮį(İ< QNRc idScTNw Pfg|hci1 || | N N N NM )NMc LNM . M`NQ |tNe |N|y |NM NMMccS N | (Nc <|-  + cc  \cc ' sgl()c*c A/c  &/cZC1ze{| 1˫ˬ$˭5i˶t˷0:˸ڊ6˿ icqH +6 seqc?@6L@Ld@N+SX[+a eCfqg m s5yL c˂˄ˆ) ˉ9(ˎ8a0˔ X˚ `ˠ hˣcp˥ct˫ xˮ$˰$˲Җ˹˻Ec&w@@7)99AF+L g`cc .w+ !rq" #| &   C C '  ; , O @ hT x m c} c  cc  c C  !&  HX+/c${eh*3cW r#a #cdM m#(t*0*8΃r#@΄r#HΘ *PΙ *XΚ *`Λ *hΜ *pθ +x '+ + 7+ , ,  , ," ,* ,4 ,; -E 0-N 7+WI-Xg-a{-g -q-yM΀ΉΏ ΐ"Εc$Κc(Μc,΢+0Τ+8η@κDο c@  cA  cC  cD  cE  cF  cG cL!P!X^`{ !?8!&') +90,^8.9@0`1p2D&3+O5a6#-7".9Ab:O< > @cBcDcGH+QcRcS^\ceghijklcmcncocp+q+z c{ c| c΂ cΉ cΌ cΏ cΒ cΕ cΘ cΛ cΞ cΡ cΣ cΨdέdβcεcζι+ κ+(λ0μ1Dirqνc4-8C(@C(0 #(0Ck|8!O(Jr#K#LMdKrcuOfpQSZ+\]_`abdeg sdbjkm cp cu cv cw&/ } ~+ πc χ&/ Ϗ  #,w# M## ##c#O(g*hiClm o50p Pr Ts 9Xt`upvrwtxvy+xz+}+ idcc lunЀ^ЁcЃ cЅІЇWЈWЉ9ЊЋ&/ЌMЍM revЎM Б+/ В+/ Г+/ Д+/ Е+/  Ж+/( З+/0 И+/8 КK+@ М.H РcP"Ч c "Э c "г c "й c "л c "м c "н c "о c "п c " c " c " c " c " c ppr c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c " c c\ ` d <h <p x cc    C (C ( c5/   cc?/9.D& k|(# *!* +#* "+#"+c+ 7+#,+ K+K+P+?HO,P#QR_devS((TAbUcDidVc Xc Yc!\c"^c#`c$d (e ,kc0lc4o W8pD/<q @rk|H<+ ,K+, ,+, ,, ,#, ,c,  - , 0-#D'- I-&5- g-$N- X{-!l- -!- --Ec-O`.=:=:h=: /8 @ D H !L "P"(c - ,X-/c&. .a&/Krcubf lencd.0/:/EcBt/ /^t/C/+/+/csA2      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgUA2Sc4j}2devkF2p+Ne2gh!X2bd23}2Ms0:tu54z3{ 8|^N/3+ :3 :3/34i333+N343[3i3N3743J3344cc4;44`47N<;7;7J7     !"#$%,!3 !3!3 $!4(!;4,.027468:J7z+Y7z+N747[3Y7N7747J3748cc4+84P87J<+;+;:;     !"#$%,!7 !7!7 $!8(!+8,.027468::;z+I;z+4<f;3`4P8u;z+`; <; 0EDu;;+;netR;+;V; MO<NFOFP offQ immR;/cq<Ecs=      !"EcQ>      !Ec%?      !"#$%&'()*+,-./0123456789:NPӷ@Ӹ ӹ Ӻ ӻ Ӽ ӿ  4 , 0 4 8 < @ H Lb@MMw A _keyL@ j8A0000  $ ( 04A  w?C  00  0  ( , 40 @  D  H L0P X \0` h l!Ap t0x0 # ' w*C0+, - 4 48C9 : 4@CA B N 7+D!C< = > ? !CD jPG EH I J K 0O0PQ R $S (T ,0X00Y8Z @cpu[ D\ H4`XEa b c d e N _E! Eg h jkEl m 0n4rEs t 4zF{ | j@qF!Ev w x 0y!E0ӂ 0Ӄ(0ӄ0Ӆ 8jӈFӉ ӊ 0ӌw(ӏDG_btfӐ0ӑӒ ӓ Ӕ ә Ӛ Ӟ $j0ӡGpidӢ fdӣ Ӥ ӥ _bufӦӫ Ӭ ӭ Ӯ (4ӲGӳ Ӵ 4ӶHӷ Ӹ wӾ@H0ӿ JYH j H cnt 000JH  JIpf    4;I  JZI!I j0I0000cnt  $pid (4I  JJ!I b0ӼJӽ {H@HMYHHHtcx;IMZIIj@ӱJ!G!GӺ ӻ LJ4J 4K  JAK !J !J JZK JsK JK  J K   J!K" # ӶL3?{@MA{A{?C3CM]+D3XEMoEMӆFMӍF{FMӯDGMJ KAKZKsKK$KKӁ MӂӃӉQMӊӋӌӍ M jt jf k11M2 3 M )!MMHy?tOy@,yA,yB,yC,yD,yE,yF,yG,yH,yI,yJ,yK,yL,yM,yN,yO,yPs=yQQ>lenyRJ ySJtagyTHyU"w yV'(yWa0auxyYah8yZw@!wH yO cntyJyJyy yyyotOTfT/  hbtf8hMh ahEfahfh?xyly yJyJ yJyJyJyJidyJ yJ$yJ(yJ,yJ0yJ4yJ8yJ<y'o@y 5vHyPy9Xylxy:vys=yQ>yyyyyyyyyyyyyy^y9yDvy mqyChyMyIvyy"NvyXvybvyJCy nrDopsy gvpy lvxy9yqvyly;y^yJyyvvy4y$ayywy wDbtfy'oywywy&w y. b(y/J0y0J4y5J8Dmody6@y7JHy8 mPvXMh lEfahl lEfJllMl m.hJl -m.h^6m FmEfo(2m gdmEftbKm mmJmim mmJm mmN^m mEf^^m m.h.hm nnnnn#nm KnEfa^-n ^_n.hPnb/cyn @QQ@QQQyV6 y'o btfy'oyynyJ8h yno btfy'oyJyJ yO1 yoyny,o 0yoyJyJyin!noooP+b yoy crcu!fJy)Ppy*Chy+9y,s= y-y.hdTEcy"q     QQ Q Q QUy?qy]q"q ]qlf|dDq mqlbqHyqylyF2yry y y 0y 1y 8yJ@qy5^ry6y7y8y9^ry:^rnr+ ?Xyry+endy+y ryCy y PWr~+b y srcufyc?ysyy0ynryڇhyxyrJ0ysy ry  y(y]ty$ybty9y <8yJ<keyy^@ysHylxygtywtyt]t wt+t+ syty,yyyJytmapyEfkeyyJ4yuyt8yuyyyauxy!t y0y1y,2yJ4yuyJyZpbtfy'oyJuyvbtfy'oyb y95vy:crcu;fus?vluSv]v?qEfuEfv+Xywycy  yR|(y^0y^8y^@y^HyPvrqLt M]Ny]Iwy]wy]IwQMXwP+^Ny^wy^Xwy^w;wP+4y\w3"w3\www4ywywy^ww+wy xyl!ww,xP+Ecy PxJy wxy xy T<Jy xy ,xpidy J;/c*x/c:Jy   /cNy /cyOۡzJyJy^^JJx 4$hpcxJ|Kdev( cz^^JJ$ |dn&^'^(^)^*^ li-^(.^0/^80^@1^H2^P3^X4^`5^hcn8^p9^x:^;^<^=^?ag}cJdJgJhzk^l^mJnJoxpJqJtwcxJyz}dev{(|d}cH~dhccC(^^^^^ ^(^0^8^@^H^P^X^`^h^p^x^^^^^^^^^^^^^^^s(^^^J&J<J@,DJHJLJPJT4X4c c!4"4#4X$4%e&c*J+x,x-&.J /^0c1c2J3z 6y9:;<J=J>J?,BdCdFCI  |g}y %4&+'( ) * + , C WOX OC_+ yz{/| C} O/c2      !"#$%01234@APQRSTUVWX`abchiprxyz{|}~ Z/ /c   /c[)*,-b // 7 7  !// 7 7 / 7 7/  /  C C4W C C C 7 / 0 72 C C C C  C C  c/D+ Ĉ///    !7#7$7%C/c6"#23PQR/cUUUUUUUUUUU/c> "(  7 7 7 7 Ec% EcIEc%9      !"#$%/;z()-.1569/FABDFINOP/cV-.)(.@KskbA (DEjFG;HJI,JKL M!N@"sj (0D8ƁDtt!,P+!g}"J^^ccc JJJJJJJJDmfsJ,,,,c49(HdX id,cnt,Joo?@=;>9?<B JcmdE!FlpIj(J0M1N2O3P J4Q J8R J<U @VˁHW JhX ,lY ,n\p]x`<a b c JdeOP+/c>ǒ     /cR/cd1/c` {  j1O(jAb idsz ,0 ,2 ,4 ,6c8c<c@cD9Hdh1 opsc J ,rcuf ,   {` '^^^^^ ^(^0^8^@^H^P^X^`^h^p ^x ^ ^ ^ ^^Rq| ,?@9emyژ lpj0 J8 < = > ?xid ,@ ,B ,Doid JHsid JLdid JP JT JXseqo\ hD&paxarg d @SyT ژU VjWXAbY, Z,"[,$d(.@@:ژ;9<=,>,@,A,~ ߘ Hkk  ( 0# Қ8+ @7H@ PG XN `U ?h_ ph x j HjJcJ kj,cM j,p jW jJJ ҚjJ j;ך j j **j/ ?jǒ{|}~ , 9(_HdX *+cR   , lj !d 6]^ _ ` a  b c J st mpuyv ( ($=+- _  K g       L  e          ^  k  kB dcPljMct(k0ljcdSMckkjcjjJca dk ckT Οd fhXOfN/hf5^@EhX pX@ kXtb<9c2ՠhc8ljhc?hXc$;Xb;;,f +[_++f5#{f|caXf<XFݡf<k<cMݡ X|> MݡfBh9 W9 UX ;@:X(][M 8xX =k|ac|ԣacf$Mc ck%E/x !^Hߞp  cerr `r *`````+`PU T QPR@i iRi9iRj j+ ji iRj j+ j'0HU T Q1R HH0rd ,d #jU* <* $j8fp* <,fh, ,ema- #. JlF2  2  x;  ;  Y  Y  ^, )0^7;^ <^BH^ I^RX^ i^O :-   u^F^Rw__@___m%U0TTQ2U0TvQ2^ũ0^7;^ <^BH^ I^RX^ i^^  ^#c71cqcUscc_cUsZ oht-4   dd  ^ 0^7;^c <^BH^ I^$X^ i^#cѫ1cqcUs^^cCc_cUs?\ K\$Pd^d3eAeUf afXY Y#cp|1cqcUsYq(Y4Y-?\aK\$Pd^d3eAeUf afbbbXUv`b`aa2U @Q~@YY4Y(Y-kZUsԣU ԣU Rvcrc_cUsu^^$w_____U0TvQ2]`]^ ^$^0^$X^  i^?\'K\$Pd^d3eAeUfafW\h\$t\ \\\ \'˲U~'ZUs'CUsTQv'TUsWUs'ԣSU ԣU ^ l x -    Y Y ^ ]^^ ^U<#c1cqcUs?\mK\$Pd^d3eAeUfafY(Y4Y-z?\arK\$Pd^d3eAeUf afbbbXU}`b`aa2U @Qs@YY4Y(Y-]ZUsԣU ԣU R}^0^7;^ <^BH^ I^RX^ i^] d]^+ ^7l ʸ m -h@hMhZh)Pj;P-N GP@P6PP+ PԣU +Q^9E+ k x\]\\\\\]+ ]^0^7;^ <^BH^ I^$X^ i^@*]}]6]A]M]Y]e]q]^^:^^^:^@^^:^'RT}Q|c?c_cUsu^^$w_____c+c_cUsu^^$w_____U0T|Q2@|    -m       ^G^^+ ^U4^Mi0^7;^D <^BH^ I^RX^ i^^N 0^7;^ÿ <^BH^ I^$X^ i^7s Z x -hP@hMhZh]R]^+ ^$^0^$X^  i^7      g d fYffffff]'  (  5  B  O  \ gi dj fZffffff^i ^^p&^^Y_t[j_U|ԣU 'ԣU 'ԣU ԣU W\ph\$t\  \\\ \)UsԣU ^8 ^9 +  ].^ 3]A Bg PT z:^j+ vhN:z+     ^0^B;^ <^BH^ I^^  ^7 B ')2UsHZHZPd ^d3eAeUf afPd ^d3eAeUfafV h:-L    ^H0^B;^ <^BH^ I^^  q^7  Z'kU|'U|TsQv' UsTv'CU}TsQvmS1TTSU|TvԣU R -:-      YYY^%j0^B;^ <^BH^ I^^7!:^^;:^^G :^#cJ1cqcU|cM_c_cU|Y_Oj_Pd=+^d3eAeUfafu^p^$w_____U0TvQ2#cU51cqcU|cXrc_cU|')Us'CU|T}Qv'ZU|' U}Tv'WU|TU|ԣU 'EUv'ԣdU 'ԣU R~ԣU ^+  > #Q& 3J& j%fh $(ema (xid ,. A * x Aa< (j,ema # #-,_wq dHn# n)# nS# HM y< 8j< < ,< ,< (,mp y# ,# ,cpu c# ژl      n# # _ _____  _`g` `%`  7`D`ՠT Q@n+L# # /U2X Y -# # ؟U } 3$#@T@Q0R  -# +# +m WmumumQi :biniziH;a  a$b bb$d }dd$e Deelf xffLa :ia]aa@a@aE aa@a3 bbb+ &bjd  |ddMe  _ejee  eegf fU|T3RA+ "HpH^U|'>'UsT|QvH^Hp'YU|ԣU R~ X} ^+8 M%src -j%dst Cj(ema (tmp #oerr   * = * xx 8emax 1Cl{ Ol$\lhlm+m mUs$ulllulLa| :ia]aa@Ma@aE aa@a3 bbb+ &bjd  6|ddMe  _ejee  eegf fT3$A+ "HpH^UvmUUmUUhUU;k >&k .Q(mpm y*m T R<T =j8mpU y<V (,emaX -|AZ #Z @_Z _`B``%`  ^7`D`ՠT Q la {llRllllFmdWmcmom+ {m[UsT}Q~ul@vab aR4b-Bb@NbZbdbRqb}bbb+ bd  "dd$ve  eee  eegf f'9T1T2x9 <9 ,j,st; ,ema< ,mp= y-#A n#A dC d$e! ef fdE 1d$e! ef fdF d$e! ef fdG ]d$e! ef fdH d$e! ef fdI d$e! ef f; C%fp.j(epC(rpH(sidJ(xid,p. ^] p, oout0 *    _[^]+M;  %ep)Cj(rrqH(fp(didJp^ *  ^+  <2j8fp< < 8arg <J,epC,sp,fh,fsp;,rcerr^0^7;^x <^BH^ I^$X^ i^^^^^3JAMZ^^cc_cUscc_cUsY4(Y4Y-?\a K\$Pd^d3eAeUf afbbGbXU|`b`aa2U @Qs@YY4Y(Y-ZUsԣU ԣU R|u^^$w_____U0TQ2'n.U~T'VZ1UsT|KU~T'$cUv|}U~T'Uv'WUsTUs58sp5-8fp5B8arg5L#7C,op8cSl-,err;? ? i; &ihԣU  I I RN N h:i]Ds] ]$] ]^ ^$^0^$X^  i^u^E5^Rw__@___'U0TTQ2UvTTQ2'(NUsmZgUQ'ԣU hԣU ^+; %rfp.j(fp(epC(rp(acc(sidJ(xid, ,,p)^] orel'oout#      N  a****!>Ce&8j%xidCJ(emaU*W<)j8sid4J8did=J,ema,cpuc-#  -D# ++# +-b#Qi:biniziH;@W:er::+  Y#c R1cqcU}7m 7 7 ?\jK\$Pd^d3eAeUfafcc_cU}-  Y4#chT1cqcU|YjyY+YHbY+6dLEDdeQ'e>fJfԣU ӢU|6dlDdeQ'e>fJfcpMc_cU|?\ rK\$Pd ^d3e AeUf af'W,U|'TDU|'CjU|TQ 'LUT0ZU|ԣU #c1cqcU}c@c_cU}ZU|; &1j& ژ%sidJ%didJ(epCCp*;c j%epc+C(spe(rcf^z p}*w w ^z+ jD5<D,<DJ<E#Gj,rjtH5,fpI,spJlzVP P iP|P-#U-hU@hMhZh^ NG^^ ^U8]T]^+ ^$^0^$X^  i^'UsTQ#R0hԣU Z%<%,#'j,acc(,fp),sp*lz0 0 00-x#5-h5@hMhZh^ .^^ ^U4]4]^+ ^$^0^$X^  i^'UsTvQ#R0hԣU 2; Z%mp2y%fpG(fh(epCJ^ *  ; K%ep/C%fpD(fh(apK(sp(low,,(rc^   *  >; %mp3y%fpH(sp;# %mp#7y%fp#L(fh%(sp&(ep'C(sof(9)J(rc*ooutworelu^ prPW@W*W*\ \ ^+; M&/j%mpJy%fp(fh(sp(epCI^ *  xH 8sp$-#@ZZ+d+Zd;{%ddh  ef 'fg1fd2f@Z7 Z+ +Z77Z 8ZBEZFZ|UshUU\^ </j8fpG,ema- #+#- #+#n #n/ #|C UvU}Qv; | %ep/C&D(fp(apK(fh(spp^ p   :   l   *;9  &92&:&;%(fp=>(fh?(rp@ (spABjCc^  M I I ` Is I P' YYYYY*Y YYY*Y*Y*ZZZZZ*Z ZZZ*Z*Z^ + +8sp,<G,fp#,fh,epC#j#cl]-#    Y_ j_^ u:^^ ^U0^0^7;^ <^BH^ I^$X^ i^^ 0^7;^Z <^BH^ I^$X^ i^^ ^^ ^^'VZU~TQvhԣU ; %sp-%fpB&Ĉ&,J(epC*.8fp+<?<.l   -        * 7 D QY^YxY] ]^ ^$^0^$X^  i^^^ s(+ 57B= G]Ud VH)^ ^^+ ^UH]x]^+ ^$^0^$X^  i^]N S-h@hMhZh]a b o |  gdfffffff^^^^J^^mhUUT3'U|TsQ#R0|U}T|ZHZ'ԣU 'ԣU X~ Y| 'ԣUU RX~ Y| ԣU X~ Y| -      Y ] ]^ ^$^0^$X^  i^^ ^  (+ 57BW G]U~ V)Tv#c 1cqcU~6d tDdeQ'e>fJfc$ c_cU~c- c_cU~Y" +Y+YHY-6dLDdeQ'e>fJfԣU ӢU~mNUUT3QGmrUUT3Q-':Us'UsT3QvZԣU R|Xvm:UUhԣU RT'; h%ep.C& J&J>%mp>y%fp(fh(epC(spJ(xid,**IE(<Cj8mpy8fp,fh,epC,sp#I#J,xid,ooutrel- #+#-f #y-K #y+#y^ 0^7;^  <^BH^ I^$X^ i^^ &!^]6!]+ ]R]]^+ ^PdA="^d3eAeUfaf#cR"1c'qc}"UsqcUsc}"c_cUsPd^r#^d3eAeUfafPdL $^d3eAeUfafcqF$c_cUsE(E \'d(W(p(+ |( (]  %]$_  ._^%0^7;^_% <^BH^I^$X^ i^^ %^^ %^^/&^?\&K\$Pd^d3eAeUfafc?'c_cUsn.UUTvPd#'^d3eAeUfaf') (U|')#(U|H(ZUs>C(&6j%mpy%fp(epC(fhxW)8sp",epC,rc- )##cR)1cqcUvc)c_cUv'W)Uv'L)UsT0hTUU\Cn.8mp9y8xidA,#j#ژ,epC,cpu,l*  * n +# +# +;+  -s+#+#c },cc g c:cj : j:!j$k %k:0kR=k Nk:Yk+dek#c,1cqcU|\W-nW{W+ W?\-K\$Pd ^d3e AeUfafc.c_cU|'ԣH.U Rs ԣU Rs C7<7j8fp,ema,epC-.#n'/#7 7:77+ 7 7 8 8"8Y)8Y08]78/ <8 I8T ]W8.h0 \8-h:@hMhZh7j80 o8780 8g8 8#c> 11cqcUs781 8\WBs1nW{W WB8 8?\YR2K\$Pd^d3eAeUf af#c`21cqcU'Wb25WBWOWlc3ll$l)lllFm3Wmcmom {m[U|TvQulPdF4PP+ Pcf4c_cUs794UT Q 7!9)5mtmumumcxr5c_cUsPdy 6^d3eAeUfaf786 8\WIr6nW{W WB8 8\WR 6nW{W WPd7p7^d3eAeUfaf'7UQ@A$R0X0UU>,C19&,:j%mp-y(ep/C(cpu0c1,2ژooutuohitXoerrwW855j8:8<*<8= 8= +*= +8B*B9I*I!9s *t C<1c,epC,sp#J,rcl]p-9#:  #c]:1cqcU|c:c'_c:U|_cU|E;E F+ Fd"F#c;;1cqcU|c;c_cU|DFU|Tsc ;c_cU|b.Cp-C |   Y^<^^+ ^U<]T=]^+ ^$^0^$X^  i^]= -h@hMhZh^>^^\?]\\\\\]+ ]^?0^7;^> <^BH^ I^$X^ i^@*]}]6]A]M]Y]e]q]^?^:^@^^:^#c1@1cqcU|YOB(Y4Y--B?\a6AK\$Pd^d3eAeUf afbbkA:bXUv`bA`aa2U @Qs@YY:4Y(Y-BZU|ԣU ԣU RvcBccBc_cU|' BUvQ R0X|ZU|ԣU 'CRCU|TvQ 'LoCUvT0mZCUUHW'TCU|ԣU  E8ep,C8sp?8fp# ,arg,res#cD1cqcUskcEc_cUs#cWE1cqcUscEc_cUs~EUvT|Q{UsT3Q1R0?F&,?F&Ac(epC*y L8epy1C<zc,sp|,fp}#~lLF  )G  )PG;P-G GP@P6PP+ PԣU YI(Y4Y-I?\aHK\$Pd^d3eAeUf afbb IbXUv`bjI`aa2U @Qs@YY4Y(Y-IZUsԣU ԣU Rv^ ZJ^^ ^U0\:L]\\\\\]+ ]^mK0^7;^2P%sp2?(ep4C^P yP4*7 7 ^P+P>"P%ep"4C&";(sp$ I'R< "j8sp 88fp M,epC#Q#cQ1cqcU}cRc_cU}'RUvTsQ| T<0j8spF8fp,epC,fh##J#out-S#-LS#+#^S0^7;^S <^BH^ I^$X^ i^^ T^u^T^$w_____U0TsQ2'VZTTsQ|U~Ts'W8ep,Cژ#,-}U#+ #cU:1cqcUv'WU:5WBWOWClVOlR\lhlmVm+ mUs $ulllulcW:c_cUvhZUU;\W&9ژ&C,%epC>CW&Dژ&,WC{ X8ep{0C,rc}@Y:Y+YHXY-X6dLDdeQ'e>fJfԣU ӢUs;n Y%epn/C&n@c;YY%epY=C&Zc^P Y_ _ *d d ;HZ%epH9C^L *K K ;7 VZ%ep7-C(mp9y*?*??\8ep/C8fpD<J,fh # ,- [#%+#%^ [0^7;^`[ <^BH^I^RX^ i^;_ [L_Y_[j_^"1\^^HGW\)ep1C5Mt\)op3c5M\)op %_& ;& Gh>|.%`&|D&|Ph*c>%c\`&<&*9>z0`&zCh&zX+>Ulj`&U!M&U4c&UGc&Vt&V"V6X(>#a%wq@d& &+; La& 4c& >5>va2>)Q2>6QG+a2+*QGa2+Q>C!a%rCC>1!a%r1E&1M'>4b%i"%r1&9'(old;Nb%r-Gqb)r/27'Gb)i)r(20'voldG{b)r{-)n{4>&+b%mJj>+c%mBj;#c&8^;b?c&b6^>D(^_c&DC^X(qc^Xc^> ec%cpu e7c> 8c%cpu 8& 86(5 %cc)cpu @cG d)cpu d1d%vd1d;NPd%vN1d;jd%v1d>d%i%v+1d5d)i)v+1dGAd)vA1d)iA5d)vd>e%v#1d;3e%v1d;Me%v1d>ve%i"%v/1d>e%i"%v/1d;e%v1d%i!>e%v!d5[f)i[6)v[C1d*V] 5A>f)vA@1d*vcC G:Uf)v:71dG3lf)v371dGf)v71d)i>5f)v=d #-h& #:& $& %& && '& (g9 U&g9 U4g9 UBg9 UPg9 Ugdg9 UZsg9 UZg9 UZg9 UZ*9 UZg9 Wg9 Wg9 Wg9 Wg9 W*g9 WZh9 WZh9 WZ h9 WZ*9 WZ h& :& & uh9 h9 h9 h9 h9 *h9 Zh9 Zh9 Zh9 Z*9 Z5A!i)ptrA<54!3i)ptr4=5'#Qi2'058+i282_28F+29+*vval<+57+i)n72+5i)n^5i)nJ5cj)l3+5 .j)nr +2 ;.j7G^Vj)v^OVj2^YGP~j)vPJVj2PTGBj)vBIVj2BS> j%x ( fls ij%x i-c(r k5 &+k2 B+5 =k)nr +2 ?.j5 rk)nr 42 V.jV 5 k)nr 42 V.j5 ,,D&l*V 1 D&kV 1 kV 1 kV 1 ,lV 1 J*V 1 ^>j>l&j8>l&jV>lG\l2/Gul27Gl222K*Gl)new42KGm)new122*5jFm2jFvretl*VoVp5Am)newA@2B2CvretEG#m2#5m%*&Gm)ptrHM>UvE60rE F F "F7/Fq 0F#cq1cqcUscrc_cUsDFUsTv ,P++G+XGPQP] uP P P P int ] ,P *P_s8i_u8|_s16_u16&_s325_u32_s64_u64~] { P +  1] 2] H I X ] ^ _ `QPP % ' ) , <] Dq #P%&*+4=B]]h5nD} N X X X ] ]0 ~0 N   4 449 4QN+(vv Nv{ ?|?|||| 5 5 | | |||O+$]#f$]*$]4%%$]/%%%%%%!%1%q%r%%%%%%%9 GWH|I? WrX rA+ op|q|r|s| yz|{?| A} MQC+ =/ M r M| /| /|||+$]       !"#$%01234@APQRSTUVWX`abchiprxyz{|}~| +| C+:F G 5H 5:J K AE I L ? @|A|B 5C 5D 5M N A v w 5x 5y 5z 5{ 5| 5 }| ~| t~ |?  M M~ $ d +| + |||| A A A  r |?|? 5 5  || 5* |?| ? M M | ? |?|? M | ?7 8|9 :|| +>]=4  A A A|| 5  0 52A++ A A A A  A A+W5IdSH R G  l "{   E( t0 8 @ uH uH uH H uH uH uH uH4@qPhGG ]A8kp ](],0 8@AB]D HDPhmem@~+ ]',6@ (0]8@]H]LEP]XJ`]hOp x]]yY]h]] ]!"]%&39]:r?AD NF P | Q](T~0@@&&,?val .q. ,@-+,H .  i-Hll    ]+,xfmtGGG]GG$,ef+gh uv5w5 keyx U V xj(keyknEkeyo6f7 8((8GGGG]]4] key9E($]=  8UtV modWtXGYy Z ([ ,\0RG uvwx]y]f +]Q+ /&1] set3M get5f7 >` t : ]  ( 08!@" H# ,P$ ,X%E`&^h'wp(^x)*+,- ./ 50 ]1 23 5 9 ; !>?D@b+ !P% + -/ (@i xiQxe+       x !; Ocs!=XOsl!?XOwfe!AX !EOss!GXOsti!IX<!KXOnmi!MX<!PX <!SX0<!VX8Olm!XX9<!]X:<!dX<,!?cs!&?csx!X!,!?ss!&?ssx!X!  !g r15!m+ r14!n+ r13!o+ r12!p+ bp!q+ bx!r+( r11!u+0 r10!v+8 r9!w+@ r8!x+H ax!y+P cx!z+X dx!{+` si!|+h di!}+p!+x ip!+!+ sp!+ "B"C&"D&<"E& <"E&(Os"E&,Odpl"E&-Op"E'&/<"F&0Oavl"F&4Ol"F&5Od"F&6Og"F%&7<"F+&8#+#+#+#+#+0#  pte##"0# 0 pmd##"$%Y$%%J$%/<:$' pgd$'J$'"f:$p pud$pJ$p"J$(@%H %I+A)vSv0% 4%+8 &;f &<&=<&? ] <&@ ]$<&A ](<&B ]+4-@' #0'@']']'  'E(' ],'!]0'( 4')>8'*]H'++P',#0X'5 `'6 d'8 h': l'; p'< t'=]xTse'?P@8rt'@-Rhdl'AR'BR'F>U6'IKB'J+'K]'OHU'XMU']MU6'`""O@'d'h]'k] 'l+'m 'n]U 'obU('p|40'q X's`'ub'x d'yTh'zp'{lU'+''' '' '' ' 'T''' '#N''B(6'KBP8mm'1h'1p'`Vx' ' ' ' '+']' ],' ],' ],' ]-' ]-' ]-' ]-' ]-' ]-' ]-' ]-' ]-' ] -' ] -' ] -' ] -'"] -'+'d@8pid' ' '+'#0' #0'''#0('0'@'VP'VX' '"2W'%1'(1'+ '- X'. X'3 X'4IM'6M': ('=+0'>+8'A X@'D XH'G+P'H+X'KzK`6'NK'TX'WX'ZX'^Y'k K='mY'p A 'qEA('t+8'u+@8fs'xYH'{YP'~YX'5Z`']h' ^p' Ex' E' E'I'+' ']'v'#^' M']'D'"J' X ' X 'A ' ' U 'B( '#08 '-^@ ' H ']^P '^X '^` 'f_h 'p_p '+x 'u_ 'J '] ' X ' X ' X 'D 'L ' '` ' ' D ' D '"` ')a '  ' a0 ' A8 ' ]X 'a\ '2a` 'Ah ' 'f ']('],',U0hrcu'N0'E@' D'#0H'4DP'Hfx'E' ' "Rf' _f'if'' ' X' ''>6'N' '!".>'$".>6'.N'<sf6'FH0@@f 80+?H0+4@@(1(=sp(+es( ds("($(&(+((+0(=8(+X(+`cr2(+h(+p(+x(>(+(](D(+(+( #=Tfpu( <@1#01 () 1) l414@@%1A }@%f@ 01U%3A{%1% Y&{ %(%,%r{0&%K{8%X%|{h%%u|p%+x%z% %z|%4%g3$]3l4     +|4+) ;1|4)?414+- 44@A@.C7&.;@.$L!.&5.: A5.<+5.=+5.>+5.@6.Aj6.Bj 6.E\86.G 6.H+6.KA6.M#06.N6.Ok6.Q6.T6.Uk6.Vj6.W#07.X7.^+7.d+7.e+ 76.iP@@7.t@7.y]`7.{+h7.}]p7.]t7.+x7.Ҋ7.+=.S=.x>6.P@?.$l?.q?.A.A 0/c7/dG/ep/g/i /l (C7 070X end0X71 71  p2b8 cwd2D swd2D twd2D fip2D fcs2D foo2D fos2D2b82DlDr8+@2*8 rip2+X rdp2,X@2.8 fip2/D fcs20D foo21D fos22D ,2)8.r8.8,02@ 92A 92B 9D9+ F2$9 cwd2%& swd2&& twd2'& fop2(&825D26D299 2<9 2> 9u8D9+D9+? 2Q: cwd2RD swd2SD twd2TD fip2UD fcs2VD foo2WD fos2XD2Zb82[l2\m2]n2^o rm2_p2`q2a:x2bD3:+X:+@2:;2; X2< X2= ;X;+4@@2OU;&2P92Q:2RU;@d;C+@2^;2_7D2`92a9D2b;@2c;;m+4@@2fp<2h]2k]2nX2qXxfd2tX2w]2z]2]2]&2d;@@2<2 X2]2] fpu@2=2]2+2=2=2p< 2p<0&2;@@; 3 K=3 X3XQ[=+Qk=+? 4=4 Ԗ4! 4" 4#k=X=+Q=m+=+==+==757575 68I>69d> 6<d>6=d>I>,7<>7=]7>  7:>7;I>i> src7A& dst7A &>>$]8>0(8Q?8Q? val8 D8!D 8"D8#X8$Q? D,8*x?8+&x?8,#? 9?9h9 5}?08'?8(8)>V?8.X0 81,@821@8384 85+86+,@,(8d@8%>8/?87? 88@8+ fn8 @6@ @@d@@ :>@:?+:@+:AD cpu:CD$];A <;A< @A;A = `A= > {A> ,?A? ?A{A?A0@ A@i@"A A)BA*4A+ osqA-`A A/ (B KBB B B(CBC+CBCBKB C BC B CBCBCB( DB1D KBD 6 D  CDB$]E )C(@E'C1E(BE) 6 E*C(E+/D0E,8E-9E.:E/; CCC)CC(@@F//DF0dF1]F2  seqF3LF4CF5B F6n0F7 68C (GvDG  G+G DGD DD4DvD HDHH HDD0I DID+D+I8D JEJ JD K+LEK,K- xLELEL]`L+h maxL+p+E+ MEM XM XM0N E sigNDNEOR{OSFEOUSOV+FFvPVFP P P 0F0P'FP(P)0P-FP.P/P0 VFP10P5FP6P7P8 VF0 P<@GP=P>P?P@PA0PSqGPT PUPV0 PYGPZ P[ 0P^GP_+P` Pa ,PJ HPLPQ PW@GP\qGPbG0 PE)HPFG0PgMHPh _fdPi0Pm~HPnPoPp] v P%HP*bFP2F?_rtP9FPBFPd HPj)HPqMH@0Q IQ Q Q Q ~H 0Q 2IHQI RuIRv  nsRwM uidRx MRy Rz0 R{aV>I Q IQ!Q" E Q%JQ'FQ(+Q.FQ0 E Q3"J saQ4I S dJS S + lenS +S  (TJT 1 U$JU%U'U( 0UDJUM#dJUP(UW) 8V RKVXVXVXVXVX V#X(V,X0 W)zKW*XW+B PW8KW9KW:]HW;]LRKK+(8WDK1WENWFAWG]0( X>^LXKXZXpXXX endX Y!yLY" ]Y&^L YDLYDyLYDL YELYEyLYEL0YT LYYLYZ AY[L0Z M valZZ M0Z =M valZ Z &M'SM'U X'V X'W>]'[M0'h#N'iyL'j'kMcpu'l]'mX'nX 'oX( 'jN'+''''N'+' DU@@'"O' X' X' X' D' D'+ '+('+0']84@'P' X' X' X' X' X ' X(' X0' X8' N@' XH' XP' NX' N`' Xh' Xp' Xx'  X'  X'  X'  X' X' X' X' X' X' X' X' X' X4@'R'jN&' KB'! X('" X0'# X8'%@'&P''Q'(R')S', XX'- X`'. Xh'/ Xp'0 Nx'1 X'3 X'6 '7R'9(R';(R'=+Tavg'GN@P#R0'KR'L'M+'N+'O] 'P$'Q&'SR(-RJ']RR RRRU'`,T&'aKB'h X'i X 'j X('k X0'l X8's N@'t XH'u]P']']']']']']']']&')CX&')Crq'QT'R',T'RJ'^9T>T #0MTRnrqMT'T'] '] ']']:'T''''' Uib'Tis'D''U''U Ul'4U9UCUVT]U+4|4gUU`V_i f@ D HBP+` +h)p+x A_i qUwpidp[7V[9 E[:][; A[<c ino[=X[?7 [@@[BjHBrcu[CN`[DGpeV  W+ \2W\]\j W(]oX]p4 uid]q M gid]r =M ]s M]t =M]u M]v =M]w M ]x =M$]y ](]zm0]{m8]|m@]}mH]~mP]X]Y`]Yh]Yp]Yx] ]]M]I]A7WXwkey^ÅY^E^A+^ sem^_i(^(P^ XM`^ xh uid^ Mp gid^ =Mt^x^|^~^ ^+^-XYYYY H_ 5Z_! E_"U_#)U_$3U_%2 _&c@(_'=U0_(=U8_)U@YFX`^]`_E`` `a`b `c`ej `h#08`kI@`nX`q``sd`t#0h`wp`x]t`zvx`]`]`]``1`)C` 6 it`{ ` `zK `h `  `V `Qtty` ` ` L `X ` X `X `X `X `X `IM `+ `+ `+ `'+ `+  `+( `"+0 `,+8 `+@ `+H `"+P `,+X `+` `+h `Jp ` ` `3 ` ` ] ` ` ` ` `1 `A `_i0:ZR `^`A`E`j`# ]^(^a]^aa2^@b^b`b `b X b (b*b,b-b0b^^ Xccf_cd4ce cg ck Acmcn(co0cq k8^k_2IFPd`dX\d Epd`xdXdd d d ddnjddd" d(d.d/d0d9X d:X(d;`0d>86dAN@z_` eaeee`a-a+-a7aAa+[a+K`ajaLEa+F@fEcBcssfY idfcof`@j`e@ f f fA  f k( f+H fP faX f f fY fY fYH fe fe fe f+ f  fc( fc0 f8f(eHfPfc`fef xfuf7ea(0fcffEcf A@e JcR0bebbbb b,b.b0b(@b(l HbPbXbP` b b+ bA b ]Qbdibq  b( bh bp bv  b Qevb  b] b] b] b b] bA b  b b b k bkQcdib  bQbbb  b} bX b P   b( (c(hgy>fgzpg|]g}qAgqgq(g4D0g+Xg#r`eCfMflh>Wfdfnf7i7i7i7i!7i%7i'7i,7i/A7i37i57i97i<7iA7iD7iH7iL7iQ7iU7iY g jgjjj j gj!Dj" N<j$] Hj'dhj(G keyj)(j*dhj+ j,(j-0j. ih8 extj/nh@3ggj3( j8h tpj9hj: j;Dj<Dg95 khk E7lm m"h,m,imAmh mZi im]m (n0in14n74 osqn9`An;n<KnKnKnKnKno !i (o8jo]o o8jo oDjIj gjgj]i o#jo$Ao%o' lj p+jp,p-KqɹKqʹKq˹r jjkk k rBkr4rrj Xsqksr kss4D wqsvkH cpuswPk(8szks{ kBrcus|N wqsk0v xt#ltvt#lt3l( lent4HtClPtpk3l++Cl+Sl+F@u-mu-mu-mu 1uA@@u kHu!+u"+u#u$4D u% kou&N  u'm0 u(+8Qcpuu*@Qsspu+mH4=m+ `u6mu7Au83lu:3l(u;+Hu<mPu=Xu>\=m uemuf] sdaug@ouh}uiEomRxuD0ouEmuF0ouH uIA(uJAHuKAPuL+puM+xuN+uO+uP+uQ+uR+uS+uTuU+uVAuW W uY  u\+ u]+ u^Bk u_mpm@o+Slm7v,wyow:w:0w"ow#5w$w%0w'ow(w)0w+ow,w-,w! pw&yow*ow.o wGpWo opswQpoGpLp w2pw4+w6]w7] $]g@p$]gHp gpqgqpgrgsqq@g@qgVpg+ggq1gNg+Ygzq.qf@q(@gqgpg+g+g+ g (g,gq0BrcugN8g/rHzq p g/rg idgr>rC+ gYrg^rYr (xrxxNxx: 0y >syXy& y)_i ldty*Cs8y.+@y9AHy:hy;Rtpy= xyC&|yD~>s z Mtzz+ altz+z+z+ z+(z0z8z@zHzPzXz`zhzpzxzz z!HsMtyFr@%\t%^ %`],%Xt?lru%Y.ct%d%e,%it%j +%k+@(%R ut%h`Vt%s+ @(%uVu%z+ pp%{[u%|+%}+%~4 Vu@%wu%+@%u%$v%  {$v{ ref{8{ WH{h{]l{+p ops{ x{{uY(%QSv.t. u.`u.wua%N,%uv%]% :% vval%+J%uvE%Mv%N %P]/%Jvilru%K.v/%Ww%X %YvE@%Gow%I+v%U`V%V + v(%[ 0%\ 4%^+8V@%Fw.wD%jE(%mw%n+%o+%q %r %s %t %v] V@%lx.wD%zE0%}yx%~+%+% % %  % (E %x%+%+%V@%|x.x.yxD%U%DxAowAw@AxJ%+xU z  A r  ``V  (]0]4X8v@P p  x#$ % 'AByy%59zctx%6>z9z%=nz%>h%@(%Xz%Y_i(%\z%b+%h+%t7%w %}$E%{%+%+V%&{.zD%N/%K{%y%xZ %r{Trb%KB%+nzw{|bp||c |h |j|k|q |s(|t0|u8|w,@|{H|~P|TX|h`|h|p|x{p|Czz%|%Xcid%% c@@% |% : % }%%+% Ec@@%A|@%,i@%+P%+X%+`%+h%+ppgd%  1x%) %5 %?%E+%L]%S %Z%]4%_%aA%p_i%r%%+%+%+%+%%+ %+(%+0%+8%yL@%AD%+H%+P%'+X%3+`%+h8brk%+p%!+x%+%+%%+%0+%%@%%Wt%+h%Ap%x%#0%M%z%&W%+%+%% % %>r%4% k%a%+%+%4% ||++3cr+FhRJMRK3VRL3V@RM3VRNMRORP MRQ =M nsRRTRS+RV  R^ R_Y R`_i ReY@ Rg kHsetRikh Rj RlI RmGV RnCl@ Rq\V`#R\+uC+%+%-%/ AJ% ]p|/=\|7=(pmd|9 10pud|; 38a@|EH|FPpte|L 1Xptl|Pf`|T h>]% @%%%%% }ʃ}} ~~~ σ,~BN~DN~ES~F~G~H߄~Iʃ  !]"] X,߄- A/ f0@~A~K ,~:~@.,~NJ~O+~P~Q  (~+~,~-~.~/  0pqzr s t u v&$( UcA;7skx&t7 Tcb (7X+hlen]p]t xz | ?~ ||||||| |?26end3643536]7E;N@JQ+/  #K6K9K<KG =4 h.ue.ve.w+`u+`@.R.+.7.3l.R8.n..8.x...(8gen.)8seg.*.0n+++++++++++++4؉+++H.-seq.+...-.=(=++S++.Ҋ.~seq.+.+.....` .e~.f .hAP.n+X.o+`.q4h.s7p.u+.xu.{؉.4."Ҋ++++.&seq.(+.*Ka., .. A +++4@.nj. A... .......nj ׌+ @... .  + +0+1.[..[k+/>].4@.7.;3l.<+ .>+(.?+0.J8.M`.O4h.P!p.Q$x.V.W.X.c+.4.+.+.+.+.G.+. L.6.P@. .x.+.A6.P@.+.+.7.+.+.].].. . 6.P@.0.@`+׌=0+ 4@+ 4P+.{.{.` ..P+ .. A..+(.;.+.+. +. +. + k@L+\+jl+04+/ 8{{+{2{2{+{+ {+({0d 03V4678  xa9 idr]] Β+BӒ rev+Β (  GBrbKB ns0]8< >ϔ@ idX` hpBrcuNx  ops!ʔ h "$ Ԗ% & (( *02 89@: *H= MP@fXA `Ŕ, ?dirؒ x4 buf44 4 4 4  4 (4 04A8 op4XX4`4]h4p y knz A A@`h x    @  A %u| y  ϖϖ ϖٖ * eCCH/ f1R k$] 0'() * +0,: - >(d &&+d5 D ] * XX ino)X dev* }(+ }, uid, M0 gid- =M4. 8/@0P1`2p3X4X5D6D7X8X9D:D;D //G/ ,/mܙ/n|/o&X/0w/1/2 /3 /4 /5 (/7 0/9 8/; @/= =H/?`Pܙܙw k @@fAGBCD E~( sdF0Gh8I]J]K]L]M] u kd`V z z =z `z1B// / ќe k ќkG ` A X֜ 0tyu vw!x*yϝ z (y7 f ϝM=MԝR }J~JZ Qbufj  Z+j+?Q{m+ ɞ{ ĞĞ GݞΞݞ  (^+++++ (0Brcu1N2h3C+ HIJK LM+Nf ^ 4Ԣ@p^HGPXbus`h p xA&chr 8msiK(8@XHXPX `hx  }8idDA h!!# $(%2'#7)+ `, a- b. c/ d9 e< f ((A get ` put ` &&+ %`& '(hF@@FgdFh cpuFi]Fj]Fk] <Fl]<Fm]<Fn]<Fo]<Fp]Fr]FsFtFu]F{ 6 F|C(F} 60F~C81Fs@@ed6ikC@+ :;<  !"# $(%0&8'@(H)P*X+`,h-p.x/012345  >UV>]lHxy Az]|]}A~0@48.   ! " # $ % & ' ( )DA  W C@ @ A B C D E&)CPX kjM  ]                ]V%%XXXXR  g(8qosq0 +C,G id-./A 0M(14D02+X3 6`4 6h5 6p6 6x7 68+9+:+;+<+ dev=> ? .Hg5Wlops    ] M&NGOGP!Q!R! TK(Ui0V8W @X HY P[X\`^h_paxcd pmfh ??F `FaG busbdteGg h$j(k0m8n @oHp PqXr`s!ht!p pmvxw pyD+ ddԢP n& `2:3G5!6!8i9 X ; m(< 0>8@(@AHC P pmEX SdS?hh:] drd 0XYGZ![i\ ^ pm`(+@ & IIϖİ 8İG  (0N st ujɰ( $1KB(XA2WI f( set0²8Dz@H P$@I Y .prcuN~]#(f1kh p"x#(hŔ۲Bdirk(`²1$BX ۲̲ f  "I "B#j &j'j' oBj@A Ya.t(ȳA@34D len4D,2.ȳ6X 1(8?,iOjkOjrs tBauN(R^T]ULVBWcX Y0[8_"^``*ha+pbx1d-m nBd_uvT4x{| }~ M =M] !< *(`V0 8+@H }L P xX x` xhDpDtDxD|AE ND_i++ && j0@H P T X \u;`&h6qUp8uuH P(0X:`Dh ph+'(@Y`` ӽ( 0 8 @ HPXھ`Y4@* }+  (!0!8@"H+P+X+`ch_ip &#$'  ( z q { ] #(6` Dxx!D"/ 0 14 6]<A BG@D"^HFPI4XL`O dRkhSpZMxabhrcucNd kfAk06nA@@oHqAXr`c$]L `c]L yy~^e y]G( y ӽcĽcؽc c E]FcG*HI llqv  mnt l cv]  cھc/ƾRQmapD4+?(NBrcuNN]]C+߾ "#f nid&-+4+7Ec(RSUXYZ ]c E d W(BrcueNHgXj` idmpptqGxrcu +b4  " $A(@@- lru/04  [22 nr[3 ns[42AG+ VC+0 m valXV$]   4@@dX&dYd+ddddddddd8knddYdY@dY]xd&Xd&Zd&\d&^d$X\`di]d+^ddnj dXdXd$0^d 6dP@@dX@dh\Hdh\pdIMd"d#Ad&jd) k8psid,KY8bpfd/V d2]d5#Rfd95^K +^^*(^lBrcu^mN^nE^o @^v ^x&^y >,^u&.?x^+ (^rn^t+ ^x^}^G nnv ^^^ +^ YYs ^+^ key^Y^xY^M^a^KB,^o^ x^ x@(^^+^+^x^}^  ,(^^&.oE ^^^ i/ ^^.#  Ecr+048 @ uid MP4X `$h ]] E] gid] =MC+Y]]prcu]N2J3+? 8`` `! `"+`#X`#X `$+(`$+0 `'`(X`)X `0`1 `2 `3  `C`D `L<`M#0`N< 8`Qv`R `S`T WA+V+$E+F)/06|7| 1IJQ R(U0V8^@fHkP1l|pn?q1oxq|rsu1vxyz{       ( 0 8 @ H P X ` h pox       #0(0.j1N (` ~Brss 08j@ X   fn > arg 0 b  D,cScTcUYcWcX acYN(8cIV qcJ ioccKf_A c\]04bb bbbb+ b](b],bE0b]4b8bHbuXb}XbuXb}XbXbA`bdbehbpb x8devb(b%0b 4b8b@bAH8idb hb+pbxbb4Db kb bIbb Db!2b"b#Ab&0b(A4b)8b*BkHb-S8fqb2]b3b5Ab6Ab7Ab= b>A0b@48tdbDg86bFN@bKjPbPAhbR[bSbUcbVcbWcb[Ab] V0 ; val$0 ^ valG<v in+v(8_`4ab<c <d BrcueN reff0j0 9 v +%$$ z0. 0 4z 45]67+," M ;,D =M ^ P] "  (8 zHЫ(y) *+ ,0-A@. A`/ d0*h1p2 x3+4&0 val y$]6B,E?uidF M?gidG =MH D&J H      ( 0 x8 x@ H,s+ ](], 0 8@ s!ts,@89:;<=$ >$(?$0@B8x * $ =*=)XDE$F G H$I$ J$(K0N 28OP@QiHSBPG * -- KK7 i-UxY]Z[X\X]X^X _X(`X0aN8cN@dHeLfXPgXXhX`iNhjp8]]]] ]]]ino  N( N0#]#]3+ ]]] ]]]]X[~ (08@HP ~*` *] *3 *n *= *`8 y ] _i y0 H8ops! +++/w}  (  ) [(0 8 @ H P X%`9h Wp vx  AAFR+-/6 7 9pc ; ] < ]!= ]"> ]#? ]$@ ]%A ]&I ]'Pc(S0V!c8 W +8 X@Qwb[H \P _X `\ a` b h c p d x- zx `VA `V$ Vz`V]VZi. z`V]]` B`VB f  %`Vy 9* W>qqq\ `V{ zBz (/d]V;DN/`!` p pe/ea  ]4@Z7[\]^` b%(dC0e\8f@hHj\PkXm`ohpGpr exsuvy{}7_x7Fi bdijql+m+op(q8rHs AXu \v` x+ y+ z+ {+ |+  +( +0 ]b8 h bl Ap x Bk Bk 8 H ]bX S\ S\    jcA!+5?(z ApidV@uid MM $  +]] ]] / BA XV )D*N+I>,-9IC+JP40  &k.+U p p ! 5( p0 E8@^HrP^Xr`hp Ex  5 N N E [F)(* B+ B,e-.D /+(0 09 }4:`V8< @=AD> H? P@XAA`BCE FAHIK 1Q F`q idX1KB +0+8h@]D]H]L]P4X+`BwbAh ` p A _i jQdev [= ( 4D0 cX-vQ+Q+$J GX] pos J ] :z! ]zϖ? zGϖb ] bb`bb S z ezC ,z]+ Ez11 ^zJ wzc z| z z +z++++tg 5eazϖ] ]zϖea]: zZib zz zz] !zz] ::]?& b:]I cc]g Gc~   c %c Ccc* \cH cGa c c} cc] cD BBD]? ecL XXj  cz] z c 7c UcUZ< xcUd mt ,i + }>] * !A 5&E*: ^*J r*c cw *1 c * *G 00! N*: bbgSqv cGu+wbio( E 1 4(8 @2HPXX<` Fhpr  t Kx * 5. DQ+e5e MA5Ye GH (EHFG modGt opsH!$I 0JKk  fR,L?argM ?strN?arrO VW]X \ max^]_] num` opsa!$b&(0(E1)EkKBV+  ~+  ] 1  Q+7 `-. mod/t@0H mp1P22WX 85|67 9 ; <(= 0  | GtG tt>]>*U8EVmodFt&G)UPpqrst]Tmtnw*  ]?kV'+1;shmh^TmcwV$]-D dS i1jk Om r JJ1 rJGT]]+>]>]8K 0v!"{v>]1>]B>]OcYd&e2f4g lidh Yvmw|Xwncma @/0 ops1" dev456(78#-7(`1٢8 grp @HP+XJ I(h8Bac9I: `$]{E2 {Ng{T w{Z{e2wl | $v++{@{{{7C+,{{7.gE(|0\vma|11|2 f|3 +|4+|5+  /|>|? |@ 01 1+ 1 1+++ ] ++ +,1 T1+1 Gh1Y 1]b4 ] eP e (P ]+ ]2e] K(KP7 n(Z(+s eB]Q eS e 3 e(/($ C(4SH=z$]  get8 put H \u \ ( 08@HPX.`Ghyp.x8 QR] idS]T Pf)gh]i: 8)H= \M uda bz G G] Gy G  . GG3 tGG]]tL ~  ]  > + ]]  Z]] 's sgl(s)]*] $] x$]Z,z{|,( I>YJaKBX0n icq n~+0 seq]4@6gA@LBk@N4SX[+a efqg]m sy] A(i0 XI`Ih]p]t x  ccl>]&c@@79AAF+]] +I!Grq"# `g`GLugj`z   v g 7g]Lg]< o[]]Q[]t [|+ +$]$,Rh*d"3]W #(a 8(ctdG mL((t/0/8#(@#(H /P /X /` /h /p /x / / / ?1 O1  h1 x1" 1* x14 1; 1E 1N /W1X2a,2g @2qY2yG "]$](],+0+8@D ]@  ]A  ]C  ]D  ]E  ]F  ]G ]L!P!XX`, }"}"&"48&&') +A0,f8.A@0`1p2#032W5j6#27"I39h: W<l> @]B]D]GH+Q]R]SX\]eghijkl]m]n]o]p+q+z ]{ ]| ] ] ] ] ] ] ] ] ] ] ] ]kk]]+ +(018irq]4^286 @6 0 (06f8&F(J#(Kj(LMBkBrcuONpQSZ+\]_`abʼndeg sdbjkm ]p ]u ]v ]w3 } ~+ ] 3  i"8(}"&(( GL(}"=( j(j(]o(F(g/h}"ilm o0p Pr Ts AXt`upvrwtxvy+xz+}+ id]] lun€X]ƒ ]…†‡QˆQ‰AŠ‹3ŒGG revŽG ‘3 ’3 “3 ”3 •3  –3( —30 ˜38 š/@ œN3H  ]P§ ] ­ ] ³ ] ¹ ] » ] ¼ ] ½ ] ¾ ] ¿ ]  ]  ]  ]  ]  ] ppr ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ]  ] ]\ ` d Dh Dp x  k]    6  6    k3   ]]3AZ3#0 f(Q( /&/ /j(/ /j(/ //j(/ //04HO?1Pj(QRTdevS (ThU]8idV] X] Y]!\]"^]#`]$d (e ,k]0l]4o Q8p3<q @rfH/O1/D1 h1}"+T1x1}"m1 1j(}1 1}"]1 11 1j((B11 1}"1 2}"1 ,2&2 @2&12 Y2}"E2>]2d"F`I311h1 C48 @ D H !L "P(] - x1X2$]&3 (a3BrcubN lencd333>]B%4 C4}"X%4$]s6      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgS6J]/j7idevk6p+Ee;7gh6Vdt7.7DsKBtuI>/z7{ 6|XE7+ 777/7.7+E!8/>8Y.7Ee85/8D.>8/8]]/8/85|E<;;|||||;|| | | | ||||||||||||||||| |!|"|#|$|%&!8 e88 $8(8,.025468:|;e+|;e+E</.<Y.;EU<5/r<D..</<]]/</<5|:<??|||||?|| | | | ||||||||||||||||| |!|"|#|$|%&< U<r< $<(<,.025468:|?e+|?e+/<?.8<|@e+UN@ ES@ &@c@+h@nnetL}@+m@)}@ M@N|<O|<P| offQ immR@$]qA>]B      !">]B      !>]%UD      !"#$%&'()*+,-./0123456789:EPŷ@EŸ Ź ź Ż ż ſ  K= , 0 4 8 < @ H LVhEDDc E TkeyA@E Z8%F&&&&  $ ( 0/JF  cG  &&  &  ( , K=0 @  D  H L&P X \&` h l%Fp t&x& # ' c*H&+, - 4 /89H9 : /@^HA B E 7HH< = > ? 9HD ZPGIH I J K &O&PQ R $S (T ,&X0&Y8Z @cpu[ D\ H/`Ia b c d e E _JIg h ZkKJl m &n/rpJs t /zJ{ | Z@q KKJv w x &ypJ&ł &Ń(&ń0Ņ 8ZňVKʼn Ŋ &Ōc(ŏKTbtfŐ&őŒ œ Ŕ ř Ś Ş $Z0š]LpidŢ fdţ Ť ť TbufŦū Ŭ ŭ Ů (/ŲLų Ŵ /ŶLŷ Ÿ cžL&ſ :L Z =M cnt &&&:dM  :Mpf    /M  :MM Z0[N&&&&cnt  $pid (/N  :N[N V0żOŽ fLLDL=MdMitcxMDMNZ@űTO]LLź Ż AN/yO /O  :O TO yO :O :P :*P  : _P   :!P" # ŶjQ.UDfhEDEfJFfG.^HD]H.IDoJDņJDō KfVKDůKDO OOOP*P$_PPŁQłŃʼnQŊŋŌō R jt| jf| k,1AR2 3 oR )RARHh?Th@&hA&hB&hC&hD&hE&hF&hG&hH&hI&hJ&hK&hL&hM&hN&hO&hPBhQBlenhRD hSDtaghThU"]| hV1(hWrf0auxhYm8hZg|@C|H hmT cnthDhDhh hhhtTKfK/  T c ops #T ] ETTRU M IQnsTT$U.U8U0UnsTMI `(BU RURDRDRD@@RURURD<UU+@RVRVRVU,@R3V.U.U @RGVVWV+ WV4qV+K]V+@R7W9W @EW0 AUW` D GW J M kWW+%WUhEWTrcuhNh|UW+%eW+%(@TWBseqX yL@[}V^DaWdX81iW@@DW+DW++RТKYУKYФЧAЪ!PY0Э=8ЮXpЯXxвBkежUY йeYQavgк{Yx н#0  о4D( пjP h l Ap  UY D X = X XWeWDeY+X{Y+++Y++ 8dY kndd+d4D(dZdX ssdN\dd d0d@ iddPd]TdXXd `d kh1dkdS\ddN\d _d`d #`d #`d #` d #`(d 8`0dQ`8dQ`@do`Hd `Pd `Xd N`d`hd `pd 1xd 1d 1d #`dddidddGdGd+^d Vdd_d_d]ZYS\h\+ (dD\dEEdHXdJX da]dfVdgh\dmh\(duh\Pd{h\xdXdX dY]ddddYi]+y]+ 4@dA+^dBӒdE]dH dKTrcudLN &dS@@dVXdY d\]d_=db[=y]\XD^C+dlx_dr[=ds+@dy Hd|]Pd]TssdN\Xd`dx_pdxd d_d_dd Ԗd d d_d_d *d Mdu X_S\_D^}_ N_S\__ _S\_X_ _S\_N_ S\_S\_ `S\`#`S\`8`S\(` Q`S\=` e`e`j`V``e`t` `#0```#0``F@ a41P@@+@4H4P+X4`4h+p+x+1"P@$ min%+ low&+'+ max(+)a` x (b++++ A (A8 kX 0]bcr ](" yL, 0,b.cr0](1,$],b ?c cnt@ AOY !c kprcuNR`c nr i `cpc+$]!ccc xc A(b4D8+`+h+p fCd idfD reffE E fNGdfOEcfQ F@fWdfYEcf\'df]df^d1flP@@fpҊ@ofqP@ frd fs!dHdd+d++ (f@efXf atfXfbYf`efprcufN@feaf`@af`@e4e+ede+eeC+GdhCee XfXXXXXhDff (f(f-f h ffmaph jh }h (}hF>wf ]ff@ hIfhJXhKfhLffhMDfRXhQihS8ihTkhU khV &khWDk hX &k(hY ]k0hZk8h\k@h^kHhakPhdkXhh ]k`hi khhj lphk lxhl lhm lhn >lhq \lhw vlhxlhylhz lh|lhmqh qh qhqhqhqh r h hAr h [r h&tr h r  h r( hr0 h s8 hs@ h1H h"sPf 3i3iP$iUhjopshuhjhh Ah Dh D h D$hX(hD0idhD4hmT8h@hDDhDHhDLbtfhsPhcXhK=`hAph h Ath# h/th0h1h2h3h4 h5 u=i jj3i=ijkjzk&kjk Dkj+k ]kjIk {kj{k3ijQbk kjXk kjz{k3ik kjXk ljk  ljXl >ljD%l \ljzClvljal ljl@{l Dllljl llllljlnbtfloRl mjmm4xhmqh hDhD hDhDhDhDidhD hD$hD(hD,hD0hD4hD8hD<hs@h zHhPhAXhqxhzhBhBhhhhhhhhhhhhhhXhAhzh !vhlhGhzhh"zh {h{hD6h "w8opsh {ph {xhAh"{hqhhXhDhh'{hK=hehh{h{8btfhsh{h{h&{ h. Zi(h/D0h0D4h5D88modh6t@h7DHh8 PjzXmqjmrqqjDqqtRq qlDq qlXQ?q qj1q erjzCr 7r7rD hs btfhshthshDl h#t btfhshDhD hmT, hEthshs 0hthDhDhs#tEttC+V hth  kxrcu!N:h)uh*lh+Ah,B h-h.iN>]hu     %% % % %Shuhvu vq{k3iu!vqvHhvhqh6hvh h h 0h 1h 8hD@vh5wh6h7h8h9wh:w"w+ 4Xhwh+endh+h wh6h) h PQwm+V hwxrcuNh k4h1xhh&h"whhhxhjw:0hfxhvh  h(hyh hyhAh E8hD<keyhX@h1xHhqxhyh)yh9yy)y+9y+whyh&hhh:hymaphjkeyhD/hyhy8hKzhhhauxhy h0h1h&2hD4hzhDhubtfhshDKzhzbtfhshtV h9zh: kxrcu;Nzfxzqy{{ujzj7{+Xh{h kh  hM(hX0hX8hX@hXHhP7{&voQ>yQ]Eh]{h]{h]{Q |C+^Eh^4|h^ |h^4|@C|C+/h\X|.{. |X|b|/h|h|hX||+|h |hql|||C+>]h }:h (}h Xh @:h O}h |pidh D*}@$]*}$]:}   $]NC~ $]ׇl~FM}}XXDD\} [=$h}"p]xD|Bdev   kXXDD$dn&X'X(X)X*X li-X(.X0/X80X@1XH2XP3XX4X`5Xhcn8Xp9Xx:X;X<X=X4acDdDgDhkXlXmDnDo}pDqDtw]xDyzhdev{ |Bk} kH~Bkh k׀ kׁ״ԃ׶X׷X׸X׹X׺X ׻X(׼X0׽X8׾X@׿XHXPXXX`XhXpXxXXXXXXXXXXXXXXX`(hXXXD80D<D@&DDHDLDPDT[=X[= ![="[=#[=X$[=%&*D+\},}-80.D /X012D3 6C~9:;<D=D>D?&BkCkFI l~ %ۆ&'|(| )| *| + , A$]$@%%%%%%%%%%%%$]6     $]d1     %%% ُK idِ M ٖfٗ M ٟٞ 5 len٠ 5١  ٧È٨ A٩Èf҈C+ ٯٰ AٱK + ٷ?ٸ 1ٹ҈ٺ gK K  1 ʼn> ]$D+ |?|?|? |  | !5#5$5%A$]6l"#23PQR$]ڍSSSSSSSSSSS$]ڮ! "($;b()-.1569$]V-.)((@BskbA  (DBEF\GݑHDI&JKL M!N"`}"22 2(0ٙ8m8tt!&+!"DXX]]] DDDDDDDD8mfsD&&&&]WA(HBkXB ܅\id܆܇&cnt܈&܉D4@=ݑ>A?EB DcmdE&FlpI(J0M1N2O3P D4Q D8R D<U @VrHW DhX &lY &n\hp]\x`4Da b c Dd\e Wa+$]>i     $]R$]dӒ$]܆ ܔܕ 22Ӓ7F(Ñhh idsM &0 &2 &4 &6]8]<]@]DAHBkhӒ ops k D &rcuN &    ɕXXXXX X(X0X8X@XHXPXXX`XhXp Xx X X X XX4@ܷ`ܸAܹܺbemܻeܼoܽ lpܾ0ܿ D8 < = > ?xid &@ &B &Doid DHsid DLdid DP DT DXseq\ h#0pjxarg Bk`j\t\ݘ  3( M0# g8+ @7H@ PG XN `U ԙh_ ph x  \ݘD]D &s] &..MDD8gDR ݑlęԙi{|}~܀܁ &܃܄ ܅A(܆H܇BkX܉ +Q+@RA  ET $H fid/ ftsW$ԛ?gid?rn?rft ?rff ?fid!/?snn"=?spn#r$ ?rpa%?&g' 4 hdr(Hq< qI D&H4"W"Uy;i:GGy]ʜG +G8 y=!<\YDO G-fpO/UmsgQGPzfhR-zctS2WU'~ei[D r 'Ku [frr$h 4?rK[frB,iB$U\{/sdid:Dsfp sop +]{!sarg${$Dq&q'zrc(', !.bo|K [fr ~   [ N9p#gϤ*6K+ ţ[fr ~   ;C%7DN,.g/qK@ [fr ~   ;1NANCب'K4 `[fr ~   ;ѧ 5W75#W8# 9 "/[;G@K[[fr ~   ;NbON\N^huKN[fr ~   NOFVS`lK~[fr ~   #y zNKmF[fr ~   #Nng K ɯ[fr ~   [/N9#g'%/6CP\hue+6'kk{'KI[fr ~   # J'nI' ,L   # . 9;D E Q ] i uG T -U2T Q'k{'KIN[fr ~    J[BGS_kw;L  -,U~Q'߷'kd{'KI[fr ~    JW'#'ke{'KI[fr ~   # J'ky{'KI[fr ~    J'{@I'krž{'KIb[fr ~    JWt' L   # . 9;DJ E Q ] i uGcT -U2T Q'k {'KI[fr ~    J[ ;L  -,U~Q #-TsRX '57BN[hu~[vr g II[;#9uIIgW3 N$1>-&U0TsQ2G(UvTsQ|R0X}Y,|<20=didD=fp=op,]2<20AXz2z1=fpzIMscr|+* Xf2f2=fpfJ:hir sppj Mppk+*nXV^2V1=fpVIMrecX^MepYc!N*Y+*\ ɕXJ2J1=fpJIMrtvL+*O X<2<2=fp<J*>+*A* X%S2%3=fp%KMsp'SMcp(X*)]+*,   X 2 3=fp KMspSMcpX*]+*X%23=fpK=op]*]McspSMcpX+*|2/2 D=fp%=op]2(<2A=did(Q?Mrc\xH2H D5fp%5op]H(<HA^ctx^len )})))!*****+*!***+*+*+*****+*!W***+*+*ԛfԃbHB}5inG5len )+)\[kH[2H\ D5fp\%5op]]H](<H^A^ct`x^lena !)))))+)!)))+)+)+)))))+)!L)))+)+)\@!x5fp@G5opA]HA%HB fHC^ctEx)F +)Jb0H035fp0K)2+)5 U#0X =fp 42 E=did  D=sid D2 )2 D2DMfh-b$5fh=-H5did D5sidDH+H DHD+)+)\K5fp=^cp 3\~5fpA5len^pp\-5fpD+)+)\-5fpFb5fp3b 5p 35v&DX$=skb.XL=skb"2t#2#:2$2%2&2'2(!"U!"U! "U!"U!'"U!o!:"U3!H"U3!V"U3!d"U3+"U3!|"W!"W!"W!"W!"W+!"W3!"W3!"W3!"W3+"W3t2:22!9"!F"!S"!`"!m"+!|"3!"3!"3!"3+"3t=p9"=qSL2]**Mlen !HM__p) *) *) +*) !U"B!b"B!o"B!|"B!"B+!"B3!"B3!"B3!"B3+"B3t=p9L*Mret!"!"!*"!7"!D"+!S"3!a"3!o"3!}"3+"3"5pALHT))^ret ! ^__p))+)!]!#]!.]!9]!D]+!Q]3!]]3!i]3!u]3+]3\ A!5ptr A<\ 4!5ptr 4=bG5valG+X5pG6!)I}I xIMbBD5valB+D5pB6!4)DD}D xDA4b=5val=+&5p=6!|)?}? x?5|, !-k{ILWK)IK[Ifr ~   L JII "'0I}T`jo9IT`#jo[9>KXer#LN#I T`jo9I pT`#jo "'I T`jo9I oT`#jo "'I T`jo9I nT`#jo "'I$T`joI&aT`#jo9L(]Nkv {(EL   # . 9;D  E Q ] i uG%T -U2T Q09L(]Nkv {9;(W L-pUQ#W-,T0I2aT`joI 4T`#jo5    # . 9;DN E Q ] i uGgT -U2T     * 7;Do E S a o }-U4T Q 6L   # . 9;D E Q ] i uGT -U2T Q6' z 5[   # . 9;D  E Q ] i uG?U@T-U2T -pUT@ IG*T`joI IT`#joJ`' 5 5   # . 9;D E Q ] i uGUT -U2T -pU~T IRT`jo9I TJT`#joUI]T`jo9I _IT`#joIiT`joI kT`#jol< "'ItT`jo9I vT`#jow; "'IT`jo9I T`#jo:IT`jo9I T`#jo[#LNIT`jo9I zT`#jo "'IT`jo9I yT`#jo "'IT`jo9I xT`#jo "'kK{'KI[fr ~    J#k*{'KI[fr ~    J9#'k{ILWK)I[Ifr ~   L JI'6I "''  5}   # . 9;DD E Q ] i uGbUT@-U2T@-pU 'B' "'' 'I&T`joWIT`#jo'I#T`jo9I T`#joIT`joI .T`#jo'  5u   # . 9;D< E Q ] i uGZUT@-U2T@-pU I;T`joI T`#joU '  5   # . 9;D E Q ] i uGUT@-U2T -pU I& T`joI ( T`#jo) ' Y  5C    # . 9;D  E Q ] i uG' UT@-U2T -pU I2 T`joI 4b T`#jo5"'  5   # . 9;Dp E Q ] i uGUT@-U2T@-pU I>oT`joI @T`#joA' % 5   # . 9;D E Q ] i uGUT@-U2T@-pU IJT`joI L.T`#joMW 95]L-pUT Q8 IV4T`joI XT`#joYM'  5   # . 9;D E Q ] i uGUT@-U2T@-pU IbT`joI dT`#joIp@T`joI rT`#jos "'I|3T`joI ~T`#joS'  5   # . 9;D E Q ] i uGUT@-U2T -pU~T IT`jo9I T`#jo9j #"'IT`joI$ T`#jo"' t" 5X"   # . 9;D" E Q ] i uG<"UT@-U2T -pU~T $# "'Iq#T`jo9I #T`#jo#$Ip$T`jo9I $T`#joI"%T`joI {%T`#jo% "'(I' !( 5(   # . 9;D' E Q ] i uG'UsT8-U2T8-pUvTs#- I(TI`jLo9I ")TI`#jLo;+' y+5c+   # . 9;D0+ E Q ] i uGH+TA-U2TA-pU -ʜUvTQ 7    R R q 8int8, * u8Fu16eu32s64u64+8  *H  %e, #UD  ** =h }  89  x     :; *W Y 83m     +8       P P P P P<q=q V,* v 1<*PPP!P%P'P,P/P3P5P9P<PAPDPHPLPQPUPYP P P PP P P P P PP 6P 9P cb ( < X*h!len8p8t exez e| ~ FFFFFFF F 2U!end3U4(5(687;p P 1""*/P?8i !#8YF      !  K.8 j@devkPp*egh bAdBsvtuV z { y|, * 7 C7  , c  * ee  8c  ,e    88 %  G ,F<  FFFFF FF F F F FFFFFFFFFFFFFFFFF F!F"F#F$F%e x  $  ( % ,e.e0e2,4e6e8e:F *F * ee  8  ,e .  P 88 r   ,FD<FFFFFFF F F F FFFFFFFFFFFFFFFFF F!F"F#F$F%e x   . $ P ( r ,e.e0e2,4e6e8e:F*F* <G  F(* R-p  E -#8"*.2#8 8BO R;()-.1569,@FskbA(D;E@FJGTHIJKL M!NY" ; E Oi"*$% $< $O G8ttH=hhI<J 8/8xx/ 88K Xh%>_s_&lp>7@L>Bhfp@_A h'6Hh(9HGTaMdU`Ts %+_so&len+)hfp-_skb.)0xN00x'?3 x3 x123 '6x6x12632+UvT Q1R 3 6!O8TUsTv%A&fp)_crcbp len8)|x)0x(( 8U Px4fp7_Qe4fpe3_R2 *skb2 0*len2 9x5 D*skb ;F5Z9Z=8[SD:tty66;Z++ +M+^MZWZc{ZZZZintc,Z*Zts8otu8ts16tu16,ts32;tu32ts64tu64c9 Z+1c2cHIX]^_`WZZ%'),<c Js #Z%&*+4=B]ch;nJ} T ^ ^ ^ c c. . T  6 66;6 WP+'xx Px}0+W;|H  M   "   (  0 8 @  H  H  H H  H  H  H  H8@ bPhMM c8;kp c(c,0 8@ABcD HPmem@v+ c %/9 $(0c8@cHcL>PcXC`chHp U xcc RcaccE c!E"c%&j)9c:k?AD F P u Qc(T 0A A, ,,*L Bval , , ` , ,L A    +*  ,l    `       `   ! ! !!! !!c!+," fmt"M"M"M"c"M"M$ *#e #f+#gU #h_ #uU #v;#w; key#x Z #U #V  #j key#kd #n key#od $6 $7 $8 '8$] $M$M$M$M$c$c$4c key$9 ($c$=  8$U $V mod$W $XM$Y $Z ($[ ,$\] 0M $u;$v;$w@$xc$yc  +c W_+ %/%1c set%3D get%5]%7 z5_u      ( 0z8!@" H# P$ X%`&h'p(x)B*`+,-./ 0 1 h273 Z5 9 J; w>B?@ &!&% &+ &-&/ '@' x' W}+( )'))  ( O( ( *;Vcs*=^Vsl*?^Vwfe*A^ *EVss*G^Vsti*I^?*K^Vnmi*M^?*P^ ?*S^0?*V^8Vlm*X^9?*]^:?*d^<**JBcs*,Bcsx*^*O**wBss*,Bssx*^* *g} r15*m+ r14*n+ r13*o+ r12*p+ bp*q+ bx*r+( r11*u+0 r10*v+8 r9*w+@ r8*x+H ax*y+P cx*z+X dx*{+` si*|+h di*}+p*+x ip*+*+ sp*+J +B5+C,+D,?+E, ?+E,(Vs+E,,Vdpl+E,-Vp+E',/?+F,0Vavl+F,4Vl+F,5Vd+F,6Vg+F%,7?+F+,8,+,+,+,+,+.,  pte,5,"q.,  pmd,A,"-%-%%eS-%/=-' pgd-'YS-'"=-p pud-pMS-p"S-:?'@.H.I+E\qq0. 4.+8 /;/<"/="?/? c ?/@ c$?/A c(?/B c+ ++?~18-@2 %2^72c2c2  2!<(2 c,2!c02( 42)?582*cH2++P2,%X25 `26 d28 h2: l2; p2< t2=cxbse2?G@;rt2@GIdl2AI2BI2F\L92IT92J+2Kc2OfL2XkL2]kL92`"+82A ^@2D ^H2G+P2H+X2KB`92NB2TO2WO2ZO2^P2k 32mP2p)8 2qN8(2t+82u+@;fs2xPH2{PP2~PX2UQ`2Th2 9Up2 <x2 <2 <2@2+2 2c2x2CU2 4D2c2;2-A2 ^ 2 ^ 28 2  2'L 29( 2%8 2MU@ 2 H 2}UP 2VX 2 V` 2Vh 2Vp 2+x 2V 2A 2c 2 ^ 2 ^ 2 ^ 2; 2C 2 2W 2 2 J 2 J 2"W 2).X 2  2 8X0 2 88 2 cX 2=X\ 2RX` 28h 2 2\X 2 2 2 2  2!c 2"c 2# 2$+ 2& ^ 2' ^ 2( ^ 92)P 23fX 2CE 2D+ 2LkX 2N+ 2R{X 2SJ( 2TJ, 2Y+0 2] 8 2^ < 2_ @ 2` D 92aPH 2dAX 2gX 2iA 2lX 2w 2x 2z+ 2} 2~X 2 ^2 ^2 2 2E222 2 2+2c2gZ2Z2\2`] 2c(2c,2IL0rcu2P02!<@2 D2%H2=;P2j]x2!<2 2 "t]2 ]2]22 2 ^2 22>92P2 2!"42$"492.P2<]92F%@@ %+? %+8@@3('354sp3+es3 ds3"3$3&3+(3+03E483+X3+`cr23+h3+p3+x3d43+3c3J3+3+3 3bfpu3  3@8'%-' (4 X'4 *]'8@@.'E@x@.p|@'c.(E;v.X'. Zv .(.,.v0&.v8.X.vh.%wp.+x.Ku. .w.D*.\X.w.Pu  5 (5 5 (w 6 )6!; key6";*6?0)6A+6Be)6Cj) 7e)7e) mod7 7j)0)( 6=)6>)$c3*      +*+4 ;='*4?4* ='D*+8 c:*     *8@A@;-&;@;$ !;&5;: 85;<+5;=+5;>+5;@6;Ac6;Bc 6;E86;G 6;H+6;K86;M%6;N6;O)6;Q6;T6;U)6;Vc6;W%7;X7;^+7;d+7;e+ 79;i@@7;tk@7;yc`7;{+h7;}cp7;ct7;+x7;7;+=;=;mx>9;@?;$+?;0?;EA;A 0".>^ end>^4? 4?  p@. cwd@J swd@J twd@J fip@J fcs@J foo@J fos@J@.@Jl J.+A@*. rip@+^ rdp@,^A@.3/ fip@/J fcs@0J foo@1J fos@2J *@)G/,.,.*0@@i/@Ai/@Bi/ Jy/+ L@$ 0 cwd@%, swd@&, twd@', fop@(,3/@5J@6J@9 0 @<0 @>i/G/ J0+ J,0+? @Q 1 cwd@RJ swd@SJ twd@TJ fip@UJ fcs@VJ foo@WJ fos@XJ@Z.@[l@\m@]n@^o rm@_p@`q@a 1x@bJ( 1+ ^.1+@@:g1@; ^@< ^@= g1 ^w1+8@@@O1&@Py/@Q.1@R1@ 1F+@@^2@_>.I@`y/@a,0I@bw1@@c2 +2+8@@@f2@hc@kc@n^@q^xfd@t^@wc@zc@c@c&@1@@@ 3@ ^@c@c fpu@@3@c@+@3@3@2 @20&@+2@@+2 A 3A ^A^ W3+ W3+? B4B B! B" B#3 ^#4+ W54+ }E4+ U4U4+Z4_4' C4CcCcCMCMCM4D4D4D E84E95 E<5E=54*F<?5F=cF>  F:z5F;45 srcFA, dstFA ,55$cG5.(G6G6 valG JG!J G"JG#^G$6 J*G*,6G+&,6G,#Y6 HY6H`H ;16.G'6G(G)5 6G.^. G16G26G3G4 G5+G6+6*(G7G%5G/^6G76 8GE7G+ fnG Y76 T7T77E7 I>7I?+I@+IAJ cpuICJ J7J^J^'(J7CctJi4J&7 7$cK$8 LD8L I8D8 M i8M N 8N *O8O O88O8.P 8P P"8 Q)9Q*D*Q+  osqQ-i8 Q/ (R T9R R R'S9S+S9S9T9 S 9S 9 S9S9S9' T95T T9T 8 T :T9$cU 2:'@U':5U(9U) 8 U*:(U+8;0U,8U-9U.:U/; :::2::'@@V/8;V0-V1cV2  seqV3CV4:V59 V670V7 88: (W;W W+W ;WJ ;;=;; X;XX X;;.Y ;Y; +;+Y8; Z!<Z Z< [+U<[,[- x\<\<\c`\+h max\+p +<+ ]<] ^] ^].^ < sig^;^<_R_S=<_U_V4==``=` ` ` 9=.`'=`(`).`-=`. `/`0 `=`1.`5=`6`7`8 `=. `<J>`=`>`?`@`A.`S{>`T O`U`V. `Y>`Z O`[ .`^>`_+`` `a *`J?`L`Q `WJ>`\{>`b>. `E3?`F>.`gW?`h _fd`i.`m?`n`o`pc  `%?`*l=`2=B_rt`9=`B=`d?`j3?`qW?A0a )@a a a a ? 0a =@?a)@ bu@bv nsbwW| uidbx 4Dby bz b{wQI@ a @a!a" < a%Aa' =a(+a.(=a0 < a3-A saa4@ c oAc $c + lenc +c  (dAd =' e$Ae%:e'e( 0eDAeM#oAeP(eW) 8f ]Bf^f^f^f^f^ f#^(f,^0 g)Bg*^g+9 Pg8Bg9Bg:cHg;cL ]BB+'8gDC5gEPgF8gGc0' h>iChKhZhphhh endhiC WxCF+ i!Ci" ci&xC iDCiDCiDC iECiECiEC.iT DiYCiZ 8i[C.j 4D valjj D.j WD valj j @D2SD2U ^2V ^2W >c2[D02h=E2iC2j2kDcpu2lc2m^2n^ 2o^( 2E2+2222E2+2 Jc@@2UHUq}UqqRU@rVrT r T r ^ r (r*r,r-r0UV XscVsdD*se sg sk 8smsnQ(so0sqe8VV=@LPtWtWt !<ptWxt`tt t t ttttt"t(t.t/t0t9` t:`(t;W0t>89tAP@VW u.Xu,uuW3X MX+MXWXaX +{X+CXX U<X+L@vgZCcssvT idv%_Ќv[@`@ v v v8  ve( v+H vP v\X v v vT vT vTH v` v` v` v+ v  vZ( vZ0 v8v(`HvPv^`v`v kxv|v7`X'0vZv¯vgZv En` lZ\0r\rrrr( r,r.r0r@r(`HrLPrXr4` r r+ r8 r c[bdir  r ( rh rp rj r [evrt rc rc rc rE rc r8 ry r% r re rf[cdir r[bbr r  r^ r D  r((Z'hwy`]wzkw|cw}1mElwJl(w=;0w+Xw#6m`\e]o]x>y]]]4y4y4y4y!4y%4y'4y,4y/84y34y54y94y<4yA4yD4yH4yL4yQ4yU4yY2 ^ z^zzz z )_z!z" ?z$c Hz'_z(M keyz) z*_z+ z,(z-0z. _8 extz/_@o)^^z3' z8_ tpz9_z: z;Jz<J)_H;VL7@P{jjLhbJQabKIQbLIQ@bMIQbNW|bObP 4DbQ WD nsbRObS+bV  b^ b_P b`d beP@ bgeHsetbi$h bjX bl@ bm]Q bntg@ bqrQ` |b|J| |c| , |^|^ ino|)^ dev|* (|+ , uid|, 4D0 gid|- WD4|. 8|/'@|0'P|1'`|2'p|3^|4^|5J|6J|7^|8^|9J|:J|;J b+ }b}b }b}b}#bbb~ ! c (~Oc~c~ ~Oc~ ~[c`c ~c~cc c ~#c~$8~%~' cP8PP cF+$cl!d  \oh eifc sdagrjh iwjh\xDbjEhFbjH I8(J8HK8PL+pM+xN+O+P+Q+R+S+TU+V8W)N Y  \+ ]+ ^ef _ip hrj+g$i4*j11."j#;$%.'k().+%k,-*!Sk&j*j.k zkj opsk%kzkk 2k4+6c7c $cw@k$cwHl wpElwqkwrwsJlElAwslwkw+wl5wPw+jwl,Olsl'@w1mwlw+w+w+ w (w,w1m0CrcuwP8wbmHlSk wbmw idw ;mqmF+ wmwmm (m T . qn^& )d ldt*vn8.+@98H:h;op= xC,|D"~qn o+ alt+++ +(08@HPX`hpx !{noFmA.\o.^ .`c*.XoBlru.Y,o.d.e*.ip.j +.k+A(.R?po.h~Mo.s+ A(.up.z+ pp.{p.|+.}+.~D* pA.p.+A.p.Wq.  WqJ ref¯8)NHhcl+p ops xpj(.Qq,p,?p,p,pv.P*.q.c. =. qval.+S.qJ.Mq.N .Pc-.Jrlru.K,q-.W8r.X .YqJ@.Gr.I+q.U~M.V + r(.[ 0.\ 4.^+8d@.Fr,8rI.j?J(.m/s.n+.o+.q .r .s .t .vc d@.lNs,rI.z?J0.}s.~+.+. . .  . (J .s.+.+.d@.|t,Ns,sI.?c.D*tErE/s@EsS.+*tc Fu - 8 t  ~M  F(c0c4O80@P p  x# $ % '%E!d.@iC(.Xu.Yd(.\v.b+.h+.t=.w .}$J.;v.+.+d.Zv,vI.P-.v.7t.*tk .vbrb.T9.+uvbwc uh ujkq so(t0u8w@{oH~oP8XL`ehpxvwwuu.w.^cid.. y@@.  x. = .@x..+. gZ@@.|Ew@.}d@.+P.+X.+`.+h.+ppgd.  'x.) .5 .?|.E+.Lc.S .Z .]D*._.a8.pd.r..+.+.+.+..+ .+(.+0.+8.C@.8D.+H.+P.'+X.3+`.+h;brk.+p.!+x.+.+.%+.0+.#|.3|@.H|.o.+h.8p.R|x.%.W|.Ku.&a|.+.+.. . .qm.D*.e.k|.+.+.D*.  xw +3|+3 mC|+C|M|'`\|f| +|F+.+|.-./ 8S. c|p/G}@7G}(pmd9 '0pud; (8E@E:HF:PpteL 'XptlP ^`T -h>c.} @"""""P6P9P<PG }D* h;u#~;v#~;w+` 3~+u@;;+;=;dg;8;,;H;H8;^x;z;z;(;gen;);seg;*;b0 ,+++ H+++ +^++ +z+++ D*+++H;seq;+;;;;( E+ +++;;<seq;+;+;A;];;;u ;e<;fʁ;h8P;n+X;o+`;qD*h;s=p;u+;x3~;{;*;} ]+++ m+;&seq;(+;*kX;, ;. 8 bʁ++ ځ+8@;; 8;;; ;;;;;;; + @;΂;΂;  ;ނ ނ+ ++1;; ; )+/>c;_8@;7ą;;dg;<+ ;>+(;?+0;Ją8;M`;O*h;P!ԅp;Q$مx;V;W;X;c+;D*;+;+;+;+;M;+; D;9;@;ޅ;x;+;89;@;+;+;=;+;+;c;c;; ; 9;@;;` ԅ+ځ }+ D*+ D*+;9;9;_u ;[;[ k+ ;; 8;;+(;;+;+; +; +; + _@ + >+ c++ D*@+/@ 8+22++ +(0|@ ؇ LJ{v 8vM  (0 st uċ' ۈ5T9X'XXEQN ( setM0{8@H‰PۈA j‰,]rcuPc܉'5$h ̊px܉'hMCdirR$'`{5ۈ9XR M MŠXŠNJ4DWD Xъ  ? *BDEFڋGH'I? Ջ :!c"c Ջߋ,'- 8/ h0AAIDK *:d@,,*NO+PQ  (+,-./ Id 0pIqKur s t u v,$E(Sc c؎E>2sk xw2 bcb  |(2X +hlen cp ct  x z  |  :~          : 21end 31 4- 5- 6c 7!< ;Q; "# & ' ' % AN8 jiv,*'~ENA34J len4J*2,~6^ 1ޏ8*ijkcr;stvuP'RTcUCVWX YF0[K8_"``ha+pbx5dimnCd_uv ;;8x{F| }~ 4D WDc __! (~M0 8+@H L P X ` hJpJtJxJ|8 PJd++,, 0@H P T X \`h9Lp8H P(X`h p [+''@=ey ( 0 8 @ ЙH]P{X`[8@ +  (!'0!,81@"@H+P+X+`hdp &O#hr$ݎ   Ku  c (9F` J!J"#/ (0 14 86c<8 BM@D"HFPPID*XL`O dRfhSpZW|xadbdrcucPdef8k09n8@@oHq8Xr`$c c 338 `3cM`ޏB y3j ~F $Й$ EFGHI[ &&+ՙ0 X mnt & 0 vvXb \šš[map; D*Қ+?'CrcuP F+ "k#h nid&-+4+7gZ'R<SZUZXYZ cc !< d)N(CrcuePHgXj` idmpptqMxru_ +PPUk<D* 034678  xa9  " $8'@@- lru/0D*  k2: nrk3 nsk4:$8 O+ ^F+. u val^^$c   8@@t`&tTt+ttttttttt;knt:tTtT@tXxt,Xt,Zt,\t,^t$W`tXtWYtt t`t`t$\Yt 9t@@t`@tWHtWptcDt"t#8t&ct)e;psit,wT;bpft/Q t2>Xt5#t]t9aYP +n n,'nlCrcunmPnn!<no Anvnx,ny @*nu/,Bxn+ (nrwnt+nnnM ww nnn  ǡ+nӡء PP| n5nǡ keynPnjnWnvnT9*nyn n A(nĢn+n+nnn $ *(nߢn/,yJ nnn r- n#n,ߢ#-  !<m+0D*8@ uid 4DPD*X `$! h mm !<m gidm  WDF+jm$mrcumP<L@@Vg-Vh cpuVicVjcVkc ?Vlc?Vmc?Vnc?Voc?VpcVrcVsVtVucV{ 8 V|:(V} 80V~:85V<@@.|82:@N+ A^+? 8pǥp p! p"+p#^p#^ p$+(p$+0 p'p(^p)^ p0$p1 p2 p3  pC?pD pLgpM%pNg? 8pQpR pS?pT)Nl ǥ+ NƦ+ƦЦ -<+L)/067 5IJQ R(U0V8^@fHk(P5lpn$q5oxq|rsu5vxyz{       ( 0 8 @ H P X ` h px       %'0Zc5P '` Crss J08c@ X  Ѫ fn z5 arg  +. bѪ J*sS0sTsUjsWRsXvsYP'8sI qsJL iocsKVE0 s\c08rLr rr r r+ rc(rc,r!<0rc4r8r¯Hr Xr Xr Xr Xr Xr8`rdr\hrprx;devr(r0r 4r 8r @r8H;idr hr+pr xrr=;rer r= rr ;r!r"r#8r&0r(84r)8r*efHr-G ;fqr2Q r3r58r68r78r= r>80r@4;tdrD[ 89rFP@rKcPrP8hrRO rSrUrVrWr[8r] RV. w val`. val<¯ in+v['8_V`D*aVbV?c ?d CrcueP reff0. u v +%`>cT Ӱ++ n$ .. -0 4 4n5c6n7 ~~+* 4D w* WD PYc   ''('8 KuH^Э()*+ ,0-8@. 8`/ d0h1p2 x3+4³. 8 val !$c6gB*EBuidF 4DBgidG WDH 8 D³sJD HE g g g g g  g( g0 8 @ Hȴ+ c(c, g0 g8@ ! ȴ@89:;<= >(?0@޵8  Y ٵٵŵXDEFG HI J(K0N ζ8O@QHS޵P YY ɶɶFg F8Ӷ FɶxYZ[^\^]^^^ _^(`^0aT8cT@dHeLf^Pg^Xh^`iThjp8cccc cccino  P( P0c ϸ+ Nccc ccccX33 V(y08y@H3PN v 3c QQϸ8 tt [ ٵt~ u8  c d 0 %H;ops!5  F%+ E5+ E+-wj}o j tIļ[y  ž ()0 B8 \@ uH P X`տh p x+X h ݼ:ݼ\+[-/6 7 9^ ; c < c!= c"> c#? c$@ c%A c&I c'P^(S0VN^8 W +8 X@[wb[H \FP _X `\ a` b h c p d xɼ tKutt` ~Mݼ~ ~Mt Ku~Mcdtʾ )Ku~Mcct DB~MD.\tG uthatz I؎ ~Mtt տtƿ tڿ t   +~Mt IIKuSND0hKu] I؎mļ-jcdIP-!  F-PXU $ cPZ8@Z[\]^5`S b{(d0e8f@hHjPk XmM`ophppr xsuv)yL{j}dLi bdijl+m+op(q8rHs 8Xu \v3|` x+ y+ z+ {+ |+  +( +0 ]8 h ]l 8p x ef ef 8 ¯H ]X W W    -^(WKu 8pidN7uid 4D4D $  +cc cc - 8 ^d ) I*P+4,W-u 9F+SP80  &Z+"I   ^w ( 0 8@HPX`h p x"""" J r   "6;EYJT^cmw|9L)* D+ D,\-L.( /+(0 09 4:~M8< @=8D> H? P@yXA8`BCE F8HIK 5QL` id^5T9 +0+8!d@cDcHcLcPD*X+`Cwbh ` p 8 d c[dev 3 ( =;0 X W8+ WH+$SUZ M^c Hpos S c Ku Ku${ KuM{ <I<cA rzrT rr G# Ku gKu Kuc+ Ku' FKu Ku9 BKu$ `KuG ~Ku~e +Ku++++^ XKu{c Ku{Xc (Ku(d-2 ZKu<ooKut xB bufB$B B B B  B (B 0B88 opBLXB`BQhBp_ JKuKuc" wKuKucO c| <c Fc MF [F _5F S$: {[FX F F [FM [F [F M[FFc% k[kR [vJcQau $ F^^ F )FKuc L[FKu. _j[Q [_o [  mt }d + F>c: FI:^FN wFݼc F|    ('$ "o J$' rMO FYw U  M + @@AMBCD E<( sdF:0G!d8IcJcKcLcMc  bio  5 4 8 @HP^X ` *hpr  t /x* ;. J W,+uIu aUImyidrcc Y+9^ rev+Y ~:':  :MCrbT9 ns0c8< >Z@ id^` hpCrcuPx~  opsK!U :hFj z"$ % & (( 02 89@: H= P@4XA R`FP* Bdirc? V kn:Kuo 8 8@`h $x    @  A %w eeVzeo o o{ o{o e$ ge 4e' Re9$cz 0'(W) ‡* +, - z5(z| | <5<M< *c>"c8ENmodF &G cPpqrstcbmtnw"  c$$EN +*4_i_WMf\p N $$ 7 7    4+$c*]$c4|"" W+/ (+++++ '0Crcu1P2!d3 F+ H|I|JK LM+Np| 8Q @p@HMP^Xbus`h p x8&QEJT ;msi-(c8h@^H^PwX |`hx  ;idJ8 !!V# ~$ %'#)+ `, a- b. c/ d9 e< f'(8 get  put  %& '(!d :;<Zn  ~!n"n#n $n(%n0&n8'n@(nH)nP*nX+n`,nh-np.nx/n0n1n2n3n4n5n n_~s>U>clHxGy 8zc|c}8~0L@G88   ! " # $ % & ' ( )J8 )N @ @ A B C D E&2:P^ec  c                c^^^^  (;qos0 +,M id-./8 0(1=;02+X3 8`4 8h5 8p6 8x7 88+9+:+;+<+ dev=> ? ;Eops n Un ~ ~nUE ncZ MNMOMP!VQ!VR!V T(U0Vn8W ~@X ~HY ~P[nX\n`^h_npanxcnd ~ pmfhs  `aM busbd eMg hc$j(k0mn8n ~@onHp ~PqXrn`s!Vht!Vp pmvxw ~ py Q Z `23M5!V6!V89 ; (< ~0>n8@(o@AHC P pmEX $ ŠNJ 0XYYMZ!V[\ ^ ~ pm`(Y$c- $ŠNJ ij k 1m T ,,$ T,M6cc+>c>c8- 0X!"]X>c1>cB>cOc;d&be2f4g lidh ; OY^^mrYcma @/0 ops1" dev456(784'`5V8 grp [@HP+X, -'h8Cac9-: [`$cE NKT [Zoe[:P |o|` Wq++tA -F+*-,KJ(0@vma1'2 h3 +4+5+ ->j? @ u'j '+z ' '+++ ||c ||++ +' 8'+ ML'= e'\XQ \X'+Ej :'+$c'M N DPcRc Tc## rCtrD rI #rN7rS7-t erArB8rC%%~` ^c*  c %uqnqoqpcqu#qw qx `qz q{ q~c8q8<qRU@qePqfpqx4 F+ 3h?O H 8 d (c03O @jtk lenl wpmnopqrts t( + +'@!+5&+@@+ H 4&8c=cBcG mapL&TJ'@@]Fac @m sbqwc | $ wsˁ(ˆ 0ˌc4˒ 8˗ <+$rm rtDrurvrwrxryrzr} cr[r r r r r  r (r&0r 8rI@rbHr Pr wXr`r hrpr xrr P[eoO~Hrr r @rcDr&HSr  cSr] crhErirjrk+rl+rncrocrpc rqc$rrc(rsc,rtc0ruc4rvc8rwc<rxc@rycDrzcHr{cLr|cPr}cTr~cXrc\rc`rcdrchrclrcprctrcxrc|rcrcrcrrrrcrcrcrcrSrRW ppcPrr r D@r DH uF+, 0Y: iB ~JO  T (X0]8b@g Hn+Pr @X{c`̀ }ḣ p̌ x̒ ̙   Lf  qgLh i[k l tagn o$qc(tc,u D0 biow8x@HX̂^`̅^ḣ^p̊x̑z̗|̘~̛ ̜e̟ ref̠ ̢+E elv>r^     = cccFFPrqs 8 B L V O ops mapc8 c< c@ cD cH LcPcT X `= h8pi` r r r >cr  <c  \D  \  Dc+  c&\c ??D+ bNw+g \DcE| $\ \(  \S# 7(G<<4Fu$cy Ņ getņ, putŇ <ň Pʼniŋ P ō}(Ŏ 0Ő8ŕ@ŘHřPŚ XŜ"`ş;hšmpŦ"xũ ū,ŬŮůŰy QRc idScT Pfghci1 ,<1 PA iU V}n M Mc M  M   " ;M' hMMcch@ r  c  2 + cc  \cc 'g sgl(g)c*c $c l $cZ*z{| *̫̬̭4j̶>v̷T9̸.̿b icqQ b r+. seqc8@6[E@Lef@N(*SX[+a eLfqgQ m sy ĉ̄̆ ̉8(̎c0̔ X̚= `̠= ḥcp̥ct̫ x̮̰̲ ̹̻`>c&y@@798AF+ Jcc  += !;rq" # T[T;@i[^yyT n LL    j  [<   +[c@[c0 cO  ccE}O  ch LO o   + +$c$ \h*X3cW "a ,"c dM m@"(t)0)8"@"H )P )X )` )h )p )x ) ) ) 3+ C+  \+ l+" +* l+4 +; +E +N )W+X ,a ,g 4,qM,yM "c$c(c,+0+8@D c@  cA  cC  cD  cE  cF  cG cL!VP!VX^`  qq v88 &') +80, ^8.8@0`1p2%3QN5c6#,7"=-9!d:)N<` > @cBcDcGH+QcRcS^\ceghijklcmcncocp+q+z c{ c| c c c c c c c c c c c cffcc+ +(01;irqc4R,89@90 (09p|8 L(J"K^"LMefCrcuOPpQSZ+\]_`abdegܐ sdbjkm cp cu cv cw- } ~+ πc χ- Ϗ ],"q," M@"q1" ^"^"cc"L(g)hqiLlm o0p Pr Ts 8Xt`upvrwtxvy+xz+}+ idcc lunЀ^ЁcЃ cЅІЇWЈWЉ8ЊЋ-ЌMЍM revЎM Б- В- Г- Д- Е-  Ж-( З-0 И-8 К)@ МB-H РcPЧ c Э c г c й c л c м c н c о c п c  c  c  c  c  c ppr c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c  c c\ ` d ;h ;p x ec    9 9  e-   cc-8N-% p|(E" ) ) )^") )^")))^") )))8HO3+P^"QRbdevS(T!dUc;idVc Xc Yc!\c"^c#`c$d (e ,kc0lc4o W8p-<q @rp|H)C+)8+ \+q+H+l+qa+ +^"q+ +qc+ + + +^"D('+ +oq+ ,q$+  , , 4, %, M,q9,>c,XL`=-55h5 7.8 @ D H !L "P(c - l+X,$c&- 'a-CrcubP lencd*--->cB. 7.q^.A. h/ dev !d"c %&(c )c$4/(5/87H8cL; P<X>` :/cg CJ/+$cs1      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg]1S c- j2dev k1 p+J e>2 gN hN1d dw2,2I sT9 t u4- z2 { 8 |^J 2 +  22N2- 2,2  +J $3  - A3 [,2J h3 7 - 3 J,A3- 3 c c- 3  - 3 7 J< 6 6      6                            ! " # $ %  ,$3    h33  $3(3, . 0 2 74 6 8 : 6}+ 6}+J 7  - 17 [,6J X7 7 - u7 J,17- 7 c c- 7  - 7 7 =< : :      :                            ! " # $ %  ,7    X7u7  $7(7, . 0 2 74 6 8 : :}+ :}+-< :,3 7 ;}+c Q;  !< V;  & iC ; f;+k;net R;+q;e; M;N?O?P offQ immR; ;F+$cq&<>c=      !">c=      !>c%h?      !"#$%&'()*+,-./0123456789:JPԷS@Ը Թ Ժ Ի Լ Կ  3 , 0 4 8 < @ H Ld{@IIy @ bkeyES@ k88A&&&&  $ ( 0-]A  yB  &&  &  ( , 30 @  D  H L&P X \&` h l8Ap t&x& # ' y*'C&+, - 4 -8LC9 : -@qCA B J 7C'C< = > ? LCD kPGDH I J K &O&PQ R $S (T ,&X0&Y8Z @cpu[ D\ H-`Da b c d e J _(EDg h kk^El m &n-rEs t -zE{ | k@q3F^Ev w x &yE&Ԃ &ԃ(&Ԅ0ԅ 8kԈiFԉ Ԋ &Ԍy(ԏFbbtfԐ&ԑԒ ԓ Ԕ ԙ Ԛ Ԟ $k0ԡpGpidԢ fdԣ Ԥ ԥ bbufԦԫ Ԭ ԭ Ԯ (-ԲGԳ Դ -ԶGԷ Ը yԾG&Կ =G k PH cnt &&&=wH  =Hpf    -H  =HH k0nI&&&&cnt  $pid (-I  =InI d0Լ.JԽ GGIGPHwHtcxHIHIk@ԱhJpGGԺ Ի EI-J -J  =J hJ J =J =K =>K  = sK   =!K" # Զ~L,h?{@I@]AB,qCI]C,DIo(EIԆEIԍ3FiFIԯFI.J JJJK>K$sKKԁLԂԃԉLԊԋԌԍ 3M jt jf k*1UM2 3 M )3MUMHx?Ox@,xA,xB,xC,xD,xE,xF,xG,xH,xI,xJ,xK,xL,xM,xN,xO,xP=xQ=lenxRJ xSJtagxTxU"w xV('(xWa0auxxYGh8xZw@ywH xO cntxJxJxx xxxoOPfP/  O  ops #O c !<OO\5PĠ W| @[nsOO:PDPNP0PnsOW|@ W(XP bPbJbJbJA@bPbPbJ< P Q+Ab0Qb0Qb0QP*@bIQ,P, Q @b]Q5Q mQ+ mQ D*Q+PQQ!dQ cQ+@\70R90R @qR0 AR` D G@R J¯ Me @R@R+%ERcxqRbrcuxPxx R+% R+%'@TRCseqX C@[Q^JaRd^85iR@@ JR+ JS++\ߢwTߣwTߤߧ8ߪ!|T0߭48߮^p߯^x߲efߵ߶T ߹T[avgߺTx ߽%  ߾=;( ߿cP h l 8p  T J ^ 4 ^ ^SR JT+ ^T++ +T++ 8tT knt:t+t=;'tUt` sstzWt¯t t0t@ idtPtcTt^Xt `teh5tftWttzWt +[t?[t O[t O[t O[ t O[(t d[0t}[8t}[@t[Ht [Pt [Xt `t[ht [pt 8'xt 8't 8't O[tttidttMtMtWYt ttZtZtcUT WW+ (tDWtE<tH^tJ^ ta>XtfQtgWtmW(tuWPt{Wxt`t` tXtttt TX+ X+ 8@tAWYtB^tEctH tKbrcutLP &tS@@tV`tY t\ct_#4tb3XW `pYF+tlZtr3ts+@ty Ht|cPtcTsstzWXt`tZptjxt ztZtZtt t t tZt[t t t  ^ZWZpYZ TZWZZ ZWZ^Z [WZTZ W+[W[ ?[W0[O[WD[d[WT[ }[oWi[ [[[[[[[ [%W[[%W[L@ \D*5@@+@D*HD*P+XD*`D*h+p+x+5"@$ min%+ low&+'+ max(+)\[ x T]++++ 8 (88eX 0]m c(" C, 0,].m0c(1 ,$c,^ ?-^ cnt@ Aj N^ercuP\^ nr i ^ t^+$c!^^^ x%_ 8T]=;8+`+h+p vCL_ idvD refvE !< vNt_vOgZvQ L@vW_vYgZv\'`v] `v^`5vl@@vp@vq@ vr` vs!L_H_`Қ +-`++ (vn`v^v atv^v^jv`vrcuvP@v`vv[@vv[@` D*`+` -``+ ``F+t_xC aa ^2a^^^^^xD>aCa WaWa\a x amapx +fx 7xx ^xxFz5a caa; xIbxJLxK2axLaxMJa\XxQNdxSgdxT0fxU EfxV UfxWsf xX Uf(xY f0xZf8x\f@x^fHxafPxdfXxh f`xi ghxj 1gpxk Ogxxl 1gxm 1gxn mgxq gxw gxxgxygxz gx|.hxlx lx lxlxmx,mx Jm x xrm x m x&m x m  x m( xn0 x 1n8 xEn@ x('H x"JnPb bdbdKSdcxfopsx6px+fxx &<x Jx J x J$x^(xJ0idxJ4xO8x@xJDxJHxJLbtfx oPxZXx3`x8px x Eox# x/ox0x1x2x3x4 x5;pld +f+fbdldfEf+fKu5fUf+fJf sf+fZf f+fxf f+ffbd~Lf f+f^f f+fKufbdf g+f^f 1g+fg Og+f^6g mg+fJTg g+fKurgg+fg g+fg;g Jggg+fog hhh)h)hf$hbtfhMg Gh+fGhLh8xxlx xJxJ xJxJxJxJidxJ xJ$xJ(xJ,xJ0xJ4xJ8xJ<x o@x vHxPx8Xxlxx!vx=x=xxxxxxxxxxxxxx^x8x+vx Sqx)hxMx0vxx"5vx?vxIvxJ9x Tr;opsx Nvpx Svxx8xXvxlx$x^xJxx]vx3x axxvxv;btfx oxvxvx&w x. d(x/J0x0J4x5J8;modx6 @x7JHx8 PuX3hl+fGhll+fJllMl lhhJl mh^6l ,m+f'm gJm+fKu1m hmhmJmmOmmhmJwm mmt]m m+f^^m mhhm mmnnm nm 1n+f`^n ^Enh6nb$cxn @""@"""xz5 x o btfx ox xnxJh xTo btfx oxJxJ xO* xvoxnxo 0xoxJxJxOnTo vooF+d xox ercu!P=x)6px*)hx+8x,= x-x.NdT>cxq     "" " " "]x%qxCqq Cqlfbd*qSqlHqHxqxlx1xqx x x 0x 1x 8xJ@qx5Drx6x7x8x9Drx:Dr Tr+ 8Xxrx+endx+x rx9x  x P Wr+d xrrcuPxe8xfsxx&xTrx¯hxxxr=0xsxqx  x(xDtxxItx8x !<8xJ<keyx^@xfsHxlxxNtx^txntDt ^t+ nt+rxtx,xxx=xtmapx+fkeyxJ-xtxt8xuxxxauxxt x0x1x,2xJ4xuxJx@pbtfx oxJuxubtfx ox d x9vx:ercu;Pus&vlt:vDv%q+fu +fmv+Xxvxex  xW|(x^0x^8x^@x^HxPmvXqLstL]Jx]0wx]wx]0w L?wF+^Jx^jwx^?wx^jw ;ywF+-x\w, w,Cwww-xwxwx^ ww+wx xxlw wxF+>cx 7x=x ^xx `x ;=x xx xpidx J(;$c*x$c:1y   $cN~y $cyLۈz1y1y^^JJx 3$hqpcxJ|Cdev ez^^JJ${dn&^'^(^)^*^ li-^(.^0/^80^@1^H2^P3^X4^`5^hcn8^p9^x:^;^<^=^8aO}cJdJgJhzk^l^mJnJoxpJqJtwcxJyzdev{|ef}eH~efheeL^^^^^ ^(^0^8^@^H^P^X^`^h^p^x^^^^^^^^^^^^^^^>c"""""""""u(^^^J%J<J@,DJHJLJPJT3X3 !3"3#3X$3%O&*J+x,x-%.J /^012J3z 6~y9:;<J=J>J?,BfCfFLI {O}y FJGJ$ [r\_$ otw$.؂  O$ wcAwc | σ m " JrOσ +,$.؂&)/ %_&'( ) * +Ѫ , C$c""""""!"1"q"r"""""""9 GHI$ W#X # C3+ oupqrs yz{$| C} O ߆ O  OiC IiC  +$c$""""""""""""  id O 5 O j 7 len 7;  C 5F+ Ɉ CɈ و+  j 6j Q l $c      !"#$%01234@APQRSTUVWX`abchiprxyz{|}~$cJ   $cǯ)*,-b=F֋G 7H 7=JK CEIL֋?@AB 7C 7D 7MN C vw 7x 7y 7z 7{ 7| 7 } ~ t$ O O$Ѫd + C C C >cK$$ Olmn$op$>cv~h$ O O4.Ѫ C C C 7 :/ 0 72 C C C C  C C 2 c$Dܐ + $$$    !7#7$7%C$c6`"#23PQR$cڒ]]]]]]]]]]]$c "($;V()-.1569$FABDFINOP'@CskbAS (DHEFgGHJI,JKL M!N"uq== =(0d8;tt!3,+!O}"J^^ccc JJJJJJJJ;mfsJ,,,,c8(HefX HH gid,cnt,J!8@=>8?!<B JcmdE FlpI(J0M1N2O3P J4Q J8R J<U @VHW JhX ,lY ,n\p]gx`=;a b c Jdge)Nl +$c>t     $cR$cdޙ$c  ( ==ޙBL(Ü!d idsz ,0 ,2 ,4 ,6c8c<c@cD8Hefhޙ opse  J  ,rcuP  ,    (  Ԝ^^^^^ ^(^0^8^@^H^P^X^`^h^p ^x ^ ^ ^ ^^Jg.g"6h  ( ؞0# 8+ @7H@ PG XN 5`U _h_ ph x 6" ghJcJ; ,gcm ,.؞JJÞJݞ  5%JJO_t:{|}~ , 8(uHefX J 0+ w    5   =Jw= WĠ+@\"A  E $J fid fts$סBgid3BrnBrft"Brff IBfid!Bsnn"߆Bspn#$وBrpa%&6'Q 4 hdrz(J~c 0~X ~\0 MD+zq4  0 job<., sggJ  ( % [  > \ s    (   ~#   + _   %T2yhT8hT?h{zJg6LJ6^A<.chTgD.JTjgcTFTT=J{ ۥ$+M^s ^u ڒ^Y cM  ^7;^F];;cM }M{r M I Hhgh ɦ T  %W%U^; :^&]%MhBlBԜT^=T=zJhJhh ֧NJ/^t Ta efTN 4f+T+Kj{na{m|^tc!<hQT¨=hըhHqJJGJ{"M{ +=^++8Z^=q# (@fh@flp@didJ(,(c(c@mfs,i qerr(qout&     R      /   ^+`122fp(R     #KU@  e¨}UsaUsT R5X Ys:.UUT0U Kx3spx(g3fpx=#y ({@op|i qerrqout~ ~ /   ^+`5152e+7+:ORQF+8xW W ` ` ! `6UvU|:1UU0IU|:eUU0}U|:UU0 U|:UU0U|:UU0U|:5UU0CRU|T9qU U  ^+`C12+=Rerr-&   !h U|^UsT U|G:.'UUT0U `101K2fp2cmd+2len ++OR.  `  !!_6KUv +agUsT QvR|X Ys:.UUU Rv 3$"U R| ^+`11+=Rerrs    U|^0UsT HU|G:.tUUT0U `A1A01AK2fpC2cmdD_+E2lenF RSJ J !N!r6<KaUs! #V _#)#65#GA#M#]T! #^ #)#65#GA#M#f#f#f#f#f#o#f#f#f#f$f$]T=U2T   JaUUsT QvR|X Ys:.nUUU Rv 3$"`%l1%12fp'R+ +  .X  0KU8 +a2UsT RbX Ys:.PUUT0U N :3sp.g3fpC#(@opi qerrqout   /    `OUsp-gUfpB1+2fh2ctO+ORerrout.  `      !bBsm~XY ! 6 !$2$ )0 U0TsQ2 U|.UvTs:UQ#,Uv}DUscU .UvTsCUvT:CUvT9CUvT<CUvT9U 3U U zN[ .3sp[-g3fp[B#\(^@fh_@ct`Oi qerrqoutb b /j j `5'15-Ufp5E+7+R78 8  I <4!KW1 _ pU @QU#!86 !$82$: UUU  ^7+'N  # 6i /$ $  ^+`13R   P!     <ը2Q4R0¨JUsbUs: {UUU R14!T_qe @WE W3 6   0#   4 ? 0s     l   |T3<!<JWd6UUT0Q0<<a6UsUsT0Q0nB1%UsUvUsUv71%Ufp=2fh2spg+RGM+ %   !bxsm~GX)  K< B< B< )0 U0TsQ2<ɦaUvTsU  ^G+ 74=U?JT"QR`l@1l4Ufpm "| ))bs)  !@N[Qhtr!E+VY& 7! ,16!/`_XG  HKUt!J k6)bs)  ! K   6  m 1 0<" jL"Y"f"!Yl}eqX{WYmeqX{!bSFsm~!XY !T{!U![_lG ^)0  (<UsTQvz"UTvQ#R0a>UsTbUsT~Q}.UsT0U R}U Q}U !) ]7 D QA  ) 0  U0TvQ2 "%UvT2Q0U  EV)& 7!   Q ! . : !6)bs)  !U6K9UaUsT )bs)  o       o G 0        ;T~Q LzuU}TvQ#R0UsT}U !DR_Qlx!6)bs)    <KU} ' )bs)  o2 +]7 0<"L"Y"f"oE OEF S ` m z l G 0        )0  *%NUvT1QzwU~TvQ#R0UsT~U  *7 )0 %UvT2Q0UsU|:UU#UsTva2UsTv<;N n#6#@fp@fh@flp (!("^(#J($Ji qout] ( ( ?1 1 /6 6 a<1-18JU|<UsTvQ0: UU##UspUU#N #3#>J3fpi /  `"13R  !G   ¨UsU TUU N #5#ti     /(/( ^+nq1!Umfs,J+c2rc~U|U|Uvn1'UvUva%Usa9UsaWUsT0Q0pUs֧Usneqw1e'aUsUv< Uv<1UvIUsaUvUsSi1S#RU U  'Ys0D`UsUsU UvpUU# ^+ D#D%5c)15!R9_7 7  >!;J0>%J UsU UvpUU# ^9+ )%X#%#n_1&2rc!UvUvyUvN D#53fpMN  #5#@fp@req =Pcidhgen@rp (Ԝ@fmt@len i 2   E (/(((((/( (((/(/(N ) #5#@fp@lenc@pp@dpi    /(((((/( (((/(/(N  #53fpMi /  N  #4#Kڒ@mp CNc ( #c2#d3opec@spg( @cph- /(jn+1+@q+-+.2cpu/c+0^+1^Q/ 440<"4L"Y"f"Qs+9_ (; Q +; ++; +M %=M %>M%?M %@M?%AM^%B"M}%C#M%D$M%E%M%FM%GM%H*M7%I"MV%J)%K#!:.K!{$8_$$$<!%M"h%"%6.%Y;% L%X%d%!%N#%"%6.%Y;% L%X%d%yU~"E*qU+!U1/q+ UvpUU#w1wJw^w^RRz z T._qe @ WE W3 6   0#   4 ? 0s     l   |T3<~Y  -.W:FPY]i}s6    )K   \ g 0s     l   |T1|T2<-U}^KUsT~cU}<G:UUU pUU#`HMD4xcpMw6w=wޙRlz z z z U}:UU#U|:UU#: UU#=UvT3CZUvT;U RsU  w+fpC) ) 0 U0TTQ2N>#>:#?H7fp=xcp(H(7fpA7lenxppHJE7fp7HJb7fp7H7fpD/e/eH7fpFs7fp3Ht 7devt@7lentLxfpvs&7p(7v&JHJB7p$xOg p3jobg@<./(j O`!q3job`A<./(d N6#6%#6@1yN 3skb .NN  3skb "N# lMH >~D >)QD >6Qs +D +*QOC!3rCCO1!3r1E#1M('O 3i"3r1#9('@oldN:3r-s]7r/D7('s7i7r(D0('xoldO&+3mJjO+3mBjO3i3v+H# 7i7v+OK 3i"3v/Os 3i"3v/H[ 7i[67v[C/e] #<"##:#$#%#&#'#(!%U#!%U2!%UA!%UP!%U!e!%UKu!%UK!%UK!%UK/%UK!%W!%W!%W!%W!%W/!%WK"%WK"%WK."%WK/%WK ##:##"%"%"%"%"%/"%K"%K"%K"%K/%K"!$7pARDTeexret #x__p$ee/e#g#g#g#g#g/#gK#gK$gK$gK/gKH A!?$7ptr A<H 4!]$7ptr 4=H '#{$D '0H8+$D82^D8F+D9+/xval<+s^$7v^O$D^YH&+%DB+H^;%D^D-JeJH^q%D#^D1JD?6s #%D #5%g %/g &s%7ptr<$DHDH,%7p,;$D,Kc<x&JWdV&UUTTQQU Qv* "G/!x* Q*G"/rNrU !$l'2$ -()0 U0TsQ2 )) )bs)  !<)JQ)!'~)¨)UvUvU R  *.*U|:J*UQ#.h*UvTs.UvTsU }*UsU 1'4GAGMGZGgGtGG!1'Q1G4AMZgtrr !$3,2$ ',)0 U0TsQ2!br-sm~M-XY !(-9Y& 7!=.6Y6!.6 !.l!(/l!E/Vx/Y& _7!/l "0:0U|:V0UQ#.t0UvTs<0UvQs0Uv.0UvTs<0UvTTQsUv*1U QTI1U h1U 1U U }1UsU l5zG!l [5zQ?5Grr !$ 22$ 3)0 U0TsQ2 x4) )bs)    44U|:4UQ#. 5UvTs$5Uv.UvTsU }s5UsU T9bnzGG!T[ 9bnzQh9Grr!bv6sm~6XY ! w&76 !$l[72$ 8)0 U0TsQ2 j^8v8U|.8UvTs:8UQ#8UvT6.8UvTs9UvT4%9UvT5=9UvZ9UvT7<U }9UsU ":0=o,:l!" :=06~:U :Uv:UspUU#pU >,A;JW>%J 7;WD;UsUUb++G+XGbQb]xbbbbint],b*bqs8lqu8qs16qu16//qs32Dqu32Sqs64qu64m]1 "b+1]2]HIX]^_`Qbb%'),<] S -#b%&*+4= B]]hDnS} c m m m ] ]4 4 c  (P PPU(PQj++ j"w+WDzH  G   "   ( 0 Y8  @  H  H  H H  H  H  H  H:@ WYPhGG Y ^]9Bkpc ](],Y0 ^8@AB]D hHPmemm@+ ] 9(i0]8i@]H]LP]X`]hp l x]] ]]]]i ]!]"]%&19]:?AD F P Q](T0J JC ///c ]val 0 0 w #C ,c J   +/  0   # w    , w   ,  ]+, !fmtGGG]GG$ / e7  f+ gl  hv  ul  vD wD key x7 q  U  V #  j !key k{  n !key o{ !6 !7 !8 +8!u !G!G!G!G$!]$!]$!4] key!9 (,]!=  8!U!V mod!W!XG!Y  !Z (![ ,!\u 0G !uS!vS!wX!x]!y]  +]Qw+ "/"1] set"3 get"5"7 6wri    U( U018!J@" cH# P$ X%`&h'p(x)* +5,]-b.5/ 0 1 23 5 9 I; v>?@ # #!D key#"D/#?#A+#B,#C1 $,$, mod$$1 #=W#>i#+@%p x%pQ{+:-@& >!&6&]&]& i &<(& ],&!]0&( 4&)68&*]H&++P&,>!X&5 `&6 d&8 h&: l&; p&< t&=]xese&?H@Brt&@Idl&AJ&BJ&FM?&I9&J+&K]&OM&XM&]M?&`"F@&d &h]&k] &l+&m &n%M &o*M(&p'0&q iX&s`&ub&x d&yLh&zp&{4M&+&&& && && & &L&&& &E&&9(?&9PBmm&c%h&c%p&(Nx& & & & &+&]& ],& ],& ],& ]-& ]-& ]-& ]-& ]-& ]-& ]-& ]-& ]-& ] -& ] -& ] -& ] -&"] -&+&-Bpid& & &+&>!& >!&&&>!(&0&@&NP&NX& &"N&%3%&(3%&+ i&- m&. m&3 m&4 E&6vE&: (&=+0&>+8&A m@&D mH&G+P&H+X&K/C`?&NtC&T_P&W_P&Z_P&^OQ&k S5&mYQ&p'9 &qL9(&t+8&u+@Bfs&xcQH&{mQP&~wQX&Q`&Uh& Up& =x& =& =&SA&+& &]&&U& D&]&9<&A& m & m &$7 &,  &L &N:( &>!8 &U@ & iH &'VP &VX &V` &0Wh &:Wp &+x &?W &B &] & m & m & m &< &D & &X & & S & S &"X &)X &  & X0 & 98 & ]X &X\ &X` &9h & &Y & & & &  &!] &"] &# &$+ && m &' m &( m ?&)j &3Y &C] &D+ &LY &N+ &R%Y &SS( &TS, &Y+0 &] 8 &^ < &_ @ &` D ?&ajH &diBX &g/Y &i4B &l9Y &w &x &z+ &} &~>Y & m& m& & &]&&& & &+&]&[&R[&]& ^ &](&],&L0rcu&j0&<@& D&>!H&;P&^x&<& i& "^& ,^&6^&i& & m& &&>?&j& &!"R6&$"R6?&.j&<@^?&F#@@S!+?@'@'@' (;!(<%(=%D(? ] D(@ ]$D(A ](D(B ]+!+ )B")C/)D/D)E/ D)E/(^s)E/,^dpl)E/-^p)E'//D)F/0^avl)F/4^l)F/5^d)F/6^g)F%/7D)F+/8*+*+*+*+*+4* " pte*"*""4* # pmd*"*"#+%A#+%%"W+%/$#;+' g#!pgd+'"W+'"N#;+p #!pud+p"W+p"t#W+##+@,H#,I+Kp#p0, 4,+8:@@-3%-5!sp-+!es- !ds-"-$-&-+(-+0-58-+X-+`!cr2-+h-+p-+x- 6-+-]-S-+-+- +5efpu- 4@"C%>!8% (. c%. q'h%:@@,%Kw@,|@g#"#%f,&Ku,c%, A##u ,(,,,u0*,u8,X,uh,%vp,+x,t, i,v,',Y,v,t# /!&/% /+ /-// ,]3q'     +'+. ;H%'.?'H%'+0 ]2d(     i(:@A@3**3e@3$w!3&53: $753<+53=+53>+53@63Ae63Be 63E863G 63H+63K963M>!63N63O63Q63T63U63Ve63W>!73X73^+73d+73e+ 7?3iW@@73t׆@73y]`73{+h73}]p73]t73+x7373+=3}=3فx>?3W@?3$?3?3A3A 04cG+4dG4e4g4i 4l# #,(*@5 @5 ,]6+4(6+6+ val6 S6!S 6"S6#m6$+ S/6*,6+&0,6,#], 70,7 7 , 8],8_8 D5,46',6(6)f+#+6.m4 61,62,6364 65+66+,/(6-6%+6/b,67, 86I-6+ fn6 ]-#, X-X--I- 9-9m end9m :;-^cs:=m^sl:?m^wfe:Am :EX.^ss:Gm^sti:ImD:Km^nmi:MmD:Pm D:Sm0D:Vm8^lm:Xm9D:]m:D:dm</:.]cs:/]csx:m:-/:.]ss:/]ssx:m:- :g/ r15:m+ r14:n+ r13:o+ r12:p+ bp:q+ bx:r+( r11:u+0 r10:v+8 r9:w+@ r8:x+H ax:y+P cx:z+X dx:{+` si:|+h di:}+p:+x ip:+#X.:+ sp:+#. ; /; ; /. p<h0 cwd<S swd<S twd<S fip<S fcs<S foo<S fos<S<h0<SlSx0+J<*0 rip<+m rdp<,mJ<.0 fip10S1+S1+? 5> F>! y>" d>#(s5m5+Q5+!5+55+66 ?>R6??+?@+?AS cpu?CS @8m6@96 @<6@=6m6/A<6A=]A>  A:6A;m6#6 srcAA/ dstAA /6"6i/B7B B$7#6B74C G7C C"07@D@D@D@D!@D%@D'@D,@D/$7@D3@D5@D9@D<@DA@DD@DH@DL@DQ@DU@DY+ E8E]E]EGEGEG F8FmFm+(F8IctFO8F&8 8,]G"9 HB9H G9B9 I g9I J 9J  K)9K*'K+,  osqK-g9 K/ (L 9L L L+M.:M+M.:M.:9 M N:M .: Mv:M3:M.:+ N:8N 9N M N :NN:,]O :+@O'N;8O(v:O) M O*b;(O+;0O,8O-9O.:O/; :];];:N;+@@P/;P0 aP1]P2  seqP3dDP4];P5: P6a0P7 M8g; (Q$<Q (Q+Q 4<QS "/</<;$< Rn<RR Rs<n<4S <S<+<+S8x< T<T T<< U+<U,U- xVA=VA=V]`V+h maxV+p+Q=+ W=W mW mW4X = sigX<X=YRYS==YUYV==Z >Z Z iZ =4Z':>Z(Z)4Z-x>Z.!Z/Z0 >Z14Z5>Z6Z7Z8 >4 Z<>Z=Z>Z?Z@ZA4ZS%?ZT gZUiZVi4 ZYI?ZZ gZ[ 4Z^z?Z_+Z` Za /ZJ?ZLZQ ZW>Z\%?ZbI?4 ZE?ZFi#z?4Zg@Zh _fdZi4Zm2@ZniZoZp]  Z%@Z*>Z2:>]_rtZ9x>ZB>Zd?Zj?Zq@J0[ @[ [ [ [ 2@ 0[ @#@[@ \uNA\v( ns\w| uid\x D\y \zZ \{O@ [ {A[![" = [%A['=[(+[.=[0 = [3A sa[4{A ] B] 9] + len] +]  (^4B^ H% _$iB_%#_'_( 0_DB_M#B_P(_W) 8` C`m`m`m`m`m `#m(`,m0 a)/Ca*ma+: Pa8dCa9dCa:]Ha;]LCtC++8aDC8aEjaF9aG]0+ b>DbKbZbpbbb endbDQ"DR+ c!=Dc" ]c&"D cDdDcD=DcDID cEDcE=DcEpD4cT DcYDcZ $7c[D4d D valdd D4d E vald d D&SFE&U m&V m&W, E]&[vE0&hE&i=D&j&kFE!cpu&l]&mm&nm &om( &.F&+&&&&YF&+& Sf@@&F& m& m& m& S& S&+ &+(&+0&]8:@&H& m& m& m& m& m & m(& m0& m8& c@& mH& mP& cX& c`& mh& mp& mx&  m&  m&  m&  m& m& m& m& m& m& m& m& m& m:@&I&.F*& 9&! m(&" m0&# m8&%@&&P&'Q&(R&)S&, mX&- m`&. mh&/ mp&0 cx&1 m&3 m&6 &7I&9I&;I&=+eavg&GYF@HI0&KbJ&L&M+&N+&O] &P$&Q&&SbJ(IW&]tJyJ JJJf&`K*&a9&h m&i m &j m(&k m0&l m8&s c@&t mH&u]P&]&]&]&]&]&]&]&]*&:X*&:!rq&L&gJ&K&JW&^KL >!LJrqL&fL&] &] &]&];&L&&&&&Lb&fLs&S&L&LL&LM ML%M+''/Mf(N{e }@ D HN:P+` +h)=p+x $7e i9Mpidpe7Ne9 <e:]e; $7e< inoe=me? e@ @eBeHIrcueCj`eDp-N(N+ fNf]ffN+goZPgp' uidgq D gidgr E gs Dgt Egu Dgv Egw D gx E$gy ](gzǻ0g{ǻ8g|ǻ@g}ǻHg~ǻPgXgOQ`gOQhgOQpgOQxg ig6g|gNAg;KOZPkeyhOQh<hKGh: semhe(hDPh iX#i`h T^h uidh Dp gidh Eth¾xh|h~h h+##hIdPTQ^QhQrQ Hi Qi! <i"Ni#Ni$Ni% i&9(i'N0i(N8i)O@|QPXj^Uj_<j` jajb jcjee jh>!8jkSA@jn Xjq`jsdjt>!hjwpjx]tjzx$j]$j]j]j j 8j:j M itj j j/C jh j  jN jcttyj j j D jm j m jm jm jm jm j E j+ j+ j+ j'+ j+  j+( j"+0 j,+8 j+@ j+H j"+P j,+X j+` j+h jBp j j jP j j ] j j j j jc% j9 je0Rd jUj$7j<jej@ UUUk'VkkU@lVl l  l m l (l*l,l-l0,VV Xmc0Wmd'me mg mk $7mm{mnC(mo 0mqa8V5W@PPnXnUn <pnXxnsnn n n nnnnn"(n(n.n/n0n9s n:s(n;X0n>8?nAj@DWX oXonoFoRXXX+XY Y+%Y+C*Y4Y<NY+P@p[Icssp5S idpi]Њp"Z@^@ p p p$7  pa( p+H pP p"[X p p pS pS pSH p^ p_ p_ p+ p  pR[( pR[0 p8p(_HpPp ]`p_p ׆xp|p7._NY+0pR[pOp[p K^ [d0l]llll l,l.l{0l}@l(Hl>PliXl` l l+ l9 l ]cbdil  l%( l h lp l l cevl l] l] l] l] l] l$7 l l l la lbccdil lcbbl l  lm l   l(N(W[+hqy ^qzkq|]q}wlKkqk(q;0q+Xq#|l`]^^r>#^1^;^ T^s s ^s T^s t^titit t ^t!t" Dt$] Ht'i_t(G keyt) t*i_t+i t,i(t-i0t. n_8 extt/s_@6^^t3+ t8_ tpt9_t: it;St<S^8D@ Xu9XuXuP@@Pg aPh, cpuPi]Pj]Pk] DPl]DPm]DPn]DPo]DPp]Pr]PsPtPu]P{ M P|];(P} M0P~];88Pa@@ `zMag;@,a+,]l[a va <v aa"aaa vav'vvva,]Cb+,]WsbU@ Xqbras; wqvbH cpuwPb+8zb{aIrcu|j wqb0E]q]c @UYYYs!bs!bs!bs!bs!bs!bs!b xcxx xXy"dd[ac]d+ z9dzad zadzadz#fd9dad{ !wd ({d{]{ i{d{ {dd dd]iwd {#e{$$7{%{' d| |"!e/|Te|$7|&e |e#2e|]|ii (}0e}1'}7' osq}9g9};, }<X}X}X}X}X} ~+:f~,, ~- xfff( len'HfPp:ff++f+f+P@ggg 8$7@@ ?fH!+"+#$; %a&j  'h0 (+8ccpu*@cssp+fhH'g+ `6h7$78f:f(;+H<hP=X>\g efhf] sdagih ii$hdxDiEhFiH I9(J$7HK9PL+pM+xN+O+P+Q+R+S+TU+V9WN Y  \+ ]+ ^sb _fhphi+fkh@/i224"#j#D$%4'Gj()4+kj,-/!j&i*#j.Gj j#i opsj#kjjj 2k4+6]7] ,]q@-k,]qHVk qpkqq-kqrqskkJqkqjq+qk8qjq+lqk0k|k+@qwlqVkq+q+q+ q (q,qwl0Ircuqj8qlHkj qlq idqllR+ qlqll (m, c 4 mm& )e ldt*m8.+@99H:ih;np= xC/|D%~m ni+ alt+++ +(08@HPX`hpx !mnFmJ,\o,^ i,`]/,X3o]lru,Y0n,d,e/,iUo,j +,k+J(,Ro#o,h(N#3o,s+ J(,uo,z+ pp,{o,|+,}+,~' oJ,o,+J,p,p, i p refO8NH\h]l+p ops _xi#Dpl(,Qp0Uo0o0o0ot,j/,p,], ;, q!val,+W,pN,M;q,N i,P]1,JYqlru,K0q1,W~q,X i,YqN@,Gq,I+#;q,U(N,V + #Yq(,[ 0,\ 4,^+8g@,Fr0~qM,j#N(,mur,n+,o+,q ,r ,s ,t ,v] g@,lr0rM,z#N0,}r,~+,+, i, i, i , i(N ,(s,+,+,g@,|Ls0r0rM,#f,DpsKqKur@K(sW,+psf t  $7   (N i (]0]4_P8и@#qP p  ix#$ % 'Kss,5t!ctx,6tt,=t,>[a,@D(,Xu,Ye(,\Zu,b+,h+,t7,w ,}$N,u,+,+g,u0ZuM,j1,u,}s,psm ,uerb,9,+tubvc h jkq: s(tS0uq8w@{H~PX`hpxuvtu,7w,m!cid,, w@@, Qw, ; ,w,,+, [@@,d{K7w@,Te@,+P,+X,+`,+h,+p!pgd,  %x,) ,5 ,?d{,E+,L],S ,Z, ,]',_,a$7,pe,r,,+,+,+,+,,+ ,+(,+0,+8,=D@,$7D,+H,+P,'+X,3+`,+hBbrk,+p,!+x,+,+,%+,0+,i{,y{@,{,n,+h,$7p,{x,>!,|,t,&|,+,+,, , ,l,',a,|,+,+,', Qwv+y{+3l{+{{Ph\J|\KO\LO@\MO\N|\O\P D\Q E ns\RN\S+\V  \^ \_OQ \`e \eOQ@ \gaHset\ih \j \lNA \mO \nf@ \qO`{||+|R+,+},-,/ $7W, ],}p/}#7}(!pmd9 %0!pud; &8#@E#HF#P!pteL %X!ptlP7`T #hE],~ @UUUUUX6X9X<XG g~' h3u~3v~3w+`~+r@3|3+373f3|833383x333(Bgen3)Bseg3*39d0+++++++++++++'+++H3W!seq3+333W3g(]g++}++33!seq3+3+33Ɂ333r 3e3f63h$7P3n+X3o+`3q'h3s7p3u+3x~3{3d(3L~Ɂ+++ف+3& !seq3(+3*Y3, 3. $7d6++F+:@33 $7333 3333333 + @3:3:3 3JJ+ +Z+1333+/E]3˃:@3703;f3<+ 3>+(3?+03J083M`3Od(h3P!@p3Q$Ex3V3W3X3c+3'3+3+3+3+3G3+3 D3?3W@3J3x3+3$7?3W@3+3+373+3+3]3]33 3 ?3W@3Z3j`@+Fg~Z+ 'j+ 'z+333˃r 3dž3džz׆+ 33 $733+(3e3+3+3 +3 +3 + ˃@w++e+Z'+/ 8+22++ +(0z)<?"JJO iwn+v+8_`'abDc Dd Ircuej reffJ03w4  v +%E]TJOJj++ snT iw ̉i /B#D#E(FgGvHIỉ b #!]"] -blq,- $7/ }0i{JA֊#щK /:@w0/NO+PQ  (+m,-./ #֊# 0p֋qtr s Ot iu v/$#(mf ceK0!sk x#0 ecb  j(#Z1X +h!len ]p ]t  x z  |  9~          #d9 2e0!end 3e0 4@- 5@- 6] 7< ;9Qz+/ 03ȍ4a678  xa9{ idr{]] @+3:E rev+@ e!+!  !GIrb9 ns0]8< >#A@ idm` ihtpIrcujxe h ops2!< !h- "($ F% d & y(( 02 89@: H= P@ؒXA `h-7/ o]dirJ&o~ x>' buf>9> > > >  > (> 0>98 op>X>`>h>ip  kn!ty i9 9@`h 9x    @  A %v '" (yi iAyA- idyiAK"yyii 9 ~ | ؒ%Ē ݒ,] 0'z() .* +, - 6(zi z S ] A mm ino)m dev* (+ , uid, D0 gid- E4. 8/`^@0`^P1`^`2`^p3m4m5S6S7m8m9S:S;S 4,4G4 /4mN4n4o&X404142 43 i44- 45 Z(47 049 Z84; @4= H4?җPNN   ݖ% @@ؖAGBC D E( sdF!0G[a8$I]$J]$K]$L]$M]%    ݖz(N( Zt 9 2 t 9 _ t  җt %44 4 Cח   ݖ9 C ݖG % ` $7% }XH 0tu vw! x*-yA z e(" G+ ##(zؖ A(2"[([`DEFd }~̙ cbufܙ  9̙+9ܙ+?Q+ #<Ux 7((7 GP(AP n(njZs# (њ+++++ +0Ircu1j2[a3R+ HrIrJK LM+N| њ|:G%w@!pHGPTX!bus`$h ip ix9\*G Bmsi(8@mHmPX `hx )w BidS$7 !! # t$%'#)2+ `, a- b. c/ d9 e< f|+($7 get Ӟ put Ӟ " %Ӟ& i'([a :;<؞Pd  t!d"d#d $d(%d0&d8'd@(dH)dP*dX+d`,dh-dp.dx/d0d1d2d3d4d5d dwU"twiEUE]lڠHx=y $7z]|]}9~0B@=:8   ! " # $ % & ' ( )S$7 N @ @ A B C D E*:Pmae  ]                ]yymmmm  (Bqosť0 +,G id-./$7 0(1;02+X3 M`4 Mh5 Mp6 Mx7 M8+9+:+;+<+ dev=w$> $? ڠ"wD;!opsd Kd t td"Kw; dw]P MzNGOGP! Q! R! T(U0Vd8W t@X tHY tP[dX\d`^֨h_dpadxcdd t pmfۨhi w `aG busbdeGg h$j(k0md8n t@odHp tPq֨Xrd`s! ht! p pmvۨxw t py nG ֨w¨Pz `23G5! 6! 89 ; (< t0>d8@(#@AթHC P pmEۨX 9" թƩ"[`ک 0XOYGZ! [\ O^ t pm`ۨ(Oi+ @ z iiA 8Gi EJ i(i0 sEt uen+ x89+XKEN ( set08@ H_PxJE l_0rcuj]y+ʼ8Eh _pxxy+h1Idir+`8x3:XO 1" E6"_[`J xd "# &'' ŭJ$7 l t0ʭ+KJ3B4S len4S/2]06m 1~#B8]/ijkerۮs(ttuj+RT]UDVWX] Y0[8_"``ha+pbix8d #m(n Id_uvۮۮ:x{| }~ D E] ! ((N0 i8+@#BH L P T^X T^` T^hSpStSxS|$7 eSe++(p// g0@H P T X \`zh?9Mp8H P(X`h ip+'+@ݷ -( =0 =8 R@ pHPX4`:@ +  Y(!0!8@"H+P+X+`hep i&#)$8=}  } t  (] v(?` iST^T^!S"/ 0 14 6]<9 BG@D"HFPI'XL`O dRbhS pZ|xazbzrcucjdaf9k0?n$7@@oHq$7Xr`,] ] ӷӷط] ӷ]G~ ӷ -"=2"RB 9p9W EFGHIM ƸƸ˸uи  mnt Ƹ и  4 dbbcmap<'r+?+IrcujR+9 " #} nid&-+4+7[+RܺSUXYZ ]c < dN(IrcuejHgiXj` idmpptqGxru + ܺ' 9 " $$7+@@-a lru/0' 9 e2 nre3 nse4"9 +fR+4 ǻ valm,] :@@ns*n5Sn+nnnnnnnnnBknn!nSnS@nVxn/Xn/Zn/\n/^n$U`nVnWnn nsnsn$Wn ?nW@@ns@nUHnUpn En"n#9n&en)aBpsin,RBbpfn/P n2Vn5#^n9WX +h5hA+hlIrcuhmjhn<ho Jhv(hx/hy Z/huA0]xh+ (hrht+#(hhhG ξ hĿhih ɿiٿ+h OQ OQĿ hGhٿ keyhOQhlhihth9/hh T^h T^J(hh+h+hhh 9 /(hhA0N hhh 1 h5h05?  <l+0'8(@ uid DP'X `$8 h gg <g gidg ER+lg6grcugjNAP+? 8jj j! j"+j#mj#m j$+(j$+0 j'j(mj)m j0j1 j2 j3  jC1jD jLYjM>!jNY1 8jQjR jS1jTN^+N+<+P)/067 8IJQ R(U0V8^@fHkP8lpn-q8oxq|rsu8vxyz{       ( 0 8 @ H P X ` h px        >!+0Le8j +` Irss  b08e@ X   fn 6 arg i+4 b S/mS"mTmUJlmWDmX(tmYj+8mI qmJ> iocmK0W#K" m\]0:l>l il7lL lV l+ l](l],l<0l]4l{8lOHl Xl Xl Xl Xl Xl$7`ldl]hl plmxBdevlw(ly0l 4l 8l @l9HBidl hl+pl xl l;lal l ll <l!l"l#9l&0l($74l)8l*sbHl- Bfql2 l3l59l69l79l= l>$70l@4BtdlD 8?lFj@lKePlP9hlR lSlUlVlWl[9l] DH4 i valR4 valu, 4. 0 4 4%5]6%7N55+?:DI/u D i/ E P] #S#u  `^`^(`^8 tHд()(*+ ,0-9@. $7`/ d0h1Xp2 x3+4y4 val ,]6B/EX]uidF D]gidG EH Dy#*J H       ( 0 T^8 T^@ H+ ](], 0 8i@ !q@8J9c:c;c<c=w >w(?w0@8 cO wh X|XDCEwF\G lHwIw Jw(Kc0N 8O@QHSP \H"la q  xYZ[m\m]m^m _m(`m0ac8cc@dHeLfmPgmXhm`ichjp8K]]]] ]]]!ino  e( e0v]v+ ]]] ]]]]Xcc  (00N80@lHP  ]  +X+ N+5 ggKSJr8  ] e 0 HBops! ++q+1w!}& :! :i+"O֋?{0I b | (0 8 @ ,H <P UXx`h p x 8T #d+-/6 7 9\ $; ] $< ]!$= ]"$> ]#$? ]$$@ ]%$A ]&$I ]'P](S0V\8 W +8 X@cwb[pH \P _X `\ a` b h c p d x +t+Ls I(N5 b(N+N"rrwg t(N]e+ t(N]]+i Y(NY"+   ,+}"<+1 U֋eA x(N++ӻZ +} +  "+ (N+ t Y"t 8֋e${1gd]g Mj1! "1/Y  9 ]:@Z[\]^4`R bz(d0e8f@hHjPkXmL`oohppr xsuv(yK{i}Pip bdijl+m+op(q8rHs $7Xu \vy{` x+ y+ z+ {+ |+  +( +0 [8 h \l $7p x sb sb 8 OH [X U U    q\u(t G7!pidN8!uid DD $ q +]] ]] 1 9 mg )M*j+m6,- R+WPi:0G  *GLY+H   ]v ( 0 8c@HPX`hp x!!!! I q   ^C $.3P)}* Y+ Y,]->. /+(0 09 4:(N8< @=$7D> iH? iP@XA9`BC E F9HIK i8Q|BP` idm89 +0+8[a@]D]H]L]P'X+`Iwbh ` {p 9 e ecdevw c5 w( ;0 XQ+Q+$W  99Gm]>i !pos W ] tv t9 A tG A ֋] l1l ll  Jt96 |ctO t]+h t% t t t t +t+0 +]t++++:E^ /YtA ]g tA/Y ] te t"yt Itt ]! vtt]N ]{ ] ] G M 4 R99 zMW   MG M M LM]$ jMjQ MS]t 9  mm  (t] KMt- iMP Mn M  !mt Te + E]9 H9"]M vb {"    3%9 !y I9 & qG N v   YGi + bioF} G  8? #_48 i@H,PmX` hpr  t xty* D. SQn+ooR  7G7 ("E"FG mod"G ops"H!z"I 9"J"K# <# 97/"L]arg"M i]str"N]arr"Ou "V"W]"X9 "\p max"^]"_] num"`b ops"a!z"bi!p+0(8)9+  +   ] 3%  z!Q+7 `-m.% mod/@0 H mp1rP2NXm 8567 9 ; . <B(= R0 9w G ".G B3"RGE]>f8E!modF*GfPpqirist]emtnw J J]99OTN<c+&x_fh_ ,]-  9O[`1 ijk m  w9T wG ]]+E]2E]\8 0!$"E]1E]B8E]O\cd&e2f48g !lidh ʥmcma @/r0w ops1" dev4w56(78|\@+` 8L 8 grp @H/P+X **w+h8\Iac9: `,]E NT Ze"# }'} p++J5 5b-DR+/_b-0N(0!vma1%2 }3 +4+5+ d1>? "@ #"% %+ % :%+++ }S'}]? }q'}++X +%v %+i G% %Y Y%+] #%+,]?+MN YP]R] T]" lClD lI lNlS elAlBlCC!%` Gm]/ S]-rkntkoJkp]ku#Ukw Dkx D`kz Dk{ Dk~]8k$7<kU@kaPkbpk(x-R+ i}i"ii H: $7 ei: ?(e0P @jk lenl wpmnopqrs t(+ ++@?!+8&+@@+, H 48]=]B]G mapLTb +@@]ae @m/ sbq?w] | $ wsŁ/(ņ 0Ō]4Œ 8ŗ <,lm] ltlulv4lwlxlylzl} ]ll  l6 lO l _ l  l (l 0l _ 8l @l Hl _ Pl Xl`l -hlKplxlZl sHlNl%l @l]Dl&#HWl  ]Wl] ]lhliSlj`lk+ll+ln]lo]lp] lq]$lr](ls],lt]0lu]4lv]8lw]<lx]@ly]Dlz]Hl{]Ll|]Pl}]Tl~]Xl]\l]`l]dl]hl]ll]pl]tl]xl]|l]l]l]llll]l]l]l]l]Wl ]iZPl#l%l Y@l YH2R+2,G 0: B JO  T 1(XE0]Y8br@g HnPr X{`ƀ hƇ pƌ xƒ ƙ +<G Q Pf  qg>hV ik Gl tagn o$q](t],u Y0 biow8x@#MH}XƂm`ƅmhƇmpƊxƑzƗ|Ƙ~ƛƜƟ* refƠ Ƣ+#oK elvm  i[     ]]]P!rqs00 $7%     !opsL !mapq]8 ]< ]@ ]D ]H L]P]T iX` h9pfh l l l E]l  6 ]  O ]; "_ ]T  }]+d  ] ]]  }    } " }+  ]Y]i  9-] K]& 2PU s] _"}x"} }"5t,]  get put    ( 038V@jHjP~X`hpx~2F QXR] idS]TXr Pfgwh]i2 ww"w X X X  XG 3XG]i  VXG  8 GjX[ w~Xo wXw wXG XGG]]] X$ iw 2X] Fw7  + ]]  q]] ' sgl()]*] K,]    ,]ZM/zo{| /ƫƬ(ƭm6lƶtƷ9Ƹ-4ƿ icqC i+4  seq] :@6K@Lsb@N'SX[+a ie>!fqg m is?yV ]ƂƄƆ3 Ɖ$7(Ǝkd0Ɣ Xƚ `Ơ hƣ]pƥ]tƫ xƮ(ư(Ʋ%ƹƻE]&w@@739$7AF+V qb]] 8+ !!rq" # ""  >"> "1 ! E 6 Y J r^" w i]"]   ]]"  ] >"  "+y  RRb+r+,]$dh*3]W !a !cdG m!(t(0(8Ƀ!@Ʉ!Hɘ )Pə )Xɚ )`ɛ )hɜ )pɸ #)x A) #) Q) * *  * *" ** *4 +; '+E J+N Q)Wc+X+a+g +q+yGɀɉɏ ɐ"ɕ]$ɚ](ɜ],ɢ+0ɤ+8ɷ@ɺDɿ ]@  ]A  ]C  ]D  ]E  ]F  ]G ]L! P! Xm`  :8 &') +$70,78.9@0`1p2>!3N5e6#,7",9[a:N< > @]B]D]GH+Q]R]Sm\]eghijkl]m]n]o]p+q+z ]{ ]| ]ɂ ]ɉ ]Ɍ ]ɏ ]ɒ ]ɕ ]ɘ ]ɛ ]ɞ ]ɡ ]ɣ ]ɨbɭbɲ]ɵ]ɶɹ+ ɺ+(ɻ0ɼ1Birqɽ]4+8?|@?|0i w(0?|8 P(J!K!LMsbIrcuOjpQSZ+\]_`abdeg  sdbjˆkm ]p ]u ]v ]w@- } ~+ ʀ] ʇ@- ʏ "!/! G!! !!]i!P(g(hi>lm o?0p Pr Ts $7Xt`upvrwtxvy+xz+}+ id]] lunˀmˁ]˃ ]˅iˆˇQˈQˉ9ˊˋ@-ˌGˍG revˎG ˑE- ˒E- ˓E- ˔E- ˕E-  ˖E-( ˗E-0 ˘E-8 ˚e)@ ˜,H ˠ]P$˧ ] $˭ ] $˳ ] $˹ ] $˻ ] $˼ ] $˽ ] $˾ ] $˿ ] $ ] $ ] $ ] $ ] $ ] ppr ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] $ ] ]\ ` d <h <p x a]    ? |? | aO- i  i]]Y-9,>! |(! ) ) #)!) <)!<)m()"Q)!F) e)e)j):HO*P!QRedevS|(T[aU]BidV] X] Y]!\]"^]#`]$d (e ,k]0l]4o Q8p^-<q i@r|HV)"*e)* *+*"** *!* +]* '+ + J+!}Y3%,+ c+yO+ +9h+ r+ + + + ++E],P`,8484h84 -8 @ D H !L "P$(] - *X,,]& - +a@-Ircubj lencd -J-T-E]B- -))m-X-+-+,]s[0      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgY[0W ]1 j0dev k`0 p+N e0 gۋ hۋ#r0g d000M s9 t um61 z#1 { M |mN J1 +  U1"U1ۋJ11 10#1  +N 1  1 1 p01N 1 L 1  2 S011 12 ] ]1 V2  1 {2 L N< V5 V5      e5                            ! " # $ %  /#1    #1# 2  $#12(#V2, . 0 2 L4 6 8 :e5{+t5{+N 5  1 5 p0t5N 5 L 1 5 S051 !6 ] ]1 F6  1 k6 L ;< F9 F9      U9                            ! " # $ %  /#5    #5#5  $#!6(#F6, . 0 2 L4 6 8 :U9{+d9{+1< 90{2 k69{+f 9  < 9  * D99+9netL:+99: Mj:NDODP offQ immR:,]q:E];      !"E]l<      !E]%=      !"#$%&'()*+,-./0123456789:NPη>θ ι κ λ μ ο  S5 , 0 4 8 < @ H Lg>MMw 1? ekeyK> m8?****  $ ( 01?  wZA  **  *  ( , S50 @  D  H L*P X \*` h l#?p t*x* # ' w*A*+, - 4 18A9 : 1@AA B N 7FB#A< = > ? #AD mPG'CH I J K *O*PQ R $S (T ,*X0*Y8Z @!cpu[ D\ H1`sCa b c d e N _C#'Cg h mkCl m *n1rCs t 1z D{ | m@qD#Cv w x *y#C*΂ *΃(*΄0΅ 8mΈDΉ Ί *Όw(Ώ_Eebtfΐ*ΑΒ Γ Δ Ι Κ Ξ $m0ΡE!pid΢ !fdΣ Τ Υ ebufΦΫ ά έ ή (1β Fγ δ 1ζ2Fη θ wξ[F*ο ;tF m F !cnt ***;F  ;1G!pf    1VG  ;uG#1G m0G****!cnt  $!pid (1 H  ;*H#G g0μHν |2F[FMtFFFtcxVGMuG Hm@αH#E# Fκ λ K*H1I 1*I  ;]I #H #I ;vI ;I ;I  ; I   ;!J" # ζJ0=|>M1?|?|ZA0AM]FB0sCMoCMΆ DM΍D|DMί_EMH *I]IvIII$IJ΁&K΂΃ΉmKΊ΋Ό΍ K jt jf k/1K2 3 K )#KKHr?Mr@/rA/rB/rC/rD/rE/rF/rG/rH/rI/rJ/rK/rL/rM/rN/rO/rP;rQl<!lenrRS rSS!tagrTbrU"u rV3%(rW_0!auxrYf8rZu@#uH rM cntrSrSrr rrrmMXfX/  XN  ops #bN ] <XN]NdN= | NAcnsNgNNNN0O!nsN|NA X(N \NO\S\S\SJ@\rO\rO\S<OO+J\O\O\OO/@\O0NO0O @\O#OO+ O'O+@d7tP9tP @P0 AP` D GP JO MaPP+%PfrPercurjrHv P+%P+%+@T3QIseqX =D@[d^Sa3Qdm88iCQ@@SCQ+SYQ++dآRأRؤا9ت!R0ح58خmpدmxزsbصضR عRcavgغRx ؽ>!  ؾ;( ؿeP h l 9p  R S m 5 m mYQPSR+mR+++S++ 8n5S knn!n+n;+nSns ssnUnOn n0n@ idnPn]TnmXn `nah8nbnUnnUn oYnYn Yn Yn Y n Y(n Y0nY8nY@nYHn YPn YXn `nZhn Zpn C%xn C%n C%n Ynnn!idnnGnGnWn ȍnnYnYn]S5SUU+ (nDVnEQ=nHmnJm naVnfOngUnmU(nuUPn{Uxnsns nVnnnnSV+V+ :@nAWnBEnE]nH nKercunLj *nS@@nVsnY n\]n_5nbc5VVsWR+nlXnrc5ns+@ny Hn|]Pn]T!ssnUXn`nXpnxn nYnYn(n Fn dn yn=Yn[Yn n n h mYUYWX cYUY Y =YUYm$Y [YUYcBY UoYU`Y YUtY"YUY"YUY YyUY YYYY"YYY Z>!XY"Z>!X ZP@ ['8W@@+@'H'P+X'`'h+p+x+8"W@$ min%+ low&+'+ max(+)["Z x [++++ $7 (98aX 0[l ](" =D, 0,\.l0](1, ,,],I\ ?q\ cnt@ Al \arcujd\ nr i \+\+,]!\]\ xi] $7[;8+`+h+p pC] idpD refpE < pN]pO[pQ P@pWB^pY[p\'G^p]Q^p^V^8plW@@pp@pqW@ pr[^ ps!]HB^L^r+q^++ (p^pmp atpmpI\lp^prcupj@p^tp"Z@tp"Z@^'_+_q^._+=_=_R+]rCN_S_ mv_mmmmmrD__ _i__ r _!mapr odr {vr vrF6_ ]__j: rIE`rJrKv_rL_rMS`dXrQbrSbrTtdrU drV drWd rX d(rY d0rZd8r\e@r^dHra9ePrddXrh d`ri \ehrj ueprk exrl uerm uern erq erw erxfryfrz 5fr|rfrjr jr kr9krWkrpkr k r] rk r k r&k r l  r l( rRl0 r ul8 rl@ r3%H r"lPJ` bbJbfr[d!opsrznrodrir :r Sr S r S$rm(rS0!idrS4rM8r@rSDrSHrSL!btfrQmPrR[XrS5`r9pr r Knr# r/)nr0r1r2r3r4 r5nb ododbb`d"dodtyd"dodd dodiid idodid doddbJd eodiimd 9eodtdbe \eodiim>e ueodiae eodimze ieodiSe ieodte"eodie fodf:e Sfi f"5fodiy f XfXf]fmfmf[dhfbtfbfK:f fodff:xrjr rSrS rSrSrSrS!idrS rS$rS(rS,rS0rS4rS8rS<rQm@r `tHriPr9Xrkxretr;rl<rrrrrrrrrrrrrrmr9rotr ormfrGrttrir"ytrtrtrS?r pBopsr tpr txr9rtrkr6rmrSrrtrS5rN_rir0ur5uBbtfrQmr:ur?ur&Du r. e(r/S0r0S4r5S8Bmodr6@r7SHr8 hP;tXwf"jodfj"kodSkkLj 9kXfS k WkXfm+>k pkod%\k |kodtuk kkiSkk"kkiSk kki^k lodmmk  lXfXf l >l>lHlHlClMl%l ulodB_imWl mlXfzlE`,]rm @UU@UUUr6 rQm btfrQmrrmrSbf rm btfrQmrSrS rM/ rmrmrVm 0rmrSrSrl#mmnR+g r)nr arcu!j;r)znr*mfr+$7r,; r-r.bcE]rLo     UU U U UYrioroLo okdbno"okoHr)prkr`0r.pr ir r 0r 1r i8rS@)pr5pr6r7r8r9pr:pp+ :Xrqr+!endr+r qr?r r PQq+g r8qrcujra:rqrir*rprOhrixriq;0rqr3pr i r(rrr(rrr9r <8rSߴT}߶m߷m߸m߹mߺm ߻m(߼m0߽m8߾m@߿mHmPmXm`mhmpmxmmmmmmmmmmmmmmmr(mmmS!S<S@/DSHSLSPSTc5Xc5^ ^!c5"c5#c5X$c5%g&^*S+v,w-!.S /m0^1^2S3y 6w9:;<S=S>S?/BbCbF>I 7z{w %`&5'( ) * + , X W{X {X+ ỳz{-| X} d݀+,]n      !"#$%01234@APQRSTUVWX`abchiprxyz{|}~ ,]    ,]o)*,-b;FG LH L;JK XEՃIoL?F@AB LC LD LMN X vӄw Lx Ly Lz L{ L| L } ~ ̀tD-Ճ d dD$dFT+Ņ X X X TE] E L~L- - d d  -&R'(-) X* X+ X 4 X X X L - ̀0 L2P X X X X  X XBCDE-KˆLM-N  ],D +ˆ ̉---    !L#L$L%X,]6"#23PQR,] YYYYYYYYYYY,]F "(,;()-.1569,]V-.)(+ @ҋIskb Ar (i0ݘ8Btt!/|+!{"Smm]]] RSSSSSSSSBmfsS////]`9(HsbX׋׋ !id/!cnt/S:@=w>$7?<B S!cmdE F!lpI(J0M1N2O3P S4Q S8R S<U @VHW ShX /lY /n\p]x`;a b c SdeN,]>     ,]R,]d],]册  "]P([a idsx /0 /2 /4 /6]8]<]@]D9Hsbh] opsoa S /rcuj /    o / ]] mmmmm m(m0m8m@mHmPmXm`mhmp mx m m m mm͔ :@d$7!emis !lp0 S8 < = > ?!xid /@ /B /D!oid SH!sid SL!did SP ST SX!seq\ h>!pex!arg isbdn"ix"i  7( Q0# k8+ @7H@ PG XN `U ؘh_ ph x  S]iS /] / "22""QSS<"kSV wp"""ØØȘ"ؘ{|}~ /i 9(HsbX Øti+   (    SŅT"(Q=+@d--A-- - -E}]}W}X}Y9}[}]xA!b G+xT xwi xi xi xi i i )i i  ؚ i ~B !bibDG]~T Wb ix~̉Sҋ~݀u%؜i5#hi2i }i8i=J} i?iY }`#oiN b+sbi+d nǝ  m 8u=  ST!QsppRo4UC?S"QsppR))S L_wqbDSi -i55fpiM.kU}VU}%UvU Q~U x%p   .;NU0TsQ2[u * 7rI`[ $l' %|B63@%E %̆3 ކ ։      & T3'!zA/z ;z&Yz Zz6fzU}T}yw z z UsT2Q07{+U|TvCUv;\`U}T3UvU U Qvƥ.ԥ[-    v  -\M\T> сBf " 3[  lzL ezz z z3%+B63@%E %̆3 ކ ։  w    & U~T3!zA/z ;z&Yz Zz6fzU~T~7{IU|T}U|T}WA&yXA&y*-.YI-<-*-A<-AI-yAyy y  Ut 1% = J Wс  " 3[  ljcz dexIVbGl q%IVbGl qx   .;NU0TsQ2y z z-UEU}]UuU}xUvTsQ#R0FU|Tv$U~U}UU}U}LU kU U U Q}U Q}U U U [Y v\\ ' "  Łс  " 3[  l'5B[h O \ hvu\  U@сa " 3[ lx   .;x-U|TsQ#R0FGU}T|UsT1QU x E     .;NU0TsQ2%B63@ %E %̆3 ކ ։      & UT3'!zA/z ;z&Yz Zz6fzUT% B63@%E %̆3 ކ ։  i    & T3'!zA/z ;z&Yz Zz6fzUT Ł'с  " 3[  lq&3[U @ M      vͤ ڤ\\сp " 3[  l Uсx " 3[ ljA FGS Tjc' he xsT0jv w FtUT~Q}R|FUT~Q}R|U y z zaax;U~TsQ#R0U~T~U [     v ,\L\Sx   .;сml " 3[ l t ULс{w " 3[ lj e|xyj z zCUsT1QF]U|T}xU~TsQ#R0FU|T~aaU %*B63@%E %̆3 ކ ։      & T3'!zA/z ;z&Yz Zz6fzUT[   v\сC N " 3[ l K ULsN 3с4  " 3[ l e5x`I7uVb&l q`I8Vb&l qƂ9ӂ݂%сO  " 3[ lU Ң[   :yF S `ymvz\\с65 " 3[  lA UDсH@ " 3[ ljr G  e Jxy2' z z$?UxhU}TsQ#R0U|T}U xQ   .;NU0TsQ2y z zs Łс  " 3[  lA Łс  '" 3'[ l' 7{U|UvUvUvUvUs=U U U R UsT1aS -45fpL..n __ A ͢  s ͢ 7 ͢ X+S\ -\9-].`%E %̆3 ކ ։      & =UU#T3'!zA/z ;zGYz Zz6fz=UU#TUy z zF6U|QvRRX YskIUUUT IsUsT U X+VZsp0ZfpEC i))KLopOTput Terr Tout   ͢   ͢   ͢  ( ͢ 4]Ex    .;NU0TvQ2%vB63@%E %̆3 ކ ։      & =T3'!zA/z ;zGYz Zz6fz=UQ#TQV Ł'с  " 3[  lс  && ~& Rcy  z z U|%U|7=Us7UUUsOsUsTvU U U U X+VC7)LfpO  ͢   U@O\'-%)6@' `  Ɋ  ۊ  & U}T1U}T2%0B63@%E %̆3 ކ ։      & =UU#T3'!zA/z ;zGYz Zz6fz=UU#TUyr z zFU|QvR5X YsU  Zsp/ZfpDCi))O" } ͢  .i4Ex   .;NU0TvQ2%B63@[%E %̆3 ކ ։  D    & =T3'!zA/z ;zGYz Zz6fz=UQ#TQUvU X"+S -9-.X YskI UUT I UsT U V&Zsp&.Zfp&CC'i))Lop*OTput^Terr\ToutZ , ,͢   4 4͢ [ LrtvBLtoqCSLtovDS%сF  46 Ex[    .;NU0TvQ2%_B63@p%E %̆3 ކ ։  Y    & =T3'!zA/z ;zGYz Zz6fz=UQ#TQ@ Łс  " 3[  lR<cy4V z znU|U|7UUsUvU OUsTvU X+VC7); !sppTLppLfp)O  ͢ Yy;fyry A UD5ACP сm} " 3[  l& enxс  " 3[ l|̀ ـ " 3j>~ ?GK L[ l%, Dht9P\Ƃ OӂA݂%Ƃ ӂA݂Oa\'-%)6@' `  &Ɋ  ۊ  & CU}T1U}T2%B63@?%E %̆3 ކ ։      & =UU#T3'!zA/z ;zGYz Zz6fz=UU#TUy z zF"UsT@Q0XU|TvQ R0Xsk7UqUUkIUUT IUsT U ]V[%Zsp[/Zfp[DC\i)^;_U` !sppaTLppb%cTLrjtd%)e)fS)gSLoph)iʅO"TputTerrTout Wk k͢  s s͢   ͢ [$) ex V ͢   ͢ 4uEx~   .;NU0TvQ2%!B63@S!%E %̆3 ކ ։   >͢ YyA[8fyry C8 UtOG:\'-%)6@' `  h:Ɋ  ۊ  & :U}T1U}T2%L=B63@<%E %̆3 ކ ։  a<    & =UU#T3'!zA/z ;zGYz Zz6fz=UU#TUy>F= z zFx=U|QvR4X Ys%kI=UUT I=UsT U VGZsp0ZfpEC i))))])LerrOTput%Terr#Tout!Tbad( ? ͢  K? ͢ [@Lrjt% ? ͢ с  ? U  7@   ͢  i@ ͢  @) )͢ x"\A   .;NU0TvQ2%&CB63@1C%E %̆3 ކ ։  C    & =T3'!zA/z ;zGYz Zz6fz=UQ#TQ D Łс  " 3[  lс IE " 3[  lYy Efyry4EEREcy 7F z zOFU|gFU|GFUsTvIFUsT}FUvFU OFUsTv%GUs/GU NGU mGU U  IC:Zfp)))])/O SH ͢ с H " 3[  l>I ŁyIyy yU VOC8ZerrC)+ToutO :J ͢ ^pJpaOUL\'-%)6@' `  LɊ  ۊ  & 7LUvT1UvT2LL^k%y1 AoU @QsR|%EOB63@N%E %̆3 ކ ։  N    & =UU#T3'!zA/z ;zGYz Zz6fz=UU#TUyO z zkOOUUTTU RvVeQCe2Zerre=)gO*Q QPk k͢ ykP z zkPUUk;\PUUT2k7UPUUk%PUUU RTX*Q+QV;"UC;2a)=O2U[Q)>i QA A͢ %[TB63@S%E %̆3 ކ ։  S    & =T3'!zA/z ;zGYz Zz6fz=UU#TUhyA^T z zvTUvPTU|TUv%TU|TU|7TU|$UU|U X2U+"UV!zZC!8O U' '͢ Yy%UfyryO)W\'-%)6@' `  wWɊ  ۊ  & WUvT1UvT2+XąЅkU @Qs%,^ZB63@Y%E %̆3 ކ ։  Y    & UvT3'!zA/z ;zGYz Zz6fzUsTsU &\C+))SO6\Tout [ ͢  H[ ͢ `[U|F[UvT0Q}F[UvT}Q0[Us;\[UsT3[U| \U U X6\+&\VaC9C]O \ ͢ Yy\fyryO^\'-%)6@' `  ^Ɋ  ۊ  & ^U|T1U|T2_ąЅkU @Qs%aB63@`%E %̆3 ކ ։  `    & U|T3!zA/z ;z&Yz Zz6fzUsTsU qdC*O*Q b ͢  Ab ͢  sb ͢  b ͢  b ͢ y c z z1cUv7IcUsacUvycUvcUvPcUscUvcUvcU dU 6dU UdU U VDyC/a)S))7)]) ) oids x) ) )OTy[e)i e ͢  e   ͢  f$ $͢  Kf+ +͢  }f9 9͢  f= =͢  fS S͢  gW W͢  Egw w͢  wg| |͢  g ͢ %[jB63@i%E %̆3 ކ ։  gi  & UT3!zA/z ;z&Yz Zz6fzU(T}%WlB63@kA%E A%̆3 ކA ։  kA A A& UT3!zAA/z ;z&Yz Zz6fzU(T}On\'-%)6@' 3 m'Ɋ  ۊ%  G mUT1UT2%&oB6@E ̆3 ކ ։    & %@qB6@E ̆3 ކy։    & %tB63@sA%E A%̆3 ކA ։  `sA& A( A& UT3!zA/z ;z&Yz Zz6fzU(T}܃~u' 3t YUp͈6وuUs3uUsFSuU|T}Q~FsuU|T}Q~uUFuU|T0Q~FuU|T~Q0uUsuUsvUv*vUsBvUsZvUsrvUs̞vT0QzZvU}vUsvUsFvU|T}Q1FwU|T}Q17U.wU}7FwU}^wUsvwUswU|aaFwU}aawU xU 3xU WxU R1vxU xU R~xU R~xU yU R~(yU R1U XTy+ DyH y28(new>]y(flp@2]omfs]y-U8S>G!z29ocpGz2$d9 Yz9 i79 szp=UU#TU@2{282CS99  z9 2{9 i {x  #{9 79 8h0h>0iSkk'{nipn4|nipn3Um\|a3p~'Mo ^'i z'ˇ ܇ 3  }'G X' ! )%I  Z3 ~É%hC z%5 FP\Ghyi u  & ‹UsT0'LtaaaSf-f25fpfJ;hi !sppjT 'x(fp FH (fp 3> t Ƃ(dev t@(len tL ofp vH (p &(v &S> S(p $vS  5skb .ۋS I5skb "ۋ- <-HG(valG+m(pG6i ~9II xId~>8m׃(p82 ƃ9: ׃ƃ: x: dH 2 3H h(new h32 hJH L(new L52 M2 M-79 T gp T tp T7p TQ %i- ; - G}Q|.i-|D -|P}7.]Q%]-< -7hQz0L-zC}-zX+Q.y-.?-/+Q5wq@b- -+Qޅ5wq8b-aS - 4a- >>m %2mBd>>O2>)d2>6 dH+i2+*dH2+dQC!5rCCQ1!̆5r1E-1M3%Q5i"5r1-93%!i(rC>!(rE2M3%Hˇ(i(r(203%oold> (i"(r1293%oold>]%(r<%<H{L(r{-(n{4lMQ&+|5mJdQ+5mBdH27H222K7p>j'2jForetl79o9p>Ai(newA@2B2CoretEH#2#5 p%7p&Q?щ5v?&щ5old?.3%5new?7Q5i5v+щ>%(i(v+щHAG(vAщ(iA>c(vcQ5v*щ5old23%5new;QɊ5i"5v/щQ5i"5v/щS5vщ5i!Q55v!c>iߋ(vi?щ(oldiG3%(newiP79k 9k 3%9k 9k 9k ߋ 9k  ϋ9k 79k >]w>['(i[6(v[Cщ79] HI(v7щ(i>>e(v=c4-:-- h h Ɍh ׌h h7 h h h &h7h> A!R(ptr A<> 4!p(ptr 4=> '#i2 '0H^(v^O2^Y HPۍ(vPJ2PT HB(vBI2BS H1(ptr<2H 2>,Y(p,;2,K]>((p(:2(J]!z#/z ;zGzߎ Lz&Yz Zz6fzzz~zz zyzjzz z' A%  A˄T jz4kUsT Q j{'iv66`iv*7A%}2<D ' 4>#{'"'iv663W' j)5A3' O8DP \؜U|T~Qv&M N6g6t@UsQ@A$R0X0zyszz zz(3%8B 63@%E %̆3 ކ ։      & T3!zA/z ;z&Yz Zz6fzUsTs7{VUvT|=UUTTb++7+R+cRb\bhbbbbinth,b* bos8tou8os16ou161os32@ou32os64ou64h@ "!b!+!!1h!2h!H!I!X!]!^!_!`\bb"%"&"'")","<h# O#### ##b#%#&#*+#4#=#B#]h#h@#nO#} Y# c# c# c# h# h# h# c:# ##:# #Y#####<#d#d#d#i<d\~+/### ~"D+W@/@$x$\ v+%&@&& % h% %mwwH' v' R' ' ' "'  ' (' &0' 8' !@' $H' $H' $H' H' $H' $H' $H' $H@@( ((((9cP(h(b(R(R((( (h(9Fkp( (h((h,(0( 8(@(A(B(hD( H(hP~mem(@(K(+( h((((y(( ()((0(h8(@(hH(hL(P(hX(`(hh(p( /x(h(h(&('(h(6(h(h('(( h(!'("h(%(&-*(9h(:@(?(A(D r(F (P J (Qh((T&0); `cs)=c`sl)?c`wfe)Ac)Ec `ss)Gc`sti)IcG)Kc`nmi)McG)Pc G)Sc0G)Vc8`lm)Xc9G)]c:G)dc<3) \cs)1\csx)c) 3) \ss)1\ssx)c) )g r15)m+r14)n+r13)o+r12)p+bp)q+ bx)r+(r11)u+0r10)v+8r9)w+@r8)x+Hax)y+Pcx)z+Xdx){+`si)|+hdi)}+p)+xip)+ c )+sp)+ *B{ *C1*D1G*E1 G*E1(`s*E1,`dpl*E1-`p*E'1/G*F10`avl*F14`l*F15`d*F16`g*F%17G*F+18++++++++++:+ pte+{ +" :+ pmd+ +" ,%,%% X,%/ N,' @pgd,' X,'"'N,p fpud,p X,p"MX,/@-H-I+Q8q bq0- 4-+83.e.f+.g/.h9.u/.v@.w@key.x4.U_.V  .j|key.k>.nkey.o>/;/<'/='G/? h G/@ h$G/A h(G/B h+O0k(    c+   1( *@-@0 ( 080h0h0  0<(0 h,0!h00( 40)580*hH0++P0,( X05 `06 d08 h0: l0; p0< t0=hxgse0?H@Frt0@J~dl0AJ0BJ0FMC0I:0J+0Kh0O$M0X)M0])MC0`"F@0d!0hh0kh 0l+0m 0n9M 0o>M(0p*00q X0s`0ub0x d0yLh0zp0{HM0+000 00 00 0 0L000 0E009(C0:PFmm0"h0"p0+80A c@0D cH0G+P0H+X0KEC`C0NC0TsP0WsP0ZsP0^cQ0k o40mmQ0p8 0q9(0t+80u+@Ffs0xwQH0{QP0~QX0R`0Uh0 Up0 =x0 =0 =0iA0+0 0h00V0 D0h0T<0A0 c 0 c 0n9 0$ 0L 0i:( 0( 8 0 V@ 0 H 0;VP 0VX 0V` 0DWh 0NWp 0+x 0SW 0B 0h 0 c 0 c 0 c 0< 0D 0 0X 0 0 O 0 O 0"X 0)X 0  0 X0 0 98 0 hX 0X\ 0Y` 09h 0 0Y 0 0 0 0  0!h 0"h 0# 0$+ 0& c 0' c 0( c C0)~ 03$Y 0C' 0D+ 0L)Y 0N+ 0R9Y 0SO( 0TO, 0Y+0 0] 8 0^ < 0_ @ 0` D C0a~H 0dBX 0gCY 0iJB 0lMY 0w 0x 0z+ 0} 0~RY 0 c0 c0 0 0'0 0 0 0 0+0h0%[0f[0]0^ 0h(0h,0M0~rcu0~00<@0 D0( H0;P0(^x0<0 0 "2^0 @^0J^00 0 c0 00>C0~0 0!"50$"5C0.~0<T^C0F @@k3@H 7\pad!H X +?@l - X &X )l @@@1!14sp1+es1 ds1"1$1&1+(1+01581+X1+`cr21+h1+p1+x1'51+1h1O1+1+1 G4gfpu1 3@h"!( !(2 "2 * "@@@-1"Qx@-K|@@  E"h-P#Qv-"-  5v -(-,-v0--Zv8-X-vh-%wp-+x-&u- -w-+-Y-w-+ufO3y#33O3#313133#\val3 7U#7y#3# #3,#O4$44$$+34,$4 7#4 M$ $4#4,$5 $5 5 $ 66 7$7#7$ 8-%8$888 88h8+,9%fmt9R9R9R9h9R9R$-%:6%:7_:8|/8:4&:R:R:R:R#:h#:h#:4hkey:9%(.h:=]&8:U&:Vmod:W&:XR:Y& :Z (:[ ,:\4&0vR:u':v':w':xh:yh%]&+\1'+ ;/s';1hset;3get;52;7 :61'p'V)'&'' ' '  ' (' 0'_8'!x@'" H'# P'$ X'%`'&h''p'(x')''*E'+m','-'.m'/ '0 '1 M'2'3 ?'5 '9 /'; \'>''?'@x' (*>(*mod>&>-*))==S*=> ).h3*     +*+2 ;!*2?*!++? hA+     +@@A@BK.-B@B$!B&5B: n95B<+5B=+5B>+5B@6BA@d6BB@d 6BE 86BG 6BH+6BK96BM( 6BN6BO6BQ6BT6BU6BV@d6BW( 7BX7B^+7Bd+7Be+ 7CBi@@7BtZ@7Byh`7B{+h7B}hp7Bht7B+x7B7B+=B=B\x>CB@?B$?B?B4ABA0Cc.CdRCeCg!Ci ?ClD (K.E+E+F.FcendFcDG DG pH/cwdHOswdHOtwdHOfipHO fcsHOfooHOfosHOH/HOlO/+OH*/ripH+crdpH,cOH./fipH/OfcsH0OfooH1OfosH2O 3H) 07/7/30H@,0HA,0HB,0O<0+ TH$0cwdH%1swdH&1twdH'1fopH(1 /H5OH6OH90 H<0 H>,0 0O0+O0+?HQ1cwdHROswdHSOtwdHTOfipHUO fcsHVOfooHWOfosHXOHZ/H[lH\mH]nH^ormH_pH`qHa1xHbO^$1+c1+@H:*2H; cH< cH= *2c:2+@@@HOx2-HP<0HQ1HRx2@2W+@H^2H_/RH`<0Ha0RHb:2@Hc22+@@@Hf3HhhHkhHncHqcxfdHtcHwhHzhHhHh-H2@@H3H cHhHh fpu@HB4HhH+HB4HB4H3 H30-H2@@2I o4I cIc\4+\4+? J4J J! J" J#h4c4+\4+ 5+55+5"5/ K{5KhKhKRKRKRDLDLDLM85M95M<5M=553N<5N=hN> N::6N;5 5srcNA1 dstNA 1?6"J6.hOm6:(O6O6valO OO!O O"OO#cO$6 O3O*6O+&6O,#7P7P`P @6:O'U7O(O)J6 6O.c: O17O27O3O4 O5+O6+73(O7O%m6O/7O7U78O8O+fnO 8 7 8878Q>`8Q?+Q@+QAOcpuQCOR8RcRc/(R8PctR,5R&8 `8.hS8T9T  99U )9UV D9V 3WZ9W$Wn9 D9WZ9:X 9XM$X"z9 Y)9Y*+Y+$osqY-)9 Y/(Z :Z Z Z/[I:[+[I:[I::[ i:[ I:[:[N:[I:/ \:>\ :\ I\ :\i:.h] :/@]'i;>](:]) I ]*};(]+;0],8]-9].:]/; :x;x;:i;/@@^/;^0 ^1h^2  seq^3zD^4x;^5: ^6*0^7 I8;(_?<_ <_+_ O<_O "J<J<;?<`<`` `<<:a <a<+<+a8<b<b b<c+=c,c-xdW=dW=dh`d+hmaxd+p+g=+ e=e ce ce :f =sigf<f=gRgS==gUwgV==h >h h h =:h'P>h(h):h->h.h/h0 >h1:h5>h6h7h8 >: h< ?h=h>h?h@hA:hS;?hT !'hUhV: hY_?hZ !'h[ :h^?h_+h` ha 3hJ?hLhQ hW ?h\;?hb_?: hE?hF ?:hg@hh_fdhi:hmH@hnhohph  h%@h*,>h2P>\_rth9>hB>hd?hj?hq@O0i @i i i i H@0i @ @i@judAjv<nsjw2|uidjx Djy jz݆ j{T Ai Ai!i" = i%Ai'=i(+i.=i0 = i3Asai4A k /Bk )k +lenk +k (lJBl !m$Bm%m'm( 0mDBmM#/BmP(mW)8n Cncncncncnc n#c(n,c0o)ECo*co+:Po8zCo9zCo:hHo;hLCC+/8oDC>oE~oF9oGh0/ p>)DpKpZpppppendp)D\8DW+q!SDq" hq&8DqDzDqDSDqD_DqEDqESDqED:qT DqYDqZ n9q[D:r Dvalrr D:r Evalr r E0S\E0U c0V c0W$Kh0[E00hE0iSD0j 0k\Ecpu0lh0mc0nc 0oc( 0DF0+0 0 0 0oF0+0 Oh@@0F0 c0 c0 c0 O0 O0+ 0+(0+00h8@@0H0 c0 c0 c0 c0 c 0 c(0 c00 c80 Y@0 cH0 cP0 YX0 Y`0 ch0 cp0 cx0  c0  c0  c0  c0 c0 c0 c0 c0 c0 c0 c0 c0 c@@0I0DF-0 :0! c(0" c00# c80%@0&P0'Q0(R0)S0, cX0- c`0. ch0/ cp00 Yx01 c03 c06 07I09J0;J0=+gavg0GoF@HI00KxJ0L0M+0N+0Oh 0P$0Q&0SxJ(JX0]JJ JJJh0`L-0a:0h c0i c 0j c(0k c00l c80s Y@0t cH0uhP0h0h0h0h0h0h0h0h-0:X-0:rq0,L0}J0L0JX0^LL ( 'LJrq'L0|L0h 0h 0h0hN0L00000Lb0|Ls0O0M0ML0MMM1L9M+**CMh'(v'qS0v(qS8v)S@QTXw^Uw_<w` wawb wcwe@d wh( 8wkiA@wn!Xwq`wsdwt( hwwpwxhtwzx#wh#whwhw!w!>w:w Iitw w wEC wh w  wN wcttyw wȧ w D wc w c wc wc wc wc w#E w+ w+ w+ w'+ w+  w+( w"+0 w,+8 w+@ w+H w"+P w,+X w+` w+h wBp w  wͧ wQ w w h w w w w w" w9 w0e0Rd wUwn9w<w@dwA UUVx;VxxV@yVyy y c y (y*y,y-y0@VVXzcDWzd+ze zg zk n9zm݌znD(zo!0zqf8VIW@TP{X{Z{ <p{Xx{S{{ { { {{t{{{"<{({.{/{0{9S {:S({;X0{>8C{A~@XWX |X|||XX Y+ YYY+9Y+C>YHY=bY+T@}%[Pcss}Wid}.bЉ}^@c@ } } }n9  }f( }+H }P }_X } } }W }W }WH }c }c }c }+ }  }f[( }f[0 }8}(cH}P}a`}c} Zx}Z|}7cbY/0}f[}}%[} Qwc *[d0y]yyyy y,y.y݌0y@y( Hy?PyXyo` y y+ y9 y hcbdiy  y( yh yp y  y cevy  yh yh yh y' yh yn9 y  y  y yf yfccdiy  ycbby  y$ yc y   y( (k[/h~y^~zk~|h~} mQvl~&l(~;0~+X~#m`]#^-^>7^E^O^D$DDD!D%D'D,D/n9D3D5D9D<DADDDHDLDQDUDY2 n__ _!h" rG$hH'O`(Rkey)|*O`+ ,(-0. T`8ext/Y`@2*n__3/ 8`tp9`: ;O<O_P@ThjJajKgTjLgT@jMgTjN2|jOjP DjQ EnsjRRjS+jV  j^ j_cQ j`0e jecQ@ jgfHsetjih jjG jldA jm{T jnQg@ jqT`9cO h = ccino)c dev* (+ ,uid, D0gid- E4. 8/@@0@P1@`2@p3c4c5O6O7c8c9O:O;OIc+dcccc#cdcc !c(ch c cc ddhc#@d$n9%' dUUU.hldd <D "d3dn9d+e dh(0e1+7+osq9)9;$<UUUUU+e,$-VL7 f f"fff Pf+eXqfrfs; wqvfHcpuwPf/8zf{fPrcu|~ wqf0x1g1gAg(len+HQgPpfAg++Qg+ag+T@n9@@ fH!+"+#$; %f&~  'h0 (+8ccpu*@cssp+hH+Lh+`6h7n98Ag:Ag(;+H<hP=X>\LhehfhsdagOjh$iTjhdxD?jEhF?jH I9(Jn9HK9PL+pM+xN+O+P+Q+R+S+TU+V9WN Y  \+ ]+ ^Pf _hphOj+agiD3j11:"j#@$%:'j():+k,-3!/k&j*j.j Vk fjops`k kVk[k2k4+6h7h .h~@k.h~Hk~p!l~qk~r~s&l!lO~Ol~ek~+~vl>~~~+k~l7+lxOl/@~ m~k~+~+~+ ~ (~,~ m0Prcu~~8~>mHl/k~>m~id~mMmW+~hm~mmhm(m$Y : Mnc& )0eldt*Rn8.+@99H:h;aop= xC1|D'~Mn \o+alt+++ +(08@HPX`hpx !Wn\oFmO-\o-^ -`h3-Xo\lru-Y7ro-d-e3-io-j +-k+O(-Rp o-hd-@)D(-Xu-Y0e(-\u-b+-h+-tB-w -}$S-v-+-+i-5v7uR-~4-Zv-t-tl -vgrb-:-+}uvbwc h jkq: s(tS0uq8w@{H~PX`hpxvwRuu-w-ccid-- u@@- w- N -x--+- %[@@-{Qw@-d@-+P-+X-+`-+h-+ppgd-  1"x-) -5 -?{-E+-Lh-S -Z$-]+-_-an9-p0e-r--+-+-+-+--+ -+(-+0-+8-SD@-n9D-+H-+P-'+X-3+`-+hFbrk-+p-!+x-+-+-%+-0+-{-|@-#|-fo-+h-n9p--|x-( -2|-&u-&<|-+-+-- - -Mm-+-f-F|-+-+-+- ww+|+3rm|+|(|`7|A|+Z|W+-+|---/ n9X- h|p/"} 7"}(pmd9 ;"0pud; P#8 @EHFPpteL 6"XptlP^`T shKh-} @HHHHH.h]~              |U6U9U<UG~+hBuBvBw+`"+p@BB+BBBAgB8BB7B78BMxBiBiB(FgenB)FsegB*Bdc0+++7++++M+++i+++++++HBڀseqB+BBBڀB('++++BB+seqB+B+B0BLBBBp Be+BfBhn9PBn+XBo+`Bq+hBsBpBu+Bx"B{B+B~L+++\+B&seqB(+B*)YB, B. n9Ic++ɂ+@@BtB n9BBB BBBBBBBt + @BBB B̓̓+ +݃+1BBB+/KhBN@@B7B;AgB<+ B>+(B?+0BJ8BM`BO+hBP!ÆpBQ$ȆxBVBWBXBc+B+B+B+B+B+BRB+B DBCB@B͆BxB+Bn9CB@B+B+BBB+B+BhBhBB B CB@B݆B`Æ+ɂ~݆+ ++ ++B(B(BNp BJBJZ+ BB n9BB+(BB+B+B +B +B + N@+- +@d+݃+/+//8+22++ +(0w@ Lj je8eR  (0 st u@do/ ʉ>:G/XGQO (set<0j8o@!HPʉO k7Lrcu~hˊ/>h pԋxˊ/h<PdirA/`j>ʉN:XA <t <"GDE ԋGً. 3BDEFɌG،HI.Č !h"h ČΌӌ,- n9/ y0݌OA8 3K 3:S@ً73NO+PQ (+ύ,-./  8 S 0'p8'q&u'r 's }'t 'u 'v1$ *(ύBhcǏQl5skx 5 gcb ( 6X+hlenhpht xz | (>~   >2 5end3 54%5%6h7<;>B"#&'' OBn9 k]q7/rQBO34Olen4O327r6c1Ґ 83ijk@dr/s<tqu~/RThUDVW X Y:0[?8_" ``יha+pbx>d] אm<n!Pd_uv//@x'{:'| '}'~ D' E'h 'D'D'! 'י('^/@@!wI%;@A+AQ+?8ww w! w"+w#cw#c w$+(w$+0w'w(cw)cw0w1 w2 w3 wC2wDwLZwM( wNZ28wQwR wS2wTN_+N+ç<ݧ+T)/067 >IJQ R(U0V8^@fHk P>lpn0q>oxq|rsu>vxyz{       ( 0 8 @ H P X ` h px      ݧ ( /0M@d>~ /` Prss  !08@d@ X īfn :6arg ԫ+: bīԫ O3zS#zTzUkzWEzX<qzY~/8zIqzJ?ioczKDW Q# z\h0@y?y y yyy+ yh(yh,y<0yh4y݌8yHy$Xy$Xy$Xy$XyXyn9`ydy]hypy3 xFdevy(y 0y 4y8y@y9HFidy hy+pyxyy;yfy yxyy <y!Qy"y#9y&0y(n94y)8y*PfHy-Ffqy2y3y59y69y79y= y>n90y@4FtdyD8CyF~@yK@dPyP9hyRySyU yV yW y[9y] EI: jvalS: valv<"iݰn+vN/8_I`+aIbIGc Gd Prcue~ reff0ݰ.h      : v + % f h !h 'h =h  A M :6Kh T++  n. :. 0 4 4S5h6S7|cc+mhrw3'' D' j3'ų' E' P'>'h'   ' '@'@('@8' &uHCд()<*+ ,0-9@. n9`/ d0יh1p2 x3+4: val .h6LB3E\uidF D\gidG EH D XJ)H* L L L L L  L( L0 8 @H+ h(h, L0 L8@ !&@8x9:;<= >(?0@÷8 י} > יXDqEFG HI J(K0N 8OѸ@QHS÷Pȷ >יv"> :L ̸:̸ :ָxY޹Z[c\c]c^c _c(`c0aY8cY@dHeLfcPgcXhc`iYhjp8yhhhh hhhino   a( a0h޹+ 3hhh hhhhXܻ ;(^0|8^@HP3 יi יh 6י6 YיY@ |יYc יyxp8  h 0e 0  HFops! : +*+*+4'wO'}T' hO hY"}8m''@'^'w' ' '('0' '8' A@' ZH' jP' X'`'h' p' x''=' M'f ¾¾Ǿd+@-/6 7 9a #; h #< h!#= h"#> h##? h$#@ h%#A h&#I h'Pa(S0VWa8 W +8 X@cwb[H \:P _X `\ a` b h c p d x Y&uYsE w/9CHR\aT)* U+ U,]-?.c /+(0 09 4: H? P@XA9`BCE F9HIK >QpT`idc>: +0+8d@hDhHhLhP+X+`Pwbh ` ݌p 9 0e @dcdev 4 ( ;0  X\+\-+$X':? ggRchl'' -pos' X' h &u &u)j &uRj !8!h& y_yyy  x&ugd x&u} &uh+ &u@" :&u &u '&u E&u, c&uchJ +&u++++r__ CY&ujh &ujCYh &u +e ?&u!"TT&uYxJbufJ)J J J J  J (J 0J98opJu)XJ`Jz)hJpD /&u&uh \&u&uh4 uuhza u!h : h R : N: D: 8 ) `N: = ~ : e :  N: R N:  N:  2N: : h PN Pų7 }Ni}OhaZ  ) :cc : : &uh 1N:&u DON 6 rN DT N w  ' mt' d' + :Kh' :.י"C:3 \:¾H p:a"יu י י   י!) T  /י) WיR4 kk:>\ יHu  R$+@@ARBCD E(sdF0Gd8#Ih#Jh#Kh#Lh#Mhbio Ʋ > %4G8 @QHPcX[` ehpr  t jx:?* @. O||6*BNidr݌hh .+N:3rev+.S/  RPrb:ns0h8< > /@idc` hbpPrcu~xS Vops !* h? O"h$ % & (( 02 89@: H= P@ XA '`V%3 ]\dir8]+kn&uT 9 9@`h )x    @  A %w ::g+"O:D hTT Tjm Tj"T :) x: :@" ':.hO0'(,) * +, - :6(Ow wC CRC 3Cm,CnCo&XC0C1C2 C3 C4N C5 {(C7 0C9 {8C; @C= HC?P,,  ! ?&w):#+ K+ h ! \+7`(-(.mod(/&@(0Hmp(1P(2OX8(5I(6(7 l(9 (; (<((= 0 bbg)I bgRq"&R &"&Kh(>h8(E#mod(F&-(GhP(py(q(r(s(thgmtn(w (( (h()()J#+[)y ^`hj`,";1E-%#Ujo.hENT Ze" || 3q++O5 5.DW+3_.7S(0vma1@"2 y3 +4+5+ d4>? @ "@" @"+ @" :@"+++ |S|h? |q|++X +@"v @"+ R@" @"Y Y@"+' @"+.h9@/0ops1"dev456(7899ÅgetÆ'putÇ 7È KÉiË K Í}(Î 0Ð8Õ@ØHÙPÚ XÜ"`ß;hámpæ"xé ë'ìîïð@@pHRPXbusk`/h p x9g- Fmsi(8@cHcPX `hx 4 FidOn9 G!!+# $&%0'#5)=+ `, a- b. c/ d9 e< fQRhidShTPfghhi1 '"7, K< ddP }n R Rh R& R  " ;R' hRRhhh@ r  h   2 + hh  mhh'gsgl(g)h*h .h/MN UPhRh Th\+/(6+++++ /0lPrcu1~2d3l{W+ HIJK LM+NK| 6/(n9get cput c ")). %c& '(d:;<h  !"# $(%0&8'@(H)P*X+`,h-p.x/012345 "KU:KhljHxy n9zh|h}9~0ȁ@@8ȗȘș  Ț !ț "Ȝ #ȝ $Ȟ %ȟ &Ƞ 'ȡ (Ȣ )ȣOȤn9 ȦȧN Ȩ'@ȩ @Ȫ Aȫ BȬ Cȭ DȮ E-ȳ:Pȴcȵfȶ@dȷ1ȸ ȹ ȺhȻ ȼ Ƚ Ⱦ ȿ            h:  cccc6  K(FqosU0+',Rid-./n9 01(1;02+X3 I`4 Ih5 Ip6 Ix7 I8+9+:+;+<+dev=#> #? ,j"K@;Pops   " hM NRORP!+Q!+R!+ T/(UH0V8W @X HY P[X\`^ah_paxcd pmffh ##*`*aRbusbkd&eRg h$j(k 0m8n @oHp PqaXr`s!+ht!+ppmvfxw py*( Hd4 aM `23R5!+6!+8H9 7 ; L(< 0>8@(D@A`HC zPpmEfXp )2d2"GG< `dQ"zde0XYRZ!+[H\ Z^  pm`f(.h- %( )Zd2< ijk m  )_ RĺĿhh+Kh=Khg8 0!"Kh1KhBCKhOgcd&e2f4Cg lidh Z{ccma !+gDS"^^ yCyD NyI ^yNrySrheyAyByCH %` ch3G hGLV`pxn:xoxphxu#xw xx `xz x{ x~h8xn9<xV@xfPxfpx<xoNW+Z nyz"H n9 +e (@d0Nn@jklenlwpmnopqrs t(++/@!+>&+@@+$H 4a8h=hBhG mapLaT!/@@]a@d@msbqwh | $wsЁ(І 0Ќh4В 8З <f.ym#ytyuyvywyxyyyzy} hy y yyy %yH yH(ya0y %8y@yHy %Py Xy`y hypy&xy y 9     Hy yy @yhDy& H Xy  hXy] hyh yi yj& yk+yl+ynhyohyph yqh$yrh(ysh,yth0yuh4yvh8ywh<yxh@yyhDyzhHy{hLy|hPy}hTy~hXyh\yh`yhdyhhyhlyhpyhtyhxyh|yhyhyhyyyyhyhyhyhy#Xy    h Py yy U@y UH  W+ , 0t: B JO  T (X0]8b@g (HnFPr [X{~`р hч (pь xђ љ   Tfqg?hivk ltagn o$qh(th,u U0biow8x@ HXтc`хchчcpъxёzї|ј~ћ[ќџrefѠ Ѣ+ Q7elvYc !xhhhPrqs n9}opsmaph8 h< h@ hD hH LhPhT X'`xh9phyyyKhyS !h ]"%] Hh+* ha]hM zzf "+ ]Uh  )]2 ]Y$ 9]8%"N>"^S rc"!w.h .hZ3z{|3ѫ7Ѭ<ѭ5kѶYqѷ:Ѹ:ѿ}icqD }+:seqh@@6vQ@LPf@N*SX[+a e?fqgm syhтфц щn9(юc0є Xњx`Ѡxhѣhpѥhtѫ xѮ<Ѱ<Ѳѹ ѻ {Kh&u@@79n9AF+!hh '+x!Vrq"#, ovoV["vy" ?"?"   v!"( Fvh-"[vhK ~hh`"h ?""T.h."(0@KK[+k+.h,     .h`2H H H H H H H H H  .h & / aPrcu b~len c dT( g! h% i? l m  o0 p P r T s n9X t` up vr wt xv y+x z+ }+id h hlun c h h   \ \ 9  % R Rrev R & & & & &  &( &0 &8 F'@ 2H hP# h # h # h # h # h # h # h # h # h # h # h # h # h # h ppr h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h # h h\ ` d <h <p x f h        C C  f P'       h h Z'  9 > (  K|(@8 % & ' )  +n90 ,^8 .9@ 0` 1p 2(  3O 5@d 6#/ 7"/ 9d :N < >  @h Bh Dh G H+ Qh Rh Sc \h e g h i j k lh mh nh oh p+ q+ z h { h | h  h  h  h  h  h  h  h  h  h  h  h f f h h  +  +( 0 1Firq h4 .8C @C 0   ( 0C K|8!@H OF' P' Q Rgdev S( Td UhFid Vh  Xh  Yh! \h" ^h# `h$ d ( e , kh0 lh4 o \8 p_'< q @ rK|H&K'U'Kh B' ' 2 h. D'T( J`) K' L MPfPrcu O~p Q S Z+ \ ] _ ` a b' d el g`)sdb j' kp) m h p h u h v h w% } ~+ h %  p)+'4!u.h $)dh *, 3h W , a - c& dR  m!-( t?-0 ?-8 ,@ ,H S-P S-X S-` S-h S-p g-x - g- - -  -  -  - " - * - 4 . ; (. E K. N - Wd. X. a. g . q. yR     " h$ h( h, +0 +8 @ D  h@   hA   hC   hD   hE   hF   hG  hL !+P !+X c`) ,%,'," -%1, R!-%- ?-'h&- S-,D- g-'X- -'-3 l-"-'- -F'-"-F'- -%+-"-%- -'- .%h. (.. K.'U!-. d.T%P. .%)i. ).,. .,. .%.Kh /,T`/>Z0>Z0h>Z0 08 @ D H !L "P#(h - -X //+/`20>208grp 0@70HU0P+Xp P0P0/<0/h80Pac9/: 0` 0%%%c0T0+0+Ǐ.hsU3      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgD!+U3f3j3k U3lenlhmh Xnp343 I 3 3H 4I e4X24Y3Z 3p@O4PQRSTVW= 4\h]Ob  ch$g (j 403 5+Xh4j?5devkk3p+Sel5g=h= 5id57?5Rs:tu54z5{ I|cS5+ 5"5=54+675+SR64o6l7+6S6<46O7o646hh464"7<S<99 :     !"#$%1 R6  6 6 $ 6( 6,.02<468: :v+:v+SB:4_:l7:S:<4:O7_:4:hh4:4;<N<===     !"#$%1 B:  : : $ :( :,.02<468:=v+ >v+4<(>7"7;7>v+h> <> -)D7>>+>netW>+>5>M?NGOGP offQimmR>.hqE?Kh5@      !"KhA      !Kh%B      !"#$%&'()*+,-./0123456789:SPڷrCڸ ڹ ں ڻ ڼ ڿ  o4 , 0 4 8 < @ H LiCRRu C gkeyQrC l8WD----  $ ( 04|D  uF  --  -  ( , o40 @  D  H L-P X \-` h l WDp t-x- # ' u*FF-+, - 4 48kF9 : 4@FA B S 7F FF< = > ?  kFD lPGGH I J K -O-PQ R $S (T ,-X0-Y8Z @cpu[ D\ H4`Ha b c d e S _GH Gg h lk}Hl m -n4rHs t 4zH{ | l@qRI }Hv w x -y H-ڂ -ڃ(-ڄ0څ 8lڈIډ ڊ -ڌu(ڏJgbtfڐ-ڑڒ ړ ڔ ڙ ښ ڞ $l0ڡJpidڢ fdڣ ڤ ڥ gbufڦګ ڬ ڭ ڮ (4ڲJڳ ڴ 4ڶJڷ ڸ uھK-ڿ NK l oK cnt ---NK  NKpf    4K  NL K l0L----cnt  $pid (4L  NL L i0ڼLMڽ xJKRKoKKtcxKRLLl@ڱM J Jں ڻ QL4M 4M  NN M  M NN N5N N\N  N N   N!N" # ڶO7BxCRCx|DxF7FR]F7HRoGHRچHRڍRIxIRگJRLM MNN5N\N$NNځOڂڃډPڊڋڌڍ QPjtjfk31sP2 3  P ) QPsPH?6R@1A1B1C1D1E1F1G1H1I1J1K1L1M1N1O1P5@QAlenRO SOtagT[U"z V!(Wd0auxYPk8Zz@ zHRcntOO r6RUfU/ S  ops # S h <SSdSSę 2| dAcnsRSXSbSlS0SnsR2|dA X(vS jSjOjOjOO@jTjTjO<S*T+OjNTjNTjNTS3@jgT7S7*T@j{T STT+ T+T+UhT+@d79U99U @zU0 AU` D GIU J MfIUIU+%NUhzUgrcu~{!U+%U+%/@TUPseqX SD@[T^OaUdc8>iV@@OV+OV++d墀WW9!W048cpcxPfW WcavgWx (  ;( @dP h l 9p  W O c 4 c cVUOW+cW+++W++8{Wkn{{+{;/{X{Sss{Z{{ {0{@id{P{hT{cX{ `{fh>{f{Z{{Z{ 4^{H^{ X^{ X^{ X^ { X^({ m^0{^8{^@{^H{ ^P{ ^X{ r`{^h{ ^p{ !x{ !{ !{ X^{{{id{{R{R{`\{ {{]{]{hXWZZ+ ({DZ{Eg={Hc{Jc {aG[{fT{gZ{mZ({uZP{{Zx{S{S {[{{{{W[+[+ @@{A`\{B3{Eh{H {Kgrcu{L~ -{S֞@@{VS{Y {\h{_4{b4[ZSy\W+{l]{r4{s+@{y H{|hP{hTss{ZX{`{]p{?x{ O{]{]{h{ { { {^{ ^{ { {$V c]Z]y\] Y]Z]] ^Z]c] ^Z]Y^ Z4^Z%^ H^Z9^"X^ZM^"m^Z]^ ^TZr^ ^^^^"^^^ ^( X^"^( X^T@ _+>@@+@+H+P+X+`+h+p+x+>"@$min%+low&+'+max(+)_^x ]`++++ n9 (98fX0`rm h(" SD,0,`.rm0h(1$,.h,a?6acnt@ Ak Wafrcu~danri aYa+.h!aaax.b n9]`;8+`+h+p}CUbid}Dref}E <}N}b}O%[}Q T@}Wc}Y%[}\' c}]c}^c>}l@@}p@}q@ }r c }s!UbHccś+6c++(}wc}c}at}c}ak}c}rcu}~@}cq}^@q}^@c+c+c6cc+ddW+}bCdd c;dcccccDGdLd `d`ded  dmap 4i A{ h{F:6d hdd? I eJu)K;dLdMOddXQWgSpgT9iU NiV ^iW|i X ^i(Y i0Zi8\i@^iHaiPdiXh i`i !jhj :jpk Xjxl :jm :jn vjq jw jxjyjz j|7ko o oop5p Sp  {p  p &p  p   p( q0  :q8 Nq@ !H "SqPe kgkgN\gh iops?s4i E? O O  O$c(O0idO4R8@ODOHOLbtfrPf[Xo4`9p  Qr# /r01234 5Dsug 4i4ikgug%i"Ni4i&u>i"^i4iSi |i4ici i4ii i4iikgOi i4ici i4i&uikgi !j4icj :j4i&j Xj4ic?j vj4iO]j j4i&u{j"j4ij j4ij>j Ojj"j4iTj kk"k2k2k i-kbtf'kPj Pk4iPkUk@xo OO OOOOidO O$O(O,O0O4O8O<r@ &yHP9Xox+y5@Ac95y ]t2kR:y"?yIySyOC ^uFops Xyp ]yx9byocOgyo4dyyFbtfrzz& z . +e(/O00O45O8Fmod6&@7OH8 PyXzW+4\z7z7Mzzz4zzczz+z {o zz{W+Kh A{N h{ S ?N { {pid O >.h *{.h :6|   .h N| T d} 6| 6| c c O O {  4$ h %p hx O|  Pdev  f } c c O O $~dn &c 'c (c )c *c li -c( .c0 /c8 0c@ 1cH 2cP 3cX 4c` 5chcn 8cp 9cx :c ;c <c =c@ a* cO dO gO h} kc lc mO nO o{ pO qO t wh xO y z~dev { |Pf }fH ~Pfh f f ?  c c c c c  c( c0 c8 c@ cH cP cX c` ch cp cx c c c c c c c c c c c c c c c~| %^&.'( ) * +ī , T _` Ta Tb zՂ{K| <} ~    T T T?0.hz 0 < < T 0  WX T+yPz{0| T} `.h      !"#$%01234@APQRSTUVWX`abchiprxyz{|}~0.h}   .h)*,-b}0 < <0  0  T T4ī T T T < 0 /0 <2{ T T T T  T T%000    !<#<$<%T.h6"#23PQR.h% "(gKh .;()-.1569.hV-.)(/@/PskbAB(DċEFGdHOI1JKL M!Ni"p% (08Ftt!1y+!*"Occhhh }OOOOOOOOFmfsO1111h9(HPfXċ ގid1cnt1O@@=d>n9?<B OcmdE,FlpI(J0M1N2O3P O4Q O8R O<U @VHW OhX 1lY 1n\p]x`;a b c OdeNy+.h>     .hR.hdZ.h񆉑 "ZT(didsd} 10 12 14 16h8h<h@hD9HPfhZopslf O 1rcu~ 1   l 1 hhccccc c(c0c8c@cHcPcXc`chcp cx c c c cckؔfspldmOn @@on9emt~ lp0 O8 < = > ?xid 1@ 1B 1Doid OHsid OLdid OP OT OXseq\ h( p@dxarg Pfoy""(  B( \0# v8+ @7H@ PG XN `U h_ ph x  OhO 1gh (1"==-"\OOG"vOa d{"""ΘΘӘ"{|}~ 1 9(HPfX Θq+\ę+@d"A  Eh! 8>?@n9AB+ C+(D0  \       8 a 2fya 8ya ?yaӛOYO]Ny]54y Ha PnRhn Y@ a  'Y=ǜhaޜYE Re$]k+O+a \6,YG M]`#c]5#8W8UY;:ѝ=0] J<+a+o] O#O]zORg66]OhahގaggYv OYtɞɞsd<] J<]n]ma6aMa]9yRY<]RY3 c.8Ɵ"Y=ݟlImޜUsT Q n0{noUs+n2ĬnnUs+l4 lΞU+n6VnoUs+n<nnUsĭU} TsܭUUvT LMT~R1aAU aU +tiiLUUv`׮U|T _UsaU aU c:+*0ϯ$0#,1fsp2d 31si41rc5 6+ 7{X D+ D+Jfsp,d(si!,!!+f)˰(_ep }  % a aU  % a ){(_ep -  _% a aU  % a )+(_ep ݱ  % a aU  ]% a )۲(_ep   % a aU  % a )(_ep =  o% a aU  % a );(_ep   % a aU  m% a )(_ep   ϴ% a aU  % a )(_ep M  % a aU  ͵% a )K(_ep   /% a aU  }% a )(_ep     ߶ %  a aU  - %  a )(_ep ]  % a aU  ݷ% a )[(_ep   ?% a aU  % a   + +YY% Yhhh+nTn]v Tjv,wvv9#w4w @wMUs,vvv[vCn"Qn^nnUvT}W W) W W WjX+n i>nZ\Xe^aXznXHZX ^XzXPCnֻQn^nnT|L o%U Q +nVnnUsllΞUs+n ݼnoUs oUvC U|s_&UUaEU adU aU aU aU aU aU aU a=U a\U a{U aU c+ ؔAeA'%eA@,!C!D(fspEd!F(rcGoutfrɿ!D2iDiIi i)CUv ]% ]a  1 } u } V }c } }c  }  }c }1 }c  }  }c }O }c)L!} - }c }c }c _ ~  ~  ~c ~ ~c  ~  ~c ~1 ~c + ~  ~c ~O ~c)~ ~ T ~c%!~c ~c      c  c    c 1 c ]  > c O c)!  c c c      c  c G  ( c 1 c   l c O c)   c%!c c   5   c  c y  Z c 1 c    c O c) !  c c chC5hiDuiIi ieI e% fZ+hu i 2%   <     &<3 44qtBGqTqaqnq{qqnnUsV_UQ)j+,],=]9nnoUsM__'mm2mmm'mmnm% n9o  op,xp  pp0p  ppEp pT1T2,nnnUs+]*]9nnnUs_UsZ'ZZLM7UsURJseqR'JfpR=JargRG(fspTd(fhU3outqno+sWxs,]a=]MnnoUsM__'mm2mmm'mmnm% n9o  op,xp  pp0p  ppEp pT1T2,nnnUsej.e<9eS :eIFe Ge,Ve ge+]p]9nnnUs_Ussere'gg2gghVU0TTQ2MU|rUsTv? $*&fspDd&idh&lun"h1rct\  |?% ?a G% Ga HJt2J<(fspd!)!!,] =]9nnoUvM_i_'mm2mmm'mmnm% n9o  :op,xp  pp0p  ppEp pQT1T2'nnVnUU]T-oT% |T T0l lL\\]'\ \;]ѝUs])]9nnnUvV_UUTvQ ? . &fsp0d1rc +t  1_ep  % a  % a  m1_ep > % a  % a  1_ep  % a  %% a  y1_ep J % a  % a  1_ep  % a % a A j &fsp-d&fpC { }e-JfspGde(fp(seq!!len (rcn); !!!!!) !     "   04qGqTqaqnq{qq2dde% e,e.e,Ve  ge,]=]Mn  noUsM__'mm2mmm'mmnm% n9o  Hop,xp  pp0p  ppEp peU}T1U}T2'nnnUsTTT% T+e fee eU 0T8 TT)^TZU  U4VUv%U Q ccccc dd%d% 2de+.e<9e :eIFe Ge,Ve ge2?dLdWdcdod{dddee;e2ee;e__'mm2mmm'mmnm% n9o  op,xp  pp0p  ppEp pU}T1U}T2+]n]9nYnnUs_Us]ToT% |T T0l lL\i\]'\ \;]ѝUsUvQ|R XsY0?i $i-&fspiGd1sik l+1rcm  t t t t t t wt  t t t t  v+ v+ {+ {+\!0e\.VT Q R9>UA# $#6&id#Jh&lun$h$$1si&1fsp'd (, )+{,  ++ ++  -  N+ N+ -A 7&fsp3d$<|]Jfsp7d!(seq(ep!Ofm)2(_ep   % a aU  d% a )!(csp   TTT% TeKee% eU00T7 TT)^TZU  U4VU~%U Q c cccc dd%d% 2de .e<9e :eIFe Ge,Ve ge2?dLdWdcdod{dddee;e2ee;e6UvU|T}M(UvsϯAUUaU cm+]P$JfspP,dJfpPB(fhR3!S$!T$!U$!VO!WO!XO!YO!Znerrf)!!!!!  ?    a  04q GqTqaqnq{qq)S (_ep    7 % a VaU  % a )!(_ep   % a aU  5!% a )!(_ep e!  !% a aU  !% a )l"(_ep "  G"% a aU Y| "% a +Y3h"Y Y+h # i]T#oT% |T T0l lL\$\]'\ \;]ѝUss7)$UUsE$UU#aj$U Ya$U a$U YVaU Ղ |.KJseq(Jfp>JargH(fspd!(fh 3(dd .K! (rc foutGnE)@&(_ep %  $&% a aU  r&% a )&(_ep$ & $ &$% $a aU Y} +'$% $a )c'!-%!-)'!/%!/)'!;%!;) (!?%!?)((_epC ;( C m(C% Ca aU Y} (C% Ca +s(se).e<9eS) :eIFe Ge,Ve geseH,*e'gg2gghs*U0Q2LՑ,],=]Mn*noUsM_h,_'mm2mmm'mmnm% n9o  9,op,xp  pp0p  ppEp pP,T1T2,nnnUs. 0< I % U jb ,]/=]9nq-noUsM_I/_'mm2mmm'mmnm% n9o  /op,xp  pp0p  ppEp p1/T1T2'nnVnUQ] 0]9n/nnUsV_UQ+Z-l0ZZLM7Us7Us+]F1]9n0nnUs_Us3K2AKNK% ZK gK tKe1.e<9e1 :eIFe Ge'Ve ge+d B2de e2\\2Us7Us)P<77PDP)7 PP \P iP^uPzPzP P P P PzP PjPjQe3.eI9e :eIFe Ged4de% eZR =4 RZ:S{4 ?SIS Si 4+i+8i  4Ii+Y4,5Y YU~d 5de% e,e.e,Ve  ge'l% 3l[?l'Jl[l+8iCYIi+iCY+iTv A* -Z&fsp*1d$*: \Jfsp1d(rcf\)Z(_ep  Z   Z %  a aU  %[ %  a  8[  |[  ][ c  c [  [ c 1 c \  [ c O c)S\! 4\ c c c\\\\Us7UshT0c\+\B \*fsp2dB ]*fsp1d6D+B,]*fsp9d=J]*fsp6d E_seq/fsp:'__Mm]_/m2;mE MmXm2fm3 xmmm% m+o  =_oo0Op  aplp0p  ppEp pVUT#T3,_  _E_ _y6B _*fsp0dB `*fsp3dmsidc=gfpJysifspd)`U TT)a,rrrr -a5 ma5 Pa5c55c a5 a5c515c a5 a5c5O5c)2bU b5c5c5c9!n+c.n8n,p} p*p,pDpp0qq)qMw}cw[w[wUsT0Q0R0X0=0cc*cmd0<,A ?d&fp 4$ E%&did  O&sid O$ )$ O$O1fh3Bd*fh=36%*did O*sidO6+6 O6O55=d*fp=dmcpY$/=e*fpAd*lenmpp=3Ve*fpDd55=3se*fpFdBe*fp3=t e*devt@*lentLmfpvBe*pY$*v&O? f$ * A' ^f&skb' 7=&i' @$( &off( "$( +A f&skb 9=&i B$ U3&off $ &A g&skb ;=&i D$ U3&off $ (  A bg$ Ibg&i $ U3&off $   gg243A g$ :gg$ U3&off "$ ?%g&skbD0Ag&skb.=Ah&skb"=$<0A~=h$~2gg$~Eh=eU3[h6e6=Nh6N6U35P5P=Fh6F7a3? h$ 2%A Xh&cmd X4,$ X>\= hi*cmd 7,= #g8i*cmd A,= hVi*cmd 8,= ti*cmd 5,? @hi$ @8'? w#F'i$ wC' y Bi60=i6.=j*sg8g?8j$:8j?]j$E8jAyj$*Aj$,YBj60YBj6.? %j$ ;$ Gy? |.2k$ |D$ |Py h? %hjk$ <$ 8 ? z0fk$ zCy$ zX+? Uk$ U!R$ U4h$ UGh$ V$ V":6 X =&+Jl6H8j5+}=+8jl6S8j yl55+}=l65J<?&+l&mJo?+l&mBoBTm*xT7OW$ ?C!;m&rCCɞ?1!fm&r1Eɞ$1M!?m&i"&r1ɞ$9!1oldAm&r-ɞBm*r/ɞ67!B!n*i*r(ɞ60!moldB{Cn*r{-ɞ*n{4An$@^$T+ + +An$8^Abn$b6^?D(f^n$DC^Y+nf^+Y( of^] +of^Y1of^=\Oomc^ BMo*valM55O o5O5OO5OAo&vo?o&i&v+o=p*i*v+oBA5p*vAo*iAAOp&vo?xp&i"&v/o?p&i"&v/oAp&vo&i!=[p*i[6*v[Co5] B3q*v37oB4q*v7o*i>#r$#:$$$%$&$'$(" q8U q8U q8U q8U q8U 2r q8U_ r8U_ r8U_ %r8U_8U_ Ar8W Pr8W _r8W nr8W }r8W r8W_ r8W_ r8W_ r8W_8W_s$:$$ s8 $s8 3s8 Bs8 Qs8 bs8_ rs8_ s8_ s8_8_=A!s*ptrA<=4!s*ptr4==t*nr+6;t=B^.t*v^O.t6^YBPWt*vPJ.t6PTBB{t*vBI.t6BS=t*nr+6?t=t*nr46Vt5=u*nr46Vt=Mu*nr+6@tmpZ_5+mval+=,,( u51 ( }u51  u51  u51 1 u51 O51 c="u*key"Ju6"Z(>u?s+v$s6+v8u ?j]v$j8+v$jV+vBwv6/Bv67Bv626K}Bv*new46KB#w*new166}=jgw6jFmretl5o5p=Aw*newA@6B6CmretEB#w6#5 w}%}&B x*ptr<.t6H6=,5x*p,;.t6,Kh=(]x*p(:.t6(Jh_>z_Mm/z/m2;mE MmXm2fm3 xmmm% m+o  zoo0Op  aplp0p  ppEp pVUU#T3,_  _E_ _V6UU?R^_^l^y ^ ?0R% _ l y  ^j+n D{n_Lx}_'mm2mmm'mmnm% n9o  =}op,xp  pp0p  ppEp pZ}U}T1U}T2+Cn M}Qn^nnUsT|,]Oa=]9nD~noUvM_(_'mm2mmm'mmnm% n9o  op,xp  pp0p  ppEp p U}T1U}T2'nnnUvHUZ) g s+l+lImޜUvT Q nWnnUvnnoUv<%ʁ *aU < aU ZB aU <x aU Z aU -Z҂UvUsT 7Uva%U aDU acU aU aU +]V/]9nnnUv_UvCnHyQn^nnT| oUs_UvUv0KWd q }  j>n +vn< < ti/Յi_5_'mm2mmm'mmnm% n9o  op,xp  pp0p  ppEp pT1T2+Cn 6Qn^nnU}+n8MnoU+nKnnUCnUوQn^nynnDnnUFQ;)LMnHnoU oU}_U o։U}ϯU8YFS` m z     j< ZZZMU|V7UUTQ;TT% Te;ee% eU@0T; T;T)&^TZU U4VU~%U Q +dde e,e.e,Ve  geZr 0rrrrcMcccc dd%d% 2de.e<9eO :eIFeGe ,Ve ge2?dLdWdcdod{ddde e;e2ee;e]TԏoT% |T T0l lL_`_'mm2mmm'mmnm% nMo  Nop'xp  pp2p ppIp pyUT@Q R XsYKՑY YqL6. .J .[J6T6`x6666rint`,6*6@s8l@u8@s16@u16#@s322@u32@s64@u64e` x6.1`2`HIX]^_`T66 % ' ) , <`  A i    #6 % & *. 4 = B ]` h2 nA } K U U U ` `   q  K        ,  , , 1, TF . n n ~F~nsstu.W2GvH  J  ^ "m    7(   0  8  @   H   H  H H  H  H   H   H!@      P h w J J     ` 6$kp   `( `, 0  8 @ A B `D  H PLmem @ ` .  `       "  ( 0 `8 @ `H `L 'P `X ,` `h 1p 9 x ` `   ; ` J ` ` )  ` !) "` % &) 9` :T ? A D  F  P ^  Q`( T 0(    (   # # 7 4val     K   ,7 ({ {   .  W    K  SS   K  s   `., fmtJJJ`JJ$e f.g9 hC u9 v2w2 keyx > Ui V  j keykH n keyoH w6 7i 8 8A JJJJ``4` key9 (`=j  8U V modW XJY Z ([ ,\A 0J uvw$x`y` j .` TC . /1` set3/ get5H7 3CD h     ,  O  r   (  0 8 !@ " H # P $ X %7` &Ph 'ip (Px ) * + , - . / ' 0 O 1  2 3  5  9  ;  > ?6 @T !% + -/ @ x TH.     3  ;i5cs=U5sl?U5wfeAU E5ssGU5stiIU%KU5nmiMU%PU %SU0%VU85lmXU9%]U:%dU<.4cs#4csxU3[4ss#4ssxUi ga r15m. r14n. r13o. r12p. bpq. bxr.( r11u.0 r10v.8 r9w.@ r8x.H axy.P cxz.X dx{.` si|.h di}.p.x ip.. sp.. BC#D#%E# %E#(5sE#,5dplE#-5pE'#/%F#05avlF#45lF#55dF#65gF%#7%F+#8..... l pte"U  pmd%"x%%%I1%/'' pgd'=1'"'p pudp11p"1#@HeI.)k:k0 4.8 ;<=%? ` %@ `$%A `(%B `+!-@ % 5 ` `    9( `, !`0 ( 4 )a38 *`H +.P ,%X 5 ` 6 d 8 h : l ; p < t =`x7se ?E@$rt @GLdl AG BG F"J" I!7 J. K` O,J X1J ]1J" `"D@ d h` k`  l. m  nAJ  oFJ( pT)0 q X s` ub x d yIh zp {PJ .             I     C  6(" !7P$mm  'h  'p DKx         . `  `,  `,  `,  `-  `-  `-  `-  `-  `-  `-  `-  `-  ` -  ` -  ` -  ` - "` - . :5$pid     . % %   %( 0 @ KP KX  "L %& (& +  - U . U 3 U 4.B 6B : ( =.0 >.8 A U@ D UH G.P H.X KP@`" N@ TzM WzM ZzM ^iN k !2 msN p5  q6( t.8 u.@$fs x}NH {NP ~NX O` Rh  Rp  :x  :  : t> .   ` n S  A ` a9 >  U   U  {6     I  v7(  %8  S@   H  ASP  SX  S`  JTh  TTp  .x  YT  ?  `   U   U   U  9  A    U     A   A  "U  )U    U0  68  `X  V\  V`  6h     V          !`  "`  #  $.  & U  ' U  ( U " )F  3*V  C)  D.  L/V  N.  R?V  SA(  TA,  Y.0  ] 8  ^ <  _ @  ` D " aFH  d?X  gIV  iU?  lSV  w  x  z.  }  ~XV   U  U     )       . ` )X jX Z "[  `( `, J0Lrcu F0 9@  D %H  9P ,[x 9   "6[ C[ M[     U    >" F   !"3 $"3" .F <W[" F%@@ % .?!@@!&!2sp!.es! ds!"!$!&!.(!.0!28!.X!.`cr2!.h!.p!.x!2!.!`!A!.!.! 17fpu! 1@&%& ("  '" D)'!@@8')q@Kw@lL'8W()o '  p (,Yp02p8Xcph%\qp.xn aq) Vfqo # (# # ([ $ ($!2 key$"2$?($A.$B)$C) %)%) mod% %)(( $=D)$>( .T) ." ;&T)"?q) &) .& )!@A@',' @'$1!'&5': {65'<.5'=.5'>.5'@6'Aw_6'Bw_ 6'EA86'G 6'H.6'K66'M%6'N6'OP6'Q6'T6'UP6'Vw_6'W%7'X7'^.7'd.7'e. 7"'i@@7't@7'y``7'{.h7'}`p7'`t7'.x7'7'.='8='x>"'@?'$Q?'V?'kA'˅A 0(cp,(dJ(eT(gr(i (l (, ),)U end)U#* #*  p+:- cwd+A swd+A twd+A fip+A fcs+A foo+A fos+A+:-+Al AJ- .(+*n- rip++U rdp+,U(+.- fip+/A fcs+0A foo+1A fos+2A +)-J-n-0+@-+A-+B- A- . /+$. cwd+%# swd+&# twd+'# fop+(#-+5A+6A+9. +<.+>-Y- A. . A. .? +Q/ cwd+RA swd+SA twd+TA fip+UA fcs+VA foo+WA fos+XA+Z:-+[l+\m+]n+^o rm+_p+`q+a/x+bAa( / . U/ .@+:/+; U+< U+= / U/ .!@@+O-0+P-+Q/+R-0@ <00.x@+^0+_,,+`-+a.,+b/@+c0 0T.!@@+fG1+h`+k`+nU+qUxfd+tU+w`+z`+`+`+<0@@+1+ U+`+` yfpu@+1+`+.+1+1+G1 +G10+0@@0 , !2, U,U T12 . TA2 .? -2- -! -" ֋-#A2 U2 . T2T. a2 . 22 .2 2#.#.#. /83/9:3 /<:3/=:330<a30=`0>  0:30;3?3 src0A# dst0A #33`13(1'41'4 val1 A1!A 1"A1#U1$'4 A1*N41+&N41,#{4 2{42]2 2S41'41(1)3,41.U 1151251314 15.16. 5(1:51%31/4174 81g51. fn1 {5 5v5v5:5g5 3>53?.3@.3AA cpu3CA`45 565 6 6 6 666 7 Q67 8g68 8{6Q68g69 69 9"6 :)6:*):+  osq:-66 :/ (; !7; ; ;<V7<.<V7<V7!7 < v7< V7 <7<[7<V7 =7 = !7= ) = 7=v7`> 7@>'v8 >(7>) ) >*8(>+90>,8>-9>.:>/;7887v8@@?/9?0H?1`?2  seq?3A?48?57 ?6R0?7 )88 (@L9@ @.@ \9@A W9W9 9L9 A9AA A9 9B 9B9 .9 .B89 C9C C9 D+":D,D- xEd:Ed:E``E.h maxE.p .t: . F:F UF UFG : sigG9G:HRxHS::HUHV;:ZI,;I I I ;I'\;I(I)I-;I.I/I0 ,;I1I5;I6I7I8 ,; I<<I=I>I?I@IAISG<IT 3IUIV IYk<IZ 3I[ I^<I_.I` Ia IJ<ILIQ IW<I\G<Ibk< IE<IF<Ig#=Ih _fdIiImT=InIoIp` Z I%=I*8;I2\;4_rtI9;IB;Id<Ij<Iq#=(0J =J J J J T= 0J >=J= Kuo>Kv nsKw2w uidKx AKy Kz K{H> J >J!J" : J%>J':J(.J.:J0 : J3> saJ4> L :?L L . lenL .L  (MU?M & N$?N%N'N( 0ND?NM#:?NP(NW) 8O (@OUOUOUOUOU O#U(O,U0 P)P@P*UP+7 PP8@P9@P:`HP;`L (@@ .8PD@ PEFPF6PG`0 Q>4AQKQZQpQQQ endQ4A TCA0. R!^AR" `R&CA RDARD^ARDjA REARE^AREART ARYARZ {6R[AS A valSS AS "B valS S  B SgB U U V U W *` [B0 hC i^A j kgBcpu l` mU nU  oU( OC .    zC .  A8@@ D  U  U  U  A  A .  .( .0 `8!@ E  U  U  U  U  U   U(  U0  U8  K@  UH  UP  KX  K`  Uh  Up  Ux  U  U  U  U  U  U  U  U  U  U  U  U  U!@ G OC !7 ! U( " U0 # U8 %@ &P 'Q (R )S , UX - U` . Uh / Up 0 Kx 1 U 3 U 6  7G 9 G ; G =.7avg GzC@E G0 KG L M. N. O`  P$ Q& SG(G1 ]GGGGG8 `I a!7 h U i U  j U( k U0 l U8 s K@ t UH u`P ` ` ` ` ` ` ` ` 7X 7rq 6I G I G1 ^I#I%2IGUrq2I I `  `  ` `' I    z IMb IMs A  J  JIS  JJ 'J ;IAJ .`)T) KJ8 DK o y B^  Y@  D  H v7P .`  .h )p .x   {6  B^  UJ[pidpT7KT9 9T:`T; {6T<E inoT=UT? T@@TBw_H+rcuTCF`TD)pIK K . ULU`U_KVouMVp) uidVq A gidVr "B Vs AVt "BVu AVv "BVw A Vx "B$Vy `(VzO0V{O8V|O@V}OHV~OPVXViN`ViNhViNpViNxV VV2wVo>V)ۼLuM[keyWiNW9W}) W semWB^(W PW X/`W h uidW Ap gidW "BtWxW|W~W W.޻WM nN xN N N HX OX! 9X"fGX#pGX$zGX% X&2(X'G0X(G8X)G@N/XY^RY_9Y` YaYb YcYew_ Yh%8Ykt>@YnXYq`YsdYt%hYwpYx`tYzXxY`Y`Y`YY Y7Y ) itY]Y۽YP@YmhY YKY9ttyYYY AYUY UYUYUYUYUY.BY.Y.Y.Y'.Y. Y.(Y".0Y,.8Y.@Y.HY".PY,.XY.`Y.hY?pYYYYY `YYYYY 'Y6YB^0O< YRY{6Y9Yw_Y R S  SZASZZS@[S[P[ P[ U [ ([*[,[-[0FS S X\cJT\d)\e \g \k {6\my\n(\o0\q_8S OT>/P]U]N] 9p]Ux]:]] ] ] ]]]]]"](].]/]0]9: ]::(];U0]>8"]AF@^T U ^U^^^U U V . V V %V .?V .@ DV NV ":hV ./@_)X+css_ L id_>VV_R@NW@___{6 __(_.H_P_SX___K_K_KH_W_W_W_._ _jX(_jX0_8_(WH_P_U`_W_ x_Zw_7XhV0_jX_x_)X_ )W .X<0[Z[[[[| [,[.[y0[@[(\H[P[X[0`[[.[6[ `9bdi[c [([h[p[f[ 9ev[p[`[`[`[)[`[{6[u[z[[_[p`9cdi[[9bb[[ [U[ @ [((oXh`y"[`zse`|``}f)Nf`e(` 90`.X`#f`Z '[ 1[Sa>;[ H[ R[#b#b#b#b!#b%#b'#b,#b/{6#b3#b5#b9#b<#bA#bD#bH#bL#bQ#bU#bYg\ c\ccc c \c!c" %c$` Hc'H]c(J keyc) c*H]c+ c,(c-0c. M]8 extc/R]@#)g\\c3 c8] tpc9]c: c;Ac<A\22 d]d 9#eff f"]f^f{6f] f=^]f`f (g0^g1)g7) osqg966g; g<2g2g2g2g2gh !^ (h_h`h h_h h'_,_J_J_`^ h#w_h${6h%h' O_ i+_i, i-2jɱ62jʱ2j˱k _____ k*`k)kk_ Xlqk`lr_ls 9 wqlvp`H cpulwP k`8lz`l{_+rcul|F wqlp`0n xm amnm ama( lenm)Hm+aPmp `a . .+a . ;a ./@nbnbnbn n{6@@n `Hn!.n".n#n$ 9n%_Vn&F n'b0n(.89cpun*@9sspn+bH )%b . `n6bn7{6n8an:a(n;.Hn<bPn=Xn>\%b nebnf` sdang(dnh ni-db<xnDdnEbnFdnH nI6(nJ{6HnK6PnL.pnM.xnN.nO.nP.nQ.nR.nS.nTnU.nV6nWKnY n\.n].n^*`n_bp b(d .;ab#opadp/p/p"dp#2p$p%p'dp(p)p+dp,p-p!ep&adp*dp.d p/e?d opsp9ed /e4e p2sep4.p6`p7` ``@e``He `pe`qe`r`se e(`(f`>e`.{`Nf `F`.=`affI(f@`f`e`.`.`. ` (`,`f0+rcu`F8`gHafe `g` id` f%g0. `@g`Eg @g (qgq qKqq r %hrUr& r)B^ ldtr**h8r..@r96Hr:hr;9ipr= xrC#|rD~ %h s 4iss. alts.s.s. s.(s0s8s@sHsPsXs`shspsxss s!/h4irFg(\ni^ ``Xi4lruYJideiij .k.((RinihDKis. ((u=jz. pp{Bj|.}.~) =j(^j.(j k  t ktp reftx8tKHtht`lt.p opst xttj=(Q:kiiGj^jAF\k` ' ukval.1\k-MkN P`JkMlruKkWkX Yuk-@GVlI.kUDKV . k([ 0\ 4^.8:@Fulk,j#-(mln.o.q r s t v` :@lmul,z#-0}`m~..     (- m..:@|mm`m,#8Dm)Vl)l@)m1.m8 n  {6  e   R DK    o( `0 `4 zM8 X@P  p  x #u $  %  'z)4mm5 octx6%o  o=Uo>]@4A(XroYB^(\ob.h.t:w }$-o..: po,F2pmm> Yp7rb!7.Uo ^pubWquc quh qujukuq usl(ut0uu8uw @u{lHu~lPu4XuH`uahupuxhpWq*oroqUcid E@@ q ' q. )X|@@u)q@^@.P.X.`.h.ppgd  8'x) 5 ?uE.L`S Z ])_a{6pB^r..... .(.0.8^A@{6D.H.P'.X3.`.h$brk.p!.x..%.0.uu@u>i.h{6pvx%2wn&KmHKn+a@KqH` v 7w Aw .Zw0.+w-/ {61 `wpu/"x<u7"x(pmdu9 B'0pudu; W(8A@uEHuFPpteuL ='XptluP[`uT h*`x @33333 vxvvx wxww xwB3ywD3ywE8ywFwywGywHywIxx xryx x!`x"` =yry |yyy,yy- {6y/ Yy0y(wAyxwK w:zw@xywN/zwO.wPwQ  (w+}zw,w-w.w/ yz 0 pz qn r  s  t  u  v#$(}zz8zcu|))skzx ) 7cbz z|(V*Xz.hlenz`pz`tz xzzz |z }2~z zzzzzzz `2z2b)endz3b)z4(z5(z6`z79z;2/z T| ./ {|{| {|{|{#|||2|62|92|<2|G }"}}) h'uJ}'vJ}'w.` Z} .D@'7~'.':'a'7~8'S~'o~'o~8'~x'~'~'($gen')$seg'*'|0 S~ . . . o~ . . . .~ . . .~ . . . )~ . . .H'seq'.''''"( )" . .8 . .''cseq'.'.'h''''D 'ec'f'h{6P'n.X'o.`'q)h's:p'u.'xZ}'{~')'} . . . .'&ۀseq'(.'*/V',ۀ '. {6 | . .  .!@'' {6''' '''''''  . @''' '  . . .1'@''@ P ./*`'!@'7';a'<. '>.('?.0'J8'M`'O)h'P!p'Q$x'V'W'X'c.')'.'.'.'.'J'.' A'"'@''x'.'{6"'@'.'.':'.'.'`'`'' ' "'@''%`  . "} . )% . )5 .'`'`'D '' 5 . '˅' {6''.(' '.'.' .' .' . O@1 . eA . w_Q . )f ./ f 8tنt.t5t5t.t. t.(t0 نG 0~3;~4~6~7~8  xa~9y }idrpy`` .[7 rev.  ׇ  J+rb!7 ns0`8< >@ idU` hp+rcuFxׇ ڈ ops! hq "$ % ֋ & (( 02 89@: H= 1P@JXA h`ڈ  4dirp  x- buf-- - - -  - (- 0-68 op-H X-`-M h-p ] knn 6 6@`h x    @  A %\qll]lv֋ۋl]'l', JlG'6hlO` 0'(m) * +, - 3(G   G vA `  UU ino)U dev* u(+ u, uid, A0 gid- "B4. 8/ @0 P1 `2 p3U4U5A6A7U8U9A:A;A ((J( (m(n`(o&jX(0[(1v(2 (3 (4 (5 ̐((7 0(9 ̐8(; @(= !H(?DPet[oO @@JAJBCD Eb( sdF0G]8I`J`K`L`M`vyroYowOGDK̐nenoѐ!noDnoG'&(t( ( IOyOJ ` {6 X 0t]u rvww!|x*y z ג(]rgtp,J͒͒ҒA"B< }.~.>9bufN > . N .? T_T. Ɠ_Jߓߓܒ˓ (B..... 0x+rcu1F2]3x 0. HIJK LM.NKw B!@p?HJPXbuso`h p x6֛DIS $msi,(b8g@UHUPvX {`hx  u$idA{6 K!!|# $ %'#)+ `, a- b. c/ d9 e< f({6 get D put D    %D& '(]/@@?gH?h cpu?i`?j`?k` %?l`%?m`%?n`%?o`%?p`?r`?s?t?u`?{ ) ?|8(?} )0?~88 ?W@@IG)MO8@h . :;<h  !"# $(%0&8'@(H)P*X+`,h-p.x/012345*U9~*`liHx̛y {6z`|`}6~0ћ@ ̛!8   ! " # $ % & ' ( )A{6 K &@ @ A B C D E7PU_w_0  `                `9  UUUU5  J($qosT0 +&,J id-./{6 00(1 902.X3 )`4 )h5 )p6 )x7 )8.9.:.;.<. dev=> ?  +iJ2: Oʠops ڠ  ڠʠ`ߠ M NJOJP!|Q!|R!| T.(UL0V8W @X HY P[X\`^eh_paxcd  pmfjh"") `)aJ busbod eJg hc$j(k0m8n @oHp PqeXr`s!|ht!|p pmvjxw  py'GGߓ3eQ `23J5!|6!|8L9 ; ; P(< 0>8@(@AdHC ~P pmEjXt6G6"KK@dGU~G͒Ғi 0XޤYJZ!|[L\ ^  pm`j(ޤ .@ ,, 8J ԥ٥ (01 sԥt uw_  !7X)ԦL, I( setw08@HP(Ԧ, =WrcuFe`I Nҧh pxhw+dir|N` [7X|ޥwwҧIç͒Ғק, "%#M &M'M' R%M({{6 =AW){(3Ϩ4A len4A26U 1 Ϩ8i2jk2w_rgst%AuFR@T`UAV%WEX Yo0[t8_"@`` ha.pbx dmn+d_uv7gg!x {o |  } ~ A  "B `    !.   ( DK0  8 .@H  uL  P  X  `  h Ap At Ax A| {6   7  A A B^ . .     # #    N0 @ H  P  T  X  \Y-` h" UJp 8YgH  P ("X ,` 6h  pJ .'@;BBe ( Ų0 Ų8 ڲ@ HPX`;!@     u  .    ( !{0 !8 @ "H .P .X .` Eh B^p     & #  $       n c m  `  (" `   A   !A "w / | 0  1 4  6` <6  BJ@ D"@H FxP I)X L` O d Rp`h Sp Z2wx a bLrcu cF d_ f6 k0" n{6@@ oH q{6X r`E`.BE`.[[`@G[`J j[EŲEڲEoʲE߲ E?FEG HINNSX  mnt N EX?EE<9map9 ) .?0+rcuF0 ??0. "#Y nid&-.4.7)XRdSUXYZ `c 9 dK(+rcueFHgXj` idmpptqJxrEu.xx}Dd) ~~ ~" ~${6@@~- lru~/~0)  T2 nrT3 nsT45 ) . 80. O valU8` ~ ~  !@@]:] L].]]]]]]]]]$kn]]K]K@]Ox]#X]#Z]#\]#^]$N`]O]qP]] ]:]:]$vP] "]@@]:@]NH]Np].B]"]#6]&w_])_$psi],K$bpf]/H ]2XO]5#6[]9{P2 sx. sWWWl˹+rcuWmFWn9Wo (WvWx#Wy 6Wu˹4xW. (WrPWt.WZW_WJ PPZ WWW d  .WκiNκӺiNU W W keyWiNWZ=W/WAW!7WQW W ((WW.W.WZW_W  (WWQ- W޻WW K WWd  غ  9Jg.0)8@ uid AP)X `$ h V̼V 9V gidV ̼ "Bۼ0.=VVWrcuVF > .? 8Y~Y Y! Y".Y#UY#U Y$.(Y$.0 Y'Y(UY)U Y0۽Y1 Y2 Y3  YCYD YLYM%YN 8YQXYR YSYTK# ~m . K} . }  9 ./)/067 IJQ R(U0V8^@fHk|P lpnH)q oxq|rsu vxyz{   (08@HPX`h pVx        %0w_ F ` `+rss .08w_@ X   fn 3 arg   . b A\S\T\U=\W\XA\YF8\IH q\J ioc\KJT) \\`0![[ [[[[. [`([`,[90[`4[y8[xH[ X[ X[ X[ X[X[{6`[d[Zh[p[x$dev[([ 0[ 4[8[@[6H$id[ h[.p[x[[ 9[_[ [9[[ 9[!["[#6[&0[({64[)8[**`H[-C$fq[2M[3[56[66[76[= [>{60[@4$td[DW8"[FF@[Kw_P[P6h[RK[S[UE[VE[WE[[6[] H   - val P val9<hssx in.v8_ `)a b %c %d +rcueF reffs0\ + v .% l. 0 4l 45`67 .    A - 6 "B P P  `       (  8 nHЧ(k)*+ ,0-6@. {6`/ d0 h1p2 x3.4 val kw`6BE4uidF A4gidG "BH DJ H      ( 0 8 @ He. `(`, 0 8@ e! e@89:;<= >(?0@48j / /XDEFG HI J(K0N $8OB@Q[HS4P9  o=o=)[oGxYOZ[U\U]U^U _U(`U0aK8cK@dHeLfUPgUXhU`iKhjp8```` ```ino  A( A0` O% . ``` ````XMp (08@ HPp R `u % ` / D8 k ` B^ k0 {H$ops!  o{ . .  . w }  z          M( 0  8  @  H  P  X ` +h  Ip  hx     338<+-/6 7 9U ; ` < `!= `"> `#? `$@ `%A `&I `'PU(S0VgU8W .8X@9wb[H\oP_X`\a`b hc pd xnmDK3DK HnDK`H=^ nDK``R5DK5Yzu|DK[+I0cccNDKmn 5nzu|  g `: - , F R !R  bhboW  IV     `  !@ Z) [r \ ] ^ `  b( d50 eN8 fq@ hH jNP kX m` o h p9p r Wx s u v y { }) Q j )/i bdijcl.m.op(q8rHs {6Xu \vu`x.y.z.{.|. .(.0T8hTl {6px*`*`8xHTXNNNGU3   ' 1(  n  6pid K 5uid  A A  $   . ` `  ` `   4 6  U:  )u, *F +3 , -+; 0.1 P!0       O . v   b  b     '(  b0  78 @ PH dP PX d` h p  7x         '  @  @  7vM     /)* 5+ 5,Z-.$ /.(0 09 u4:DK8< @={6D> H? P@uXA6`BCE F6HIK  Q/`c idU !7 .0.8]@`D`H`L`P)X.`+wb3h`yp6B^w_9dev12( 90EX h r T . T .$1 JU`   pos  1  `,nOn1rnJTz` [[P[[ C wn]n'n`.7nG'#Pon<inUnnnn .n....X\'IVn`OnIV`,rnr=^w| Tnnnn`nn`,,`1 T,`;EroE`YJEo`wooEoE5EoENoE:qoEJSoEvoEuoEoE`E644A`#WE>zozUU \ooEn`onE)E GEGL .jEGV mt ^ .oo*` o oo3'o7 ,P <d U}E} i &E  J""o@ },TTY E chEJr .[bio 7   48 @HPUX` &hpr  t +x* 2. A^^ /#;GJ* (E*FJ modG  opsH!I -JKM H4L{4argM 4strN4arrO VW`X{ \ max^`_` num`. opsa!b0(' )'O!78 .  `.  ` & e T .7 ` - . mod / @ 0H mp 1P 2LX  8 5^ 6v 7  9  ;  <( = 0ww|^w|J J  *` > 88 E8mod F  G 8P p q r s t`7mtn w     `   <O8 .m  W]bc] @6 OEYs 8`-   'hG6͒Ғ ijvk 0m S++S+J5``.*`*`8, 0W!ކ"\ W*`1*`B*`Oc:d&ae2f4g lidh :Y N X]U lqXUcma   @/0 ops1"  dev456(78  #` 8 grp @HP.Xt+*h8+ac9*: ``tE tNHtT XtZlteXMwlw] k..qft(ttt u,0.ttu,H-(u0<vmau1G'u2 Yu3 .u4.u5. u>fu? lu@ qG'fG'.vG'G'...ww`ww... G'4G'.JHG'9aG' VM VG'.)fG'.`xMxN 5xP`xR` xT`  [Cp[D  [I  [N3 [S3 )p e[A[B[C%%z` U` `   !=yDZnZoZp`Zu#Zw Zx `Zz Z{ Z~`8Z{6<ZS@Z_PZp`pZx0 =y0./Y;K H {6 =^ (w_0/K  @jpk lenl wpmnopqrps t(  .  .@!. &.@@+ H 4"8`=`B`G mapL"T.@@]Baw_ @m sbqw` | $ ws( 0`4 8 <'[m [t@[u[v[w[x[y[z[} `[W[ [[[ [  [ ([" 0[ 8[E @[^ H[ P[ s X[ `[ h[ p[ x[ [  LW a kK z H[[[ @[`D[&H1[  `1[] `[hA[i[j[k.[l.[n`[o`[p` [q`$[r`([s`,[t`0[u`4[v`8[w`<[x`@[y`D[z`H[{`L[|`P[}`T[~`X[`\[``[`d[`h[`l[`p[`t[`x[`|[`[`[`[[[[`[`[`[`[1[NSll`P[[[ 5@[ 5H q0. ,0U: eB zJO  T (X0]8b@g Hn'Pr <X{_` yh p x   /f qghiWk l tagn o$q`(t`,u 50 biow8x@HXU`UhUpxz|~a ref .) elv:nU   9```BBPrqs {6 > H RKopsmap`8 `< `@ `D `H L`P`T X`9h6pb\[{[[*`[`Z@Z @`.`" Z` ; ; @  ' ^ J s .c  Z5`Ax  Z6  Z\({     Z     3 $ C 8 2n`u    get(  put 8  L e  L  y ( 0 8 @ H P X `7 hi p x (     u   Q R` idS`T  Pf gh`i/(  8 - L  = e  GQ R y  j   J~   J`   J  J         7  J# d  JJ``d  <     n     `    . . ``  M`` 'c sgl(c)`*`  `h`Zz{|3=:A!7=y^ icq ^ n . seq`!@6W)@L*`@Ne)SX[.a efqgMm sy` {6(^0 X9`9h`p`t xEE \*`&E@@79{6AF..``  .9!7rq"# PWP7<eWZuuPjfW 'W`<W`,_K``AyK`d~K  .  .`$<h*T3`W a (c dJ m<(t$0$8@H $P $X $` $h $p $x $ $ $ /& ?&  X& h&" &* h&4 &; &E &N $W&X'a'g 0'qI'yJ "`$`(`,.0.8@D `@  `A  `C  `D  `E  `F  `G `L!|P!|XU`mmr!8&') +{60,[8.6@0`1p2%3L5w_6#'7"9(9]:K<\> @`B`D`GH.Q`R`SU\`eghijkl`m`n`o`p.q.z `{ `| ` ` ` ` ` ` ` ` ` ` ` `p`p```. .(01$irq`4N'8"@"0 (0"Kw8/(JKZLM*`+rcuOFpQSZ.\]_`abxdeg(x sdbjwk8xm `p `u `v `w(}~.`( Y(m#J<m-ZZ`_/(g$hmilm o0p Pr Ts {6Xt`upvrwtxvy.xz.}. id`` lunU` `TT6(JJ revJ((((( (((0(8$@>(H`P `  `  `  `  `  `  `  `  `  `  `  `  `  ` ppr `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  `  ` `\` d9h9px_`    " "  _(   ``(6J(% Kw(A$$$Z$$Z$$$Z$$$$!HO/&PZQR7devS(T]U`$idV` X` Y`!\`"^`#``$d (e ,k`0l`4o T8p(<q @rKwH$?&$4&X&m.D&h&m]&&Zm&&m`&&&&Z5&&&m&'m&' '0'!'I'm5'*`'T/`9(  h 3)8@D H!L"P(` - h&X'`&( a(+rcubF lencd( ( (*`B)3)mU) 9H) . X) . X)1z`zj)Mdevzk])zp.-ze)zgzzhzo):zd)),zs!7ztzu3zz*z{ )z|U-zF*z.z Q*Q*zF*z**zz.-z*zzz*zQ*-z*z-zz+zA*z-+z`z`zR+zzzw+z-z-88  $ ( 08  EU:      ( , !20 @  D  H LP X \` h l8p tx # ' E*:+, - 4 8:9 : @:A B - 7A;:< = > ? :D >PG"<H I J K OPQ R $S (T ,X0Y8Z @cpu[ D\ H`n<a b c d e - _<"<g h >k<l m nr<s t z={ | >@q=<v w x y< (0 8>=  E(Z>7btf      $>0>pid fd   7buf    (?  -?  EV? 'o? > ? cnt '?  ',@pf    Q@  'p@,@ >0@cnt  $pid (A  '%A@ :0A I-?V?,o???MtcxQ@,p@A>@A>?  )%AA $B  'WB A A 'pB 'B 'B  ' B   '! C" # C6I7,,8I8IU::,]A;n<,o<,=,=I=,Z>,A $BWBpBBB$B C DgD D jt jf k1D2 3 D )DDHa?Fa@#aA#aB#aC#aD#aE#aF#aG#aH#aI#aJ#aK#aL#aM#aN#aO#aP4aQg5lenaRA aSAtagaTaU"n aV&(aWX0auxaY]_8aZn@nH aF cntaAaAaa aaafF2f2/  RG E ops #\G ` 9 RGWG aG kG uG G0GnsG2wo> U(G K HKAKAKA(@K-HK-HKA< G=H .(KaHKaHKaHG@KzH H=H @KHfH H . H )H .2 `H .h@<7JI9JI@I0AI`DGZIJxM_ ZIZI .%_I8aI7rcuaFao I .% I .%@T J+seqX ^A@[H^Aa JdU8 iJ@@ AJ . A/J . .<ɢKɣKɤɧ6ɪ!K0ɭ28ɮUpɯUxɲ*`ɵɶKɹK9avgɺKxɽ% ɾ 9(ɿw_P h l6pKAU2UU/JI AK . UK . . .K . . 8] L kn]].] 9]L]: ss]N]x] ]0]@ id]P]`T]UX] `]_h ]u`]N]]N] ER]YR] iR] iR] iR ] iR(] ~R0]R8]R@]RH] RP] RX] `]Rh] Rp] &x] &] &] iR]]]id]]J]J]qP] ;]]Q]Q]`L L NN . (]DN]Et:]HU]JU ]aXO]fH]gN]mN(]uNP]{Nx]:]: ]O]]]] KO . O . !@]AqP]B]E`]H ]K7rcu]LF ]S@@]V:]Y ]\`]_2]b12ON :P0.]lQ]r12]s.@]y H]|`P]`Tss]NX]`]Qp]qx] ]Q]Q]] ] ֋] ]R]1R] ] 1] ڈUQNQPQKQNQQRNQUQ1RNQKRNERN6RYRNJRiRN^R~RNnRRNRRRR RRRRR%URR%UR/@ S) @@.@)H)P.X)`)h.p.x. "@$ min%. low&.'. max(.)SR x nT.... {6 (68_X 0TJg `(" ^A, 0,T.Jg0`(1 ,`,U ?GU cnt@ A2= gU_WrcuF<U nr i U U .`!U UU x>V {6nT 98.`.h.p _CeV id_D ref_E 9 _NV_O)X_Q /@_WW_Y)X_\'W_]%W_^*W _l@@_p@V_q@_r/W_s!eVH W  W .EW . . (_W_U_ at_U_U=_W_Wrcu_F@_WA_R@A_R@ W )W . W EWX . XX0.VaC!X&XUIXUUUUUaDUXZXnXnXsX a Xmapa B]a Eoa loaF3X`XXe3 aIYaJH aKIXaLXaMAX<XaQe[aS~[aTG]aU \]aV l]aW] aX l](aY ]0aZ]8a\]@a^]Haa ^Pad]Xah ]`ai /^haj H^pak f^xal H^am H^an ^aq ^aw ^ax^ay^az _a|D_aca ca ca da(daAda _daada da&da d a d(a#e0a Fe8aZe@a&Ha"_ePYy[y[ Cj[8a.]opsaJgaB]aa 3a Aa A a A$aU(aA0idaA4aF8a@aADaAHaALbtfa"fPajXXa!2`a6pa a )fa# a/fa0a1a2a3a4 a5Og[B]B]y[[3]\]B]nL]l]B]a]]B]q]]B]]]B]]y[C]]B]U] ^B]n]y[]/^B]U^H^B]4^f^B]UM^^B]Ak^^B]n^^B]^^B]^3^A^^_B]^+_+_0_?_?_.]:_Ubtf5_D _]_B]]_b_!xaca aAaA aAaAaAaAidaA aA$aA(aA,aA0aA4aA8aA<a"f@a ,mHaPa6Xacxa1ma4ag5aaaaaaaaaaaaaaUa6a;ma gha?_aJa@maa"EmaOmaYmaA"a hi$opsa ^mpa cmxa6ahmacaaUaAaamma!2a!Xaaman$btfa"fana na&n a. =^(a/A0a0A4a5A8$moda6 @a7AHa8 PNmXI_cB]]_ccB]AccDc d+_gAc(d+_U'4dAdB]G'-d]_dB]n'Fd}d}dAd ddd}dAddd6[ddB]UUdd+_+_deeeee e dFeB]XU(eUZe+_KeY`ae @33@333a3 a"f btfa"fa aeaA5_ aif btfa"faAaA aF afaea'f 0afaAaAadeif ff0.: afa _\rcu!F'a)Jga*?_a+{6a,4 a-a.e[K*`ah     33 3 3 3;a9haWhhWhc]y[>hghc\hHahaca])aha a a 0a 1a 8aA@ ha5Xia6a7a8a9Xia:Xi hi . !Xaia.enda.a ia"a  a P TiT.: aj\rcuFa_!awjaaahiaxhaxaNi'0ajaia  a(aUkaaZka6a 98aA<keyaU@awjHacxa_kaokak Uk ok . k .jaka#aaa'akmapaB]keyaAa lak8alaaaauxak a0a1a#2aA4alaAaTgbtfa"faAlambtfa"fa : a9,ma:_\rcu;Flj 6mc l Jm Tm9hB]l B]}m .Xama_a  a2w(aU0aU8aU@aUHaP}mlhCk Di]-a]?na]na]?n gDNn0.i^-a^xna^Nna^xn 3n0.a\nnQn n nananaU nn .n a oacn n!o0.*`a Eo'a loa :a j3'a oa !opida A]3`*o`::p   `Np /hq:p:pUUAAo 12$hmp`xA|+dev_qUUAA$rdn&U'U(U)U*U li-U(.U0/U80U@1UH2UP3UX4U`5Uhcn8Up9Ux:U;U<U=U!a.tcAdAgAhqkUlUmAnAoopAqAtw`xAyzLdev{|*`}_H~*`h__uUUUUU U(U0U8U@UHUPUXU`UhUpUxUUUUUUUUUUUUUUUrp %bv&'( ) * + , 9 W}vX }v 9v . yvz{H)| 9} E v .4ҌzwҍҎ 9ҏ 9Ґ 9ґҒғ -Ҕ 8) ҕv0Җ -2w 9 9 9 9  9 9 x. `D(x 8x .w`Ӎx;;;;;;;;;;;`Ӯx "(;3y()-.1569@Oy+skbAzD|m// /(08u$tt!#}.!.t"̄AUU``` vAAAAAAAA$mfsA####`bv6(H*`XфOy i|id#cnt#A#|!@=}>{6?9B AcmdEFlpI|(J0M1N2O3P A4Q A8R A<U @VuHW AhX #lY #n\up]i|x` 9a b c Adi|eKn|`>f~     `R~`d~`~  /|/~4/(Í|u]~ idshq #0 #2 #4 #6`8`<`@`D6H*`h~ ops_ A #grcuF #  ~ ŁUUUUU U(U0U8U@UHUPUXU`UhUp Ux U U U UUځi|ځ3yŁӂ<U<  o( 0# 8+ @7H@ уPG уXN `U h_ уph уx|ځӂi||Aځ`߁A<|#c`U|#Aj|jzwZ|AAt|Aځ|}߁у|ƃ|ځփ||f~{̄|}~ # 6(vH*`X   .^( ^G ^ j.|j?|5#`m}'kō_k_llrJ,|?|?'?B?.UvB].U|.TsQ}.UvlucJu(|?wu?xm?y|_y &B%.UsB=.U|B[.U}.TvB}s.U|}[ aɈJ[1|J\|?^u_ve&&XvlM&&Xvh&&m..UTm.UT.UT1|,C16|C1BAP3|P4|nP=`P=|/J6uJA?m?|?|X/ &@NoF[Fhpy +&{~&RRp|ۊ&RRQ`.TT#X#&&1&&'&3_H&Z&e&qF}Q?.U~.Tv.Q@R?B.UQ}.Uaq|vshtq3'Kq<]s|]tm6K6%uK6@:paK2majKj8KjVbcnew4CKbHcnew1CC`dAcnewA@CBCCretEb#C#5nd%`d&Ɉ&ۈ&Ɉ1&ۈ&oFF `FFB.U}Q}.U}H  5A : F ^  q q     Iint F ,  * +s8R+u8e+s16}+u16 +s32+u32+s64+u64P \    1F 2F Hc IP X ] ^P _ `:   <F  '   o   #SB  %{ & 4 = B h n' } 1  ;  ;  F  F   $1  XXX0xx : JKL Wx K  s \x1MH  5  G "V y  ( ;$0 t8 ]@ "H "H "H ~H "H "H "H "H$@    0  RP h  5 5 F @  E F 1/kp J  F( F, @0  E8 B@ BA BB FD  OH sP8mem T@ t   F 0 e j  t ~  ( 0 F8 @ FH FL P FX ` Fh p  x F F @$  F  F F $  F !$ "F % &r' 9F : ?0 A0 D } F  P  QF( TE$0N  ; cs =;sl ?;wfe A; Ex ss G;sti I; K;nmi M; P;  S;0 V;8lm X;9 ];: d;<  cs  csx ;    ss  ssx ;   g r15 mr14 nr13 or12 pbp q bx r(r11 u0r10 v8r9 w@r8 xHax yPcx zXdx {`si |hdi }p xip x  sp   B  C  D  E   E (s E ,dpl E -p E' / F 0avl F 4l F 5d F 6g F% 7 F+ 8  % %% )%/ 9' pgd' )'"  @H? I!_0_0 48em f g h u vwkeyx\m  U V ? j keyk n keyo ;l<=? F @ F$A F(B F+$-@ (y0FF  4( F,!F0( 4)Y.8*FH+P,(X5 `6 d8 h: l; p< t=Fx5se?@@/rt@A8dlABBBFD%I2JKFODXD]D%`"w>@d]hFkF lm nD oD(p'0q Xs`ubx dy/Dhz0p{D 0 0  /D00 x=01(%2P/mmhpEx    F F, F, F, F- F- F- F- F- F- F- F- F- F - F - F - F -"F -30/pid * *( (00((000@>FPCFX 0"{F%v(v+ - ;. ;3 ;4<6=: (=0>8A ;@D ;HGPHXK:`%N;TGWGZG^Hk -mHp0 q1(t8u@/fsxHH{HP~HXI`Lh Lp 5x 5 58 ~FL o<F\4h9 ;  ; u1 2" TD p2( (8 L@  H MP  MX M` Mh Mp x M /: F  ;  ;  ; 4 <  M 0  '  ' "M )M  0  M0  18  FX N\ N` 1h 0  N      !F "F # $ & ; ' ; ( ; %) 3*N C$ D L/N N R?N S'( T', Y0 ] 8 ^ < _ @ ` D %aH d9X gIN i9 lSN w x z } ~XN  ; ;  $  FmNwNNN F(F,vD08rcu04@ D(H4POx4  " O OO  ; >% !"-$"-%.<(O%F-@@l$@@q-spes ds"$&(0-8X`cr2hpx-F' i-5fpu ,@F(  '$@@!d@&i@ , !c c B(,Gd0&d80XQdh%`dpxb ed' Njdb !  >!val   R!! ,>!!! !!  ^! !!R! ! " \ " ?? 2"R! " "2" F, #fmt555F55$O6,# 7 8 8#5555'F'F'4Fkey9 #("F=#   8U;$V0modW;$X5Y@$ Z ([ ,\#05u$v$w$xFyF,## :$ /$1Fset3Cget5\7 .$D&;$ 5 X {  -( -08!@" ߙH# P$ X%`&/h'Hp(/x)k*+,ٚ-ޚ./ 0 .1 2`3 5 9 ϛ; >k?@=$ !'% + -/  :' !key " ?h' A Bm' Cr' h'' =' >:' '  ;{' ! $0"c("d5"e."gL"i j"lo 5('# N# Np$(cwd$'swd$'twd$'fip$' fcs$'foo$'fos$'$($'l '($*(rip$+;rdp$,;$..)fip$/'fcs$0'foo$1'fos$2' $)B)((0$@d) $Ad) $Bd) 't) :$$*cwd$% swd$& twd$' fop$( .)$5'$6'$9* $<*$>d)@B) '* '&*?$Q+cwd$R'swd$S'twd$T'fip$U' fcs$V'foo$W'fos$X'$Z($[l$\m$]n$^orm$_p$`q$a+x$b'! +@$:Q+$; ;$< ;$= Q+ ;a+$@@$O+&$Pt)$Q+$R+@ +2P@$^,$_9(-$`t)$a&*-$ba+@$c, ,E$@@$f,$hF$kF$n;$q;xfd$t;$wF$zF$F$F&$+@@$,$ ;$F$F Qfpu@$d-$F$$d-$d-$, $,0&$,@@,% -% ;%; :- - --- -&N&N&N'8.'92.'<2.'=2..(<Y. (=F (> (:.(;.7.src(A  dst(A .."F).  () /) /val) ')!' )"')#;)$ / ')*G/ )+&G/ ),#t/#*t/*uQ* L/)'/)(6)).%/).; )1/)20)3)4 )5)6 /()30 )%. )/y/ )7/8)`0)fn) t00\o0o030`0+>0+?+@+A'cpu+C'"F,0     - 1- 1  1. 01.0/ K1/ 0a1 0"0u1K1 0a11 11! 1"1 2)12*'2+2"osq2-01 2/0(3 23 3 0304P244P24P224 p24 P2424U24P2 52(5 25 5 25p2"F6 2 @6'q3(6(26)  6*3(6+406,86-96.:6/;2332q3@@7/470~71F72 6 seq73;743752 76077 83(8G48 x88 W48' R4R44G49499 94 4: 4:4 4 :84;4;  ;4<+5<,c<-cx=_5=_5=F`=hmax=p o5 > 5sig>4 >o5 ?RE ?S55 ?U ?V55A@5 @  @  @ 5@'"6@(o@){@-`6@.@/@0 5@1@56@6o@7{@8 5 @<6@=o@>{@?@@@A@S 7@T $@U@V @Y17@Z $@[ @^b7@_@` @a @J7 @L @Q @W6 @\ 7 @b17 @E7@Fb7@g7@h\_fd@i@m8@n@o@pF A @%|8 @*5 @2"6_rt@9`6 @B6 @d7 @j7 @q70A 8A A A A 80A 8|8 A8 8A  9A!0A" 5 A%N9A'5A(A.5A0 5 A3h9saA4 9 B 9B B lenB B B(C9C {D$9D% D'D( 0DD/:DM#9DPB(DWB)8E :E;E;E;E;E; E#;(E,;0F):F*;F+2PF8:F9:F:FHF;FL :;8FD;;(FEFF1FGF0 G>;GKGZGpGGGendG; :;2H!;H" F H&;HD;HD; HD;HE<HE; HE<HT L<HY<HZ u1 H[(<I o<valIZ I X<I <valI f I {<S<U ;V ;W2"6F[=    0hx=i;jk<cpulFm;n; o;( == ',@@w> ; ; ; ' ' (0F8$@@ ; ; ; ; ;  ;( ;0 ;8 1@ ;H ;P 1X 1` ;h ;p ;x  ;  ;  ;  ; ; ; ; ; ; ; ; ; ;$@qA=& 2! ;(" ;0# ;8%0@&qP'qQ(qR)qS, ;X- ;`. ;h/ ;p0 1x1 ;3 ;6 7qA9{A;{A=5avgG=@@ vA0KAL0MNOF P$Q&SA(A)]BBBBBB,`C&a2h ;i ; j ;(k ;0l ;8s 1@t ;HuFPFFFFFFFF&2X&2rqCACB)^CC(CBRrqCC;F ;F ;F;F9/DSTDBbCBs'qDqDTD? ~DD D CD'' D,EqRjS @ D Hp2P` h)px u10S DFpidpJ7>FJ9 4J:FJ; u1J<minoJ=;J?y J@]@JBSH.rcuJC`JDypE xSF K{FKFKZTSFLoGLp'uidLq o<gidLr < Ls o<Lt <Lu o<Lv <Lw o< Lx <$Ly F(Lzy0L{y8L|y@L}yHL~yPLqXLH`LHhLHpLHxL L}L iL8L}!}FGFkeyMHM4Moz!{M| semMS(M|PM X|`M huidM o<pgidM <tM{zxM|M~M M||M|G H H H H H:XN^LN_4N` NaNb Nc0NeS Nh(8Nk8@Nn]XNq`NsdNt(hNwpNxFtNzx'NF'NFNFN]N](N2N itNN4N:NƀhN N>FN\V_eNW_fFsda_gX_h"_iX WCx_DX_EW_FX_H _I1(_Ju1H_K1P_Lp_Mx_N_O_P_Q_R_S_TB_U_V1_WSF_Y _\_]_^T__NWp WXUSW`NaX a+ a+a" Ya#a$a%a'/Ya(a)a+SYa,a-a!Y a&X a* Y a./Y aYXopsaYSY YYa2Ya4a6Fa7F "FQ@Z   "FQH@Z   QpuZQqZQrQszZ uZQZQYQVQZ(QQ3QZZWZ@Q`[Q@ZQQQ Q B(Q,Q`[0.rcuQ8Q[HZYQ[QidQ j[[2Q[Q[ [(b\b2"b1b0b  c \c;c& $c)Sldtc*\8c.@c91Hc:hc;]pc= xcC |cD~ \d ]ddaltddd d(d0d\8d\@d\Hd\Pd\Xd\`d\hd\pd\xd\d \d!\\] cF\\]^ `FX^lruY0] d0 e0i>^ j  k(Rn^]hE^s (u^zpp{^|}~' ^^^_  ^3(Q0_>^n^^^7R_ F  9 k_val)R_0M_N PF*J_BlruK0x_*W_X Yk_0@GL`I_UEV  _([ 0\ 4^84@Fj`_-j 0(m`noq r s t vF 4@l`j`-z 00}Ta~     (0 a04@|a`Ta- ,Da!L`!`@!a)a, b  u1   E  q(F0F4G8w@pP rp  x#Օ$ % 'ڕ!a5cctx6c c=Cc>AS@;(X`cYS(\cbht%w }$0c4cc-*daaX Gd5rb2Cc Ld Vd[dc`cd;cid Y@@ d 9 d0 mNZ@@h!d@S@PX`hppgd  x) 5 ?hELFS Z2"]'_au1pSr0$ (08;@u1DHP'X3`h/brkp!x%0hh@h]hu1pix( ib&i  ['T!i' dod h3 [h h iQ i i 5i2#e6N#e9N#ej gGMj gHj gIii 4j9j CjHjh,jh- u1h/ h0RjgAjigK ~g:j g@~ijgNj gO gP gQ r(g+Dkg,g-Bg.Bg/ ~jj 0pkqbr rs t u v $H(Dkji"ki#ki&ki'ki' kkkj(lju1j 3jBl7jljWl!(lk3{lk4'lenk4'k2lWl k6;k1l{lk8lkil kj0 kklS[krm ksx ktk7kukRmkTFkU<kVkkWmkXl kYq0k[q8k_"q`k`uhkapkbx(kdBllkmxkn].d_ukvlmm$x{q| }~ o< <F !e u(E0 8@H L rP X ` h'p't'x'|u1^ 'Sx0o  000 \?0$@$H P T X \@e`yh%Dp08@H P(X`h pm q-q'@kqkukukvk6vkJv k^v(k nv0k nv8k v@k vHk.wPkLwXkew`-qq$@u0 q r t(!0!8@"HPX`mhSp &!#:D$SXk 0 b b l vxF (%` '!'"/ 0 14 6F<1 B5@D"qHFxPI'XL`O dRUhS]pZ ixaxbx8rcucdTf1k0%nu1@@o0Hqu1Xr0`q"Fku umFuvv vmlu1vvF51vlvJvv;v^vmOvnvmcvvmqsvvmv lEvlFmlGulHlIvvvvwm)wmntm vm mwvGwGwB)w3wmewmuQw n"wn#nidn&n-n4n7mNnRxnSxnUxnX\nYnZ Fnc 4 ndSF(.rcuneHngXnj0`idnmpnptnq5xnrmnuxxxxwjwx'0o3xo4\yo60o7o8 Bxao9Rj  o4yo 0o" \o$u1@@o-\ylruo/xo0' 4yJ2ynrJ3nsJ4y0 ]y ayy2p yvalp; py"Fq y   y r1zrr r#sNteztjzt ez M MMlz.rcuMmMn4Mo BMvzMx My MuzzxM(MrA{MtzMK{MP{M5 A{A{zA M{{ M M {U{ { M{{{H{{HF{{{M{M{keyMHMK{3M| M07M2MA| M  M (M|MMMK{MP{M  (M| MzA|0 M|M0M =z* M|MU{| | |{u}u 4u[u0u'8ux@uidu o<Pu'Xu `u$>"hL}L 4LgidL } <}23L} L]rcuL}}:@@7g~7h2"cpu7iF7jF7kF 7lF7mF7nF7oF7pF7rF7s7t7uF7{  7|3(7} 07~38(7M@@}1~"F7:M        =3@^ N9n?8NN N! \N"N#;N#; N$(N$0N'N(;N);N04N1 $N2 $N3 $NCONDNLwNM(NNwO8NQNR NSONTSF| ƀ >Fր ր  4  v)v(0wlwwwS(w `x .rssx )xq0x8xS@x Xy fny .argy  ez bz z { 'OSA OT0 OUy3OWb OXx7OY8OIqOJiocOKM!A O\F0 b | ҂val|Z || val|f |ނ} v}  }%6F}T^    "q~      . 0 $ 4"F.ۃ   45F679 * % /4`  o<  ҂  <  PF >`  rKK(K8 bHЁ()x*0+0 ,00-1@. u1`/ d0uh1bp2 rx34 { څval ÅGF  "F6(   BEbuidF o<gidG < H څD4JH ( ( ( ( (  (( (0 8 @HЇ0 F(F, (0 (8@ Ї!;$ЇGF        @89:;<=È >È(?È0@8uÈ܈u܈bȈXDEÈFG HÈIÈ JÈ(K0N щ8O@QHSPủ̉q(qڅ։q̉xYZ[;\;];^; _;(`;0a18c1@dHeLf;Pg;Xh;`i1hjp8FFFF FFFino  ( 0‹F‹ ҋ QFFF FFFFX66 Y(|08|@H6PQuGw6uF"TuTҋ;wubw ^u܈wuD8  F S 0 (H/ops!8  q( 8 H*wm}r mwk\Ǐ! : T (0 ѐ8 @ H P -XP`dh p x   ̏ba!E B:E&JJO ?bErFSYbErFFѐE~~֐B -kkPEy2dUB~~iBEؑؑbݑ bkkǏ*?MF4e]-*! &q*ޒIN  F ޒ $@Z`[[\~]^`؜ b(d0e78fZ@h}Hj7PkXmҝ`ohp"pr @xsmuvyў{}:S` j t ~  ( b 1pid>F0uid o<o< $ p FF FF r* 1 ;4 )Օ-*+., -])P^F    $0c  &c=ltΟ    ( 0 8@9HMP9XM`php x Ϡ  ) ) y  +& 05 ? INۃ ] g q { : :$)Bߘߘ5r;F pos r) Fr5brXb~oi:{b5~oi]kF bߘՙbՙڙ \bFb/qbHbߕ4kbrrMbpb ٚb$PINboi~F.boiIN~F QbQSV[ 3\brreb ϛbrbr~FrbrbrrFԛF =F$m[qmFB5ymqy`qqB؜mqmBݜmqm7qm#Zqm5<}qm_qmҝqmqmFmםGw'FQ@m~'cqc;;h EqrqmbFўqbm֞m0m05 Sm0? mt S qX6F   qΟuqӟqq u9u%Mu>fmfk RuvumϠu~ru5~rԠ q\)ux==B . LQmyt5[ "@@AA5B0CFD֪ E<(sdF90GAS8'IF'JF'KF'LF'MF *  . 'PPW     qq  ZU2_rev Z99  95.rb2ns0F8< >Y@id;` hp.rcux opsJ!T r9hEi y"$ % ɦ & ަ(( 02 ~89B@: H= P@3XA Q`E O dir d > Ukn9b 1 1@`0h x  ~  B@  BA %`dddUydn~oiɦoiަΦd~rdՙ3drQdr8"Fz  0'֧(V) ji* +, - .(z1ۧ 1"5"5" "mW "n "o&X"0"1 "2 ~"3 "4y "5 ("7 ө0"9 8"; ө@"= H"?PWW )F) LF3~jFQ)1EtbFr~~өbFr~rbFrةbF"N" l" #lF)SF)5~q`֪0 u1 X0t7u LvQw!Vx*yy z (۪7LFAN[(oot֧A`t~ttiyiC }~(E>F5modG;$opsH!I JKa ܬì\׬HLargM strNarrOVWFX \max^F_Fnum`qopsa!b$0(;();=2L t F v   :7` -  .mod /;$@ 0FHmp 1P 2{FX  8 5r 6  7  9  ; ͯ  <( = 0r5~ͯ;$5;$ү;$6F >   ,8 ELmod F;$& G6 J       _,P p q r sB tF5mtn w  1  1 F   6;"ܬy=e& o y#QNW/Q  "L Aϱ >ϱ `   A >  A3#>W3  A\"L>Z\ a M b L % Kint 1u8? #W   1 <!%',/359<ADHLQUYɲʲ˲  6 9 < GK 1 :@ 1T| 1.111-  g l - - - `J 9   % V9  `/V ,4p ,   : ;9 I8  : ; 9 I8  !II : ;9 I8( 'I : ; 9 I8  : ; 9  : ; 9 I8 I < !I/ : ; 9 I&I : ;9  : ;9 I k : ; 9 I : ;9 I k  : ;9 I' I8  : ; 9 I k : ;9 I8  : ;9 I 8   : ; 9!1B : ; 9  I : ;9   >! I: ; 9!! : ; 9 ".?: ;9!'<#4: ; 9 I$I~% : ; 9 I 8 &4:!; 9 IB'  : ;9 ( : ;9 I 8)4: ;9!I * : ;9 I8+ : ; 9 I k , : ; 9 - : ;9 .> !I: ;9!/ I 8 0 : ; 9 I 8 1 : ;9 I 2 : ;9 3  : ; 9!4!I5 6: ;9 I74: ; 9!I 8 : ; 9 I9(: ; : ; 9 I k <$ > = : ; 9 I8> : ; 9!? : ;9 I 8 @  : ;9!A  : ;9 B: ; 9 IC: ;9 ID:!; 9 IBE4: ; 9 I?<F !: ; 9!G !: ;9 HH}I:! ; 9!IJ : ; 9 I K4:!; 9 ILH}M: ; 9 IN.: ; 9 ' !O : ;9!P  : ;9 Q1RB X Y W R S:!; 9 IBT.: ; 9 'I !U'IV!I7!W I!X4:!; 9!I Y.?: ; 9!'<Z:!;9 IB[1RB UX Y W \ ] : ;9 I 8^ : ;9 I_ I 8`I a.?: ; 9 '<b41BcH}d1RB X Y W e4:!; 9 IBf.?: ; 9 '<g !: ;9!h!I/i<j : ; 9 I 8k : ; 9!I!l.?: ; 9 'I<mH}n.?:!; 9!'@zo Up I8q : ; 9 r !: ; 9!s :!;9!I!t4G:!; 9 u.?: ;9 'I<v.?:!; 9!'I<w.?:!;9!'@zx Uy1RB X YW!z.: ;9 'I !{4: ; 9 I|>! !I: ; 9 }4:! ; 9!I? <~ !: ; 9  : ; 9!I!84: ;9!&I?< !: ; 9! !:!;9!4: ;9 I4G:!; 9!I4:!;9!I1RB UX Y W  1H}:!; 9 I 11RB X!Y W! :!; 9!:!;!9 I.:!;9!' !.:!; 9!' !% U $ > &4: ; 9 I?' : ; 9   : ;9   : ;9  : ;9   : ; 9   : ;9   : ; 9  : ; 9 (  : ; 9 I k  : ;9   : ; 9 (!.?: ; 9 '<1RB UX YW 1RB X YW .?: ;9 'I@z4: ;9 IB4: ;9 IBH} 1.?: ; 9 'I@z141.: ; 9 '@z.: ; 9 'I@z4: ;9 I.?: ;9 'I .?: ;9 'I  : ;9 I8  : ; 9 I8  !II : ;9 I8( 'I : ; 9 I8  : ; 9  : ; 9 I8 1B I <!I/ I~: ; 9 I&I : ;9  : ;9 I k : ; 9 I : ;9 I k  : ;9 I' I8  : ; 9 I k : ;9 I8 41BH} : ;9 I 8    : ; 9! >! I: ; 9!!4:!;9 IB" : ; 9 #: ; 9 I$ I% : ;9 & : ; 9 '((H}): ;9 I* : ; 9 I 8 +: ; 9 I,  : ;9 -4: ; 9 I.4:!;9 I/ : ;9 I 804: ;9!I 1.: ; 9 'I !2 : ;9 I83: ;9 I4 : ; 9 I k 5.?: ;9!'<6> !I: ;9!71RBUX Y W 8.: ;9 'I 9 : ;9 : : ; 9 I 8 ;1RBUX YW < : ; 9 = I 8 > : ;9 I ? : ;9 @ A  : ; 9!B UC!ID1RBUX YW E1RBUX Y W F: ;9 IG4: ; 9!I H UI.: ; 9 ' J4:!; 9 IK : ; 9 IL : ; 9 I k M1RBX Y W N$ > O4: ;9 IP : ;9 I 8 Q  : ;9!R : ; 9 I8S  : ;9 T4: ; 9 IU : ; 9!V !: ; 9!W !: ;9 X1RBX YW Y1RBX YW Z [.?: ; 9 '<\.?: ;9 'I<] 1U^4:!;9 IB_:!; 9!I` : ; 9 I a:!;9 IBb : ;9!c  : ;9 d1eH}f'Ig!I7!h I!i 1j:!;9 IBkH}l5Im : ;9 I 8n : ;9 Io I 8pI q.?: ; 9 'I<r 1s4I4t.: ;9 ' u:!; 9 IBvH}w !: ;9!x!I/y<z : ; 9 I 8{ : ; 9!I!|.?: ;9 '<} ~.:!;9! '@z 1U4:!; 9 IB.?:!; 9!'<>! !I: ; 9  I8 : ; 9  !: ; 9! :!;9!I!H} 14I41RBX Y W  !: ; 9 4: ;9 I?< : ; 9!I!8 !: ; 9!( !:!;9!.?:!; 9!'<.?:!;9!'@z:!;!9 I414: ;9 I.:!;9! 'U@z :!;9! :!;9! H}.:!; 9! 'U@z41.1U@z% U$ >  &4: ; 9 I?' : ; 9   : ;9   : ;9  : ;9   : ; 9   : ;9  : ; 9 (   : ; 9  : ; 9 I k  : ;9   : ; 9 4: ; 9 I?<.?: ;9 '<.?: ; 9 '<.: ;9 'IU@z4: ;9 I.: ; 9 '@z: ; 9 IB4: ; 9 IB 1H} : ; 9  : ; 9 .?: ;9 'I .?<n: ; .?<n : ;9 I8  : ; 9 I8 I !I(  : ;9 I81BI~ 'I : ; 9 I8 41B  : ; 9  : ; 9 I8 IH}!I/ <1RBUX YW : ; 9 I4: ;9 I1RBX YW &I : ;9  : ;9 I k 1RBX YW  : ; 9 I : ;9 I k  : ;9 I4:!;9 I : ;9 I8 '! I8 " : ; 9 I k#4:!;9 IB$1RBX Y W %: ;9 I&: ;9 I'H}(4: ;9 I): ; 9 I* + U,4:!;9 IB- U.  : ; 9!/>! I: ; 9!0 : ;9 I 8 1 : ; 9 2: ; 9 I3 I4 : ;9 5.: ; 9 'I 6 : ; 9 7 1U8:!;9 IB9.?: ;9!'<:1;.: ;9 ' <:!;9 IB= : ; 9 I 8 >.: ;9 'I ?  : ;9 @1RBUX YW A4: ;9 I B 1UC : ;9 I 8D : ;9 I8E> !I: ;9!F : ; 9 I k G.: ; 9 ' !HH}I : ; 9 J : ;9 K : ; 9 I 8 L I 8 M : ;9 I N : ;9 O  : ; 9!P!IQ(R1RBUX Y W S: ;9 IT4: ; 9!I U(V4: ; 9 IW : ; 9 IX.?: ; 9 '<Y 1Z [ : ; 9 I k \$ > ] 1^4I4_ : ;9 I 8 `  : ;9!a : ; 9 I8b  : ;9 c.?: ;9 'I<d41e : ; 9!f.?: ; 9 'I<g 1hH}i !: ; 9!j !: ;9 k.?: ;9 '<l4I4mH}n o :!;9!p :!;9!q4: ;9 I?<r:!; 9!Is : ;9!t : ; 9 I u 1v4: ; 9 Iw  : ;9 x.?:!;9!'@zy'Iz!I7!{ I!|H}} : ;9 I 8~!I/ : ;9 I I 8I 4:!; 9 IH}.?:!;9 'I@z !: ;9!4: ; 9 I?<< : ; 9 I 8 : ; 9!I! :!;9! :!;9!1RBUX Y W .?: ;9 'I 41!.:!;9 'I@z.?:!; 9!'<>! !I: ; 9  I8 : ; 9  !: ; 9! :!;9!I!.?:!;9!'U@zH}.?:!;9 'IU@z1RBX Y W .:!;9! 'U@ 1.:!;9 'IU@z.1@z5I4:! ; 9!I? < !: ; 9  : ; 9!I!8 !: ; 9! !:!;9!.?: ;9 '<.?:! ; 9!'< .:!;9! 'U@z.:!;9! '@z% U$ >  &4: ; 9 I?' : ; 9   : ;9   : ;9  : ;9   : ; 9   : ;9  : ; 9 (   : ; 9  : ; 9 I k  : ;9   : ; 9 4G: ; 9 .?: ; 9 '<41: ;9 I41 1RBX YW H}1RBUX YW 4: ;9 I.: ;9 'I .?<n : ;9 I8  : ; 9 I8  !II : ;9 I8( 1B41B 'I : ; 9 I8  : ; 9  : ; 9 I8 1I<!I/ : ; 9 I1RBUX YW I~ : ;9  : ;9 I k : ; 9 I&I : ;9 I : ;9 I k  U 1U : ;9 I8 ' I8  : ; 9 I k 1RBX Y W ! ".?:!;9!'<# 1$>! I: ; 9!%(& : ;9 I 8 '1RBUX Y W (  : ; 9!)4: ; 9 I*4: ;9 I+ , : ; 9 -H}. I/ : ;9 0 : ; 9 1 : ; 9 I 8 2: ;9 I3 4  : ;9 5: ; 9 I6 : ;9 I 874: ;9!I 8 : ;9 I891RBX YW : : ;9 ; 1< : ; 9 I k =: ;9 I>> !I: ;9!? : ; 9 I@ : ; 9 A I 8 B : ; 9 I 8 C!ID : ;9 I E : ;9 F  : ; 9!GH}H: ; 9 II1J: ;9 IK4: ; 9!I L41M4: ;9 IN1RBX YW O : ; 9 I k P$ > Q : ; 9 I8R : ; 9!S(T : ;9 I 8 U  : ;9!V  : ;9 W1RBX Y W X.: ;9 ' !Y !: ; 9!Z !: ;9 [ 1U\.: ; 9 'I !].?:!;!9!'<^4: ; 9 I_:! ; 9!I` : ;9!a : ; 9 I b.: ; 9!' !c  : ;9 d'Ie!I7!f I!g1RBUX YW h : ;9 I 8i : ;9 Ij I 8kI l !: ;9!m!I/n<o : ; 9 I 8p : ; 9!I!q4:!; 9 Ir1RBUX Y W s:!; 9 IBt.?:!;9 'I !u I8v : ; 9 w !: ; 9!x :!;9!I!y.?: ; 9 '<z4:!; 9 IB{:!; 9 IB|.: ;9 'I !} :!; 9!~>! !I: ; 9  : ; 9! !: ; 9  : ; 9!I!8 !: ; 9! !:!;9!.?:!; 9!'<.?:!; 9 'I@z.?<n:!;!% U$ >  & : ;9 4: ; 9 I?'  : ;9   : ;9  : ;9   : ; 9   : ;9  : ; 9 (   : ; 9  : ; 9 I k  : ;9   : ; 9 4: ; 9 I?<.?: ;9 '<.?: ;9 n'I<.?: ; 9 n'I<.?: ; 9 'I<.?: ; 9 '<.?: ;9 'I<: ; 9 I4: ; 9 I41: ; 9 I.?: ; 9 'IU@zI~H}.: ; 9 'I .?: ; 9 'I .1U@z1.?<n(  :!;!9!I k  :!;9 I8 4: ;9!I  :!;9 I : ; 9 I8 : ; 9 II  !I I8  :!;9  $ >  4: ; 9!I 1B.?:!;!9!'<I4:!; 9 IBI~  :!;9 I k :!;9  I4:!; 9 IB&I:!; 9!I<!I7!: ;9 I  : ; 9 H} >! I: ; 9!! :!;9 I8 "!I/ #>! !I: ;9!$4:!; 9!I%.?:!; 9 'I@z&:!; 9 IB' (1RB X Y W ) U*:!;9 I+>! !I: ; 9!, !: ; 9!- !:!;9!.: ;9 I/.?:!;9 'I<04:!; 9!I!1 2.?:!; 9 '<31RB UX!Y W 4:!; 9 I5.:!;9 'I !6 7% U8$ > 9 : ; 9 : ;4: ; 9 I? : ;9 I 8 ?> I: ;9 @ : ;9 IA  : ;9 B : ;9 I C'D : ;9 E : ;9 I 8 F : ; 9 I 8 G.?: ; 9 '<H.?: ; 9 '<I.?: ; 9 '<J.?: ;9 '<K.?: ; 9 'I<L: ; 9 IBMH}N UO1RB X Y W P.: ; 9 'I Q.: ; 9 ' R.: ;9 ' S.?: ;9 'I  : ;9 I8  : ; 9 I8 I !I : ;9 I8( I~1B 'I : ; 9 I8  : ; 9  : ; 9 I8 I!I/ <41BH}: ; 9 I : ;9 &I : ;9 I4:!;9 I : ;9 I k : ; 9 I : ;9 I k  ' I8 H} : ;9 I8  : ; 9 I k 1RBX YW !1RBUX!YW "(#: ;9 I$>! I: ; 9!%.?: ;9 '<& : ;9 I 8 '  : ; 9!(4: ;9 I)1RBX Y W * : ; 9 +4:!;9 IB, I- : ;9 . : ; 9 / 01RBX YW 1:!;9 IB24:!;9 IB3: ;9 I44: ;9 I 5 : ; 9 I 8 6 U7: ; 9 I8  : ;9 9 : ;9 I 8:H}; : ;9 I8> !I: ;9!? : ; 9 I k @4: ;9 IA : ; 9 B : ; 9 IC : ; 9 I 8 D: ; 9 IE I 8 F!IG41H.: ; 9 'I I : ;9 I J : ;9 K L  : ; 9!M N.: ;9 ' O.: ;9 'I !P4: ; 9 I Q UR4I4S: ;9 IT.?: ;9 'I<U:!;9 IBV : ; 9 I k W1RBUX YW X 1UY1RBUX Y W Z$ > [ : ; 9 I8\ : ; 9!](^.?: ; 9 '<_1`.:!;9! 'U@zaH}b : ;9 I 8 c  : ;9!d  : ;9 e4: ; 9 If 1g.?: ; 9 '<h.?: ;9 '<i4I4j !: ; 9!k !: ;9 l 1m 1Un.?:!;9 'I@zo 1pH}q :!;9!r 1s.: ; 9 ' !t:!; 9!Iu : ;9!v : ; 9 I w:!; 9 IBx4: ; 9 Iy  : ;9 z4:!; 9 I{.?: ; 9 'I<|'I}!I7!~4: ; 9 I?< I!H}1RBUX Y W .1U@z : ;9 I 8!I/ : ;9 I I 8I :!;9 I.?:!;9!'@z !: ;9!< : ; 9 I 8 : ; 9!I!.?: ; 9!'<.?:!;9!' ! :!;9!H}>! !I: ; 9  I8 : ; 9  !: ; 9! !: ; 9  :!;9!I! : ;9!.:!;9! 'I@z 5I : ; 9! : ; 9!I!84: ;9 I?< !: ; 9! !:!;9!1RBX Y W .:!;9! '@zH}H}.:!; 9! 'U@z !:!; 9 .:! ;9 ' !.?:!;9!'I !.1@z% U$ >  &4: ; 9 I?'  : ;9   : ;9  : ;9 4: ; 9 I? <  : ; 9   : ;9   : ; 9  : ; 9 (  : ; 9 I k  : ;9   : ; 9 !4G: ;9 .?: ; 9 n'I<.?: ;9 '<.?: ;9 'I<.?: ; 9 '<1UX YW .?: ;9 'U@z : ;9 41.: ; 9 'I@z: ; 9 IB.?: ; 9 'I 1 .?<n: ; .?<n : ;9 I8  : ; 9 I8 1B !II : ;9 I8( I~ 41B 'I : ; 9 I8  : ; 9  : ; 9 I8 H}I!I/ 4:!;9 I<: ; 9 I : ;9 &IH}1RBX YW  U : ;9 I k1RBX Y W 1RBUX YW  : ;9 I : ; 9 I : ;9 I k 1RBX YW ! : ;9 I8 "'# I8 $ : ; 9 I k%1RBUX YW & 1'1RBUX Y W (: ; 9 I)4:!;9 IB* : ;9 I 8 +  : ; 9!,>! I: ; 9!-: ;9 I.4: ;9 I/ : ; 9 0 I1 : ;9 2: ; 9 I31RBUX Y W 4 : ; 9 5: ;9 I6 17 8 : ; 9 I 8 94: ; 9 I:  : ;9 ; : ;9 <4: ;9 I=H}>.: ; 9 'I ? : ;9 I 8@4: ;9!I A1B : ;9 I8C:!;9 IBD : ; 9 I k E> !I: ;9!FH}G 1UH.: ; 9 ' I : ; 9 I 8 J : ; 9 K I 8 L4:!;9 IBM : ;9 I N : ;9 O4I4P  : ; 9!Q.: ;9 'I R!IS.: ;9 ' T :!;9!U(V.:!;9! 'U@zW: ;9 IX4: ; 9!I Y(Z:!;9 IB[ U\ 1] : ; 9 I^ : ; 9 I k _ :!;9!`1RBX Y W aH}b$ > c : ; 9 I8d : ; 9!e : ;9 I 8 f  : ;9!g  : ;9 h.?: ;9!'<i.?: ;9 'I<j 1UkH}l !: ; 9!m !: ;9 n4I4o4: ; 9 Ip.?: ; 9!'<q:!; 9!Ir : ;9!s4: ;9 I?<t : ; 9 I u.?: ; 9 '<v41w  : ;9 x4:!; 9 Iy41z'I{!I7!| I!}4:!; 9 I?<~.?: ;9 '<.?: ; 9 'I<5I : ;9 I 8 : ;9 I I 8I :!;9 I  !: ;9!!I/< : ; 9 I 8 : ; 9!I! 14:!; 9 IB>! !I: ; 9  I8 : ; 9  !: ; 9! :!;9!I!.?: ; 9!'<.?:!;9!'@zH}  :!;9!:!; 9 IB.1@z !: ; 9  : ; 9!I!8 !: ; 9! !:!;9!4G:!;9!.:!;9! 'I@z:!;9 I 1H}.?:!;9!'IU@z  !:!; 9 .:! ;9 ' !% U $ > &4: ; 9 I?' : ; 9   : ;9   : ;9  : ;9   : ; 9   : ;9  : ; 9 (   : ; 9  : ; 9 I k  : ;9   : ; 9  : ;9 !.?: ;9 '<.?: ; 9 '<H}.?: ;9 'I@z.?: ;9 'U@z.: ;9 '@z.: ;9 'IU@z4: ;9 I.?: ; 9 '@z: ; 9 I.?: ; 9 ' .?: ; 9 'I .?: ; 9 'I@z.?: ;9 'I 41 411.?<n: ; .?<n : ;9 I8  : ; 9 I8 I !I( 1B : ;9 I8I~ 4: ;9 I  'I : ; 9 I8 41B : ; 9 4:!;9 I : ; 9 I8 H}I!I/ < : ; 9 I1RBUX YW &I : ;9  : ;9 I kH} : ;9 I : ; 9 I : ;9 I k  : ;9 I8 I8 !4:!;9 IB"'# : ; 9 I k$: ;9 I% U&: ;9 I'1RBUX Y W (4:!;9 IB) U*: ; 9 I+1RBX YW ,1RBX Y W - : ;9 I 8 .>! I: ; 9!/  : ; 9!01RBX YW 14: ;9 I21RBUX YW 3 : ; 9 4 : ;9 54: ; 9 I6: ; 9 I7 I8.?: ;9 '<91RBX Y W : : ; 9 ;1< 1U=.: ; 9 'I > : ; 9 I 8 ?.: ;9 'I @  : ;9 A.: ;9 ' B.: ; 9 ' C : ;9 I 8D4: ;9!I E 1F : ;9 I8G : ; 9 I k H(I 1UJ:!;9 IBK> !I: ;9!LH}M1RBUX Y W N : ;9 O : ; 9 P : ; 9 I 8 Q I 8 R : ;9 I S : ;9 T  : ; 9!U4: ; 9 I VH}W!IX: ;9 IY.?: ; 9 '<Z 1[ 1\ : ; 9 I].?: ; 9 'I<^41_ ` : ; 9 I k a.?: ;9 'I<b$ > c : ; 9 I8d : ; 9!e:!;9 IBf4I4g : ;9 I 8 h  : ;9!i  : ;9 j 1k !: ; 9!l !: ;9 m4: ; 9 In :!;9!o:! ; 9!Ip : ;9!q : ; 9 I r sH}t4I4u  : ;9 v!I7!w'Ix I!yH}z41{ :!;9!|.:!;9! 'U@z}.?: ; 9 '<~ : ;9 I 8 : ;9 I I 8I  :!;9! :!;9!.:!;9! '@z !: ;9!4: ; 9 I?<!I/< : ; 9 I 8 : ; 9!I!.?: ;9 '<.?:!;9!'IU@z>! !I: ; 9 4: ; 9 I?!< I8 : ; 9  !: ; 9! :!;9!I!.?: ;9 'I 41H}:!; 9 IB.1@z5I : ; 9!I!8 !: ; 9  !: ; 9!( !:!;9!4: ; 9 I.?:!; 9!'<.?:!;9!'I@z.?:!;9!'@z.:!;9! 'U@|H}I~.:!;9 'I@z4:!; 9 IB4:!; 9 IB.:!;9!' !.:!; 9!' !% U$ >  &4: ; 9 I?' : ; 9   : ;9   : ;9  : ;9   : ; 9   : ;9   : ; 9 4: ;9 I?< : ; 9 (  : ; 9 I k  : ;9   : ; 9 .?: ; 9 '<.?: ;9 'U@z4: ;9 I   1U1RBUX Y W 1RBX Y W .?: ;9 ' .: ;9 'IU@z.: ; 9 '@z.: ; 9 'I@z: ; 9 IB : ; 9 .1U@z.1@|.?<n.?<n: ;  : ;9 I8  : ; 9 I8  !II : ;9 I8( 'I : ; 9 I8  : ; 9  : ; 9 I8 < I !I/ : ; 9 I : ;9  : ;9 I k : ; 9 I : ;9 I k  : ;9 I&I I8 ' : ; 9 I k : ;9 I8  : ;9 I 8   : ; 9! : ; 9  I : ;9  : ; 9 >! I: ; 9! : ; 9 I 8 !  : ;9 " : ;9 I 8#4: ;9!I $ : ;9 I8% : ; 9 I k &1B' : ;9 ( : ; 9 ) I 8 *> !I: ;9!+ : ; 9 I 8 , : ;9 I - : ;9 .I~/  : ; 9!0!I1: ;9 I24: ; 9!I 3(4 : ; 9 I5 : ; 9 I k 6$ > 7 : ;9 I 8 8  : ;9!9 : ; 9 I8:  : ;9 ;(< : ; 9!= !: ; 9!> !: ;9 ?4:!; 9 IB@:!; 9!IA : ; 9 I BH}C: ; 9 ID : ;9!E  : ;9 F41BG'IH!I7!I I!J:!; 9 IBK: ;9 IL : ;9 I 8M : ;9 IN I 8OI P4: ; 9 IQH}R 1S !: ;9!T!I/U<V : ; 9 I 8W : ; 9!I!X1RB UX!Y W Y I8Z : ; 9 [ !: ; 9!\ :!;9!I!]4: ;9 I^4:!; 9!I_1RB X Y W ` a.: ;9 'I !b.:!; 9!' !c:!; 9 Id.?:!; 9!'<e>! !I: ; 9 f !: ; 9 g : ; 9!I!8h !: ; 9!i !:!;9!j.?:!;9!'<k.?:!; 9! '<l.?:!; 9!'@zmH}n o Up1RB X!YW q% r$ > s t&u4: ; 9 I?v'w : ; 9 x  : ;9 y  : ;9 z : ;9 {  : ; 9 |  : ;9 } : ; 9 ~(   : ; 9  : ; 9 I k  : ;9   : ; 9 .?: ; 9 'I<.?: ;9 'I< U H}.: ; 9 '@zH}.?: ; 9 'I .?: ; 9 'I@z11RB UX YW 1RB X Y W : ;9 I.: ;9 ' .: ; 9 'I 4: ; 9 I.1@z41 411RB UX Y W  1U 1 : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 'I : ; 9 I8 < ( : ; 9 I : ; 9 I I&I!I/  : ; 9 I8 : ;9  I8  : ;9 I k : ; 9  : ; 9 4: ;9!I '  : ; 9! : ;9 I I : ;9 I8  : ; 9 I k  : ; 9  : ; 9 I k  : ; 9 I $ > ! I 8 ">! I: ; 9 #4: ; 9!I $  : ;9!% : ;9 I 8& : ;9 I 8 ' : ; 9 I k( : ; 9 I 8 ): ;9 I* : ;9 +:!; 9!I,  : ;9!- : ;9 I . : ; 9 I!8 / : ;9 I80 : ;9 1'I2!I3 !: ; 9!4  : ;9!5 : ;9 I 8 6> !I: ;9!7 : ; 9 I!8 : ;9 I 89 : ;9 :  : ; 9!; :!;9!I k < : ; 9 I8=I >4:!; 9!I!? !: ;9!@ I8A : ; 9 B : ;9 IC : ; 9!D : ;9!E!I/F !: ; 9!G>! !I: ; 9!H% I$ > J K&L4: ; 9 I?M'N4: ; 9 I?<O : ; 9 P  : ;9 Q  : ;9 R<S : ;9 T : ; 9 U : ; 9 I 8V  : ; 9 W I X  : ;9 Y  : ;9 Z  : ;9 [  : ; 9 \ I 8] : ; 9 I ^> I: ;9 _( `4G: ; 9 a.?: ; 9 '<b.?: ; 9 'I<( 4: ;9!I $ > 4: ; 9!I &II!I/ 4:!; 9!I  : ; 9 I :!; 9!I!8 >! !I: ; 9  :!;9!I8 > !I: ;9!>! !I: ; 9! !!:!; 9! :!; 9!I8!% $ > : ; 9 I4: ; 9 I?> I: ;9  : ;9 ( S           3#uMX/MX/KZY< KYY [q[Ytttu - .2tY-Xt. tKWjw< M./tYu V.st J rft r  q= <K Y =.~%< yXX*XX UuvyX..J=usY [t !=M u  uJu ;n =tY p  ~tYMg K<" Zu#&            KrX/// K|#Xtzt?zXtzJXfzJJJ |fY  z .Jz OIKfJ ~JftsttY ~ J!J!lx| L  <o f .*.. XY;iZ~!!lSy t  Y~ .../=f.J-xXX..X XseJ<.eX#YX@ X f n iXZ & ~  <<~ Jh  <}X/ ~ }t J    X}  ?UX w _L XY  {  J{|z&ztB.\- ~JXMK  ~[f$m WY mX$F$tY= X}.YPIK .  kX!K=!:&<uXX x6xJ6xJRx< DYu= .-X oJ m/Zs t/ h JcQ E uw< JwJ fX  wJf<Y  uf JZs t/K  3<JK "Jat(t %.~%~  y ;XGX ZJ $<=   VY;=Yg;Y}} X}tXJ<YXJg;KY~X .{J  {xX XJ{K X=sJ <=r<>HLJ*K~ t^YK fjD<r%.Kgf | XX<<'.$X.% KX Ju   WX . JY* ~zJ ..X.K* ~ XjD2,<B.KJ*u~t<tX X          X.< XKu`2{J $Jf {JttJ~ttY 3 J!J!lx| L  <o f .*..!!lSy t  Y~ ..= J-X..|.t$Y~"w JwJ w-=XY .-XsXJ  ...XwY }<XIK ,z Y,Ku}<u}}.83K |J =`|xX{Yn J+ 3 zKYYfv XWfY2K< + Xa @< t=XHwJ1  wX XXJ=J {<=!s qX<;<JJJY /s <YsX <f<X <XXt..n<p YMgt K<"nJ=m!J!lSy   ]J= oX~ JYm= oX= X 1G1J<YSJJ<YWfX ]#YZs.|btWKZJY tKuWLHK~X{X.XtXtXtXtXX.XtXtXtXB!Zs t.JK|hb=ZY7 ttJ=J@J?BX![Zs t.JK|YU=KKX!GZs t.JK|hbg=ZY, tt=J fY Kfr!NZs t.JK|Jtd U=ZK% t=J, X" YZs.|jTtX<.WKJZYJ* |fKX$XttXtXtXtX_tX< !l: v t< E;JsO tYg J  fZXm tY h J lo f.sO  vt    J  J$  <\  J  J  J  J  J  J  J  J  J  J  J  J  J    J  J?  !   lz&z<BJ;K Xr >>0yX#2f   JEu .u  Ddu  ?JuJuJuJuJu"Ju# Ju$!Ju%"tut=t=*'Ju"Ju)&Ju#J mt~  ~. ~f<~y<}<<!(}~<}ZJX.Y?9ithtY -Y .X[Y ?u tY/e=v W%/sJ=<Zf = -zXK= -X~!s =<Yv9Z/< |Xh utXwy.yJy<fs tK  YXL X L XR ..x.[ Xy u}Y= ..-Y ..ytt !Xt qt= qXt qJXwu| w t Z<R #9 ?wv<!t(<t!t=(<t!tK)ut <')K)K,wt <3&u&u,<f%t=(u tK) KtK) KtY) ut) utY)vA,tu"&u!u&u <<pX) u) ut=@IK !q t<Yq v< t<qJsrK  f#; fq u= ...-"cXXZJrmY h ].,dfp X<N7]eZXZ:;L'< ...Y.qX.srt r,Y ?JYY ~!!lSy   ]J`K ~JmEz   L  <J<L":K"JKZ= ..- X ~Y .X,..Yw v< < pJ X==qH30JYZs.ps t o/J  yX=J=o= oooJ JyX=Kv %w.~%~ <  ] =}K\bK?q= X ]/ <..pX<n t >Vg[&{ <}~ t |tX  | X= Y XJY Axu vX r [t.fX.d ` x zX<r `ft~fYz Byu s ]XXj xX`x Xw..= JYYY< $Y A|u v ]XXj xX`x XYz"lz<Bu{ufmX <X<<s.s s~ sm/ h2 {s ["f <Ig&t? YKHK = /Y .tL.tte<fKguLVrt t$ vȭsX    K/<sgur t bJ J< 'b J<k<< .$r< .{h @ xf  fY !v v u/= -rXwmgZs t/ hi bt<X<<zXX8@u #f<`w<sw SX.t$tM. !w4w u= ..-Y J$Wt.R.<X<<wX.sw X X lg(Z)mX .YxfD{uf=goJ.J.Sp.X.=usY< #sY;J_zm<Zs t/  X* zk{~ X XbJ<J'< X$b<<$yt<z  ^ zzZs t.JK |~ vX=}yJ}t}t<JvJ|<J|<KXYzsZX zftyL h<y=t]y J y<[z uy} u} =I= .ejXz~ XX<<'.$X.e. |<!Z |~<<=~3JYZs. }< <i~3JH0YZs.* ~gf |}XYe? }}33YXt 9= ,> :=>=s=/Y - YoX t.tX"o Xs .sX Xy  tv %.~   z@z  svD|tXU=8MY+vK+MJJuJJXttJXp FtJ; fu Cbr  vM u u    J      |J|fJ.gJJ=K /oXu z|.K /|X.. .t@ !u  u uu!J!lSy   ]J  v~ Xt < uJX v  X vJX >fX<u1z Y X.Xa<!J!lSy XX  ]JJ .X~ tJ .XY }}.J}</ut|JmEz   L  <J X t t$L|!!lSy   ]K.,.~ XX Yf==  u ZtJmEz XX  L  <J 'i .st!!lSy   ]K v  <v  X.v.X,.~ X .u.XY^zP~u~ftPg zt|JmEz   L  <J ~t t~K|!!lSy   ]K.X.~ XX .NF.==L<ZY f=>ʃ< ..jXY==fL3JJ ygut <Kt6 yguyXt xXK  x]wJ>wmEz     <0l ..sX .t. Xw!!lSy   ]Ky <y X.y.XVX~  .x.XY.=><D x mXY m X rX< r [ < u XXY&~.J ~<> wgut  v ]uJmEz     < 0l ..uX <u.`u!!lSy   ]Kw <w X.w.XVX~ X .v.X XYf== ugut   t \tJmEz     < 0l ..vX <v._t!!lSy   ]K u  <u  X.u.XVX~ X .u.XXt>i <Y !v % v uu!J!lSy   ]J [t wm<YZs t/ h v w~ Xt < v.Xw X w.X<X<X w  ;=/ [Y= = e// .tKh !u X{Yg=zB {gut  z[yJmEz     <J0l ..nX < n.{X.  < w.^y!!lSy   ]K{ <{ X.{.XX~  .z.X  tAi <Y !t  t ut!J!lSy   ]  dt  um  uf < u<YZs t/ h J  uY  tf J0 J t<<<'.$J! .Nv~ Xt < u.X v  X v.X~ t9 tf tE km !t XwJ!I =<Z eK;^u< < fX< yX< nX < rX < X:>=i <Y+ z u|z!J!lSy    P {m<Zs t/ th J   {Zs t/ </Y>t {guuX~ t< {JX{ X {JX  A.f"AX !z<X< !zXfY. {.x fu xf.fi <Y !w w ucv!J!lSy    v xm<YZs t/ h= w xYx ~ tXmfxX<X<X xYXgg x'?XX !wXyJY</YY]K Yz HWf t&J| 8;=XwXZ XXX Yq.Jq<<r< wgut  v | zZs t.JK|iKK<uY w0gZs.=i <Y !x( x u~x!J!lSy   ] JXt ym<YZs t/ h y  y yYz~ Xt< Jy.Xf zy X Jy.X<X<X yx tKx tMv Y WKKhKyXytJ.gXJ=Kk !xXyJ..|t0J$F @<Y<{!J!lSy   ]J <gX}.~ Xt< |<Xv.3}.} X} Jv<LHK XY/ q uXr~ tX  xXdZXs~ tX rt.X  y~ {Zs t.JK} vf=zJzzt<JVJK z0Zs.>t5 <Y# zYutx!J!lSy   ~ tX ׃sfs ~ tXs~ tX   <uK q @ Y X$K&L <&J <&f"  qJY q< q3X<3JZs/ qt< qXvf Js UXF==YYCwJ=xtQY a_ = XY<1 < YVY= `<XuKXY X e rX #J^"JZ s uXs!J!lSy    5 sXt ~= t   t s Zs.tK~|=JoJp  h=J  tZs. =X = q p  p pZs/fs fi8X=YI=Z!/X} ~= t   t  tZs.tK v hHY !/Xx s u sX t~ tX ~ZYX vXtzX |X. vtt%p zB }KKKKKX!ZX8Xriq JstPzt7Y IK sK/f  u ;KZ<Y JY}.lXKLY u;uY;Y t}!!lSy   JXu ~<~tXmEz     <Y 0Y~!!lSy   ~ u w<=#J> u=t=Kt=t=Z<Y JY}!!lSy }!!lSy   ]X~ X<  .sM=uʃJ ~8 }JYMg K< Z ~LK <f` ztw~ RJmEz   L  <JyJyWu XZ&6 X }fw~< w.X[.#~ft#<< ~L.KXx < x.X Ys s[ JiKtYYW/IK  JKP K"J J6!e/!;f r+ A.X %g(r J I<qp YMg K<"~fKrX =X .-X s([#JJY2fjJkX s r  rtX sX .cX+&JNX <#'"<,'JV JxXXZX$)hXw Y Jz.RKKYfu= e[Xg <J(;%Y8t&h2WZ f TX y. I= { }X=X zJys tf ~KJx<Jx<J=~~vKKtX {X /00t9X99:#yXtY JPk//0999: KJy] T [ J 1 _XrJ X  lXXX YJ=UKKu4 W= Xx X/v  LV= (r  s< pJmEz     <r q~ RmEz     < yg Xq~yv X y<yXx<>xX nȞwXXr  frXX  pXXX  gw <rXX~X  Yy.QKx <Wu.K;u .i.zX J w }uJ  JKv f9uts t utf ~J tt Jt< JvX=~~KvKKt tJm fYwKWu XZ&6 X }f  <s .-yX uJmEz   WL  <KX  .u.X#~ft#t< ~h.  /00t9X99:$uX =J#Gw<<vvX~ RJmEz     <J i K J K Lv~ < v.X v.  v fvJ  v<L.KX v w < w.XYu Kt <uh[G=YK{[ JiKtYYW/IK6f O"f= f-X:<f Jhf(<fMJf ftZy J t.X u W="Ys= ....`X) KZJ 9/}* 0r>Jgf <<jXf&f <$ v zJ!rO1<0Kx|KWu XZ&6 X }#~ft#t< ~hXf!u xX<vX~ RJmEz   L  <J tvfs thv~ vu~ ~ .~.Xw. .vXXcJ4~  [(z  zJ 6 x<RZH<J K[<"f<JJ K |X <JJ K | <<i xJmEz     <zz XXz_!J<XJ(zzJf :.=Zv tv s x<>xX Kxw x JYYxPfy< eY K fXfy. f.!r  @s f s~ dt JXsX uK Xuu XZ&6 X }#~ft#t< ~vX  t JYY K:uKX tXX s X~X~X.x< yJtts tf ~<< .X |<=~X~=JvKKt uJu XXZ&6 X &[us< JK s  XIK smEz X  WL  < JX .... tXJX  /00J0t9X99:#  tJXX X ...s.Xa ad<!J!lSy   ]JX LtXX:fx<x z{ff|Jfs f ~}0gZs. =I Y  0.XXXt~rY~t"t|~X. }==}.}t{|J< |XXXX!t w.<X <uX~ RJmEz     < um<YZs t/ t0 J  ( Ki u  YW/ 0  @>&t~ tu<} X} .}.XwX u. <ufN ,h:v YeX !s tX~ RJmEz     < DK ft~ U< +.XtX     =W L y._?X u JYY K:uKX uX   ` . wKWu XZ&6 X }#~ft#t< ~vX s tX JK vJ Jg vYYJ =v 9=KX vX  W tX~X~Xb M%K(tYf ~#< LL fU &tiKtYXg X  q p 7* Xw .  }f*} _. vX}}fX !t}f,G9GJ9JXB>BJ>XJXg[%[J%XJ g X(XJ(XJ r s sJ XJX r TaaJXJX$JXJXlQ/QJ/JXJXJXJJX4L4LJ4XJXakkJJXr"w"9L JK% -%/gX gfxJJX z, XJXJX|<JJXr EXJX JXJX J<XJXHXJXi<tJJXfXzzJzXlzfX.zX|.xJ8X J  xJ X.ktJXJf  ff.Xfwtf .f tff.X&XyQyXJXyJtXJXyv<~J~< JXt.X s JJXJXstJff.. X<as,JaJXJX~~J~<}JXJd XJ<X}JXJJ JtX.JXtJtXpf~JJX.JJXzzzJX voJJofX.f J~ X (           ..fyK Y~uyttv <tytttytiuqL~[ =M  I suJ yYoy/fz<^/zf<=zZyX/zf<=zX .vxpK{tt<Y= .-Xyx. YtttvX.<ZX..XwttY. y<1qMttt]f        x $=Jn4gKKD ~HB,hJAI AE ,WJAv AE T_KGE B(D0D8DH 8A0A(B BBBE <LKED D(b DGBTKBB B(A0A8D`C 8D0A(B BBBE C4~KAA iAB${Jlx $~Tet0GFB B(A0D8D@ 8A0A(B BBBE d8D0A(B BBB$@LFDb AE v AE V AE EA0<FEO MF AE F AE ,-JEXA$OP[ E U<BKFE G([ ABBXKBB B(D0A8DQ 8K0A(B BBBE  8D0A(B BBBE N$:tKBB A(A0 (A BBBE A (A BBBE  (F BBBE $f0\GIB E(A0A8G`7 8A0A(B BBBE $6`LKBB A(D0 (D BBBE TKBE G(  ABBE u  ABBE $(x ,JEA,<GBD A(|  ABBE LGEB A(D0 (A BBBE <IKFD G(c ABBTKBE B(E0A8Kp 8A0A(B BBBE TNBC A(  ABBE C  DBBE $K(t/RBE B(A0A8G@ 8A0A(B BBBE Q 8A0A(B BBBE D)@Z8A0A(B BBBlGEB B(D0C8g 0A(B BBBE W0A(B BBB<(8E0M(E BBHLGBA D(\  ABBE W ABB4$(E MEBlGBB B(D0D8 0D(B BBBE Y0A(B BBB\GEF B(A0A8DX 8D0A(B BBBE 4MLAqAJ,FA AE \KBJ K(I0^ (A BBBE N (A BBBE $kN_ E j"DWKAE r ABE ADB<JAH AE j AE 4fR AP tATGBB E(D0D8D@ 8D0A(B BBBE <KEA D(W  ABBE T]KBI B(A0A8Dh08A0A(B BBB$ThDJAN AE ^ AE NADuKEA L FBE ACB,AJKfA,KBB B(A0A8GHa 8A0A(B BBBE  8A0A(B BBBE  8N0A(B BBBE I 8A0A(D BBBE D 8N0A(B BBBE I 8I0A(B BBBE  8D0A(B BBBE ) 8D0A(B BBBE LPHPNH` 8A0A(D BBBE ,OJEzA%\KBE E(A0A8G@ 8D0A(B BBBE $(@4`GAC Z ABE   KBB B(D0D8D@o 8K0A(B BBBE  8A0A(B BBBE  8G0A(B BBBE $@\?KEE E(D0A8DH% 8D0A(B BBBE $GH4KHA  DBE  4HPAhAJ,6JCcA$ M0 E !x ,t-BEB E(D0A8GH. 8F0A(B BBBE i 8A0A(B BBBE $AH\ KEB B(D0D8IHB 8A0A(B BBBE $&Hx $AJl G ,sJA^ AE 4sJGG TAAx ",UJH}ADKKI G(C0(A BBBDUGDC v ABE AAB ,sFQ E K:DaKHC h DBE PAB,JHwAtKBB A(D0Y (A BBBE g (D BBBE A (A BBBE $&0$T$JR E lqKBB B(A0D8 0A(B BBBE  0A(B BBBE LGEB D(D0 (A BBBE 4"0V(A BBBLbGBE D(C0 (A BBBE LvGBE D(C0 (A BBBE L1KBB A(D0D8U 0A(A BBBE ,F E A E ,F E D E :D{FDZ AE D AE AAS4F~ E qYK E D E :,cJARA,FdMF E F:,qJA`A,F\MF E F:L+GAC (M F ABE ] ABE @ DGAA b ABE FAB: DGAA b ABE FAB: DKAD V DBE t ABE j \KBA D(G0Z (D ABBE n (A ABBE $0DKAD V DBE p ABE 5 \KBB A(D0 (D BBBE A (A BBBE $0LGAC y(M J ABE  ABE W dKBD D(  DBBE l  ABBE V  ABBE $M(<KBH E(N  ABBE X  ABBE V  DBBE L  ABBE L  ABBE L  ABBE $e(DKAD  DBE A ABE 5 ,_JH@ AE <DJAV AE C AE NA4YQ AK vA4qKHG ~ ABE ,BJAqA\KBB B(H0A8JX7 8D0A(B BBBE $X,iJAXA,$7XZx ,HJClJo#\zGGE A(H0 (A BBBE I(A BBBTKDD Y ABE K ABE S ABE dKBA D(|  ABBE P  ABBE A  FBBE TyKDD K GBE ^ ABE S ABE ,FAR AE  lGBA A(F0`(F  ABBE T  DGBE n ABB$5(DQAC o ABE WE * <KBE A(r  ABBE $@(GBA A(B  ABBE 0N(F  ABBE V  ABBE a  DGBE x ABB$z(TzFAk AE a AE A AE D AE DA=dGAC e ABE R ABE T IBE _ ABE 9 |*GBA A(}0N(F  ABBE I  ABBE a  DGBE t ABB$5(|*GBA A(}0N(F  ABBE I  ABBE a  DGBE t ABB$5(TqKAD o ABE G ABE A FBE 4 AGBA A(0N(F  ABBE A  ABBE X  ABBE a  DGBE f ABB$5(T[KAD s ABE | ABE A FBE  TJEP AE S AE S AE [ AE SAd9KBA D(}  ABBE   ABBE A  FBBE $(LKBB A(D0DH 0A(A BBBE $H@GBA A(  ABBE D  ABBE U  ABBE a  DGBE  ABB$2(tKBB A(D0v (A BBBE ] (A BBBE b (F BBBE $~0TKEE T ABE d ABE _FB8 \KBB B(A0A8D 8A0A(B BBBE $O\KBB I(A0A8Kp 8A0A(B BBBE $pCx <GAA G(w AAB,FD AE $JAD , V AAE ,CJArA, JD AE >tKBB B(D0D8GP_ 8C0A(B BBBE D 8F0A(B BBBE $,P,wJ E [ G TKHE i ABE l ABE }DBDGBA A(G8 (A ABBE $8lSBB A(A0 (A BBBE @(A BBBJ0,T0g8O0,Sn E f E _14@FCg AE DARD>KBA D(  ABBE $(|GBA A(l  ABBE 0M(G  ABBE I  ABBE d  ABBE D"KAE  ABE mDB, p(E0T(A GBB B(A0D8p 0A(B BBBE  0A(B BBBE x 0A(B BBBE 8i@EHHPI8v@EHHPI8F@U8w@BHDPR8f 0P(B BBBE B@P8F@U8F0C(I BBBDXGD p IDE YE TGBE F(G0E8FH 8G0A(B BBBE !!\KBB E(A0D8D@ 8D0A(B BBBE $~@d}KBA D(  FDBE R  ABBE   ABBE $(L}KBB D(G0a (C BBBE YGBB B(A0A8GHF 8A0A(B BBBE s 8A0A(B BBBE V 8A0A(B BBBE E KBB B(A0D8Dm 8K0A(B BBBE  8D0A(B BBBE  8D0A(B BBBE luVLIEXyYwPQWHKADKDD  FDE  ABE \E j(Q w(I0D8I ^(S v(H0O(A (D0T(B }(H0I(A ,\PA@A$KOr$M0y E 0x TKHB B(A0D8D@ 8D0A(B BBBE a<cKBA D(G ABBLKBA D(J  ABBO e ABB<lKIA A(L ABBcall_get_stackstartparentlookupkernel_siginfowritten_stamp_sigpoll__compiletime_assert_109initializedSDEV_CANCELkill_sb__bi_remainingnum_bugsnr_requestscftypesecurity_supportedsock_fprog_kernklistusercntirq_delay_totalstatefc_non_bls_respstatsdev_loss_tmousersactive_basesDEV_DMA_COHERENTswap_slot_free_notifystart_databoolcompact_order_failedbv_leninquirymodsctimernid_atypedestroy_inodecma_pagesfutex_pi_staterport_priv_sizei_mutex_dir_keyrescue_workrestartsdevice_physical_location_vertical_positionget_aclset_aclac_exe_devmemory_tiers_voppercpudescpoll_bioiterate_sharedmemswsym_vdso32_sigreturn_landing_padfc_fpin_statscma_areafeaturesrcu_tasks_exit_cpulink_fdmigrate_from_cpubd_size_lockwriteerror_codebuddy_listref_ctr_offsetsldt_structprog_attach_flagsfcp_control_requestscred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_nameVTIME_INACTIVEmg_src_cgrpeh_target_reset_handlerclass_preempt_is_conditionallink_createtimeouturing_cmdshrinker_idnr_dirtiedgetattrBPF_SK_SKB_STREAM_PARSERsetattrPTR_TO_TCP_SOCKvmstats_percpufixupblockMQ_RQ_IDLEdevtlast_cpufor_backgroundnr_wakeups_localcn_sig_warnuidhash_nodemax_ratioalloc_cpupost_attachworker_privatepoll_eventalloc_factorlinelinkbi_pooleffectivecompact_blockskip_flushmoderead_chardestroy_emserver_pick_tasknode_idPTR_TO_STACKtargetget_nextdqblkrcu_tasks_idxBPF_PROG_TYPE_NETFILTER__ret_do_oncejournal_infobi_inline_vecstqheadlast_used_atrq_end_io_retline_offhres_activeold_subtree_controllesb_link_failmod_namenotes_attrsdelay_workFC_VPORT_NO_FABRIC_SUPPblock_device_operationsoffset_ctxbi_blkgFREEZE_HOLDER_KERNELtail_call_reachablelast_switch_timefcp_output_requestscompact_init_free_pfnwakeup_countwait_indexlog_sizerunnable_weightFC_VPORT_FAILEDmap_push_elemtarget_busyclass_releaselast_sum_exec_runtimedd_key_trueFC_RCTL_ELS4_REPFC_RCTL_ELS4_REQsa_handlerfree_countcg_listscsi_transport_templatelocked_vmqueue_rqaddressmq_hctxstart_timeRPORT_EV_STOPzone_wplugs_hashkprobe_multicookielistfreezersig_okextabledma_data_directionmax_entriesi_sizeentry_eipcgroup_atypesplice_pipexstate_headerinquiry_lenrtpoll_timerdma_addrem_perf_domaind_flagsdying_tasks_large_mapcountnode_present_pagespid_namespaceliveclock_was_set_seqspc_warnlimitseqcount_tmin_fltblock_devicethreadedfp_fidMEMORY_DEVICE_GENERIC__preempt_count_dec_and_testpkruBPF_MAP_TYPE_PERF_EVENT_ARRAYattribute_containerprojid_tvendorvport_idmemcg_nodeBPF_CGROUP_UNIX_SENDMSGdma_lengthcn_clearkey_payloadadd_linksnbp_th_start__empty_insnsiuse_10_for_msBPF_RB_NODE_dummy_bndexception_cbBPF_TRACE_UPROBE_MULTIper_cpu_pagesetfcp_cmndsaved_stateparent_exec_idutil_sumdd_key_falsesigvalfsnotify_mark_connector__ubuf_ioveccputime_atomicdeadlinebio_integrity_payloadlun_in_cdbexit_requeste_d_tovwait_queue_upperclass_write_lock_irq_is_conditionalcgroup_fileswap_readahead_infovtimeexpecting_cc_uas_rootli_device_specificstack_refcountgrpmaskdevice_attributes_remove_countBPF_SK_LOOKUPlru_genwrite_newuser_namespaceclass_rwsem_write_is_conditionalpids_active_resethlist_nodeblk_features_tsuper_operationsautosleep_enabledwrite_file_infoload_sumaddress_spacecpus_maskdl_yieldedstarget_dataextension_progfile_dispread_newd_spc_softlimitfc_discuse_10_for_rwkrefrseq_css_lock_keydqi_flagsmq_ctxjump_entrypi_top_taskhlist_nulls_nodefc_els_lesbpacct_structac_padpathnameuser_sizelast_queue_ramp_upbd_statsshow_fdinfoFC_RCTL_DD_DATA_DESCFAULT_FLAG_MKWRITEput_budgetfadviseclass_read_lock_irq_is_conditionallesb_inv_crclinenoMODULE_STATE_LIVEtask_listtc_at_ingressasync_scanPTR_TO_CTXFAULT_FLAG_RETRY_NOWAITBPF_CGROUP_SOCK_OPSread_foliosc_data_directionhas_elevatordtordq_countvpd_pg0nlinksignalnr_wakeups_passiveprov_entryself_exec_idstate_syncedws_activefr_max_payloadf_epctl_table__this_modulercu_specialprog_fdscsi_device_handlerentryold_subtree_ss_maskbacksda_is_staticBPF_MAP_TYPE_LRU_HASHfr_flagscgwb_domaincnts__UNIQUE_ID___addressable_init_module660sockidr_rtsdev_bflagsdispatch_fromdqio_semnr_linfoRPM_REQ_RESUMEmq_freeze_wqstart_prevent_timepgd_tsigset_twq_offLPORT_ST_DNSmap_btf_idbucket_idFC_RCTL_LCRrstat_flush_nextignoredgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64prog_id__list_del_entry_validreserved_tailroomi_inoserver_has_tasks__UNIQUE_ID_author654_killRPORT_ST_PRLIpgdati_spc_warnlimitunderflowf_posBPF_MAP_TYPE_HASH_OF_MAPSperformancesoftac_pidowner_trapnoload_weightBPF_PROG_TYPE_SOCK_OPSfc_fh_typesleepablevport_statesymlinkclass_rwsem_write_try_is_conditionalbd_queueerror_framesin_iowaitDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclbdi_writebackrb_leftmostdst_neededbug_addr_dispmigration_pendingscan_mutexhosttd_realns_commonmap_ifindexdevice_get_match_datas_max_linksctl_table_rootfc_rport_eventscatterlistverified_insnsthread_headacquire_dquotclockid_tfifo_timetarget_destroyzone_capacityFORTIFY_FUNC_strlenFC_EOF_DTIpgdval_td_managedevice_attrsmax_ctx_offsetis_late_suspendedmax_device_blockedback_padMIGRATE_SYNCwcharRQ_END_IO_FREEseq_filefcp_output_megabytesonline_cntBPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATEDrestoreline_infoHPROBE_LEASEDBPF_LSM_MACthaw_superspp_type_extalt_lenseq_operationslesb_prim_errfallocatelog_true_sizedst_pending_confirmgranted_mac_call_addrwriteback_sync_modesi_mmap_rwsemundo_listattribute_groupdma_poolspersonalityprintk_index_sizeuprobe_task_stateWB_REASON_BACKGROUNDstimestatic_priotmpfileattach_func_namedata_indqi_formatnvcsw_nr_pages_mappedfrequencyrtpoll_totaldev_pm_opspfmemallocblk_mq_ctx__UNIQUE_ID_debug_logging658no_updateiter_typeDEVICE_PANEL_BOTTOMscsi_pkt_lockencap_hdr_csumtransporttmap_get_next_keyBPF_SK_REUSEPORT_SELECT_OR_MIGRATEnr_wakeupsquery_spp_resvdbpf_prog_typeenabledki_filpmultiple_queueswork_func_tmemcg_vmstats_percpupp_magicfpu_state_permfwnode_reference_argsdevres_headused_maps_mutexremainingRPM_REQ_IDLEfilenamebaseRPORT_ST_ADISCac_ppidd_prunerestore_noirqr_ctlsysfs_registeredDumpedFramesrlockBPF_PROG_TYPE_SCHED_CLSi_rt_spc_warnlimitqueue__compiletime_assert_82__compiletime_assert_83BPF_PROG_TYPE_CGROUP_SOCK__compiletime_assert_85__compiletime_assert_86__compiletime_assert_87__compiletime_assert_88__compiletime_assert_89fc_fill_reply_hdrnuma_migrate_retryMEMORY_DEVICE_COHERENTenclavefiltersaved_dst_prog_typeroot_blkgd_revalidateLPORT_ST_SCR__compiletime_assert_90WB_REASON_PERIODIC__compiletime_assert_92__compiletime_assert_93__compiletime_assert_94__compiletime_assert_95__compiletime_assert_96__compiletime_assert_97__compiletime_assert_98__compiletime_assert_99cgrpwatermark_boosttracepoints_incoredqsi_opsubtree_controlquota_syncsrcu_have_cbsmemory_peaksInvalidTxWordCountasync_in_progresssignumdqi_dirty_listpi_lockdirtied_stamptm_donetimespec64BPF_WORKQUEUEscan_finishedlesb_sig_lossreplace_bpf_fdnr_forced_migrationsdst_mutexumount_beginchannelbadblocksnr_descendantsll_nodeport_idkernfs_nodecpumaskptrace_messagehton24lengthFC_RCTL_ACK_1tag_listbio_alloc_cachepdt_1f_for_no_luni_wb_frn_avg_timeBPF_LIST_HEAD_pincountreclaim_statecur_imageruntime_errori_sb__poll_tbpf_jit_poke_descriptorsubvolon_dispatchdirty_inodesymtabd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structfs_parameter_specrcu_data0real_blockedruntime_suspendspp_params__s16BPF_CGROUP_UNIX_GETPEERNAMEwifi_ackedbacktraceoffline_alreadys_umountn_nodeon_listcn_lost_creditrefaultsdata_vmneeds_force_resumeblk_eh_timer_returnbtf_recordcsum_levelrpm_statusscsi_host_statedeferred_split_queue__s32p_sizechildrenbpf_local_storage_map__mono_tc_offsetcheck_eventsmarkfc_rport_fcp_initdqi_bgracei_wbhost_nof_inoderx_framesserialburstname_offpermissionsgraph_rootkernel_load_data_strcgroup_rootscsi_target_statehostmsi_device_dataslave_destroykallsymsmap_alloc_checki_ino_timelimitbi_issuebd_holder_opsBPF_KPTR_REFlink_idscgwb_frnsrcu_idxSTARGET_CREATEDutil_est__s64ipc_nshugetlb_usagebpf_cookiesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenacct_rss_mem1___orig_eipsrcu_datadevice_physical_locationcgtimebypass_spec_v1pagefault_disabledindex__preempt_count_adds_time_maxucount_maxdelayed_workprog_flagsopen_partitionssa_maskkswapd_lockmmappedElf64_Wordold_dom_cgrpjited_imageactive_timeatomic_flagsnum_jump_entriesextra_lenPIDTYPE_PGIDbtf_vmlinux_value_type_idmnt_namespaceelemwb_completionend_ioquotalensrcu_data_have_cbsnivcswoffdev_tidlinfo_idxmce_vaddrBPF_CGROUP_UNIX_GETSOCKNAMEdl_dev_stateFC_RCTL_ENDshowrb_subtree_lasts_listpage_addrBPF_MAP_TYPE_CGROUP_STORAGEhigh_workmq_pollsender_cpunr_segssame_target_siblingstailcall_targetof_match_tableBPF_PROG_TYPE_CGROUP_DEVICEfc_tm_flagsino_timelimitfc_setup_exch_mgrcpu_numberalternative_gpt_sectori_readcountFC_RCTL_IFRHblkcg_polsincrfreeseq_offloadrange_cyclicprog_cntlock_countthrotl_datalist_lru_onei_pagesmxcsrarchdataptrace_entryuid_mapguest_permwait_queue_headnum_srcu_structsnr_activeprev_sum_exec_runtimei_flagsgendisku_flagstag_set_listlogical_block_sizesubtree_ss_maskinvalidate_lock_keyinfol1d_flush_killctx_outFC_VPORT_ACTIVEtimestampsfc_els_spprlimit_maxwrite_beginSHOST_CANCELbpf_prog_offloadwrite_infohrtimer_restarts_encoding_flagssessionids_time_minseq_ptrvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrbpf_iter_aux_infos_stack_depthnode_offsetkprobe_override__vm_flagsresid_lenqueue_depthbpf_tramp_imagecsum_offsetpm_messagememcg_lrufred_cschangedvportpao_ID__cur_ktimeinitfop_flags_tgroupsoffstty_structnotify_nextvirtual_dr6dma_opsdma_addressmmap_basebd_devsyscall_workinit_cmd_privelowbpf_trampolinelockdep_mapnum_trace_evals_addr_bndcgroup_base_statset_dbd_for_msnumberzone_device_dataquota_readloss_of_sync_counthlistpinned_vmfunc_cntwritepagesnuma_faults_localityqrwlockPTR_TO_FLOW_KEYS__write_overflow_fieldrw_semaphoreattach_bpf_fdfirst_minori_blockstask_fragWB_REASON_LAPTOP_TIMERsource_listsum_block_runtimeBPF_NETKIT_PRIMARYnuma_scan_period_maxtotal_timepowerrequest_queuenum_ei_funcsi_generationfcp_input_requestsflushBPF_PROG_TYPE_PERF_EVENTtask_fd_querymg_dst_cgrponlinernid_ip_addr__compiletime_assert_664BPF_PROG_TYPE_RAW_TRACEPOINT__compiletime_assert_667__compiletime_assert_668no_vpd_sizeformatlast_switch_counthardirq_stack_ptrlast_wakee__cloned_offsetswapuint32_t__compiletime_assert_674ssize_tRQ_END_IO_NONEvtime_statetry_vpd_pagesparent_could_setfcapper_cpu_nodestats_blocksizequeue_numprevent_sleep_timeclass_spinlock_irqsave_try_is_conditionals_readonly_remounti_io_listrefaultedspp_resp_pachild_countBPF_MAP_TYPE_ARRAY_OF_MAPSrelease_agent_workVTIME_IDLEBPF_PROG_TYPE_STRUCT_OPSwb_domaincgroup_subsysnbp_th_nr_candip_summedcompat_uptr_tcgwb_treeDEVICE_HORI_POS_LEFT_hugetlb_subpoolend_pfnuclamptgidlimits_lockreleasenr_wakeups_migrateserial_nrstack_vmi_fieldmaskupidBPF_CGROUP_INET_SOCK_CREATEprotection_supportkcompactd_highest_zoneidxfreeze_mutextrace_evalsia_vfsuidbtf_mod_pairquota_format_opsi_datarescue_listfsverity_infocore_threadclosidsched_avgRPORT_ST_PLOGIcodeBPF_LSM_CGROUPu64_stats_syncsyscorenr_reserved_highatomic__i_nlinkpmd_tinumli_invalid_tx_word_countsrcu_barrier_cpu_cntbatchedreadaheadopt_sectorsFC_VPORT_FABRIC_REJ_WWNhrtimer_cpu_baseirq_domainwait_liststatic_call_trampac_etime__UNIQUE_ID___addressable_cleanup_module661fsverity_operationscoublockbug_tablemigrate_modesecmarkusing_gplonly_symbolswb_listremovedhandleremulatednr_writeback_throttledsym_vvar_pagemembarrier_stateBPF_PROG_TYPE_LWT_INdma_pad_maskBPF_KPTR_UNREFbin_sizeFORTIFY_FUNC_strlcatrcu_read_lock_nesting__UNIQUE_ID___addressable_fc_fc4_deregister_provider675reg_typecb_accessrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_tio_bitmapDEVICE_VERT_POS_CENTERretry_countsbitmap_wordmanaged_pageslong unsigned intmax_timelast_queue_full_countread_file_infoexec_startia_sizeema_listRPM_RESUMINGunpinned_netfs_wbMODULE_STATE_COMINGsym___kernel_sigreturnZONE_DEVICEfunc_info_cntuser_cpus_ptruser_scand_opstate_initializedrelease_dquotplugsoftirq_activatedkey_sizeinv_weightsecuritykernel_symboldl_timerlockdep_map_pmodule_param_attrsdirty_ratelimitno_read_capacity_16scsi_host_template__user_state_sizechainedVTIME_GUESTretriessdtrsysvsemdisconnectstasheduser_xfeaturesdisc_mutexuse_memdelaynr_cached_objectshas_timeoutcgroup_namespacecommcallback_headhead_fragpagefault_disabled_decexception_table_entryin_hrtirqctl_table_set_overruncondhash_lenDEV_DMA_NON_COHERENTcoredumpd_sbio_lock_cls_keyksetsleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsnodesysvshmno_highmemdata_outfirst_nfctSecondsSinceLastResetactive_countRPORT_ST_RTVnr_active_requests_shared_tagsnum_tracepointsvpd_pgb7ueventfc_pri_tablocking_notifier_call_chainsharednext_cpu_batchmemcg_completionsdisk_eventss_sysfs_namesigval_trqst_qSDEV_QUIESCEmap_pop_elembitsbase_pfnclass_mutex_try_is_conditionalsem_undo_listcompat_rmtpclass_local_lock_is_conditionalget_currentstatic_key_trueno_fcs_stimeinsnsperf_event_ctxpprogsOutputBytescostxcomp_bvio_contextPIDTYPE_PIDwakee_flipsvlagufdsvlansegment_boundary_maskattach_tracing_progioctlprev_cputimectx_inbtf_flagshorizontal_positionem_perf_tablebi_crypt_contextprivateswp_entry_tcharFC_PORTSTATE_BYPASSEDmatchnr_failed_migrations_hotreg_offsetBPF_TRACE_KPROBE_MULTIqueue_stoppedFORTIFY_FUNC_UNKNOWNwrite_charbin_attrscpu_itimerdevres_lockfiles_struct__ret_onceblk_zoneSDEV_RUNNINGicq_treePTR_TO_BTF_ID_OR_NULLfc_local_portsvfsuid_tf_lockexec_vmkernel_parambtf_fieldfh_f_ctlget_lesbvertical_positionbtf_dtor_kfunc_tshutdown_prerelease_folioftrace_managedbi_io_vecvendor_idmtimearchrobust_listasync_probe_requestedthaw_earlyac_btimevectors_securitysplice_writeparam_lockreq_listi_opflagstot_write_bandwidthdentry_operationsstats_sectorss_blocksize_bitsexp_hintclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapsw_hash_head_2asym___kernel_vsyscallopen_mutexfortify_funcsk_buffcan_forklow_usageget_timeki_flagss_inode_wblist_lockpermwriteback_inodesdestroy_worklockableuprobes_statemm_counttrace_overrunargsargvuclamp_reqswap_info_structs_qcopwb_tcand_bytesblk_mq_queue_mapFC_VPORT_INITIALIZING__kernel_long_tsrcu_usagefaultableperf_event_mutexfctsexit_hctxfc_xid_not_foundsync_modemap_gen_lookupin_execverlim_maxFC_PORTSTATE_MARGINALsimple_tagstarget_listmutex_lockVLinkFailureCountbpf_kfunc_btf_tabrtpoll_next_updatecoherent_dma_mask__data_lendriver_flagsscsi_residfile_ra_statek_sigaction_hugetlb_hwpoisoninsn_offshrinker_infocompletionslld_event_callbackreadahead_controlfwnode_operationsprocs_fileswait_queue_headmemory_typevm_userfaultfd_ctxTT_NONEmap_pagesBPF_PROG_TYPE_TRACEPOINTmod_tree_nodelocal_watermarkprobe_offsetxfer_ddpcmd_flagss_bdev_filedev_pagemaptarget_private_offsetRPORT_ST_INITcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fshost_eh_scheduledsoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLErb_nodereturn_consumerround_robinksymi_private_dataroot_csetused_btfsptracer_credsrcu_barrier_headleadercheckTT_COMPATtop_of_stackcap_effectivenetfilterexit_statefc_fcp_pktfaultscan_startprogs_hlistnuma_pages_migratedidr_nextsched_tagssupported_modefiltersnr_frozen_descendantssbitmap_queueno_cgroup_migrationsched_databpf_func_info_auxprintk_index_startindex_keybreserved_tags__bi_nr_segmentsLPORT_ST_FDMIforce_scanintervalavgs_lockbug_entryzswap_maxtimers_activenum_classesprotocolbpf_cgroup_storagevma_lockrtpoll_untilkswapd_waitdl_throttledbpf_progseccompDEVICE_VERT_POS_UPPERrolesblk_holder_opsfprop_local_percpustatic_key_modextensionsspp_orig_pafilter_countpsi_filesmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodecreate_work_queuerport_delete_workumode_tinitial_nsno_pmGRPQUOTAia_vfsgidioctx_locktimer_slack_nss_bdixarrayjited_linfocan_wakeuptime_namespacepdeath_signalexpected_attach_typedst_regnr_wakeups_idledqi_igraceqf_nextBPF_MAP_TYPE_LPM_TRIEmaple_treensproxyslave_dir__write_overflow_pkeyFC_TYPE_ELSucountsget_next_idDD_CLASS_TYPE_LEVEL_NUMhooknumwrite_syscallslistscore_relo_rec_sizerefcount_tslow_grocmd_lenDEVICE_PANEL_TOPmemtiermax_hw_discard_sectorsint32_txol_areadefault_lockfc_fc4_deregister_providerguess_capacitysrcu_gp_mutexdebugfs_dirwakee_flip_decay_tsprio_listlast_timerequestblk_unique_idwpcopy_delay_totalSDEV_DELfc_destroy_rportmax_payloadcontexthost_lockrwlock_tvm_fault_tskb_extuse_autosuspendclass_spinlock_irq_try_is_conditionalfc_disc_eventcfs_rqtree_reclaimedvirt_boundary_maskcgroupscore_occupationget_policycore_cookiepcrefrefcount_struct__kernel_ulong_tkf_opsfwnodeZONE_DMABPF_CGROUP_GETSOCKOPTcgroup_storagestatic_call_keycsum_startsysnamenamespaceparametersbtf_sizegroup_leaderdma_channelrunnable_avglookaheadiowait_countli_loss_of_signals_countshstkioac__kernel_clock_twas_resetgp_seqscsi_device_stateuuidmaj_fltWB_REASON_FORKER_THREADcached_requested_keyfp_flagsdqb_rsvspacemap_lookup_and_delete_batch__s8inode_operations__kernel_size_tdma_configurefile_leasepage_counterarg_flagsclass_local_lock_nested_bh_is_conditionalgpl_symsallowed_attachsrecursion_detectedpercpu_rw_semaphoresymbolic_namearch_spinlock_tseqcount_raw_spinlock_tbpf_iter_init_seq_priv_thighthread_pidmap_lookup_batchcss_idrrtpoll_min_periodemindl_non_contendinglso_maxcurr_ret_stackpgtable_t__u8q_usage_counterwakeirqi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyssdev_targetcore_forceidle_sumget_offset_ctxreleasedexport_operationsqc_stateget_budgetBLK_INTEGRITY_CSUM_IPmempool_smempool_timplicit_on_dflFC_PORTSTATE_LOOPBACKd_inodespecial_vecpageset_batchworkqueue_structBPF_MAP_TYPE_SOCKMAPi_lock_keyuevent_suppressgraveyard_linkbi_opfscsi_cmndfail_io_workfs_superscall_get_func_ip__read_overflow2tcp_tsorted_anchorwce_default_on__rcu_icq_cachecompact_cached_free_pfncap_ambientqstrtaskss_d_opBPF_MAP_TYPE_TASK_STORAGEno_report_lunsi_rcu__count__already_doneinit_requestFC_PORTTYPE_NPORTio_optspanned_pagespcountbio_listwlockedrtpoll_trigger_lockdevicemodule_kobjectmap_releasePTR_TO_PACKET_METAmg_tasksBPF_TRACE_ITERpercpu_count_ptrnr_ia_rangesthawmap_update_batchlink_attach_flagstlbflush_unmap_batchremoveoffload_fwd_markbvec_iteroom_mmfcp_abort_iobpf_local_storagefr_crcname_linkrnid_vend_idcompat_long_tcnivcswmap_freeInvalidCRCCountPTR_TO_SOCKET_OR_NULLshort intkswapd_highest_zoneidxtrc_reader_specialgtimepscr_ret__disk_events_disable_depththread_group_cputimertransport_headersizemigrate_to_ramUTASK_SSTEP_ACKloginuiddesc_structi_wb_lists_umount_keyquota_typenamecgrp_ancestor_storagespp_typesetleasebitmap_tagsmnt_rootBPF_MAP_TYPE_SK_STORAGEpsi_flagspage_offset_basesighandbtf_key_type_idavgs_workaddr__rcu_headac_utimeFC_PORTSTATE_DELETEDksm_zero_pagesBPF_MAP_TYPE_LRU_PERCPU_HASHqueuedataprivate_dataBPF_MAP_TYPE_CPUMAPgid_mapFC_RCTL_F_BSYpageset_high_minfs_structnuma_nodedev_archdatanr_perf_statess_flagsrcu_nodeorig_pmdrb_rightclock_baseBPF_SK_REUSEPORT_SELECTclass_irq_is_conditionallaunder_foliowake_batchis_funcs_vfs_rename_mutexElf64_Xwordf_ctlflockiter_createFC_RCTL_DD_UNSOL_DATAhandler_datavalue_type_btf_obj_fd__paddingoffline_waitqnr_reclaim_startstatus_codeio_lockdep_mapatomic_write_hw_boundarymap_nr_maxiowait_sumdescriptionfolio_batchbi_nextblk_status_tUSRQUOTABPF_CGROUP_ITER_SELF_ONLYdriver_privatecore_relospm_onlyd_rt_spc_warnsset_read_onlypgmapactive_refmap_owner_storage_ptrhctx_tablefc_xid_busykernfs_open_filelowmem_reserves_iflagsprintednr_hw_queuesstate_mutexallowed_mapsctx_arg_infoinner_network_headerlast_queue_full_depthBPF_PROG_TYPE_SK_LOOKUPskb_put_zerocid_worki_versionswap_deactivatesr_lockattachclass_rwsem_read_is_conditionalqueue_limitsunitil_weightstarved_listdma_parmsbdi_idKOBJ_NS_TYPEStstampcmin_fltchunksarch_uprobe_tasklicensewrite_protect_seqclearedkobj_ns_type_operationsshutdownevent_countsched_statisticslru_lock__kernel_uid32_tnode_zonelistsallocb_attachedorig_pterq_timeoutkeysinit_nameper_cpu_zonestattc_indexfile_lockstatfsrw_semswappinessdevice_privatevm_policydl_deadlineLPORT_ST_RSNN_NNtracepoint_extclass_mutex_is_conditionalfpregs_statememcg_datadqb_curinodesBPF_XDPfileattr_seteh_actionac_tgetimeRPORT_EV_NONEpage_linkno_write_samebtf_log_sizedn_timeoutDEVICE_PANEL_UNKNOWNFC_VPORT_FABRIC_LOGOUTPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetmce_ripvDL_DEV_NO_DRIVERbpf_arenafree_after_mult_rcu_gpret_stacknbp_rl_nr_candreal_timerFC_EOF_DTi_privateextended_state_areanum_kprobe_blacklistaccessmap_seq_show_elemfp_resvdsubdirsdev_releasecgroup_freezer_statemlock_countBPF_PROG_TYPE_LWT_SEG6LOCALget_next_child_nodemempolicyfc_rportcacheline_padding_bandfd_arraypollfdblinding_requestedFC_RCTL_BA_RJT__UNIQUE_ID___addressable_fc_fc4_register_provider672laptop_mode_wb_timerdev_tplatform_dataf_refprev_posenv_endfileattrs_subtypeusage_countpr_opsstate_in_sysfsdqb_ihardlimitunlocked_ioctluprobebd_mappingFC_RCTL_DD_UNSOL_CMDkmem_cachenuma_next_scansg_pageLPORT_ST_FLOGIbudget_mapbsg_devsrcu_last_gp_endxfer_lentnodeclass_local_lock_irq_is_conditionalpage_listinner_ipprotoproperty_read_int_arraywdtrmq_rq_stateholders_dirMODULE_STATE_UNFORMEDst_valuelist_headptrace_bpsFC_RCTL_BA_RMCfc_port_states_user_nscan_attachhost_attrsmap_lookup_elem_sys_onlytagset_refcntqueuecommand_may_blockmin_usagearch_tlbflush_unmap_batchquick_threadsdefer_syncBPF_TASK_ITER_TIDmissedfc_no_free_exch_xidusernsndisc_nodetypeBPF_UPTRvlan_allBPF_PROG_TYPE_CGROUP_SKBsum_sleep_runtimecleanup_rqd_spc_timerd_ino_hardlimitchange_cookiebi_statuscss_allocdl_periods_dquotErrorFramesfsnotify_sb_infomap_fd_get_ptrrecent_cida_opsftrace_opsprocnamepad_untilmap_redirectperf_event_listinterval_expinsnBPF_CGROUP_UDP4_SENDMSGrstat_css_listvm_node_stat_difftagski_completepgprotrnid_node_mgmtread_syscallstimespec_typebd_devicevmstatsdquot_operationsbio_vecFC_EOF_NIposix_cputimers_workgsbase__lruvecBPF_CGROUP_INET_EGRESScompact_delay_totalio_tlb_memseq_showFC_RCTL_DD_UNSOL_CTLcpusfilesinblockbd_claimingtails_magicFC_RCTL_BA_NOPcontainersnuma_faultsmem_dqblktarget_ifindexnos_countstgt_delete_workstatusBPF_PROG_TYPE_CGROUP_SOCKOPTWRITE_LIFE_NONEread_countlink_speedBPF_CGROUP_INET6_CONNECTlport_listHRTIMER_NORESTARTscsi_privlast_update_timesas_ss_spold_map_fddisc_startpanelfc_rport_operationswatermarknode_start_pfnmax_allowed_capacityfc_statsopen_modeFC_RCTL_ELS_REPseq_cntread_posclass_cpus_read_lock_is_conditionalmg_dst_preload_nodecpu_run_real_totalD_REAL_METADATAgpl_crcsFC_EOF_RTtimes_prevclass_raw_spinlock_try_is_conditionalfc_frame_headerkiocbmg_nodeexecute_only_pkeyreturn_instancesma_lockblk_mq_queue_datacss_offlineattach_btf_tracedockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsFC_RCTL_DD_SOL_CTLwb_tcand_idFC_PORTTYPE_OTHERdentrysequential_iowait_pidfdprli_countcdb_statusInputRequestss_writersgroup_stop_countavg_next_updateswap_lockvm_opswb_reasonpartial_bufread_before_msget_unmapped_areamkobjsym_VDSO32_NOTE_MASKfrozenactive_uprobeunregisteringget_parentmin_vruntimestoragesdebug_dirhost_resetfc_els_rnid_genclass_disable_irq_is_conditionalsyscrnr_mapssyscwsync_ionum_bpf_raw_eventswork_qorig_nentski_pose_csetsavx512_timestampfh_typeend_io_datae_freezeBPF_GRAPH_ROOTfree_cached_objectstaints_BoolFC_RCTL_DD_UNCATmax_tp_accessxol_vaddrb_dirtylist_lru_nodeuclamp_ses_time_granvm_statblk_integritykuid_tdev_pm_qosbd_holdersper_cpu_zonestats_sifieldstaskBPF_CGROUP_INET6_BINDresetsched_reset_on_forkcompound_headnr_retrieswake_irqbranchi_cdevfunc_infoi_fsnotify_marksin_thrashingdl_deferBPF_MODIFY_RETURNvpd_pg80waitersvpd_pg83vm_startvpd_pg89mprotectquota_ond_automountDEVICE_REMOVABLE_NOT_SUPPORTEDrnid_gencsum_not_inetctl_table_headeratimeget_ownershipf_task_workmy_qfc_lport_stateBPF_SK_SKB_STREAM_VERDICTeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditional__UNIQUE_ID_y_663FC_TYPE_FCPsectorinner_mac_headers_wb_err__q_sizeattach_prog_fdcloseiopl_warnelevator_queueptraced__MAX_BPF_MAP_TYPEdonesym___kernel_rt_sigreturnsrcu_struct_ptrsskip_ms_page_3fbinfmt_miscinodesencapsulationmemcg_awarezonehost_waitFC_PORTSTATE_LINKDOWNmanage_shutdownac_schedqsize_t__fpstatemap_poke_trackBPF_MAP_TYPE_SOCKHASHqf_ownersuspend_noirqd_inamePTR_TO_MAP_VALUEbi_flagslinks_countprealloc_pterdevd_ino_countarg_lockclass_rcu_tasks_trace_is_conditionalDEVICE_REMOVABLE_UNKNOWNdoes_npivignore_childrenpoint_to_multipointframe_sendBPF_CGROUP_UDP6_RECVMSGdirty_exceededfreeze_fsin_eventfdresume_earlymax_dev_sectorsdup_xol_workalimititemsooo_okaynuma_groupblk_independent_access_rangesdeferred_resumekmap_ctrlfscrypt_operationsrangesevents_lockfs_contextmnt_idBPF_CGROUP_INET6_POST_BINDretry_hwerrordrop_inodeBPF_MAP_TYPE_REUSEPORT_SOCKARRAYk_lockorc_unwindgraph_get_next_endpointfrom_ingresslast_sector_bugmq_mapprojid_mapkprojid_t__u16PTR_TO_XDP_SOCKsaved_end_ioBPF_MAP_TYPE_STACKsyscall_dispatchdl_densityon_rqlru_gen_mm_walkaltmapmin_perf_statercu_tasks_exit_listlro_xidsp_regdma_drain_buflast_resets_master_keysflagsbd_holder_locknr_threadsvm_mm__u32query_flagsmax_secure_erase_sectorsseq_nextenable_statss_quota_typesvm_lockswapin_countdisc_stop_final_ddebugFAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitoffload_l3_fwd_markdelayskcompactd_max_ordermnt_nstimerqueue_headBLK_INTEGRITY_CSUM_CRCsdev_groupskioctx_tablepriorityksm_rmap_itemsclass_read_lock_is_conditional__u64revoked_at_folio_nr_pagesfcp_packet_abortswritepageis_dirty_writebackpkey_allocation_mapLPORT_ST_DHBAdq_iddisable_depthem_perf_statethread_shstkfr_devTxWordsposix_timerswait_chldexitTxFramessas_ss_flagsunreadableunmap_limit_for_wspresent_early_pagesgpl_compatibleinsn_idxPTR_TO_MEMbi_itersrcu_cblist_invokingiopollcsum_complete_swline_coliov_lenlatency_record__compiletime_assert_673fc_lportdirty_limit_tstampsector_sizeskb_mstamp_ns__BPF_REG_TYPE_LIMITd_releaseavg_totalfh_cs_ctldev_dma_attrBPF_NETKIT_PEERzswap_writebackexpiresnuma_scan_seqmnt_sbblkcg_csshashnodemask_tref_cntsize_poke_tabsignalfd_wqhhang_detecteddevice_driverlast_zone_capacitystatisticsfsindexout_batchraw_spinlock_ts_cops_activenum_argspidlist_mutextag_sizeBPF_MAP_TYPE_PERCPU_HASHFC_LPORT_EV_DELlast_old_flushs_uuidclear_child_tidruntime_statusdqb_btimedq_opBPF_MAP_TYPE_DEVMAPshow_pathdl_serverVTIME_USERquota_disablesched_delayedsrcu_gp_seq_needed__param_debug_loggingtask_structtimer_delaycurrent_may_mountpushpeaks_lockbpffs_fdpath_fdis_noirq_suspendedfwnode_endpointPTR_TO_TP_BUFFERcounterunique_idsuspendsupported_eventsoom_score_adj_minlast_bdp_sleepzone_wplugs_poolzone_typedomain_datacopy_file_rangesrcu_gp_startreport_zones_cbxa_flagsFC_EOF_Aattach_btf_idlru_gen_foliobtf_idFC_EOF_Nbpf_insnFC_EOF_Ttv_nsecmax_zone_append_sectorssas_ss_sizeeh_eflagss_inode_list_lockUTASK_SSTEPraw_tracepointfc_prov_mutexFC_RCTL_F_RJTehandlerdq_sbexpecting_lun_changescsi_targets_mountselem_flagsBLK_EH_DONEvm_stat_diffsym_pvclock_pageswapin_delay_totalfree_listBPF_CGROUP_UDP6_SENDMSGpage_fraginfo_lenrun_workfsuidRPM_REQ_AUTOSUSPENDsrcversionlist_add_tailtrace_event_callwakeup_sourceis_partially_uptodatehost_faileddl_runtimemay_splitio_uring_cmdprogs_cntread_dqblkpeekedrtpoll_nr_triggerssrcu_parentinit_seq_privatebi_cookiesuppliersfile_operationsRxFramesbpf_ctx_arg_auxblist_flags_tmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotLPORT_ST_RESETis_preparedpgprotval_tmemorytrc_holdout_listasync_suspendq_nodezone_pgdatclass_mutex_intr_is_conditionalstrtabpage_freeftopdepends_onHPROBE_CONSUMEDi_mmapnr_cgrpsdirty_paused_whenirq_getfc_copy_buffer_to_sglistcss_resetcapacitymax_channelversionlink_failure_countget_reference_argsllisthiwater_vmmax_perf_statebi_idxcookiesfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntInputBytesrseqattach_typetarget_knlimit0limit1pi_blocked_onpid_tac_exe_inodevmemmap_shiftbpf_attach_typeusage__kernel_time64_trq_qos_mutexkernel_read_file_strscsi_data_buffercapabilitiesi_securitydevice_physical_location_panellimitsq_lock_cls_keyenvpactive_memcg__targetsElf64_Halfallow_reinittimer_autosuspendsratelimitSHOST_DELslave_configurestat_threshold_softexpiresautosuspend_delayline_info_rec_size_zonerefsi_flctxFC_PORTSTATE_ONLINEli_invalid_crc_countlist_lockvm_faultip_epilogueoptimistic_spin_queuepermissionlibfc_exitbpf_prog_array_itemin_fhin_fptransport_containerflush_listreap_refDEVICE_FIXEDlast_statusfdmi_enabledSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsslice_maxFC_RCTL_P_BSYmap_namebi_max_vecsthaw_noirqsched_debugfs_diraccounting_timestampcan_matchtime_archcmd_sizechunk_sectorshlist_bl_headqc_dqblkLPORT_ST_RFT_IDcalledpasid_activatedancestorsmap_fd_sys_lookup_elem__fortify_panicbvec_integrity_poolBPF_XDP_DEVMAParch_datashrink_controlegidthreaded_csetsmax_rdonly_accessmap_direct_value_addrnet_deviceenvp_idxcrypto_kobjectcdb_cmdf_modetagged_supportedoffloadsvpd_pgb0vpd_pgb1vpd_pgb2ff_type_mapzone_idxfolioruntime_autopref_node_forklru_zone_sizeclassipc_namespaceBPF_SK_SKB_VERDICTarenaprev_scan_seqfc_dl_perfpsi_group_cpufr_seqhardirq_stack_inusewait_queue_head_talloc_hinttask_cputimeFAULT_FLAG_INSTRUCTIONdeferred_splituser_nsfc_cdbnohdrclass_raw_spinlock_irqsave_is_conditionalsyms_flagscgwb_release_mutexFC_PORTTYPE_NPIVsync__compiletime_assert_100__compiletime_assert_101__compiletime_assert_102__compiletime_assert_103__compiletime_assert_104__compiletime_assert_105__compiletime_assert_106__compiletime_assert_107__compiletime_assert_108mq_freeze_locksg_prot_tablesized_childrenucountmap_local_storage_unchargectl_table_sizebpf_map_opsfc_rport_identifierseh_host_reset_handlerddebug_class_map__compiletime_assert_110__compiletime_assert_111dfl_cftypesprealloc_bufaudit_contextfl_owner_tipi_listBPF_MAP_TYPE_DEVMAP_HASHpersistent_keyring_registeri_pipemachined_waitllist_headsense_buffernr_phys_segmentstask_itersnode_spanned_pagesavg_refaultedFC_RCTL_ENCHwait_page_queuecn_credit_stallbpf_line_infoBPF_SK_MSG_VERDICTFAULT_FLAG_REMOTEdl_bwhierarchy_idunaccepted_pagesi_dir_seqignore_dfheaderwatchdog_stampstate_startlist_op_pendingdatasrcu_cb_mutexsysfs_lockBPF_CGROUP_UNIX_CONNECTallowed_progsno_callbackssaved_trap_nrclock_listbpf_func_infofolioq_slotMODULE_STATE_GOINGxattr_handlerac_utimescaledrqos_debugfs_dirprot_sdbidr_baseunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_lockfrom__UNIQUE_ID___addressable_fc_fill_reply_hdr670nextentseventkeytypeMissDiscAdvCount__kernel_gid32_tevicteddev_pm_domainnentsstart_time_nsuaddr2f_securityprot_opdefparamdiscard_granularityiotmo_cntclass_raw_spinlock_irq_is_conditionalq_sizefr_sofFC_PORTSTATE_BLOCKED__bi_cntrcuwaitattributes_maskcloneddl_defer_runningnpiv_enabledlru_gen_mm_listqueuecommandevents_filetagged_writepagesia_validsrculog_bufreq_flagsiorequest_cntsrcu_size_jiffiesclassesstatic_call_sitecputimenotifyis_seenupdated_nextfh_s_idsrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitmap_fdrchari_verity_info_addr_pkeyfpin_statsrw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countBPF_PROG_TYPE_XDPbpf_ksymSTARGET_RUNNINGFC_SOF_C4atomic_opennapi_idload_time__mptrsigactionrlimbtf_token_fdmce_addr__q_size_fieldf_freeptrBPF_MAP_TYPE_CGROUP_ARRAY__sighandler_tclass_spinlock_try_is_conditionalzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMESlrugenmax_target_blockedfs_flagsvm_filei_countuser_structmap_idaddress_space_operationsFAULT_FLAG_USERkey_perm_tused_btf_cnt__UNIQUE_ID_description655btf_log_bufeh_strategy_handlertimer_listverifier_zextmemory_eventscgwb_listrun_delaynum_ftrace_callsiteschange_queue_depthsrcu_cblistoffload_requestedblk_independent_access_rangeavg_write_bandwidthtlb_ubcpgtables_bytesi_lrufh_parm_offsetGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacktrc_ipi_to_cpuparm_offsetscsi_luncss_onlinePTR_TO_FUNCmemory_events_localkmap_atomicallow_restartmin_slicedecryptedcommit_rqssysfs_opsinq_periph_qualcore_relo_cntFcpPktAbortsatomic_write_hw_unit_maxFC_SOF_I2cmaj_fltFC_SOF_I4bio_integrity_poolnf_tracekparam_arrayFORTIFY_FUNC_strscpyFcpFrameAllocFailspercpu_refevict_inodeignore_media_changertpoll_statesthread_keyringmap_nrcgroup_nslist_delcpumask_tpcpu_hotrstat_css_noderb_leftRPORT_ST_DELETEgfp_maskdma_addr_tinactive_timerattributeinner_protocolinit_hctxperiod_timemm_lock_seqFORTIFY_FUNC_memchrkernfs_elem_symlinkBLK_UID_T10wb_lcand_idFC_RCTL_DD_CMD_STATUS__kernel_dev_tcrypt_keyslotprog_namepm_domainBPF_CGROUP_INET4_BINDmax_rdwr_accessmax_prop_fracfsgidsector_tcompact_cached_migrate_pfnnode_name_sys_privatesignal_structactive_mmFC_SOF_N2FC_SOF_N3FC_SOF_N4kernfs_iattrsshow_devnamecn_oversubscriptionthread_infoi_mmap_writabledata_size_outattach_btf_obj_fdreadr_a_tovvalue_recpto_tmp__secondarydevicesatomic_write_max_sectorsgroup_exit_codetx_framesFORTIFY_FUNC_memcmpopc1value_btf_idexec_maxrecvsync_statedev_groupsuts_namespacefcloneDMA_FROM_DEVICEzone_start_pfnvalue_sizekernfs_elem_dirport_namepercpu_counterDMA_BIDIRECTIONALcgroup_subsys_statesequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startUTASK_RUNNINGopenseglenBPF_MAP_TYPE_QUEUEFORTIFY_FUNC_memcpy__kernel_ssize_tvdso_imagesi_signounused_hctx_lockrseq_sigresultrefsdelayed_calltime_slicefunc_info_rec_sizenr_rangemax_seqbtf_func_modelspc_timelimituid_gid_mapnr_freeresumeset_ownershipbpf_iter_task_typeFC_PORTSTATE_NOTPRESENTregsbi_write_hintrq_nextclass_rcu_is_conditionalshort_inquiryattrd_aliasis_suspendedseq_priv_sizerp_mutexrestore_sigmaskrequeue_lockevent_worknr_deferredmem_cgroup_idsrcu_sspi_lockuser_event_mmbtrace_seqs_devsiblingcdl_supportedia_rangetarget_sizemap_lookup_elemldt_usr_semrec_dataposix_cputimerslink_supported_speedstry_rc_10_firstRPM_INVALIDdd_datafreeze_kcountrequest_key_authblockspercpu_ref_datad_spc_warnssrcu_supnbp_thresholdfreeptr_tLPORT_ST_DPRTns_typeRPM_REQ_NONEFC_RCTL_VFTHprog_btf_fdforce_runtime_start_on_system_startsg_timeoutixolfasyncarg_startLPORT_ST_DISABLEDkprobes_text_sizekfunc_tabblk_crypto_profilefop_flagswork_lock_addr_lsb_addrpfn_mkwritentimeuaddrrtpoll_waitBPF_STRUCT_OPSfunc_proto_unreliableioerr_cnt__compiletime_assert_84_uidmm_states_fs_infomm_stats__rb_parent_colorWRITE_LIFE_EXTREMEicq_list__MAX_NR_ZONESmm_users_pp_mapping_pad__UNIQUE_ID_x_662imagekey_serial_tno_uld_attachfolioqfoliosshost_groupssiblingscputimernrpageswake_q_nodeFC_PORTTYPE_NOTPRESENT__compiletime_assert_91blk_flags_tmap_fd_put_ptrs_maxbyteshd_geometryioctx_tabledma_io_tlb_memfc_cmdrefeh_cmd_qfree_after_rcu_gpget_unique_idexpire_countcompact_init_migrate_pfnfor_syncwake_cpujited_lenPTR_TO_SOCKETlinfobio_splitfreeze_supertick_dep_maskcall_depthvmpressurelruvecmap_check_btfiter_infoqc_infoobjcg_listfault_flaglist_is_headmodnamesg_nextia_ctimeperf_rdpmc_allowedFC_VPORT_NO_FABRIC_RSCStrace_eval_mapcompact_defer_shiftorig_objcgasync_put_workresvnum_static_call_sitesZONE_MOVABLEl4_hashvm_lock_seqFORTIFY_FUNC_strncatroot_listBPF_TRACE_FENTRYElf64_Addrwait_queue_entry_tseqlock_tlatency_record_countnr_integrity_segmentshost_blockedmay_skip_resumeprot_flagsVTIME_SYSbase0base1base2SHOST_CREATEDbio_setfh_seq_idCONST_PTR_TO_DYNPTRBPF_MAP_TYPE_RINGBUFalignment_offsetlinksbasesfutex_staterseq_lenkobj_completionlesb_inv_wordi_spc_timelimitf_opnargsbindcpuhp_onlineproc_ns_operationsold_prog_fdBPF_PROG_TYPE_SK_REUSEPORTmm_mtgid_trelease_workSDEV_CREATEDavg_nr_triggersno_report_opcodesBPF_PROG_TYPE_LWT_OUTrcu_read_unlock_specialBPF_CGROUP_UNIX_RECVMSGtls_arrayipvs_propertyfr_eoftask_io_accountingcss_rstat_flushf_raDEVICE_PANEL_FRONTmodule_memorynetkitsitescompat_robust_list_headcss_releasedthread_nodestatic_call_mods_shrinkctx_arg_info_sizegp_countRxWordsnr_sectorsbpf_raw_eventsiommutimer_expiresbpf_storagekset_uevent_opsf_ownerqfull__state_permDEVICE_PANEL_BACKmax_retry_countpagefault_enableoffsetswb_switch_rwsemdisc_syscalldiskSHOST_DEL_RECOVERYjit_requestedsrcu_lock_counttrc_blkd_cpugp_waitcopy_leniommu_mmfuncio_uring_taskshared_tagsrepeatjit_keyringLinkFailureCounts_fsnotify_infofunctionlinkagedisc_recv_reqBPF_PROG_TYPE_CGROUP_SOCK_ADDRprojidmce_kill_mema_external_lockpid_linksconv_zones_bitmapscsi_target_ids_dio_done_wqRPORT_EV_FAILEDfor_kupdaternid_ip_verstart_all_reasonhlist_head_pad3_ioc_nodethrottle_diskbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACErunningrw_hintblk_integrity_checksumdestroy_rworkdma_skip_syncpartition_meta_infotstamp_type_accessDEVICE_VERT_POS_LOWERBPF_CGROUP_ITER_ANCESTORS_UPnr_dying_subsysclass_spinlock_irqsave_is_conditionalutf8datahlist_nulls_headrequeue_workof_node_reuseddyndbg_infoFORTIFY_FUNC_strncpyElf64_Symreclaim_waitsaved_errd_rt_spc_softlimitpollfree_file_infoin_lru_faultsched_contributes_to_loadtlb_genruntime_idlemap_counthost_scribblei_rt_spc_timelimitqc_type_states_dentry_lruac_comms_bdevvmemmap_baseskip_vpd_pagescrcssense_lenrun_listuevent_opsabort_workmax_cmd_lenbpf_func_statebpf_reg_typesched_classret_sizeutil_avganon_vmaFC_VPORT_LINKDOWNdevice_private_offset_pidsigcntDD_CLASS_TYPE_LEVEL_NAMEShas_callchain_buftailcall_target_stablebpf_cgrp_storagemodinfo_attrsst_spaceclass_map_typekparam_stringd_real_typemaxrsscredBPF_MAP_TYPE_ARRAYkernfs_open_nodef_wb_errmm_cid_activemodule_sect_attrsreq_flags_truntime_resumeac_stimescaledgroup_exec_taskrestrict_linkirq_countget_inode_usageFC_TYPE_IPxarray_startbpf_ctxpm_domain_databw_dworkattach_btfmap_lookup_and_delete_elem__p_size_fieldload_avgrecordi_private_lockget_dqblktail_callmq_listrnid_phys_portphysical_block_sizepgoffportnetdevBPF_LIST_NODEdefault_setmodelfreeze_latemf_statsZONE_NORMAL__list_del_entrycount_objectsvma_numab_statedma_map_opsdq_dirtylnodemax_lunexit_cmd_privfd_typeatomic_write_boundary_sectorsboot_timewpcopy_countmax_queue_depthwrite_byteseh_entryDISC_EV_FAILEDpending_eventsoom_reaper_listnumab_statefutex_offsetbpf_fdsubsys_fmt_prefixdq_lockintegritypte_tnr_scanned__stateBPF_MAP_TYPE_UNSPECpto_val__nr_iosk_listn_io_portslicecgroupdrv_groupstrack_queue_depthtruesizecustom_sliceper_cpu_pagesstart_idbdi_listmq_freeze_depthpadding1RPORT_ST_READYnestedatomic_write_segments_maxinsn_cnt__compiletime_assert_218__compiletime_assert_219map_set_for_each_callback_argsnr_dirtied_pausequeue_kobjdst_progreal_addressbd_holder_dirac_tgidinvalidate_locknum_exentriesfcp_cmd_sendfix_capacitycss_local_stat_showio_portvport_last_stateblk_mode_tpmdval_tspp_flagshost_tagsetBPF_GRAPH_NODEkveceh_noresumefree_areaset_latency_tolerancedepthd_ino_timerprobenetlink_nsnr_argstokendev_ueventfc_vportdep_mappage_mkwritelast_busyvm_flags_toffloadnregnr_failed_migrations_affinelro_enabledd_in_lookup_hashdom_csetptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLERreschedule_countfc_fc4_conf_lport_paramsmax_hang_timeFC_PORTSTATE_UNKNOWNcmd_per_lunopt_failedcdl_enablecutimelockrefnew_map_fdmap_meta_equaltlb_flush_batcheddev_privia_uidautogroupsequencercu_syncarg_endclass_spinlock_irq_is_conditional_dummy_pkeyvruntimehostdataBPF_CGROUP_ITER_DESCENDANTS_POSTscannedSCALAR_VALUEnr_extentsstart_stop_pwr_condpidlistsWB_REASON_VMSCANfeatures_locked__kernel_pid_tdev_statedevice_blockedfile_flagsPIDTYPE_SIDconst_pcpu_hotcinblockdma_alignmentprot_typeBPF_TCX_INGRESS__kernel_loff_tset_performance_stateserial_nodelru_gen_mm_statestate_remove_uevent_sentnotify_countsrc_regupdated_childrenspin_lock_offBPF_CGROUP_SYSCTLsingle_lunhprobesg_reserved_sizeswap_activatedqb_isoftlimitsaved_auxvnoinstr_text_sizedl_overrunfc_no_free_exchdetachedloff_toom_flag_originfreepages_delay_totaldesc_lendma_devoom_score_adjwb_waitqSHOST_RECOVERYrq_end_io_fnksm_merging_pagestest_runDISC_EV_SUCCESSlport_set_port_idgraph_parse_endpointrmidptp_rdataFC_RCTL_P_RJTsoftirq_pendinglist_lrudevice_removablefc_seq_not_foundfxsavedev_pagemap_opsbv_offsetBPF_MAP_TYPE_XSKMAPset_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETd_lockrefbtf_typenr_populated_domain_childrenSCSI_EH_DONEsession_keyringshost_devbtf_log_true_sized_deleteuts_nsd_ino_softlimitd_weak_revalidatealloc_time_nsi_devicesFC_PORTSTATE_ERRORdqb_curspaceBPF_TRACE_KPROBE_SESSIONalloc_lockearly_inittotal_numa_faultswritable_sizefc_fc4_del_lportmax_segmentsdma_need_drainobj_cgroupem_tableBPF_PROG_TYPE_TRACINGmq_sysfs_init_doneactive_queuescompact_consideredfc_debug_logging__lstatepercpu_drift_mark__BPF_REG_TYPE_MAXinodesubtree_bstatbd_fsfreeze_mutexhrtimeratomic_write_unit_maxFAULT_FLAG_UNSHARELossOfSignalCountlocal_fwnodetask_sizemust_resumeRPM_ACTIVEend_codePTR_TO_SOCK_COMMON_OR_NULLuintnr_free_highatomicpreempt_notifierstlb_flush_pendingmigration_flagsDEVICE_PANEL_RIGHTfast_io_fail_tmotx_wordscap_inheritablebpf_cgroup_iter_orderkobj_sigvaleh_timeoutwritecntBPF_KPTR_PERCPUsrcu_n_exp_nodelayin_batchseqcount_spinlock_tlowmem_page_addressextra1extra2write_s64graph_get_remote_endpoints_rootstree_scanned__int128 unsignedverifiedcpu_countcgroup_rstat_cpuevent_callbackwb_lcand_byteswait_sumuprobe_xol_opssg_suppmin_align_masknextevtthis_idrcu_segcblistread_s64reported_split_lockreturn_instancewait_countconfirm_switchnr_wakeups_affine_attemptspud_ti_ino_warnlimitpreallocmax_open_zonesrmtpnext_offsetFC_PORTTYPE_LPORTio_statuslp_mutexblindedacpi_device_iddev_scratchctx_idutaskpoweroff_noirqactive_modesdev_datais_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangsSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYfc_lport_eventcss_setfwnode_handlegfp_ttype__vpp_verifyqf_fmt_idlink_updatepagepageset_high_maxatomic_write_unit_minsleep_startmap_mem_usagememalloc_noiobegintypetabuse_192_bytes_for_3fnr_reserved_tagsBPF_PROG_TYPE_RAW_TRACEPOINT_WRITABLEi_crypt_infoFC_TYPE_NVMEretry_workDEVICE_HORI_POS_CENTERio_start_time_nsaudit_ttyrecov_retrybatch_sizedns_rdatanr_zonesmutex_unlockjobctlsi_errnonr_leaves_on_treequeue_ctxmin_shallow_depthfc_seq_sigchlddqb_itimeHPROBE_STABLEquota_format_type__ret_condbio_crypt_ctxpercpu_ref_func_tpm_message_tsplit_queueac_memBPF_CGROUP_INET4_POST_BINDpprevlip_countino_warnlimitremcsum_offloadexception_boundarybroken_fuabpf_iter_seq_info__UNIQUE_ID___addressable_fc_lport_notifier_head659zone_wplugs_lockmnt_flagsfc_setup_rportac_stimemem_cgroup_reclaim_iterrange_endlast_mergememcg_nr_pages_over_highsw_reservedbpf_tokenwbt_flagscrc32_lebpf_iter_fini_seq_priv_tcss_freecpu_delay_totalobjcgfh_r_ctlno_read_disc_infoblock_startvm_area_structnum_gpl_symsselect_no_atnnotifier_callBPF_CGROUP_INET6_GETPEERNAMEis_extendednr_charged_byteslong long unsigned intWRITE_LIFE_MEDIUMBPF_MAP_TYPE_CGRP_STORAGEtmf_in_progressnext_addrSDEV_CREATED_BLOCKhuge_faulti_fopautasklast_task_numa_placementfortify_memcpy_chkrnid_prot_portip_after_callrefcntfreeze_holderpsi_groupcdevperf_event__param_str_debug_loggingunregfuncoom_groupseqcountBPF_XDP_CPUMAPclass_idbitsetallowed_cmdsbtf_field_typeinquiry_mutexcan_swapof_device_iddisk_statsmanage_runtime_start_stopclass_migrate_is_conditionalnetwork_headermin_ratioclass_write_lock_is_conditionals_xattrpart__pkt_type_offsetb_dirty_timeli_loss_of_sync_countBLK_EH_RESET_TIMERil_prevPTR_TO_SOCK_COMMONd_initget_name_prefixused_mapsspan_seqlockfc_soffileattr_getthreaded_csets_nodeclass_groupsSDEV_TRANSPORT_OFFLINE__ret_warn_on__call_single_nodeunicode_mappathrwsemhigh_maxpreempt_countrecent_used_cpuruntimeold_time32_tsocket_pressureenforce_expected_attach_type__state_sizeBPF_CGROUP_INET6_GETSOCKNAMEvportsunsigned intsbitmapclass_irqsave_is_conditionalcore_kallsymsscsi_devices_fsnotify_maskscan_objectsbi_privatewb_idDD_CLASS_TYPE_DISJOINT_BITSevent_liststartupkeyring_index_keyiov_iterd_rcustatic_key_falseuintptr_twake_entryrcu_tasks_holdoutfreezefprop_globalassoc_array_ptrbatchcacheBPF_TRACE_RAW_TPold_timespec32rcu_blocked_nodejiffies_at_allocfunc_idxfcp_frame_alloc_failuressubsys_datast_namegroup_nodei_mtime_secbus_dma_regionrp_statefh_rx_idstatic_rqsstarget_sdev_userac_majfltdn_device_specificmce_kflagssyscall_user_dispatchFORTIFY_FUNC_memsetscheduledbus_dma_limitubufbtimeia_gidmigrate_foliohigh_minrq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrnext_posix_timer_idmq_ops_mapcounti_atime_secstarttimefile_costreschedule_jiffies__list_delhprobe_state__UNIQUE_ID_x_665i_sb_listquota_offmap_poke_runmap_delete_batchshm_clistmap_delete_elemwait_for_compcb_headpages_skippedzone_wplugs_hash_bitspi_offsetac_flagfh_df_ctlpt_regsmmap_missexpires_nextblk_opf_treport_zoneskeyring_name_listnum_trace_bprintk_fmtiter_seq_infosubsys_maskcdrom_device_infolruvec_stats_percpuaccess_statebpf_prog_statssdev_gendevwork_structtruelast_queuedreverseri_timernr_populated_threaded_childrenfc_active_provpipe_bufsavg_last_updatebp_offsetswap_events_fileprotectedbsyncrequestedsaved_scratch_registertracepoints_ptrsfcp_cleanupwifi_acked_validblock_maxstatic_keyqueue_rqsdev_boundlibfc_function_templatecsum_validFAULT_FLAG_VMA_LOCKtotalreserve_pageskswapd_orderdma_range_mapvaluesKOBJ_NS_TYPE_NONEctl_table_pollmin_slab_pages_dataFAULT_FLAG_WRITEshow_optionswait_queue_entryexpirei_uidtagset_freedmax_sectorsexpiryperiodbmaprescue_workqueuerx_wordsmap_allocdispatch_wait_lockscsi_levelfsaveBPF_TRACE_UPROBE_SESSIONi_write_hintsuspended_timeread_byteszone_wplugs_worksum_sched_runtimes_writers_keySYSCTL_TABLE_TYPE_DEFAULTbpf_callback_tRPORT_EV_READYstart_boottimetimer_offentriesi_modecap_permittedfc_rport_priv_flags_2afcoe_rcv_infoBLK_UID_NAAstart_coderet_flagsvm_flagststamp_typesi_codeseqcount_spinlockBPF_PERF_EVENTheadHPROBE_GONElast_siginfosched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorsdworkdevice_dma_parametersdir_contextsaved_dst_attach_typeiopl_emulconsumersratelimit_statepower_statedq_flagsrstat_cpufieldsswap_plugcapture_controlPTR_TO_MAP_VALUE_OR_NULLfc_setup_fcpoffline_nodequeue_offsetclass_device_is_conditionalnon_rcuput_supershostbpf_exception_cbxdp_has_fragsdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_statblocking_notifier_headddp_setupjitedopen_flagslegacy_namemap_lookup_percpu_elemFAULT_FLAG_INTERRUPTIBLEmap_token_fds_inodes_wbvport_delete_worksubsysfolio_queuedurationinner_transport_headerinit_fs_contextuprobe_taskf_mappingFcpPktAllocFailstailcall_bypassstart_stackBPF_MAP_TYPE_STRUCT_OPSnotifier_blockprog_array_member_cntfh_ox_idDL_DEV_PROBINGi_linkWB_REASON_MAXstack_vm_areafc_lund_hashBPF_SPIN_LOCKdl_server_pick_ftty_old_pgrpst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquotaorc_entrydma_drain_len__MAX_BPF_ATTACH_TYPESCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listutimemmapshrinkeralloc_dquotbw_time_stampmappingdl_defer_armedfc_ns_ftsmap_pollrunnable_sumcpu_scaled_run_real_totalshort unsigned inteventsget_rq_budget_tokenqueue_ramp_up_perioddevice_nodemm_walkfc_gpn_ft_resprequeue_listlocal_portFC_PORTSTATE_DIAGNOSTICSp_size_fieldpkt_typelong long intsym_vvar_start_hugetlb_cgroup_rsvdsival_ptrproc_namepercpu_sizefc_vport_stateFC_PORTTYPE_UNKNOWNBPF_TASK_ITER_ALL__wsuminvalidate_foliois_vallocdrop_nsNOT_INITnr_queuesgenerationno_pm_callbackscountddp_targetd_parentpagessched_task_groupBPF_TIMERupdate_timetc_skip_classifymemcg_idpidsof_noderun_nodedata_sourcesubmit_bios_instancesvm_rcubd_start_sectctl_nodepage_table_locksysv_semquota_infoquota_enable__kernel_timer_twork_listBPF_MAP_TYPE_PROG_ARRAYPTR_TO_PACKETdomain_tagmax_integrity_segmentscmaxrssit_real_incrprobestubextable_lenlast_arrivalwake_index_watermarkswap_rwreservemap_extrasplit_queue_lockFC_RCTL_DD_SOL_DATAevents_local_filesrcu_gp_seq_needed_expDEVICE_HORI_POS_RIGHTSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOia_mtimenr_thpslegacy_cftypesrnid_vend_specsysv_shmfopssuppress_bind_attrsinsnlen__page_1__page_2i_mutex_keykey_restrictionstatquota_writedomainget_linkFC_PORTTYPE_NLPORTmax_depthctl_table_argdata_lenpriv_stack_ptrblkcg_nodeforksa_flagsno_start_on_addcancelled_write_bytesdispatch_busyfcp_packet_alloc_failuresnbp_rl_startFC_RCTL_ACK_0task_worksmm_cidatomic_write_hw_maxdfl_cgrp_ddebug_infoparam_ops_intaddrsshrinker_info_unitstats_locknum_kpSTARGET_CREATED_REMOVEshost_gendevcsumMEMORY_DEVICE_PRIVATE__bd_flagsfc_eofsuper_blockbi_bvec_donemap_get_unmapped_areabus_typeget_named_child_nodeBPF_MAP_TYPE_PERCPU_CGROUP_STORAGE_DEPRECATEDassoc_arrayactorBPF_CGROUP_ITER_DESCENDANTS_PREpagefault_disabled_incbpf_offload_devkobj_ns_typemax_descendantssched_shared_tagsfp_wwpnlong intcore_nodebdi_nodecn_device_specifictarget_btf_idmem_dqinfodevnodesaved_sigmaskac_uidBLK_UID_EUI64synchronize_rcuMEMORY_DEVICE_PCI_P2PDMAac_nicedq_offpinsblkcg_mutexis_visiblecgrp_linksdisk_nameuuid_t__kernel_clockid_twritabledqb_bsoftlimitvfork_donetask_cputime_atomicki_waitqra_pagesgroup__UNIQUE_ID_license656mmap_compat_legacy_basedevice_dma_supportedsysfs_dir_lockscsi_cmnd_submitterignored_posix_timerslockedsival_intia_filecancel_attachio_pageswakeup_cntrequest_pendingdl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsclass_read_lock_irqsave_is_conditionalblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startavg_triggersctl_dirFC_PORTTYPE_PTProbust_list_headunsigned charwake_qrange_startrethooksnuma_scan_periodelem_countnr_tagswakeup_pathresult_maskFORTIFY_FUNC_memscanscsi_timeout_actionei_funcsfc_passive_provpfo_val__BPF_NETFILTERtablesRPORT_ST_PLOGI_WAITpipe_inode_inforaw_spinlockmemcg_cgwb_frnblkio_delay_totaldomainnamektypebpf_attrBPF_PROG_TYPE_CGROUP_SYSCTLhost_sizemigration_disabledext_mutexfr_fspRPM_REQ_SUSPENDcancel_forkpgprot_ttracepoint_ptr_tfor_reclaim_skb_refdstphysical_locationchildren_low_usagenum_vfPIDTYPE_MAXbi_sizemg_dst_csetvlan_protothrashing_countwatcherscrypt_ctxstopwait_maxclass_write_lock_irqsave_is_conditionalioveca_flagsiomapd_dnameScsi_Hostnr_migrations_coldbtf_value_type_idmnt_idmapseeksquotactl_opski_iopriovport_typesched_remote_wakeuptag_alloc_policysock_filterBPF_LIRC_MODE2fc_lport_els_provtracing_graph_pausefc_fc4_register_providerread_itersuspend_latefront_padFC_TYPE_CTsdev_devmaxframe_sizerecoveredfc_seq_start_nexti_rwsembi_integrityexitio_uringeh_device_reset_handlerchild_ns_typeorderslave_bdevscommit_dqblkclass_local_lock_irqsave_is_conditionalmark_dirtyFC_PORTSTATE_OFFLINEnr_ctxkernfs_opsfc_rport_t0_provnr_dying_descendantsoom_reaper_timermodulewb_bytesbd_securitynodeinfoqueue_lockf_pathstatic_call_siteself64_symunlinkmap_queuescpumask_var_ttime64_tdrivers_diri_gidfc4_provtype_idFORTIFY_FUNC_strnlenrq_qosmark_deadicq_hintrmdirdq_dqbmemory_failureblkcg_gqdma_flagsbtf_field_kptrSUBMITTED_BY_BLOCK_LAYERmax_hw_sectorsselectors_mtdmod_kallsymss_typefield_maskjits_use_priv_stackprog_bind_mapli_failure_unknownfini_seq_privateremount_fsbd_holdernext_idtask_delay_infopi_senew_utsnamejit_datarelative_fdin_useforwardrq_countMIGRATE_SYNC_LIGHTerrseq_tms_rdatakstatfslruvec_statsreclaimedmems_allowed_seqmax_user_discard_sectorsinsnsitarget_allocbug_listBPF_CGROUP_INET4_CONNECTmax_nr_cidmod_arch_specificDMA_NONEtransfersizepp_recyclesplit_queue_lensharebpf_net_contextprobe_addrno_cgroup_ownerdisc_stopftrace_timestampbi_iopriobypass_addrd_ino_warnsstack_depthkernfs_elem_attrBPF_PROG_TYPE_SK_SKBi_ctime_nsecrelative_idrbnodei_private_listbinfmtftrace_sleeptimedata_size_inBPF_CGROUP_ITER_ORDER_UNSPECi_statebv_pagedestructorpcpu_cidsched_migratedZONE_DMA32FC_TYPE_ILScgroup_tasksetdup_xol_addrdevice_configurePROBE_PREFER_ASYNCHRONOUSrcu_node_entryreverse_orderingBPF_MAP_TYPE_BLOOM_FILTERcgroup_bpffile_system_typeorig_ret_vaddrelsct_sendbtf_log_levelmmu_notifier_subscriptionsswap_iocbBPF_RB_ROOTdefault_groups__sifieldsb_ionr_watchesfind_special_pageDL_DEV_DRIVER_BOUNDadj_offcurr_ret_depthstarved_entryfc_flags__fillerdestroy_dquot__task_fpstatefilldir_tget_reserved_spaceiopriomap_poke_untrackunreliablelibfc_initcreateBPF_PROG_TYPE_SCHED_ACTdirtied_time_whenstart_scan_seqmin_seqfc_rctlsym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerbd_openersdq_inuseofflinedev_pm_infomremaptime_nsin_memstallhost_self_blockednode_size_lockcss_extra_stat_showkptrpoweroff_latei_nlinkwakeupcb_listcpu_iditer_info_lenpushable_taskstty_audit_bufmaxlenkernel_cap_t__be16bpf_funcpoke_tabmems_alloweds_inode_lrucached_rqse_cset_noderecov_seqkf_rootmmap_compat_baseretvalpreparenr_threaded_childrenclock_op_might_sleepf_sb_errneed_mbd_namecheck_flagsi_sequencert_prioritykretprobe_instancescrypto_profile__be32token_createiov_basecpus_ptrq_lockdep_mapb_more_ioloadfuncscpu_bitmapSTARGET_DELatomic_write_lensaved_tfxa_headdetachprog_ifindexmm_listproperty_read_string_arrayget_statetracepoint_funcd_seqnuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmt__be64blkg_listnum_symtabexec_update_lockfscrypt_inode_infosplice_readBPF_PROG_TYPE_SOCKET_FILTERsleepable_refcntneed_qsctx_mapFC_VPORT_UNKNOWNbd_diskuid_gid_extentnumberszone_wplugs_wqWRITE_LIFE_SHORTsigpendingpi_entryBPF_MAP_TYPE_ARENAs_inodesdirtied_whenmap_direct_value_metaMIGRATE_ASYNCBPF_MAP_TYPE_PERCPU_CGROUP_STORAGEnext_scangsindexwrite_bandwidthcompletewatch_listli_prim_seq_err_counteh_abort_listBPF_CGROUP_UDP4_RECVMSGd_sibmodule_attributemax_host_blockedneed_tsin_dpm_listwordwork__list_add_valid_or_reportmultiprocessquiesce_depthfbatchclass_task_lock_is_conditionalBPF_CGROUP_INET_INGRESStask_groupfc_destroy_exch_mgrf_pos_lockperiod_timerBPF_FLOW_DISSECTORfillsk_buff_data_texpected_revisionbio_pooltimeout_workBPF_PROG_TYPE_LWT_XMITwrite_endsrcu_barrier_completionBPF_MAP_TYPE_STACK_TRACEpacctblk_mq_tag_setcurr_targetvm_page_protbalanced_dirty_ratelimitbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatPTR_TO_PACKET_ENDperf_event_contextatomic64_tnoinstr_text_startctx_size_outddp_doneac_btime64HRTIMER_RESTARTrpm_autosuspend_delayac_gidnotify_timercorememfh_d_idBPF_MAP_TYPE_USER_RINGBUF__UNIQUE_ID___addressable_fc_lport_iterate671LPORT_ST_LOGObusystack_canaryuser_keyring_registermax_write_zeroes_sectors_utimedn_unable_to_routetmf_work_q__fortify_size_flags_1_flags_2FC_TYPE_BLStaskstatsport_stateproactive_compact_triggerposix_acli_dio_countarch_rwlock_tpao_tmp__driversym_timens_pagerport_event_callbackprog_token_fdsysctlsoffsetrtpoll_taskprot_guard_typedev_iommuWB_REASON_SYNCmap_typeclass_rwsem_read_intr_is_conditionalcompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_usersSDEV_BLOCKbacking_dev_infoi_mappingheadersdiscard_alignmentbsg_deviceshow_statsnr_populated_csetss_vfs_rename_keysubmitteretypei_bytesnormal_prioblkio_countshost_datadispatch_waitBPF_MAP_TYPE_INODE_STORAGEsrcu_nodelast_mm_ciddelayedhdr_lenpagefault_disableper_cpu_nodestatsvaddrscsi_vpdis_softnext_cpugrab_current_nsclass_namesdisc_worknr_taskslock_class_keypriv_stack_requestedsum_exec_runtimememory_failure_statssetup__UNIQUE_ID_y_666dev_pin_infolesb_sync_losspoll_table_structmce_whole_pageia_modercu_tasks_holdout_listsched_rt_mutexs_pinsswap_peaksnon_seqbpf_prog_arrayattach_func_protopresent_pageshctx_listrenamecontiguousthrashing_delay_totalmajorktime_tPRJQUOTAlink_idzswap_lruvec_stateBPF_CGROUP_INET_SOCK_RELEASEkprobe_blacklistjump_entriesdio_offset_alignreserved_tagsdma_masksa_restorerqueuelistdatalenmkdirnextrelax_countrestore_earlyPIDTYPE_TGIDilencpu_run_virtual_totalmax_active_zonesdevice_physical_location_horizontal_positionattach_flagskfunc_btf_tab__list_addrportkobj_uevent_envkernfs_rootkprobes_text_startpid_typefown_structi_default_aclBPF_PROG_TYPE_LIRC_MODE2fregs_statemap_flagsBPF_PROG_TYPE_LSMzonerefshift__devicesFORTIFY_FUNC_strcpypendingfc_destroy_fcpBPF_MAP_TYPE_PERCPU_ARRAYdma_boundarybd_nr_sectors__UNIQUE_ID___addressable_fc_fill_hdr669nr_eventssdev_statekmemcg_idkstatanon_vma_namedq_hash__iovgp_stategrphiFC_RCTL_ELS_REQntabiommu_mm_datamap_for_each_callbackinvalid_crc_countnr_disk_swapinszone_wplugs_err_listma_flagsarch_uprobebio_issueDL_DEV_UNBINDINGcurrent_taskrefcountmmap_lockuprobe_multidevice_sizeLPORT_ST_RFF_IDzonelistsrcu_reader_flavorbtf_fddumped_framespeerstimerqueue_nodereal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_alloweduse_16_for_syncrt_mutex_waitermem_cgroup_per_nodekcompactd_pad_page_pooldq_dqb_lockf_flagsblk_qc_tshow_infoinner_map_fdslave_allocflush_requiredWB_REASON_FS_FREE_SPACEsg_tablememcg_vmstatskeyring_semattributesblk_queue_statsgrplomax_rport_retry_countkgid_tkey_userreadlinkoffline_disabledd_comparetime_ns_for_childreni_wb_frn_winnerqspinlocksighand_structstart_brkdisc_callbackmap_mmapdio_completeshost_statelocked_pendinglockdep_keyrnid_resvdextentfile_offsets_idstate_maskcore_statelink_upalignsym_int80_landing_padngroupsmajor_retriessp_offset__sigrestore_tRPM_SUSPENDEDvolnameDMA_TO_DEVICEmutexn_refattrsexch_mgr_resetBPF_TCX_EGRESSFC_VPORT_DISABLEDbi_sectoreh_deadlinefsbaseinactivesrcu_barrier_mutexloss_of_signal_countdirty_limitswregs_state__kernel_timespecchildren_min_usageeh_should_retry_cmdpglist_datad_lruwaitqmax_pkt_offsetd_fieldmaskcountersfaults_disabled_mappingnameidataarg_sizefailedpoweroffbpf_prog_opsbpf_verifier_envminorsnonresident_ageControlRequestselemsizerlim_curFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagscan_workdebugfs_entrywait__list_add_validshow_rqcan_queuest_shndxreservedi_wb_frn_historyctxsprocess_keyringset_dqblkrestart_blocks_opbi_end_iokobjectposix_cputimer_basenr_memcgsleveluser_definedcow_page__warn_printkFC_SOF_Fnanosleepinvalid_tx_word_countfalsecn_sig_alarmpi_state_listtv_secac_exitcodeBPF_KPTRsuidFC_SOF_I3prog_typekey_typedismissi_hashmm_cid_next_scanfreeze_noirqoublockdisc_idia_atime_timerfifovm_private_dataskip_ms_page_8FC_RCTL_BA_PRMTrtpoll_scheduledWB_SYNC_NONEBPF_PROG_TYPE_KPROBEorig_progdq_freeSHOST_RUNNINGrootLPORT_ST_RNN_IDDISC_EV_NONEsupported_classespolicycpu_baseBPF_PROG_TYPE_SYSCALLcap_bsetnr_to_writerportsnr_itemsanon_costseq_startfcp_input_megabytesbp_regbvec_poolkern_versionrb_root_cachedfc_host_statisticsWB_REASON_FOREIGN_FLUSHmac_headeri_blkbitswritervm_pgoffvirtmem_refcounttarget_fdcsum_typeFC_RCTL_F_BSYLbin_attributemath_emu_infopushable_dl_taskswrite_u64testWB_SYNC_ALLsched_infogroup_infotailsdqi_fmt_idPTR_TO_ARENAactive_extensionsmemcg_csssoftirq_next_timerrevisionis_child_subreaper__UNIQUE_ID_debug_loggingtype657sg_tablesizeexit_codefile_lock_contexttracingnr_pageswriteback_indexread_u64fiemap_extent_infofilemempool_free_tPTR_TO_TCP_SOCK_OR_NULLfree_foliort_spc_warnlimitcmndatomic_write_hw_unit_mincompact_count_sk_redirfc_fill_hdrtimer__empty_rangessbq_wait_statedev_namebpf_mapi387__p_sizeBPF_PROG_TYPE_EXTBPF_PROG_TYPE_FLOW_DISSECTORnotified_atn_klistwb_errbudget_tokenfc_framevlan_tcikswapdwrite_dquotrefcount_offpercpu_pvec_drainedf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachewwnnstorebi_bdevst_infodispatchdescsquiesced_bydqi_max_ino_limitllseeknet_nsRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleget_projidfunc_info_aux__sectorpart0cnvcswwwpnkqidmem_cgroupPTR_TO_BUFfree_inodenext_keysiglockwait_queue_func_tperf_recursionnr_wakeups_remoted_spacei_ctime_secdebugfs_idreal_func_cntnext_timer_typeBPF_TASK_ITER_TGIDTT_NATIVEused_map_cnt__empty_insnshlist_bl_nodenum_descs_head_1_head_2clockid__read_overflow2_fieldFREEZE_MAY_NESTsym_hvclock_pageremap_file_rangemmap_legacy_basepfmemalloc_waitend_dataxa_lockfutex_exit_mutexuse_16_for_rwiommu_groupmap_peek_elemnr_isolate_pageblockmempool_alloc_tdevice_get_dma_attrtarget_blockeddev_loss_workalloc_inodepayloadbtf_field_graph_rootdirty_foliodn_unknownnode_zonesseq_countfscrypt_keyringis_hardasync_sizetrap_nrmac_lenf_iocb_flagsctx_size_in__flagsRPORT_EV_LOGOkcompactd_waitnodenametotal_vm_entire_mapcountiteratorlastpool_dataqf_opsforce_atomic_pad1_LPORT_ST_RHBAreal_credno_difblkcnt_td_rt_spaceprog_idsBPF_MAP_TYPE_HASHsigned charmap_local_storage_chargehas_child_subreapermount_pad2_reasonblk_flush_queuesched_entitydev_links_infoinner_protocol_types_uuid_lenpcpufh_seq_cntdqi_privfmode_trpm_autosuspendrnid_att_nodessweventactivatefxregs_state_lowerpaddingDEVICE_REMOVABLEpid_ns_for_childrentimestimer_rand_statelru_gen_memcgfr_encapsllist_nodebpf_run_ctxbio_slabstate_add_uevent_sentLPORT_ST_RSPN_IDenv_startfc_lport_notifier_headmodule_notes_attrsio_cqlower_firstrangebvecacct_vm_mem1on_cpumanage_system_start_stopmg_src_preload_nodestringSHOST_CANCEL_RECOVERYnuma_preferred_nidfree_diskPTR_TO_MAP_KEYvmem_altmapbiotailwait_startelevatorspinlockmin_unmapped_pagessrcu_barrier_seqi_aclssb_statnofaultbpf_map_typeia_rangesq_size_fieldis_reltablepteval_tlog_levelblk_mq_tagsDEVICE_PANEL_LEFTorc_unwind_iprel_deadlinexfer_contig_endkobj_typeskip_settle_delaysb_writersdma_cleanupeh_timed_outdriver_dataphys_addr_tdma_iommumax_idirq_safeLPORT_ST_READYrescue_lockdefault_timer_slack_nsxregs_states_statecompletion_cnt_deferred_listcurr_nrset_child_tidiattracpi_match_tablenfdsrlimitBPF_TRACE_FEXITmap_update_elemlast_subtree_bstatnr_frozen_tasks__list_del_entry_valid_or_reportiterrelease_agent_pathidle_notificationmodule_statertpoll_triggersPTR_TO_BTF_IDwait_lockf_pipegetgeocset_linkswrite_iterD_REAL_DATAsp_featuresacct_timexpdclock_mutexnr_failed_migrations_runninguserfaultfd_ctxevent_flagsthread_structbuf_lenfc_rport_statemm_context_tnotifier_fn_tbd_stampdio_mem_aligncstimeRPORT_ST_FLOGIprot_capabilitiesFC_RCTL_BA_ABTSatomic_long_trpm_requestpositionMQ_RQ_COMPLETEio_comp_batchline_info_cntcftsf_credtrace_eventsfc_port_typed_iputlast_bstatnew_prog_fdskb_putfc_lport_iteratenr_wakeups_syncklist_nodestackmap_release_urefBPF_REFCOUNTblockedvm_numa_eventdst_trampolineallowedmce_countweighttotalblk_plugOutputRequeststrc_reader_nestingfpstatetag_setis_roxno_scsi2_lun_in_cdbprevseqcount_raw_spinlockbios_paramnum_orcskswapd_failuresFORTIFY_FUNC_kmemdupbuflenbpf_kfunc_desc_tabdeadBPF_CGROUP_DEVICEWRITE_LIFE_LONGcrc_offloadexpiry_activeeh_bus_reset_handlermtd_infois_confidentiali_dentryfixupsFC_RCTL_BA_ACCvm_endvm_structproc_handlerprlimemcgfsyncsgid__fc_frame_header_getcompat_robust_listnuma_workprioprivvaluesg_bytesrcu_workBPF_CGROUP_INET4_GETPEERNAMEredirectedcurrent_stack_pointerac_minfltbpf_prog_aux_hugetlb_cgroupset_policyinternal_tagthreadftrace_callsitesmmlistservice_paramsBPF_CGROUP_SETSOCKOPTforceidle_sumusedpage_typeclass_spinlock_is_conditionaluserskb_iifmynodeseq_stop__MAX_BPF_PROG_TYPEblk_traceactionseconds_since_last_resetlink_detachpi_waitersdom_cgrpqueue_mappingscsi_comp_flagsprlolportfile_name_offbstatfailcntatomic_tpcp_listqueue_flagsBPF_PROG_TYPE_UNSPECdestroy_pkt_cacherb_rootLPORT_ST_RPAfreepages_countutf8data_tableBPF_PROG_TYPE_SK_MSGprim_seq_protocol_err_countexe_fileuid_telementsd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_datafc_fc4_add_lportdef_flagssrcu_n_lock_retries__kunmap_atomicraw_locksrcu_structprovinner_map_metais_guestli_link_failure_countio_minnf_skip_egresstarget_attrsrtpoll_wakeupsplice_eofs_sync_lockproganon_vma_chainFC_LPORT_EV_ADDi_mtime_nsecseq_opsrseq_event_maskem_pdi_fsnotify_maskshared_pending__int128FC_EOF_RTI__mce_reservedwriteback_controlmax_write_lenmm_struct__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEbuild_idhost_statss_export_opCONST_PTR_TO_MAPBPF_CGROUP_INET4_GETSOCKNAMElen_descseg_boundary_maskanon_namesched_dl_entitypp_ref_countactivest_othercall_get_stackstartparentlookupkernel_siginfowritten_stamp_sigpollSKB_CONSUMEDfc_disc_stop_rportsinitializedSDEV_CANCELkill_sb__bi_remainingnum_bugskmalloc_cachescftypesecurity_supportedsock_fprog_kernklistusercntSKB_DROP_REASON_OTHERHOSTirq_delay_totalstate_entry_ptrfc_non_bls_respstatsdev_loss_tmousersactive_basesDEV_DMA_COHERENTswap_slot_free_notifyELS_EXPL_INSUF_RESstart_databoolcompact_order_failedbv_len___GFP_RECLAIMABLE_BITinquirymodsctimernid_atypedestroy_inodecma_pagesfutex_pi_state__compiletime_assert_127SKB_DROP_REASON_TCP_OLD_SEQUENCESKB_DROP_REASON_PKT_TOO_SMALLi_mutex_dir_keyrescue_workrestartsSKB_DROP_REASON_UDP_CSUMdevice_physical_location_vertical_positionget_aclset_aclac_exe_devmemory_tiers_voppercpudescpoll_bioiterate_sharedmemswsym_vdso32_sigreturn_landing_padfc_fpin_statscma_areafeatures__compiletime_assert_133rcu_tasks_exit_cpulink_fdmigrate_from_cpubd_size_lockwriteerror_codebuddy_listref_ctr_offsetsldt_structprog_attach_flagsfcp_control_requestscred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_nameVTIME_INACTIVEmg_src_cgrpeh_target_reset_handlerclass_preempt_is_conditionallink_createtimeouturing_cmdshrinker_idnr_dirtiedgetattrBPF_SK_SKB_STREAM_PARSERsetattrPTR_TO_TCP_SOCKvmstats_percpufixupblockMQ_RQ_IDLEdevtlast_cpufor_backgroundnr_wakeups_localcn_sig_warnuidhash_nodemax_ratioalloc_cpupost_attachworker_privatepoll_eventalloc_factorlinelinkbi_pooleffectivecompact_blockskip_flushmoderead_char___GFP_NOWARN_BITnode_idPTR_TO_STACKtargetget_nextdqblkrcu_tasks_idxBPF_PROG_TYPE_NETFILTER__ret_do_oncejournal_inforefcount_inc_not_zerobi_inline_vecstqheadlast_used_atrq_end_io_retline_offhres_activeold_subtree_controllesb_link_failmod_namenotes_attrsdelay_workFC_VPORT_NO_FABRIC_SUPPblock_device_operationsoffset_ctxbi_blkgseq_nexttail_call_reachablelast_switch_timefcp_output_requestscompact_init_free_pfnwakeup_countwait_indexSKB_DROP_REASON_IP_INVALID_SOURCElog_sizerunnable_weightSKB_DROP_REASON_NEIGH_DEADFC_VPORT_FAILEDmap_push_elemtarget_busyclass_releaselast_sum_exec_runtimeSKB_DROP_REASON_PACKET_SOCK_ERRORdd_key_truesa_handlerfree_countcg_listscsi_transport_templatelocked_vmqueue_rqaddressmq_hctxstart_timeRPORT_EV_STOPzone_wplugs_hashkprobe_multicookielistWORKER_DESC_LENfreezer__pptrsig_okextabledma_data_directionmax_entriesi_sizeentry_eipcgroup_atypesplice_pipexstate_headerinquiry_lenrtpoll_timerdma_addrELS_TESTem_perf_domaind_flags___GFP_HIGHMEM_BITdying_tasks_large_mapcountnode_present_pagespid_namespacelivefc_els_rscnclock_was_set_seqspc_warnlimitseqcount_tmin_fltblock_devicethreadedfp_fidMEMORY_DEVICE_GENERICpkruBPF_MAP_TYPE_PERF_EVENT_ARRAYattribute_containerELS_AUTH_ELSprojid_tvendorvport_idmemcg_nodeBPF_CGROUP_UNIX_SENDMSGdma_lengthcn_clearkey_payloadadd_linksrdata_argnbp_th_start__empty_insnsiuse_10_for_msELS_QSABPF_RB_NODE_dummy_bndrefcount_saturation_typeexception_cbBPF_TRACE_UPROBE_MULTIper_cpu_pagesetfcp_cmndsaved_stateparent_exec_idutil_sumdd_key_falsesigvalfsnotify_mark_connector__ubuf_iovecsize_is_constantcputime_atomicdeadlinect_in_idbio_integrity_payloadlun_in_cdbexit_requeste_d_tovwait_queue_upperclass_write_lock_irq_is_conditionalcgroup_fileswap_readahead_infovtimeexpecting_cc_uas_rootli_device_specificstack_refcountgrpmaskdevice_attributes_remove_countBPF_SK_LOOKUPlru_genwrite_newuser_namespaceclass_rwsem_write_is_conditionalpids_active_resethlist_nodeFC_FS_EXP_COSblk_features_tsuper_operationsautosleep_enabledwrite_file_infoload_sumaddress_spacecpus_maskdl_yieldedstarget_dataextension_progfile_dispread_newd_spc_softlimitfc_discuse_10_for_rwkrefrseq_css_lock_keyfc_disc_restartdqi_flagsmq_ctxjump_entrypi_top_taskhlist_nulls_nodefc_els_lesbpacct_structRPM_REQ_RESUMEpathnameuser_sizelast_queue_ramp_upkref_getbd_statsshow_fdinfoFAULT_FLAG_MKWRITEput_budgetfadviseclass_read_lock_irq_is_conditionallesb_inv_crclinenoMODULE_STATE_LIVEtask_listtc_at_ingressasync_scanPTR_TO_CTXFAULT_FLAG_RETRY_NOWAITBPF_CGROUP_SOCK_OPSread_foliosc_data_directionhas_elevatordtordq_countvpd_pg0nlinksignalnr_wakeups_passiveself_exec_idstate_syncedrjt_dataws_activefr_max_payloadf_epctl_tablercu_specialprog_fdscsi_device_handlerentryold_subtree_ss_maskbackWORK_STRUCT_FLAG_BITSBPF_MAP_TYPE_LRU_HASHfr_flagscgwb_domaincntsmsecs_to_jiffiessock___GFP_THISNODE_BITidr_rtsdev_bflagsdispatch_fromWORK_STRUCT_PWQ_SHIFTnr_linfoFC_NS_GNN_IDmq_freeze_wqstart_prevent_timepgd_tsigset_twq_offLPORT_ST_DNSmap_btf_idbucket_idELS_PRLIELS_PRLOrstat_flush_nextignoredgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64prog_id__list_del_entry_validreserved_tailroomi_inoserver_has_tasksrport_work_killRPORT_ST_PRLIpgdati_spc_warnlimitunderflowf_posBPF_MAP_TYPE_HASH_OF_MAPSperformancesoftac_pidowner_trapnoload_weightBPF_PROG_TYPE_SOCK_OPSfc_fh_typesleepablevport_statesymlinkclass_rwsem_write_try_is_conditionalkmalloc_noprofbd_queueerror_framesin_iowaitDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclbdi_writebackrb_leftmostSKB_DROP_REASON_TCP_AUTH_HDRdst_neededbug_addr_dispmigration_pendingscan_mutexhosttd_real__msecs_to_jiffiesns_commonmap_ifindexdevice_get_match_dataELS_GAIDs_max_linksctl_table_rootfc_rport_eventscatterlistverified_insnsthread_headacquire_dquotclockid_tfifo_timetarget_destroyzone_capacityFORTIFY_FUNC_strlenpgdval_td_managedevice_attrsmax_ctx_offsetmax_device_blockedback_padMIGRATE_SYNCwcharRQ_END_IO_FREEexplanseq_filefcp_output_megabytesonline_cntBPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATEDrestoreSKB_DROP_REASON_IPV6_BAD_EXTHDRline_infoseq_ptrHPROBE_LEASEDBPF_LSM_MACthaw_superalt_lenseq_operationslesb_prim_errfallocatelog_true_size__retdst_pending_confirmgranted_mac_call_addrwriteback_sync_modesi_mmap_rwsemSKB_DROP_REASON_TCP_INVALID_SYNundo_listattribute_groupdma_poolspersonalityprintk_index_sizeuprobe_task_stateWB_REASON_BACKGROUNDstimeskb_is_nonlinearstatic_priotmpfileattach_func_namedata_indqi_formatnvcsw_nr_pages_mappedfrequencyrtpoll_totaldev_pm_ops__refcount_sub_and_test__kmalloc_indexpfmemallocblk_mq_ctxno_updateiter_typeDEVICE_PANEL_BOTTOMscsi_pkt_lockencap_hdr_csumtransporttmap_get_next_keyBPF_SK_REUSEPORT_SELECT_OR_MIGRATEnr_wakeupsquerybpf_prog_typeenabledki_filpmultiple_queueswork_func_tmemcg_vmstats_percpupp_magicfpu_state_perm__refcount_dec_and_testfwnode_reference_argsdevres_headused_maps_mutexRPM_REQ_IDLEfilenamebaseRPORT_ST_ADISCac_ppidd_prunerestore_noirqsysfs_registeredDumpedFramesSKB_DROP_REASON_TCP_TOO_OLD_ACKrlockBPF_PROG_TYPE_SCHED_CLSi_rt_spc_warnlimitqueueBPF_PROG_TYPE_CGROUP_SOCKbytesnuma_migrate_retryMEMORY_DEVICE_COHERENTenclavefiltersaved_dst_prog_typeroot_blkgd_revalidateLPORT_ST_SCRWB_REASON_PERIODICcgrpwatermark_boosttracepoints_incoredqsi_opsubtree_controlquota_syncsrcu_have_cbsmemory_peaksInvalidTxWordCountasync_in_progresssignumdqi_dirty_listpi_lockdirtied_stamptm_donetimespec64BPF_WORKQUEUEscan_finishedlesb_sig_lossreplace_bpf_fdnr_forced_migrationsdst_mutexumount_beginchannelbadblocksnr_descendantsll_nodeport_idkernfs_nodearch_atomic_readcpumaskptrace_messagelengthtag_listbio_alloc_cachepdt_1f_for_no_luni_wb_frn_avg_timeBPF_LIST_HEAD_pincountreclaim_statecur_imageruntime_errori_sb__poll_tbpf_jit_poke_descriptorsubvolon_dispatchdirty_inodesymtabd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structELS_LIRRfs_parameter_specSKB_DROP_REASON_MAXrcu_data0real_blockedruntime_suspend__s16BPF_CGROUP_UNIX_GETPEERNAME__compiletime_assert_137wifi_ackedbacktraceschedule_delayed_workoffline_alreadys_umountn_nodeon_listcn_lost_creditmax_descendantsrefaultsdata_vmneeds_force_resumeblk_eh_timer_returnbtf_recordcsum_levelrpm_statusscsi_host_statedeferred_split_queue__s32p_sizechildrenbpf_local_storage_map__mono_tc_offsetcheck_eventsmarkdqi_bgracei_wbhost_nof_inoderx_framesserialburstname_offpermissionsgraph_rootkernel_load_data_strELS_RJT_UNABcgroup_rootscsi_target_statehostmsi_device_dataslave_destroykallsymsmap_alloc_checki_ino_timelimitinit_timer_keybi_issuebd_holder_opsBPF_KPTR_REFlink_idscgwb_frnsrcu_idxSTARGET_CREATEDutil_est__s64ipc_nshugetlb_usagebpf_cookiesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenacct_rss_mem1___orig_eipsrcu_datadevice_physical_location__keycgtimebypass_spec_v1pagefault_disabledELS_CSUindexs_time_max__mutex_initucount_maxdelayed_workprog_flagsopen_partitionssa_maskkswapd_lockmmappedElf64_Wordold_dom_cgrpjited_imageactive_timeatomic_flagscallernum_jump_entriesextra_lenPIDTYPE_PGIDbtf_vmlinux_value_type_idmnt_namespaceelemwb_completionSKB_DROP_REASON_IP_LOCAL_SOURCEend_ioquotalensrcu_data_have_cbsnivcswoffdev_tidlinfo_idxmce_vaddrBPF_CGROUP_UNIX_GETSOCKNAMEdl_dev_stateshowrb_subtree_lasts_listBPF_MAP_TYPE_CGROUP_STORAGEhigh_workmq_pollsender_cpunr_segssame_target_siblingstailcall_targetof_match_table_entryBPF_PROG_TYPE_CGROUP_DEVICEfc_tm_flagsino_timelimitalternative_gpt_sectori_readcountELS_ABTXblkcg_polsincrfreeseq_offloadrange_cyclicprog_cntlock_countthrotl_datalist_lru_onei_pagesmxcsrclass_rcu_is_conditionalarchdataptrace_entryuid_mapguest_permwait_queue_headnum_srcu_structsnr_activeprev_sum_exec_runtimei_flagsgendisku_flagstag_set_listlogical_block_sizesubtree_ss_maskinvalidate_lock_keyinfol1d_flush_killctx_outFC_VPORT_ACTIVEtimestampsrlimit_maxwrite_beginSHOST_CANCELbpf_prog_offloadwrite_infohrtimer_restarts_encoding_flagssessionids_time_minSKB_DROP_REASON_UNHANDLED_PROTOWORK_STRUCT_PWQ_BITvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrbpf_iter_aux_infos_stack_depthnode_offsetkprobe_override__vm_flagsresid_lenqueue_depthbpf_tramp_imagecsum_offsetpm_messagememcg_lrufred_cschangedvportcur_ktimeinitfop_flags_tgroupsoffstty_structnotify_nextvirtual_dr6dma_opsdma_addressmmap_basebd_devsyscall_workinit_cmd_privelowbpf_trampolinelockdep_mapnum_trace_evals_addr_bndcgroup_base_statELS_RDFELS_RDPset_dbd_for_msnumberzone_device_dataquota_readloss_of_sync_countplenhlistpinned_vmfunc_cntELS_RECwritepagesnuma_faults_localityqrwlockELS_RESPTR_TO_FLOW_KEYS__write_overflow_fieldrw_semaphoreattach_bpf_fdfirst_minori_blockstask_fragWB_REASON_LAPTOP_TIMERsource_listsum_block_runtimeBPF_NETKIT_PRIMARYnuma_scan_period_maxtotal_timepowerfromnum_ei_funcsi_generationfcp_input_requestsflushBPF_PROG_TYPE_PERF_EVENTtask_fd_querymg_dst_cgrponlinernid_ip_addrBPF_PROG_TYPE_RAW_TRACEPOINTno_vpd_sizeformatlast_switch_countlast_wakee__cloned_offsetswapuint32_tssize_tRQ_END_IO_NONEvtime_statetry_vpd_pagesSKB_DROP_REASON_TCP_OFO_DROPparent_could_setfcapper_cpu_nodestats_blocksizequeue_numprevent_sleep_timeBPF_MAP_TYPE_CGROUP_ARRAYclass_spinlock_irqsave_try_is_conditionals_readonly_remounti_io_listrefaultedchild_countBPF_MAP_TYPE_ARRAY_OF_MAPSrelease_agent_workVTIME_IDLEBPF_PROG_TYPE_STRUCT_OPSwb_domaincgroup_subsysnbp_th_nr_candELS_ADDR_FMT_PORTip_summedcompat_uptr_tcgwb_treeDEVICE_HORI_POS_LEFT_hugetlb_subpoolend_pfnuclamptgidlimits_lockreleasenr_wakeups_migrateserial_nrstack_vmi_fieldmaskupidBPF_CGROUP_INET_SOCK_CREATEprotection_supportkcompactd_highest_zoneidxfreeze_mutextrace_evalsELS_RLSia_vfsuidbtf_mod_pairquota_format_opsi_datarescue_listfsverity_infocore_threadclosidsched_avgRPORT_ST_PLOGIcodearch_atomic_fetch_addBPF_LSM_CGROUPu64_stats_syncsyscorenr_reserved_highatomic__i_nlinkpmd_tinumli_invalid_tx_word_countsrcu_barrier_cpu_cntbatchedreadaheadopt_sectorsFC_VPORT_FABRIC_REJ_WWNhrtimer_cpu_baseirq_domainwait_liststatic_call_trampac_etimefsverity_operationscoublockbug_tablemigrate_modesecmarkusing_gplonly_symbolswb_listremovedhandleremulatednr_writeback_throttledsym_vvar_pageELS_RPLmembarrier_stateELS_RPSBPF_PROG_TYPE_LWT_INdma_pad_maskfc_seq_els_dataELS_RPSCBPF_KPTR_UNREFbin_sizeFORTIFY_FUNC_strlcatrcu_read_lock_nestingreg_typecb_accessrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_tio_bitmapDEVICE_VERT_POS_CENTERELS_RRQfc_disc_initretry_countsbitmap_wordmanaged_pageslong unsigned intmax_timelast_queue_full_countread_file_infoELS_RSSexec_startia_sizeema_listRPM_RESUMINGunpinned_netfs_wbMODULE_STATE_COMINGsym___kernel_sigreturnZONE_DEVICEfunc_info_cntuser_cpus_ptrSKB_DROP_REASON_TCP_MD5FAILUREuser_scand_opstate_initializedrelease_dquotELS_RTVplugsoftirq_activatedkey_sizeinv_weightsecuritykernel_symboldl_timerlockdep_map_pmodule_param_attrsdirty_ratelimitno_read_capacity_16scsi_host_template__user_state_sizechainedVTIME_GUESTretriessdtrsysvsemdisconnectstasheduser_xfeatures__kmalloc_cache_noprofdisc_mutexuse_memdelaynr_cached_objectshas_timeoutcgroup_namespacecommcallback_headhead_fragexception_table_entryin_hrtirqctl_table_set_overruncondhash_lenDEV_DMA_NON_COHERENTcoredumpd_sbio_lock_cls_keyct_fs_typeSKB_DROP_REASON_IPV6_NDISC_FRAGksetsleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsPTR_ERRnodesysvshmno_highmemdata_outREFCOUNT_ADD_UAFfirstSKB_DROP_REASON_TCP_FASTOPENELS_EXPL_UNAB_DATA_nfctSecondsSinceLastResetWORK_OFFQ_BH_BITactive_countRPORT_ST_RTVnr_active_requests_shared_tagsnum_tracepointsFC_NS_RSNN_NNvpd_pgb7ueventfc_pri_tasharednext_cpu_batchmemcg_completionsdisk_eventss_sysfs_namesigval_trqst_qfc_rport_destroySDEV_QUIESCEmap_pop_elembitsbase_pfnclass_mutex_try_is_conditionalsem_undo_listcompat_rmtpclass_local_lock_is_conditionalELS_ESTCELS_ESTSstatic_key_trueno_fcs_stimeSKB_DROP_REASON_TCP_AONOTFOUNDinsnsperf_event_ctxpprogsOutputBytesFC_NS_GSPN_IDcostxcomp_bvio_contextfc_disc_stop_finalPIDTYPE_PIDwakee_flipsvlagufdsvlansegment_boundary_maskattach_tracing_progioctlprev_cputimectx_inbtf_flagshorizontal_positionem_perf_tablebi_crypt_contextprivateswp_entry_tcharFC_PORTSTATE_BYPASSEDmatchnr_failed_migrations_hotreg_offsetBPF_TRACE_KPROBE_MULTIqueue_stoppedFORTIFY_FUNC_UNKNOWNwrite_charbin_attrscpu_itimerdevres_lockfiles_struct__ret_onceblk_zoneSDEV_RUNNINGicq_treePTR_TO_BTF_ID_OR_NULLvfsuid_tf_lockexec_vmkernel_parambtf_fieldfh_f_ctlget_lesbvertical_positionbtf_dtor_kfunc_traw_atomic_fetch_add_relaxedshutdown_prerelease_folioftrace_managedbi_io_vecvendor_idmtimearchrobust_listasync_probe_requestedthaw_earlyac_btimevectors_securitysplice_writeparam_lockreq_listi_opflagstot_write_bandwidthdentry_operationsstats_sectorss_blocksize_bitskfreeexp_hintclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapsw_hash_head_2asym___kernel_vsyscallopen_mutexfortify_funcsk_buff_fc_frame_alloccan_forkFC_FS_RJT_VERlow_usageget_timeki_flagss_inode_wblist_lockpermwriteback_inodesERR_PTRdestroy_worklockableuprobes_statemm_countfc_frame_is_lineartrace_overrunargsargvuclamp_reqswap_info_structs_qcopwb_tcand_bytesblk_mq_queue_mapFC_VPORT_INITIALIZING__kernel_long_tsrcu_usagefaultableperf_event_mutexfctsexit_hctxqueue_delayed_work_onfc_xid_not_foundsync_modemap_gen_lookupin_execverlim_maxFC_PORTSTATE_MARGINALDEVICE_REMOVABLEsimple_tagstarget_listmutex_lockVLinkFailureCountbpf_kfunc_btf_tabrtpoll_next_updatecoherent_dma_mask__data_lendriver_flagsscsi_residfile_ra_statek_sigaction_hugetlb_hwpoisoninsn_offshrinker_infocompletionslld_event_callbackreadahead_controlfwnode_operationsprocs_fileswait_queue_headmemory_typevm_userfaultfd_ctxTT_NONEmap_pagesBPF_PROG_TYPE_TRACEPOINTSKB_DROP_REASON_TCP_ABORT_ON_DATAmod_tree_nodelocal_watermarkprobe_offsetct_fs_subtypecmd_flagss_bdev_filerequest_queuedev_pagemaptarget_private_offsetRPORT_ST_INITcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fsELS_RJT_BUSYhost_eh_scheduledsoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLErb_nodeELS_EXPL_PLOGI_REQDreturn_consumerround_robinksymi_private_dataroot_csetused_btfsptracer_credWORK_STRUCT_COLOR_BITSsrcu_barrier_headleadercheckTT_COMPATcap_effectivenetfilterexit_statefc_fcp_pktfaultscan_startprogs_hlistWORK_STRUCT_COLOR_SHIFTnuma_pages_migratedidr_nextsched_tagssupported_modefiltersnr_frozen_descendantssbitmap_queueno_cgroup_migrationsched_databpf_func_info_auxprintk_index_startindex_keybreserved_tags__bi_nr_segmentsLPORT_ST_FDMIforce_scanintervalavgs_lockbug_entryzswap_maxtimers_activenum_classesprotocolbpf_cgroup_storagevma_lockrtpoll_untilkswapd_waitdl_throttledbpf_progseccompDEVICE_VERT_POS_UPPERrolesblk_holder_opsfprop_local_percpustatic_key_modextensionsfilter_countpsi_filesmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodecreate_work_queuerport_delete_workumode_t__init_workinitial_nsno_pmGRPQUOTAia_vfsgidioctx_locktimer_slack_nss_bdixarrayjited_linfocan_wakeuptime_namespacepdeath_signalexpected_attach_typedst_regnr_wakeups_idledqi_igraceqf_nextBPF_MAP_TYPE_LPM_TRIEmaple_treensproxyELS_EXPL_OXID_RXIDslave_dir__write_overflow_pkeykernfs_rootFC_TYPE_ELSucountsget_next_idDD_CLASS_TYPE_LEVEL_NUMhooknumwrite_syscallslistscore_relo_rec_sizerefcount_tslow_grocmd_lenDEVICE_PANEL_TOPmemtiermax_hw_discard_sectorsint32_txol_areadefault_lockguess_capacitysrcu_gp_mutexdebugfs_dirwakee_flip_decay_tsprio_listlast_timerequestblk_unique_idwpcopy_delay_totalSDEV_DELmax_payloadcontextSKB_DROP_REASON_TCP_ZEROWINDOWhost_lockrwlock_tvm_fault_tskb_extuse_autosuspendfc_rport_createclass_spinlock_irq_try_is_conditionalfc_disc_eventcfs_rqtree_reclaimednr_requestsvirt_boundary_maskSKB_DROP_REASON_TCP_INVALID_ACK_SEQUENCEcgroupscore_occupationget_policycore_cookiepcrefrefcount_struct__kernel_ulong_tkf_opsfwnodeZONE_DMA__UNIQUE_ID___addressable_fc_disc_init655BPF_CGROUP_GETSOCKOPTcgroup_storagestatic_call_keycsum_startnamespaceSKB_DROP_REASON_IP_TUNNEL_ECNparametersbtf_sizeSKB_DROP_REASON_IP_INHDRgroup_leaderdma_channelrunnable_avglookaheadiowait_countli_loss_of_signals_countshstkfn_wwpnioac__kernel_clock_t___GFP_DMA32_BITwas_resetgp_seqscsi_device_stateuuidmaj_fltWB_REASON_FORKER_THREADcached_requested_keyfp_flagsdqb_rsvspaceSKB_DROP_REASON_SUBSYS_MASK___GFP_NOMEMALLOC_BITmap_lookup_and_delete_batch__s8inode_operations__kernel_size_tdma_configurefile_leasepage_counterarg_flagsclass_local_lock_nested_bh_is_conditionalgpl_symsallowed_attachsrecursion_detectedpercpu_rw_semaphoresymbolic_namearch_spinlock_tseqcount_raw_spinlock_tbpf_iter_init_seq_priv_thighthread_pidmap_lookup_batchcss_idrrtpoll_min_periodemindl_non_contendinglso_maxcurr_ret_stackpgtable_t__u8q_usage_counterwakeirqi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyssdev_targetcore_forceidle_sumget_offset_ctxreleasedexport_operationsqc_stateELS_LCLMget_budgetBLK_INTEGRITY_CSUM_IPmempool_smempool_timplicit_on_dflFC_PORTSTATE_LOOPBACKd_inodespecial_vecpageset_batchworkqueue_structBPF_MAP_TYPE_SOCKMAPi_lock_keyuevent_suppressgraveyard_linkbi_opfscsi_cmndfail_io_workfs_superscall_get_func_ip__read_overflow2tcp_tsorted_anchorwce_default_on__rcu_icq_cache___GFP_KSWAPD_RECLAIM_BITcompact_cached_free_pfncap_ambientqstrtaskss_d_opBPF_MAP_TYPE_TASK_STORAGEno_report_lunsi_rcu__countFREEZE_HOLDER_KERNEL__already_doneinit_requestFC_PORTTYPE_NPORTio_optspanned_pagespcountbio_listwlockedrtpoll_trigger_lockdevicemodule_kobjectmap_releaseELS_SCNPTR_TO_PACKET_METAELS_SCRmg_tasksBPF_TRACE_ITERpercpu_count_ptrnr_ia_rangesthawmap_update_batchlink_attach_flagstlbflush_unmap_batchremoveoffload_fwd_markbvec_iteroom_mmfcp_abort_iobpf_local_storagefr_crcname_linkSKB_DROP_REASON_PROTO_MEMrnid_vend_idcompat_long_tcnivcswmap_freeInvalidCRCCountPTR_TO_SOCKET_OR_NULLshort intkswapd_highest_zoneidxtrc_reader_specialgtimedisk_events_disable_depththread_group_cputimertransport_headersizemigrate_to_ramUTASK_SSTEP_ACKloginuiddesc_structi_wb_lists_umount_keyquota_typenameSKB_DROP_REASON_SKB_UCOPY_FAULTcgrp_ancestor_storagespp_typesetleasebitmap_tagsmnt_rootBPF_MAP_TYPE_SK_STORAGEpsi_flagssubsys_masksighandbtf_key_type_idavgs_workaddrELS_EXPL_NONE__rcu_headac_utimeFC_PORTSTATE_DELETEDksm_zero_pagesBPF_MAP_TYPE_LRU_PERCPU_HASHqueuedataSKB_DROP_REASON_TCP_OFO_QUEUE_PRUNEprivate_dataBPF_MAP_TYPE_CPUMAPgid_mappageset_high_minfs_structnuma_nodedev_archdatanr_perf_statess_flagsrcu_nodeorig_pmdrb_rightclock_baseBPF_SK_REUSEPORT_SELECTclass_irq_is_conditionallaunder_foliowake_batchis_funcs_vfs_rename_mutexElf64_XwordflockSKB_DROP_REASON_BPF_CGROUP_EGRESSiter_createhandler_datavalue_type_btf_obj_fd__paddingoffline_waitqnr_reclaim_startstatus_codeio_lockdep_mapatomic_write_hw_boundarymap_nr_maxiowait_sumdescriptionfolio_batchbi_nextblk_status_tUSRQUOTAFC_FS_EXP_NNAMBPF_CGROUP_ITER_SELF_ONLYdriver_privateWORK_OFFQ_POOL_BITSpm_onlyd_rt_spc_warnsset_read_onlypgmapSKB_DROP_REASON_TAP_FILTERactive_refmap_owner_storage_ptrhctx_tablefc_xid_busykernfs_open_filelowmem_reserves_iflagsprintednr_hw_queuescodetagstate_mutexallowed_mapsctx_arg_infoinner_network_headerlast_queue_full_depthBPF_PROG_TYPE_SK_LOOKUPfc_frame_header_getcid_worki_versionswap_deactivatesr_lockattachclass_rwsem_read_is_conditionalqueue_limitsunitfc_disc_erroril_weightstarved_listdma_parmsbdi_idKOBJ_NS_TYPEStstampcmin_fltchunksSKB_DROP_REASON_VXLAN_INVALID_HDRarch_uprobe_tasklicensewrite_protect_seqclearedkobj_ns_type_operationsshutdownevent_countsched_statisticslru_lock__kernel_uid32_tnode_zonelistsallocSKB_DROP_REASON_TCP_AOUNEXPECTEDb_attachedorig_pterq_timeoutkeysinit_nameper_cpu_zonestattc_indexfile_lockstatfsrw_semswappinessrediscdevice_privatevm_policydl_deadlineLPORT_ST_RSNN_NNtracepoint_extELS_SRLclass_mutex_is_conditionalELS_SRRfpregs_stateWORK_STRUCT_PENDING_BITmemcg_datadqb_curinodesBPF_XDPfileattr_seteh_actionac_tgetimeRPORT_EV_NONEpage_linkno_write_samebtf_log_sizedn_timeoutDEVICE_PANEL_UNKNOWNFC_VPORT_FABRIC_LOGOUTPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetmce_ripvDL_DEV_NO_DRIVERbpf_arenafree_after_mult_rcu_gpret_stacknbp_rl_nr_candreal_timeri_privatealloc_tagextended_state_areanum_kprobe_blacklistaccessmap_seq_show_elemfp_resvdsubdirsdev_releasefree_fpcgroup_freezer_statemlock_countBPF_PROG_TYPE_LWT_SEG6LOCALget_next_child_nodemempolicyfc_rportcacheline_padding_bandfd_arraypollfdblinding_requestedlaptop_mode_wb_timerdev_tplatform_dataf_refprev_posenv_endfileattrs_subtypeusage_countpr_opsstate_in_sysfsdqb_ihardlimitSKB_DROP_REASON_TCP_MD5NOTFOUNDunlocked_ioctluprobebd_mappingkmem_cachenuma_next_scanLPORT_ST_FLOGIbudget_mapbsg_devsrcu_last_gp_endxfer_lentnodeclass_local_lock_irq_is_conditionalpage_listinner_ipprotoproperty_read_int_arraywdtrmq_rq_stateholders_dirMODULE_STATE_UNFORMEDst_valuelist_headptrace_bpsfc_port_states_user_nscan_attachhost_attrsmap_lookup_elem_sys_onlytagset_refcntqueuecommand_may_blockmin_usagearch_tlbflush_unmap_batchquick_threadsELS_EXPL_INPROGdefer_syncBPF_TASK_ITER_TIDmissedfc_no_free_exch_xidusernsndisc_nodetypeBPF_UPTRvlan_allBPF_PROG_TYPE_CGROUP_SKBsum_sleep_runtimecleanup_rqfc_disc_gpn_ft_respd_spc_timerd_ino_hardlimitchange_cookiebi_statuscss_allocdl_periods_dquotErrorFramesfsnotify_sb_infomap_fd_get_ptrrecent_cida_opsftrace_opsprocnamepad_untilSKB_DROP_REASON_TCP_MINTTLmap_redirectperf_event_listinterval_expinsnBPF_CGROUP_UDP4_SENDMSGrstat_css_list___GFP_LAST_BITvm_node_stat_difftagski_completepgprotrnid_node_mgmtread_syscallstimespec_typebd_devicevmstatsdquot_operationsSKB_DROP_REASON_TC_INGRESSposix_cputimers_workgsbase__lruvecBPF_CGROUP_INET_EGRESScompact_delay_totalio_tlb_memseq_showcpusfilesinblockbd_claimingtails_magiccontainersnuma_faultsmem_dqblktarget_ifindexnos_countstgt_delete_workfc_ns_reqstatusBPF_PROG_TYPE_CGROUP_SOCKOPTWRITE_LIFE_NONEread_countlink_speedBPF_CGROUP_INET6_CONNECTlport_listHRTIMER_NORESTARTscsi_privlast_update_timesas_ss_spold_map_fddisc_startpanel___GFP_ZEROTAGS_BITac_padfc_rport_operationswatermarknode_start_pfnmax_allowed_capacityfc_statsopen_modeseq_cntread_pos___GFP_ACCOUNT_BITclass_cpus_read_lock_is_conditionalmg_dst_preload_nodecpu_run_real_totalD_REAL_METADATAgpl_crcstimes_prevclass_raw_spinlock_try_is_conditionalfc_frame_headerkiocbmg_node___GFP_MEMALLOC_BITexecute_only_pkeyreturn_instancesma_lockblk_mq_queue_datacss_offlineattach_btf_tracedockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsELS_NACTwb_tcand_idFC_PORTTYPE_OTHERdentrysequential_iowait_pidfdprli_countcdb_statusInputRequestsSKB_DROP_REASON_SECURITY_HOOKs_writersgroup_stop_countavg_next_updateswap_lockvm_opswb_reasonpartial_bufread_before_msget_unmapped_areamkobjsym_VDSO32_NOTE_MASKfrozenactive_uprobeunregisteringget_parentmin_vruntimestoragesdebug_dirhost_resetfc_els_rnid_genclass_disable_irq_is_conditionalFC_FS_RJT_IUSIZsyscrnr_mapssyscwsync_ionum_bpf_raw_eventswork_qorig_nentski_pose_csetsavx512_timestampfh_typeend_io_datae_freezeBPF_GRAPH_ROOTfree_cached_objectstaints_Boolmax_tp_accessxol_vaddrb_dirtylist_lru_nodeuclamp_ses_time_granvm_statblk_integritykuid_tdev_pm_qosbd_holdersper_cpu_zonestats_sifieldstaskBPF_CGROUP_INET6_BINDresetsched_reset_on_forkcompound_headnr_retrieswake_irqbranchi_cdevfunc_infoi_fsnotify_marksin_thrashingdl_deferBPF_MODIFY_RETURNvpd_pg80waitersvpd_pg83vm_startvpd_pg89mprotectquota_ond_automountDEVICE_REMOVABLE_NOT_SUPPORTEDrnid_genELS_EDCcsum_not_inetctl_table_headeratimeget_ownershipf_task_workmy_q__refcount_add_not_zerofc_lport_stateBPF_SK_SKB_STREAM_VERDICTeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalFC_TYPE_FCPsectorinner_mac_headers_wb_err__q_sizeflush_listattach_prog_fdcloseiopl_warnelevator_queueptraced__MAX_BPF_MAP_TYPEWORK_NR_COLORSdonesym___kernel_rt_sigreturnsrcu_struct_ptrsskip_ms_page_3fbinfmt_miscinodesencapsulationmemcg_awarezonehost_waitFC_PORTSTATE_LINKDOWNmanage_shutdownac_schedqsize_t__fpstatemap_poke_trackBPF_MAP_TYPE_SOCKHASHqf_ownerqueue_delayed_worksuspend_noirqd_inamePTR_TO_MAP_VALUEbi_flagslinks_countprealloc_pterdevd_ino_countarg_lockskb_drop_reasonclass_rcu_tasks_trace_is_conditionalDEVICE_REMOVABLE_UNKNOWNdoes_npivignore_childrenpoint_to_multipointframe_sendBPF_CGROUP_UDP6_RECVMSGdirty_exceededfreeze_fsin_eventfdresume_earlymax_dev_sectorsdup_xol_workalimititemsooo_okaynuma_groupblk_independent_access_rangeskmap_ctrlfscrypt_operationsrangesevents_lockfs_contextmnt_idBPF_CGROUP_INET6_POST_BINDretry_hwerrordrop_inodeBPF_MAP_TYPE_REUSEPORT_SOCKARRAYk_lockorc_unwindgraph_get_next_endpointfrom_ingresslast_sector_bugmq_mapprojid_mapkprojid_t__u16PTR_TO_XDP_SOCKsaved_end_ioBPF_MAP_TYPE_STACKsyscall_dispatchdl_densityon_rqlru_gen_mm_walkaltmapmin_perf_statercu_tasks_exit_listlro_xidsp_regdma_drain_buflast_resets_master_keysflagsbd_holder_locknr_threadsvm_mm__u32query_flagsmax_secure_erase_sectorsenable_statss_quota_typesvm_lockswapin_countdisc_stop_final_ddebugFAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitrcuwaitoffload_l3_fwd_markSKB_DROP_REASON_NOT_SPECIFIEDdelayskcompactd_max_ordermnt_nstimerqueue_headBLK_INTEGRITY_CSUM_CRCsdev_groupskioctx_tableprioritybtf_func_modelksm_rmap_itemsclass_read_lock_is_conditionalKMALLOC_RECLAIM__u64revoked_at_folio_nr_pagesfcp_packet_abortswritepageis_dirty_writebackpkey_allocation_mapLPORT_ST_DHBAdq_iddisable_depthem_perf_statethread_shstkfr_devTxWordsposix_timerswait_chldexitTxFramessas_ss_flagsunreadableunmap_limit_for_wspresent_early_pagesSKB_DROP_REASON_IP_INNOROUTESinsn_idxELS_RNFTPTR_TO_MEMbi_itersrcu_cblist_invokingiopollcsum_complete_swline_coliov_lenlatency_recordfc_lportdirty_limit_tstampsector_sizeskb_mstamp_ns__BPF_REG_TYPE_LIMITd_releaseavg_totalfh_cs_ctldev_dma_attrBPF_NETKIT_PEERzswap_writebackexpiresnuma_scan_seqmnt_sbblkcg_csshashnodemask_tref_cntsize_poke_tabsignalfd_wqhhang_detecteddevice_driverSKB_DROP_REASON_ICMP_CSUMlast_zone_capacityfc_disc_donestatisticsfsindexout_batchraw_spinlock_tfc_ns_gid_pns_cops_activenum_argspidlist_mutextag_sizeBPF_MAP_TYPE_PERCPU_HASHlast_old_flushs_uuidclear_child_tidruntime_statusdqb_btimedq_opBPF_MAP_TYPE_DEVMAPELS_ADVCshow_pathdl_serverVTIME_USERquota_disablesched_delayedWORK_OFFQ_DISABLE_BITSsrcu_gp_seq_neededtask_structtimer_delaycurrent_may_mountREFCOUNT_ADD_OVFpushpeaks_lockbpffs_fdpath_fdis_noirq_suspendedfwnode_endpointFC_NS_RFT_IDPTR_TO_TP_BUFFERcounterunique_idsuspendsupported_eventsoom_score_adj_minlast_bdp_sleepzone_wplugs_poolzone_typedomain_datacopy_file_rangesrcu_gp_startreport_zones_cbxa_flagsattach_btf_idlru_gen_foliobtf_idbpf_insntv_nsecmax_zone_append_sectorssas_ss_sizeeh_eflagss_inode_list_lockUTASK_SSTEPraw_tracepointehandlerdq_sbexpecting_lun_changescsi_targets_mountselem_flagsBLK_EH_DONEvm_stat_diffsym_pvclock_pageswapin_delay_totalfree_listBPF_CGROUP_UDP6_SENDMSGpage_fraginfo_lenrun_workfsuidRPM_REQ_AUTOSUSPENDsrcversionlist_add_tailtrace_event_callwakeup_sourceis_partially_uptodatehost_faileddl_runtimemay_splitio_uring_cmdprogs_cntread_dqblkpeekedrtpoll_nr_triggerssrcu_parentinit_seq_privatebi_cookiesuppliersfile_operationsRxFramesSKB_DROP_REASON_TAP_TXFILTERbpf_ctx_arg_auxblist_flags_tmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotLPORT_ST_RESETis_preparedpgprotval_tmemorytrc_holdout_listELS_CSRasync_suspendq_nodezone_pgdatclass_mutex_intr_is_conditionalstrtabpage_freeftopdepends_onHPROBE_CONSUMEDi_mmapnr_cgrpsdirty_paused_whenirq_getrport_priv_size___GFP_COMP_BITcss_resetFC_FS_RJT_UNABLmax_channelversionlink_failure_count__refcount_inc_not_zeroget_reference_argsllisthiwater_vmmax_perf_statebi_idxSKB_DROP_REASON_IP_RPFILTERcookiesfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntInputBytesrseqattach_typetarget_knlimit0limit1pi_blocked_onpid_tac_exe_inodevmemmap_shiftbpf_attach_typeELS_FARP_REPLusage__kernel_time64_tSKB_DROP_REASON_IPV6DISABLEDrq_qos_mutexkernel_read_file_strscsi_data_bufferSKB_DROP_REASON_IP_LOCALNETcapabilitiesi_securitydevice_physical_location_panellimitsq_lock_cls_keyenvpactive_memcg__targetsElf64_Halfallow_reinitSKB_DROP_REASON_IP_OUTNOROUTEStimer_autosuspendsratelimitSHOST_DELslave_configurestat_threshold_softexpiresautosuspend_delayline_info_rec_size_zonerefsi_flctxFC_PORTSTATE_ONLINEli_invalid_crc_countlist_lockvm_faultELS_RJT_INPROGip_epilogueoptimistic_spin_queuepermissionSKB_DROP_REASON_IP_NOPROTObpf_prog_array_itemtransport_containerpreallocreap_refDEVICE_FIXEDlast_statusfdmi_enabledSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsslice_maxIS_ERRmap_namebi_max_vecsthaw_noirqsched_debugfs_diraccounting_timestampcan_matchtime_archcmd_sizechunk_sectorshlist_bl_headqc_dqblkLPORT_ST_RFT_IDcalledpasid_activatedancestorsmap_fd_sys_lookup_elem__fortify_panicbvec_integrity_poolBPF_XDP_DEVMAParch_data_oldshrink_controlegidthreaded_csetsmax_rdonly_accessfc_disc_recv_rscn_reqmap_direct_value_addrnet_deviceenvp_idxcrypto_kobjectcdb_cmd___GFP_NO_OBJ_EXT_BITf_modetagged_supportedoffloadsvpd_pgb0vpd_pgb1vpd_pgb2ff_type_mapzone_idxfolioruntime_autopref_node_forklru_zone_sizeclassipc_namespaceBPF_SK_SKB_VERDICTarenaprev_scan_seqfc_dl_perfpsi_group_cpufr_seqwait_queue_head_talloc_hintELS_RJT_FIPtask_cputimeFAULT_FLAG_INSTRUCTIONdeferred_splituser_nsfc_cdbnohdrclass_raw_spinlock_irqsave_is_conditionalsyms_flagscgwb_release_mutexSKB_DROP_REASON_TCP_OLD_DATASKB_DROP_REASON_TCP_MD5UNEXPECTEDFC_PORTTYPE_NPIVsyncmq_freeze_locksg_prot_tablesized_childrenucountELS_EXPL_SPP_ICTL_ERRmap_local_storage_unchargectl_table_sizebpf_map_opsfc_rport_identifierseh_host_reset_handlerddebug_class_mapdfl_cftypes__compiletime_assert_119prealloc_bufaudit_contextfl_owner_tipi_listBPF_MAP_TYPE_DEVMAP_HASHpersistent_keyring_register__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126i_pipe__compiletime_assert_128__compiletime_assert_129d_waitllist_headsense_buffernr_phys_segmentstask_itersnode_spanned_pagesavg_refaultedwait_page_queuecn_credit_stallbpf_line_infoBPF_SK_MSG_VERDICTFAULT_FLAG_REMOTE__compiletime_assert_130dl_bw__compiletime_assert_132hierarchy_id__compiletime_assert_134__compiletime_assert_135__compiletime_assert_136unaccepted_pages__compiletime_assert_138i_dir_seqignore_dfheaderwatchdog_stampFC_FS_EXP_NONEstate_startlist_op_pendingdatasrcu_cb_mutexsysfs_lockBPF_CGROUP_UNIX_CONNECTallowed_progsno_callbackssaved_trap_nrcapacityclock_listbpf_func_infofolioq_slotMODULE_STATE_GOINGxattr_handlerac_utimescaledrqos_debugfs_dirprot_sdbidr_baseunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_locknextentseventkeytypeMissDiscAdvCount__kernel_gid32_tevicteddev_pm_domainnentsstart_time_nsuaddr2f_securityprot_opfc_els_rscn_addr_fmtdefparamdiscard_granularitySKB_DROP_REASON_TC_RECLASSIFY_LOOPiotmo_cntclass_raw_spinlock_irq_is_conditionalq_sizefr_sofFC_PORTSTATE_BLOCKED__bi_cntstate_remove_uevent_sentattributes_maskcloneddl_defer_runningnpiv_enabledlru_gen_mm_listqueuecommandevents_filetagged_writepagesia_validsrculog_bufreq_flagsiorequest_cntsrcu_size_jiffiesclassesstatic_call_sitecputimeis_seenupdated_nextfh_s_idsrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitmap_fdrchari_verity_info_addr_pkeyfpin_statsELS_TPRLOrw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countBPF_PROG_TYPE_XDPbpf_ksymSTARGET_RUNNINGFC_SOF_C4atomic_opennapi_idload_time__mptrsigactionrlimbtf_token_fdmce_addr__q_size_fieldf_freeptrSKB_DROP_REASON_TCP_OVERWINDOW__sighandler_tclass_spinlock_try_is_conditionalzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMESlrugenmax_target_blockedfs_flagsvm_filei_countfc_ct_hdruser_structmap_idaddress_space_operationsELS_LSTSFAULT_FLAG_USERkey_perm_tused_btf_cntbtf_log_bufeh_strategy_handlertimer_listverifier_zextmemory_eventscgwb_listrun_delaynum_ftrace_callsiteschange_queue_depthsrcu_cblistoffload_requestedblk_independent_access_rangeavg_write_bandwidthtlb_ubcpgtables_bytesi_lrufh_parm_offsetGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacktrc_ipi_to_cpuscsi_luncss_onlinePTR_TO_FUNCmemory_events_localallow_restartmin_sliceSKB_DROP_REASON_XFRM_POLICYSKB_DROP_REASON_IPV6_NDISC_BAD_CODEcommit_rqssysfs_opsinq_periph_qualcore_relo_cntFcpPktAbortsatomic_write_hw_unit_maxFC_SOF_I2cmaj_fltFC_SOF_I4bio_integrity_poolnf_tracekparam_arrayFORTIFY_FUNC_strscpyFcpFrameAllocFailspercpu_refevict_inodeignore_media_changertpoll_statesthread_keyringmap_nrcgroup_nslist_delcpumask_trstat_css_noderb_leftRPORT_ST_DELETEgfp_maskdma_addr_tinactive_timerattributeinner_protocolinit_hctxperiod_timemm_lock_seqFORTIFY_FUNC_memchrELS_FANkernfs_elem_symlinkBLK_UID_T10wb_lcand_id__kernel_dev_tcrypt_keyslotprog_namepm_domainBPF_CGROUP_INET4_BINDfc_rport_logoffmax_rdwr_accessmax_prop_fracfsgidsector_tcompact_cached_migrate_pfnnode_name_sys_privatesignal_structactive_mmFC_SOF_N2FC_SOF_N3FC_SOF_N4kernfs_iattrsshow_devnamecn_oversubscriptionthread_infoi_mmap_writabledata_size_outattach_btf_obj_fdreadWORK_OFFQ_DISABLE_SHIFTr_a_tovvalue_recsecondarydevicesatomic_write_max_sectorsgroup_exit_codetx_framesFORTIFY_FUNC_memcmpopc1REFCOUNT_SUB_UAFrscn_cmdvalue_btf_idexec_maxsync_statedev_groupsuts_namespacefcloneDMA_FROM_DEVICEzone_start_pfnvalue_sizeFC_NS_RPN_IDkernfs_elem_dirport_namepercpu_counter_printkDMA_BIDIRECTIONALcgroup_subsys_statesequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startELS_EXPL_SIDUTASK_RUNNINGopenseglenBPF_MAP_TYPE_QUEUEFORTIFY_FUNC_memcpy__kernel_ssize_tvdso_imagesi_signounused_hctx_lockatomic_readrseq_sigresultrefsdelayed_calltime_slicefunc_info_rec_sizect_reasonnr_rangemax_seqSKB_DROP_REASON_DEV_READYspc_timelimituid_gid_mapnr_freeresumeset_ownershipELS_RNCbpf_iter_task_typeFC_PORTSTATE_NOTPRESENTregsbi_write_hinterrorSKB_DROP_REASON_PKT_TOO_BIGrq_nextsyscall_user_dispatchshort_inquiryattrd_aliasis_suspendedseq_priv_sizerp_mutexdqio_semFC_FS_RJT_PROTOrestore_sigmaskrequeue_lockSKB_DROP_REASON_CPU_BACKLOGkcsan_check_accessevent_worknr_deferredmem_cgroup_idsrcu_sspi_lockELS_NDACTuser_event_mmbtrace_seqs_devsiblingcdl_supportedia_rangetarget_sizemap_lookup_elemldt_usr_semrec_dataposix_cputimerslink_supported_speedstry_rc_10_firstRPM_INVALIDdd_datafreeze_kcountrequest_key_authblocksSKB_DROP_REASON_IPV6_NDISC_HOP_LIMITpercpu_ref_datad_spc_warnssrcu_supnbp_thresholdfreeptr_tLPORT_ST_DPRTns_typeRPM_REQ_NONEprog_btf_fdforce_runtime_start_on_system_startsg_timeoutixolELS_LS_ACCfasyncarg_startLPORT_ST_DISABLEDkprobes_text_sizekfunc_tabELS_TPLSblk_crypto_profileSKB_DROP_REASON_SKB_GSO_SEGfop_flagswork_lock_addr_lsb_addrpfn_mkwritentimeELS_RJT_UNSUPuaddrrtpoll_waitBPF_STRUCT_OPSKMALLOC_DMAfunc_proto_unreliableioerr_cnt_uidmm_states_fs_infomm_stats__rb_parent_colorWRITE_LIFE_EXTREMEicq_list__MAX_NR_ZONESmm_users_pp_mapping_padimagekey_serial_tno_uld_attachfolioqfoliosshost_groupssiblingscputimernrpageswake_q_nodeFC_PORTTYPE_NOTPRESENTblk_flags_tmap_fd_put_ptr__news_maxbyteshd_geometryioctx_tabledma_io_tlb_memFC_FS_ACCfc_cmdrefKMALLOC_CGROUPeh_cmd_qfc_rport_flush_queuefree_after_rcu_gpget_unique_idkasan_check_readFC_FS_EXP_FTNRNR_KMALLOC_TYPESexpire_countcompact_init_migrate_pfnfor_syncwake_cpujited_lenPTR_TO_SOCKETlinfobio_split___GFP_DMA_BITfreeze_superELS_RSItick_dep_maskvmpressurelruvecmap_check_btfiter_infoqc_infoobjcg_listfault_flaglist_is_headmodnameia_ctimeFC_VPORT_NO_FABRIC_RSCStrace_eval_mapcompact_defer_shiftorig_objcgasync_put_workresvnum_static_call_sitesZONE_MOVABLEl4_hashvm_lock_seqFORTIFY_FUNC_strncatroot_listBPF_TRACE_FENTRYElf64_Addrwait_queue_entry_tseqlock_tlatency_record_countnr_integrity_segmentshost_blockedmay_skip_resumeprot_flagsVTIME_SYSalloc_tag_countersbase0base1base2SHOST_CREATEDbio_setfh_seq_idCONST_PTR_TO_DYNPTRBPF_MAP_TYPE_RINGBUFalignment_offsetlinksbasesfutex_staterseq_lenkobj_completionlesb_inv_wordi_spc_timelimitf_opnargsbindcpuhp_onlineproc_ns_operationsold_prog_fdBPF_PROG_TYPE_SK_REUSEPORTmm_mtgid_trelease_workSDEV_CREATEDavg_nr_triggersno_report_opcodesELS_RSCNBPF_PROG_TYPE_LWT_OUTrcu_read_unlock_specialBPF_CGROUP_UNIX_RECVMSGtls_arrayipvs_propertyELS_EXPL_UNSUPRfc_disc_gpn_ft_parsefr_eoftask_io_accountingcss_rstat_flushf_raDEVICE_PANEL_FRONTmodule_memorynetkitsitescompat_robust_list_headcss_releasedthread_nodestatic_call_mods_shrinkgp_countRxWordsnr_sectorsbpf_raw_eventsiommutimer_expiresbpf_storagekset_uevent_opsf_ownerqfull__state_permDEVICE_PANEL_BACKELS_RJT_INVALmax_retry_countoffsetswb_switch_rwsemdisc_syscalldiskSHOST_DEL_RECOVERYjit_requestedsrcu_lock_counttrc_blkd_cpugp_wait__compiletime_assert_131WORK_OFFQ_FLAG_ENDiommu_mmfuncSKB_DROP_REASON_TCP_OFOMERGEget_unaligned_be64io_uring_taskshared_tagsrepeatjit_keyringLinkFailureCounts_fsnotify_infofunctionlinkagedisc_recv_reqBPF_PROG_TYPE_CGROUP_SOCK_ADDRprojidmce_kill_mema_external_lockfc_disc_gpn_id_respWORK_OFFQ_FLAG_BITSpid_linkskfree_skb_reasonconv_zones_bitmapscsi_target_ids_dio_done_wqRPORT_EV_FAILEDfor_kupdaternid_ip_verstart_all_reasonsystem_wqhlist_head_pad3_ioc_nodethrottle_diskELS_FDISCbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACErunningrw_hintblk_integrity_checksumdestroy_rworkdma_skip_syncpartition_meta_infotstamp_type_accessDEVICE_VERT_POS_LOWERBPF_CGROUP_ITER_ANCESTORS_UPnr_dying_subsysclass_spinlock_irqsave_is_conditionalutf8datakref_get_unless_zerohlist_nulls_headrequeue_workof_node_reuseddyndbg_infoFORTIFY_FUNC_strncpyfc_seq_els_rsp_sendElf64_Symreclaim_waitsaved_errd_rt_spc_softlimitpollsk_skb_reason_dropfree_file_infoin_lru_faultsched_contributes_to_loadtlb_genruntime_idlemap_counthost_scribblei_rt_spc_timelimitqc_type_states_dentry_lruac_comms_bdevskip_vpd_pagescrcssense_lenrun_listuevent_opsabort_workmax_cmd_lenbpf_func_statebpf_reg_typesched_classret_sizeutil_avganon_vmaFC_VPORT_LINKDOWNdevice_private_offset_pidsigcntDD_CLASS_TYPE_LEVEL_NAMEShas_callchain_bufELS_EVFPtailcall_target_stablebpf_cgrp_storagemodinfo_attrsst_spaceclass_map_typekparam_stringd_real_typemaxrsscredBPF_MAP_TYPE_ARRAYkernfs_open_nodearch_atomic_try_cmpxchgf_wb_errmm_cid_activeSKB_DROP_REASON_VXLAN_ENTRY_EXISTSkzalloc_noprofdecryptedmodule_sect_attrsreq_flags_truntime_resumeac_stimescaledxfer_ddpgroup_exec_taskrestrict_linkirq_countget_inode_usagekmalloc_typeFC_TYPE_IPxarray_startbpf_ctxpm_domain_dataserver_pick_taskbw_dworkattach_btfmap_lookup_and_delete_elem__p_size_fieldload_avgrecordi_private_lockget_dqblktail_callmq_listrnid_phys_portphysical_block_sizepgoffportnetdevBPF_LIST_NODEdefault_setmodelfreeze_latemf_statsZONE_NORMAL__list_del_entrycount_objectsvma_numab_statedma_map_opsdq_dirtyREFCOUNT_ADD_NOT_ZERO_OVFlnodemax_lunexit_cmd_privfd_typeatomic_write_boundary_sectorsboot_timewpcopy_countmax_queue_depthwrite_bytesSKB_DROP_REASON_SOCKET_BACKLOGeh_entryDISC_EV_FAILEDpending_eventsoom_reaper_listnumab_statefutex_offsetbpf_fdsubsys_fmt_prefixdq_lockintegritypte_tnr_scannedSKB_DROP_REASON_TCP_ACK_UNSENT_DATA__stateBPF_MAP_TYPE_UNSPECnr_iosk_listn_io_portslicecgroupdrv_groupstrack_queue_depthtruesizecustom_sliceper_cpu_pagesstart_idbdi_listmq_freeze_depthpadding1RPORT_ST_READYnestedatomic_write_segments_maxinsn_cntmap_set_for_each_callback_argsnr_dirtied_pausequeue_kobjdst_progreal_addressbd_holder_dirac_tgidinvalidate_locknum_exentriesfcp_cmd_sendfix_capacitycss_local_stat_showio_portvport_last_stateblk_mode_tpmdval_tSKB_DROP_REASON_NEIGH_FAILEDhost_tagsetBPF_GRAPH_NODEkveceh_noresumefree_areaset_latency_tolerancedepthd_ino_timerct_cmdprobenetlink_nsnr_argstokenSKB_DROP_REASON_TCP_CSUMdev_ueventELS_RJT_NONEfc_vportdep_mappage_mkwritelast_busyfc_rport_loginvm_flags_toffloadnregnr_failed_migrations_affinelro_enabledd_in_lookup_hashdom_csetptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLERreschedule_countmax_hang_timeFC_PORTSTATE_UNKNOWNcmd_per_lunopt_failedcdl_enablecutimelockrefELS_RLIRnew_map_fdmap_meta_equaltlb_flush_batcheddev_priv___GFP_HIGH_BITia_uidautogroupsequencercu_syncarg_endclass_spinlock_irq_is_conditional_dummy_pkeyvruntimehostdataBPF_CGROUP_ITER_DESCENDANTS_POSTscanned___GFP_HARDWALL_BIT_ct_resvd1_ct_resvd2SCALAR_VALUEnr_extentsstart_stop_pwr_condpidlistsWB_REASON_VMSCANfeatures_locked__kernel_pid_tdev_statedevice_blockedfile_flagsPIDTYPE_SIDcinblockdma_alignmentprot_typeBPF_TCX_INGRESS__kernel_loff_tset_performance_stateserial_nodeELS_EXPL_AH_REQlru_gen_mm_statenotify_countrscn_page_flagssrc_regupdated_childrenspin_lock_offBPF_CGROUP_SYSCTLsingle_lunhprobesg_reserved_sizeswap_activatedqb_isoftlimitsaved_auxvnoinstr_text_sizeELS_SBRPdl_overrunfc_no_free_exchiattrdetachedloff_toom_flag_originfreepages_delay_totaldesc_lendma_devSKB_DROP_REASON_NETFILTER_DROPoom_score_adjwb_waitqSHOST_RECOVERYrq_end_io_fnksm_merging_pagesfc_ct_reasontest_runDISC_EV_SUCCESSSKB_DROP_REASON_TC_COOKIE_ERRORgraph_parse_endpointrmidptp_rdatact_vendorlist_lrudevice_removablefc_seq_not_foundfxsavedev_pagemap_opsbv_offsetFC_NS_GID_FTBPF_MAP_TYPE_XSKMAPset_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETd_lockrefbtf_typenr_populated_domain_childrenSCSI_EH_DONEfc_disc_portsession_keyringseeksshost_devbtf_log_true_sized_deleteuts_nsd_ino_softlimitrscn_page_lend_weak_revalidatealloc_time_nsi_devicesSKB_DROP_REASON_NEIGH_CREATEFAILFC_PORTSTATE_ERRORdqb_curspaceSKB_DROP_REASON_XDPSKB_DROP_REASON_NO_SOCKETBPF_TRACE_KPROBE_SESSIONELS_FDACDTalloc_lockearly_inittotal_numa_faultswritable_sizemax_segmentsdma_need_drainobj_cgroupem_tableBPF_PROG_TYPE_TRACINGmq_sysfs_init_doneFC_FS_RJT_CMDactive_queuescompact_consideredfc_debug_logging__lstatepercpu_drift_mark__BPF_REG_TYPE_MAXinodesubtree_bstatbd_fsfreeze_mutexhrtimeratomic_write_unit_maxFAULT_FLAG_UNSHARELossOfSignalCountlocal_fwnodetask_sizemust_resumeRPM_ACTIVEend_codePTR_TO_SOCK_COMMON_OR_NULLuintnr_free_highatomicpreempt_notifierstlb_flush_pendingmigration_flagsDEVICE_PANEL_RIGHTfast_io_fail_tmomap_poke_untracktx_wordscap_inheritablebpf_cgroup_iter_orderkobj_sigvaleh_timeout__stack_chk_failwritecntBPF_KPTR_PERCPUsrcu_n_exp_nodelayin_batchseqcount_spinlock_tFC_NS_GID_NNextra1extra2write_s64graph_get_remote_endpoints_rootstree_scanned__int128 unsignedverifiedcpu_countcgroup_rstat_cpuevent_callbackwb_lcand_byteswait_sumuprobe_xol_opssg_suppmin_align_masknextevtthis_idrcu_segcblistread_s64reported_split_lockreturn_instancewait_countconfirm_switchFC_NS_GID_PNFC_NS_GID_PTnr_wakeups_affine_attemptspud_ti_ino_warnlimitmax_open_zonesrmtpnext_offsetFC_PORTTYPE_LPORTio_statusfc_ct_cmdlp_mutexSKB_DROP_REASON_FRAG_REASM_TIMEOUTblindedct_revacpi_device_iddev_scratchctx_idutaskpoweroff_noirqactive_modesdev_datais_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangsSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcss_setfwnode_handleELS_EXPL_NOT_NEIGHBORgfp_ttypeqf_fmt_idlink_updatepagepageset_high_maxatomic_write_unit_minsleep_startmap_mem_usagememalloc_noiobegintypetabuse_192_bytes_for_3fnr_reserved_tagsBPF_PROG_TYPE_RAW_TRACEPOINT_WRITABLEi_crypt_infoFC_TYPE_NVMEretry_workDEVICE_HORI_POS_CENTERio_start_time_nsaudit_ttyrecov_retrybatch_sizedns_rdatanr_zonesmutex_unlockrejectjobctlsi_errnonr_leaves_on_treequeue_ctxmin_shallow_depthfc_seq_sigchlddqb_itimeHPROBE_STABLEatomic_try_cmpxchg_relaxedquota_format_type__ret_condbio_crypt_ctxpercpu_ref_func_tpm_message_tsplit_queueac_memBPF_CGROUP_INET4_POST_BINDpprevlip_countino_warnlimitremcsum_offloadexception_boundarybroken_fuabpf_iter_seq_infozone_wplugs_lockmnt_flagsac_stimemem_cgroup_reclaim_iterrange_endlast_mergememcg_nr_pages_over_highsw_reservedbpf_tokenwbt_flagsbpf_iter_fini_seq_priv_tcss_freeFC_NS_GPN_FTcpu_delay_totalobjcgfc_els_rscn_pagefh_r_ctlno_read_disc_infoblock_startvm_area_structnum_gpl_symsselect_no_atn__compiletime_assert_0__compiletime_assert_1__compiletime_assert_2__compiletime_assert_3SKB_DROP_REASON_TCP_INVALID_SEQUENCEBPF_CGROUP_INET6_GETPEERNAMEis_extendednr_charged_bytesct_explanlong long unsigned intWRITE_LIFE_MEDIUM__builtin_memcpyBPF_MAP_TYPE_CGRP_STORAGEtmf_in_progressnext_addrSDEV_CREATED_BLOCKhuge_faulti_fopautasklast_task_numa_placementFC_NS_GPN_IDfortify_memcpy_chkSKB_DROP_REASON_IP_INADDRERRORSrnid_prot_portip_after_callrefcntfreeze_holderpsi_groupcdevperf_eventSKB_DROP_REASON_VXLAN_VNI_NOT_FOUNDELS_RJT_LOGICunregfuncoom_groupseqcountBPF_XDP_CPUMAPclass_idbitsetWORK_STRUCT_LINKED_BITallowed_cmdsbtf_field_typeinquiry_mutexcan_swapof_device_iddisk_statsmanage_runtime_start_stopclass_migrate_is_conditionalnetwork_headermin_ratioclass_write_lock_is_conditionals_xattrpart__pkt_type_offsetb_dirty_timeli_loss_of_sync_countBLK_EH_RESET_TIMERil_prevFC_FS_EXP_PNAMPTR_TO_SOCK_COMMONd_initget_name_prefixused_mapsspan_seqlockfc_soffileattr_get__kmalloc_noproffc_disc_gpn_ft_reqthreaded_csets_nodeclass_groupsSDEV_TRANSPORT_OFFLINE__ret_warn_on__call_single_nodeunicode_mappathhigh_maxrstat_cpuSKB_DROP_REASON_DEV_HDRrecent_used_cpuruntimeold_time32_tsocket_pressureenforce_expected_attach_type__state_sizeBPF_CGROUP_INET6_GETSOCKNAMEvportsunsigned intsbitmapclass_irqsave_is_conditionalcore_kallsymsscsi_deviceSKB_DROP_REASON_IPV6_NDISC_BAD_OPTIONSs_fsnotify_maskraw_atomic_try_cmpxchg_relaxedscan_objectsbi_privatewb_idDD_CLASS_TYPE_DISJOINT_BITSevent_liststartupkeyring_index_keyiov_iterd_rcustatic_key_false___GFP_DIRECT_RECLAIM_BITuintptr_twake_entryrcu_tasks_holdoutfreezefprop_globalassoc_array_ptrbatchcacheBPF_TRACE_RAW_TPold_timespec32rcu_blocked_nodejiffies_at_allocfunc_idxfcp_frame_alloc_failuressubsys_datast_namegroup_nodei_mtime_secbus_dma_regionrp_statefh_rx_idSKB_DROP_REASON_TCP_OLD_ACKfc_disc_singlestatic_rqsstarget_sdev_userac_majfltdn_device_specificmce_kflags___GFP_NORETRY_BITFORTIFY_FUNC_memset__oldscheduledbus_dma_limitubufbtimeSKB_DROP_REASON_QUEUE_PURGEia_gidmigrate_foliohigh_minrq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrnext_posix_timer_idmq_ops_mapcounti_atime_secstarttimefile_costreschedule_jiffies__list_delWORK_BUSY_RUNNINGhprobe_statei_sb_listquota_offmap_poke_runmap_delete_batchshm_clistmap_delete_elemwait_for_compcb_headpages_skippedzone_wplugs_hash_bitspi_offsetac_flagfh_df_ctlpt_regsmmap_missexpires_nextblk_opf_tSKB_DROP_REASON_IP_INVALID_DESTreport_zoneskeyring_name_list___GFP_ZERO_BITnum_trace_bprintk_fmtiter_seq_infoSKB_DROP_REASON_TCP_AOKEYNOTFOUNDcdrom_device_infolruvec_stats_percpuaccess_statebpf_prog_statssdev_gendevwork_structtruelast_queuedreverseSKB_DROP_REASON_VXLAN_NO_REMOTEri_timernr_populated_threaded_childrenpipe_bufsavg_last_updatebp_offsetkmalloc_cache_typeswap_events_filefc_frame_freeprotectedbsyncrequestedsaved_scratch_registertracepoints_ptrsfcp_cleanupwifi_acked_validblock_maxstatic_keyqueue_rqsdev_boundlibfc_function_templatecsum_validFAULT_FLAG_VMA_LOCKtotalreserve_pageskswapd_orderdma_range_mapvaluesKOBJ_NS_TYPE_NONEctl_table_pollfc_els_rjt_explanmin_slab_pages_dataFAULT_FLAG_WRITEshow_optionswait_queue_entryexpirei_uidtagset_freedmax_sectorsexpiryfc_frame_payload_opperiodbmaprescue_workqueuerx_wordsmap_allocdispatch_wait_lockscsi_levelfsaveBPF_TRACE_UPROBE_SESSIONi_write_hintsuspended_timeread_byteszone_wplugs_worksum_sched_runtimes_writers_keySYSCTL_TABLE_TYPE_DEFAULTbpf_callback_tRPORT_EV_READYstart_boottimetimer_offentriesi_modecap_permittedfc_rport_priv_flags_2adisc_argfcoe_rcv_infoBLK_UID_NAAstart_coderet_flagsvm_flagststamp_typesi_codeseqcount_spinlockBPF_PERF_EVENTheadHPROBE_GONElast_siginfosched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorsdworkdevice_dma_parametersdir_contextsaved_dst_attach_typeiopl_emulconsumersratelimit_statepower_statedq_flagsis_late_suspendedfieldsswap_plugcapture_controlPTR_TO_MAP_VALUE_OR_NULLraw_atomic_fetch_sub_releaseoffline_nodequeue_offsetclass_device_is_conditionalnon_rcuput_superwrite_endshostbpf_exception_cbxdp_has_fragsdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_statctx_arg_info_size__kmalloc_large_noprofddp_setupjitedopen_flagslegacy_namemap_lookup_percpu_elemfc_frame_payload_getFAULT_FLAG_INTERRUPTIBLEmap_token_fds_inodes_wbvport_delete_worksubsysfolio_queuedurationrefcount_readct_mr_sizeinner_transport_headerinit_fs_contextuprobe_taskELS_RPBCf_mappingFcpPktAllocFailstailcall_bypassstart_stackBPF_MAP_TYPE_STRUCT_OPSprog_array_member_cntfh_ox_idDL_DEV_PROBINGi_linkWB_REASON_MAXfc_frame_allocstack_vm_areafc_lund_hashBPF_SPIN_LOCKdl_server_pick_frefcount_dec_and_testtty_old_pgrpst_sizevfsgid_tELS_ADDR_FMT_DOMneed_parent_lockseccomp_filternr_migrationsrm_xquotaorc_entrydma_drain_len__MAX_BPF_ATTACH_TYPESCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listutimemmapshrinkeralloc_dquotbw_time_stampmappingdl_defer_armedfc_ns_ftsmap_pollFC_NS_GA_NXTrunnable_sumatomic_fetch_sub_releasecpu_scaled_run_real_totalshort unsigned inteventsget_rq_budget_tokenqueue_ramp_up_perioddevice_nodemm_walkgpl_compatiblefc_gpn_ft_resprequeue_listlocal_portFC_PORTSTATE_DIAGNOSTICSp_size_fieldpkt_typelong long intsym_vvar_start_hugetlb_cgroup_rsvdSKB_DROP_REASON_ARP_PVLAN_DISABLEsival_ptrproc_namepercpu_sizefc_vport_stateFC_PORTTYPE_UNKNOWNBPF_TASK_ITER_ALL__wsuminvalidate_foliois_vallocdrop_nsNOT_INITELS_RJT_VENDORWORK_STRUCT_INACTIVE_BITnr_queuesgenerationno_pm_callbackscountELS_RJT_PROTddp_targetd_parentpagessched_task_group__compiletime_assert_326BPF_TIMERupdate_timetc_skip_classifymemcg_idpidsof_noderun_nodedata_sourcesubmit_bio___GFP_UNUSED_BITs_instancesvm_rcubd_start_sectctl_nodepage_table_locksysv_semquota_infoquota_enable__kernel_timer_twork_listBPF_MAP_TYPE_PROG_ARRAYPTR_TO_PACKETdomain_tagmax_integrity_segmentscmaxrssit_real_incrprobestubextable_lenlast_arrivalwake_index_watermarkSKB_DROP_REASON_SOCKET_FILTERswap_rwrdatareservemap_extrasplit_queue_lockevents_local_filesrcu_gp_seq_needed_expDEVICE_HORI_POS_RIGHTSKB_DROP_REASON_HDR_TRUNCSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOia_mtimenr_thpslegacy_cftypesrnid_vend_specsysv_shmfopssuppress_bind_attrsinsnlen__page_1__page_2WORK_CPU_UNBOUNDi_mutex_keykey_restrictionstatquota_writedomainget_linkFC_PORTTYPE_NLPORTmax_depthctl_table_argdata_lenpriv_stack_ptr___GFP_NOFAIL_BITblkcg_nodeforksa_flagsno_start_on_addcancelled_write_bytesdispatch_busyfcp_packet_alloc_failuresnbp_rl_starttask_worksmm_cidatomic_write_hw_maxdfl_cgrp_ddebug_infoaddrsshrinker_info_unitstats_locknum_kpSTARGET_CREATED_REMOVEshost_gendevcsumMEMORY_DEVICE_PRIVATE__bd_flagssuper_blockbi_bvec_donemap_get_unmapped_areabus_typeget_named_child_nodeBPF_MAP_TYPE_PERCPU_CGROUP_STORAGE_DEPRECATEDassoc_arrayactorBPF_CGROUP_ITER_DESCENDANTS_PREbpf_offload_devkobj_ns_typedeferred_resumesched_shared_tagsfp_wwpnlong intcore_nodebdi_nodecn_device_specifictarget_btf_idmem_dqinfodevnodesaved_sigmaskac_uidBLK_UID_EUI64MEMORY_DEVICE_PCI_P2PDMAac_nicedq_offpinsblkcg_mutexis_visiblecgrp_linksdisk_nameuuid_t__kernel_clockid_twritabledqb_bsoftlimitvfork_donetask_cputime_atomicki_waitqra_pagesgroupfc_ct_explanmmap_compat_legacy_basedevice_dma_supportedsysfs_dir_lockscsi_cmnd_submitterignored_posix_timerslockedsival_intia_filecancel_attachio_pagesSKB_DROP_REASON_TC_EGRESSwakeup_cntrequest_pendingdl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsclass_read_lock_irqsave_is_conditionalfc_els_rjt_reasonblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startavg_triggersctl_dirFC_PORTTYPE_PTProbust_list_headunsigned charwake_qrange_startrethooksnuma_scan_periodelem_countnr_tagssda_is_staticwakeup_pathresult_maskFORTIFY_FUNC_memscanscsi_timeout_actionei_funcs__func__BPF_NETFILTERtablesRPORT_ST_PLOGI_WAITpipe_inode_inforaw_spinlockmemcg_cgwb_frnblkio_delay_totalinstrument_atomic_readktypebpf_attrBPF_PROG_TYPE_CGROUP_SYSCTLhost_sizemigration_disabledSKB_DROP_REASON_FRAG_TOO_FARext_mutexfr_fspRPM_REQ_SUSPENDcancel_forkpgprot_ttracepoint_ptr_tfor_reclaim_skb_refdstphysical_locationELS_PDISCchildren_low_usagenum_vfPIDTYPE_MAXbi_sizemg_dst_csetvlan_protothrashing_countwatcherscrypt_ctxstopwait_maxclass_write_lock_irqsave_is_conditionalioveca_flagsiomapd_dnameScsi_Hostnr_migrations_coldbtf_value_type_idmnt_idmap___GFP_FS_BITPTR_ERR_OR_ZEROfc_disc_lportWORK_OFFQ_LEFTquotactl_opski_iopriovport_typesched_remote_wakeuptag_alloc_policymemcpysock_filterBPF_LIRC_MODE2tracing_graph_pauseread_itersuspend_latefront_padFC_TYPE_CTsdev_devmaxframe_sizerecoveredi_rwsembi_integrityexitio_uringeh_device_reset_handlerchild_ns_typeorderslave_bdevscommit_dqblkclass_local_lock_irqsave_is_conditionalmark_dirtyFC_PORTSTATE_OFFLINEnr_ctxkernfs_opsnr_dying_descendantsoom_reaper_timermodulewb_bytesbd_securitynodeinfoqueue_lockf_pathstatic_call_siteself64_symunlinkmap_queuescpumask_var_trefcount_warn_saturatetime64_tdrivers_diri_gidtype_idnew_rdataFORTIFY_FUNC_strnlenrq_qosmark_deadREFCOUNT_DEC_LEAKicq_hintrmdirdq_dqbmemory_failureblkcg_gqdma_flagsbtf_field_kptrSUBMITTED_BY_BLOCK_LAYERmax_hw_sectorsselectors_mtdmod_kallsymss_typefield_maskjits_use_priv_stackprog_bind_mapli_failure_unknownfini_seq_privateremount_fsbd_holdernext_idtask_delay_infopi_sejit_datarelative_fdin_useforwardrq_countMIGRATE_SYNC_LIGHTerrseq_tms_rdatakstatfslruvec_statsreclaimedmems_allowed_seqmax_user_discard_sectorsinsnsitarget_allocbug_listBPF_CGROUP_INET4_CONNECTmax_nr_cidmod_arch_specificDMA_NONEtransfersizepp_recyclesplit_queue_lensharebpf_net_contextprobe_addrno_cgroup_ownerSKB_DROP_REASON_DUP_FRAGdisc_stopftrace_timestampbi_iopriobypass_addrd_ino_warnsstack_depthkernfs_elem_attrBPF_PROG_TYPE_SK_SKBi_ctime_nsecrelative_idrbnodei_private_listbinfmtftrace_sleeptimedata_size_inBPF_CGROUP_ITER_ORDER_UNSPECi_statebv_pagedestructorpcpu_cidsched_migratedZONE_DMA32FC_TYPE_ILScgroup_tasksetdup_xol_addrdevice_configurePROBE_PREFER_ASYNCHRONOUSrcu_node_entrydisc_portsreverse_orderingBPF_MAP_TYPE_BLOOM_FILTERcgroup_bpffile_system_typeorig_ret_vaddrelsct_sendbtf_log_levelELS_RCSmmu_notifier_subscriptionsswap_iocbBPF_RB_ROOTdefault_groups__sifieldsb_ionr_watchesfind_special_pageDL_DEV_DRIVER_BOUNDELS_EXPL_SPP_OPT_ERRadj_offcurr_ret_depthstarved_entryfc_flags__fillerdestroy_dquot__task_fpstatefilldir_tfc_lport_test_readySKB_DROP_REASON_TCP_AOFAILUREget_reserved_spaceioprioKMALLOC_NORMAL__UNIQUE_ID___addressable_fc_disc_config654unreliablecreateBPF_PROG_TYPE_SCHED_ACTdirtied_time_whenstart_scan_seqperf_rdpmc_allowedmin_seqsym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerSKB_DROP_REASON_QDISC_DROPbd_openersdq_inuseofflinedev_pm_infomremaptime_nsin_memstallhost_self_blockednode_size_lockcss_extra_stat_showkptrpoweroff_latei_nlinkwakeupcb_list___GFP_IO_BITcpu_iditer_info_lenpushable_tasksraw_atomic_readtty_audit_bufkref_putmaxlenkernel_cap_t__be16bpf_funcpoke_tabmems_alloweds_inode_lrucached_rqse_cset_noderecov_seqSKB_DROP_REASON_SKB_CSUMkf_rootmmap_compat_baseretvalpreparenr_threaded_childrenclock_op_might_sleepf_sb_errneed_mbd_namecheck_flagsi_sequencert_prioritykretprobe_instancescrypto_profile__be32token_createiov_basecpus_ptrq_lockdep_mapb_more_ioloadfuncscpu_bitmapSTARGET_DELatomic_write_lensaved_tfxa_headdetachprog_ifindexmm_listSKB_DROP_REASON_NOMEMproperty_read_string_arrayFC_FS_EXP_PIDget_statetracepoint_funcd_seqnuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmt__be64blkg_listnum_symtabexec_update_lockfscrypt_inode_infoFC_NS_RSPN_IDsplice_readSKB_DROP_REASON_SOCKET_RCVBUFFBPF_PROG_TYPE_SOCKET_FILTERSKB_DROP_REASON_TCP_RFC7323_PAWSSKB_DROP_REASON_MAC_INVALID_SOURCEneed_qsctx_mapFC_VPORT_UNKNOWNbd_diskuid_gid_extentnumberszone_wplugs_wqWRITE_LIFE_SHORTsigpendingpi_entryBPF_MAP_TYPE_ARENAs_inodesdirtied_whenmap_direct_value_metaMIGRATE_ASYNCBPF_MAP_TYPE_PERCPU_CGROUP_STORAGEnext_scangsindexwrite_bandwidthcompletewatch_listli_prim_seq_err_counteh_abort_listBPF_CGROUP_UDP4_RECVMSGd_sibsleepable_refcntmodule_attributemax_host_blockedneed_tsin_dpm_listwordwork__list_add_valid_or_reportmultiprocessquiesce_depthfbatchclass_task_lock_is_conditionalBPF_CGROUP_INET_INGRESStask_groupf_pos_lockperiod_timerBPF_FLOW_DISSECTORsk_buff_data_texpected_revisionbio_pooltimeout_workBPF_PROG_TYPE_LWT_XMITmac_lensrcu_barrier_completionBPF_MAP_TYPE_STACK_TRACEpacctfc_disc_startblk_mq_tag_setSKB_DROP_REASON_TUNNEL_TXINFOcurr_targetvm_page_protbalanced_dirty_ratelimitbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatPTR_TO_PACKET_ENDperf_event_contextatomic64_tnoinstr_text_startctx_size_outddp_doneac_btime64HRTIMER_RESTARTrpm_autosuspend_delayac_gidELS_LINITnotify_timercorememfh_d_idBPF_MAP_TYPE_USER_RINGBUFLPORT_ST_LOGObusystack_canaryFC_NS_RFF_IDuser_keyring_registermax_write_zeroes_sectors_utimedn_unable_to_routetmf_work_q__fortify_size_flags_1_flags_2FC_TYPE_BLS__ptrtaskstatsport_stateproactive_compact_triggerELS_FLOGIposix_acli_dio_counttlenarch_rwlock_tdriversym_timens_pagerport_event_callbackprog_token_fdsysctlsoffsetrtpoll_taskprot_guard_typedev_iommuWB_REASON_SYNCmap_typeclass_rwsem_read_intr_is_conditionalcompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_usersSDEV_BLOCKbacking_dev_infoi_mappingheadersdiscard_alignmentbsg_deviceshow_statsnr_populated_csets_ress_vfs_rename_keysubmitteretypekfree_skbi_bytes___GFP_WRITE_BITnormal_prioblkio_countshost_datadispatch_waitBPF_MAP_TYPE_INODE_STORAGEsrcu_nodelast_mm_ciddelayedhdr_lenper_cpu_nodestats__refcount_addSKB_DROP_REASON_TC_CHAIN_NOTFOUNDvaddrscsi_vpdis_softnext_cpugrab_current_nsclass_namesdisc_worknr_taskslock_class_keyfc_disc_stoppriv_stack_requestedsum_exec_runtimememory_failure_statssetupdev_pin_infolesb_sync_losspoll_table_structmce_whole_pageELS_QOSRia_modercu_tasks_holdout_listsched_rt_mutexs_pinsswap_peaksnon_seqbpf_prog_arrayattach_func_protoSKB_DROP_REASON_IP_CSUMpresent_pageshctx_listrenamecontiguousthrashing_delay_totalmajorktime_tonstackPRJQUOTAlink_idzswap_lruvec_stateBPF_CGROUP_INET_SOCK_RELEASEkprobe_blacklistjump_entriesdio_offset_alignELS_LKAreserved_tagsdma_masksa_restorerqueuelistdatalenmkdirnextrelax_countrestore_earlyPIDTYPE_TGIDilencpu_run_virtual_totalmax_active_zonesdevice_physical_location_horizontal_positionfc_disc_gpn_id_reqattach_flagskfunc_btf_tab__list_addrportkobj_uevent_env___GFP_MOVABLE_BITkprobes_text_startpid_typeFC_FS_RJT_LOGfown_structi_default_aclBPF_PROG_TYPE_LIRC_MODE2fregs_statemap_flagsBPF_PROG_TYPE_LSMzonerefshift__devicesFORTIFY_FUNC_strcpypendingBPF_MAP_TYPE_PERCPU_ARRAYdma_boundarybd_nr_sectorsnr_eventssdev_statekmemcg_idkstatanon_vma_namedq_hash__iovgp_stategrphintabiommu_mm_datamap_for_each_callbackinvalid_crc_countnr_disk_swapinszone_wplugs_err_listma_flagsFC_NS_RNN_IDarch_uprobebio_issueSKB_DROP_REASON_IPV6_NDISC_NS_OTHERHOSTDL_DEV_UNBINDINGKMALLOC_RANDOM_ENDrefcountmmap_lockuprobe_multidevice_sizeLPORT_ST_RFF_IDzonelistELS_LS_RJTsrcu_reader_flavorbtf_fddumped_framespeerstimerqueue_nodeELS_FARP_REQreal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_alloweduse_16_for_syncrt_mutex_waitermem_cgroup_per_nodekcompactd_pad_page_pooldq_dqb_lockf_flagsblk_qc_tshow_infoinner_map_fdslave_allocflush_requiredWB_REASON_FS_FREE_SPACEsg_tablememcg_vmstatskeyring_semattributesblk_queue_statsgrplomax_rport_retry_countkgid_tkey_userreadlinkoffline_disabledd_comparetime_ns_for_childreni_wb_frn_winnerqspinlocksighand_structELS_FACTstart_brkFC_FS_RJTELS_RNIDdisc_callbackmap_mmapdio_completeshost_statelocked_pendinglockdep_keyrnid_resvdextentfile_offsets_idstate_maskcore_statelink_upalignsym_int80_landing_padngroupsmajor_retriessp_offset__sigrestore_tRPM_SUSPENDEDvolnameDMA_TO_DEVICEmutexn_refattrsexch_mgr_resetBPF_TCX_EGRESSFC_VPORT_DISABLEDbi_sectoreh_deadlinefsbaseinactivelport_set_port_idsrcu_barrier_mutexloss_of_signal_countdirty_limitswregs_state__kernel_timespecchildren_min_usageeh_should_retry_cmdpglist_datad_lruwaitqmax_pkt_offsetd_fieldmaskcountersfaults_disabled_mappingnameidataarg_sizefailedpoweroffbpf_prog_opsbpf_verifier_envminorsnonresident_ageControlRequestselemsizerlim_curFORTIFY_FUNC_memchr_invkey_tagscan_workdebugfs_entrywait__list_add_validshow_rqcan_queuest_shndxreservedi_wb_frn_historyELS_EXPL_AHctxsprocess_keyringset_dqblkfc_disc_configrestart_blocks_opbi_end_iokobjectposix_cputimer_basenr_memcgsleveluser_definedcow_page__warn_printkFC_SOF_Fnanosleepinvalid_tx_word_countfalsecn_sig_alarmpi_state_listtv_secac_exitcodeBPF_KPTRsuidFC_SOF_I3prog_typeKMALLOC_RANDOM_STARTkey_typedismissi_hashmm_cid_next_scanfreeze_noirqoublockcancel_delayed_work_syncdisc_idia_atime_timerfifovm_private_dataskip_ms_page_8work_bitsfc_frame_alloc_fillrtpoll_scheduledFC_NS_GI_AWB_SYNC_NONEBPF_PROG_TYPE_KPROBEorig_progdq_freeSHOST_RUNNINGrootLPORT_ST_RNN_IDDISC_EV_NONEsupported_classespolicycpu_baseBPF_PROG_TYPE_SYSCALLfc_disc_timeoutcap_bsetnr_to_writerportsnr_itemsSKB_DROP_REASON_NEIGH_QUEUEFULLanon_costseq_startfcp_input_megabytesbp_regbvec_poolkern_versionrb_root_cachedfc_host_statisticsWB_REASON_FOREIGN_FLUSHmac_headeri_blkbitswritervm_pgoffvirtmem_refcounttarget_fdcsum_typeSKB_DROP_REASON_TCP_CLOSEbin_attributesuccessELS_LOGOmath_emu_infopushable_dl_taskswrite_u64testWB_SYNC_ALLsched_infogroup_infotailsrscn_fiddqi_fmt_idPTR_TO_ARENAactive_extensionsmemcg_csssoftirq_next_timerrevisionis_child_subreapersg_tablesizeexit_codefile_lock_contexttracingnr_pagesntoh24writeback_indexread_u64fiemap_extent_infofilemempool_free_tPTR_TO_TCP_SOCK_OR_NULLfree_foliort_spc_warnlimitcmndatomic_write_hw_unit_mincompact_count_sk_redirtimer__empty_rangessbq_wait_statedev_namebpf_map__p_sizeBPF_PROG_TYPE_EXTBPF_PROG_TYPE_FLOW_DISSECTORnotified_atWORK_OFFQ_POOL_SHIFTn_klistwb_errbudget_tokenfc_framevlan_tcikswapdwrite_dquotrefcount_offpercpu_pvec_drainedf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachewwnnstorebi_bdevELS_PLOGIst_infodispatchdescsquiesced_bydqi_max_ino_limitllseeknet_nsRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleget_projidfunc_info_aux__sectorpart0cnvcswwwpncallskqidmem_cgroupPTR_TO_BUFfree_inodenext_keysiglockwait_queue_func_tperf_recursionnr_wakeups_remoted_spacei_ctime_secdebugfs_idreal_func_cntnext_timer_typeBPF_TASK_ITER_TGIDTT_NATIVEused_map_cnt__empty_insnshlist_bl_nodenum_descsSKB_DROP_REASON_TCP_FLAGS_head_1_head_2clockiddelayed_work_timer_fn__read_overflow2_fieldFREEZE_MAY_NESTsym_hvclock_pageremap_file_rangemmap_legacy_basepfmemalloc_waitend_dataxa_lockfutex_exit_mutexuse_16_for_rwiommu_groupmap_peek_elemnr_isolate_pageblockmempool_alloc_tdevice_get_dma_attrtarget_blockeddev_loss_workalloc_inodepayloadbtf_field_graph_rootdirty_foliodn_unknownnode_zonesseq_countfscrypt_keyringis_hardasync_sizeSKB_DROP_REASON_INVALID_PROTOtrap_nrf_iocb_flagsctx_size_in__flagsRPORT_EV_LOGOkcompactd_waittotal_vm_entire_mapcountiteratorlastpool_dataqf_opsforce_atomic_pad1_LPORT_ST_RHBAFC_FS_RJT_UNSUPreal_credno_difblkcnt_td_rt_spaceprog_idsrscn_plenBPF_MAP_TYPE_HASHsigned charmap_local_storage_chargehas_child_subreapermount_pad2_reasonblk_flush_queuesched_entitydev_links_infoinner_protocol_types_uuid_lenpcpufh_seq_cnt___GFP_RETRY_MAYFAIL_BITdqi_privINIT_LIST_HEADfc_els_cmdfmode_trpm_autosuspendrnid_att_nodessweventactivatefxregs_state_lowerpaddingct_optionspid_ns_for_childrenSKB_DROP_REASON_FULL_RINGtimestimer_rand_statelru_gen_memcgfr_encapsllist_nodeELS_EXPL_INV_LENbpf_run_ctxbio_slabstate_add_uevent_sentLPORT_ST_RSPN_IDenv_startmodule_notes_attrsio_cqlower_firstrangeSKB_DROP_REASON_TCP_RESETbvecacct_vm_mem1on_cpumanage_system_start_stopmg_src_preload_noderefcount_incstringSHOST_CANCEL_RECOVERYatomic_fetch_add_relaxednuma_preferred_nidELS_FPINfree_diskPTR_TO_MAP_KEYvmem_altmapbiotailwait_startelevatorspinlockmin_unmapped_pagessrcu_barrier_seqi_aclssb_statnofaultbpf_map_typeia_rangesq_size_fieldis_reltablepteval_tlog_levelblk_mq_tagsfc_disc_recv_reqDEVICE_PANEL_LEFTorc_unwind_iprel_deadlinexfer_contig_endkobj_typeskip_settle_delaysb_writersdma_cleanupeh_timed_outdriver_datai387dma_iommumax_idirq_safeLPORT_ST_READYrescue_lockdefault_timer_slack_nsxregs_statedelays_statecompletion_cntSKB_DROP_REASON_LOCAL_MAC_deferred_listcurr_nrset_child_tidSKB_DROP_REASON_UNICAST_IN_L2_MULTICASTbio_vecacpi_match_tablenfdsrlimitBPF_TRACE_FEXITmap_update_elemlast_subtree_bstatnr_frozen_tasks__list_del_entry_valid_or_reportiterrelease_agent_pathidle_notificationmodule_stateWORK_OFFQ_FLAG_SHIFTrtpoll_triggersPTR_TO_BTF_IDwait_lockf_pipegetgeocset_linkswrite_iterD_REAL_DATAsp_featuresacct_timexpdclock_mutexnr_failed_migrations_runninguserfaultfd_ctxevent_flagsthread_structoldpcore_relosbuf_lenfc_rport_statemm_context_tbd_stampELS_RVCSdio_mem_aligncstimeRPORT_ST_FLOGIprot_capabilitiesatomic_long_trpm_request__refcount_incpositionMQ_RQ_COMPLETEio_comp_batchline_info_cntSKB_NOT_DROPPED_YETcftsf_credtrace_eventsfc_port_typed_iputlast_bstatnew_prog_fdnr_wakeups_syncklist_nodeELS_ADISCstackmap_release_urefBPF_REFCOUNTblockedvm_numa_eventELS_ADDR_FMT_FABdst_trampolineallowedmce_countweighttotalblk_plugOutputRequeststrc_reader_nestingfpstateELS_ADDR_FMT_AREAtag_setis_roxno_scsi2_lun_in_cdbprevseqcount_raw_spinlockinstrument_atomic_read_writebios_paramnum_orcskswapd_failuresFORTIFY_FUNC_kmemdupbuflenbpf_kfunc_desc_tabdeadBPF_CGROUP_DEVICEWRITE_LIFE_LONGcrc_offloadexpiry_activeeh_bus_reset_handlermtd_infois_confidentiali_dentryfixupswq_misc_constsvm_endvm_structproc_handlermemcgfsyncFC_FS_RJT_BSYsgid__fc_frame_header_getcompat_robust_listnuma_workELS_ECHOprioprivvaluercu_workBPF_CGROUP_INET4_GETPEERNAMEredirectedcurrent_stack_pointerac_minfltbpf_prog_aux_hugetlb_cgroup_msecs_to_jiffiesset_policyinternal_tagthreadftrace_callsitesmmlistservice_paramsBPF_CGROUP_SETSOCKOPTforceidle_sumusedpage_typeclass_spinlock_is_conditionaluserskb_iifmynodeseq_stopWORK_BUSY_PENDING__MAX_BPF_PROG_TYPEblk_traceactionseconds_since_last_resetlink_detachpi_waitersdom_cgrpqueue_mappingscsi_comp_flagslportfile_name_offbstatfailcntatomic_tpcp_listqueue_flagsBPF_PROG_TYPE_UNSPECrb_rootLPORT_ST_RPAfreepages_countutf8data_tableBPF_PROG_TYPE_SK_MSGprim_seq_protocol_err_countexe_fileuid_telementsd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_datadef_flagssrcu_n_lock_retriesraw_locksrcu_structprovinner_map_metais_guestli_link_failure_countio_minnf_skip_egresstarget_attrsrtpoll_wakeupsplice_eofs_sync_lockproganon_vma_chaini_mtime_nsecseq_opsrseq_event_maskem_pdi_fsnotify_maskshared_pending__int128kasan_check_write__mce_reservedwriteback_controlmax_write_lenmm_struct__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEbuild_idhost_statss_export_opCONST_PTR_TO_MAPBPF_CGROUP_INET4_GETSOCKNAMElen_descseg_boundary_maskanon_namesched_dl_entitypp_ref_countactivest_othercall_get_stackstartparentlookupkernel_siginfowritten_stamp_sigpoll__compiletime_assert_109SKB_CONSUMEDinitializedfc_fcp_ddp_setupSDEV_CANCELkill_sb__bi_remainingnum_bugskmalloc_cachescftypesecurity_supportedsock_fprog_kernklistusercntSKB_DROP_REASON_OTHERHOSTirq_delay_totalstate_entry_ptrfc_non_bls_respstatsdev_loss_tmo__compiletime_assert_118usersactive_basesresp_taskDEV_DMA_COHERENTfc_els_rrqswap_slot_free_notifyELS_EXPL_INSUF_RESstart_databoolcompact_order_failedbv_len___GFP_RECLAIMABLE_BITinquirymodsctimernid_atypedestroy_inode__init_waitqueue_headcma_pagesfutex_pi_state__compiletime_assert_127SKB_DROP_REASON_TCP_OLD_SEQUENCESKB_DROP_REASON_PKT_TOO_SMALLi_mutex_dir_keyrescue_workrestartsSKB_DROP_REASON_UDP_CSUMdevice_physical_location_vertical_positionget_aclset_aclac_exe_devencapsmemory_tiers_voppercpudescpoll_bioiterate_sharedFC_RJT_F_CTLmemswtimer_msecsym_vdso32_sigreturn_landing_padfc_fpin_statscma_areafeatures__compiletime_assert_133rcu_tasks_exit_cpulink_fdmigrate_from_cpubd_size_lockwriteerror_codebuddy_listref_ctr_offsetsldt_structprog_attach_flagsfcp_control_requestscred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_namemempool_free_slabVTIME_INACTIVEmg_src_cgrpeh_target_reset_handlerclass_preempt_is_conditionallink_createtimeouturing_cmdshrinker_idnr_dirtiedgetattrBPF_SK_SKB_STREAM_PARSERsetattrsystem_long_wqPTR_TO_TCP_SOCKvmstats_percpufixupblockfc_exch_timer_cancelMQ_RQ_IDLEdevtlast_cpufor_backgroundnr_wakeups_localcn_sig_warnuidhash_nodemax_ratioalloc_cpupost_attachworker_privatepoll_eventFC_FID_FLOGIalloc_factorlinelinkbi_pooleffectivecompact_blockskip_flushmoderead_char___GFP_NOWARN_BITatomic_setFC_FID_ALIASESnode_idPTR_TO_STACKtargetget_nextdqblkrcu_tasks_idxBPF_PROG_TYPE_NETFILTER__ret_do_oncejournal_infobi_inline_vecstqheadlast_used_atrq_end_io_retline_offhres_activeold_subtree_controllesb_link_failmod_namenotes_attrsdelay_workFC_VPORT_NO_FABRIC_SUPPblock_device_operationsoffset_ctxbi_blkgseq_nextarch_test_bittail_call_reachablelast_switch_timefcp_output_requestscompact_init_free_pfnwakeup_countwait_indexsystem_freezable_power_efficient_wq_head_2arunnable_weightSKB_DROP_REASON_NEIGH_DEADFC_VPORT_FAILEDmap_push_elemtarget_busyclass_releaselast_sum_exec_runtimeSKB_DROP_REASON_PACKET_SOCK_ERRORdd_key_trueFC_RCTL_ELS4_REPFC_RCTL_ELS4_REQsa_handlerfree_countcg_listscsi_transport_templatelocked_vmfc_exch_mgr_anchorqueue_rqaddressmq_hctxstart_timeRPORT_EV_STOPzone_wplugs_hashkprobe_multicookielistWORKER_DESC_LENfreezersig_okextabledma_data_directionmax_entriesi_sizeentry_eipcgroup_atypesplice_pipexstate_headerinquiry_lenrtpoll_timerdma_addrELS_TEST__pcpu_ptrem_perf_domaind_flags___GFP_HIGHMEM_BITdying_tasks_large_mapcountrrq_ox_idnode_present_pagespid_namespaceliveclock_was_set_seqspc_warnlimitseqcount_tmin_fltblock_devicethreadedfp_fidMEMORY_DEVICE_GENERICpkruBPF_MAP_TYPE_PERF_EVENT_ARRAYattribute_containerELS_AUTH_ELSprojid_tvendorvport_idmemcg_nodeBPF_CGROUP_UNIX_SENDMSGdma_lengthcn_clearkey_payloadFC_RJT_INVL_CLSadd_linksnbp_th_start__empty_insnsiuse_10_for_msELS_QSABPF_RB_NODE_dummy_bndWQ_FREEZABLErefcount_saturation_typeexception_cb__WQ_ORDEREDBPF_TRACE_UPROBE_MULTIper_cpu_pagesetfcp_cmndsaved_stateparent_exec_idutil_sumdd_key_falsesigvalfsnotify_mark_connector__ubuf_iovecsize_is_constantcputime_atomicdeadlinebio_integrity_payloadlun_in_cdbmodel_descriptionexit_requeste_d_tovFC_BA_RJT_VENDORwait_queue_upperclass_write_lock_irq_is_conditionalcgroup_fileswap_readahead_infovtimeels_cmdexpecting_cc_uas_rootli_device_specificstack_refcountgrpmaskdevice_attributereca_rfids_remove_countBPF_SK_LOOKUPlru_genwrite_newuser_namespaceclass_rwsem_write_is_conditionalpids_active_resethlist_nodeblk_features_tsuper_operationsautosleep_enabledwrite_file_infoload_sumaddress_spacecpus_maskdl_yieldedstarget_dataextension_progfile_dispread_newd_spc_softlimitfc_discuse_10_for_rwkrefrseq_css_lock_keydqi_flagsmq_ctxjump_entrypi_top_taskhlist_nulls_nodefc_els_lesbpacct_structRPM_REQ_RESUMEpathnameuser_sizelast_queue_ramp_upfc_seq_lookup_recipkref_getbd_statsfree_mempoolshow_fdinfoFC_RCTL_DD_DATA_DESCFAULT_FLAG_MKWRITEput_budgetfadviseclass_read_lock_irq_is_conditionallesb_inv_crclinenoMODULE_STATE_LIVEtask_listtc_at_ingressasync_scanPTR_TO_CTXFAULT_FLAG_RETRY_NOWAITBPF_CGROUP_SOCK_OPSread_foliosc_data_directionhas_elevatordtordq_countvpd_pg0nlinksignalnr_wakeups_passiveself_exec_idstate_syncedws_activefr_max_payloadf_epctl_tablercu_specialprog_fdscsi_device_handlerentryold_subtree_ss_maskbackWORK_STRUCT_FLAG_BITSBPF_MAP_TYPE_LRU_HASHfr_flagscgwb_domaincntsmsecs_to_jiffiessock___GFP_THISNODE_BITidr_rtsdev_bflagsdispatch_fromWORK_STRUCT_PWQ_SHIFTnr_linfomq_freeze_wqstart_prevent_timepgd_tsigset_twq_offLPORT_ST_DNSmap_btf_idbucket_idELS_PRLIFC_RCTL_LCRELS_PRLOrstat_flush_nextignoredgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64prog_id__list_del_entry_validreserved_tailroomi_inoserver_has_tasks_killRPORT_ST_PRLIpgdati_spc_warnlimitunderflowf_posBPF_MAP_TYPE_HASH_OF_MAPSperformancesoftac_pidowner_trapnoload_weightBPF_PROG_TYPE_SOCK_OPSfls_longfc_fh_typesleepablevport_statesymlinkclass_rwsem_write_try_is_conditionalkmalloc_noprofbd_queueerror_framesin_iowaitDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclbdi_writebackrb_leftmostSKB_DROP_REASON_TCP_AUTH_HDRdst_neededbug_addr_dispmigration_pendingscan_mutexhosttd_real__msecs_to_jiffiesns_commonmap_ifindexdevice_get_match_dataELS_GAIDs_max_linksctl_table_rootfc_rport_eventscatterlistverified_insnsthread_headacquire_dquotclockid_tfifo_timetarget_destroyzone_capacityFORTIFY_FUNC_strlenFC_EOF_DTIpgdval_td_managedevice_attrsmax_ctx_offsetmax_device_blockedback_padMIGRATE_SYNCwcharRQ_END_IO_FREEexplanseq_filefcp_output_megabytesonline_cntBPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATEDrestoreSKB_DROP_REASON_IPV6_BAD_EXTHDRline_infoseq_ptrHPROBE_LEASEDBPF_LSM_MACthaw_superalt_lenseq_operationslesb_prim_errfallocatelog_true_size__retdst_pending_confirmgranted_mac_call_addrwriteback_sync_modesi_mmap_rwsemSKB_DROP_REASON_TCP_INVALID_SYNundo_listattribute_groupdma_poolsretrypersonalitykmem_argsprintk_index_sizeuprobe_task_stateWB_REASON_BACKGROUNDstimestatic_priotmpfileattach_func_namedata_indqi_formatnvcsw_nr_pages_mappedfrequencyrrq_zerortpoll_totaldev_pm_ops__refcount_sub_and_test__kmalloc_indexfc_exch_timeoutpfmemallocblk_mq_ctxnext_indexno_updateiter_typeDEVICE_PANEL_BOTTOMscsi_pkt_lockencap_hdr_csumtransporttmap_get_next_keyBPF_SK_REUSEPORT_SELECT_OR_MIGRATEspin_lock_bhnr_wakeupsquerybpf_prog_typeenabledki_filppool_exch_rangemultiple_queueswork_func_tmemcg_vmstats_percpupp_magicfpu_state_permer_reason__refcount_dec_and_testfwnode_reference_argsdevres_head_SLAB_RED_ZONEused_maps_mutexRPM_REQ_IDLEfilenameex_lockbaseRPORT_ST_ADISCac_ppidd_pruneno_free_exchrestore_noirqr_ctlFC_RJT_PREEMT_RJTsysfs_registeredDumpedFramesSKB_DROP_REASON_TCP_TOO_OLD_ACKrlockBPF_PROG_TYPE_SCHED_CLSi_rt_spc_warnlimitqueueBPF_PROG_TYPE_CGROUP_SOCKbytesfc_fill_reply_hdrnuma_migrate_retryMEMORY_DEVICE_COHERENTenclavefiltersaved_dst_prog_typeroot_blkgd_revalidateLPORT_ST_SCRsystem_power_efficient_wqWB_REASON_PERIODICcgrpwatermark_boosttracepoints_incoredqsi_opsubtree_controlquota_syncsrcu_have_cbsmemory_peaksInvalidTxWordCountasync_in_progresssignummempool_destroydqi_dirty_listpi_lockdirtied_stamptm_donetimespec64BPF_WORKQUEUEscan_finishedlesb_sig_lossreplace_bpf_fdmax_ct_payloadnr_forced_migrationsdst_mutexcpu_possibleumount_beginchannelbadblocksnr_descendantsbootbios_statell_nodeport_idFC_RJT_LINK_CTLkernfs_nodearch_atomic_readcpumaskptrace_messagehton24lengthFC_RCTL_ACK_1tag_listbio_alloc_cachepdt_1f_for_no_luni_wb_frn_avg_timefc_exch_allocBPF_LIST_HEAD_pincount__roundup_pow_of_tworeclaim_statecur_imageruntime_errori_sb__poll_tbpf_jit_poke_descriptorsubvolon_dispatchdirty_inodesymtabd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structELS_LIRRfs_parameter_specSKB_DROP_REASON_MAXrcu_data0real_blockedba_resvdruntime_suspend__s16BPF_CGROUP_UNIX_GETPEERNAME__compiletime_assert_137wifi_ackedbacktracerefcount_incoffline_alreadyfc_exch_abts_resps_umountn_nodeon_listcn_lost_creditmax_descendantsrefaultsdata_vmneeds_force_resumeblk_eh_timer_returnbtf_recordrec_zerocsum_levelrpm_statusscsi_host_statedeferred_split_queue__s32p_sizechildrenbpf_local_storage_map__mono_tc_offsetcheck_eventsmarkrx_fhdqi_bgracei_wbhost_nof_inoderx_framesnext_rport_numberserialburstname_offpermissionsgraph_rootkernel_load_data_strELS_RJT_UNABcgroup_rootscsi_target_statehostmsi_device_data__UNIQUE_ID___addressable_fc_exch_mgr_del666slave_destroykallsymsmap_alloc_checki_ino_timelimitbr_vendorinit_timer_keybi_issuebd_holder_opsBPF_KPTR_REFlink_idscgwb_frnsrcu_idxSTARGET_CREATEDutil_est__s64ipc_nsfc_exch_els_rechugetlb_usagebpf_cookiesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenacct_rss_mem1fc_exch_mgr___orig_eipsrcu_datadevice_physical_location__keycgtimebypass_spec_v1pagefault_disabledELS_CSUindexs_time_maxucount_maxdelayed_workprog_flagsopen_partitionssa_maskkswapd_lockmmappedElf64_Wordold_dom_cgrpjited_imageactive_timeatomic_flagscallernum_jump_entriesextra_lenPIDTYPE_PGIDbtf_vmlinux_value_type_idmnt_namespaceelemwb_completionSKB_DROP_REASON_IP_LOCAL_SOURCEend_ioquotalensrcu_data_have_cbsnivcswoffdev_tidlinfo_idxmce_vaddrBPF_CGROUP_UNIX_GETSOCKNAMEdl_dev_stateFC_RCTL_ENDshowrb_subtree_lasts_listBPF_MAP_TYPE_CGROUP_STORAGEhigh_workmq_pollsender_cpunr_segssame_target_siblingstailcall_targetof_match_table_entryBPF_PROG_TYPE_CGROUP_DEVICEfc_tm_flagsino_timelimitfc_setup_exch_mgrcpu_numberalternative_gpt_sectori_readcountELS_ABTXFC_RCTL_IFRHblkcg_polsincrfreeseq_offloadresp_idrange_cyclicprog_cntlock_countthrotl_datalist_lru_onei_pagesmxcsrWQ_POWER_EFFICIENTclass_rcu_is_conditionalarchdataptrace_entryuid_mapguest_permwait_queue_headfdmi_versionnum_srcu_structsnr_activeprev_sum_exec_runtimei_flagsgendisku_flagstag_set_listlogical_block_sizesubtree_ss_maskinvalidate_lock_keyinfousersizel1d_flush_killfc_exch_recv_blsctx_outFC_VPORT_ACTIVEtimestampsrlimit_maxwrite_beginSHOST_CANCELbpf_prog_offloadwrite_infohrtimer_restarts_encoding_flagssessionids_time_minSKB_DROP_REASON_UNHANDLED_PROTOWORK_STRUCT_PWQ_BITvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrbpf_iter_aux_infos_stack_depthnode_offsetkprobe_override__vm_flagsresid_lenqueue_depthbpf_tramp_imagecsum_offsetpm_messagememcg_lrufred_cschangedvportcur_ktimeinitfop_flags_tgroupsoffstty_structnotify_nextvirtual_dr6dma_opsreq_spdma_addressmmap_basebd_devsyscall_workinit_cmd_privelowbpf_trampolinelockdep_mapnum_trace_evals_addr_bndcgroup_base_statELS_RDF__UNIQUE_ID___addressable_fc_seq_assign660ELS_RDPset_dbd_for_msnumberzone_device_dataquota_readexchesloss_of_sync_countvolnamehlistpinned_vmfc_sof_needs_ackfunc_cntELS_RECwritepagesnuma_faults_localityqrwlockELS_RESPTR_TO_FLOW_KEYS__write_overflow_fieldrw_semaphoreattach_bpf_fdfirst_minori_blockstask_fragWB_REASON_LAPTOP_TIMERsource_listsum_block_runtimeBPF_NETKIT_PRIMARYnuma_scan_period_maxtotal_timepowerfromnum_ei_funcsi_generationFC_FID_NONEfcp_input_requestsflushBPF_PROG_TYPE_PERF_EVENTFC_RJT_TYPE_UNSUPtask_fd_querymg_dst_cgrponlinernid_ip_addrBPF_PROG_TYPE_RAW_TRACEPOINTno_vpd_sizeformatlast_switch_counthardirq_stack_ptrlast_wakee__cloned_offsetswapuint32_tssize_tRQ_END_IO_NONEvtime_statetry_vpd_pagescancel_forkSKB_DROP_REASON_TCP_OFO_DROPparent_could_setfcapFC_BA_RJT_INV_XIDper_cpu_nodestats_blocksizequeue_numprevent_sleep_timeBPF_MAP_TYPE_CGROUP_ARRAYclass_spinlock_irqsave_try_is_conditionals_readonly_remounti_io_listrefaultedchild_countBPF_MAP_TYPE_ARRAY_OF_MAPSrelease_agent_workVTIME_IDLEBPF_PROG_TYPE_STRUCT_OPSwb_domaincgroup_subsysnbp_th_nr_candrestartip_summedcompat_uptr_tresp_wqcgwb_treeDEVICE_HORI_POS_LEFT_hugetlb_subpoolend_pfnuclamptgidlimits_lockreleasenr_wakeups_migrateserial_nrstack_vmi_fieldmaskupidBPF_CGROUP_INET_SOCK_CREATEprotection_supportkcompactd_highest_zoneidxfreeze_mutextrace_evalsELS_RLSia_vfsuidbtf_mod_pairquota_format_opsi_datarescue_listfsverity_infocore_threadclosidsched_avgRPORT_ST_PLOGIcodearch_atomic_fetch_addBPF_LSM_CGROUPfc_exch_holdu64_stats_syncsyscorenr_reserved_highatomic__i_nlinkpmd_tinumli_invalid_tx_word_countsrcu_barrier_cpu_cntbatchedreadaheadopt_sectorsFC_VPORT_FABRIC_REJ_WWNhrtimer_cpu_baseirq_domainwait_liststatic_call_trampac_etimefsverity_operationscoublockFC_RJT_INVL_DIDbug_tablemigrate_modesecmarkusing_gplonly_symbolswb_listremovedhandleremulatednr_writeback_throttledsym_vvar_pageELS_RPLmembarrier_stateELS_RPSBPF_PROG_TYPE_LWT_INdma_pad_maskfc_seq_els_dataELS_RPSCBPF_KPTR_UNREFbin_sizeFC_RJT_PREEMT_DISFORTIFY_FUNC_strlcatfc_exch_els_rrqrcu_read_lock_nestingreg_typecb_accessrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_tio_bitmapDEVICE_VERT_POS_CENTERELS_RRQretry_countsbitmap_wordmanaged_pageslong unsigned intmax_timelast_queue_full_countread_file_infoELS_RSSexec_startia_sizeema_listRPM_RESUMINGunpinned_netfs_wbMODULE_STATE_COMINGsym___kernel_sigreturnZONE_DEVICEfunc_info_cntuser_cpus_ptrSKB_DROP_REASON_TCP_MD5FAILUREuser_scand_opstate_initializedrelease_dquotELS_RTVplugsoftirq_activatedkey_sizeinv_weightsecuritykernel_symboldl_timerlockdep_map_pmodule_param_attrsdirty_ratelimitno_read_capacity_16scsi_host_template__user_state_sizechainedVTIME_GUESTretriessdtrsysvsemdisconnectstasheduser_xfeatures__kmalloc_cache_noprofdisc_mutexuse_memdelaynr_cached_objectshas_timeoutcgroup_namespacecommcallback_headhead_fragexception_table_entryin_hrtirqctl_table_set_overruncondhash_lenDEV_DMA_NON_COHERENTFC_RJT_SEQ_CNTcoredumpd_sbio_lock_cls_keySKB_DROP_REASON_IPV6_NDISC_FRAGksetfc_exch_ptr_getsleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsPTR_ERRnodesysvshmno_highmemdata_outREFCOUNT_ADD_UAFFC_BA_RJT_INVL_CMDfirstSKB_DROP_REASON_TCP_FASTOPENELS_EXPL_UNAB_DATA_nfctSecondsSinceLastResetFC_CLASS_2FC_CLASS_3FC_CLASS_4WORK_OFFQ_BH_BITactive_countRPORT_ST_RTVFC_CLASS_Fnr_active_requests_shared_tagsnum_tracepointsvpd_pgb7ueventfc_pri_tasharednext_cpu_batchmemcg_completionsdisk_eventss_sysfs_namesigval_trqst_qFC_FID_CLOCKSDEV_QUIESCEmap_pop_elembitsbase_pfnclass_mutex_try_is_conditionaler_vendorsem_undo_listcompat_rmtp_SLAB_CONSISTENCY_CHECKSclass_local_lock_is_conditionalELS_ESTCget_currentELS_ESTSstatic_key_trueno_fcs_stimeSKB_DROP_REASON_TCP_AONOTFOUNDinsnsperf_event_ctxpprogsOutputBytescostxcomp_bvio_contextPIDTYPE_PIDwakee_flipsFC_RJT_RX_IDvlagufdsvlansegment_boundary_maskattach_tracing_progioctlprev_cputimectx_inbtf_flagshorizontal_positionem_perf_tablebi_crypt_contextprivateswp_entry_tcharFC_PORTSTATE_BYPASSEDmatchnr_failed_migrations_hotreg_offsetBPF_TRACE_KPROBE_MULTIfc_exch_resetqueue_stoppedFORTIFY_FUNC_UNKNOWNwrite_charbin_attrscpu_itimerFC_RJT_MCAST_ETdevres_lockfiles_struct__ret_onceblk_zoneSDEV_RUNNINGicq_treePTR_TO_BTF_ID_OR_NULLFC_CLASS_NONEvfsuid_tf_lockexec_vmkernel_parambtf_fieldfh_f_ctlget_lesbvertical_positionbtf_dtor_kfunc_traw_atomic_fetch_add_relaxedshutdown_prerelease_folioftrace_managedbi_io_vecvendor_idmtimearchrobust_listasync_probe_requestedfc_exch_initmax_xidthaw_earlyac_btimevectors_securitysplice_writeparam_lockreq_listi_opflagstot_write_bandwidthfreeptr_offsetdentry_operationsstats_sectorss_blocksize_bitskfreeexp_hintbr_resvdclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapsw_hash__per_cpu_offsetsym___kernel_vsyscallopen_mutexfortify_funcsk_buff_fc_frame_alloccan_forklow_usageget_timeki_flagss_inode_wblist_lockFC_RJT_DEL_USAGEFC_FID_FCTRLpermwriteback_inodesERR_PTRdestroy_worklockableuprobes_statemm_counttrace_overrunargsargvuclamp_reqswap_info_structs_qcopwb_tcand_bytesblk_mq_queue_mapFC_VPORT_INITIALIZINGFC_RJT_INSUF_RES__kernel_long_tsrcu_usagefaultableperf_event_mutexfctsFC_FID_BCASTexit_hctxqueue_delayed_work_onfc_xid_not_foundsync_modemap_gen_lookupin_execverlim_maxFC_PORTSTATE_MARGINALsimple_tagstarget_listVLinkFailureCountbpf_kfunc_btf_tabrtpoll_next_updatecoherent_dma_mask__data_lendriver_flagsscsi_residfile_ra_statek_sigaction_hugetlb_hwpoisoninsn_offshrinker_infocompletionslld_event_callbackreadahead_controlfwnode_operationsprocs_fileswait_queue_headmemory_typevm_userfaultfd_ctxTT_NONEmap_pagesBPF_PROG_TYPE_TRACEPOINTSKB_DROP_REASON_TCP_ABORT_ON_DATAmod_tree_node__UNIQUE_ID___addressable_fc_exch_seq_send663local_watermarkprobe_offsetxfer_ddpFC_RJT_INVL_SIDcmd_flagss_bdev_filerequest_queuedev_pagemapfc_exch_setup_hdrtarget_private_offsetRPORT_ST_INITcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fsELS_RJT_BUSYhost_eh_scheduledsoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLErb_nodeELS_EXPL_PLOGI_REQDreturn_consumerround_robinksymi_private_dataroot_csetfc_seq_allocused_btfsptracer_credWORK_STRUCT_COLOR_BITSsrcu_barrier_headleadercheckTT_COMPATtop_of_stackcap_effectivenetfilterexit_statefc_fcp_pktfaultscan_start_SLAB_POISONprogs_hlistWORK_STRUCT_COLOR_SHIFTnuma_pages_migratedidr_nextsched_tagssupported_modeer_explanfiltersnr_frozen_descendantssbitmap_queueno_cgroup_migration_SLAB_SKIP_KFENCEsched_databpf_func_info_auxprintk_index_startindex_keybreserved_tags__bi_nr_segmentsLPORT_ST_FDMIforce_scanintervalavgs_lockbug_entryzswap_maxtimers_activenum_classesprotocolbpf_cgroup_storagevma_lockrtpoll_untilkswapd_waitdl_throttledbpf_progseccompDEVICE_VERT_POS_UPPERrolesblk_holder_opsfprop_local_percpustatic_key_modextensionsfilter_countpsi_filesmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodecreate_work_queuerport_delete_workumode_t__init_workdestroy_workqueueinitial_nsfc_em_cachepno_pmGRPQUOTAia_vfsgidioctx_locktimer_slack_nss_bdixarrayjited_linfocan_wakeuptime_namespacepdeath_signalexpected_attach_typedst_regnr_wakeups_idledqi_igraceqf_nextBPF_MAP_TYPE_LPM_TRIEmaple_treensproxyELS_EXPL_OXID_RXIDslave_dir__write_overflow_pkeyxid_not_foundkernfs_rootFC_TYPE_ELSucountsget_next_idfc_exch_mgr_delDD_CLASS_TYPE_LEVEL_NUMhooknumwrite_syscallslistscore_relo_rec_sizerefcount_tslow_grocmd_lenDEVICE_PANEL_TOPmemtierrxidmax_hw_discard_sectorsint32_txol_areadefault_lockguess_capacitysrcu_gp_mutexdebugfs_dirwakee_flip_decay_tsprio_listnext_vport_numberlast_timerequestblk_unique_idwpcopy_delay_totalSDEV_DELmax_payloadcontextSKB_DROP_REASON_TCP_ZEROWINDOWhost_lockcpumask_check__UNIQUE_ID___addressable_fc_exch_mgr_list_clone667rwlock_tvm_fault_tskb_extuse_autosuspendclass_spinlock_irq_try_is_conditionalfc_disc_eventcfs_rqtree_reclaimednr_requestsfc_exchvirt_boundary_maskSKB_DROP_REASON_TCP_INVALID_ACK_SEQUENCEcgroupscore_occupationget_policycore_cookiefc_exch_mgr_resetpcrefrefcount_struct__kernel_ulong_tkf_opsfwnodeZONE_DMABPF_CGROUP_GETSOCKOPTcgroup_storagestatic_call_keycsum_startnamespaceSKB_DROP_REASON_IP_TUNNEL_ECNparametersbtf_sizeSKB_DROP_REASON_IP_INHDRgroup_leaderdma_channelrunnable_avglookaheadiowait_countli_loss_of_signals_countshstkioac__kernel_clock_t___GFP_DMA32_BITwas_resetgp_seqscsi_device_stateuuidmaj_fltWB_REASON_FORKER_THREADcached_requested_keyfp_flagsdqb_rsvspaceSKB_DROP_REASON_SUBSYS_MASK___GFP_NOMEMALLOC_BIT__wake_up_SLAB_OBJECT_POISON__s8inode_operations__kernel_size_tdma_configurefile_leasepage_counterarg_flagsclass_local_lock_nested_bh_is_conditionalWQ_BHgpl_symsraw_atomic_incallowed_attachsrecursion_detectedrctlpercpu_rw_semaphoresymbolic_namearch_spinlock_tseqcount_raw_spinlock_tbpf_iter_init_seq_priv_tfc_exch_ptr_setrrq_cmdhighFC_RJT_PRLI_REQrrq_resvdthread_pidmap_lookup_batchcss_idrrtpoll_min_periodemindl_non_contendinglso_maxcurr_ret_stackpgtable_t__u8q_usage_counterwakeirqi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyssdev_targetcore_forceidle_sumget_offset_ctxreleasedexport_operationsbitposqc_stateELS_LCLMget_budgetrx_fpBLK_INTEGRITY_CSUM_IPmempool_smempool_timplicit_on_dflFC_PORTSTATE_LOOPBACKd_inodespecial_vecpageset_batchworkqueue_structBPF_MAP_TYPE_SOCKMAPi_lock_keyuevent_suppresscancel_delayed_workgraveyard_linkbi_opfscsi_cmndfail_io_workfs_superscall_get_func_ip__read_overflow2tcp_tsorted_anchorfc_exch_rrq_respwce_default_on__rcu_icq_cache___GFP_KSWAPD_RECLAIM_BITcompact_cached_free_pfncap_ambientqstrtaskss_d_op_raw_spin_lock_bhBPF_MAP_TYPE_TASK_STORAGEno_report_lunsi_rcu__countFREEZE_HOLDER_KERNEL__already_donefc_exch_releaseinit_requestFC_PORTTYPE_NPORTio_optspanned_pagespcountbio_listwlockedrtpoll_trigger_lockdevicemodule_kobjectmap_releaseELS_SCNPTR_TO_PACKET_METAfc_sof_normalELS_SCRmg_tasksBPF_TRACE_ITERpercpu_count_ptrnr_ia_rangesthawmap_update_batchlink_attach_flagstlbflush_unmap_batchremoveoffload_fwd_markbvec_iteroom_mmfcp_abort_iobpf_local_storagefr_crcname_linkSKB_DROP_REASON_PROTO_MEMrnid_vend_idcompat_long_tcnivcswmap_freeInvalidCRCCountPTR_TO_SOCKET_OR_NULLshort intkswapd_highest_zoneidxtrc_reader_specialgtimepscr_ret__disk_events_disable_depththread_group_cputimertransport_headersizemigrate_to_ramUTASK_SSTEP_ACKloginuiddesc_structi_wb_lists_umount_keyquota_typenameSKB_DROP_REASON_SKB_UCOPY_FAULTcgrp_ancestor_storagespp_typesetleasereca_resvd1bitmap_tagsmnt_rootBPF_MAP_TYPE_SK_STORAGEpsi_flagssubsys_masksighandbtf_key_type_idavgs_workaddrELS_EXPL_NONE__rcu_headac_utime_SLAB_HWCACHE_ALIGNFC_PORTSTATE_DELETEDksm_zero_pagesBPF_MAP_TYPE_LRU_PERCPU_HASHqueuedataSKB_DROP_REASON_TCP_OFO_QUEUE_PRUNEprivate_dataBPF_MAP_TYPE_CPUMAPfc_exch_poolgid_mapFC_RCTL_F_BSYpageset_high_minfs_structnuma_nodedev_archdatanr_perf_statess_flagsrcu_nodereca_resvd2orig_pmdrb_rightclock_baseBPF_SK_REUSEPORT_SELECTclass_irq_is_conditionallaunder_foliowake_batchmax_indexis_funcs_vfs_rename_mutexElf64_Xwordf_ctlflockSKB_DROP_REASON_BPF_CGROUP_EGRESSiter_createFC_RCTL_DD_UNSOL_DATAhandler_datavalue_type_btf_obj_fd__paddingoffline_waitqnr_reclaim_startstatus_codeio_lockdep_mapatomic_write_hw_boundarymap_nr_maxiowait_sumdescriptionfolio_batchbi_nextblk_status_tUSRQUOTABPF_CGROUP_ITER_SELF_ONLYdriver_private__flush_workqueueWORK_OFFQ_POOL_BITSpm_onlyd_rt_spc_warnsset_read_onlypgmapSKB_DROP_REASON_TAP_FILTERactive_refmap_owner_storage_ptrhctx_tablefc_xid_busykernfs_open_filelowmem_reserves_iflagsprintednr_hw_queuescodetagstate_mutexallowed_mapsctx_arg_infoinner_network_headerex_listlast_queue_full_depthBPF_PROG_TYPE_SK_LOOKUPfc_frame_header_getfc_exch_respcid_worki_versionswap_deactivatesr_lockattachclass_rwsem_read_is_conditionalqueue_limitsunitil_weightstarved_listdma_parmsbdi_idKOBJ_NS_TYPEStstampcmin_fltchunksSKB_DROP_REASON_VXLAN_INVALID_HDRarch_uprobe_tasklicensewrite_protect_seqclearedkobj_ns_type_operationsshutdownevent_countsched_statisticslru_lock__kernel_uid32_tnode_zonelistsallocSKB_DROP_REASON_TCP_AOUNEXPECTEDb_attachedorig_pterq_timeoutkeysinit_nameper_cpu_zonestattc_indexfile_lockstatfs__UNIQUE_ID___addressable_fc_exch_mgr_reset662rw_semswappinessdevice_privatevm_policydl_deadlineLPORT_ST_RSNN_NNtracepoint_extELS_SRLclass_mutex_is_conditionalELS_SRRfpregs_stateWORK_STRUCT_PENDING_BITmemcg_datadqb_curinodesBPF_XDPfileattr_seteh_actionac_tgetimeRPORT_EV_NONEfc_els_ls_accpage_linkno_write_samebtf_log_sizedn_timeoutDEVICE_PANEL_UNKNOWNFC_VPORT_FABRIC_LOGOUTPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetfc_exch_recv_reqmce_ripvDL_DEV_NO_DRIVERbpf_arenafree_after_mult_rcu_gpret_stacknbp_rl_nr_candreal_timerFC_EOF_DTi_privatealloc_tagextended_state_areanum_kprobe_blacklistaccesspool_max_indexmap_seq_show_elemfp_resvdsubdirsvariable__ffspcpu_alloc_noprofdev_releasecgroup_freezer_statemlock_countfc_seq_sendBPF_PROG_TYPE_LWT_SEG6LOCALget_next_child_nodemempolicyfc_rportcacheline_padding_bandfd_arraypollfdblinding_requestedFC_RCTL_BA_RJTlaptop_mode_wb_timerdev_tplatform_dataf_refprev_posfc_cpu_mask__UNIQUE_ID___addressable_fc_seq_release661env_endfileattrs_subtypeusage_countpr_opsstate_in_sysfsdqb_ihardlimitSKB_DROP_REASON_TCP_MD5NOTFOUNDunlocked_ioctluprobebd_mappingFC_RCTL_DD_UNSOL_CMDkmem_cachenuma_next_scanLPORT_ST_FLOGIbudget_mapbsg_devsrcu_last_gp_endxfer_lentnodeclass_local_lock_irq_is_conditionalpage_listinner_ipprotoproperty_read_int_arraywdtrmq_rq_stateELS_LS_RJTholders_dirMODULE_STATE_UNFORMEDst_value__warn_flushing_systemwide_wqlist_headptrace_bpsFC_RCTL_BA_RMCfc_port_states_user_nscan_attachhost_attrsmap_lookup_elem_sys_onlytagset_refcntqueuecommand_may_blockmin_usagearch_tlbflush_unmap_batchquick_threadsELS_EXPL_INPROGdefer_syncfc_ba_rjtBPF_TASK_ITER_TIDmissedfc_no_free_exch_xidfc_exch_deleteusernsndisc_nodetypeBPF_UPTRvlan_allBPF_PROG_TYPE_CGROUP_SKBsum_sleep_runtimecleanup_rqd_spc_timerd_ino_hardlimitchange_cookiebi_statuscss_allocdl_periods_dquotErrorFrameswq_flagsfsnotify_sb_infomap_fd_get_ptrrecent_cida_opsftrace_opsprocnamepad_untilSKB_DROP_REASON_TCP_MINTTLmap_redirectperf_event_listinterval_expinsnBPF_CGROUP_UDP4_SENDMSGrstat_css_list___GFP_LAST_BITvm_node_stat_difftagski_completepgprotrnid_node_mgmtread_syscallstimespec_typebd_devicevmstatsdquot_operationsSKB_DROP_REASON_TC_INGRESSFC_EOF_NIposix_cputimers_workgsbase__lruveccpu_max_bits_warnBPF_CGROUP_INET_EGRESScompact_delay_totalio_tlb_memseq_showFC_RCTL_DD_UNSOL_CTLcpusfilesinblockbd_claimingtails_magicFC_RCTL_BA_NOPcontainersnuma_faultsmem_dqblktarget_ifindexnos_countstgt_delete_workstatusBPF_PROG_TYPE_CGROUP_SOCKOPTWRITE_LIFE_NONEread_countlink_speedBPF_CGROUP_INET6_CONNECTlport_listHRTIMER_NORESTARTscsi_privlast_update_timeSKB_DROP_REASON_IP_INVALID_SOURCEsas_ss_spfc_exch_mgr_destroyold_map_fddisc_startpanel___GFP_ZEROTAGS_BITac_padfc_rport_operationswatermark_SLAB_CMPXCHG_DOUBLEnode_start_pfnmax_allowed_capacityfc_statsopen_modeFC_RCTL_ELS_REPread_pos___GFP_ACCOUNT_BITclass_cpus_read_lock_is_conditionalmg_dst_preload_nodecpu_run_real_totalD_REAL_METADATAgpl_crcsFC_EOF_RTtimes_prevclass_raw_spinlock_try_is_conditionalfc_frame_headerkiocbfree_mpmg_node___GFP_MEMALLOC_BITexecute_only_pkeyreturn_instancesma_lockblk_mq_queue_datacss_offlineattach_btf_tracedockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsELS_NACTFC_RCTL_DD_SOL_CTLwb_tcand_idFC_PORTTYPE_OTHERdentrysequential_iowait_pidfdprli_countcdb_statusInputRequestsSKB_DROP_REASON_SECURITY_HOOKs_writersgroup_stop_countavg_next_updateswap_lockvm_opswb_reasonpartial_buffc_seq_releaseread_before_msget_unmapped_areamkobjsym_VDSO32_NOTE_MASKfrozenactive_uprobeunregisteringget_parentmin_vruntimestoragesdebug_dirhost_resetfc_els_rnid_genclass_disable_irq_is_conditionalFC_RJT_NONEsyscrnr_mapssyscwsync_ionum_bpf_raw_eventswork_qorig_nentski_pose_csetsavx512_timestampfh_typeend_io_datae_freezeBPF_GRAPH_ROOTfree_cached_objectstaints_BoolFC_RCTL_DD_UNCATmax_tp_accessxol_vaddrb_dirtylist_lru_nodeuclamp_ses_time_granvm_statblk_integritykuid_tdev_pm_qosmempool_alloc_slabbd_holdersper_cpu_zonestats_sifieldstaskBPF_CGROUP_INET6_BINDresetsched_reset_on_forkcompound_headnr_retriesfc_seq_lookup_origwake_irqbranchi_cdev__UNIQUE_ID___addressable_fc_exch_update_stats664fc_exch_rrqfunc_infoi_fsnotify_marksep_poolin_thrashingdl_deferBPF_MODIFY_RETURNvpd_pg80waitersvpd_pg83vm_startvpd_pg89mprotectquota_onFC_RJT_P_UNAV_Td_automountDEVICE_REMOVABLE_NOT_SUPPORTEDrnid_genELS_EDCcsum_not_inetctl_table_headeratimeget_ownershipf_task_workfc_host_attrsmy_qfc_lport_stateBPF_SK_SKB_STREAM_VERDICTeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalFC_TYPE_FCPsectorinner_mac_headers_wb_err__q_sizerec_rx_idflush_listattach_prog_fdfinish_waitcloseiopl_warnelevator_queueptraced__MAX_BPF_MAP_TYPEWORK_NR_COLORSdonesym___kernel_rt_sigreturnsrcu_struct_ptrsskip_ms_page_3fbinfmt_miscinodesencapsulationmemcg_awarezonehost_waitFC_PORTSTATE_LINKDOWNmanage_shutdownac_schedqsize_t__fpstatemap_poke_trackBPF_MAP_TYPE_SOCKHASHqf_ownerqueue_delayed_worksuspend_noirqd_inamePTR_TO_MAP_VALUEbi_flagslinks_countprealloc_pterdevd_ino_countarg_lockskb_drop_reasonclass_rcu_tasks_trace_is_conditionalDEVICE_REMOVABLE_UNKNOWNdoes_npivignore_childrenpoint_to_multipointframe_sendBPF_CGROUP_UDP6_RECVMSGdirty_exceededfreeze_fsreca_e_statin_eventfdresume_earlymax_dev_sectorsdup_xol_workalimititemsooo_okaynuma_groupblk_independent_access_rangeskmap_ctrlfscrypt_operationsrangesevents_lockfs_contextmnt_idBPF_CGROUP_INET6_POST_BINDretry_hwerrordrop_inodeBPF_MAP_TYPE_REUSEPORT_SOCKARRAYk_lockorc_unwindgraph_get_next_endpointfrom_ingresslast_sector_bugmq_mapprojid_mapmap_lookup_and_delete_batchkprojid_t__u16PTR_TO_XDP_SOCKsaved_end_ioBPF_MAP_TYPE_STACKsyscall_dispatchdl_densityon_rqlru_gen_mm_walkaltmapmin_perf_statercu_tasks_exit_listlro_xidsp_regdma_drain_buffc_exch_recv_seq_resplast_resets_master_keysflagsbd_holder_locknr_threadsvm_mm__u32query_flagsmax_secure_erase_sectorsenable_statss_quota_typesvm_lockswapin_countdisc_stop_final_ddebugFAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitrcuwaitoffload_l3_fwd_markSKB_DROP_REASON_NOT_SPECIFIEDdelayskcompactd_max_ordermnt_nstimerqueue_headBLK_INTEGRITY_CSUM_CRCsdev_groupskioctx_tableprioritybtf_func_modelksm_rmap_itemsclass_read_lock_is_conditionalKMALLOC_RECLAIM__u64revoked_at_folio_nr_pagesfcp_packet_abortswritepageis_dirty_writebackpkey_allocation_mapLPORT_ST_DHBAdq_iddisable_depthem_perf_statethread_shstkfr_devTxWordsposix_timerswait_chldexitTxFramessas_ss_flagsunreadableunmap_limit_for_wspresent_early_pagesSKB_DROP_REASON_IP_INNOROUTESinsn_idxELS_RNFTPTR_TO_MEMbi_itersrcu_cblist_invokingiopollcsum_complete_swline_coliov_lenlatency_recordfc_lportreca_zerodirty_limit_tstampsector_sizeskb_mstamp_ns__BPF_REG_TYPE_LIMITd_releasefc_seq_start_next_lockedavg_totalfh_cs_ctldev_dma_attrBPF_NETKIT_PEERzswap_writebackexpiresnuma_scan_seqmnt_sbblkcg_csshashnodemask_tref_cntsize_poke_tabsignalfd_wqhhang_detecteddevice_driverSKB_DROP_REASON_ICMP_CSUMlast_zone_capacitystatisticsfsindexout_batchraw_spinlock_ter_resvs_cops_active__WQ_DESTROYINGnum_argspidlist_mutextag_sizeBPF_MAP_TYPE_PERCPU_HASHlast_old_flushs_uuidclear_child_tidrec_ox_idruntime_statusdqb_btimedq_opBPF_MAP_TYPE_DEVMAPELS_ADVCshow_pathdl_serverVTIME_USERquota_disablesched_delayedWORK_OFFQ_DISABLE_BITSsrcu_gp_seq_neededtask_structtimer_delaycurrent_may_mountREFCOUNT_ADD_OVFpushpeaks_lockbpffs_fdpath_fdis_noirq_suspendedfwnode_endpointfind_next_bitPTR_TO_TP_BUFFERcounterunique_idsuspendsupported_eventsoom_score_adj_minlast_bdp_sleepzone_wplugs_poolzone_typedomain_datacopy_file_rangesrcu_gp_startreport_zones_cbxa_flagsFC_EOF_Aattach_btf_idlru_gen_foliobtf_idFC_EOF_Nbpf_insnFC_EOF_Ttv_nsecFC_RJT_SEQ_IDmax_zone_append_sectorssas_ss_sizeeh_eflagss_inode_list_lockUTASK_SSTEPraw_tracepointFC_RCTL_F_RJTehandlerdq_sbexpecting_lun_changescsi_targets_mountselem_flagsBLK_EH_DONEvm_stat_diffsym_pvclock_pageswapin_delay_totalfree_listBPF_CGROUP_UDP6_SENDMSGpage_fraginfo_lenrun_workfsuidRPM_REQ_AUTOSUSPENDfc_els_rec_accsrcversionlist_add_tailtrace_event_callwakeup_sourcefc_seq_ls_accis_partially_uptodatehost_faileddl_runtimemay_splitio_uring_cmdprogs_cntread_dqblkfc_pf_rjt_reasonpeekedrtpoll_nr_triggerssrcu_parentinit_seq_privatebi_cookiesuppliersfree_percpufile_operationsRxFramesSKB_DROP_REASON_TAP_TXFILTERbpf_ctx_arg_auxblist_flags_tmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotLPORT_ST_RESETis_preparedFC_RJT_OX_IDpgprotval_tmemorytrc_holdout_listELS_CSRasync_suspendq_nodezone_pgdatclass_mutex_intr_is_conditionalstrtabpage_freeftopdepends_onHPROBE_CONSUMEDi_mmapnr_cgrpsdirty_paused_whenirq_getrport_priv_size___GFP_COMP_BITcss_resetcapacitymax_channelfc_exch_recv_respversionlink_failure_countarch_atomic_dec__WQ_BH_ALLOWSget_reference_argsllisthiwater_vmmax_perf_statebi_idxSKB_DROP_REASON_IP_RPFILTERcookiesfreeze_ucountKOBJ_NS_TYPE_NETfc_seq_send_ackconsumers_cntInputBytesrseqattach_typetarget_knlimit0limit1pi_blocked_onpid_tac_exe_inodevmemmap_shiftbpf_attach_typeELS_FARP_REPLusage__kernel_time64_tSKB_DROP_REASON_IPV6DISABLEDrq_qos_mutexkernel_read_file_strscsi_data_bufferSKB_DROP_REASON_IP_LOCALNETcapabilitiesi_securitydevice_physical_location_panellimitsq_lock_cls_keyenvpactive_memcg__targetsElf64_Halfallow_reinitSKB_DROP_REASON_IP_OUTNOROUTEStimer_autosuspendsratelimitfc_exch_doneSHOST_DEL_test_bitslave_configurestat_threshold_softexpiresautosuspend_delayline_info_rec_size_zonerefsi_flctxFC_PORTSTATE_ONLINEli_invalid_crc_countlist_lockvm_faultELS_RJT_INPROGip_epilogueoptimistic_spin_queuepermissionSKB_DROP_REASON_IP_NOPROTObpf_prog_array_itemrec_cmdtransport_containerpreallocreap_refsystem_unbound_wqDEVICE_FIXEDlast_statusfdmi_enabledSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsslice_maxFC_RCTL_P_BSYIS_ERRmap_namebi_max_vecsthaw_noirqsched_debugfs_diraccounting_timestampserial_numbercan_matchtime_archFC_RJT_SEQ_XScmd_sizechunk_sectorshlist_bl_headqc_dqblkLPORT_ST_RFT_IDcalledpasid_activatedancestorsmap_fd_sys_lookup_elem__fortify_panicbvec_integrity_poolBPF_XDP_DEVMAP__UNIQUE_ID___addressable_fc_exch_init671arch_data_oldshrink_controlegidsupported_fc4sthreaded_csetsmax_rdonly_accessmap_direct_value_addr_SLAB_NO_USER_FLAGSnet_deviceenvp_idxcrypto_kobjectcdb_cmd___GFP_NO_OBJ_EXT_BITf_modetagged_supportedoffloadsvpd_pgb0vpd_pgb1vpd_pgb2ff_type_mapzone_idxfolioruntime_autopref_node_forklru_zone_sizeclassipc_namespaceBPF_SK_SKB_VERDICTarenaprev_scan_seqfc_dl_perfpsi_group_cpufr_seqhardirq_stack_inusewait_queue_head_talloc_hintELS_RJT_FIPtask_cputimeFAULT_FLAG_INSTRUCTIONdeferred_splituser_nsfc_cdbnohdrclass_raw_spinlock_irqsave_is_conditionalsyms_flagscgwb_release_mutexSKB_DROP_REASON_TCP_OLD_DATAleftSKB_DROP_REASON_TCP_MD5UNEXPECTEDFC_PORTTYPE_NPIVsyncmq_freeze_lockno_free_exch_xidsg_prot_tablesized_childrenucountELS_EXPL_SPP_ICTL_ERRmap_local_storage_unchargectl_table_sizebpf_map_opsfc_rport_identifierseh_host_reset_handlerrightddebug_class_map__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115__compiletime_assert_116__compiletime_assert_117dfl_cftypes__compiletime_assert_119prealloc_bufFC_TGTID_BIND_BY_IDaudit_contextfl_owner_tipi_listBPF_MAP_TYPE_DEVMAP_HASHpersistent_keyring_register__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126i_pipe__compiletime_assert_128__compiletime_assert_129hardware_versiond_waitllist_headsense_buffernr_phys_segmentstask_itersnode_spanned_pagesavg_refaultedFC_RCTL_ENCHwait_page_queuecn_credit_stallbpf_line_infoBPF_SK_MSG_VERDICTFAULT_FLAG_REMOTE__compiletime_assert_130dl_bw__compiletime_assert_132hierarchy_id__compiletime_assert_134__compiletime_assert_135__compiletime_assert_136unaccepted_pages__compiletime_assert_138i_dir_seqignore_dfheaderfc_exch_mgr_list_clonewatchdog_stamprefcount_setstate_startlist_op_pendingdatasrcu_cb_mutexsysfs_lockBPF_CGROUP_UNIX_CONNECTallowed_progsno_callbackssaved_trap_nrclock_listbpf_func_infofolioq_slotMODULE_STATE_GOINGxattr_handlerac_utimescaledrqos_debugfs_dirprot_sdbidr_baseunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_locknextentseventkeytypeMissDiscAdvCount__kernel_gid32_tevicteddev_pm_domainnentsstart_time_nsuaddr2f_securityprot_opvariable_test_bitdefparamFC_RJT_PROTOdiscard_granularity_SLAB_ACCOUNTSKB_DROP_REASON_TC_RECLASSIFY_LOOPiotmo_cntclass_raw_spinlock_irq_is_conditionalq_sizefr_sofFC_PORTSTATE_BLOCKED__bi_cntstate_remove_uevent_sentattributes_maskcloneddl_defer_runningnpiv_enabledlru_gen_mm_listqueuecommandevents_filetagged_writepagesia_validsrcu_SLAB_NO_OBJ_EXTlog_bufinstrument_atomic_writereq_flagsiorequest_cntsrcu_size_jiffiesclassesstatic_call_sitecputimeis_seenfc_exch_done_lockedupdated_nextfh_s_idsrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitmap_fdrchari_verity_info_addr_pkeyfpin_statsELS_TPRLOrw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countBPF_PROG_TYPE_XDPbpf_ksymSTARGET_RUNNINGFC_SOF_C4atomic_opennapi_idload_timefc_exch_timer_set__mptrsigactionrlimbtf_token_fdmce_addr__q_size_fieldf_freeptrSKB_DROP_REASON_TCP_OVERWINDOW__sighandler_tclass_spinlock_try_is_conditionalzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMESlrugenmax_target_blockedfs_flagsvm_filei_countuser_structmap_idaddress_space_operationsFC_BA_RJT_LOG_BUSYELS_LSTSFAULT_FLAG_USERkey_perm_tused_btf_cntbtf_log_bufeh_strategy_handlertimer_listverifier_zextmemory_eventscgwb_listrun_delayarch_atomic_setnum_ftrace_callsiteschange_queue_depthsrcu_cblistoffload_requestedblk_independent_access_rangeavg_write_bandwidthreca_rx_idtlb_ubcpgtables_bytesi_lrufirmware_versionfh_parm_offsetGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackFC_FID_MCAST_SERVtrc_ipi_to_cpuparm_offsetscsi_luncss_onlinePTR_TO_FUNCFC_RJT_VENDORmempool_alloc_noprofmemory_events_local__WQ_LEGACYallow_restartmin_sliceSKB_DROP_REASON_XFRM_POLICYSKB_DROP_REASON_IPV6_NDISC_BAD_CODEcommit_rqssysfs_opsinq_periph_qualcore_relo_cntFcpPktAborts_find_next_bitatomic_write_hw_unit_maxFC_SOF_I2cmaj_fltFC_SOF_I4bio_integrity_poolnf_tracekparam_arrayscheduleFORTIFY_FUNC_strscpyFC_RCTL_VFTHesb_statFcpFrameAllocFailspercpu_refevict_inodeignore_media_changertpoll_statesthread_keyringmap_nrcgroup_nslist_delcpumask_tfc_sof_classpcpu_hotrstat_css_noderb_leftreca_ofidRPORT_ST_DELETEgfp_maskdma_addr_tinactive_timerattributeinner_protocolinit_hctxperiod_timemm_lock_seqFORTIFY_FUNC_memchrELS_FANkernfs_elem_symlinkBLK_UID_T10FC_TGTID_BIND_NONEmin_xider_cmdwb_lcand_idFC_RCTL_DD_CMD_STATUS__kernel_dev_tcrypt_keyslotprog_namepm_domainBPF_CGROUP_INET4_BINDmax_rdwr_accessmax_prop_fracfsgidsector_tcompact_cached_migrate_pfnnode_name_sys_privatesignal_structactive_mmFC_SOF_N2FC_SOF_N3FC_SOF_N4kernfs_iattrsshow_devnamecn_oversubscriptionthread_infoi_mmap_writabledata_size_outattach_btf_obj_fdreca_cmdreadWORK_OFFQ_DISABLE_SHIFTr_a_tovnum_portsvalue_recsecondarydevicesatomic_write_max_sectorsgroup_exit_codetx_framesFORTIFY_FUNC_memcmpopc1REFCOUNT_SUB_UAFvalue_btf_idexec_maxsync_statedev_groupsuts_namespacefcloneDMA_FROM_DEVICEzone_start_pfnvalue_sizekernfs_elem_dirport_namepercpu_counter_printkDMA_BIDIRECTIONALcgroup_subsys_statesequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startELS_EXPL_SIDUTASK_RUNNINGopenseglenBPF_MAP_TYPE_QUEUEFORTIFY_FUNC_memcpy__kernel_ssize_tvdso_imagesi_signounused_hctx_lockatomic_readrseq_signpiv_vports_inuseresultrefsdelayed_calltime_slicefunc_info_rec_sizenr_rangemax_seqSKB_DROP_REASON_DEV_READY__UNIQUE_ID___addressable_fc_exch_mgr_free669spc_timelimituid_gid_mapnr_freeresumeset_ownershipELS_RNCWQ_CPU_INTENSIVEbpf_iter_task_typeFC_PORTSTATE_NOTPRESENTregsbi_write_hinterrorSKB_DROP_REASON_PKT_TOO_BIGfc_lport_recvrq_nextsyscall_user_dispatchshort_inquiryattrd_aliasis_suspendedseq_priv_sizerp_mutexdqio_semrestore_sigmaskrequeue_lockatomic_decSKB_DROP_REASON_CPU_BACKLOGkcsan_check_accessevent_worknr_deferredmem_cgroup_idsrcu_sspi_lockELS_NDACTuser_event_mmbtrace_seqs_devsiblingcdl_supportedia_rangetarget_sizemap_lookup_elemldt_usr_semrec_dataposix_cputimerslink_supported_speedstry_rc_10_firstRPM_INVALIDdd_datafreeze_kcountrequest_key_authblocksSKB_DROP_REASON_IPV6_NDISC_HOP_LIMITpercpu_ref_datad_spc_warnssrcu_supnbp_thresholdfreeptr_tLPORT_ST_DPRTns_typemempool_freeRPM_REQ_NONErrq_s_idprog_btf_fdforce_runtime_start_on_system_startsg_timeoutixoldevloss_work_qELS_LS_ACCfasyncarg_startLPORT_ST_DISABLEDkprobes_text_sizekfunc_tabELS_TPLSblk_crypto_profileSKB_DROP_REASON_SKB_GSO_SEGfop_flagswork_lockoptionrom_version_addr_lsb_addrpfn_mkwritentimedriver_versionELS_RJT_UNSUPuaddrrtpoll_waitBPF_STRUCT_OPSKMALLOC_DMAfunc_proto_unreliablefc_seq_exch_abortioerr_cnt_uidmm_statefc_ba_accs_fs_infomm_stats__rb_parent_colorWRITE_LIFE_EXTREMEicq_list__MAX_NR_ZONESmm_users_pp_mapping_padimagekey_serial_tno_uld_attachfolioqfolios_slab_flag_bitsshost_groupssiblingscputimernrpageswake_q_nodeFC_PORTTYPE_NOTPRESENTblk_flags_tmap_fd_put_ptrs_maxbyteshd_geometryioctx_tabledma_io_tlb_memfc_cmdrefKMALLOC_CGROUPeh_cmd_qfc_seq_set_respfree_after_rcu_gpget_unique_idkasan_check_readNR_KMALLOC_TYPESexpire_countcompact_init_migrate_pfnfor_syncwake_cpujited_lenPTR_TO_SOCKETlinfobio_split___GFP_DMA_BITfreeze_superELS_RSItick_dep_maskFC_BA_RJT_LOG_ERRcall_depthvmpressurelruvecmap_check_btfiter_infoqc_infoobjcg_listfault_flaglist_is_headmodnameia_ctimeFC_VPORT_NO_FABRIC_RSCStrace_eval_mapcompact_defer_shiftorig_objcgrespasync_put_workresvnum_static_call_sitesZONE_MOVABLEl4_hashvm_lock_seqFORTIFY_FUNC_strncatroot_listBPF_TRACE_FENTRYElf64_Addrwait_queue_entry_tseqlock_tlatency_record_countnr_integrity_segmentshost_blockedmay_skip_resumeprot_flagsVTIME_SYSalloc_tag_countersbase0base1base2SHOST_CREATEDbio_setfh_seq_idCONST_PTR_TO_DYNPTRBPF_MAP_TYPE_RINGBUFalignment_offsetlinksbasesfutex_staterseq_lenkobj_completionlesb_inv_wordi_spc_timelimitf_opnargsbindcpuhp_onlineproc_ns_operationsold_prog_fdnum_discovered_portsBPF_PROG_TYPE_SK_REUSEPORTmm_mtgid_trelease_workSDEV_CREATEDavg_nr_triggersno_report_opcodesELS_RSCNBPF_PROG_TYPE_LWT_OUTrcu_read_unlock_specialBPF_CGROUP_UNIX_RECVMSGtls_arrayipvs_propertyELS_EXPL_UNSUPRfr_eoftask_io_accountingcss_rstat_flushf_raDEVICE_PANEL_FRONTmodule_memorynetkitsitescompat_robust_list_headcss_releasedthread_nodestatic_call_mods_shrinkgp_countRxWordsnr_sectorsbpf_raw_eventsiommutimer_expires__UNIQUE_ID___addressable_fc_exch_mgr_alloc668bpf_storagekset_uevent_opsf_ownerqfull__state_permDEVICE_PANEL_BACKELS_RJT_INVALmax_retry_countoffsetswb_switch_rwsemdisc_syscalldiskSHOST_DEL_RECOVERYjit_requestedsrcu_lock_counttrc_blkd_cpugp_wait__compiletime_assert_131WORK_OFFQ_FLAG_ENDiommu_mmfuncSKB_DROP_REASON_TCP_OFOMERGEio_uring_task__WQ_DRAININGshared_tagsrepeatjit_keyringLinkFailureCounts_fsnotify_infofunctionlinkagedisc_recv_reqraw_atomic_decBPF_PROG_TYPE_CGROUP_SOCK_ADDRprojidmce_kill_mema_external_lockWORK_OFFQ_FLAG_BITSpid_linkskfree_skb_reasonconv_zones_bitmapscsi_target_ids_dio_done_wqRPORT_EV_FAILEDfor_kupdaternid_ip_verstart_all_reasonsystem_wqhlist_head_pad3_ioc_nodethrottle_diskELS_FDISCbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACErunningrw_hintblk_integrity_checksumdestroy_rworkdma_skip_syncpartition_meta_infotstamp_type_accessDEVICE_VERT_POS_LOWERBPF_CGROUP_ITER_ANCESTORS_UPnr_dying_subsysfc_well_known_fidclass_spinlock_irqsave_is_conditionalutf8datahlist_nulls_headrequeue_workof_node_reuseddyndbg_infoFORTIFY_FUNC_strncpyfc_seq_els_rsp_sendElf64_Symreclaim_waitsaved_errd_rt_spc_softlimitpollsk_skb_reason_dropfree_file_infoin_lru_faultsched_contributes_to_loadtlb_genruntime_idlemap_countspin_unlock_bhhost_scribblei_rt_spc_timelimitqc_type_states_dentry_lruac_comms_bdevskip_vpd_pagescrcssense_lenrun_listuevent_opsabort_workmax_cmd_lenfc_exch_workqueuebpf_func_statebpf_reg_typesched_classret_sizeutil_avganon_vmaFC_VPORT_LINKDOWN__UNIQUE_ID___addressable_fc_seq_start_next656device_private_offset_pidsigcntuse_freeptr_offsetDD_CLASS_TYPE_LEVEL_NAMEShas_callchain_bufELS_EVFPtailcall_target_stablebpf_cgrp_storagemodinfo_attrsst_spaceclass_map_typekparam_stringd_real_typemaxrsspoolcredBPF_MAP_TYPE_ARRAYkernfs_open_nodef_wb_errmm_cid_activeSKB_DROP_REASON_VXLAN_ENTRY_EXISTSkzalloc_noprofWQ_MEM_RECLAIMdecryptedmodule_sect_attrsreq_flags_truntime_resumeac_stimescaledunlockgroup_exec_taskrestrict_linkirq_countget_inode_usagekmalloc_typeFC_TYPE_IPxarray_startbpf_ctxpm_domain_dataserver_pick_taskbw_dworkattach_btfmap_lookup_and_delete_elem__p_size_fieldload_avgrecordi_private_lockget_dqblktail_callFC_RJT_CS_CTLmq_listrnid_phys_portphysical_block_sizepgoffportnetdevBPF_LIST_NODEba_seq_id_valdefault_setmodelfreeze_latemf_statsZONE_NORMAL__list_del_entrycount_objectsvma_numab_statedma_map_opsdq_dirtyREFCOUNT_ADD_NOT_ZERO_OVFlnodemax_lunexit_cmd_privkasan_check_writefd_typeatomic_write_boundary_sectorsboot_timewpcopy_countmax_queue_depthwrite_bytesSKB_DROP_REASON_SOCKET_BACKLOGeh_entryDISC_EV_FAILEDpending_eventsoom_reaper_listnumab_statefutex_offsetbpf_fdsubsys_fmt_prefixdq_lockintegritypte_tnr_scannedSKB_DROP_REASON_TCP_ACK_UNSENT_DATA__stateBPF_MAP_TYPE_UNSPECnr_iosk_listn_io_portslicecgroupdrv_groupstrack_queue_depthtruesizecustom_slicenext_target_idper_cpu_pagesstart_idbdi_listmq_freeze_depthpadding1_SLAB_TRACEnestedatomic_write_segments_maxinsn_cntmap_set_for_each_callback_argsnr_dirtied_pausequeue_kobjdst_progreal_addressbd_holder_dirac_tgidinvalidate_lock__UNIQUE_ID___addressable_fc_seq_send655num_exentriesfcp_cmd_sendfix_capacitycss_local_stat_showio_portvport_last_stateblk_mode_tpmdval_tSKB_DROP_REASON_NEIGH_FAILEDhost_tagsetBPF_GRAPH_NODEkveceh_noresumefree_areaset_latency_tolerancedepthd_ino_timerprobenetlink_nsnr_argstokenSKB_DROP_REASON_TCP_CSUMdev_ueventELS_RJT_NONEfc_vportdep_mappage_mkwritelast_busyvm_flags_toffloadnregnr_failed_migrations_affinelro_enabledd_in_lookup_hashdom_csetptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLER_SLAB_KMALLOCreschedule_countmax_hang_timeFC_PORTSTATE_UNKNOWNcmd_per_lunopt_failedcdl_enablecutimelockrefELS_RLIRnew_map_fdmap_meta_equaltlb_flush_batcheddev_priv___GFP_HIGH_BITia_uidautogroupsequencercu_syncarg_endclass_spinlock_irq_is_conditional_dummy_pkeyvruntimehostdataBPF_CGROUP_ITER_DESCENDANTS_POSTscanned___GFP_HARDWALL_BITSCALAR_VALUEnr_extentsstart_stop_pwr_condpidlistsWB_REASON_VMSCANfeatures_locked__kernel_pid_tdev_statedevice_blockedfile_flagsPIDTYPE_SIDconst_pcpu_hotcinblockdma_alignmentprot_typeBPF_TCX_INGRESS__kernel_loff_tset_performance_stateserial_nodeELS_EXPL_AH_REQlru_gen_mm_statenotify_countsrc_regupdated_childrenactive_fc4sspin_lock_offBPF_CGROUP_SYSCTLsingle_lunhprobesg_reserved_sizeswap_activatedqb_isoftlimitsaved_auxvnoinstr_text_sizeELS_SBRPdl_overrunfc_no_free_exchiattrdetachedbootbios_versionloff_toom_flag_originfreepages_delay_totaldesc_lendma_devSKB_DROP_REASON_NETFILTER_DROPoom_score_adjwb_waitqSHOST_RECOVERYrq_end_io_fnksm_merging_pagestest_runDISC_EV_SUCCESSSKB_DROP_REASON_TC_COOKIE_ERRORgraph_parse_endpointrmidptp_rdataoxidFC_RCTL_P_RJTsoftirq_pendingfc_exch_recvlist_lrudevice_removablefc_seq_not_foundfxsavedev_pagemap_opsbv_offsetBPF_MAP_TYPE_XSKMAPset_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETd_lockrefbtf_typenr_populated_domain_childrenSCSI_EH_DONEsession_keyringseeksshost_devbtf_log_true_sized_deleteuts_nsd_ino_softlimitd_weak_revalidateraw_atomic_setalloc_time_nsi_devicesSKB_DROP_REASON_NEIGH_CREATEFAILfc_exch_rctl_namesFC_PORTSTATE_ERRORdqb_curspaceSKB_DROP_REASON_XDPSKB_DROP_REASON_NO_SOCKETBPF_TRACE_KPROBE_SESSIONELS_FDACDTalloc_lockearly_inittotal_numa_faultswritable_sizemax_segmentsdma_need_drainobj_cgroupem_tableBPF_PROG_TYPE_TRACINGmq_sysfs_init_doneactive_queuescompact_consideredfc_debug_logging__lstatepercpu_drift_mark__BPF_REG_TYPE_MAXkmem_cache_argsinodesubtree_bstatbd_fsfreeze_mutexhrtimeratomic_write_unit_maxFAULT_FLAG_UNSHARELossOfSignalCountlocal_fwnodetask_sizemust_resumefc_seq_assignRPM_ACTIVEend_codePTR_TO_SOCK_COMMON_OR_NULLuintnr_free_highatomicpreempt_notifierstlb_flush_pendingmigration_flagsDEVICE_PANEL_RIGHTfast_io_fail_tmomap_poke_untracktx_wordscap_inheritablebpf_cgroup_iter_orderkobj_sigvaleh_timeout__stack_chk_failwritecntBPF_KPTR_PERCPUsrcu_n_exp_nodelayin_batchseqcount_spinlock_textra1extra2write_s64graph_get_remote_endpoints_rootstree_scanned__int128 unsignedverifiedcpu_countcgroup_rstat_cpuevent_callbackwb_lcand_byteswait_sumuprobe_xol_opssg_suppmin_align_masknextevt__UNIQUE_ID___addressable_fc_exch_done658this_idrcu_segcblistread_s64reported_split_lockreturn_instancewait_countconfirm_switchnr_wakeups_affine_attemptspud_ti_ino_warnlimitmax_open_zonesrmtpnext_offsetFC_PORTTYPE_LPORTio_statuslp_mutexSKB_DROP_REASON_FRAG_REASM_TIMEOUTblindedacpi_device_iddev_scratchctx_idutaskpoweroff_noirqactive_modesdev_datais_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexrec_resvdauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangsSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYFC_RJT_FAB_CLASScss_setfwnode_handleELS_EXPL_NOT_NEIGHBORgfp_ttype__vpp_verifyqf_fmt_idlink_updatepagepageset_high_maxatomic_write_unit_minsleep_startmap_mem_usagememalloc_noiobegintypetabuse_192_bytes_for_3fnr_reserved_tagsBPF_PROG_TYPE_RAW_TRACEPOINT_WRITABLEi_crypt_infoFC_TYPE_NVMEretry_workseq_not_foundDEVICE_HORI_POS_CENTERio_start_time_nsaudit_ttyrecov_retrybatch_sizedns_rdatanr_zonesrejectjobctlsi_errnonr_leaves_on_treequeue_ctxmin_shallow_depthfc_seq_sigchlddqb_itimeHPROBE_STABLEquota_format_type__ret_condbio_crypt_ctxpercpu_ref_func_t_SLAB_TYPESAFE_BY_RCUpm_message_tFC_RJT_LOGI_REQsplit_queueac_memBPF_CGROUP_INET4_POST_BINDpprevlip_countino_warnlimitremcsum_offloadexception_boundarybroken_fuabpf_iter_seq_infozone_wplugs_lockmnt_flagsac_stimemem_cgroup_reclaim_iterrange_endlast_mergememcg_nr_pages_over_highsw_reservedbpf_tokenwbt_flagsbpf_iter_fini_seq_priv_tcss_freecpu_delay_totalobjcgfh_r_ctlno_read_disc_infoblock_startvm_area_structnum_gpl_symsselect_no_atn__compiletime_assert_0__compiletime_assert_1__compiletime_assert_2__compiletime_assert_3SKB_DROP_REASON_TCP_INVALID_SEQUENCEBPF_CGROUP_INET6_GETPEERNAMEis_extendednr_charged_byteslong long unsigned intWRITE_LIFE_MEDIUMBPF_MAP_TYPE_CGRP_STORAGEtmf_in_progressnext_addrSDEV_CREATED_BLOCKhuge_faultRPORT_ST_READYi_fopautasklast_task_numa_placementfc_els_ls_rjtfortify_memcpy_chkSKB_DROP_REASON_IP_INADDRERRORSrnid_prot_portip_after_callrefcntfreeze_holderpsi_groupcdevperf_eventSKB_DROP_REASON_VXLAN_VNI_NOT_FOUNDELS_RJT_LOGICunregfuncoom_group_SLAB_STORE_USERseqcountBPF_XDP_CPUMAPclass_idbitsetWORK_STRUCT_LINKED_BITallowed_cmdsbtf_field_typeinquiry_mutexcan_swapof_device_iddisk_statsmanage_runtime_start_stopclass_migrate_is_conditionalnetwork_headermin_ratioclass_write_lock_is_conditionals_xattrpart__pkt_type_offsetb_dirty_timeli_loss_of_sync_countBLK_EH_RESET_TIMERil_prevPTR_TO_SOCK_COMMONd_initatomic_incget_name_prefixused_mapsspan_seqlockfc_soffileattr_get__kmalloc_noprofthreaded_csets_nodeclass_groupsSDEV_TRANSPORT_OFFLINE__ret_warn_on__call_single_nodeunicode_mappathhigh_maxrstat_cpuSKB_DROP_REASON_DEV_HDRpreempt_countrecent_used_cpuruntimeold_time32_t_SLAB_CACHE_DMA32socket_pressurespinlock_checkenforce_expected_attach_type__state_sizeBPF_CGROUP_INET6_GETSOCKNAMEvportsfc_ba_rjt_reasonunsigned intsbitmapclass_irqsave_is_conditionalcore_kallsymshas_recFC_BA_RJT_EXP_NONEscsi_deviceSKB_DROP_REASON_IPV6_NDISC_BAD_OPTIONSs_fsnotify_maskscan_objectsbi_privatewb_idDD_CLASS_TYPE_DISJOINT_BITSevent_liststartupkeyring_index_keyiov_iterd_rcustatic_key_false___GFP_DIRECT_RECLAIM_BITuintptr_twake_entryrcu_tasks_holdoutfreezefprop_globalassoc_array_ptrbatchcacheskip_respBPF_TRACE_RAW_TPreca_fc4valueold_timespec32rcu_blocked_nodejiffies_at_allocfunc_idxfcp_frame_alloc_failuressubsys_datast_namegroup_nodei_mtime_secbus_dma_regionrp_statefh_rx_idSKB_DROP_REASON_TCP_OLD_ACKstatic_rqsstarget_sdev_userac_majfltdn_device_specificmce_kflags___GFP_NORETRY_BITFORTIFY_FUNC_memsetba_low_seq_cntscheduledbus_dma_limitubufbtimefc_sof_is_initSKB_DROP_REASON_QUEUE_PURGEia_gidmigrate_foliohigh_minrq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrnext_posix_timer_id__UNIQUE_ID___addressable_fc_exch_recv670mq_ops_mapcounti_atime_secstarttimefile_costreschedule_jiffies__list_delWORK_BUSY_RUNNINGhprobe_statei_sb_listquota_offmap_poke_runmap_delete_batchshm_clistmap_delete_elemwait_for_compcb_headarch_atomic_incpages_skippedzone_wplugs_hash_bitspi_offsetac_flagfh_df_ctlpt_regsmmap_missexpires_nextblk_opf_tSKB_DROP_REASON_IP_INVALID_DESTreport_zoneskeyring_name_list___GFP_ZERO_BITnum_trace_bprintk_fmtiter_seq_infoSKB_DROP_REASON_TCP_AOKEYNOTFOUNDcdrom_device_infolruvec_stats_percpuaccess_statela_resvbpf_prog_statssdev_gendevwork_structtruelast_queuedreverseSKB_DROP_REASON_VXLAN_NO_REMOTEri_timernr_populated_threaded_childrenex_refcntpipe_bufsavg_last_updatebp_offsetkmalloc_cache_typeswap_events_filefc_frame_freeprotectedbsyncrequestedsaved_scratch_registertracepoints_ptrsfcp_cleanupwifi_acked_validblock_maxstatic_keyqueue_rqsdev_boundlibfc_function_templatecsum_validFAULT_FLAG_VMA_LOCKtotalreserve_pageskswapd_order__UNIQUE_ID___addressable_fc_exch_mgr_add665dma_range_mapvaluesKOBJ_NS_TYPE_NONEctl_table_pollfc_els_rjt_explanmin_slab_pages_dataFAULT_FLAG_WRITEshow_optionswait_queue_entryexpirei_uidtagset_freedmax_sectorsexpiryfc_frame_payload_opperiodbmaprescue_workqueuerx_wordsmap_allocdispatch_wait_lockfc_exch_timer_set_lockedscsi_levelfsaveBPF_TRACE_UPROBE_SESSIONi_write_hintels_datasuspended_timeread_byteszone_wplugs_worksum_sched_runtimes_writers_keySYSCTL_TABLE_TYPE_DEFAULTbpf_callback_tRPORT_EV_READYstart_boottimetimer_offentriesi_modecap_permittedfc_rport_priv_flags_2aslab_flags_tfcoe_rcv_infoBLK_UID_NAAstart_coderet_flagsvm_flagststamp_typesi_codeseqcount_spinlockBPF_PERF_EVENTheadHPROBE_GONElast_siginfosched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorsdworkdevice_dma_parametersdir_contextsaved_dst_attach_typeiopl_emulconsumersratelimit_statepower_statedq_flagsis_late_suspendedfieldsswap_plugcapture_controlPTR_TO_MAP_VALUE_OR_NULLraw_atomic_fetch_sub_releaseoffline_nodequeue_offsetclass_device_is_conditionalnon_rcuput_superwrite_endshostbpf_exception_cbxdp_has_fragsdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_statctx_arg_info_size__kmalloc_large_noprofddp_setupba_seq_idjitedopen_flagslegacy_namemap_lookup_percpu_elemfc_frame_payload_getFAULT_FLAG_INTERRUPTIBLEFC_RJT_LENmap_token_fds_inodes_wbvport_delete_worksubsysfolio_queueFC_RJT_PARAMdurationba_high_seq_cntinner_transport_headerinit_fs_contextuprobe_taskELS_RPBCf_mappingconstant_test_bitFcpPktAllocFails__UNIQUE_ID___addressable_fc_seq_set_resp657tailcall_bypassstart_stackBPF_MAP_TYPE_STRUCT_OPSprog_array_member_cntfh_ox_idDL_DEV_PROBINGi_linkWB_REASON_MAXfc_frame_alloce_statstack_vm_areatgtid_bind_typefc_lund_hashBPF_SPIN_LOCKdl_server_pick_frefcount_dec_and_testtty_old_pgrpst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquotaorc_entrydma_drain_len__MAX_BPF_ATTACH_TYPESCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listutimemmapshrinkerorig_idalloc_dquotbw_time_stampmappingdl_defer_armedfc_ns_ftsmap_pollrunnable_sumatomic_fetch_sub_releasecpu_scaled_run_real_totalshort unsigned inteventsFC_BA_RJT_ABTget_rq_budget_tokenqueue_ramp_up_perioddevice_nodemm_walkgpl_compatiblefc_gpn_ft_resprequeue_listlocal_portFC_PORTSTATE_DIAGNOSTICSp_size_fieldpkt_typelong long intsym_vvar_start_hugetlb_cgroup_rsvdSKB_DROP_REASON_ARP_PVLAN_DISABLEsival_ptrproc_namepercpu_sizefc_vport_stateFC_PORTTYPE_UNKNOWNBPF_TASK_ITER_ALL__wsuminvalidate_foliois_vallocdrop_nsNOT_INITELS_RJT_VENDORWORK_STRUCT_INACTIVE_BITnr_queuesgenerationno_pm_callbackscountELS_RJT_PROTddp_targetd_parentpagessched_task_group__compiletime_assert_326BPF_TIMERupdate_timetc_skip_classifymemcg_idpidsof_noderun_nodedata_sourcesubmit_bio___GFP_UNUSED_BITs_instancesvm_rcubd_start_sectctl_nodepage_table_locksysv_semquota_infoquota_enable__kernel_timer_twork_listresp_activeBPF_MAP_TYPE_PROG_ARRAYPTR_TO_PACKETdomain_tagmax_integrity_segmentscmaxrssit_real_incrprobestubextable_lenlast_arrivalwake_index_watermarkSKB_DROP_REASON_SOCKET_FILTERswap_rwreservemap_extrasplit_queue_lockFC_RCTL_DD_SOL_DATAseq_idevents_local_filesrcu_gp_seq_needed_expDEVICE_HORI_POS_RIGHTSKB_DROP_REASON_HDR_TRUNCSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOia_mtimenr_thpsla_cmdlegacy_cftypesrnid_vend_specsysv_shmfopssuppress_bind_attrsinsnlen__page_1__page_2WORK_CPU_UNBOUNDi_mutex_keykey_restrictionstatquota_writedomainget_linkFC_PORTTYPE_NLPORTmax_depthctl_table_argdata_lenpriv_stack_ptr___GFP_NOFAIL_BITblkcg_nodeforksa_flagsno_start_on_addcancelled_write_bytesdispatch_busyfcp_packet_alloc_failuresnbp_rl_startFC_RCTL_ACK_0task_worksFC_BA_RJT_PROTO_ERRmm_cidatomic_write_hw_maxdfl_cgrp_ddebug_infoaddrsshrinker_info_unitstats_locknum_kpfc_fill_fc_hdrSTARGET_CREATED_REMOVEshost_gendevcsumMEMORY_DEVICE_PRIVATE__bd_flagsfc_eofsuper_blockbi_bvec_donemap_get_unmapped_areabus_typeget_named_child_nodeBPF_MAP_TYPE_PERCPU_CGROUP_STORAGE_DEPRECATEDassoc_arrayfc_exch_mgr_freeactorBPF_CGROUP_ITER_DESCENDANTS_PREfls64bpf_offload_devkobj_ns_typedeferred_resumesched_shared_tagsfp_wwpnlong intfc_seq_send_lockedcore_nodebdi_nodecn_device_specifictarget_btf_idmem_dqinfodevnodesaved_sigmaskac_uidBLK_UID_EUI64FC_TGTID_BIND_BY_WWNNMEMORY_DEVICE_PCI_P2PDMAac_nicedq_offpinsblkcg_mutexis_visiblecgrp_linksdisk_nameuuid_tfc_exch_name_lookup__kernel_clockid_twritabledqb_bsoftlimit__fc_fill_fc_hdrvfork_donetask_cputime_atomicki_waitqra_pagesgroupmmap_compat_legacy_basedevice_dma_supportedsysfs_dir_lockscsi_cmnd_submitterFC_TGTID_BIND_BY_WWPNignored_posix_timerslockedsival_intia_filecancel_attachio_pagesSKB_DROP_REASON_TC_EGRESSwakeup_cntrequest_pending_raw_spin_unlock_bhFC_BA_RJT_NONEdl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsfabric_nameclass_read_lock_irqsave_is_conditionalfc_els_rjt_reasonfc_exch_mgr_allocblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startavg_triggersctl_dirFC_PORTTYPE_PTProbust_list_headunsigned charwake_qrange_startrethookspermanent_port_namenuma_scan_periodelem_countnr_tagssda_is_staticwakeup_pathresult_maskFORTIFY_FUNC_memscanscsi_timeout_actionei_funcs__func__pfo_val__BPF_NETFILTERtablesRPORT_ST_PLOGI_WAITpipe_inode_inforaw_spinlockmemcg_cgwb_frnblkio_delay_totalinstrument_atomic_readktypebpf_attrBPF_PROG_TYPE_CGROUP_SYSCTLhost_sizemigration_disabledSKB_DROP_REASON_FRAG_TOO_FARsystem_hostnameext_mutexfr_fspRPM_REQ_SUSPENDFC_RJT_P_UNAV_SLAB_FLAGS_LAST_BITpgprot_ttracepoint_ptr_tfor_reclaim_skb_refdstphysical_locationELS_PDISCchildren_low_usagenum_vfPIDTYPE_MAXbi_sizemg_dst_csetvlan_protothrashing_countwatcherscrypt_ctx__kmem_cache_createstopwait_maxclass_write_lock_irqsave_is_conditionalioveca_flagsiomapd_dnameScsi_Hostnr_migrations_coldbtf_value_type_idmnt_idmap___GFP_FS_BITWORK_OFFQ_LEFTnr_cpu_idsquotactl_opski_iopriovport_typesched_remote_wakeuptag_alloc_policysock_filterBPF_LIRC_MODE2tracing_graph_pauseread_iternon_bls_respsuspend_latefront_padFC_TYPE_CTsdev_devmaxframe_sizerecoveredfc_seq_start_nexti_rwsembi_integrityexitio_uringeh_device_reset_handlerchild_ns_typeorderslave_bdevscommit_dqblkclass_local_lock_irqsave_is_conditionalmark_dirtyFC_PORTSTATE_OFFLINEnr_ctxkernfs_opsnr_dying_descendantsoom_reaper_timermodulewb_bytesbd_securitynodeinfoqueue_lockfc_cpu_orderf_pathstatic_call_siteself64_symunlinkmap_queuescpumask_var_trefcount_warn_saturatetime64_tdrivers_diri_gidtype_idFORTIFY_FUNC_strnlenrq_qosmark_deadREFCOUNT_DEC_LEAKicq_hintrmdirdq_dqbaborted_epspeedmemory_failureblkcg_gqdma_flagsbtf_field_kptrSUBMITTED_BY_BLOCK_LAYERskb_trimmax_hw_sectorsselectors_mtdmod_kallsymss_typefield_maskjits_use_priv_stackprog_bind_mapli_failure_unknownfini_seq_privateremount_fsbd_holdernext_idtask_delay_infopi_sejit_datarelative_fdin_useforwardrq_countMIGRATE_SYNC_LIGHTerrseq_tms_rdatakstatfslruvec_statsreclaimedmems_allowed_seqmax_user_discard_sectorsinsnsitarget_allocbug_listBPF_CGROUP_INET4_CONNECTmax_nr_cidmod_arch_specificDMA_NONEtransfersizepp_recyclesplit_queue_lensharearch_atomic_dec_and_testbpf_net_contextprobe_addrno_cgroup_ownerSKB_DROP_REASON_DUP_FRAGcleanupdisc_stopftrace_timestampbi_iopriobypass_addrd_ino_warnsstack_depthkernfs_elem_attrBPF_PROG_TYPE_SK_SKBi_ctime_nsecrelative_idrbnodei_private_listbinfmtftrace_sleeptimedata_size_inBPF_CGROUP_ITER_ORDER_UNSPECi_statebv_pagedestructorpcpu_cidsupported_speedssched_migratedZONE_DMA32FC_TYPE_ILScgroup_tasksetdup_xol_addrdevice_configurePROBE_PREFER_ASYNCHRONOUSrcu_node_entryreverse_orderingBPF_MAP_TYPE_BLOOM_FILTERcgroup_bpffile_system_typeorig_ret_vaddrelsct_sendbtf_log_levelELS_RCSmmu_notifier_subscriptionsswap_iocbfc_invoke_respBPF_RB_ROOTdefault_groups__sifieldsb_iofc_exch_update_statsnr_watchesfind_special_pageDL_DEV_DRIVER_BOUNDELS_EXPL_SPP_OPT_ERRadj_offcurr_ret_depthpool_sizestarved_entryfc_flags__fillerdestroy_dquot__task_fpstatefilldir_tSKB_DROP_REASON_TCP_AOFAILUREget_reserved_spaceioprioKMALLOC_NORMALFC_RJT_FAB_UNAVunreliablecreateBPF_PROG_TYPE_SCHED_ACTdirtied_time_whenstart_scan_seqFC_RJT_VC_IDautoremove_wake_functionperf_rdpmc_allowedmin_seqfc_rctlsym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerSKB_DROP_REASON_QDISC_DROPbd_openersdq_inuseofflinedev_pm_infomremaptime_nsin_memstallhost_self_blockednode_size_lockcss_extra_stat_showkptrpoweroff_latei_nlinkwakeupcb_list___GFP_IO_BITcpu_iditer_info_lenpushable_tasksraw_atomic_readtty_audit_buffc_quarantine_exchkref_putmaxlenkernel_cap_t__be16bpf_funcpoke_tabmems_alloweds_inode_lrucached_rqse_cset_noderecov_seqSKB_DROP_REASON_SKB_CSUMkf_rootmmap_compat_baseretvalpreparenr_threaded_childrenclock_op_might_sleepf_sb_errneed_mbd_namecheck_flagsi_sequencert_prioritykretprobe_instancescrypto_profile__be32token_createiov_basecpus_ptrq_lockdep_mapb_more_ioload__kmem_cache_create_argsfuncscpu_bitmapfc_ba_rjt_explanSTARGET_DELatomic_write_lensaved_tfmempool_create_node_noprofxa_headdetachprog_ifindexmm_listSKB_DROP_REASON_NOMEMproperty_read_string_arrayget_statefc_fcp_ddp_donetracepoint_funcd_seqnuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmt__be64blkg_listnum_symtabexec_update_lockfscrypt_inode_infosplice_readSKB_DROP_REASON_SOCKET_RCVBUFFBPF_PROG_TYPE_SOCKET_FILTER_SLAB_RECLAIM_ACCOUNTSKB_DROP_REASON_TCP_RFC7323_PAWSSKB_DROP_REASON_MAC_INVALID_SOURCEFC_FID_TIME_SERVneed_qsctx_mapFC_VPORT_UNKNOWNbd_diskuid_gid_extentnumberszone_wplugs_wqWRITE_LIFE_SHORTsigpendingpi_entryBPF_MAP_TYPE_ARENAs_inodesdirtied_whenmap_direct_value_metaMIGRATE_ASYNCBPF_MAP_TYPE_PERCPU_CGROUP_STORAGEnext_scangsindexwrite_bandwidthcompletewatch_listli_prim_seq_err_counteh_abort_listBPF_CGROUP_UDP4_RECVMSGfc_exch_mgr_addd_sibsleepable_refcntmodule_attributemax_host_blockedneed_tsin_dpm_listwordwork__list_add_valid_or_reportmultiprocessquiesce_depthfbatchclass_task_lock_is_conditionalBPF_CGROUP_INET_INGRESStask_groupfc_destroy_exch_mgrf_pos_lockfc_exch_send_ba_rjtperiod_timerBPF_FLOW_DISSECTORfillsk_buff_data_texpected_revisionbio_pooltimeout_workBPF_PROG_TYPE_LWT_XMITmac_lensrcu_barrier_completionBPF_MAP_TYPE_STACK_TRACEpacctblk_mq_tag_setSKB_DROP_REASON_TUNNEL_TXINFOcurr_targetFC_RJT_CLS_UNSUPvm_page_protbalanced_dirty_ratelimitbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatPTR_TO_PACKET_ENDperf_event_contextatomic64_tnoinstr_text_startctx_size_outddp_doneba_rx_idac_btime64HRTIMER_RESTARTrpm_autosuspend_delayac_gidELS_LINITnotify_timercorememfh_d_idBPF_MAP_TYPE_USER_RINGBUFLPORT_ST_LOGObusystack_canaryuser_keyring_registermax_write_zeroes_sectors_utimedn_unable_to_routetmf_work_q__fortify_size_flags_1_flags_2FC_TYPE_BLS__ptrtaskstatsport_stateproactive_compact_triggerELS_FLOGIposix_acli_dio_countarch_rwlock_tdriversym_timens_pagerport_event_callbackcpumask_test_cpuprog_token_fdsysctlsoffsetrtpoll_taskprot_guard_typedev_iommuWB_REASON_SYNCmap_typeclass_rwsem_read_intr_is_conditional__cpu_possible_maskcompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_userslog_sizeSDEV_BLOCKbacking_dev_infoi_mappingheadersdiscard_alignmentbsg_deviceshow_statsnr_populated_csets_resbr_reasons_vfs_rename_keyfc_seq_send_lastsubmitteretypekfree_skbi_bytes___GFP_WRITE_BITnormal_prioFC_BA_RJT_UNABLEWQ_UNBOUNDblkio_countshost_datadispatch_waitBPF_MAP_TYPE_INODE_STORAGEsrcu_nodelast_mm_ciddelayedhdr_lenper_cpu_nodestats__refcount_addSKB_DROP_REASON_TC_CHAIN_NOTFOUNDvaddrscsi_vpdis_softnext_cpugrab_current_nsclass_namesdisc_worknr_taskslock_class_keypriv_stack_requestedsum_exec_runtimememory_failure_statssetupdev_pin_infoFC_RJT_MCAST_ERRlesb_sync_losspoll_table_structmce_whole_pageELS_QOSRia_modercu_tasks_holdout_listprepare_to_waitsched_rt_mutexs_pinsfc_exch_abort_lockedswap_peaksnon_seqbpf_prog_arrayattach_func_protoSKB_DROP_REASON_IP_CSUMpresent_pageshctx_listfc_vport_id_lookuprenamecontiguousthrashing_delay_totalmajorktime_tonstackFC_RJT_R_CTLPRJQUOTAlink_idzswap_lruvec_stateBPF_CGROUP_INET_SOCK_RELEASEkprobe_blacklistjump_entriesdio_offset_align__UNIQUE_ID___addressable_fc_seq_els_rsp_send659ELS_LKAreserved_tagsdma_masksa_restorerqueuelistdatalenmkdirnextrelax_countrestore_earlyPIDTYPE_TGIDilencpu_run_virtual_totalmax_active_zonesdevice_physical_location_horizontal_position_SLAB_CACHE_DMAattach_flagskfunc_btf_tabkmem_cache_destroy__list_addrportkobj_uevent_env___GFP_MOVABLE_BITkprobes_text_startkref_initpid_typefc_frame_classfown_structxid_busyi_default_aclBPF_PROG_TYPE_LIRC_MODE2fregs_statemap_flagsBPF_PROG_TYPE_LSMzonerefshift__devicesFORTIFY_FUNC_strcpypendingfc_exch_set_addrfc_classfc_find_emaBPF_MAP_TYPE_PERCPU_ARRAYdma_boundarybd_nr_sectorsnr_eventssdev_statekmemcg_idkstatanon_vma_namedq_hashFC_RJT_UNEXP_ACK__iovgp_stategrphiFC_RCTL_ELS_REQntabiommu_mm_datamap_for_each_callbackinvalid_crc_countnr_disk_swapinszone_wplugs_err_listma_flagsarch_uprobebio_issueSKB_DROP_REASON_IPV6_NDISC_NS_OTHERHOSTDL_DEV_UNBINDINGcurrent_taskKMALLOC_RANDOM_ENDrefcountmmap_lockuprobe_multidevice_sizeLPORT_ST_RFF_IDzonelistsrcu_reader_flavorbtf_fddumped_framespeerstimerqueue_nodeELS_FARP_REQreal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_alloweduse_16_for_syncrt_mutex_waitermem_cgroup_per_nodekcompactdba_ox_id_pad_page_pooldq_dqb_lockctorf_flagsblk_qc_tshow_infoinner_map_fdslave_allocFC_RJT_DF_CTLflush_requiredWB_REASON_FS_FREE_SPACEsg_tablememcg_vmstatskeyring_semattributesblk_queue_statsgrplomax_rport_retry_countkgid_tkey_userreadlinkoffline_disabledd_comparetime_ns_for_childreni_wb_frn_winnerqspinlocksighand_structELS_FACTstart_brkELS_RNIDdisc_callbackmap_mmapdio_completeshost_statelocked_pendinglockdep_keyrnid_resvdextentfile_offsets_idstate_maskcore_statelink_upalignsym_int80_landing_padngroupsmajor_retriessp_offset__sigrestore_tRPM_SUSPENDEDsystem_highpri_wqDMA_TO_DEVICEmutexn_refattrsexch_mgr_resetBPF_TCX_EGRESS__UNIQUE_ID___addressable_fc_cpu_mask654total_exchesFC_VPORT_DISABLEDbi_sectoreh_deadlinefsbaseinactivelport_set_port_idsrcu_barrier_mutexloss_of_signal_countdirty_limitswregs_state__kernel_timespecchildren_min_usageeh_should_retry_cmdpglist_dataWQ_HIGHPRId_lruwaitqmax_pkt_offsetd_fieldmaskcountersfaults_disabled_mappingnameidataarg_sizefailedfc_exch_pool_resetpoweroffbpf_prog_opsbpf_verifier_envminorsnonresident_ageControlRequestselemsizerlim_curFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagscan_workdebugfs_entrywait__list_add_validshow_rqcan_queuest_shndxreservedfc_exch_recv_abtsi_wb_frn_historyELS_EXPL_AHctxsprocess_keyringset_dqblkrestart_blocks_opbi_end_iokobjectposix_cputimer_basenr_memcgsleveluser_definedcow_page__warn_printkFC_SOF_Fnanosleepinvalid_tx_word_countfalsemax_npiv_vportscn_sig_alarmpi_state_listtv_secac_exitcodeBPF_KPTRsuidFC_SOF_I3prog_typeKMALLOC_RANDOM_STARTkey_typedismissi_hashmm_cid_next_scanfreeze_noirqoublockcancel_delayed_work_syncdisc_idia_atime_timerfifofc_exch_lookupvm_private_dataskip_ms_page_8work_bitsfc_frame_alloc_fillFC_RCTL_BA_PRMTrtpoll_scheduledWB_SYNC_NONEBPF_PROG_TYPE_KPROBEorig_progdq_freeSHOST_RUNNINGrootLPORT_ST_RNN_IDDISC_EV_NONEsupported_classespolicycpu_baseBPF_PROG_TYPE_SYSCALLcap_bsetnr_to_writerportsnr_itemsSKB_DROP_REASON_NEIGH_QUEUEFULLanon_costseq_startfcp_input_megabytesbp_regbvec_poolkern_versionrb_root_cachedfc_host_statisticsWB_REASON_FOREIGN_FLUSHmac_headeri_blkbitswritervm_pgoffvirtmembr_explan_refcounttarget_fdcsum_typeFC_RCTL_F_BSYLSKB_DROP_REASON_TCP_CLOSEbin_attributeELS_LOGOmath_emu_infopushable_dl_taskswrite_u64testWB_SYNC_ALLsched_infogroup_infotailsport_typedqi_fmt_idPTR_TO_ARENAactive_extensionsmemcg_csssoftirq_next_timerrevisionis_child_subreapersg_tablesizeexit_codefile_lock_contexttracingnr_pagesntoh24writeback_indexread_u64fiemap_extent_infofilemempool_free_tPTR_TO_TCP_SOCK_OR_NULLfree_foliort_spc_warnlimitcmndatomic_write_hw_unit_mincompact_count_sk_redirtimer__empty_rangessbq_wait_statedev_namebpf_map__p_sizeBPF_PROG_TYPE_EXTBPF_PROG_TYPE_FLOW_DISSECTORnotified_atrport_bindingsWORK_OFFQ_POOL_SHIFTn_klistwb_errbudget_tokenfc_framevlan_tcikswapdwrite_dquotrefcount_offpercpu_pvec_drainedf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachewwnnstorebi_bdevELS_PLOGIst_infodispatchdescsquiesced_bydqi_max_ino_limitllseeknet_nsRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleget_projidfunc_info_aux__sectorpart0cnvcswwwpncallskqidmem_cgroupPTR_TO_BUFfree_inodenext_keysiglockwait_queue_func_tperf_recursionreca_ox_idnr_wakeups_remotefc_seq_ls_rjtd_spacei_ctime_secdebugfs_idreal_func_cntnext_timer_typeBPF_TASK_ITER_TGIDTT_NATIVEused_map_cntFC_RJT_INVL_ATT__empty_insnshlist_bl_nodeoldbitnum_descsSKB_DROP_REASON_TCP_FLAGS_head_1_head_2clockiddelayed_work_timer_fn__read_overflow2_fieldFREEZE_MAY_NESTsym_hvclock_pageremap_file_rangemmap_legacy_basepfmemalloc_waitend_dataxa_lockfutex_exit_mutexuse_16_for_rwiommu_groupmap_peek_elemnr_isolate_pageblockmempool_alloc_tdevice_get_dma_attrtarget_blockeddev_loss_workalloc_inodepayloadbtf_field_graph_rootdirty_foliodn_unknownnode_zonesseq_countfscrypt_keyringis_hardasync_sizeSKB_DROP_REASON_INVALID_PROTOtrap_nrraw_atomic_dec_and_testf_iocb_flagsctx_size_in__flagsRPORT_EV_LOGOkcompactd_waittotal_vm_entire_mapcountiteratorlastpool_dataqf_opsforce_atomic_pad1_LPORT_ST_RHBAreal_credno_difblkcnt_td_rt_spaceprog_idsBPF_MAP_TYPE_HASHsigned charmap_local_storage_chargehas_child_subreapermount_pad2_reasonblk_flush_queuesched_entitydev_links_infoinner_protocol_types_uuid_lenpcpufh_seq_cnt___GFP_RETRY_MAYFAIL_BITdqi_privINIT_LIST_HEADfc_els_cmdfmode_trpm_autosuspendrnid_att_nodessweventactivatefxregs_state_lowerpaddingDEVICE_REMOVABLEpid_ns_for_childrenSKB_DROP_REASON_FULL_RINGtimestimer_rand_statelru_gen_memcgfr_encapsllist_nodeELS_EXPL_INV_LENbpf_run_ctxbio_slabstate_add_uevent_sentLPORT_ST_RSPN_IDenv_startmodule_notes_attrsio_cqsystem_freezable_wqlower_firstrangeSKB_DROP_REASON_TCP_RESETbvecacct_vm_mem1on_cpumanage_system_start_stopmg_src_preload_nodestringSHOST_CANCEL_RECOVERYatomic_fetch_add_relaxednuma_preferred_nidELS_FPINfree_diskPTR_TO_MAP_KEYvmem_altmapbiotailwait_startelevatorspinlockmin_unmapped_pagessrcu_barrier_seqi_aclssb_statnofaultbpf_map_typeia_rangesq_size_fielduseroffsetis_rel__ilog2_u32tablepteval_tFC_FID_DIR_SERVlog_levelblk_mq_tagsDEVICE_PANEL_LEFTorc_unwind_iprel_deadlinexfer_contig_endkobj_typeskip_settle_delaysb_writersdma_cleanupeh_timed_outdriver_datai387FC_FID_QOSdma_iommumax_idirq_safeLPORT_ST_READYrescue_lockdefault_timer_slack_nsxregs_statedelays_statecompletion_cntSKB_DROP_REASON_LOCAL_MAC_deferred_listcurr_nrset_child_tidSKB_DROP_REASON_UNICAST_IN_L2_MULTICASTbio_vec__ilog2_u64acpi_match_tablenfdsrlimitBPF_TRACE_FEXITmap_update_elemlast_subtree_bstatnr_frozen_tasks__list_del_entry_valid_or_reportiterrelease_agent_pathidle_notificationmodule_stateWORK_OFFQ_FLAG_SHIFTrtpoll_triggersPTR_TO_BTF_IDwait_lockf_pipegetgeocset_linkswrite_iterD_REAL_DATAFC_RJT_EXCH_ERRsp_featuresacct_timexpdclock_mutexFC_FID_SEC_KEYatomic_dec_and_testnr_failed_migrations_runninguserfaultfd_ctxFC_RJT_EXCH_ESTevent_flagsthread_structoldpcore_relosbuf_lenfc_rport_statemm_context_tbd_stampELS_RVCSdio_mem_aligncstimeRPORT_ST_FLOGIprot_capabilitiesFC_RCTL_BA_ABTSatomic_long_trpm_request__refcount_incpositionMQ_RQ_COMPLETEio_comp_batchline_info_cntSKB_NOT_DROPPED_YETcftsf_credtrace_eventsfc_port_typed_iputlast_bstatnew_prog_fdskb_putnr_wakeups_syncklist_nodeELS_ADISCstackmap_release_urefBPF_REFCOUNTblockedvm_numa_eventdst_trampolineallowedmce_countweighttotalblk_plugOutputRequeststrc_reader_nestingfpstatetag_setis_roxno_scsi2_lun_in_cdbprevseqcount_raw_spinlockinstrument_atomic_read_writebios_paramnum_orcskswapd_failuresFORTIFY_FUNC_kmemdupbuflenbpf_kfunc_desc_tabfc_exch_seq_senddeadBPF_CGROUP_DEVICEWRITE_LIFE_LONGcrc_offloadexpiry_activeeh_bus_reset_handlermtd_infois_confidentialvendor_identifieri_dentryfixupsFC_RCTL_BA_ACCwq_misc_constsvm_endvm_structproc_handlermemcgfsyncfc_els_recsgid__fc_frame_header_getcompat_robust_listnuma_workELS_ECHOprio_SLAB_NOLEAKTRACEprivvaluercu_workBPF_CGROUP_INET4_GETPEERNAMEredirectedcurrent_stack_pointerac_minfltbpf_prog_aux_hugetlb_cgroup_msecs_to_jiffiesset_policyinternal_tagthreadfc_exch_findftrace_callsitesmmlistservice_paramsBPF_CGROUP_SETSOCKOPT_SLAB_PANICforceidle_sumusedpage_typeclass_spinlock_is_conditionaluserskb_iifmynodeseq_stopWORK_BUSY_PENDING__MAX_BPF_PROG_TYPEblk_tracealloc_workqueueactionseconds_since_last_resetlink_detachpi_waitersdom_cgrprec_s_idqueue_mappingscsi_comp_flagsfc_exch_rctl_namelportfile_name_offbstatfailcntatomic_tpcp_listqueue_flagsBPF_PROG_TYPE_UNSPECrb_rootLPORT_ST_RPAfreepages_countutf8data_tableBPF_PROG_TYPE_SK_MSGprim_seq_protocol_err_countexe_filefc_exch_em_allocuid_telementsd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_datadef_flagssrcu_n_lock_retriesraw_locksrcu_structprovinner_map_metaFC_FID_MGMT_SERVis_guestli_link_failure_countio_minnf_skip_egresstarget_attrsrtpoll_wakeupsplice_eofs_sync_lockunlock_rejectproganon_vma_chainfc_tgtid_binding_typei_mtime_nsecseq_opsrseq_event_maskem_pdi_fsnotify_maskshared_pending__int128FC_EOF_RTI__mce_reservedwriteback_controlmax_write_lenmm_struct__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONErrq_rx_idbuild_idhost_statss_export_opCONST_PTR_TO_MAPBPF_CGROUP_INET4_GETSOCKNAME_SLAB_NO_MERGElen_descseg_boundary_maskWQ_SYSFSanon_namesched_dl_entitypp_ref_countactivest_othercall_get_stackstartparentlookupkernel_siginfowritten_stamp_sigpoll__compiletime_assert_109SKB_CONSUMEDinitializedSDEV_CANCELkill_sb__bi_remainingnum_bugsnr_requestscftypesecurity_supportedsock_fprog_kernklistELS_NDACTusercntSKB_DROP_REASON_OTHERHOSTirq_delay_totalstatefc_non_bls_respstatsdev_loss_tmo__compiletime_assert_118usersactive_basesresp_taskDEV_DMA_COHERENTswap_slot_free_notifystart_databoolcompact_order_failedbv_leninquirymodsctimernid_atypedestroy_inodecma_pagesfutex_pi_state__compiletime_assert_127SKB_DROP_REASON_TCP_OLD_SEQUENCESKB_DROP_REASON_PKT_TOO_SMALLi_mutex_dir_keyrescue_workrestartsSKB_DROP_REASON_UDP_CSUMdevice_physical_location_vertical_positionget_aclset_aclac_exe_devfc_els_rtvencapsmemory_tiers_voppercpudescpoll_bioiterate_sharedmemswtimer_msecsym_vdso32_sigreturn_landing_padfc_fpin_statscma_areafeatures__compiletime_assert_133rcu_tasks_exit_cpulink_fdmigrate_from_cpubd_size_lockwriteerror_codebuddy_listref_ctr_offsetsldt_structprog_attach_flagsfcp_control_requestscred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_nameVTIME_INACTIVEmg_src_cgrpeh_target_reset_handlerclass_preempt_is_conditionallink_createtimeouturing_cmdshrinker_idnr_dirtiedadisc_port_idBPF_SK_SKB_STREAM_PARSERsetattrPTR_TO_TCP_SOCKvmstats_percpufixupblockMQ_RQ_IDLEdevtlast_cpufor_backgroundnr_wakeups_localcn_sig_warnspinlockuidhash_nodemax_ratioalloc_cpupost_attachworker_privatepoll_eventFC_FID_FLOGIalloc_factorlinelinkbi_pooleffectivecompact_blockskip_flushmoderead_charserver_pick_taskFC_FID_ALIASESnode_idPTR_TO_STACKtargetget_nextdqblkrcu_tasks_idxBPF_PROG_TYPE_NETFILTER__ret_do_oncejournal_infobi_inline_vecstqheadlast_used_atrq_end_io_retline_offhres_activeold_subtree_controlmod_namenotes_attrsdelay_workspp_typeblock_device_operationsoffset_ctxbi_blkgseq_nexttail_call_reachablelast_switch_timefcp_output_requestscompact_init_free_pfnwakeup_countwait_indexSKB_DROP_REASON_IP_INVALID_SOURCElog_sizerunnable_weightSKB_DROP_REASON_NEIGH_DEADFC_VPORT_FAILEDmap_push_elemFC_FDMI_PORT_ATTR_OSDEVICENAMEtarget_busyclass_releaselast_sum_exec_runtimeSKB_DROP_REASON_PACKET_SOCK_ERRORdd_key_trueFC_RCTL_ELS4_REPFC_RCTL_ELS4_REQsa_handlerfree_countcg_listscsi_transport_templatelocked_vmqueue_rqaddressmq_hctxstart_timeRPORT_EV_STOPzone_wplugs_hashkprobe_multicookielistfreezer__pptrsig_okextabledma_data_directionmax_entriesi_sizeentry_eipcgroup_atypesplice_pipexstate_headerinquiry_lenrtpoll_timerdma_addrELS_TESTem_perf_domaind_flagsdying_tasks_large_mapcountnode_present_pagespid_namespaceliveclock_was_set_seqfdiscspc_warnlimitseqcount_tmin_fltfr_wwnblock_devicethreadedfp_fidMEMORY_DEVICE_GENERICpkruBPF_MAP_TYPE_PERF_EVENT_ARRAYattribute_containerprojid_tvendorvport_idmemcg_nodeBPF_CGROUP_UNIX_SENDMSGdma_lengthcn_clearkey_payloadadd_linksELS_PLOGInbp_th_start__empty_insnsiuse_10_for_msELS_QSABPF_RB_NODE_dummy_bndFC_FDMI_PORT_ATTR_MAXFRAMESIZEexception_cbBPF_TRACE_UPROBE_MULTIper_cpu_pagesetfcp_cmndsaved_stateparent_exec_idutil_sumdd_key_falsesigvalfsnotify_mark_connector__ubuf_ioveccputime_atomicdeadlinect_in_idbio_integrity_payloadlun_in_cdbmodel_descriptionexit_requeste_d_tovwait_queuefc_ns_rsnn_upperclass_write_lock_irq_is_conditionalcgroup_fileswap_readahead_infovtimeexpecting_cc_uas_rootli_device_specificstack_refcountgrpmaskdevice_attributegetattrs_remove_countBPF_SK_LOOKUPlru_genwrite_newuser_namespaceclass_rwsem_write_is_conditionalp_sizepids_active_resethlist_nodefc_ns_rspnblk_features_thbaidsuper_operationsautosleep_enabledwrite_file_infoload_sumaddress_spacecpus_maskdl_yieldedstarget_dataextension_progfile_dispread_newd_spc_softlimitfc_discuse_10_for_rwkrefrseq_css_lock_keydqi_flagsmq_ctxjump_entrypi_top_taskhlist_nulls_nodepacct_structRPM_REQ_RESUMEpathnameuser_sizelast_queue_ramp_upbd_statsshow_fdinfoFC_RCTL_DD_DATA_DESCFAULT_FLAG_MKWRITEput_budgetFC_FDMI_HBA_ATTR_BIOSVERSIONfadviseFC_FST_MGMTclass_read_lock_irq_is_conditionallesb_inv_crclinenoMODULE_STATE_LIVEtask_listtc_at_ingressasync_scanPTR_TO_CTXFAULT_FLAG_RETRY_NOWAITBPF_CGROUP_SOCK_OPSread_foliosc_data_directionhas_elevatordtordq_countvpd_pg0nlinksignalnr_wakeups_passiveself_exec_idstate_syncedws_activefr_max_payloadf_epctl_tablercu_specialprog_fdscsi_device_handlerentryold_subtree_ss_maskbacksda_is_staticBPF_MAP_TYPE_LRU_HASHfr_flagscgwb_domaincntssockidr_rtsdev_bflagsdispatch_fromdqio_semnr_linfoFC_NS_GNN_IDmq_freeze_wqstart_prevent_timepgd_tsigset_twq_offLPORT_ST_DNSmap_btf_idbucket_idELS_PRLIFC_RCTL_LCRELS_PRLOrstat_flush_nextignoredgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64prog_idreserved_tailroomi_inoserver_has_tasks_killRPORT_ST_PRLIpgdati_spc_warnlimitunderflowf_posBPF_MAP_TYPE_HASH_OF_MAPSperformancesoftac_pidowner_trapnoload_weightBPF_PROG_TYPE_SOCK_OPSfc_fh_typesleepablevport_statesymlinkclass_rwsem_write_try_is_conditionalbd_queueerror_framesin_iowaitfc_els_flogiDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclELS_SCRF_FULLbdi_writebackrb_leftmostSKB_DROP_REASON_TCP_AUTH_HDRdst_neededbug_addr_dispmigration_pendingscan_mutexhosttd_realSKB_DROP_REASON_IP_CSUMns_commonmap_ifindexdevice_get_match_dataELS_GAIDs_max_linksctl_table_rootfc_rport_eventscatterlistverified_insnsthread_headacquire_dquotclockid_tELS_LINITtarget_destroyzone_capacityFORTIFY_FUNC_strlenpgdval_td_managedevice_attrsmax_ctx_offsetmax_device_blockedback_padMIGRATE_SYNCwcharRQ_END_IO_FREEseq_filefcp_output_megabytesonline_cntBPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATEDrestoreSKB_DROP_REASON_IPV6_BAD_EXTHDRline_infoseq_ptrHPROBE_LEASEDBPF_LSM_MACthaw_superspp_type_extalt_lenseq_operationslesb_prim_errfallocatelog_true_size__retdst_pending_confirmgranted_mac_call_addrwriteback_sync_modesi_mmap_rwsemSKB_DROP_REASON_TCP_INVALID_SYNundo_listattribute_groupdma_poolspersonalityprintk_index_sizeuprobe_task_stateWB_REASON_BACKGROUNDstimestatic_priotmpfileattach_func_namedata_indqi_formatnvcswfc_scr_fillcp_init_nr_pages_mappedfrequency__compiletime_assert_39rtpoll_totaldev_pm_opspfmemallocfrozenno_updateiter_type__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_44DEVICE_PANEL_BOTTOM__compiletime_assert_46__compiletime_assert_47__compiletime_assert_48__compiletime_assert_49scsi_pkt_lockencap_hdr_csumtransporttmap_get_next_keyBPF_SK_REUSEPORT_SELECT_OR_MIGRATE__compiletime_assert_50__compiletime_assert_51__compiletime_assert_52__compiletime_assert_53__compiletime_assert_54__compiletime_assert_55__compiletime_assert_56__compiletime_assert_57__compiletime_assert_58__compiletime_assert_59nr_wakeupsquery_spp_resvdbpf_prog_typeenabledki_filpmultiple_queueswork_func_tmemcg_vmstats_percpupp_magicfpu_state_perm__compiletime_assert_60__compiletime_assert_61__compiletime_assert_62__compiletime_assert_63__compiletime_assert_64__compiletime_assert_65__compiletime_assert_66__compiletime_assert_67__compiletime_assert_68fwnode_reference_argsdevres_headused_maps_mutexRPM_REQ_IDLEfilenameex_lockbaseRPORT_ST_ADISCac_ppidd_prunerestore_noirqr_ctlsysfs_registeredDumpedFramesSKB_DROP_REASON_TCP_TOO_OLD_ACKrlockBPF_PROG_TYPE_SCHED_CLSi_rt_spc_warnlimitqueuertv_cmdBPF_PROG_TYPE_CGROUP_SOCKnuma_migrate_retryMEMORY_DEVICE_COHERENTenclavefiltersaved_dst_prog_typeroot_blkgd_revalidateLPORT_ST_SCRWB_REASON_PERIODICcgrpwatermark_boosttracepoints_incoredqsi_opsubtree_controlquota_syncsrcu_have_cbsmemory_peaksInvalidTxWordCountasync_in_progresssignumdqi_dirty_listpi_lockdirtied_stamptm_donetimespec64fc_ct_ms_fill_attrBPF_WORKQUEUEscan_finishedreplace_bpf_fdmax_ct_payloadnr_forced_migrationsdst_mutexumount_beginchannelbadblocksnr_descendantsbootbios_statell_nodeport_idkernfs_nodekobject_namecpumaskptrace_messagehton24lengthFC_RCTL_ACK_1tag_listbio_alloc_cachepdt_1f_for_no_luni_wb_frn_avg_timeBPF_LIST_HEAD_pincountreclaim_statecur_imageruntime_errori_sb__poll_tbpf_jit_poke_descriptorsubvolon_dispatchdirty_inodesymtabcpu_bitmaprcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structELS_LIRRfs_parameter_specSKB_DROP_REASON_MAXrcu_data0real_blockedruntime_suspendcp_open_seqspp_params__s16BPF_CGROUP_UNIX_GETPEERNAME__compiletime_assert_137wifi_ackedbacktraceoffline_alreadys_umountn_nodefc_els_scron_listcn_lost_creditmax_descendantsrefaultsdata_vmneeds_force_resumeblk_eh_timer_returnbtf_recordrec_zerocsum_levelrpm_statusscsi_host_statedeferred_split_queue__s32fr_resvdchildrenbpf_local_storage_map__mono_tc_offsetcheck_eventsmarkdqi_bgracei_wbhost_nof_inoderx_framesnext_rport_numberserialburstname_offpermissionsgraph_rootkernel_load_data_strcgroup_rootscsi_target_statehostmsi_device_dataslave_destroykallsymsfc_els_lesbi_ino_timelimitbi_issuebd_holder_opsBPF_KPTR_REFlink_idscgwb_frnsrcu_idxSTARGET_CREATEDutil_est__s64ipc_nshugetlb_usagebpf_cookiesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenacct_rss_mem1fc_exch_mgr___orig_eipsrcu_datadevice_physical_locationcgtimebypass_spec_v1ELS_CSRELS_CSUindexs_time_maxucount_maxdelayed_workprog_flagsopen_partitionssa_maskkswapd_lockmmappedElf64_Wordold_dom_cgrpjited_imageactive_timeatomic_flagsnum_jump_entriesextra_lenPIDTYPE_PGIDbtf_vmlinux_value_type_idmnt_namespaceelemwb_completionSKB_DROP_REASON_IP_LOCAL_SOURCEend_ioquotalensrcu_data_have_cbsnivcswoffdev_tidlinfo_idxmce_vaddrBPF_CGROUP_UNIX_GETSOCKNAMEdl_dev_stateFC_RCTL_ENDshowrb_subtree_lasts_listBPF_MAP_TYPE_CGROUP_STORAGEhigh_workmq_pollsender_cpunr_segssame_target_siblingssp_plogitailcall_targetof_match_tableBPF_PROG_TYPE_CGROUP_DEVICEfc_tm_flagsino_timelimitalternative_gpt_sectori_readcountELS_ABTXFC_RCTL_IFRHblkcg_polsincrfreeseq_offloadrange_cyclicFC_FDMI_HBA_ATTR_FABRICNAMEprog_cntlock_countthrotl_datalist_lru_onei_pagesmxcsrclass_rcu_is_conditionalarchdataptrace_entryuid_mapguest_permwait_queue_headfdmi_versionnum_srcu_structsnr_activeprev_sum_exec_runtimei_flagsgendisku_flagstag_set_listlast_queue_full_countlogical_block_sizesubtree_ss_maskinvalidate_lock_keyinfol1d_flush_killctx_outFC_VPORT_ACTIVEtimestampsfc_els_sppcp_reciprlimit_maxELS_RPBCSHOST_CANCELbpf_prog_offloadwrite_infohrtimer_restarts_encoding_flagssessionids_time_minSKB_DROP_REASON_UNHANDLED_PROTOvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrbpf_iter_aux_infos_stack_depthnode_offsetkprobe_override__vm_flagsresid_lenqueue_depthbpf_tramp_imagecsum_offsetpm_messagememcg_lrufred_cschangedvportcur_ktimeinitfop_flags_tgroupsoffstty_structnotify_nextvirtual_dr6dma_opsdma_addressELS_RCSbd_devsyscall_workinit_cmd_privelowbpf_trampolinelockdep_mapnum_trace_evals_addr_bndcgroup_base_statELS_RDFELS_RDPset_dbd_for_msnumberzone_device_dataquota_readloss_of_sync_counthlistpinned_vmfunc_cntELS_RECwritepagesnuma_faults_localityqrwlockELS_RESPTR_TO_FLOW_KEYS__write_overflow_fieldrw_semaphoreattach_bpf_fdfirst_minori_blockstask_fragWB_REASON_LAPTOP_TIMERsource_listsum_block_runtimeBPF_NETKIT_PRIMARYnuma_scan_period_maxtotal_timepowerfromnum_ei_funcsi_generationFC_FID_NONEfcp_input_requestsflushBPF_PROG_TYPE_PERF_EVENTtask_fd_querymg_dst_cgrponlinecp_con_seqBPF_PROG_TYPE_RAW_TRACEPOINTno_vpd_sizeformatlast_switch_countlast_wakee__cloned_offsetswapuint32_tssize_tRQ_END_IO_NONEvtime_statetry_vpd_pagesSKB_DROP_REASON_TCP_OFO_DROPparent_could_setfcapper_cpu_nodestats_blocksizequeue_numprevent_sleep_timeBPF_MAP_TYPE_CGROUP_ARRAYclass_spinlock_irqsave_try_is_conditionals_readonly_remounti_io_listrefaultedchild_countBPF_MAP_TYPE_ARRAY_OF_MAPSrelease_agent_workVTIME_IDLEBPF_PROG_TYPE_STRUCT_OPSwb_domaincgroup_subsysnbp_th_nr_candip_summedcompat_uptr_tresp_wqcgwb_treeDEVICE_HORI_POS_LEFTfc_plogi_fill_hugetlb_subpoolend_pfnuclamptgidlimits_lockreleasenr_wakeups_migrateserial_nrstack_vmi_fieldmaskupidBPF_CGROUP_INET_SOCK_CREATEprotection_supportkcompactd_highest_zoneidxfreeze_mutextrace_evalsELS_RLSia_vfsuid_softexpiresbtf_mod_pairquota_format_opsi_datarescue_listfsverity_infocore_threadclosidsched_avgRPORT_ST_PLOGIcodeBPF_LSM_CGROUPu64_stats_syncsyscorenr_reserved_highatomic__i_nlinkELS_RNCinumli_invalid_tx_word_countsrcu_barrier_cpu_cntbatchedreadaheadopt_sectorsFC_VPORT_FABRIC_REJ_WWNhrtimer_cpu_baseirq_domainwait_liststatic_call_trampfp_wwpnfsverity_operationscoublockbug_tablemigrate_modesecmarkusing_gplonly_symbolswb_listremovedhandleremulatedmax_segmentsnr_writeback_throttledsym_vvar_pageELS_RPLmembarrier_stateELS_RPSBPF_PROG_TYPE_LWT_INdma_pad_maskELS_RPSCBPF_KPTR_UNREFbin_sizeFORTIFY_FUNC_strlcatrcu_read_lock_nestingreg_typecb_accessrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_tio_bitmapDEVICE_VERT_POS_CENTER__UNIQUE_ID___addressable_fc_elsct_send654ELS_RRQretry_countsbitmap_wordmanaged_pageslong unsigned intmax_timeELS_RSIread_file_infoELS_RSSexec_startia_sizeema_listRPM_RESUMINGunpinned_netfs_wbMODULE_STATE_COMINGsym___kernel_sigreturnZONE_DEVICEfunc_info_cntuser_cpus_ptrSKB_DROP_REASON_TCP_MD5FAILUREuser_scand_opstate_initializedrelease_dquotELS_RTVplugsoftirq_activatedkey_sizeinv_weightsecuritykernel_symboldl_timerfl_csspmodule_param_attrsdirty_ratelimitno_read_capacity_16scsi_host_template__user_state_sizechainedVTIME_GUESTretriessdtrsysvsemdisconnectstasheduser_xfeaturesdisc_mutexuse_memdelaynr_cached_objectshas_timeoutcgroup_namespacecommq_nodecallback_headhead_fragexception_table_entryin_hrtirqctl_table_set_overruncondhash_lenDEV_DMA_NON_COHERENTcoredumpd_sbio_lock_cls_keyct_fs_typeSKB_DROP_REASON_IPV6_NDISC_FRAGksetsleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsPTR_ERRnodesysvshmno_highmemdata_outfirstSKB_DROP_REASON_TCP_FASTOPEN_nfctSecondsSinceLastResetFC_CLASS_2FC_CLASS_3FC_CLASS_4active_countRPORT_ST_RTVFC_CLASS_Fnr_active_requests_shared_tagsnum_tracepointsFC_NS_RSNN_NNvpd_pgb7ueventfc_pri_tasp_usharednext_cpu_batchmemcg_completionsdisk_eventss_sysfs_namesigval_trqst_qFC_FID_CLOCKSDEV_QUIESCEmap_pop_elembitsbase_pfnclass_mutex_try_is_conditionalsem_undo_listcompat_rmtpclass_local_lock_is_conditionalELS_ESTCELS_ESTSstatic_key_trueno_fcs_stimeSKB_DROP_REASON_TCP_AONOTFOUNDinsnsperf_event_ctxpprogsOutputBytesFC_NS_GSPN_IDcostxcomp_bvio_contextPIDTYPE_PIDwakee_flipsFC_FDMI_PORT_ATTR_PORTIDvlagufdsvlansegment_boundary_maskattach_tracing_progioctlprev_cputimectx_inbtf_flagshorizontal_positionem_perf_tablebi_crypt_contextprivateswp_entry_tcharfc_els_adiscmatchnr_failed_migrations_hotreg_offsetBPF_TRACE_KPROBE_MULTIqueue_stoppedFORTIFY_FUNC_UNKNOWNwrite_charbin_attrscpu_itimerdevres_lockfiles_struct__ret_onceblk_zoneSDEV_RUNNINGd_rt_spc_timericq_treePTR_TO_BTF_ID_OR_NULLFC_CLASS_NONEvfsuid_tf_lockexec_vmkernel_paramfs_typebtf_fieldfh_f_ctlget_lesbvertical_positionbtf_dtor_kfunc_tshutdown_prerelease_folioftrace_managedbi_io_vecvendor_idmtimearchrobust_listasync_probe_requestedthaw_earlyac_btimevectors_securitysplice_writeparam_lockreq_listi_opflagstot_write_bandwidthdentry_operationsstats_sectorss_blocksize_bitsexp_hintclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapsw_hashstrnlen_head_2asym___kernel_vsyscallopen_mutexfortify_funcsk_buffcan_forklow_usageget_timeki_flagss_inode_wblist_lockFC_FID_FCTRLpermwriteback_inodesdestroy_worklockableuprobes_statemm_counttrace_overrunargsargvuclamp_reqswap_info_structs_qcopwb_tcand_bytesblk_mq_queue_mapFC_VPORT_INITIALIZING__kernel_long_tsrcu_usagefaultableperf_event_mutexfctsFC_FID_BCASTexit_hctxfc_xid_not_foundsync_modemap_gen_lookupin_execverlim_maxFC_PORTSTATE_MARGINALDEVICE_REMOVABLEsimple_tagstarget_listVLinkFailureCountbpf_kfunc_btf_tabrtpoll_next_updatecoherent_dma_mask__data_lendriver_flagsscsi_residfile_ra_statek_sigaction_hugetlb_hwpoisoninsn_offshrinker_infocompletionslld_event_callbackreadahead_controlfwnode_operationsprocs_fileswait_queue_headmemory_typevm_userfaultfd_ctxTT_NONEmap_pagesBPF_PROG_TYPE_TRACEPOINTSKB_DROP_REASON_TCP_ABORT_ON_DATAmod_tree_nodelocal_watermarkprobe_offsetct_fs_subtypecmd_flagss_bdev_filerequest_queuedev_pagemaptarget_private_offsetRPORT_ST_INITcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fshost_eh_scheduledsoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLErb_nodereturn_consumerround_robinksymi_private_dataroot_csetused_btfsptracer_credsrcu_barrier_headleadercheckTT_COMPATcap_effectivenetfilterexit_statefc_fcp_pktfaultscan_startprogs_hlistnuma_pages_migratedidr_nextsched_tagssupported_modeFC_FST_ALIASfiltersnr_frozen_descendantssbitmap_queueno_cgroup_migrationsched_databpf_func_info_auxprintk_index_startindex_keybreserved_tags__bi_nr_segmentsLPORT_ST_FDMIforce_scanintervalavgs_lockbug_entryzswap_maxtimers_activenum_classesprotocolbpf_cgroup_storagevma_lockrtpoll_untilkswapd_waitdl_throttledbpf_progseccompDEVICE_VERT_POS_UPPERrolesblk_holder_opsfprop_local_percpustatic_key_modextensionsspp_orig_pafilter_countpsi_filesmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodecreate_work_queuerport_delete_workumode_tfn_area_id_scopeinitial_nsno_pmGRPQUOTAia_vfsgidioctx_lockfl_n_port_ids_bdixarrayjited_linfocan_wakeuptime_namespacepdeath_signalexpected_attach_typedst_regnr_wakeups_idledqi_igraceqf_nextBPF_MAP_TYPE_LPM_TRIEmaple_treensproxyslave_dir__p_len__write_overflow_pkeyFC_TYPE_ELSucountsget_next_idDD_CLASS_TYPE_LEVEL_NUMhooknumwrite_syscallslistscore_relo_rec_sizerefcount_tslow_grocmd_lenDEVICE_PANEL_TOPmemtierrxidmax_hw_discard_sectorsint32_txol_areadefault_lockguess_capacitysrcu_gp_mutexdebugfs_dirwakee_flip_decay_tsprio_listnext_vport_numberlast_timerequestblk_unique_idwpcopy_delay_totalSDEV_DELmax_payloadcontexthost_lockrwlock_tvm_fault_tskb_extuse_autosuspendclass_spinlock_irq_try_is_conditionalfc_disc_eventcfs_rqtree_reclaimedfc_exchvirt_boundary_maskSKB_DROP_REASON_TCP_INVALID_ACK_SEQUENCEcgroupscore_occupationget_policycore_cookiepcrefrefcount_struct__kernel_ulong_tkf_opsfwnodeZONE_DMA__UNIQUE_ID___addressable_fc_elsct_init655BPF_CGROUP_GETSOCKOPTcgroup_storagestatic_call_keycsum_startsysnamenamespaceSKB_DROP_REASON_IP_TUNNEL_ECNparametersbtf_sizeSKB_DROP_REASON_IP_INHDRgroup_leaderdma_channelrunnable_avglookaheadiowait_countli_loss_of_signals_countshstkioac__kernel_clock_tfc_ct_ns_fillwas_resetgp_seqscsi_device_stateuuidmaj_fltWB_REASON_FORKER_THREADcached_requested_keyfp_flagsdqb_rsvspaceSKB_DROP_REASON_SUBSYS_MASKmap_lookup_and_delete_batch__s8inode_operations__kernel_size_tdma_configurefile_leasepage_counterarg_flagsclass_local_lock_nested_bh_is_conditionalgpl_symsallowed_attachsFC_FDMI_GRPLrecursion_detectedpercpu_rw_semaphoresymbolic_namearch_spinlock_tseqcount_raw_spinlock_tbpf_iter_init_seq_priv_thighthread_pidmap_lookup_batchFC_VPORT_NO_FABRIC_SUPPcss_idrrtpoll_min_periodemindl_non_contendinglso_maxcurr_ret_stackpgtable_t__u8q_usage_counterwakeirqi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsysfilessdev_targetcore_forceidle_sumget_offset_ctxreleasedexport_operationsqc_stateELS_LCLMget_budgetBLK_INTEGRITY_CSUM_IPmempool_smempool_timplicit_on_dflFC_PORTSTATE_LOOPBACKd_inodespecial_vecpageset_batchworkqueue_structBPF_MAP_TYPE_SOCKMAPi_lock_keyuevent_suppressgraveyard_linkbi_opfscsi_cmndfail_io_workct_mr_sizecall_get_func_ip__read_overflow2tcp_tsorted_anchorwce_default_on__rcu_icq_cachecompact_cached_free_pfncap_ambientqstrtaskss_d_opBPF_MAP_TYPE_TASK_STORAGEno_report_lunsi_rcu__countFREEZE_HOLDER_KERNEL__already_doneadisc_wwnninit_requestFC_PORTTYPE_NPORTio_optspanned_pagespcountbio_listwlockedrtpoll_trigger_lockdevicemodule_kobjectmap_releaseELS_SCNPTR_TO_PACKET_METAELS_SCRmg_tasksBPF_TRACE_ITERpercpu_count_ptrnr_ia_rangesthawmap_update_batchlink_attach_flagsmap_alloc_checkadisc_wwpntlbflush_unmap_batchremoveoffload_fwd_markbvec_iteroom_mmfcp_abort_iobpf_local_storagefr_crcname_linkSKB_DROP_REASON_PROTO_MEMmm_cidrnid_vend_idcompat_long_tcnivcswmap_freeInvalidCRCCountPTR_TO_SOCKET_OR_NULLshort intkswapd_highest_zoneidxtrc_reader_specialgtimedisk_events_disable_depththread_group_cputimertransport_headersizemigrate_to_ramUTASK_SSTEP_ACKloginuiddesc_structi_wb_lists_umount_keyquota_typenameSKB_DROP_REASON_SKB_UCOPY_FAULTcgrp_ancestor_storagesetleasebitmap_tagsmnt_rootBPF_MAP_TYPE_SK_STORAGEpsi_flagssubsys_masksighandbtf_key_type_idavgs_workaddr__rcu_headac_utimeFC_PORTSTATE_DELETEDksm_zero_pagesBPF_MAP_TYPE_LRU_PERCPU_HASHqueuedataSKB_DROP_REASON_TCP_OFO_QUEUE_PRUNEprivate_dataBPF_MAP_TYPE_CPUMAPfc_exch_poolgid_mapFC_RCTL_F_BSYpageset_high_minfs_structnuma_nodedev_archdatafifo_timenr_perf_statess_flagsrcu_nodeorig_pmdrb_rightclock_baseBPF_SK_REUSEPORT_SELECTclass_irq_is_conditionallaunder_foliowake_batchis_funcs_vfs_rename_mutexElf64_Xwordf_ctlflockSKB_DROP_REASON_BPF_CGROUP_EGRESSiter_createFC_RCTL_DD_UNSOL_DATAhandler_datavalue_type_btf_obj_fd__paddingoffline_waitqnr_reclaim_startstatus_codeio_lockdep_mapatomic_write_hw_boundarymap_nr_maxiowait_sumdescriptionfolio_batchbi_nextblk_status_tUSRQUOTABPF_CGROUP_ITER_SELF_ONLYdriver_privatecore_relospm_onlyd_rt_spc_warnsset_read_onlypgmapSKB_DROP_REASON_TAP_FILTERactive_refmap_owner_storage_ptrhctx_tablefc_xid_busykernfs_open_filelowmem_reserves_iflagsprintednr_hw_queuesstate_mutexallowed_mapsctx_arg_infoinner_network_headerex_listlast_queue_full_depthBPF_PROG_TYPE_SK_LOOKUPfc_frame_header_getcid_worki_versionswap_deactivateflogisr_lockattachclass_rwsem_read_is_conditionalqueue_limitsunitil_weightFC_FDMI_HBA_ATTR_NODENAMEstarved_listdma_parmsbdi_idKOBJ_NS_TYPEStstamppmd_tfc_fdmi_port_namecmin_fltchunksSKB_DROP_REASON_VXLAN_INVALID_HDRarch_uprobe_tasklicensewrite_protect_seqclearedkobj_ns_type_operationsshutdownevent_countinit_uts_nssched_statisticslru_lock__kernel_uid32_tnode_zonelistsallocSKB_DROP_REASON_TCP_AOUNEXPECTEDb_attachedorig_pterq_timeoutkeysinit_nameper_cpu_zonestattc_indexfile_lockstatfsrw_semswappinessfsavevm_policydl_deadlineLPORT_ST_RSNN_NNtracepoint_extELS_SRLclass_mutex_is_conditionalELS_SRRfpregs_statememcg_datadqb_curinodesBPF_XDPfileattr_seteh_actionac_tgetimeRPORT_EV_NONEpage_linkno_write_samebtf_log_sizedn_timeoutDEVICE_PANEL_UNKNOWNFC_VPORT_FABRIC_LOGOUTPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetmce_ripvDL_DEV_NO_DRIVERbpf_arenafree_after_mult_rcu_gpret_stacknbp_rl_nr_candreal_timeri_privateextended_state_areanum_kprobe_blacklistaccessmap_seq_show_elemfp_resvdsubdirsdev_releasecgroup_freezer_statemlock_countBPF_PROG_TYPE_LWT_SEG6LOCALget_next_child_nodemempolicyfc_rportcacheline_padding_bandfd_arraypollfdblinding_requestedFC_RCTL_BA_RJTlaptop_mode_wb_timerdev_tfs_fdmi_attrsplatform_dataf_refprev_posenv_endfileattrs_subtypeusage_countFC_FDMI_PORT_ATTR_FABRICNAMEpr_opsstate_in_sysfsdqb_ihardlimitSKB_DROP_REASON_TCP_MD5NOTFOUNDunlocked_ioctluprobebd_mappingFC_RCTL_DD_UNSOL_CMDkmem_cachenuma_next_scanLPORT_ST_FLOGIbudget_mapbsg_devsrcu_last_gp_endxfer_lentnodeclass_local_lock_irq_is_conditionalpage_listinner_ipprotoproperty_read_int_arraywdtrmq_rq_stateholders_dirMODULE_STATE_UNFORMEDst_valuelist_headptrace_bpsFC_RCTL_BA_RMCfc_port_states_user_nsFC_FDMI_HBA_ATTR_MAXCTPAYLOADcan_attachhost_attrsmap_lookup_elem_sys_onlytagset_refcntqueuecommand_may_blockmin_usagearch_tlbflush_unmap_batchquick_threadsdefer_syncfc_els_scr_funcBPF_TASK_ITER_TIDmissedFC_FDMI_PORT_ATTR_SYMBOLICNAMEfc_no_free_exch_xidusernsndisc_nodetypeBPF_UPTRvlan_allBPF_PROG_TYPE_CGROUP_SKBsum_sleep_runtimecleanup_rqd_spc_timerfc_elsct_sendd_ino_hardlimitchange_cookiebi_statuscss_allocfc_logo_filldl_periods_dquotErrorFramesfsnotify_sb_infomap_fd_get_ptrrecent_cida_opsftrace_opsprocnamepad_untilSKB_DROP_REASON_TCP_MINTTLmap_redirectperf_event_listinterval_expinsnBPF_CGROUP_UDP4_SENDMSGrstat_css_listvm_node_stat_difftagski_completepgprotFC_FDMI_HBA_ATTR_MODELDESCRIPTIONfc_ct_fillrnid_node_mgmtread_syscallstimespec_typebd_devicevmstatsdquot_operationsSKB_DROP_REASON_TC_INGRESSposix_cputimers_workgsbase__lruvecBPF_CGROUP_INET_EGRESScompact_delay_totalio_tlb_memseq_showFC_RCTL_DD_UNSOL_CTLcpusELS_LKAinblockbd_claimingtails_magicFC_RCTL_BA_NOPcontainersnuma_faultsmem_dqblktarget_ifindexnos_countstgt_delete_workfc_ns_reqstatusBPF_PROG_TYPE_CGROUP_SOCKOPTWRITE_LIFE_NONEread_countlink_speedBPF_CGROUP_INET6_CONNECTblist_flags_tlport_listHRTIMER_NORESTARTscsi_privlast_update_timesas_ss_spold_map_fdFC_FDMI_PORT_ATTR_PORTNAMEdisc_startfc_ns_rftpanelac_padfc_rport_operationswatermarknode_start_pfnmax_allowed_capacityfc_statsopen_modeFC_RCTL_ELS_REPread_posclass_cpus_read_lock_is_conditionalmg_dst_preload_nodecpu_run_real_totalD_REAL_METADATAgpl_crcstimes_prevclass_raw_spinlock_try_is_conditionalfc_frame_headerkiocbmg_nodeexecute_only_pkeyreturn_instancesma_lockblk_mq_queue_datacss_offlineattach_btf_tracedockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsELS_NACTFC_RCTL_DD_SOL_CTLwb_tcand_idFC_PORTTYPE_OTHERdentrysequential_iowait_pidfdportnamecdb_statusInputRequestsSKB_DROP_REASON_SECURITY_HOOKs_writersgroup_stop_countavg_next_updateswap_lockvm_opswb_reasonpartial_bufread_before_msget_unmapped_areamkobjsym_VDSO32_NOTE_MASK_sp_rel_offfl_cmdunregisteringget_parentmin_vruntimestoragesdebug_dirfr_namehost_resetfc_els_rnid_genclass_disable_irq_is_conditionalsyscrnr_mapssyscwsync_ionum_bpf_raw_eventsvm_startwork_qcp_resv1orig_nentski_pose_csetsavx512_timestampfh_typeend_io_datae_freezeBPF_GRAPH_ROOTfree_cached_objectstaints_BoolFC_RCTL_DD_UNCATmax_tp_accessxol_vaddrb_dirtylist_lru_nodesp_bb_datas_time_granvm_statblk_integritykuid_tdev_pm_qosbd_holdersper_cpu_zonestats_sifieldstaskBPF_CGROUP_INET6_BINDresetsched_reset_on_forkcompound_headnr_retriesfc_fdmi_port_attr_typewake_irqbranchi_cdevfunc_infoi_fsnotify_marksin_thrashingscr_resvdl_deferBPF_MODIFY_RETURNvpd_pg80waitersvpd_pg83cp_rdfsvpd_pg89mprotectquota_ond_automountDEVICE_REMOVABLE_NOT_SUPPORTEDrnid_genELS_EDCcsum_not_inetctl_table_headeratimeget_ownershipf_task_workfc_host_attrsfl_cspfc_rec_fillfc_lport_stateBPF_SK_SKB_STREAM_VERDICTeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalFC_TYPE_FCPsectorinner_mac_headers_wb_err__q_sizerec_rx_idcp_classattach_prog_fdcloseiopl_warnelevator_queueptraced__MAX_BPF_MAP_TYPEdoneFC_FDMI_HBA_ATTR_NODESYMBLNAMEsym___kernel_rt_sigreturnsrcu_struct_ptrsskip_ms_page_3fbinfmt_miscinodesencapsulationmemcg_awarezonehost_waitFC_PORTSTATE_LINKDOWNmanage_shutdownac_schedqsize_t__fpstatemap_poke_trackBPF_MAP_TYPE_SOCKHASHqf_ownersuspend_noirqd_inamePTR_TO_MAP_VALUEbi_flagslinks_countprealloc_pterdevd_ino_countarg_lockskb_drop_reasonclass_rcu_tasks_trace_is_conditionalDEVICE_REMOVABLE_UNKNOWNdoes_npivignore_childrenpoint_to_multipointframe_sendBPF_CGROUP_UDP6_RECVMSGdirty_exceededfreeze_fsin_eventfdresume_earlymax_dev_sectorsdup_xol_workalimititemsooo_okaynuma_groupblk_independent_access_rangeskmap_ctrlfscrypt_operationsrangesevents_locklesb_link_failmnt_idBPF_CGROUP_INET6_POST_BINDretry_hwerrorfc_els_csspdrop_inodeBPF_MAP_TYPE_REUSEPORT_SOCKARRAYk_lockorc_unwindgraph_get_next_endpointfrom_ingresslast_sector_bugmq_mapprojid_mapkprojid_t__u16PTR_TO_XDP_SOCKsaved_end_ioBPF_MAP_TYPE_STACKsyscall_dispatchdl_densityon_rqfc_ns_gid_ftlru_gen_mm_walkaltmapmin_perf_statercu_tasks_exit_list__real_strscpylro_xidsp_regdma_drain_buffc_flogi_filldhbalast_resets_master_keysflagsbd_holder_locknr_threadsvm_mm__u32query_flagsmax_secure_erase_sectorsenable_statss_quota_typesvm_lockswapin_countdisc_stop_finalFC_FDMI_HBA_ATTR_VENDORIDENTIFIER_ddebugFAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitrcuwaithost_sizeoffload_l3_fwd_markSKB_DROP_REASON_NOT_SPECIFIEDdelayskcompactd_max_ordercp_ee_credmnt_nstimerqueue_head_cp_resv2BLK_INTEGRITY_CSUM_CRCsdev_groupskioctx_tableprioritybtf_func_modelksm_rmap_itemsclass_read_lock_is_conditional__u64revoked_at_folio_nr_pagesfcp_packet_abortswritepageis_dirty_writebackpkey_allocation_mapLPORT_ST_DHBAdq_iddisable_depthem_perf_statethread_shstkfr_devTxWordsposix_timerswait_chldexitTxFramessas_ss_flagsunreadableunmap_limit_for_wspresent_early_pagesSKB_DROP_REASON_IP_INNOROUTESinsn_idxfl_wwnnbi_itersrcu_cblist_invokingiopollcsum_complete_swline_coliov_lenlatency_recordfc_lportdirty_limit_tstampsector_sizeskb_mstamp_ns__BPF_REG_TYPE_LIMITd_releaseavg_totalfh_cs_ctldev_dma_attrBPF_NETKIT_PEERzswap_writebackexpiresnuma_scan_seqmnt_sbfl_wwpnFC_FDMI_PORT_ATTR_SUPPORTEDCLASSSRVCblkcg_csshashnodemask_tref_cntsize_poke_tabsignalfd_wqhhang_detecteddevice_driverSKB_DROP_REASON_ICMP_CSUMlast_zone_capacitystatisticsfsindexout_batchraw_spinlock_ts_cops_activenum_argspidlist_mutextag_sizeBPF_MAP_TYPE_PERCPU_HASHlast_old_flushs_uuidfr_featclear_child_tidrec_ox_idruntime_statusdqb_btimeput_unaligned_be16dq_opBPF_MAP_TYPE_DEVMAPELS_ADVCshow_pathdl_serverVTIME_USERquota_disablesched_delayedsrcu_gp_seq_neededtask_structtimer_delaycurrent_may_mountpushpeaks_lockbpffs_fdpath_fdis_noirq_suspendedfwnode_endpointFC_NS_RFT_IDPTR_TO_TP_BUFFERcounterunique_idsuspendsupported_eventsoom_score_adj_minlast_bdp_sleepzone_wplugs_poolzone_typedomain_datacopy_file_rangesrcu_gp_startreport_zones_cbxa_flagsattach_btf_idlru_gen_foliobtf_idbpf_insntv_nsecmax_zone_append_sectorssas_ss_sizeeh_eflagss_inode_list_lockUTASK_SSTEPraw_tracepointFC_RCTL_F_RJTFC_FDMI_PORT_ATTR_SUPPORTEDSPEEDehandlerdq_sbexpecting_lun_changescsi_targets_mountselem_flagsBLK_EH_DONEvm_stat_diffsym_pvclock_pageswapin_delay_totalfree_listBPF_CGROUP_UDP6_SENDMSGput_unaligned_be64page_fraginfo_lenrun_workfsuidRPM_REQ_AUTOSUSPENDsrcversiontrace_event_callwakeup_sourceis_partially_uptodatehost_faileddl_runtimemay_splitio_uring_cmdprogs_cntread_dqblkpeekedrtpoll_nr_triggerssrcu_parentinit_seq_privatebi_cookiesuppliersfile_operationsRxFramesSKB_DROP_REASON_TAP_TXFILTERbpf_ctx_arg_auxlesb_sync_lossmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotLPORT_ST_RESETis_preparedpgprotval_tmemoryfl_n_port_wwntrc_holdout_listasync_suspendscr_reg_funczone_pgdatclass_mutex_intr_is_conditionalstrtabpage_freeftopdepends_onHPROBE_CONSUMEDi_mmapnr_cgrpsdirty_paused_whenirq_getrport_priv_sizecss_resetcapacitymax_channelversionlink_failure_countget_reference_argsllisthiwater_vmmax_perf_statebi_idxSKB_DROP_REASON_IP_RPFILTERcookiesfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntInputBytesrseqattach_typetarget_knlimit0limit1pi_blocked_onpid_tac_exe_inodevmemmap_shiftbpf_attach_typeELS_FARP_REPLusage__kernel_time64_tSKB_DROP_REASON_IPV6DISABLEDrq_qos_mutexkernel_read_file_strscsi_data_bufferFC_FDMI_PORT_ATTR_FC4TYPESSKB_DROP_REASON_IP_LOCALNETcapabilitiesi_securitydevice_physical_location_panellimitsq_lock_cls_keyenvpactive_memcg__targetsElf64_Halfallow_reinitSKB_DROP_REASON_IP_OUTNOROUTEStimer_autosuspendsadiscratelimitSHOST_DELslave_configurestat_thresholdELS_SBRPautosuspend_delayline_info_rec_size_zonerefsi_flctxFC_PORTSTATE_ONLINEli_invalid_crc_countlist_lockvm_faultip_epilogueoptimistic_spin_queuepermissionSKB_DROP_REASON_IP_NOPROTObpf_prog_array_itemrec_cmdtransport_containerpreallocreap_refDEVICE_FIXEDlast_statusfdmi_enabledSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsslice_maxFC_RCTL_P_BSYIS_ERRmap_namebi_max_vecsfc_fdmi_hba_attr_typethaw_noirqsched_debugfs_diraccounting_timestampserial_numberFC_FDMI_HBA_ATTR_HARDWAREVERSIONcan_matchtime_archcmd_sizechunk_sectorshlist_bl_headqc_dqblkLPORT_ST_RFT_IDcalledpasid_activatedancestorsFC_FDMI_PORT_ATTR_NODENAMEmap_fd_sys_lookup_elemmmap_base__fortify_panicbvec_integrity_poolBPF_XDP_DEVMAParch_datashrink_controlegidsupported_fc4sthreaded_csetsmax_rdonly_accessmap_direct_value_addrnet_deviceenvp_idxcrypto_kobjectcdb_cmdsubtypef_modetagged_supportedoffloadsvpd_pgb0vpd_pgb1vpd_pgb2ff_type_mapzone_idxfolioruntime_autopref_node_forklru_zone_sizeclassipc_namespaceBPF_SK_SKB_VERDICTarenaprev_scan_seqfc_dl_perfpsi_group_cpufr_seqwait_queue_head_talloc_hinttask_cputimeFAULT_FLAG_INSTRUCTIONdeferred_splituser_nsfc_cdbnohdrclass_raw_spinlock_irqsave_is_conditionalsyms_flagscgwb_release_mutexSKB_DROP_REASON_TCP_OLD_DATASKB_DROP_REASON_TCP_MD5UNEXPECTEDFC_PORTTYPE_NPIVsyncprli_cmdmq_freeze_locksg_prot_tablesized_childrenucountmap_local_storage_unchargectl_table_sizebpf_map_opsfc_rport_identifierseh_host_reset_handlerddebug_class_map__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115__compiletime_assert_116__compiletime_assert_117dfl_cftypes__compiletime_assert_119prealloc_bufFC_TGTID_BIND_BY_IDaudit_contextfl_owner_tipi_listBPF_MAP_TYPE_DEVMAP_HASHpersistent_keyring_register__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126i_pipe__compiletime_assert_128__compiletime_assert_129hardware_versionmachined_waitllist_headsense_buffernr_phys_segmentstask_itersnode_spanned_pagesavg_refaultedFC_RCTL_ENCHwait_page_queuefc_idcn_credit_stallbpf_line_infoBPF_SK_MSG_VERDICTFAULT_FLAG_REMOTE__compiletime_assert_130dl_bw__compiletime_assert_132hierarchy_id__compiletime_assert_134__compiletime_assert_135__compiletime_assert_136unaccepted_pages__compiletime_assert_138i_dir_seqignore_dfheaderac_etimewatchdog_stampFC_FDMI_GHATstate_startlist_op_pendingdatafc_els_logosrcu_cb_mutexsysfs_lockBPF_CGROUP_UNIX_CONNECTallowed_progsno_callbackssaved_trap_nrclock_listbpf_func_infofolioq_slotMODULE_STATE_GOINGxattr_handlerac_utimescaledrqos_debugfs_dirprot_sdbidr_baseunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_locknextentseventkeytypeMissDiscAdvCount__kernel_gid32_tevicteddev_pm_domainnentsstart_time_nsuaddr2f_securityprot_opuclamp_sedefparamdiscard_granularitySKB_DROP_REASON_TC_RECLASSIFY_LOOPiotmo_cntclass_raw_spinlock_irq_is_conditionalq_sizefr_sofFC_PORTSTATE_BLOCKED__bi_cntstate_remove_uevent_sentattributes_maskcloneddl_defer_runningnpiv_enabledlru_gen_mm_listqueuecommandevents_filetagged_writepagesput_unaligned_be32ia_validsrculog_bufsp_bb_credreq_flagsiorequest_cntsrcu_size_jiffiesfc_fdisc_fillclassesstatic_call_sitecputimeis_seenupdated_nextfh_s_idsrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitmap_fdrchari_verity_infofn_resvd_addr_pkeyfpin_statsELS_TPRLOrw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countBPF_PROG_TYPE_XDPbpf_ksymSTARGET_RUNNINGFC_SOF_C4atomic_opennapi_idload_time__mptrsigactionrlimbtf_token_fdmce_addr__q_size_fieldf_freeptrSKB_DROP_REASON_TCP_OVERWINDOW__sighandler_tclass_spinlock_try_is_conditionalzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMESlrugenmax_target_blockedfs_flagsvm_filei_countfc_ct_hdruser_structmap_idaddress_space_operationsELS_LSTSFAULT_FLAG_USERkey_perm_tused_btf_cntbtf_log_bufeh_strategy_handlertimer_listverifier_zextmemory_eventscgwb_listrun_delaynum_ftrace_callsiteschange_queue_depthsrcu_cblistoffload_requestedblk_independent_access_rangeavg_write_bandwidthtlb_ubcpgtables_bytesi_lrufirmware_versionfh_parm_offsetGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackFC_FID_MCAST_SERVtrc_ipi_to_cpuparm_offsetscsi_luncss_onlinePTR_TO_FUNCmemory_events_localallow_restartlockdep_map_pmin_sliceSKB_DROP_REASON_XFRM_POLICYSKB_DROP_REASON_IPV6_NDISC_BAD_CODEcommit_rqsfl_zerosysfs_opsinq_periph_qualcore_relo_cntFcpPktAbortsFC_FDMI_RHATatomic_write_hw_unit_maxFC_SOF_I2cmaj_fltFC_SOF_I4bio_integrity_poolnf_traceFC_FDMI_RPAkparam_arrayFC_FDMI_HBA_ATTR_FIRMWAREVERSIONFORTIFY_FUNC_strscpyesb_statFC_FDMI_RHBAFcpFrameAllocFailspercpu_refevict_inodeignore_media_changertpoll_statesthread_keyringmap_nrcgroup_nscpumask_trstat_css_noderb_leftRPORT_ST_DELETEgfp_maskdma_addr_tinactive_timerattributeinner_protocolinit_hctxperiod_timemm_lock_seqFORTIFY_FUNC_memchrELS_FANkernfs_elem_symlinkBLK_UID_T10FC_TGTID_BIND_NONEinit_utsnamewb_lcand_idFC_RCTL_DD_CMD_STATUS__kernel_dev_tcrypt_keyslotprog_namepm_domainBPF_CGROUP_INET4_BINDmax_rdwr_accessmax_prop_fracfsgidsector_tcompact_cached_migrate_pfnnode_name_sys_privatesignal_structactive_mmFC_SOF_N2FC_SOF_N3FC_SOF_N4kernfs_iattrsshow_devnamecn_oversubscriptionthread_infoi_mmap_writabledata_size_outattach_btf_obj_fdreadr_a_tovfc_ct_revnum_portsvalue_recsecondarydevicesatomic_write_max_sectorsgroup_exit_codetx_framesFORTIFY_FUNC_memcmpopc1value_btf_idplogiexec_maxsync_statedev_groupsuts_namespacefcloneDMA_FROM_DEVICEzone_start_pfnvalue_sizeFC_NS_RPN_IDkernfs_elem_dirport_namepercpu_counterreq_sizeDMA_BIDIRECTIONALcgroup_subsys_statesequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startfc_els_resp_typeUTASK_RUNNINGopenseglen__compiletime_assert_45BPF_MAP_TYPE_QUEUEFORTIFY_FUNC_memcpy__kernel_ssize_tvdso_imagesi_signounused_hctx_lockfc_fdmi_rparseq_signpiv_vports_inuseresultrefsdelayed_calltime_slicefunc_info_rec_sizect_reasonnr_rangemax_seqSKB_DROP_REASON_DEV_READYspc_timelimituid_gid_mapnr_freeresumeset_ownershipbpf_iter_task_typeFC_PORTSTATE_NOTPRESENTregsbi_write_hintdprtSKB_DROP_REASON_PKT_TOO_BIGrq_nextsyscall_user_dispatchshort_inquiryattrd_aliasis_suspendedseq_priv_sizerp_mutexrestore_sigmaskrequeue_lockSKB_DROP_REASON_CPU_BACKLOGevent_worknr_deferredmem_cgroup_idsrcu_sspi_lockuser_event_mmbtrace_seqs_devsiblingcdl_supportedia_rangetarget_sizemap_lookup_elemldt_usr_semrec_datapagefault_disabledposix_cputimerslink_supported_speedstry_rc_10_firstRPM_INVALIDdd_datafreeze_kcountrequest_key_authblocksSKB_DROP_REASON_IPV6_NDISC_HOP_LIMITpercpu_ref_datad_spc_warnssrcu_supnbp_thresholdfreeptr_tLPORT_ST_DPRTns_typeRPM_REQ_NONEFC_RCTL_VFTHprog_btf_fdforce_runtime_start_on_system_startsg_timeoutixoldevloss_work_qELS_LS_ACCfasyncarg_startLPORT_ST_DISABLEDkprobes_text_sizekfunc_tabELS_TPLSblk_crypto_profileSKB_DROP_REASON_SKB_GSO_SEGfop_flagswork_lockoptionrom_version_addr_lsb_addrpfn_mkwritentimedriver_versionuaddrrtpoll_waitBPF_STRUCT_OPSfunc_proto_unreliableioerr_cnt_uidmm_states_fs_infomm_stats__rb_parent_colorWRITE_LIFE_EXTREMEicq_list__MAX_NR_ZONESmm_users_pp_mapping_padimagefn_domain_id_scopekey_serial_tno_uld_attachfolioqfoliosadisc_resv1adisc_resv2shost_groupssiblingscputimernrpageswake_q_nodeFC_PORTTYPE_NOTPRESENTblk_flags_tmap_fd_put_ptrs_maxbyteshd_geometryioctx_tabledma_io_tlb_memFC_FS_ACCfc_cmdrefeh_cmd_qfree_after_rcu_gpget_unique_idexpire_countcompact_init_migrate_pfnfor_syncwake_cpujited_lenPTR_TO_SOCKETlinfobio_splitfreeze_supertick_dep_masksp_e_d_tovvmpressurelruvecmap_check_btfiter_infoqc_infoobjcg_listfault_flagmodnameia_ctimeperf_rdpmc_allowedFC_VPORT_NO_FABRIC_RSCStrace_eval_mapcompact_defer_shiftorig_objcgrespasync_put_workresvnum_static_call_sitesZONE_MOVABLEl4_hashvm_lock_seqFORTIFY_FUNC_strncatroot_listBPF_TRACE_FENTRYElf64_Addrwait_queue_entry_tseqlock_tlatency_record_countnr_integrity_segmentshost_blockedmay_skip_resumeprot_flagsVTIME_SYSbase0base1base2SHOST_CREATEDbio_setfh_seq_idCONST_PTR_TO_DYNPTRBPF_MAP_TYPE_RINGBUFalignment_offsetlinksbasesfutex_staterseq_lenkobj_completionlesb_inv_wordi_spc_timelimitf_opnargsfc_els_fillbindcpuhp_onlineproc_ns_operationsold_prog_fdnum_discovered_portsBPF_PROG_TYPE_SK_REUSEPORTmm_mtgid_trelease_workSDEV_CREATEDavg_nr_triggersno_report_opcodesELS_RSCNBPF_PROG_TYPE_LWT_OUTrcu_read_unlock_specialBPF_CGROUP_UNIX_RECVMSGtls_arrayipvs_propertyfr_eoftask_io_accountingcss_rstat_flushf_raDEVICE_PANEL_FRONTmodule_memorynetkitsitescompat_robust_list_headfc_fdmi_hba_identifiercss_releasedthread_nodestatic_call_mods_shrinkgp_countRxWordsnr_sectorsbpf_raw_eventsiommutimer_expiresbpf_storagekset_uevent_opsf_ownerqfull__state_permDEVICE_PANEL_BACKmax_retry_countoffsetswb_switch_rwsemdisc_syscalldiskSHOST_DEL_RECOVERYjit_requestedsrcu_lock_counttrc_blkd_cpugp_wait__compiletime_assert_131FC_FDMI_HBA_ATTR_BIOSSTATEiommu_mmfuncSKB_DROP_REASON_TCP_OFOMERGEio_uring_taskshared_tagsrepeatjit_keyringLinkFailureCounts_fsnotify_infofunctionlinkagedisc_recv_reqia_mtimeFC_FDMI_GPATBPF_PROG_TYPE_CGROUP_SOCK_ADDRprojidmce_kill_mema_external_lockpid_linkskfree_skb_reasonconv_zones_bitmapscsi_target_ids_dio_done_wqRPORT_EV_FAILEDfor_kupdaternid_ip_verstart_all_reasonSKB_DROP_REASON_TCP_ZEROWINDOWhlist_head_pad3_ioc_nodethrottle_diskELS_FDISCbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACE__fortify_strlenrunningrw_hintblk_integrity_checksumdestroy_rworkdma_skip_syncpartition_meta_infotstamp_type_accessDEVICE_VERT_POS_LOWERBPF_CGROUP_ITER_ANCESTORS_UPnr_dying_subsysfc_well_known_fidclass_spinlock_irqsave_is_conditionalhba_attrsutf8datahlist_nulls_headrequeue_workof_node_reuseddyndbg_infoFC_FDMI_DPAFORTIFY_FUNC_strncpyElf64_Symreclaim_waitsaved_errd_rt_spc_softlimitpollsk_skb_reason_dropfree_file_infoin_lru_faultsp_lo_versched_contributes_to_loadtlb_genruntime_idlemap_counthost_scribblei_rt_spc_timelimitqc_type_states_dentry_lruac_comms_bdevskip_vpd_pagescrcssense_lenrun_listuevent_opsabort_workmax_cmd_lenbpf_func_statebpf_reg_typesched_classret_sizeutil_avganon_vmaFC_VPORT_LINKDOWNdevice_private_offset_pidsigcntDD_CLASS_TYPE_LEVEL_NAMEShas_callchain_bufELS_EVFPtailcall_target_stablebpf_cgrp_storagemodinfo_attrsst_spaceclass_map_typekparam_stringd_real_typemaxrsspoolcredBPF_MAP_TYPE_ARRAYkernfs_open_nodef_wb_errmm_cid_activeSKB_DROP_REASON_VXLAN_ENTRY_EXISTSdecryptedmodule_sect_attrsreq_flags_truntime_resumeac_stimescaledxfer_ddpgroup_exec_taskrestrict_linkirq_countget_inode_usageFC_TYPE_IPxarray_startbpf_ctxpm_domain_databw_dworkattach_btfmap_lookup_and_delete_elem__p_size_fieldload_avgrecordi_private_lockget_dqblktail_callmq_listrnid_phys_portprli_spp_lenphysical_block_sizepgoffportnetdevBPF_LIST_NODEdefault_setmodelfreeze_latemf_statsZONE_NORMALcount_objectsvma_numab_statedma_map_opsdq_dirtylnodemax_lunexit_cmd_privfd_typeELS_SCRF_NPORTatomic_write_boundary_sectorsboot_timewpcopy_countmax_queue_depthwrite_bytesSKB_DROP_REASON_SOCKET_BACKLOGeh_entryDISC_EV_FAILEDpending_eventsoom_reaper_listnumab_statefutex_offsetbpf_fdsubsys_fmt_prefixdq_lockintegritypte_tnr_scannedSKB_DROP_REASON_TCP_ACK_UNSENT_DATA__stateBPF_MAP_TYPE_UNSPECnr_iosk_listn_io_portslicecgroupdrv_groupstrack_queue_depthtruesizecustom_slicenext_target_idper_cpu_pagesstart_idbdi_listmq_freeze_depthpadding1RPORT_ST_READYnestedatomic_write_segments_maxwrite_endinsn_cntmap_set_for_each_callback_argsnr_dirtied_pausequeue_kobjdst_progreal_addressbd_holder_dirac_tgidinvalidate_locknum_exentriesfcp_cmd_sendfix_capacitycss_local_stat_showio_portvport_last_stateblk_mode_tpmdval_tspp_flagshost_tagsetBPF_GRAPH_NODEkveceh_noresumefree_areaset_latency_tolerancedepthd_ino_timerct_cmdprobenetlink_nsnr_argstokenSKB_DROP_REASON_TCP_CSUMdev_ueventfc_vportactive_uprobedep_mappage_mkwritelast_busyFC_FDMI_HBA_ATTR_DRIVERVERSIONvm_flags_toffloadnregnr_failed_migrations_affinelro_enabledd_in_lookup_hashdom_csetptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLERreschedule_countmax_hang_timeFC_PORTSTATE_UNKNOWNcmd_per_lunopt_failedcdl_enablecutimelockrefELS_RLIRnew_map_fdmap_meta_equaltlb_flush_batcheddev_privia_uidautogroupsequencercu_syncarg_endFC_FDMI_PORT_ATTR_DISCOVEREDPORTSclass_spinlock_irq_is_conditional_dummy_pkeyvruntimehostdataBPF_CGROUP_ITER_DESCENDANTS_POSTscanned_ct_resvd1_ct_resvd2SCALAR_VALUEnr_extentsstart_stop_pwr_condpidlistsWB_REASON_VMSCANfeatures_locked__kernel_pid_tdev_statedevice_blockedfc_hostfile_flagsPIDTYPE_SIDcinblockdma_alignmentprot_typeBPF_TCX_INGRESS__kernel_loff_tset_performance_stateserial_nodelru_gen_mm_statenotify_countsrc_regupdated_childrenactive_fc4sspin_lock_offBPF_CGROUP_SYSCTLsingle_lunhprobesg_reserved_sizeswap_activatedqb_isoftlimitsp_flogi_accsaved_auxvnoinstr_text_sizedl_overrunfc_no_free_exchiattrdetachedbootbios_versionloff_toom_flag_originfreepages_delay_totaldesc_lendma_devSKB_DROP_REASON_NETFILTER_DROPoom_score_adjwb_waitqSHOST_RECOVERYrq_end_io_fnksm_merging_pagestest_runDISC_EV_SUCCESSSKB_DROP_REASON_TC_COOKIE_ERRORgraph_parse_endpointrmidptp_rdataFC_FST_TIMEoxidFC_RCTL_P_RJTct_vendorlist_lrudevice_removablefc_seq_not_foundfxsavedev_pagemap_opsbv_offsetFC_NS_GID_FTBPF_MAP_TYPE_XSKMAPset_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETjobctld_lockrefbtf_typenr_populated_domain_childrenSCSI_EH_DONEsession_keyringshost_devbtf_log_true_sized_deleteuts_nsd_ino_softlimitfc_els_prlid_weak_revalidatealloc_time_nsi_devicesSKB_DROP_REASON_NEIGH_CREATEFAILFC_PORTSTATE_ERRORdqb_curspaceFC_FDMI_RPRTfs_contextSKB_DROP_REASON_XDPSKB_DROP_REASON_NO_SOCKETBPF_TRACE_KPROBE_SESSIONalloc_lockearly_inittotal_numa_faultswritable_sizefn_fc4_typeFC_FDMI_DPRTdma_need_drainobj_cgroupem_tableBPF_PROG_TYPE_TRACINGmq_sysfs_init_doneactive_queuescompact_consideredSKB_DROP_REASON_NEIGH_QUEUEFULL__lstatepercpu_drift_mark__BPF_REG_TYPE_MAXinodesubtree_bstatbd_fsfreeze_mutexhrtimeratomic_write_unit_maxFAULT_FLAG_UNSHARELossOfSignalCountlocal_fwnodetask_sizemust_resumeRPM_ACTIVEend_codePTR_TO_SOCK_COMMON_OR_NULLuintnr_free_highatomicpreempt_notifierstlb_flush_pendingmigration_flagsDEVICE_PANEL_RIGHTfast_io_fail_tmotx_wordscap_inheritablelesb_sig_losskobj_sigvaleh_timeout__stack_chk_failwritecntBPF_KPTR_PERCPUsrcu_n_exp_nodelayin_batchseqcount_spinlock_tFC_NS_GID_NNextra1extra2write_s64graph_get_remote_endpoints_rootstree_scanned__int128 unsignedFC_FDMI_PORT_ATTR_CURRENTFC4TYPEverifiedcpu_countcgroup_rstat_cpuevent_callbackwb_lcand_byteswait_sumuprobe_xol_opssg_suppmin_align_masknextevtfl_resvdthis_idfc_ct_hdr_fillrcu_segcblistread_s64reported_split_lockreturn_instancewait_countconfirm_switchFC_NS_GID_PNFC_NS_GID_PTnr_wakeups_affine_attemptspud_ti_ino_warnlimitmax_open_zonesrmtpnext_offsetFC_PORTTYPE_LPORTio_statuslp_mutexSKB_DROP_REASON_FRAG_REASM_TIMEOUTblindedct_revacpi_device_iddev_scratchctx_idutaskpoweroff_noirqactive_modesdev_dataFC_FDMI_HBA_ATTR_OPTIONROMVERSIONis_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexrec_resvdauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangsSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcss_setfwnode_handlegfp_ttypeqf_fmt_idlink_updatepagepageset_high_maxatomic_write_unit_minsleep_startELS_SCRF_FABmap_mem_usagememalloc_noiobegintypetabuse_192_bytes_for_3fnr_reserved_tagsBPF_PROG_TYPE_RAW_TRACEPOINT_WRITABLEi_crypt_infoFC_TYPE_NVMEretry_workDEVICE_HORI_POS_CENTERio_start_time_nsaudit_ttyrecov_retrybatch_sizedns_rdatanr_zonesfc_ns_rff_idspp_resp_pasi_errnonr_leaves_on_treequeue_ctxmin_shallow_depthfc_seq_sigchlddqb_itimeHPROBE_STABLEquota_format_type__ret_condbio_crypt_ctxpercpu_ref_func_tpm_message_tsplit_queueac_memBPF_CGROUP_INET4_POST_BINDpprevlip_countino_warnlimitremcsum_offloadexception_boundarybroken_fuabpf_iter_seq_infozone_wplugs_lockmnt_flagsac_stimemem_cgroup_reclaim_iterrange_endlast_mergememcg_nr_pages_over_highsw_reservedbpf_tokenwbt_flagsbpf_iter_fini_seq_priv_tcss_freeFC_NS_GPN_FTcpu_delay_totalobjcgfh_r_ctlno_read_disc_infoblock_startvm_area_structnum_gpl_symsselect_no_atnSKB_DROP_REASON_TCP_INVALID_SEQUENCEBPF_CGROUP_INET6_GETPEERNAMEis_extendednr_charged_bytesct_explanlong long unsigned intFC_FDMI_PORT_ATTR_CURRENTPORTSPEEDWRITE_LIFE_MEDIUM__builtin_memcpyBPF_MAP_TYPE_CGRP_STORAGEtmf_in_progressnext_addrSDEV_CREATED_BLOCKhuge_faulti_fopautasklast_task_numa_placementFC_NS_GPN_IDfortify_memcpy_chkSKB_DROP_REASON_IP_INADDRERRORSrnid_prot_portip_after_callrefcntfreeze_holderpsi_groupcdevperf_eventSKB_DROP_REASON_VXLAN_VNI_NOT_FOUNDunregfuncoom_groupseqcountBPF_XDP_CPUMAPclass_idbitsetallowed_cmdsbtf_field_typeinquiry_mutexcan_swapof_device_iddisk_statsmanage_runtime_start_stopadisc_cmdclass_migrate_is_conditionalnetwork_headermin_ratioclass_write_lock_is_conditionals_xattrpart__pkt_type_offsetb_dirty_timeli_loss_of_sync_countBLK_EH_RESET_TIMERil_prevPTR_TO_SOCK_COMMONd_initget_name_prefixused_mapsspan_seqlockfc_soffileattr_getthreaded_csets_nodeclass_groupsSDEV_TRANSPORT_OFFLINE__ret_warn_on__call_single_nodeunicode_mappathhigh_maxrstat_cpuSKB_DROP_REASON_DEV_HDRrecent_used_cpuruntimeold_time32_tsocket_pressureenforce_expected_attach_typeprli_len__state_sizeBPF_CGROUP_INET6_GETSOCKNAMEvportsunsigned int_fl_resvdsbitmapclass_irqsave_is_conditionalcore_kallsymsscsi_deviceSKB_DROP_REASON_IPV6_NDISC_BAD_OPTIONSs_fsnotify_maskscan_objectsbi_privatewb_id__real_strnlenfc_ct_fs_typeDD_CLASS_TYPE_DISJOINT_BITSfc_fdmi_reqevent_liststartupfr_fidkeyring_index_keyiov_iterd_rcustatic_key_falseuintptr_twake_entryrcu_tasks_holdoutfreezefprop_globalassoc_array_ptrbatchcacheBPF_TRACE_RAW_TPold_timespec32rcu_blocked_nodeFC_FST_DIRjiffies_at_allocfunc_idxfcp_frame_alloc_failuressubsys_datast_namegroup_nodei_mtime_secbus_dma_regionrp_statefh_rx_idSKB_DROP_REASON_TCP_OLD_ACKstatic_rqsstarget_sdev_userac_majfltdn_device_specificmce_kflagsFORTIFY_FUNC_memsetscheduledbus_dma_limitubufbtimeSKB_DROP_REASON_QUEUE_PURGEia_gidmigrate_foliohigh_minrq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrnext_posix_timer_idmq_ops_mapcounti_atime_secstarttimefile_costreschedule_jiffieshprobe_statei_sb_listquota_offmap_poke_runmap_delete_batchshm_clistmap_delete_elemwait_for_compfc_fdmi_dhbacb_headnf_skip_egresspages_skippedzone_wplugs_hash_bitspi_offsetac_flagfh_df_ctlpt_regsmmap_missexpires_nextblk_opf_tSKB_DROP_REASON_IP_INVALID_DESTreport_zoneskeyring_name_listnum_trace_bprintk_fmtiter_seq_infoSKB_DROP_REASON_TCP_AOKEYNOTFOUNDcdrom_device_infolruvec_stats_percpuaccess_statebpf_prog_statssdev_gendevwork_structtruelast_queuedreverseSKB_DROP_REASON_VXLAN_NO_REMOTEri_timernr_populated_threaded_childrenex_refcntpipe_bufsavg_last_updatebp_offsetswap_events_filefc_frame_freeprotectedbsyncrequestedsaved_scratch_registertracepoints_ptrsfcp_cleanupwifi_acked_validblock_maxstatic_keyqueue_rqsdev_boundlibfc_function_templatecsum_validFAULT_FLAG_VMA_LOCKtotalreserve_pageskswapd_order_sp_tot_seqdma_range_mapvaluesfc_fdmi_rplKOBJ_NS_TYPE_NONEctl_table_pollmin_slab_pages_dataFAULT_FLAG_WRITEshow_optionswait_queue_entryexpirep_leni_uidtagset_freedmax_sectorsexpiryfc_frame_payload_opperiodbmaprescue_workqueuerx_wordsmap_allocdispatch_wait_lockscsi_levelfc_ns_fidBPF_TRACE_UPROBE_SESSIONi_write_hintsuspended_timeread_byteszone_wplugs_worksum_sched_runtimes_writers_keySYSCTL_TABLE_TYPE_DEFAULTbpf_callback_tRPORT_EV_READYstart_boottimetimer_offentriesi_modecap_permittedfc_rport_priv_flags_2afcoe_rcv_infoBLK_UID_NAAstart_coderet_flagsvm_flagststamp_typesi_codeseqcount_spinlockBPF_PERF_EVENTheadHPROBE_GONElast_siginfosched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorsdworkdevice_dma_parametersdir_contextsaved_dst_attach_typeiopl_emulconsumersratelimit_statepower_statedq_flagsis_late_suspendedfieldsswap_plugcapture_controlPTR_TO_MAP_VALUE_OR_NULLwrite_beginoffline_nodequeue_offsetsized_strscpyclass_device_is_conditionalnon_rcuput_superfc_ns_rn_idshostbpf_exception_cbxdp_has_fragsdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_statbpf_cgroup_iter_orderctx_arg_info_sizertv_zeroddp_setupjitedopen_flagslegacy_namemap_lookup_percpu_elemfc_frame_payload_getFAULT_FLAG_INTERRUPTIBLEfc_elsct_initmap_token_fds_inodes_wbvport_delete_worksubsysfolio_queuedurationinner_transport_headerinit_fs_contextuprobe_taskf_mappingFcpPktAllocFailstailcall_bypassstart_stackBPF_MAP_TYPE_STRUCT_OPSprog_array_member_cntfh_ox_idDL_DEV_PROBINGi_linkWB_REASON_MAXstack_vm_areatgtid_bind_typefc_lund_hashBPF_SPIN_LOCKdl_server_pick_ftty_old_pgrpst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquotaorc_entrydma_drain_len__MAX_BPF_ATTACH_TYPESCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listutimemmapshrinkeralloc_dquotbw_time_stampmappingdl_defer_armedfc_ns_ftsmap_pollFC_NS_GA_NXTrunnable_sumcpu_scaled_run_real_totalshort unsigned inteventsget_rq_budget_tokenqueue_ramp_up_perioddevice_nodemm_walkgpl_compatiblefc_gpn_ft_resprequeue_listlocal_portFC_PORTSTATE_DIAGNOSTICSp_size_fieldpkt_typelong long intsym_vvar_start_hugetlb_cgroup_rsvdSKB_DROP_REASON_ARP_PVLAN_DISABLEsival_ptrproc_namepercpu_sizefc_vport_stateFC_PORTTYPE_UNKNOWNFC_FDMI_HBA_ATTR_MODELBPF_TASK_ITER_ALL__wsuminvalidate_foliois_vallocdrop_nsNOT_INITnr_queuesgenerationno_pm_callbackscountddp_targetd_parentpagessched_task_groupBPF_TIMERupdate_timetc_skip_classifymemcg_idpidsof_noderun_nodedata_sourcesubmit_bios_instancesvm_rcubd_start_sectctl_nodepage_table_locksysv_semquota_infoquota_enable__kernel_timer_twork_listresp_activeBPF_MAP_TYPE_PROG_ARRAYPTR_TO_PACKETdomain_tagmax_integrity_segmentscmaxrssit_real_incrprobestubextable_lenlast_arrivalwake_index_watermarkSKB_DROP_REASON_SOCKET_FILTERswap_rwreservemap_extrasplit_queue_lockFC_RCTL_DD_SOL_DATAseq_idevents_local_filesrcu_gp_seq_needed_expDEVICE_HORI_POS_RIGHTSKB_DROP_REASON_HDR_TRUNCSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOmy_qnr_thpsFC_FDMI_PORT_ATTR_PORTTYPElegacy_cftypesrnid_vend_specsysv_shmfopssuppress_bind_attrsinsnlen__page_1__page_2i_mutex_keykey_restrictionstatquota_writeFC_FDMI_HBA_ATTR_VENDORSPECIFICINFOdomainget_linkFC_PORTTYPE_NLPORTmax_depthctl_table_argdata_lenpriv_stack_ptrsnprintffl_vendblkcg_nodeforksa_flagsno_start_on_addcancelled_write_bytesdispatch_busyfcp_packet_alloc_failuresnbp_rl_startFC_RCTL_ACK_0task_worksadisc_hard_addratomic_write_hw_maxdfl_cgrp_ddebug_infoaddrsshrinker_info_unitstats_locknum_kpfc_fill_fc_hdrSTARGET_CREATED_REMOVEshost_gendevcsumMEMORY_DEVICE_PRIVATE__bd_flagssuper_blockbi_bvec_donemap_get_unmapped_areabus_typeget_named_child_nodeBPF_MAP_TYPE_PERCPU_CGROUP_STORAGE_DEPRECATEDassoc_arrayactorBPF_CGROUP_ITER_DESCENDANTS_PREbpf_offload_devkobj_ns_typedeferred_resumesched_shared_tagslong intcore_nodebdi_nodefr_typecn_device_specifictarget_btf_idmem_dqinfodevnodesaved_sigmaskac_uidBLK_UID_EUI64FC_TGTID_BIND_BY_WWNNMEMORY_DEVICE_PCI_P2PDMAac_nicedq_offpinsblkcg_mutexis_visiblecgrp_linksdisk_nameuuid_t__kernel_clockid_twritabledqb_bsoftlimit__fc_fill_fc_hdrvfork_donetask_cputime_atomicki_waitqra_pagesgroupmmap_compat_legacy_basedevice_dma_supportedsysfs_dir_lockscsi_cmnd_submitterFC_TGTID_BIND_BY_WWPNignored_posix_timerslockedsival_intia_filecancel_attachio_pagesSKB_DROP_REASON_TC_EGRESSwakeup_cntrequest_pendingdl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsfabric_nameclass_read_lock_irqsave_is_conditionalblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startfc_fdmi_rhbaavg_triggersFC_PORTSTATE_BYPASSEDctl_dirFC_PORTTYPE_PTProbust_list_headunsigned charwake_qfc_adisc_fillrange_startrethookspermanent_port_namenuma_scan_periodelem_countnr_tagswakeup_pathresult_maskFORTIFY_FUNC_memscanscsi_timeout_actionei_funcsBPF_NETFILTERtablesRPORT_ST_PLOGI_WAITpipe_inode_inforaw_spinlockmemcg_cgwb_frnblkio_delay_totals_iddomainnamektypebpf_attrBPF_PROG_TYPE_CGROUP_SYSCTLblk_mq_ctxnumportmigration_disabledSKB_DROP_REASON_FRAG_TOO_FARsystem_hostnameext_mutexfr_fspRPM_REQ_SUSPENDcancel_forkpgprot_ttracepoint_ptr_tfor_reclaim_skb_refdstphysical_locationELS_PDISCchildren_low_usagenum_vfPIDTYPE_MAXbi_sizemg_dst_csetvlan_protothrashing_countwatcherscrypt_ctxstopwait_maxclass_write_lock_irqsave_is_conditionalioveca_flagsiomapd_dnameScsi_Hostnr_migrations_coldbtf_value_type_idmnt_idmapseeksquotactl_opski_iopriovport_typesched_remote_wakeuptag_alloc_policymemcpysock_filterBPF_LIRC_MODE2tracing_graph_pauseread_itersuspend_latefront_padFC_TYPE_CTsdev_devmaxframe_sizerecoveredi_rwsembi_integrityexitio_uringeh_device_reset_handlerchild_ns_typeorderslave_bdevscommit_dqblkclass_local_lock_irqsave_is_conditionalmark_dirtyFC_FDMI_HBA_ATTR_SERIALNUMBERdevice_privatenr_ctxkernfs_opsnr_dying_descendantsoom_reaper_timermodulewb_bytesbd_securitynodeinfoqueue_lockf_pathstatic_call_siteself64_symunlinkmap_queuescpumask_var_ttime64_tdrivers_diri_gidFC_FDMI_HBA_ATTR_OSNAMEVERSIONtype_idFORTIFY_FUNC_strnlenrq_qosmark_deadicq_hintrmdirdq_dqbspeedmemory_failureblkcg_gqdma_flagsbtf_field_kptrSUBMITTED_BY_BLOCK_LAYERmax_hw_sectorsselectors_mtdmod_kallsymss_typefield_maskjits_use_priv_stackprog_bind_mapli_failure_unknownfini_seq_privateremount_fsbd_holdernext_idtask_delay_infopi_senew_utsnamejit_datarelative_fdin_useforwardrq_countMIGRATE_SYNC_LIGHTerrseq_tms_rdatakstatfslruvec_statsreclaimedmems_allowed_seqmax_user_discard_sectorsinsnsitarget_allocbug_listBPF_CGROUP_INET4_CONNECTmax_nr_cidmod_arch_specificDMA_NONEtransfersizepp_recyclesplit_queue_lensharebpf_net_contextprobe_addrno_cgroup_ownerSKB_DROP_REASON_DUP_FRAGdisc_stopftrace_timestampbi_iopriobypass_addrd_ino_warnsstack_depthkernfs_elem_attrBPF_PROG_TYPE_SK_SKBi_ctime_nsecrelative_idrbnodei_private_listbinfmtftrace_sleeptimedata_size_inBPF_CGROUP_ITER_ORDER_UNSPECi_statebv_pagedestructorpcpu_cidsupported_speedssched_migratedZONE_DMA32FC_TYPE_ILScgroup_tasksetdup_xol_addrdevice_configurePROBE_PREFER_ASYNCHRONOUSrcu_node_entryreverse_orderingBPF_MAP_TYPE_BLOOM_FILTERcgroup_bpffile_system_typeorig_ret_vaddrelsct_sendbtf_log_levelmmu_notifier_subscriptionsswap_iocbBPF_RB_ROOTdefault_groups__sifieldsb_ionr_watchesfind_special_pageDL_DEV_DRIVER_BOUNDadj_offcurr_ret_depthscr_cmdstarved_entryfc_flags__fillerdestroy_dquot__task_fpstatefilldir_tSKB_DROP_REASON_TCP_AOFAILUREget_reserved_spaceiopriomap_poke_untrackunreliablecreateBPF_PROG_TYPE_SCHED_ACTdirtied_time_whenstart_scan_seqreal_parenttimer_slack_nsmin_seqfc_rctlsym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerSKB_DROP_REASON_QDISC_DROPbd_openersdq_inuseofflinedev_pm_infomremaptime_nsin_memstallhost_self_blockednode_size_lockcss_extra_stat_showkptrpoweroff_latei_nlinkwakeupcb_listcpu_iditer_info_lenpushable_taskstty_audit_bufmaxlenkernel_cap_t__be16bpf_funcpoke_tabmems_alloweds_inode_lrucached_rqse_cset_noderecov_seqSKB_DROP_REASON_SKB_CSUMkf_rootmmap_compat_baseretvalpreparenr_threaded_childrenclock_op_might_sleepf_sb_errneed_mbd_namecheck_flagsi_sequencert_prioritykretprobe_instancescrypto_profile__be32token_createiov_basecpus_ptrFC_PORTSTATE_OFFLINEq_lockdep_mapb_more_ioloadfuncsfc_ct_cmdSTARGET_DELatomic_write_lensaved_tfxa_headdetachprog_ifindexmm_listSKB_DROP_REASON_NOMEMproperty_read_string_arrayget_statetracepoint_funcd_seqnuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmt__be64blkg_listnum_symtabexec_update_lockfscrypt_inode_infoFC_NS_RSPN_IDsplice_readSKB_DROP_REASON_SOCKET_RCVBUFFBPF_PROG_TYPE_SOCKET_FILTERSKB_DROP_REASON_TCP_RFC7323_PAWSSKB_DROP_REASON_MAC_INVALID_SOURCEFC_FID_TIME_SERVneed_qsctx_mapFC_VPORT_UNKNOWNbd_diskuid_gid_extentnumberszone_wplugs_wqWRITE_LIFE_SHORTsigpendingpi_entryBPF_MAP_TYPE_ARENAs_inodesdirtied_whenfc_prli_fillmap_direct_value_metaMIGRATE_ASYNCBPF_MAP_TYPE_PERCPU_CGROUP_STORAGEnext_scangsindexwrite_bandwidthcompletewatch_listli_prim_seq_err_counteh_abort_listBPF_CGROUP_UDP4_RECVMSGd_sibsleepable_refcntmodule_attributemax_host_blockedlogoneed_tsin_dpm_listwordworkmultiprocessquiesce_depthfbatchclass_task_lock_is_conditionalBPF_CGROUP_INET_INGRESStask_groupf_pos_lockperiod_timerBPF_FLOW_DISSECTORFC_FDMI_PORT_ATTR_PORTSTATEsk_buff_data_texpected_revisionbio_pooltimeout_workBPF_PROG_TYPE_LWT_XMITmac_lensrcu_barrier_completionBPF_MAP_TYPE_STACK_TRACEpacctblk_mq_tag_setflush_listSKB_DROP_REASON_TUNNEL_TXINFOcurr_targetvm_page_protbalanced_dirty_ratelimitbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatPTR_TO_PACKET_ENDperf_event_contextatomic64_tnoinstr_text_startctx_size_outddp_doneac_btime64HRTIMER_RESTARTrpm_autosuspend_delayac_gidnotify_timercorememfh_d_idBPF_MAP_TYPE_USER_RINGBUFLPORT_ST_LOGObusystack_canarynumattrsFC_NS_RFF_IDuser_keyring_registermax_write_zeroes_sectors_utimedn_unable_to_routetmf_work_q__fortify_size_flags_1_flags_2FC_TYPE_BLStaskstatsport_stateproactive_compact_triggerELS_FLOGIposix_acli_dio_countarch_rwlock_tdriversym_timens_pagerport_event_callbackprog_token_fdsysctlsoffsetPTR_TO_MEMrtpoll_taskprot_guard_typedev_iommuWB_REASON_SYNCmap_typeclass_rwsem_read_intr_is_conditionalcompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_usersSDEV_BLOCKbacking_dev_infoi_mappingheadersfc_ct_ms_filldiscard_alignmentbsg_deviceshow_statsnr_populated_csetss_vfs_rename_keysubmitteretypekfree_skbi_bytesnormal_prioblkio_countshost_datadispatch_waitBPF_MAP_TYPE_INODE_STORAGEsrcu_nodelast_mm_ciddelayedhdr_lenper_cpu_nodestatsSKB_DROP_REASON_TC_CHAIN_NOTFOUNDvaddrscsi_vpdis_softnext_cpugrab_current_nsclass_namesdisc_worknr_taskslock_class_keyfr_name_lenpriv_stack_requestedsum_exec_runtimememory_failure_statssetupdev_pin_infopoll_table_structmce_whole_pageELS_QOSRia_modercu_tasks_holdout_listFC_FDMI_GRHLsched_rt_mutexs_pinsswap_peaksnon_seqbpf_prog_arrayattach_func_protoELS_FDACDTpresent_pageshctx_listrenamecontiguousthrashing_delay_totalmajorfc_ct_reqktime_tPRJQUOTAlink_idzswap_lruvec_stateBPF_CGROUP_INET_SOCK_RELEASEkprobe_blacklistjump_entriesdio_offset_alignct_plenreserved_tagsdma_masksa_restorerqueuelistdatalenmkdirnextrelax_countrestore_earlyPIDTYPE_TGIDilencpu_run_virtual_totalmax_active_zonesdevice_physical_location_horizontal_positionattach_flagskfunc_btf_tabrportkobj_uevent_envkernfs_rootkprobes_text_startpid_typefown_structi_default_aclBPF_PROG_TYPE_LIRC_MODE2fregs_statemap_flagsBPF_PROG_TYPE_LSMzonerefshift__devicesFORTIFY_FUNC_strcpypendingfc_classBPF_MAP_TYPE_PERCPU_ARRAYdma_boundarybd_nr_sectorsnr_eventssdev_statekmemcg_idkstatanon_vma_namedq_hash__iovgp_stategrphiFC_RCTL_ELS_REQntabiommu_mm_datamap_for_each_callbackinvalid_crc_countnr_disk_swapinszone_wplugs_err_listma_flagsFC_NS_RNN_IDarch_uprobebio_issueSKB_DROP_REASON_IPV6_NDISC_NS_OTHERHOSTDL_DEV_UNBINDINGrefcountmmap_lockuprobe_multidevice_sizeLPORT_ST_RFF_IDzonelistprli_countELS_LS_RJTsrcu_reader_flavorbtf_fddumped_framespeerstimerqueue_nodeELS_FARP_REQELS_RNFTdiskseqdev_msi_infoiov_offsetnr_cpus_allowedFC_CT_REVuse_16_for_syncrt_mutex_waitermem_cgroup_per_nodekcompactd_pad_page_pooldq_dqb_lockf_flagsblk_qc_tshow_infoinner_map_fdslave_allocflush_requiredWB_REASON_FS_FREE_SPACEsg_tablememcg_vmstatskeyring_semattributesblk_queue_statsgrplomax_rport_retry_countkgid_tkey_userreadlinkoffline_disabledd_comparetime_ns_for_childreni_wb_frn_winnerELS_AUTH_ELSsighand_structELS_FACTstart_brkFC_FS_RJTELS_RNIDdisc_callbackmap_mmapdio_completeshost_statelocked_pendinglockdep_keyrnid_resvdextentfile_offsetFC_NS_GI_Astate_maskcore_statelink_upalignsym_int80_landing_padngroupsmajor_retriessp_offset__sigrestore_tRPM_SUSPENDEDvolnameDMA_TO_DEVICEmutexn_refattrsexch_mgr_resetBPF_TCX_EGRESSFC_VPORT_DISABLEDbi_sectoreh_deadlinefsbaseinactivelport_set_port_idsrcu_barrier_mutexloss_of_signal_countdirty_limitswregs_state__kernel_timespecchildren_min_usageeh_should_retry_cmdpglist_datad_lruwaitqmax_pkt_offsetd_fieldmaskcountersfaults_disabled_mappingnameidataarg_sizefailedpoweroffbpf_prog_opsbpf_verifier_envminorsnonresident_ageControlRequestselemsizerlim_curFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagscan_workdebugfs_entrywaitshow_rqcan_queuest_shndxreservedi_wb_frn_historyctxsprocess_keyringset_dqblkrestart_blocks_opbi_end_iokobjectposix_cputimer_basenr_memcgsleveluser_definedcow_page__warn_printkFC_SOF_Fnanosleepinvalid_tx_word_countfalsemax_npiv_vportscn_sig_alarmpi_state_listtv_secac_exitcodeBPF_KPTRsuidFC_SOF_I3prog_typekey_typedismissi_hashmm_cid_next_scanfreeze_noirqoublockdisc_idia_atime_timerfifovm_private_dataskip_ms_page_8FC_RCTL_BA_PRMTrtpoll_scheduledWB_SYNC_NONEBPF_PROG_TYPE_KPROBEorig_progadisc_resvdq_freeSHOST_RUNNINGFC_FDMI_HBA_ATTR_MANUFACTURERrootLPORT_ST_RNN_IDDISC_EV_NONEsupported_classespolicycpu_baseBPF_PROG_TYPE_SYSCALLcap_bsetnr_to_writerportsnr_items_sp_r_a_tovFC_FDMI_HBA_ATTR_NUMBEROFPORTSanon_costseq_startfcp_input_megabytesbp_regbvec_poolkern_versionrb_root_cachedfc_host_statisticsWB_REASON_FOREIGN_FLUSHmac_headeri_blkbitswritervm_pgoffvirtmem_refcounttarget_fdcsum_typeFC_RCTL_F_BSYLSKB_DROP_REASON_TCP_CLOSEbin_attributeELS_LOGOmath_emu_infopushable_dl_taskswrite_u64fc_fdmi_attr_entrytestWB_SYNC_ALLsched_infogroup_infotailsport_typedqi_fmt_idPTR_TO_ARENAfs_supersactive_extensionsmemcg_csssoftirq_next_timerrevisionis_child_subreapersg_tablesizeexit_codefile_lock_contexttracingnr_pageswriteback_indexread_u64fiemap_extent_infofilemempool_free_tPTR_TO_TCP_SOCK_OR_NULLfree_foliort_spc_warnlimitcmndatomic_write_hw_unit_mincompact_count_sk_redirtimer__empty_rangessbq_wait_statedev_namebpf_map__p_sizeBPF_PROG_TYPE_EXTBPF_PROG_TYPE_FLOW_DISSECTORnotified_atrport_bindingsn_klistwb_errbudget_tokenfc_frameFC_FDMI_DHATvlan_tcikswapdwrite_dquotrhbarefcount_offpercpu_pvec_drainedf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachewwnnstorebi_bdevst_infoFC_FDMI_DHBAdispatchdescsquiesced_bydqi_max_ino_limitllseeknet_nsRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleget_projidfunc_info_aux__sectorpart0cnvcswwwpnkqidmem_cgroupPTR_TO_BUFfree_inodenext_keysiglockwait_queue_func_tperf_recursionnr_wakeups_remoted_spacei_ctime_secdebugfs_idreal_func_cntnext_timer_typeBPF_TASK_ITER_TGIDTT_NATIVEused_map_cnt__empty_insnshlist_bl_nodenum_descsSKB_DROP_REASON_TCP_FLAGSELS_SCRF_CLEAR_head_1_head_2clockid__read_overflow2_fieldFREEZE_MAY_NESTsym_hvclock_pageremap_file_rangemmap_legacy_basepfmemalloc_waitend_dataxa_lockfutex_exit_mutexuse_16_for_rwiommu_groupmap_peek_elemnr_isolate_pageblockmempool_alloc_tdevice_get_dma_attrtarget_blockeddev_loss_worksp_hi_veralloc_inodepayloadbtf_field_graph_rootdirty_foliodn_unknownnode_zonesseq_countfscrypt_keyringis_hardasync_sizeSKB_DROP_REASON_INVALID_PROTOtrap_nrcopiedf_iocb_flagsctx_size_in__flagsRPORT_EV_LOGOkcompactd_waitnodenametotal_vm_entire_mapcountiteratorlastpool_dataqf_opsforce_atomic_pad1_LPORT_ST_RHBAreal_credno_difblkcnt_td_rt_spaceprog_idsBPF_MAP_TYPE_HASHsigned charmap_local_storage_chargehas_child_subreapermount_pad2_reasonblk_flush_queuesched_entitydev_links_infoinner_protocol_types_uuid_lenpcpufh_seq_cntdqi_privfc_els_cmdfmode_trpm_autosuspendrnid_att_nodessweventactivatefxregs_state_lowerpaddingct_optionspid_ns_for_childrenSKB_DROP_REASON_FULL_RINGtimestimer_rand_statelru_gen_memcgfr_encapsllist_nodebpf_run_ctxbio_slabstate_add_uevent_sentLPORT_ST_RSPN_IDenv_startmodule_notes_attrsio_cqlower_firstrangeSKB_DROP_REASON_TCP_RESETbvecSKB_DROP_REASON_NEIGH_FAILEDFC_FDMI_PORT_ATTR_HOSTNAMEacct_vm_mem1on_cpumanage_system_start_stopmg_src_preload_nodestringSHOST_CANCEL_RECOVERYnuma_preferred_nidmemsetELS_FPINfree_diskPTR_TO_MAP_KEYvmem_altmapbiotailwait_startelevatorqspinlockmin_unmapped_pagessrcu_barrier_seqi_aclssb_statnofaultbpf_map_typeia_rangesq_size_fieldis_reltablepteval_tFC_FID_DIR_SERVfc_els_cspfc_fdmi_dprtlog_levelblk_mq_tagsDEVICE_PANEL_LEFTorc_unwind_iprel_deadlinexfer_contig_endkobj_typeskip_settle_delaysb_writersdma_cleanupeh_timed_outdriver_datai387FC_FID_QOSdma_iommumax_idirq_safeLPORT_ST_READYrescue_lockdefault_timer_slack_nsxregs_states_statecompletion_cntSKB_DROP_REASON_LOCAL_MAC_deferred_listcurr_nrset_child_tidSKB_DROP_REASON_UNICAST_IN_L2_MULTICASTbio_vecacpi_match_tablenfdsrlimitBPF_TRACE_FEXITmap_update_elemlast_subtree_bstatnr_frozen_tasksiterrelease_agent_pathidle_notificationmodule_statertpoll_triggersPTR_TO_BTF_IDwait_lockf_pipegetgeocset_linkswrite_iterD_REAL_DATAsp_featuresacct_timexpdclock_mutexFC_FID_SEC_KEYnr_failed_migrations_runninguserfaultfd_ctxevent_flagsthread_structbuf_lenfc_rport_statemm_context_tbd_stampELS_RVCSdio_mem_aligncstimeRPORT_ST_FLOGIprot_capabilitiesFC_RCTL_BA_ABTSatomic_long_trpm_requestpositionMQ_RQ_COMPLETEio_comp_batchline_info_cntSKB_NOT_DROPPED_YETcftsf_credtrace_eventsfc_port_typed_iputlast_bstatnew_prog_fdnr_wakeups_syncklist_nodeELS_ADISCstackmap_release_urefBPF_REFCOUNTblockedvm_numa_eventdst_trampolinefc_rtv_fillallowedmce_countweighttotalblk_plugOutputRequeststrc_reader_nestingfpstatetag_setis_roxno_scsi2_lun_in_cdbprevseqcount_raw_spinlockbios_paramnum_orcskswapd_failuresFORTIFY_FUNC_kmemdupbuflenbpf_kfunc_desc_tabfc_exch_seq_senddeadBPF_CGROUP_DEVICEWRITE_LIFE_LONGcrc_offloadexpiry_activeeh_bus_reset_handlermtd_infois_confidentialvendor_identifieri_dentryfixupsFC_RCTL_BA_ACCvm_endvm_structproc_handlerprlimemcgfsyncfc_els_recsgid__fc_frame_header_getcompat_robust_listnuma_workELS_ECHOprioprivvaluercu_workBPF_CGROUP_INET4_GETPEERNAMEredirectedcurrent_stack_pointerac_minfltbpf_prog_aux_hugetlb_cgroupset_policyinternal_tagthreadftrace_callsitesmmlistservice_params__builtin_memsetBPF_CGROUP_SETSOCKOPTforceidle_sumusedpage_typeclass_spinlock_is_conditionaluserskb_iifmynodeseq_stop__MAX_BPF_PROG_TYPEblk_traceactionseconds_since_last_resetlink_detachpi_waitersdom_cgrprec_s_idqueue_mappingscsi_comp_flagslportfile_name_offbstatfailcntatomic_tpcp_listqueue_flagsBPF_PROG_TYPE_UNSPECrb_rootLPORT_ST_RPAfreepages_countutf8data_tableBPF_PROG_TYPE_SK_MSGprim_seq_protocol_err_countexe_fileuid_telementsd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_datadef_flagssrcu_n_lock_retriesraw_locksrcu_structprovinner_map_metaFC_FID_MGMT_SERVis_guestli_link_failure_countio_minrnid_ip_addrtarget_attrsrtpoll_wakeupsplice_eofs_sync_lockproganon_vma_chainfc_tgtid_binding_typei_mtime_nsecseq_opsrseq_event_maskem_pdi_fsnotify_maskshared_pending__int128__mce_reservedwriteback_controlmax_write_lenmm_struct__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEbuild_idhost_statss_export_opCONST_PTR_TO_MAPBPF_CGROUP_INET4_GETSOCKNAMElen_descseg_boundary_maskanon_namesched_dl_entitypp_ref_countactivest_otherlong intclass_write_lock_irqsave_is_conditionalqueue_mappingFLOW_DISSECTOR_KEY_IPnet_device___GFP_MEMALLOC_BITFLOW_DISSECTOR_KEY_ENC_IP__flagsdecryptedclass_spinlock_try_is_conditional___GFP_ZEROTAGS_BITndisc_nodetypesk_buff_data_tskb_extusersfc_frame_is_linearFORTIFY_FUNC_memchr_invTCA_FLOWER_KEY_FLAGS_TUNNEL_CRIT_OPT__rb_parent_colorktime_tunsigned intGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacknextcsum_fc_frame_allocll_nodeheadclass_raw_spinlock_irq_is_conditionalFLOW_DISSECTOR_KEY_ENC_CONTROLrefs___GFP_HIGHMEM_BITfc_frame_crc_checkFLOW_DISSECTOR_KEY_METAFC_SOF_I2FC_SOF_I3FC_SOF_I4fc_frame__UNIQUE_ID___addressable_fc_frame_alloc_fill615short intclass_rwsem_write_is_conditionalprotocolscsi_device_eventTCA_FLOWER_KEY_FLAGS_TUNNEL_CSUMFORTIFY_FUNC_strcpy__compiletime_assert_109prevFORTIFY_FUNC_strcatclass_local_lock_nested_bh_is_conditionalSDEV_EVT_POWER_ON_RESET_OCCURREDsender_cpufr_crcipvs_propertynf_traceSKB_EXT_BRIDGE_NFfc_frame_alloc_fillwifi_ackedcsum_validclass_raw_spinlock_nested_is_conditionallist___GFP_NORETRY_BIT__compiletime_assert_613fc_frame_initclonedclass_preempt_is_conditionalskb_trimclass_mutex_intr_is_conditional__compiletime_assert_110___GFP_UNUSED_BITl4_hash__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115__compiletime_assert_116__compiletime_assert_117class_irqsave_is_conditional___GFP_THISNODE_BIT___GFP_RETRY_MAYFAIL_BITFLOW_DISSECTOR_KEY_ARPno_fcs__kernel_size_tFLOW_DISSECTOR_KEY_CFMFLOW_DISSECTOR_KEY_MPLS_ENTROPY__UNIQUE_ID___addressable_fc_frame_crc_check607class_rcu_is_conditionallong long unsigned intfc_seqflow_dissector_key_idHCTX_TYPE_POLLencap_hdr_csum___GFP_RECLAIMABLE_BITSDEV_EVT_CAPACITY_CHANGE_REPORTEDblk_opf_t__pkt_type_offsetFLOW_DISSECTOR_KEY_ICMPFLOW_DISSECTOR_KEY_ENC_IPV4_ADDRS__kernel_ulong_tclass_task_lock_is_conditional___GFP_HIGH_BITFLOW_DISSECTOR_KEY_HASHclass_rwsem_write_try_is_conditionalrb_rightFLOW_DISSECTOR_KEY_ENC_PORTSTCA_FLOWER_KEY_FLAGS_IS_FRAGMENTvlan_tci__UNIQUE_ID_y_609granted_mac__compiletime_assert_111__compiletime_assert_112p_sizetailFLOW_DISSECTOR_KEY_ENC_KEYIDskb_mstamp_ns__compiletime_assert_610tstamp_type__compiletime_assert_118counterfr_sofsize_tclass_device_is_conditionalnetwork_headeroffsetrefcntreserved_tailroomcurrent_stack_pointerclass_spinlock_irq_is_conditionalFORTIFY_FUNC_memchrtstampclass_preempt_notrace_is_conditionalSKB_EXT_MPTCPvlan_all___GFP_NOMEMALLOC_BIT__UNIQUE_ID_y_612llist_nodeclass_raw_spinlock_irqsave_try_is_conditionalclass_mutex_try_is_conditionalencapsulationfcoe_rcv_info_nfctcsum_not_inettrueslow_gro___GFP_MOVABLE_BITclass_read_lock_irqsave_is_conditional_sk_redir___GFP_DIRECT_RECLAIM_BITerrorskb_iiffcloneFLOW_DISSECTOR_KEY_ENC_IPV6_ADDRSalloc_skb_fclone__alloc_skbrb_nodeheadersoffload_l3_fwd_markFLOW_DISSECTOR_KEY_IPSECchar___GFP_NO_OBJ_EXT_BIT__fortify_panictc_at_ingresscsum_startrb_left___GFP_LAST_BITclass_spinlock_irqsave_try_is_conditionalhctx_typefr_fspFLOW_DISSECTOR_KEY_PPPOEsockFC_SOF_N2FC_SOF_N3FC_SOF_N4class_migrate_is_conditional__u16__cloned_offsetchunks__u32FLOW_DISSECTOR_KEY_ETH_ADDRSFLOW_DISSECTOR_KEY_BASIC___GFP_DMA_BITclass_rwsem_read_is_conditionalip_summedFC_SOF_Factive_extensionsrbnodepayload_lenFORTIFY_FUNC_memsetfr_encapslong long intfc_fcp_pktFORTIFY_FUNC_memcmpFLOW_DISSECTOR_KEY_GRE_KEYIDmarkFLOW_DISSECTOR_KEY_CONTROL___GFP_FS_BITboolclass_raw_spinlock_is_conditionalSDEV_EVT_LUN_CHANGE_REPORTEDextensionsalloc_cpuSDEV_EVT_FIRSTclass_write_lock_irq_is_conditional___GFP_ZERO_BITSDEV_EVT_MAXBITS__ret_warn_onfc_sofpeekedSKB_EXT_NUMsizeclass_read_lock_is_conditionalFLOW_DISSECTOR_KEY_NUM_OF_VLANSclass_spinlock_irqsave_is_conditionalnohdrclass_spinlock_irq_try_is_conditionalremcsum_offloadsecmarktc_indexhead_frag_Boolskb_putFORTIFY_FUNC_UNKNOWNdataSDEV_EVT_MEDIA_CHANGEshort unsigned intcsum_complete_swTC_SKB_EXTinner_protocol_typefr_flagsFORTIFY_FUNC_strnlenFLOW_DISSECTOR_KEY_CTskb_ext_id__UNIQUE_ID_x_608hdr_lendata_lenclass_rwsem_read_try_is_conditionalclass_srcu_is_conditional__u64FORTIFY_FUNC_strlcatFLOW_DISSECTOR_KEY_TIPCclass_spinlock_is_conditionalFORTIFY_FUNC_memmoveFLOW_DISSECTOR_KEY_MPLSfr_seq__UNIQUE_ID___addressable__fc_frame_alloc614pfmemallocTCA_FLOWER_KEY_FLAGS_TUNNEL_DONT_FRAGMENTclass_local_lock_is_conditionalwifi_acked_validcsum_levelFORTIFY_FUNC_strscpyrefcount_thashclass_read_lock_irq_is_conditionalFLOW_DISSECTOR_KEY_FLOW_LABELHCTX_MAX_TYPESsk_buff__UNIQUE_ID_x_611priorityHCTX_TYPE_READsw_hashSKB_EXT_SEC_PATHdev_scratchdestructorFC_SOF_C4___GFP_IO_BIT___GFP_COMP_BIT__fortify_sizefr_devunreadable___GFP_DMA32_BITredirectedFLOW_DISSECTOR_KEY_L2TPV3__be16fortify_funcTCA_FLOWER_KEY_FLAGS_TUNNEL_OAM__write_overflowooo_okayinner_network_headerp_size_fieldfr_eofblk_mq_req_flags_tfc_lporttc_skip_classifyuintptr_tFLOW_DISSECTOR_KEY_TCPclass_irq_is_conditionalrefcount_structatomic_tnapi_idpkt_typelong unsigned int__u8vlan_protoFORTIFY_FUNC_strncpynf_skip_egress__TCA_FLOWER_KEY_FLAGS_MAXinner_mac_headerFORTIFY_FUNC_kmemdup___GFP_NOWARN_BIT___GFP_ACCOUNT_BITclass_raw_spinlock_try_is_conditionalSDEV_EVT_ALUA_STATE_CHANGE_REPORTEDinner_ipproto__int128skb_reserveSDEV_EVT_SOFT_THRESHOLD_REACHED_REPORTEDunsigned charSKB_EXT_MCTPtransport_headerFLOW_DISSECTOR_KEY_VLANfalseskb_is_nonlinear__write_overflow_fieldfortify_memset_chk___GFP_WRITE_BITclass_local_lock_irqsave_is_conditional__s64FLOW_DISSECTOR_KEY_IPV4_ADDRSFORTIFY_FUNC_memcpy__mono_tc_offsetlist_headTCA_FLOWER_KEY_FLAGS_FRAG_IS_FIRSTFLOW_DISSECTOR_KEY_PORTS_RANGEpp_recycleFLOW_DISSECTOR_KEY_MAXSDEV_EVT_MODE_PARAMETER_CHANGE_REPORTEDHCTX_TYPE_DEFAULTtruesizefillcsum_offsetmac_lenFLOW_DISSECTOR_KEY_ENC_OPTSinner_transport_headerFORTIFY_FUNC_strncat_skb_refdst___GFP_KSWAPD_RECLAIM_BITclass_local_lock_irq_is_conditionalSDEV_EVT_LASTclass_write_lock_is_conditionalcrc32_le___GFP_NOFAIL_BITsigned charoffload_fwd_markignore_dfinner_protocoltcp_tsorted_anchor___GFP_HARDWALL_BIT__wsumFLOW_DISSECTOR_KEY_CVLANclass_raw_spinlock_irqsave_is_conditionalclass_raw_spinlock_irq_try_is_conditional__int128 unsignedSDEV_EVT_INQUIRY_CHANGE_REPORTEDclass_rwsem_read_intr_is_conditionaldst_pending_confirmFORTIFY_FUNC_strlenclass_mutex_is_conditionalgfp_tFLOW_DISSECTOR_KEY_IPV6_ADDRSmac_headerFLOW_DISSECTOR_KEY_PORTSfr_max_payloadFORTIFY_FUNC_memscanfrom_ingresscall_get_stackstartparentlookupkernel_siginfowritten_stamp_sigpoll__compiletime_assert_109SKB_CONSUMEDinitializedSDEV_CANCELkill_sb__bi_remainingnum_bugsnr_requestscftypesecurity_supportedsock_fprog_kernklistusercntSKB_DROP_REASON_OTHERHOSTirq_delay_totalstate_entry_ptrfc_non_bls_respstatsfc_vports_linkchangedev_loss_tmo__compiletime_assert_118usersactive_basesDEV_DMA_COHERENTswap_slot_free_notifyELS_EXPL_INSUF_RESstart_databoolcompact_order_failedbv_len___GFP_RECLAIMABLE_BITinquirymodsctimefc_vport_set_staternid_atypedestroy_inodecma_pagesfutex_pi_statercu_read_unlock__compiletime_assert_127SKB_DROP_REASON_TCP_OLD_SEQUENCESKB_DROP_REASON_PKT_TOO_SMALLi_mutex_dir_keyrescue_workrestartsSKB_DROP_REASON_UDP_CSUMdevice_physical_location_vertical_positionget_aclset_aclac_exe_devmemory_tiers_voppercpudescpoll_bioiterate_sharedmemswsym_vdso32_sigreturn_landing_padfc_fpin_statscma_areafeatures__compiletime_assert_133rcu_tasks_exit_cpulink_fdmigrate_from_cpubd_size_lockwriteerror_codebuddy_listref_ctr_offsetsldt_structprog_attach_flagsfcp_control_requestscred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_nameVTIME_INACTIVEmg_src_cgrpeh_target_reset_handlerclass_preempt_is_conditionallink_createtimeouturing_cmdshrinker_idnr_dirtiedgetattrBPF_SK_SKB_STREAM_PARSERsetattrPTR_TO_TCP_SOCKvmstats_percpufixupblockMQ_RQ_IDLEdevtlast_cpufor_backgroundnr_wakeups_localcn_sig_warnuidhash_nodemax_ratioalloc_cpupost_attachworker_privatepoll_eventfc_fabric_logoffFC_FID_FLOGIalloc_factorfc_bsg_host_add_rportlinelinkbi_pooleffectivecompact_blockskip_flushmoderead_char___GFP_NOWARN_BITFC_FID_ALIASESnode_idPTR_TO_STACKtargetget_nextdqblkrcu_tasks_idxbsg_requestBPF_PROG_TYPE_NETFILTER__ret_do_oncejournal_infobi_inline_vecstqheadlast_used_atrq_end_io_retline_offhres_activeold_subtree_controllesb_link_failmod_namenotes_attrsdelay_workFC_VPORT_NO_FABRIC_SUPPblock_device_operationsoffset_ctxbi_blkgFREEZE_HOLDER_KERNELtail_call_reachablelast_switch_timefcp_output_requestscompact_init_free_pfnwakeup_countwait_indexSKB_DROP_REASON_IP_INVALID_SOURCE_head_2arunnable_weightSKB_DROP_REASON_NEIGH_DEADFC_VPORT_FAILEDmap_push_elemtarget_busyclass_releaselast_sum_exec_runtimeSKB_DROP_REASON_PACKET_SOCK_ERRORdd_key_trueFC_RCTL_ELS4_REPFC_RCTL_ELS4_REQfc_get_event_numbersa_handlerfree_countcg_listscsi_transport_templatelocked_vmqueue_rqaddressmq_hctxFCH_EVT_PORT_UNKNOWNstart_timeRPORT_EV_STOPzone_wplugs_hashkprobe_multicookielistWORKER_DESC_LENfreezer__pptrsig_okextabledma_data_directionmax_entriesi_sizeentry_eipcgroup_atypesplice_pipexstate_headerinquiry_lenrtpoll_timerdma_addrELS_TEST__pcpu_ptrem_perf_domaind_flags___GFP_HIGHMEM_BITdying_tasks_large_mapcountnode_present_pagespid_namespaceliveclock_was_set_seqspc_warnlimitseqcount_tmin_fltfr_wwnblock_devicethreadedfp_fidMEMORY_DEVICE_GENERICpkruBPF_MAP_TYPE_PERF_EVENT_ARRAYattribute_containerELS_AUTH_ELSprojid_tvendorvport_idmemcg_nodeBPF_CGROUP_UNIX_SENDMSGdma_lengthcn_clearkey_payloadadd_linksnbp_th_start__empty_insnsiuse_10_for_msfc_lport_disc_callbackELS_QSABPF_RB_NODE_dummy_bndrefcount_saturation_typeexception_cbBPF_TRACE_UPROBE_MULTIper_cpu_pagesetfcp_cmndsaved_stateparent_exec_idutil_sumdd_key_falsesigvaldev_to_shostfsnotify_mark_connector__ubuf_iovecsize_is_constantcputime_atomicdeadlinect_in_id__UNIQUE_ID___addressable_fc_lport_set_local_id678bio_integrity_payloadlun_in_cdbmodel_descriptionexit_requeste_d_tovwait_queuereclaimedfc_ns_rsnn_upperclass_write_lock_irq_is_conditionalcgroup_fileswap_readahead_infovtimeexpecting_cc_uarnid_resvs_rootli_device_specificstack_refcountgrpmaskdevice_attributes_remove_countBPF_SK_LOOKUPlru_genwrite_newuser_namespaceclass_rwsem_write_is_conditionalp_sizepids_active_resethlist_nodefc_ns_rspnblk_features_thbaidsuper_operationsautosleep_enabledwrite_file_infoload_sumaddress_spacecpus_maskdl_yieldedstarget_dataextension_progfile_dispread_newd_spc_softlimitfc_discuse_10_for_rwkrefrseq_csspp_flagss_lock_keydqi_flagsmq_ctxjump_entrypi_top_taskhlist_nulls_nodefc_els_lesbpacct_structac_padpathnameuser_sizelast_queue_ramp_upkref_getfc_lport_set_port_idbd_statsshow_fdinfoFC_RCTL_DD_DATA_DESCFAULT_FLAG_MKWRITEput_budgetfadviseFC_FST_MGMTclass_read_lock_irq_is_conditionallesb_inv_crclinenoMODULE_STATE_LIVEtask_listtc_at_ingressasync_scanPTR_TO_CTXFAULT_FLAG_RETRY_NOWAITBPF_CGROUP_SOCK_OPSread_foliosc_data_directionhas_elevatordtordq_countvpd_pg0nlinksignalnr_wakeups_passiveself_exec_idstate_syncedrjt_dataws_activefr_max_payloadf_epctl_tablercu_specialprog_fdscsi_device_handlerentryold_subtree_ss_maskbackWORK_STRUCT_FLAG_BITSBPF_MAP_TYPE_LRU_HASHfr_flagscgwb_domaincntsmsecs_to_jiffiessock___GFP_THISNODE_BITidr_rtsdev_bflagsdispatch_fromWORK_STRUCT_PWQ_SHIFTnr_linfoRPM_REQ_RESUMEFC_NS_GNN_IDmq_freeze_wqstart_prevent_timepgd_tsigset_twq_offLPORT_ST_DNSmap_btf_idbucket_idELS_PRLIFC_RCTL_LCRELS_PRLOrstat_flush_nextignoredgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64prog_idreserved_tailroomi_inoserver_has_tasks_killRPORT_ST_PRLIpgdati_spc_warnlimitunderflowf_posBPF_MAP_TYPE_HASH_OF_MAPSperformancesoftac_pidowner_trapnoload_weightBPF_PROG_TYPE_SOCK_OPSfc_fh_typesleepablevport_statesymlinkclass_rwsem_write_try_is_conditionalkmalloc_noprofbd_queueerror_framesin_iowaitfc_els_flogiDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclbdi_writebackrb_leftmost__UNIQUE_ID___addressable_fc_lport_logo_resp683SKB_DROP_REASON_TCP_AUTH_HDRdst_neededbug_addr_dispmigration_pendingscan_mutexhosttd_real__msecs_to_jiffiesns_commonmap_ifindexdevice_get_match_dataELS_GAIDs_max_linksctl_table_rootfc_rport_eventscatterlistverified_insnsthread_headacquire_dquotclockid_tfifo_timetarget_destroyzone_capacityFORTIFY_FUNC_strlenFC_EOF_DTIpgdval_td_managedevice_attrsmax_ctx_offsetis_late_suspendedmax_device_blockedback_padMIGRATE_SYNCwcharRQ_END_IO_FREEexplanseq_filefcp_output_megabytesonline_cntBPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATEDrestoreSKB_DROP_REASON_IPV6_BAD_EXTHDRline_infoseq_ptrHPROBE_LEASEDBPF_LSM_MACthaw_superspp_type_extalt_lenseq_operationslesb_prim_errfallocatelog_true_size__retdst_pending_confirmgranted_mac_call_addrwriteback_sync_modesi_mmap_rwsemSKB_DROP_REASON_TCP_INVALID_SYNundo_listattribute_groupdma_poolsFC_SPP_RESP_RESpersonalityprintk_index_sizeuprobe_task_stateWB_REASON_BACKGROUNDstimestatic_priotmpfileattach_func_namedata_indqi_formatnvcswcp_initrequest_payload_nr_pages_mappedfrequency__compiletime_assert_39rtpoll_totaldev_pm_ops__refcount_sub_and_test__kmalloc_indexpfmemallocblk_mq_ctxno_updateiter_type__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_44DEVICE_PANEL_BOTTOM__compiletime_assert_46__compiletime_assert_47__compiletime_assert_48scsi_pkt_lockencap_hdr_csumtransporttmap_get_next_keyspp_lenBPF_SK_REUSEPORT_SELECT_OR_MIGRATEnr_wakeupsquery_spp_resvdbpf_prog_typeenabledki_filpmultiple_queueswork_func_tmemcg_vmstats_percpupp_magicfpu_state_permfc_lport_bsg_respfwnode_reference_argsdevres_headused_maps_mutexfc_lport_enter_msRPM_REQ_IDLEfilenamebaseRPORT_ST_ADISCac_ppidd_prunerestore_noirqsysfs_registeredDumpedFramesSKB_DROP_REASON_TCP_TOO_OLD_ACKrlockBPF_PROG_TYPE_SCHED_CLSi_rt_spc_warnlimitqueueBPF_PROG_TYPE_CGROUP_SOCKbytesfc_fill_reply_hdrnuma_migrate_retryMEMORY_DEVICE_COHERENTenclavefiltersaved_dst_prog_typefc_lport_enter_nsroot_blkgd_revalidateLPORT_ST_SCRWB_REASON_PERIODICcgrpwatermark_boosttracepoints_incoredqsi_opsubtree_controlquota_syncsrcu_have_cbsmemory_peaksInvalidTxWordCountasync_in_progresssignumdqi_dirty_listpi_lockdirtied_stamptm_donetimespec64BPF_WORKQUEUEscan_finishedlesb_sig_lossreplace_bpf_fdmax_ct_payloadnr_forced_migrationsdst_mutexumount_beginchannelbadblocksnr_descendantsbootbios_statell_nodeport_idkernfs_nodecpumaskptrace_messagehton24lengthFC_RCTL_ACK_1__rcu_read_locktag_listbio_alloc_cachepdt_1f_for_no_lunfind_next_biti_wb_frn_avg_timeBPF_LIST_HEAD_pincountreclaim_statecur_imageruntime_errori_sb__poll_tbpf_jit_poke_descriptorsubvolon_dispatchdirty_inodesymtabd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structELS_LIRRfs_parameter_specSKB_DROP_REASON_MAXrcu_data0real_blockedfc_linkupruntime_suspendcp_open_seqspp_params__s16BPF_CGROUP_UNIX_GETPEERNAME__compiletime_assert_137wifi_ackedbacktraceschedule_delayed_workoffline_alreadys_umountn_nodeon_listcn_lost_creditrefaultsdata_vmneeds_force_resumeblk_eh_timer_returnbtf_recordcsum_levelrpm_statusscsi_host_statedeferred_split_queue__s32fr_resvdchildrenbpf_local_storage_map__mono_tc_offsetcheck_eventsmarkdqi_bgracei_wbhost_nof_inoderx_framesnext_rport_numberserialburstname_offpermissionsgraph_rootkernel_load_data_strELS_RJT_UNABcgroup_rootscsi_target_statehostmsi_device_dataslave_destroykallsymsmap_alloc_checki_ino_timelimitreply_payloadinit_timer_keybi_issuebd_holder_opsBPF_KPTR_REFlink_idscgwb_frnsrcu_idxSTARGET_CREATEDutil_est__s64ipc_nshugetlb_usagebpf_cookiesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenacct_rss_mem1___orig_eipsrcu_datadevice_physical_location__keycgtimebypass_spec_v1pagefault_disabledELS_CSUindexs_time_max__mutex_initfc_bsg_host_elsELS_RNIDF_GENucount_maxdelayed_workprog_flagsopen_partitionssa_maskkswapd_lockmmappedElf64_Wordold_dom_cgrpjited_imageactive_timeatomic_flagscallernum_jump_entriesextra_lenPIDTYPE_PGIDbtf_vmlinux_value_type_idmnt_namespaceelemwb_completionSKB_DROP_REASON_IP_LOCAL_SOURCEend_ioquotalenfc_lport_state_namessrcu_data_have_cbsnivcswoffdev_tidFCH_EVT_PORT_ONLINEpreamble_word0linfo_idxmce_vaddrBPF_CGROUP_UNIX_GETSOCKNAMEdl_dev_stateFC_RCTL_ENDshowrb_subtree_lasts_listBPF_MAP_TYPE_CGROUP_STORAGEhigh_workmq_pollsender_cpunr_segssame_target_siblingssp_plogitailcall_targetof_match_table_entryBPF_PROG_TYPE_CGROUP_DEVICEfc_tm_flagsino_timelimitalternative_gpt_sectori_readcountELS_ABTXFC_RCTL_IFRHblkcg_polsincrfreeseq_offloadrange_cyclicprog_cntlock_countreason_explanationthrotl_datalist_lru_onei_pagesmxcsrclass_rcu_is_conditionalarchdataptrace_entryuid_mapguest_permwait_queue_headfdmi_versionnum_srcu_structsnr_activeprev_sum_exec_runtimei_flagsgendisku_flagstag_set_listlogical_block_sizesubtree_ss_maskinvalidate_lock_keyinfol1d_flush_killctx_outFC_VPORT_ACTIVEtimestampsfc_els_sppcp_reciprlimit_maxwrite_beginSHOST_CANCELbpf_prog_offloadwrite_infohrtimer_restarts_encoding_flagssessionids_time_minSKB_DROP_REASON_UNHANDLED_PROTOWORK_STRUCT_PWQ_BITvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrbpf_iter_aux_infos_stack_depthnode_offsetkprobe_override__vm_flagsresid_lenqueue_depthbpf_tramp_imagecsum_offsetpm_messagememcg_lrufred_cschangedvportcur_ktimeinitfop_flags_tgroupsoffstty_structnotify_nextvirtual_dr6dma_opsmsgcodedma_addressmmap_basebd_devsyscall_workinit_cmd_privelowbpf_trampolinelockdep_mapnum_trace_evalsbidi_rq_addr_bndcgroup_base_statELS_RDFfl_wwnnELS_RDPset_dbd_for_msnumberzone_device_dataquota_readloss_of_sync_countcsp_flagshlistpinned_vmfunc_cntELS_RECwritepagesnuma_faults_localityqrwlockELS_RESPTR_TO_FLOW_KEYS__write_overflow_fieldrw_semaphoreattach_bpf_fdfirst_minori_blockstask_fragWB_REASON_LAPTOP_TIMERsource_listsum_block_runtimefc_lport_enter_disabledBPF_NETKIT_PRIMARYnuma_scan_period_max__compiletime_assert_656__compiletime_assert_657total_timepowerrequest_queuenum_ei_funcsi_generationFC_FID_NONEfcp_input_requestsflushBPF_PROG_TYPE_PERF_EVENTtask_fd_querymg_dst_cgrponlinecp_con_seqrnid_ip_addr__compiletime_assert_660__compiletime_assert_661__compiletime_assert_662__compiletime_assert_663__compiletime_assert_664BPF_PROG_TYPE_RAW_TRACEPOINT__compiletime_assert_666__compiletime_assert_667__compiletime_assert_668__compiletime_assert_669no_vpd_sizeformatlast_switch_countlast_wakee__cloned_offsetswap__compiletime_assert_670uint32_tssize_tRQ_END_IO_NONEvtime_statetry_vpd_pagesSKB_DROP_REASON_TCP_OFO_DROPparent_could_setfcapper_cpu_nodestat__compiletime_assert_680s_blocksizequeue_numprevent_sleep_timeBPF_MAP_TYPE_CGROUP_ARRAYclass_spinlock_irqsave_try_is_conditionals_readonly_remounti_io_listrefaultedspp_resp_pachild_countBPF_MAP_TYPE_ARRAY_OF_MAPSrelease_agent_workVTIME_IDLEBPF_PROG_TYPE_STRUCT_OPSwb_domaincgroup_subsysnbp_th_nr_candip_summedcompat_uptr_tcgwb_treeDEVICE_HORI_POS_LEFT_hugetlb_subpoolend_pfnuclamptgidfc_lport_bsg_requestlimits_lockreleasenr_wakeups_migrateserial_nrstack_vmi_fieldmaskupidBPF_CGROUP_INET_SOCK_CREATEprotection_supportkcompactd_highest_zoneidxfreeze_mutextrace_evalsELS_RLSia_vfsuidbtf_mod_pairquota_format_opsi_datarescue_listfsverity_infocore_threadclosidsched_avgRPORT_ST_PLOGIcodearch_atomic_fetch_addBPF_LSM_CGROUPbsg_jobu64_stats_syncsyscorenr_reserved_highatomic__i_nlinkpmd_tinumli_invalid_tx_word_countsrcu_barrier_cpu_cntbatchedreadaheadopt_sectorsFC_VPORT_FABRIC_REJ_WWNhrtimer_cpu_baseirq_domainwait_liststatic_call_trampac_etimefsverity_operationscoublockbug_tablemigrate_modesecmarkusing_gplonly_symbolswb_listremovedhandleremulatednr_writeback_throttledsym_vvar_pageELS_RPLmembarrier_stateELS_RPSBPF_PROG_TYPE_LWT_INFCH_EVT_LINKUPdma_pad_maskfc_seq_els_dataELS_RPSCBPF_KPTR_UNREFbin_sizeFORTIFY_FUNC_strlcatrcu_read_lock_nestingreg_typecb_accessrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_tio_bitmapDEVICE_VERT_POS_CENTERELS_RRQretry_countsbitmap_wordmanaged_pageslong unsigned inth_delrportmax_timelast_queue_full_countread_file_infoELS_RSSexec_startia_sizeema_listRPM_RESUMINGunpinned_netfs_wbMODULE_STATE_COMINGsym___kernel_sigreturnfc_lport_recv_rlir_reqZONE_DEVICEfunc_info_cntuser_cpus_ptrSKB_DROP_REASON_TCP_MD5FAILUREuser_scand_opstate_initializedrelease_dquotELS_RTVplugsoftirq_activatedkey_sizeinv_weightsecuritykernel_symboldl_timerlockdep_map_pmodule_param_attrsdirty_ratelimitno_read_capacity_16scsi_host_template__user_state_sizechainedVTIME_GUESTretriessdtrsysvsemdisconnectstasheduser_xfeatures__kmalloc_cache_noprofdisc_mutexuse_memdelaynr_cached_objectshas_timeout__empty_vendor_rsppayload_lencgroup_namespacecommcallback_headhead_fragexception_table_entryin_hrtirqctl_table_set_overruncondhash_lenDEV_DMA_NON_COHERENTcoredumpd_sbio_lock_cls_keyct_fs_typeSKB_DROP_REASON_IPV6_NDISC_FRAGfc_lport_ct_requestksetsleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsPTR_ERRnodesysvshmno_highmemdata_outREFCOUNT_ADD_UAFfirstSKB_DROP_REASON_TCP_FASTOPENELS_EXPL_UNAB_DATA_nfctSecondsSinceLastResetWORK_OFFQ_BH_BITactive_countRPORT_ST_RTVnr_active_requests_shared_tagsnum_tracepointsFC_NS_RSNN_NNvpd_pgb7ueventfc_pri_tasp_usharednext_cpu_batchmemcg_completionsdisk_eventss_sysfs_namesigval_trqst_qFC_FID_CLOCKfc_rport_destroySDEV_QUIESCEmap_pop_elembitsbase_pfnclass_mutex_try_is_conditionalsem_undo_listcompat_rmtph_elsclass_local_lock_is_conditionalELS_ESTCELS_ESTSstatic_key_trueno_fcs_stimeSKB_DROP_REASON_TCP_AONOTFOUNDinsns_sp_r_a_tovperf_event_ctxpprogsOutputBytesFC_NS_GSPN_IDcostxcomp_bvio_contextPIDTYPE_PIDwakee_flipsvlagufdsvlansegment_boundary_maskattach_tracing_progioctlprev_cputimectx_inbtf_flagshorizontal_positionem_perf_tablebi_crypt_contextprivateswp_entry_tcharFC_PORTSTATE_BYPASSEDmatchnr_failed_migrations_hotreg_offsetBPF_TRACE_KPROBE_MULTIfc_lport_recv_els_reqqueue_stoppedFORTIFY_FUNC_UNKNOWNwrite_charbin_attrscpu_itimerdevres_lockfiles_struct__UNIQUE_ID___addressable_fc_fabric_logoff675__ret_onceblk_zoneSDEV_RUNNINGicq_treePTR_TO_BTF_ID_OR_NULLvfsuid_tf_lockexec_vmkernel_parambtf_fieldfh_f_ctlget_lesbvertical_positionbtf_dtor_kfunc_traw_atomic_fetch_add_relaxedshutdown_prerelease_folioftrace_managedbi_io_vecvendor_idmtimearchrobust_listasync_probe_requestedthaw_earlyac_btimevectors_securityfc_frame_sidsplice_writeparam_lockreq_listi_opflagstot_write_bandwidthdentry_operationsstats_sectorss_blocksize_bitskfreeexp_hintclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapsw_hashstrnlen__per_cpu_offsetsym___kernel_vsyscallopen_mutexfortify_funcsk_buff_fc_frame_alloccan_forklow_usageget_timeki_flagss_inode_wblist_lockFC_FID_FCTRLpermwriteback_inodesERR_PTRdestroy_worklockableuprobes_statemm_counttrace_overrunargsargvcommand_codeuclamp_reqswap_info_structs_qcopwb_tcand_bytesblk_mq_queue_mapFC_VPORT_INITIALIZING__kernel_long_tsrcu_usagefaultableperf_event_mutexfctsFC_FID_BCASTexit_hctxqueue_delayed_work_onfc_xid_not_foundsync_modemap_gen_lookupin_execverlim_maxFC_PORTSTATE_MARGINALDEVICE_REMOVABLEsimple_tagstarget_listmutex_lockVLinkFailureCountbpf_kfunc_btf_tabrtpoll_next_updatecoherent_dma_mask__data_lendriver_flagsscsi_residfile_ra_statek_sigaction_hugetlb_hwpoisoninsn_offshrinker_infocompletionslld_event_callbackreadahead_controlfwnode_operationsprocs_fileswait_queue_headmemory_typevm_userfaultfd_ctxTT_NONEmap_pagesBPF_PROG_TYPE_TRACEPOINTSKB_DROP_REASON_TCP_ABORT_ON_DATAmod_tree_nodelocal_watermarkprobe_offsetct_fs_subtypecmd_flagss_bdev_filedev_pagemaptarget_private_offsetRPORT_ST_INITcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fsELS_RJT_BUSYhost_eh_scheduledsoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLErb_nodeELS_EXPL_PLOGI_REQDreturn_consumerround_robinksymi_private_dataroot_csetused_btfsptracer_credWORK_STRUCT_COLOR_BITSsrcu_barrier_headleadercheckTT_COMPATcap_effectivenetfilterexit_statefc_fcp_pktfaultscan_startprogs_hlistWORK_STRUCT_COLOR_SHIFTnuma_pages_migratedidr_nextsched_tagssupported_modeFC_FST_ALIASfc_els_rnid_fmtfiltersnr_frozen_descendantssbitmap_queueno_cgroup_migrationsched_databpf_func_info_auxprintk_index_startindex_keybreserved_tags__bi_nr_segmentsLPORT_ST_FDMIforce_scanintervalavgs_lockbug_entryzswap_maxtimers_activenum_classesprotocolbpf_cgroup_storagevma_lockrtpoll_untilkswapd_waitdl_throttledbpf_progseccompDEVICE_VERT_POS_UPPERrolesblk_holder_opsfc_lport_recv_rnid_reqfprop_local_percpustatic_key_modextensionsspp_orig_pafc_lport_ns_respfilter_countpsi_filesmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodecreate_work_queueFCH_EVT_LIPrport_delete_workumode_t__init_workfn_area_id_scopeinitial_nsno_pmGRPQUOTArnid_fmtia_vfsgidioctx_locktimer_slack_nss_bdixarrayjited_linfocan_wakeuptime_namespacepdeath_signalexpected_attach_typefc_lport_enter_resetdst_regnr_wakeups_idledqi_igraceqf_nextBPF_MAP_TYPE_LPM_TRIEmaple_treensproxyFC_SPP_RESP_INITELS_EXPL_OXID_RXIDslave_dir__p_len__write_overflow_pkeykernfs_rootFC_TYPE_ELSucountsget_next_idDD_CLASS_TYPE_LEVEL_NUMhooknumwrite_syscallslistscore_relo_rec_sizeels_coderefcount_tslow_grocmd_lenDEVICE_PANEL_TOPmemtiermax_hw_discard_sectorsint32_txol_areadefault_lockguess_capacitysrcu_gp_mutexdebugfs_dirwakee_flip_decay_tsprio_listnext_vport_numberlast_timerequestblk_unique_idFCH_EVT_PORT_OFFLINEwpcopy_delay_totalSDEV_DELbsg_replymax_payloadcontextSKB_DROP_REASON_TCP_ZEROWINDOWhost_lockrwlock_tvm_fault_tskb_extuse_autosuspendfc_rport_createclass_spinlock_irq_try_is_conditionalfc_disc_eventcfs_rqtree_reclaimedvirt_boundary_maskSKB_DROP_REASON_TCP_INVALID_ACK_SEQUENCEcgroupscore_occupationget_policycore_cookiepcrefrefcount_struct__kernel_ulong_tkf_opsfwnodeZONE_DMABPF_CGROUP_GETSOCKOPTcgroup_storagestatic_call_keycsum_startsysnamenamespaceSKB_DROP_REASON_IP_TUNNEL_ECNparametersbtf_sizeSKB_DROP_REASON_IP_INHDRgroup_leaderdma_channelrunnable_avglookaheadiowait_countli_loss_of_signals_countshstkioac__kernel_clock_t___GFP_DMA32_BITwas_resetgp_seqscsi_device_stateuuidmaj_fltWB_REASON_FORKER_THREADcached_requested_keyfp_flagsdqb_rsvspaceSKB_DROP_REASON_SUBSYS_MASK___GFP_NOMEMALLOC_BITmap_lookup_and_delete_batch__s8inode_operations__kernel_size_tdma_configurefile_leasepage_counterarg_flagsclass_local_lock_nested_bh_is_conditionalgpl_symsallowed_attachsFC_FDMI_GRPLrecursion_detectedpercpu_rw_semaphoresymbolic_namearch_spinlock_tseqcount_raw_spinlock_tbpf_iter_init_seq_priv_thighthread_pidmap_lookup_batchcss_idrrtpoll_min_periodemindl_non_contendinglso_maxcurr_ret_stackpgtable_t__u8q_usage_counterwakeirqi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyssdev_targetcore_forceidle_sumget_offset_ctxreleasedFC_SPP_RESP_INVL__UNIQUE_ID___addressable_fc_lport_init686export_operationsqc_stateremote_wwpnELS_LCLMget_budgetrx_fpBLK_INTEGRITY_CSUM_IPmempool_smempool_timplicit_on_dflFC_PORTSTATE_LOOPBACKd_inodespecial_vecpageset_batchworkqueue_structBPF_MAP_TYPE_SOCKMAPi_lock_keyuevent_suppressgraveyard_linkbi_opfscsi_cmndfail_io_workfs_superscall_get_func_ip__read_overflow2tcp_tsorted_anchorwce_default_on__rcu_icq_cache___GFP_KSWAPD_RECLAIM_BITcompact_cached_free_pfncap_ambientqstrtaskss_d_opBPF_MAP_TYPE_TASK_STORAGEno_report_lunsi_rcu__count__already_doneinit_requestFC_PORTTYPE_NPORTio_optspanned_pagespcountbio_listwlockedrtpoll_trigger_lockdevicemodule_kobjectmap_releaseELS_SCNPTR_TO_PACKET_METAELS_SCRmg_tasksBPF_TRACE_ITERpercpu_count_ptrnr_ia_rangesthawmap_update_batchlink_attach_flagstlbflush_unmap_batchremoveoffload_fwd_markfc_lport_recv_echo_reqbvec_iteroom_mmfcp_abort_iobpf_local_storagefr_crcname_linkSKB_DROP_REASON_PROTO_MEMrnid_vend_idcompat_long_tcnivcswmap_freeInvalidCRCCountPTR_TO_SOCKET_OR_NULLshort intkswapd_highest_zoneidxtrc_reader_specialgtimedisk_events_disable_depththread_group_cputimertransport_headersizemigrate_to_ramUTASK_SSTEP_ACKloginuiddesc_structi_wb_lists_umount_keyquota_typenameSKB_DROP_REASON_SKB_UCOPY_FAULTcgrp_ancestor_storagespp_typesetleasebitmap_tagsmnt_rootBPF_MAP_TYPE_SK_STORAGEpsi_flagsFC_SPP_RESP_CONDFC_SPP_RESP_CONFsubsys_masksighandbtf_key_type_idavgs_workaddrELS_EXPL_NONE__rcu_headac_utimeFC_PORTSTATE_DELETEDksm_zero_pagesBPF_MAP_TYPE_LRU_PERCPU_HASHqueuedataSKB_DROP_REASON_TCP_OFO_QUEUE_PRUNEprivate_dataBPF_MAP_TYPE_CPUMAPfc_lport_enter_logogid_mapFC_RCTL_F_BSYpageset_high_minfs_structfc_lport_confignuma_nodedev_archdatanr_perf_statess_flagsrcu_nodeorig_pmdrb_rightclock_baseBPF_SK_REUSEPORT_SELECTclass_irq_is_conditionallaunder_foliowake_batchis_funcs_vfs_rename_mutexElf64_XwordflockSKB_DROP_REASON_BPF_CGROUP_EGRESSiter_createFC_RCTL_DD_UNSOL_DATAhandler_datavalue_type_btf_obj_fd__paddingoffline_waitqnr_reclaim_startstatus_codeio_lockdep_mapatomic_write_hw_boundarymap_nr_maxiowait_sumdescriptionfolio_batchbi_nextblk_status_tUSRQUOTABPF_CGROUP_ITER_SELF_ONLYdriver_privateWORK_OFFQ_POOL_BITSpm_onlyd_rt_spc_warnsset_read_onlypgmapSKB_DROP_REASON_TAP_FILTERdiv_u64_remactive_refmap_owner_storage_ptrhctx_tablefc_xid_busykernfs_open_filelowmem_reserves_iflagsprintednr_hw_queuescodetagstate_mutexallowed_mapsctx_arg_infoinner_network_headerlast_queue_full_depthBPF_PROG_TYPE_SK_LOOKUPfc_frame_header_geth_addrportcid_worki_versionswap_deactivateflogisr_lockattachclass_rwsem_read_is_conditionalqueue_limitsunitil_weightstarved_listdma_parmsbdi_idKOBJ_NS_TYPEStstampfc_fdmi_port_namecmin_fltchunksSKB_DROP_REASON_VXLAN_INVALID_HDRarch_uprobe_taskfc_bsg_host_del_rportlicensewrite_protect_seqclearedkobj_ns_type_operationsshutdownevent_countsched_statisticslru_lock__kernel_uid32_tnode_zonelistsallocSKB_DROP_REASON_TCP_AOUNEXPECTEDb_attachedorig_pterq_timeoutkeysinit_nameper_cpu_zonestattc_indexfile_lockstatfsrw_semswappinessdevice_privatevm_policydl_deadlineLPORT_ST_RSNN_NNtracepoint_extELS_SRLclass_mutex_is_conditionalELS_SRRfpregs_stateWORK_STRUCT_PENDING_BITmemcg_datadqb_curinodesBPF_XDPfileattr_seteh_actionac_tgetimeRPORT_EV_NONEctels_replypage_linkno_write_samebtf_log_sizedn_timeoutDEVICE_PANEL_UNKNOWNFC_VPORT_FABRIC_LOGOUTPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetmce_ripvDL_DEV_NO_DRIVERbpf_arenafree_after_mult_rcu_gpret_stacknbp_rl_nr_candreal_timerFC_EOF_DTi_privatealloc_tagextended_state_areanum_kprobe_blacklistaccessmap_seq_show_elemfp_resvdsubdirsvariable__ffsdev_releasecgroup_freezer_statemlock_countBPF_PROG_TYPE_LWT_SEG6LOCALget_next_child_nodemempolicyfc_rportcacheline_padding_bandfd_arraypollfdblinding_requestedFC_RCTL_BA_RJTlaptop_mode_wb_timerdev_tfs_fdmi_attrsplatform_dataf_refprev_posenv_endfileattrs_subtypeusage_countpr_opsstate_in_sysfsdqb_ihardlimitSKB_DROP_REASON_TCP_MD5NOTFOUNDunlocked_ioctluprobebd_mappingFC_RCTL_DD_UNSOL_CMDkmem_cachenuma_next_scanLPORT_ST_FLOGIbudget_mapbsg_devsrcu_last_gp_endxfer_lentnodeclass_local_lock_irq_is_conditionalpage_listinner_ipprotoproperty_read_int_arraywdtrmq_rq_stateholders_dirMODULE_STATE_UNFORMEDst_valuelist_headptrace_bpsFC_RCTL_BA_RMCfc_port_states_user_nscan_attachhost_attrsmap_lookup_elem_sys_onlyfc_get_host_port_statetagset_refcntqueuecommand_may_blockmin_usagearch_tlbflush_unmap_batchquick_threadsELS_EXPL_INPROGdefer_syncBPF_TASK_ITER_TIDmissedfc_no_free_exch_xidusernsndisc_nodetypeBPF_UPTRvlan_allBPF_PROG_TYPE_CGROUP_SKBsum_sleep_runtimecleanup_rqd_spc_timerd_ino_hardlimitchange_cookiebi_statuscss_allocdl_periods_dquotErrorFramesfsnotify_sb_infomap_fd_get_ptrrecent_cida_opsftrace_opsprocnamepad_untilSKB_DROP_REASON_TCP_MINTTLmap_redirectperf_event_listinterval_expinsnBPF_CGROUP_UDP4_SENDMSGrstat_css_list___GFP_LAST_BITvm_node_stat_difftagski_completepgprotrnid_node_mgmtread_syscallstimespec_typebd_devicevmstatsdquot_operationsSKB_DROP_REASON_TC_INGRESSFC_EOF_NIposix_cputimers_workgsbase__lruvecBPF_CGROUP_INET_EGRESScompact_delay_totalio_tlb_memseq_showFC_RCTL_DD_UNSOL_CTLcpusfilesinblockbd_claimingtails_magicFC_RCTL_BA_NOPcontainersnuma_faultsmem_dqblktarget_ifindexnos_countstgt_delete_workfc_ns_reqstatusBPF_PROG_TYPE_CGROUP_SOCKOPTWRITE_LIFE_NONEread_countlink_speedBPF_CGROUP_INET6_CONNECTlport_listHRTIMER_NORESTARTscsi_privlast_update_timesas_ss_spold_map_fddisc_startfc_ns_rftpanel___GFP_ZEROTAGS_BITfc_rport_operationswatermarknode_start_pfnmax_allowed_capacityfc_statsopen_modeFC_RCTL_ELS_REPread_pos___GFP_ACCOUNT_BITclass_cpus_read_lock_is_conditional__UNIQUE_ID___addressable_fc_get_host_speed655mg_dst_preload_nodecpu_run_real_totalD_REAL_METADATAgpl_crcsFC_EOF_RTtimes_prevclass_raw_spinlock_try_is_conditionalfc_frame_headerkiocbmg_node___GFP_MEMALLOC_BITexecute_only_pkeyreturn_instancesma_lockblk_mq_queue_datacss_offlineattach_btf_tracedockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsELS_NACTFCH_EVT_LIPRESETFC_RCTL_DD_SOL_CTLwb_tcand_idFC_PORTTYPE_OTHERdentrysequential_iowait_pidfd__UNIQUE_ID___addressable_fc_fabric_login672prli_countcdb_statusInputRequestsSKB_DROP_REASON_SECURITY_HOOKs_writersgroup_stop_countavg_next_updateswap_lockvm_opswb_reasonpartial_bufread_before_msget_unmapped_areamkobjsym_VDSO32_NOTE_MASKr_elsfrozenactive_uprobeunregisteringget_parentmin_vruntimestoragesdebug_dirfr_namehost_resetfc_els_rnid_genclass_disable_irq_is_conditionalnew_statesyscrnr_mapssyscwsync_ionum_bpf_raw_eventswork_qcp_resv1orig_nentski_pose_csetsavx512_timestampfh_typeend_io_datae_freezeBPF_GRAPH_ROOTfree_cached_objectstaints_BoolFC_RCTL_DD_UNCATmax_tp_accessxol_vaddrb_dirtylist_lru_nodeuclamp_ses_time_granvm_statblk_integritykuid_tdev_pm_qosbd_holdersper_cpu_zonestats_sifieldstaskfc_host_event_codeBPF_CGROUP_INET6_BINDresetsched_reset_on_forkcompound_headnr_retriesshost_privwake_irqbranchi_cdevfunc_infoi_fsnotify_marksin_thrashingdl_deferBPF_MODIFY_RETURNvpd_pg80waitersvpd_pg83vm_startvpd_pg89mprotectquota_ond_automountDEVICE_REMOVABLE_NOT_SUPPORTEDrnid_genELS_EDCcsum_not_inetctl_table_headeratimeget_ownershipf_task_workfc_host_attrsmy_qfc_lport_stateBPF_SK_SKB_STREAM_VERDICTeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalFC_TYPE_FCPsectorinner_mac_headers_wb_err__q_sizecp_classattach_prog_fdcloseiopl_warnelevator_queueptraced__MAX_BPF_MAP_TYPEWORK_NR_COLORSdonesym___kernel_rt_sigreturnsrcu_struct_ptrsskip_ms_page_3fbinfmt_miscinodesencapsulationmemcg_awarezonehost_waitFC_PORTSTATE_LINKDOWNmanage_shutdownac_schedqsize_t__fpstatefc_frame_didmap_poke_trackfc_set_mfs__rcu_read_unlockBPF_MAP_TYPE_SOCKHASHqf_ownerqueue_delayed_worksuspend_noirqd_inamePTR_TO_MAP_VALUEbi_flagsfc_bsg_host_ctlinks_countprealloc_pterdevd_ino_countarg_lockskb_drop_reasonclass_rcu_tasks_trace_is_conditionalscsi_is_fc_rportDEVICE_REMOVABLE_UNKNOWNdoes_npivignore_childrenpoint_to_multipointfcp_out_bytesframe_sendBPF_CGROUP_UDP6_RECVMSGdirty_exceededfreeze_fsin_eventfdresume_earlymax_dev_sectorsdup_xol_workalimititemsooo_okaynuma_groupblk_independent_access_rangesdeferred_resumekmap_ctrlfscrypt_operationsrangesevents_lockfs_contextmnt_idBPF_CGROUP_INET6_POST_BINDretry_hwerrorfc_els_csspdrop_inodeBPF_MAP_TYPE_REUSEPORT_SOCKARRAYk_lockorc_unwindgraph_get_next_endpointfrom_ingresslast_sector_bugmq_mapprojid_mapkprojid_t__u16PTR_TO_XDP_SOCKlp_argsaved_end_ioBPF_MAP_TYPE_STACKsyscall_dispatchdl_densityon_rqfc_ns_gid_ftlru_gen_mm_walkaltmapmin_perf_statercu_tasks_exit_listlro_xidsp_regdma_drain_bufdhbalast_resets_master_keysflagsbd_holder_locknr_threadsvm_mm__u32query_flagsmax_secure_erase_sectorsseq_nextenable_statss_quota_typesvm_lockswapin_countremainderdisc_stop_final_ddebug__compiletime_assert_659FAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitoffload_l3_fwd_markSKB_DROP_REASON_NOT_SPECIFIEDdelayskcompactd_max_ordercp_ee_credmnt_nstimerqueue_head_cp_resv2BLK_INTEGRITY_CSUM_CRCsdev_groupskioctx_tableprioritybtf_func_modelksm_rmap_itemsclass_read_lock_is_conditionalKMALLOC_RECLAIM__u64revoked_at_folio_nr_pages__compiletime_assert_665fcp_packet_abortswritepageis_dirty_writebackpkey_allocation_mapLPORT_ST_DHBAdq_iddisable_depthem_perf_statethread_shstkfr_devTxWordsposix_timerswait_chldexitTxFramessas_ss_flagsunreadableunmap_limit_for_wspresent_early_pagesSKB_DROP_REASON_IP_INNOROUTESinsn_idxELS_RNFTPTR_TO_MEMbi_itersrcu_cblist_invokingiopollcsum_complete_swline_coliov_lenlatency_recordfc_lportdirty_limit_tstampsector_sizeskb_mstamp_nsfc_get_host_speed__BPF_REG_TYPE_LIMITd_releaseavg_totalfh_cs_ctldev_dma_attrBPF_NETKIT_PEERzswap_writebackexpiresnuma_scan_seqmnt_sbfl_wwpnblkcg_csshashnodemask_tref_cntsize_poke_tabsignalfd_wqhhang_detecteddevice_driverSKB_DROP_REASON_ICMP_CSUMlast_zone_capacitystatisticsfsindexout_batchFCH_EVT_PORT_FABRICraw_spinlock_ts_cops_activenum_argspidlist_mutexsp_bb_datatag_sizeBPF_MAP_TYPE_PERCPU_HASHlast_old_flushs_uuidfr_featclear_child_tidruntime_statusdqb_btimedq_opBPF_MAP_TYPE_DEVMAPELS_ADVCbidi_bioshow_pathdl_serverVTIME_USERquota_disablesched_delayedWORK_OFFQ_DISABLE_BITSsrcu_gp_seq_neededtask_structtimer_delaycurrent_may_mountkmalloc_cachesREFCOUNT_ADD_OVFpushpeaks_lockbpffs_fdpath_fdis_noirq_suspendedfwnode_endpointFC_NS_RFT_IDPTR_TO_TP_BUFFERcounterunique_idsuspendsupported_eventsoom_score_adj_minlast_bdp_sleepzone_wplugs_poolzone_typedomain_datacopy_file_rangesrcu_gp_startreport_zones_cbxa_flagsFC_EOF_Aattach_btf_idlru_gen_foliobtf_idFC_EOF_Nbpf_insnFC_EOF_Ttv_nsec__fc_linkupmax_zone_append_sectorssas_ss_sizeeh_eflagss_inode_list_lockUTASK_SSTEPraw_tracepointFC_RCTL_F_RJTehandlerdq_sbexpecting_lun_changescsi_targets_mountselem_flagsBLK_EH_DONEvm_stat_diffsym_pvclock_pageswapin_delay_totalfree_listBPF_CGROUP_UDP6_SENDMSGput_unaligned_be64page_fraginfo_lenrun_workfsuidRPM_REQ_AUTOSUSPENDsrcversiontrace_event_callwakeup_sourceis_partially_uptodatehost_faileddl_runtimemay_splitio_uring_cmdprogs_cntread_dqblkpeekedrtpoll_nr_triggerssrcu_parentinit_seq_privatebi_cookiesuppliersfile_operationsRxFramesSKB_DROP_REASON_TAP_TXFILTERbpf_ctx_arg_auxblist_flags_tmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotLPORT_ST_RESETis_preparedpgprotval_tmemoryfl_n_port_wwntrc_holdout_listELS_CSRasync_suspendq_nodezone_pgdatclass_mutex_intr_is_conditionalstrtabpage_freeftopdepends_onHPROBE_CONSUMEDi_mmapnr_cgrpsdirty_paused_whenirq_getrport_priv_sizefc_copy_buffer_to_sglist___GFP_COMP_BITcss_resetcapacitymax_channelversionlink_failure_countget_reference_argsllisthiwater_vmmax_perf_statebi_idxSKB_DROP_REASON_IP_RPFILTERcookiesfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntInputBytesrseqattach_typetarget_knlimit0limit1pi_blocked_onpid_tac_exe_inodevmemmap_shiftbpf_attach_typeELS_FARP_REPLusage__kernel_time64_tSKB_DROP_REASON_IPV6DISABLEDrq_qos_mutexkernel_read_file_strscsi_data_bufferSKB_DROP_REASON_IP_LOCALNETcapabilitiesi_securitydevice_physical_location_panellimitsfc_els_rnidq_lock_cls_keyenvpactive_memcg__targetsElf64_Halfallow_reinitSKB_DROP_REASON_IP_OUTNOROUTEStimer_autosuspendsratelimitfc_exch_doneSHOST_DELslave_configurestat_threshold_softexpiresautosuspend_delayline_info_rec_size_zonerefsi_flctxFC_PORTSTATE_ONLINEli_invalid_crc_countlist_lockvm_faultELS_RJT_INPROGip_epilogueoptimistic_spin_queuepermissionSKB_DROP_REASON_IP_NOPROTOvendor_cmdbpf_prog_array_itemin_fptransport_containerflush_listreap_refDEVICE_FIXEDlast_statusfdmi_enabledSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsslice_maxFC_RCTL_P_BSYIS_ERRmap_namebi_max_vecsthaw_noirqsched_debugfs_diraccounting_timestampserial_numbercan_matchtime_archrnid_sid_lencmd_sizechunk_sectorshlist_bl_headqc_dqblkLPORT_ST_RFT_IDcalledpasid_activatedancestorsmap_fd_sys_lookup_elem__fortify_panicbvec_integrity_poolBPF_XDP_DEVMAParch_data_oldfc_fabric_loginshrink_controlegidsupported_fc4sthreaded_csetsmax_rdonly_accessmap_direct_value_addrnet_deviceenvp_idxcrypto_kobjectcdb_cmd___GFP_NO_OBJ_EXT_BITf_modetagged_supportedoffloadsvpd_pgb0vpd_pgb1vpd_pgb2ff_type_mapzone_idxfolioruntime_autopref_node_forklru_zone_sizeclassipc_namespaceBPF_SK_SKB_VERDICTarenaprev_scan_seqfc_dl_perfpsi_group_cpufr_seqfc_rport_recv_reqwait_queue_head_talloc_hintfc_rport_lookupELS_RJT_FIPtask_cputimeFAULT_FLAG_INSTRUCTIONdeferred_splituser_nsfc_cdbnohdrsnprintfclass_raw_spinlock_irqsave_is_conditionalsyms_flagscgwb_release_mutexSKB_DROP_REASON_TCP_OLD_DATASKB_DROP_REASON_TCP_MD5UNEXPECTEDFC_PORTTYPE_NPIVsyncmq_freeze_locksg_prot_tablesized_childrenucountELS_EXPL_SPP_ICTL_ERRmap_local_storage_unchargectl_table_sizebpf_map_opsfc_rport_identifierseh_host_reset_handlerddebug_class_map__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115__compiletime_assert_116__compiletime_assert_117dfl_cftypes__compiletime_assert_119prealloc_bufFC_TGTID_BIND_BY_IDaudit_contextfl_owner_tipi_listBPF_MAP_TYPE_DEVMAP_HASHpersistent_keyring_register__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126i_pipe__compiletime_assert_128__compiletime_assert_129hardware_versionmachined_waitllist_headsense_buffernr_phys_segmentstask_itersnode_spanned_pagesavg_refaultedFC_RCTL_ENCH__UNIQUE_ID___addressable_fc_lport_destroy676wait_page_queuecn_credit_stallbpf_line_infoBPF_SK_MSG_VERDICTFAULT_FLAG_REMOTE__compiletime_assert_130dl_bw__compiletime_assert_132hierarchy_id__compiletime_assert_134__compiletime_assert_135__compiletime_assert_136unaccepted_pages__compiletime_assert_138i_dir_seqignore_dfheaderfc_lport_destroywatchdog_stampFC_FDMI_GHATstate_startlist_op_pendingdatafc_els_logosrcu_cb_mutexsysfs_lockBPF_CGROUP_UNIX_CONNECTallowed_progsno_callbackssaved_trap_nrclock_listbpf_func_infofolioq_slotMODULE_STATE_GOINGxattr_handlerac_utimescaledsg_cntrqos_debugfs_dirprot_sdbidr_baseunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_lockfromnextentseventkeytypeMissDiscAdvCount__kernel_gid32_tevicteddev_pm_domainnentsstart_time_nsfc_fdmi_requaddr2f_securityprot_opdefparamdiscard_granularitySKB_DROP_REASON_TC_RECLASSIFY_LOOPiotmo_cntclass_raw_spinlock_irq_is_conditionalq_sizefr_sofFC_PORTSTATE_BLOCKED__bi_cntrcuwaitattributes_maskcloneddl_defer_runningnpiv_enabledlru_gen_mm_listqueuecommandevents_filetagged_writepagesia_validsrculog_bufsp_bb_credreq_flagsiorequest_cntsrcu_size_jiffiesclassesstatic_call_sitecputimeis_seenupdated_nextfh_s_idsrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitmap_fdrchari_verity_infofn_resvd_addr_pkeyfpin_statsELS_TPRLOrw_copyfc_lport_flogi_respbi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countBPF_PROG_TYPE_XDPbpf_ksymSTARGET_RUNNINGFC_SOF_C4atomic_opennapi_idload_time__mptrsigactionrlimbtf_token_fdmce_addr__q_size_fieldf_freeptrSKB_DROP_REASON_TCP_OVERWINDOW__sighandler_tclass_spinlock_try_is_conditionalzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMESlrugenmax_target_blockedfs_flagsvm_filei_countfc_ct_hdruser_structmap_idaddress_space_operationsELS_LSTSFAULT_FLAG_USERkey_perm_tused_btf_cntbtf_log_bufeh_strategy_handlertimer_listverifier_zextmemory_eventscgwb_listrun_delaynum_ftrace_callsiteschange_queue_depthsrcu_cblistoffload_requestedblk_independent_access_rangedivisoravg_write_bandwidthtlb_ubcpgtables_bytesi_lrufirmware_versionfh_parm_offsetGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackFC_FID_MCAST_SERVtrc_ipi_to_cpuscsi_luncss_onlinePTR_TO_FUNCmemory_events_localallow_restartmin_sliceSKB_DROP_REASON_XFRM_POLICYSKB_DROP_REASON_IPV6_NDISC_BAD_CODEcommit_rqsfl_zerosysfs_opsinq_periph_qualcore_relo_cntrequest_len_find_next_bitFC_FDMI_RHATatomic_write_hw_unit_maxFC_SOF_I2cmaj_fltFC_SOF_I4bio_integrity_poolnf_traceFC_FDMI_RPAfc_linkdownkparam_arrayFORTIFY_FUNC_strscpyFC_FDMI_RHBAFcpFrameAllocFailspercpu_refevict_inodeignore_media_changertpoll_statesthread_keyringmap_nrcgroup_nscpumask_trstat_css_noderb_leftRPORT_ST_DELETEgfp_maskdma_addr_tinactive_timerattributefc_bsg_infoinner_protocolinit_hctxperiod_timemm_lock_seqFORTIFY_FUNC_memchrELS_FANkernfs_elem_symlinkBLK_UID_T10FC_TGTID_BIND_NONEwb_lcand_idFC_RCTL_DD_CMD_STATUS__kernel_dev_tcrypt_keyslotprog_namepm_domainBPF_CGROUP_INET4_BINDfc_rport_logoffmax_rdwr_accessmax_prop_fracfsgidsector_tcompact_cached_migrate_pfnnode_name_sys_privatesignal_structactive_mmFCH_EVT_RSCNFC_SOF_N3FC_SOF_N4kernfs_iattrsshow_devnamecn_oversubscriptionfc_bsg_rport_elsthread_infoi_mmap_writabledata_size_outattach_btf_obj_fdreadWORK_OFFQ_DISABLE_SHIFTr_a_tovnum_portsvalue_recsecondarydevicesatomic_write_max_sectorsgroup_exit_codefc_lport_ptp_setuptx_framesFORTIFY_FUNC_memcmpopc1REFCOUNT_SUB_UAFvalue_btf_idvendor_rspexec_maxrecvreason_codesync_statedev_groupsuts_namespacefcloneDMA_FROM_DEVICEzone_start_pfndividendvalue_sizeFC_NS_RPN_IDkernfs_elem_dirport_namepercpu_counter_printkDMA_BIDIRECTIONALcgroup_subsys_statesequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startELS_EXPL_SID__UNIQUE_ID___addressable_fc_lport_bsg_request687fc_els_resp_typeUTASK_RUNNINGopenseglen__compiletime_assert_45BPF_MAP_TYPE_QUEUEFORTIFY_FUNC_memcpy__kernel_ssize_tvdso_imagesi_signounused_hctx_lockfc_fdmi_rparseq_signpiv_vports_inuseresultrefsdelayed_calltime_slicefunc_info_rec_sizect_reasonnr_rangemax_seqSKB_DROP_REASON_DEV_READYspc_timelimituid_gid_mapnr_freeresumeset_ownershipELS_RNCbpf_iter_task_typeFC_PORTSTATE_NOTPRESENTregsbi_write_hintdprtSKB_DROP_REASON_PKT_TOO_BIGfc_lport_recvrq_nextsyscall_user_dispatchshort_inquiryattrd_aliasfc_bsg_host_vendoris_suspendedseq_priv_sizerp_mutexdqio_semrestore_sigmaskrequeue_lockSKB_DROP_REASON_CPU_BACKLOGkcsan_check_accessevent_worknr_deferredmem_cgroup_idsrcu_sspi_lockELS_NDACTuser_event_mmbtrace_seqs_devsiblingcdl_supportedia_rangetarget_sizemap_lookup_elemldt_usr_semrec_dataposix_cputimerslink_supported_speedstry_rc_10_firstRPM_INVALIDdd_datafreeze_kcountrequest_key_authblocksSKB_DROP_REASON_IPV6_NDISC_HOP_LIMITpercpu_ref_datad_spc_warnssrcu_supnbp_thresholdfreeptr_tLPORT_ST_DPRTns_typeRPM_REQ_NONEFC_RCTL_VFTHprog_btf_fdforce_runtime_start_on_system_startsg_timeoutixoldevloss_work_qELS_LS_ACCfasyncarg_startLPORT_ST_DISABLEDkprobes_text_sizekfunc_tabELS_TPLSblk_crypto_profileSKB_DROP_REASON_SKB_GSO_SEGfop_flagswork_lockoptionrom_version_addr_lsb_addrpfn_mkwritentimedriver_versionELS_RJT_UNSUPuaddrrtpoll_waitBPF_STRUCT_OPSKMALLOC_DMAfunc_proto_unreliableioerr_cnt_uidmm_states_fs_infomm_stats__rb_parent_colorWRITE_LIFE_EXTREMEicq_list__MAX_NR_ZONESmm_users_pp_mapping_padimagefn_domain_id_scopekey_serial_tno_uld_attachfolioqfoliosshost_groupssiblingscputimernrpageswake_q_nodeFC_PORTTYPE_NOTPRESENTblk_flags_tmap_fd_put_ptrs_maxbyteshd_geometryioctx_tabledma_io_tlb_memFC_FS_ACCfc_cmdrefKMALLOC_CGROUPspp_outeh_cmd_qfc_rport_flush_queuefree_after_rcu_gpget_unique_idNR_KMALLOC_TYPESexpire_countcompact_init_migrate_pfnfor_syncwake_cpujited_lenPTR_TO_SOCKETlinfobio_split___GFP_DMA_BITfreeze_superELS_RSItick_dep_masksp_e_d_tovvmpressurelruvecmap_check_btfiter_infoqc_infoobjcg_listfault_flagmodnameia_ctimeFC_VPORT_NO_FABRIC_RSCStrace_eval_mapcompact_defer_shiftorig_objcgasync_put_workresvnum_static_call_sitesZONE_MOVABLEl4_hashvm_lock_seqFORTIFY_FUNC_strncatroot_listBPF_TRACE_FENTRYElf64_Addrwait_queue_entry_tseqlock_tlatency_record_countnr_integrity_segmentshost_blockedmay_skip_resumeprot_flagsVTIME_SYSalloc_tag_countersbase0base1base2SHOST_CREATEDbio_setfh_seq_idCONST_PTR_TO_DYNPTRBPF_MAP_TYPE_RINGBUFalignment_offsetlinksbasesfutex_staterseq_lenkobj_completionlesb_inv_wordi_spc_timelimitf_opnargsfc_lport_enter_flogibindcpuhp_onlineproc_ns_operationsold_prog_fdnum_discovered_portsBPF_PROG_TYPE_SK_REUSEPORTmm_mtgid_tFCH_EVT_LINKDOWNrelease_workSDEV_CREATEDavg_nr_triggersno_report_opcodesfc_lport_rport_opsELS_RSCNBPF_PROG_TYPE_LWT_OUTrcu_read_unlock_specialBPF_CGROUP_UNIX_RECVMSGtls_arrayipvs_propertyELS_EXPL_UNSUPRfr_eoftask_io_accountingcss_rstat_flushf_raDEVICE_PANEL_FRONTfc_lport_ms_respmodule_memorynetkitsitescompat_robust_list_headfc_fdmi_hba_identifiercss_releasedthread_nodestatic_call_mods_shrinkgp_countRxWordsnr_sectorsremote_fidbpf_raw_eventsiommutimer_expiresbpf_storagekset_uevent_opsf_ownerqfull__state_permDEVICE_PANEL_BACKELS_RJT_INVALmax_retry_countoffsetswb_switch_rwsemdisc_syscall__UNIQUE_ID___addressable_fc_lport_recv681diskSHOST_DEL_RECOVERYjit_requestedsrcu_lock_counttrc_blkd_cpugp_wait__compiletime_assert_131WORK_OFFQ_FLAG_ENDiommu_mmfuncSKB_DROP_REASON_TCP_OFOMERGEget_unaligned_be64io_uring_taskshared_tagsrepeatjit_keyringLinkFailureCounts_fsnotify_infofunctionlinkagedisc_recv_reqFC_FDMI_GPATBPF_PROG_TYPE_CGROUP_SOCK_ADDRprojidmce_kill_meELS_RNIDF_NONEma_external_lockWORK_OFFQ_FLAG_BITSpid_linkskfree_skb_reasonconv_zones_bitmapscsi_target_ids_dio_done_wqRPORT_EV_FAILEDfor_kupdaternid_ip_verstart_all_reasonsystem_wqhlist_head_pad3_ioc_nodethrottle_diskELS_FDISCbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACErunningrw_hintblk_integrity_checksumdestroy_rworkdma_skip_syncnew_flppartition_meta_infotstamp_type_accessDEVICE_VERT_POS_LOWERBPF_CGROUP_ITER_ANCESTORS_UPnr_dying_subsysfc_well_known_fidclass_spinlock_irqsave_is_conditionalhba_attrsutf8datahlist_nulls_headrequeue_workof_node_reuseddyndbg_infoFC_FDMI_DPAFORTIFY_FUNC_strncpyfc_seq_els_rsp_sendElf64_Symreclaim_waitsaved_errd_rt_spc_softlimitpollsk_skb_reason_dropfree_file_infoin_lru_faultsp_lo_versched_contributes_to_loadtlb_genruntime_idlemap_counthost_scribblei_rt_spc_timelimitqc_type_states_dentry_lruac_comms_bdevskip_vpd_pagescrcssense_lenrun_listuevent_opsabort_workmax_cmd_lenbpf_func_statebpf_reg_typesched_classret_sizeutil_avganon_vmaFC_VPORT_LINKDOWNdevice_private_offset_pidsigcntDD_CLASS_TYPE_LEVEL_NAMEShas_callchain_bufELS_EVFPtailcall_target_stablebpf_cgrp_storagemodinfo_attrsst_spaceclass_map_typekparam_stringd_real_typemaxrsscredBPF_MAP_TYPE_ARRAYkernfs_open_nodefc_lport_resetf_wb_errmm_cid_activeSKB_DROP_REASON_VXLAN_ENTRY_EXISTSkzalloc_noprofdecryptedmodule_sect_attrsreq_flags_truntime_resumeac_stimescaledxfer_ddpgroup_exec_taskrestrict_linkirq_countget_inode_usagekmalloc_typeFC_TYPE_IPxarray_startbpf_ctxpm_domain_dataserver_pick_taskbw_dworkattach_btfmap_lookup_and_delete_elem__p_size_fieldload_avgrecordi_private_lockget_dqblktail_callmq_listrnid_phys_portphysical_block_sizepgoffportnetdevBPF_LIST_NODEdefault_setmodelfreeze_latemf_statsfl_n_port_idZONE_NORMALcount_objectsvma_numab_statedma_map_opsdq_dirtyREFCOUNT_ADD_NOT_ZERO_OVFlnodemax_lunexit_cmd_privkasan_check_writefd_typeatomic_write_boundary_sectorsboot_timewpcopy_countmax_queue_depthwrite_bytesSKB_DROP_REASON_SOCKET_BACKLOGeh_entryDISC_EV_FAILEDpending_eventsoom_reaper_listnumab_statefutex_offsetbpf_fdsubsys_fmt_prefixdq_lockintegritypte_tnr_scannedSKB_DROP_REASON_TCP_ACK_UNSENT_DATA__stateBPF_MAP_TYPE_UNSPEC_sp_rel_offnr_iosk_listn_io_portslicecgroupdrv_groupstrack_queue_depthtruesizecustom_slicenext_target_idper_cpu_pagesstart_idbdi_listfc_lport_state_entermq_freeze_depthpadding1errorRPORT_ST_READYnestedatomic_write_segments_maxinsn_cntmap_set_for_each_callback_argsnr_dirtied_pausequeue_kobjdst_progreal_addressbd_holder_dirac_tgidinvalidate_locknum_exentriesfcp_cmd_sendfix_capacitycss_local_stat_showio_portvport_last_stateblk_mode_tpmdval_tSKB_DROP_REASON_NEIGH_FAILEDhost_tagsetBPF_GRAPH_NODEkveceh_noresumefree_areaset_latency_tolerancedepthd_ino_timerct_cmdprobenetlink_nsnr_argstokenSKB_DROP_REASON_TCP_CSUMdev_ueventELS_RJT_NONEfc_vportdep_mappage_mkwritelast_busyfc_rport_loginvm_flags_toffloadnregFC_SPP_RESP_NO_PAnr_failed_migrations_affinelro_enabledd_in_lookup_hashdom_csetptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLERreschedule_countfc_fc4_conf_lport_paramslocal_fidmax_hang_timeFC_PORTSTATE_UNKNOWNcmd_per_lunopt_failedcdl_enablecutimelockrefELS_RLIRnew_map_fdmap_meta_equaltlb_flush_batcheddev_priv___GFP_HIGH_BITia_uidautogroupsequencercu_syncarg_endclass_spinlock_irq_is_conditional_dummy_pkeyvruntimehostdataBPF_CGROUP_ITER_DESCENDANTS_POSTscanned___GFP_HARDWALL_BIT_ct_resvd1_ct_resvd2SCALAR_VALUEnr_extentsstart_stop_pwr_condpidlistsWB_REASON_VMSCANfeatures_locked__kernel_pid_tdev_statedevice_blockedfc_hostfile_flagsPIDTYPE_SIDcinblockdma_alignmentprot_typeBPF_TCX_INGRESS__kernel_loff_tset_performance_stateserial_nodeELS_EXPL_AH_REQlru_gen_mm_statestate_remove_uevent_sentnotify_countsrc_regupdated_childrenactive_fc4sspin_lock_offBPF_CGROUP_SYSCTLsingle_lunhprobesg_reserved_sizeswap_activatedqb_isoftlimitsp_flogi_accsaved_auxvnoinstr_text_sizeELS_SBRPdl_overrunfc_no_free_exchiattrdetachedbootbios_versionloff_toom_flag_originfreepages_delay_totaldesc_lendma_devSKB_DROP_REASON_NETFILTER_DROPoom_score_adjwb_waitqSHOST_RECOVERYrq_end_io_fnksm_merging_pagestest_runDISC_EV_SUCCESSSKB_DROP_REASON_TC_COOKIE_ERRORgraph_parse_endpointrmidptp_rdataFC_FST_TIMEFC_RCTL_P_RJTct_vendorlist_lrudevice_removablefc_seq_not_foundfxsavedev_pagemap_opsbv_offsetFC_NS_GID_FTBPF_MAP_TYPE_XSKMAPset_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETfc_get_host_statsd_lockrefbtf_typenr_populated_domain_childrenSCSI_EH_DONEsession_keyringseeksshost_devbtf_log_true_sized_deleteuts_nsd_ino_softlimitd_weak_revalidatealloc_time_nsrcu_read_locki_devicesSKB_DROP_REASON_NEIGH_CREATEFAILFC_PORTSTATE_ERRORdqb_curspaceFC_FDMI_RPRTSKB_DROP_REASON_XDPSKB_DROP_REASON_NO_SOCKETBPF_TRACE_KPROBE_SESSIONELS_FDACDTalloc_lockearly_inittotal_numa_faultswritable_sizefc_fc4_del_lportmax_segmentsFC_FDMI_DPRTdma_need_drainobj_cgroupem_tableBPF_PROG_TYPE_TRACINGmq_sysfs_init_doneactive_queuescompact_considered__UNIQUE_ID_rcu679fc_debug_logging__lstatepercpu_drift_mark__BPF_REG_TYPE_MAXfc_bsg_host_vendor_replyinodesubtree_bstatbd_fsfreeze_mutexhrtimeratomic_write_unit_maxFAULT_FLAG_UNSHARE__compiletime_assert_658LossOfSignalCountlocal_fwnodetask_sizemust_resumeRPM_ACTIVEend_codePTR_TO_SOCK_COMMON_OR_NULLuintnr_free_highatomicpreempt_notifiersrqst_datatlb_flush_pendingmigration_flagsDEVICE_PANEL_RIGHTfast_io_fail_tmomap_poke_untracktx_wordscap_inheritablebpf_cgroup_iter_orderkobj_sigvaleh_timeout__stack_chk_failwritecntBPF_KPTR_PERCPUsrcu_n_exp_nodelayin_batchseqcount_spinlock_tFC_NS_GID_NNextra1extra2write_s64graph_get_remote_endpoints_rootstree_scanned__int128 unsignedverifiedcpu_countcgroup_rstat_cpuevent_callbackwb_lcand_byteswait_sumuprobe_xol_opssg_suppmin_align_masknextevtfl_resvdthis_idrcu_segcblistread_s64reported_split_lockreturn_instancewait_countconfirm_switchFC_NS_GID_PNFC_NS_GID_PTnr_wakeups_affine_attemptspud_ti_ino_warnlimitpreallocmax_open_zonesrmtpnext_offsetFC_PORTTYPE_LPORTio_statusfc_ct_cmdlp_mutexSKB_DROP_REASON_FRAG_REASM_TIMEOUTblindedct_revacpi_device_iddev_scratchctx_idutaskpoweroff_noirqactive_modesdev_datais_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangsSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcss_setfwnode_handleELS_EXPL_NOT_NEIGHBORgfp_ttype__vpp_verifyqf_fmt_idlink_updatepagepageset_high_maxatomic_write_unit_minsleep_startmap_mem_usagememalloc_noiobegintypetabuse_192_bytes_for_3fnr_reserved_tagsBPF_PROG_TYPE_RAW_TRACEPOINT_WRITABLEi_crypt_infoFC_TYPE_NVMEretry_workDEVICE_HORI_POS_CENTERio_start_time_nsaudit_ttyrecov_retrybatch_sizedns_rdatanr_zonesfc_ns_rff_idmutex_unlockjobctlsi_errnonr_leaves_on_treequeue_ctxmin_shallow_depthfc_seq_sigchlddqb_itimeHPROBE_STABLEquota_format_type__ret_condbio_crypt_ctxpercpu_ref_func_tpm_message_tsplit_queueac_memBPF_CGROUP_INET4_POST_BINDpprevlip_countino_warnlimitremcsum_offloadexception_boundarybroken_fuabpf_iter_seq_infozone_wplugs_lockmnt_flagsac_stimemem_cgroup_reclaim_iterrange_endlast_mergememcg_nr_pages_over_highsw_reservedbpf_tokenwbt_flagsbpf_iter_fini_seq_priv_tcss_freeFC_NS_GPN_FTcpu_delay_totalobjcgfh_r_ctlno_read_disc_infoblock_startvm_area_structnum_gpl_symsselect_no_atn__compiletime_assert_0__compiletime_assert_1SKB_DROP_REASON_TCP_INVALID_SEQUENCEBPF_CGROUP_INET6_GETPEERNAMEis_extendednr_charged_bytesct_explanlong long unsigned intWRITE_LIFE_MEDIUM__builtin_memcpyBPF_MAP_TYPE_CGRP_STORAGEtmf_in_progressnext_addrSDEV_CREATED_BLOCKhuge_faulti_fopautasklast_task_numa_placementFC_NS_GPN_IDfortify_memcpy_chkSKB_DROP_REASON_IP_INADDRERRORSrnid_prot_portip_after_callrefcntfreeze_holderpsi_groupcdevperf_event__UNIQUE_ID___addressable_fc_linkdown674SKB_DROP_REASON_VXLAN_VNI_NOT_FOUNDcp_rdfsELS_RJT_LOGICunregfuncoom_groupseqcountBPF_XDP_CPUMAPclass_idbitsetWORK_STRUCT_LINKED_BITallowed_cmdsbtf_field_typeinquiry_mutexcan_swapof_device_iddisk_statsmanage_runtime_start_stopclass_migrate_is_conditionalnetwork_headermin_ratioclass_write_lock_is_conditionals_xattrpart__pkt_type_offsetb_dirty_timeli_loss_of_sync_countBLK_EH_RESET_TIMERil_prevPTR_TO_SOCK_COMMONd_initmax_slack_shiftget_name_prefixused_mapsspan_seqlockfc_soffileattr_get__kmalloc_noprofthreaded_csets_nodeclass_groupsSDEV_TRANSPORT_OFFLINE__ret_warn_on__call_single_nodeunicode_mappathhigh_maxSKB_DROP_REASON_DEV_HDRvendor_replyrecent_used_cpuruntimeold_time32_tsocket_pressureenforce_expected_attach_type__state_sizeBPF_CGROUP_INET6_GETSOCKNAMEvportsunsigned int_fl_resvdsbitmapclass_irqsave_is_conditionalcore_kallsymsscsi_deviceSKB_DROP_REASON_IPV6_NDISC_BAD_OPTIONSs_fsnotify_maskscan_objectsbi_privatewb_id__real_strnlenfc_ct_fs_typeDD_CLASS_TYPE_DISJOINT_BITSh_vendorevent_liststartupfr_fidkeyring_index_keyiov_iterd_rcustatic_key_false___GFP_DIRECT_RECLAIM_BITuintptr_twake_entryrcu_tasks_holdoutfreezefprop_globalassoc_array_ptrbatchcacheBPF_TRACE_RAW_TPold_timespec32rcu_blocked_nodeFC_FST_DIRjiffies_at_allocfunc_idxfcp_frame_alloc_failuressubsys_datast_namegroup_nodei_mtime_secbus_dma_regionrp_statefh_rx_idSKB_DROP_REASON_TCP_OLD_ACKfc_lport_logo_respstatic_rqsstarget_sdev_userac_majfltdn_device_specificmce_kflags___GFP_NORETRY_BITFORTIFY_FUNC_memsetfc_bsg_requestscheduledbus_dma_limitubufbtimer_ctfc_lport_add_fc4_typeSKB_DROP_REASON_QUEUE_PURGEia_gidmigrate_foliohigh_minrq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrnext_posix_timer_idmq_ops_mapcounti_atime_secstarttimefile_costreschedule_jiffiesWORK_BUSY_RUNNINGhprobe_statei_sb_listquota_offmap_poke_runmap_delete_batchshm_clistfn_fc4_typemap_delete_elemwait_for_compfc_fdmi_dhbacb_headpages_skippedzone_wplugs_hash_bitspi_offsetac_flagfh_df_ctlfc_lport_errorpt_regsmmap_missexpires_nextblk_opf_tSKB_DROP_REASON_IP_INVALID_DESTreport_zoneskeyring_name_list___GFP_ZERO_BITnum_trace_bprintk_fmtiter_seq_infoSKB_DROP_REASON_TCP_AOKEYNOTFOUNDcdrom_device_infolruvec_stats_percpuaccess_statebpf_prog_statssdev_gendevwork_structtruefc_lport_enter_fdmilast_queuedreverseSKB_DROP_REASON_VXLAN_NO_REMOTEri_timernr_populated_threaded_childrenpreamble_word1preamble_word2pipe_bufsavg_last_updatebp_offsetkmalloc_cache_typeswap_events_filefc_frame_freeprotectedbsyncrequestedsaved_scratch_registertracepoints_ptrsfcp_cleanupwifi_acked_validblock_maxstatic_keyqueue_rqsdev_boundlibfc_function_templatecsum_validFAULT_FLAG_VMA_LOCKtotalreserve_pageskswapd_order_sp_tot_seqdma_range_mapvaluesfc_fdmi_rplKOBJ_NS_TYPE_NONEctl_table_pollfc_els_rjt_explanmin_slab_pages_dataFAULT_FLAG_WRITEshow_optionswait_queue_entryexpirep_leni_uidtagset_freedmax_sectorsexpiryfc_frame_payload_opperiodbmaprescue_workqueuerx_wordsmap_allocdispatch_wait_lockfc_ns_rn_idscsi_levelfsaveBPF_TRACE_UPROBE_SESSIONi_write_hintfl_csspsuspended_timeread_byteszone_wplugs_worksum_sched_runtimes_writers_keySYSCTL_TABLE_TYPE_DEFAULTbpf_callback_tRPORT_EV_READYstart_boottimetimer_offentriesi_modecap_permittedfc_rport_priv_flags_2afcoe_rcv_infoBLK_UID_NAAstart_coderet_flagsvm_flagststamp_typesi_codeseqcount_spinlockBPF_PERF_EVENTheadHPROBE_GONElast_siginfosched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorssg_listdworkdevice_dma_parametersdir_contextsaved_dst_attach_typeiopl_emulconsumersratelimit_statepower_statedq_flagsrstat_cpufieldsswap_plugcapture_controlPTR_TO_MAP_VALUE_OR_NULLraw_atomic_fetch_sub_releasebsg_bufferoffline_nodequeue_offsetbsg_job_doneclass_device_is_conditionalnon_rcuput_superwrite_endshostFCH_EVT_LINK_UNKNOWNbpf_exception_cbxdp_has_fragsdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_statctx_arg_info_size__kmalloc_large_noprofddp_setupjitedopen_flagslegacy_namemap_lookup_percpu_elemfc_frame_payload_getFAULT_FLAG_INTERRUPTIBLEmap_token_fds_inodes_wbvport_delete_worksubsysfolio_queuedurationct_mr_sizeinner_transport_headerinit_fs_contextuprobe_taskELS_RPBCf_mappingFcpPktAllocFailstailcall_bypassstart_stackBPF_MAP_TYPE_STRUCT_OPSprog_array_member_cntfh_ox_idDL_DEV_PROBINGi_linkWB_REASON_MAXfc_frame_allocstack_vm_areatgtid_bind_typefc_lund_hashBPF_SPIN_LOCKdl_server_pick_frefcount_dec_and_testtty_old_pgrpst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquotaorc_entrydma_drain_len__MAX_BPF_ATTACH_TYPESCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listutimemmapshrinkeralloc_dquotbw_time_stampmappingdl_defer_armedfc_ns_ftsmap_pollFC_NS_GA_NXTrunnable_sumatomic_fetch_sub_releasecpu_scaled_run_real_totalshort unsigned inteventsget_rq_budget_tokenqueue_ramp_up_perioddevice_nodemm_walkgpl_compatiblefc_gpn_ft_resprequeue_listlocal_portFC_PORTSTATE_DIAGNOSTICSp_size_fieldpkt_typelong long intsym_vvar_start_hugetlb_cgroup_rsvdfc_lport_enter_dnsSKB_DROP_REASON_ARP_PVLAN_DISABLEsival_ptrproc_namepercpu_sizefc_vport_stateFC_PORTTYPE_UNKNOWNBPF_TASK_ITER_ALL__wsuminvalidate_foliois_vallocdrop_nsNOT_INITELS_RJT_VENDORWORK_STRUCT_INACTIVE_BITnr_queuesgenerationno_pm_callbackscountELS_RJT_PROTddp_targetd_parentpagessched_task_groupBPF_TIMERupdate_timetc_skip_classifymemcg_idvendor_uniquepidsof_noderun_nodedata_sourcesubmit_bio___GFP_UNUSED_BITs_instancesvm_rcubd_start_sectctl_nodepage_table_locksysv_semquota_infoquota_enable__kernel_timer_twork_list__fc_linkdownBPF_MAP_TYPE_PROG_ARRAYPTR_TO_PACKETdomain_tagmax_integrity_segmentscmaxrssit_real_incrprobestubextable_lenlast_arrivalwake_index_watermarkSKB_DROP_REASON_SOCKET_FILTERswap_rwrdatareservefc_lport_recv_logo_reqmap_extrasplit_queue_lockFC_RCTL_DD_SOL_DATAevents_local_filesrcu_gp_seq_needed_expDEVICE_HORI_POS_RIGHTSKB_DROP_REASON_HDR_TRUNCSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOia_mtimenr_thpslegacy_cftypesrnid_vend_specsysv_shmfopssuppress_bind_attrsinsnlen__page_1__page_2WORK_CPU_UNBOUNDi_mutex_keykey_restrictionstatquota_writedomainget_linkFC_PORTTYPE_NLPORTmax_depthctl_table_argdata_lenpriv_stack_ptrFCH_EVT_VENDOR_UNIQUE___GFP_NOFAIL_BITfl_vendblkcg_nodeforksa_flagsno_start_on_addcancelled_write_bytesdispatch_busyfcp_packet_alloc_failuresnbp_rl_startFC_RCTL_ACK_0task_worksmm_cidatomic_write_hw_maxFC_SPP_RESP_ACKdfl_cgrp_ddebug_infoaddrsshrinker_info_unitstats_lockfc_host_post_eventnum_kpSTARGET_CREATED_REMOVEshost_gendevcsumMEMORY_DEVICE_PRIVATE__bd_flagsfc_eofsuper_blockbi_bvec_donemap_get_unmapped_areabus_typeget_named_child_nodeBPF_MAP_TYPE_PERCPU_CGROUP_STORAGE_DEPRECATEDassoc_arrayactorBPF_CGROUP_ITER_DESCENDANTS_PREbpf_offload_devkobj_ns_typemax_descendantsFC_SPP_RESP_MULTsched_shared_tagsfp_wwpnlong intFCH_EVT_ADAPTER_CHANGEcore_nodebdi_nodefr_typernidcn_device_specifictarget_btf_idmem_dqinfodevnodesaved_sigmaskac_uidBLK_UID_EUI64FC_TGTID_BIND_BY_WWNNMEMORY_DEVICE_PCI_P2PDMAac_nicedq_offpinsblkcg_mutexis_visiblecgrp_linksdisk_nameuuid_t__kernel_clockid_twritabledqb_bsoftlimit__UNIQUE_ID___addressable_fc_lport_flogi_resp684vfork_donetask_cputime_atomicki_waitqra_pagesgroupmmap_compat_legacy_basefc_lport_rport_callbackdevice_dma_supportedsysfs_dir_lockscsi_cmnd_submitterFC_TGTID_BIND_BY_WWPNignored_posix_timerslockedsival_intia_filecancel_attachio_pagesSKB_DROP_REASON_TC_EGRESSwakeup_cntrequest_pendingdl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsfabric_nameclass_read_lock_irqsave_is_conditionalfc_els_rjt_reasonblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startfc_fdmi_rhbaavg_triggersctl_dirFC_PORTTYPE_PTProbust_list_headunsigned charrnid_cid_lenwake_qrange_startrethookspermanent_port_namenuma_scan_periodelem_countnr_tagsfc_lport_enter_scrsda_is_staticwakeup_pathresult_maskFORTIFY_FUNC_memscanscsi_timeout_actionei_funcs__func__fc_passive_provBPF_NETFILTERtablesRPORT_ST_PLOGI_WAITpipe_inode_inforaw_spinlockmemcg_cgwb_frnblkio_delay_totaldomainnamektypebpf_attrBPF_PROG_TYPE_CGROUP_SYSCTLhost_sizenumportmigration_disabledSKB_DROP_REASON_FRAG_TOO_FARsystem_hostnameext_mutexfr_fspFcpPktAbortsRPM_REQ_SUSPENDcancel_forkpgprot_ttracepoint_ptr_tfc_lport_els_prlifor_reclaim_skb_refdstphysical_locationELS_PDISCchildren_low_usagenum_vfPIDTYPE_MAXbi_sizemg_dst_csetvlan_protothrashing_countwatcherscrypt_ctxstopwait_maxclass_write_lock_irqsave_is_conditionalioveca_flagsiomapd_dnameScsi_Hostnr_migrations_coldbtf_value_type_idmnt_idmap___GFP_FS_BITWORK_OFFQ_LEFTnr_cpu_idsquotactl_opski_iopriovport_typesched_remote_wakeuptag_alloc_policymemcpysock_filterBPF_LIRC_MODE2fc_lport_els_provtracing_graph_pauseread_iterfc_lport_enter_readysuspend_latefront_padfcp_in_bytesFC_TYPE_CTfc_lport_recv_flogi_reqsdev_devmaxframe_sizerecoveredrsp_codei_rwsembi_integrityexitio_uringeh_device_reset_handlerchild_ns_typeorderslave_bdevscommit_dqblkclass_local_lock_irqsave_is_conditionalmark_dirtyFC_PORTSTATE_OFFLINEnr_ctxkernfs_opsFCH_EVT_LINK_FPIN_ACKnr_dying_descendantsoom_reaper_timermodulewb_bytesbd_securitynodeinfoqueue_lockf_pathstatic_call_siteself64_symtry_module_getunlinkmap_queuescpumask_var_trefcount_warn_saturatetime64_tdrivers_diri_gidfc4_provtype_idFORTIFY_FUNC_strnlenrq_qosmark_deadREFCOUNT_DEC_LEAKicq_hintrmdirdq_dqbdropspeedmemory_failureblkcg_gqdma_flagsbtf_field_kptrSUBMITTED_BY_BLOCK_LAYERmax_hw_sectorsselectors_mtdmod_kallsymss_typefield_maskjits_use_priv_stackprog_bind_mapli_failure_unknownfini_seq_privateremount_fsbd_holdernext_idtask_delay_infopi_senew_utsnamejit_datarelative_fdin_useforwardrq_countMIGRATE_SYNC_LIGHTerrseq_tms_rdatakstatfslruvec_statsreply_payload_rcv_lenmems_allowed_seqmax_user_discard_sectorsinsnsifc_lport_timeouttarget_allocbug_listBPF_CGROUP_INET4_CONNECTmax_nr_cidmod_arch_specificDMA_NONEtransfersizepp_recyclesplit_queue_lensharebpf_net_contextprobe_addrno_cgroup_ownerSKB_DROP_REASON_DUP_FRAGdisc_stopftrace_timestampbi_iopriobypass_addrd_ino_warnsstack_depthkernfs_elem_attrBPF_PROG_TYPE_SK_SKBi_ctime_nsecrelative_idrbnodei_private_listbinfmtftrace_sleeptimedata_size_inBPF_CGROUP_ITER_ORDER_UNSPECi_statebv_pagedestructorpcpu_cidsupported_speedssched_migratedZONE_DMA32FC_TYPE_ILScgroup_tasksetdup_xol_addrdevice_configurePROBE_PREFER_ASYNCHRONOUSrcu_node_entryreverse_orderingBPF_MAP_TYPE_BLOOM_FILTERcgroup_bpffile_system_typeorig_ret_vaddrelsct_sendbtf_log_levelELS_RCSmmu_notifier_subscriptionsswap_iocbBPF_RB_ROOTdefault_groups__sifieldsb_iofc_exch_update_statsnr_watchesfind_special_pageDL_DEV_DRIVER_BOUNDELS_EXPL_SPP_OPT_ERRadj_offcurr_ret_depthstarved_entryfc_flags__fillerdestroy_dquot__task_fpstatefilldir_tSKB_DROP_REASON_TCP_AOFAILUREget_reserved_spacediv_u64ioprioKMALLOC_NORMALunreliablecreateBPF_PROG_TYPE_SCHED_ACTdirtied_time_whenstart_scan_seqperf_rdpmc_allowedmin_seqfc_bsg_to_shostfc_rctlsym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerfc_lport_flogi_fillSKB_DROP_REASON_QDISC_DROPbd_openersdq_inuseofflinedev_pm_infomremaptime_nsin_memstallhost_self_blockednode_size_lockcss_extra_stat_showkptrpoweroff_latei_nlinkwakeupcb_list___GFP_IO_BITcpu_iditer_info_lenpushable_taskstty_audit_bufkref_putmaxlenkernel_cap_t__be16bpf_funcpoke_tabmems_alloweds_inode_lrureply_datacached_rqse_cset_noderecov_seqSKB_DROP_REASON_SKB_CSUMkf_rootmmap_compat_baseretvalpreparenr_threaded_childrenclock_op_might_sleepf_sb_errneed_mbd_namecheck_flagsi_sequencefc_els_rnid_cidrt_prioritykretprobe_instancescrypto_profile__be32token_createiov_baseFCH_EVT_LINK_FPINcpus_ptrq_lockdep_mapb_more_ioloadfuncscpu_bitmapSTARGET_DELatomic_write_lensaved_tfxa_headdetachprog_ifindexmm_listSKB_DROP_REASON_NOMEMproperty_read_string_arrayget_statetracepoint_funcd_seqnuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmt__be64blkg_listnum_symtabexec_update_lockfscrypt_inode_infoFC_NS_RSPN_IDsplice_readSKB_DROP_REASON_SOCKET_RCVBUFFBPF_PROG_TYPE_SOCKET_FILTERSKB_DROP_REASON_TCP_RFC7323_PAWSremote_wwnnSKB_DROP_REASON_MAC_INVALID_SOURCEFC_FID_TIME_SERVneed_qsctx_mapFC_VPORT_UNKNOWNbd_diskuid_gid_extentnumberszone_wplugs_wqWRITE_LIFE_SHORTsigpendingpi_entryBPF_MAP_TYPE_ARENAs_inodesdirtied_when__UNIQUE_ID___addressable_fc_get_host_stats671map_direct_value_metaMIGRATE_ASYNCBPF_MAP_TYPE_PERCPU_CGROUP_STORAGEnext_scangsindexwrite_bandwidthcompletewatch_listli_prim_seq_err_counteh_abort_listBPF_CGROUP_UDP4_RECVMSGd_sibsleepable_refcntmodule_attributemax_host_blockedlogoneed_tsin_dpm_listwordworkmultiprocessquiesce_depthfbatchclass_task_lock_is_conditionalBPF_CGROUP_INET_INGRESStask_groupf_pos_lockperiod_timerfc_els_rnid_respBPF_FLOW_DISSECTORportnamesk_buff_data_texpected_revisionbio_pooltimeout_workBPF_PROG_TYPE_LWT_XMITmac_lensrcu_barrier_completionBPF_MAP_TYPE_STACK_TRACEpacctblk_mq_tag_setrnid_cmdSKB_DROP_REASON_TUNNEL_TXINFOcurr_targetvm_page_protbalanced_dirty_ratelimitbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatPTR_TO_PACKET_ENDperf_event_contextatomic64_tnoinstr_text_startctx_size_outddp_doneac_btime64HRTIMER_RESTARTrpm_autosuspend_delayac_gidELS_LINITnotify_timercorememfh_d_idBPF_MAP_TYPE_USER_RINGBUFLPORT_ST_LOGObusystack_canarynumattrsFC_NS_RFF_IDuser_keyring_registermax_write_zeroes_sectors_utimedn_unable_to_routetmf_work_q__fortify_size_flags_1_flags_2FC_TYPE_BLS__ptrtaskstatsport_stateproactive_compact_triggerELS_FLOGIposix_acli_dio_countfc_bsg_ctels_replyarch_rwlock_tdriversym_timens_pagerport_event_callbackprog_token_fdsysctlsoffsetrtpoll_taskprot_guard_typedev_iommuWB_REASON_SYNCmap_typeclass_rwsem_read_intr_is_conditional__cpu_possible_masksg_copy_to_buffercompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_userslog_sizeSDEV_BLOCKbacking_dev_infoi_mappingheadersdiscard_alignmentbsg_deviceshow_statsnr_populated_csets_ress_vfs_rename_keysubmitteretypekfree_skbi_bytes___GFP_WRITE_BITnormal_prioblkio_countshost_datadispatch_waitBPF_MAP_TYPE_INODE_STORAGEsrcu_nodelast_mm_ciddelayedhdr_lenper_cpu_nodestats__refcount_addSKB_DROP_REASON_TC_CHAIN_NOTFOUNDvaddrscsi_vpdis_softnext_cpugrab_current_nsclass_namesdisc_worknr_taskslock_class_keyfr_name_lenpriv_stack_requestedsum_exec_runtimememory_failure_statssetupdev_pin_infolesb_sync_losspoll_table_structmce_whole_pageELS_QOSRia_modercu_tasks_holdout_listFC_FDMI_GRHLsched_rt_mutexfl_cmds_pinsswap_peaks__refcount_dec_and_testnon_seqbpf_prog_arrayattach_func_protoSKB_DROP_REASON_IP_CSUMpresent_pageshctx_listrenamecontiguousthrashing_delay_totalmajorfc_ct_reqktime_tonstackPRJQUOTAlink_idzswap_lruvec_stateBPF_CGROUP_INET_SOCK_RELEASEkprobe_blacklistjump_entriesdio_offset_alignELS_LKAreserved_tagsdma_masksa_restorerqueuelistdatalenmkdirnextrelax_countrestore_earlyPIDTYPE_TGIDilencpu_run_virtual_totalmax_active_zonesdevice_physical_location_horizontal_positionattach_flagskfunc_btf_tabrportkobj_uevent_env___GFP_MOVABLE_BITkprobes_text_startpid_typefown_structi_default_aclBPF_PROG_TYPE_LIRC_MODE2fregs_statemap_flagsBPF_PROG_TYPE_LSMzonerefshift__devicesFORTIFY_FUNC_strcpypendingBPF_MAP_TYPE_PERCPU_ARRAYdma_boundarybd_nr_sectorsnr_eventssdev_statekmemcg_idfc_lport_set_local_idkstatanon_vma_namedq_hash__iovgp_stategrphiFC_RCTL_ELS_REQntabiommu_mm_datamap_for_each_callbackinvalid_crc_countnr_disk_swapinszone_wplugs_err_listma_flagsFC_NS_RNN_IDarch_uprobebio_issueSKB_DROP_REASON_IPV6_NDISC_NS_OTHERHOSTDL_DEV_UNBINDINGKMALLOC_RANDOM_ENDrefcountmmap_lockuprobe_multidevice_sizeLPORT_ST_RFF_IDzonelistELS_LS_RJTsrcu_reader_flavorbtf_fddumped_framespeerstimerqueue_nodeELS_FARP_REQreal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_alloweduse_16_for_syncrt_mutex_waitermem_cgroup_per_nodekcompactd_pad_page_pooldq_dqb_lockf_flagsblk_qc_tshow_infoinner_map_fdslave_allocflush_requiredWB_REASON_FS_FREE_SPACE__UNIQUE_ID___addressable_fc_linkup673sg_tablememcg_vmstatskeyring_semattributesblk_queue_statsgrplomax_rport_retry_countkgid_tkey_userreadlinkoffline_disabledd_comparetime_ns_for_childreni_wb_frn_winnerqspinlock__compiletime_assert_451sighand_structELS_FACTstart_brkFC_FS_RJTELS_RNIDfl_cspdisc_callbackrnid_resv2map_mmapdio_completeshost_statelocked_pendinglockdep_keyrnid_resvdextentfile_offsets_idstate_maskcore_statelink_upalignsym_int80_landing_padngroupsmajor_retriessp_offset__sigrestore_tRPM_SUSPENDEDvolnameDMA_TO_DEVICEmutexn_refattrsexch_mgr_resetBPF_TCX_EGRESSFC_VPORT_DISABLEDbi_sectoreh_deadlinefsbaseinactivelport_set_port_idsrcu_barrier_mutexloss_of_signal_countdirty_limitswregs_state__kernel_timespecchildren_min_usageeh_should_retry_cmdpglist_datad_lruwaitqmax_pkt_offsetd_fieldmaskcountersfaults_disabled_mappingnameidataarg_sizefailedpoweroffbpf_prog_opsbpf_verifier_envminorsnonresident_ageControlRequestselemsizerlim_curFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagscan_workh_ctdebugfs_entrywaitshow_rqcan_queuest_shndxreservedi_wb_frn_historyELS_EXPL_AHctxsprocess_keyringfc_frame_dropset_dqblkrestart_blocks_opbi_end_iokobjectposix_cputimer_basenr_memcgsleveluser_definedcow_page__warn_printkFC_SOF_Fnanosleepinvalid_tx_word_countfalsemax_npiv_vportscn_sig_alarmpi_state_listtv_secac_exitcodeBPF_KPTRsuidFC_SOF_I3prog_typeKMALLOC_RANDOM_STARTjiffieskey_typedismissi_hashmm_cid_next_scanfreeze_noirqoublockcancel_delayed_work_syncdisc_idia_atime_timerfifovm_private_dataskip_ms_page_8work_bitsfc_frame_alloc_fillFC_RCTL_BA_PRMTrtpoll_scheduledFC_NS_GI_AWB_SYNC_NONEBPF_PROG_TYPE_KPROBEorig_progdq_freeSHOST_RUNNINGrootLPORT_ST_RNN_IDDISC_EV_NONEsupported_classespolicycpu_baseBPF_PROG_TYPE_SYSCALLcap_bsetnr_to_writerportsnr_itemsSKB_DROP_REASON_NEIGH_QUEUEFULLanon_costseq_startfcp_input_megabytesbp_regbvec_poolkern_versionrb_root_cachedfc_host_statisticsWB_REASON_FOREIGN_FLUSHmac_headeri_blkbitswritervm_pgoffvirtmemfc_lport_reset_lockedfc_lport_scr_resp_refcounttarget_fdcsum_typeFC_RCTL_F_BSYLSKB_DROP_REASON_TCP_CLOSEbin_attributeELS_LOGOmath_emu_infopushable_dl_taskswrite_u64fc_fdmi_attr_entrytestWB_SYNC_ALLsched_infogroup_infotailsport_typedqi_fmt_idPTR_TO_ARENAactive_extensions__UNIQUE_ID___addressable_fc_get_host_port_state654memcg_csssoftirq_next_timerrevisionis_child_subreapersg_tablesizeexit_codefile_lock_contexttracingnr_pagesntoh24writeback_indexread_u64fc_els_spp_respfiemap_extent_infofilemempool_free_tPTR_TO_TCP_SOCK_OR_NULLfree_foliort_spc_warnlimitcmndatomic_write_hw_unit_mincompact_count_sk_redirtimer__empty_rangessbq_wait_statedev_namebpf_map__p_sizeBPF_PROG_TYPE_EXTBPF_PROG_TYPE_FLOW_DISSECTORnotified_atrport_bindings__UNIQUE_ID___addressable_fc_lport_reset682WORK_OFFQ_POOL_SHIFTn_klistwb_errspp_inbudget_tokenfc_frameFC_FDMI_DHATvlan_tcikswapdwrite_dquotrhbarefcount_offpercpu_pvec_drainedf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachewwnnstorebi_bdevELS_PLOGIst_infoFC_SOF_N2FC_FDMI_DHBAdispatchdescsquiesced_bydqi_max_ino_limitllseeknet_nsRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleget_projidfunc_info_aux__sectorpart0cnvcswwwpncallskqidmem_cgroupPTR_TO_BUFfree_inodenext_keysiglockwait_queue_func_tperf_recursionnr_wakeups_remoted_spacei_ctime_secdebugfs_idreal_func_cntfc_bsg_replynext_timer_typeBPF_TASK_ITER_TGIDTT_NATIVEused_map_cnt__empty_insnshlist_bl_nodenum_descsSKB_DROP_REASON_TCP_FLAGS_head_1_head_2clockiddelayed_work_timer_fn__read_overflow2_fieldFREEZE_MAY_NESTsym_hvclock_pageremap_file_rangemmap_legacy_basepfmemalloc_waitend_dataxa_lockfutex_exit_mutexuse_16_for_rwiommu_groupmap_peek_elemnr_isolate_pageblockmempool_alloc_tdevice_get_dma_attrtarget_blockeddev_loss_worksp_hi_veralloc_inodepayloadbtf_field_graph_rootdirty_foliodn_unknownnode_zonesseq_countfscrypt_keyringis_hardasync_sizeSKB_DROP_REASON_INVALID_PROTOtrap_nrf_iocb_flagsctx_size_in__flagsRPORT_EV_LOGOkcompactd_waitnodenametotal_vm_entire_mapcountiteratorlastpool_dataqf_opsforce_atomic_pad1_LPORT_ST_RHBAreal_credno_difblkcnt_td_rt_spaceprog_idsBPF_MAP_TYPE_HASHsigned charmap_local_storage_chargehas_child_subreapermount_pad2_reasonblk_flush_queuesched_entitydev_links_infoinner_protocol_typeRPORT_ST_FLOGIs_uuid_lenpcpufh_seq_cnt___GFP_RETRY_MAYFAIL_BITinfo_argdqi_privold_mfsINIT_LIST_HEADfc_ns_fidfc_els_cmdfmode_trpm_autosuspendrnid_att_nodessweventactivatefxregs_state_lowerpaddingct_optionspid_ns_for_childrenSKB_DROP_REASON_FULL_RINGtimestimer_rand_statelru_gen_memcgfr_encapsllist_nodeELS_EXPL_INV_LENbpf_run_ctxbio_slabstate_add_uevent_sentLPORT_ST_RSPN_IDenv_startmodule_notes_attrsio_cqlower_firstrangeSKB_DROP_REASON_TCP_RESETbvecacct_vm_mem1on_cpumanage_system_start_stopmg_src_preload_noderefcount_incstringSHOST_CANCEL_RECOVERYatomic_fetch_add_relaxednuma_preferred_nidELS_FPINfree_diskPTR_TO_MAP_KEYvmem_altmapbiotailwait_startelevatorspinlockmin_unmapped_pagessrcu_barrier_seq__UNIQUE_ID___addressable_fc_set_mfs677i_aclssb_statnofaultbpf_map_typeia_rangesq_size_fieldis_reltablepteval_tFC_FID_DIR_SERVfc_els_cspfc_fdmi_dprtlog_levelblk_mq_tagsDEVICE_PANEL_LEFTorc_unwind_iprel_deadlinexfer_contig_endkobj_typeskip_settle_delaysb_writersdma_cleanupeh_timed_outdriver_datafc_bsg_to_rporti387FC_FID_QOSdma_iommumax_idirq_safeLPORT_ST_READYrescue_lockdefault_timer_slack_nsxregs_statedelays_statecompletion_cntSKB_DROP_REASON_LOCAL_MAC_deferred_listcurr_nrset_child_tidSKB_DROP_REASON_UNICAST_IN_L2_MULTICASTbio_vecacpi_match_tablenfdsrlimitBPF_TRACE_FEXITmap_update_elemlast_subtree_bstatnr_frozen_tasksiterrelease_agent_pathidle_notificationmodule_stateWORK_OFFQ_FLAG_SHIFTrtpoll_triggersPTR_TO_BTF_IDwait_lockf_pipegetgeocset_linkswrite_iterD_REAL_DATAsp_featuresacct_timexpdclock_mutexFC_FID_SEC_KEYnr_failed_migrations_runninguserfaultfd_ctxevent_flagsthread_structoldpcore_relosbuf_lenfc_rport_statemm_context_treply_lenfc_lport_els_requestbd_stampELS_RVCSdio_mem_aligncstimereplyprot_capabilitiesFC_RCTL_BA_ABTSatomic_long_trpm_request__refcount_incpositionMQ_RQ_COMPLETEio_comp_batchline_info_cntSKB_NOT_DROPPED_YETcftsf_credtrace_eventsfc_port_typed_iputlast_bstatnew_prog_fdnr_wakeups_syncklist_nodeELS_ADISCstackmap_release_urefBPF_REFCOUNTblockedvm_numa_eventdst_trampolineallowedmce_countweighttotalblk_plugOutputRequeststrc_reader_nestingfpstatetag_setis_roxno_scsi2_lun_in_cdbprevseqcount_raw_spinlockinstrument_atomic_read_writebios_paramnum_orcskswapd_failuresFORTIFY_FUNC_kmemdupbuflenbpf_kfunc_desc_tabfc_exch_seq_send__UNIQUE_ID___addressable_fc_lport_config685deadBPF_CGROUP_DEVICEWRITE_LIFE_LONGcrc_offloadexpiry_activeeh_bus_reset_handlermtd_infois_confidentialvendor_identifieri_dentryfixupsFC_RCTL_BA_ACCwq_misc_constsvm_endvm_structproc_handlerprlimemcgfsyncsgid__fc_frame_header_getcompat_robust_listnuma_workELS_ECHOprioprivvaluercu_workBPF_CGROUP_INET4_GETPEERNAMEredirectedcurrent_stack_pointerac_minfltbpf_prog_aux_hugetlb_cgroup_msecs_to_jiffiesset_policyinternal_tagthreadftrace_callsitesmmlistservice_paramsfc_bsg_rport_ctBPF_CGROUP_SETSOCKOPTrnid_wwnnforceidle_sumusedpage_typeclass_spinlock_is_conditionaluserskb_iifmynodeseq_stopWORK_BUSY_PENDING__MAX_BPF_PROG_TYPEblk_traceactionseconds_since_last_resetlink_detachpi_waitersdom_cgrpqueue_mappingscsi_comp_flagsprlolportfile_name_offbstatfailcntatomic_tpcp_listqueue_flagsBPF_PROG_TYPE_UNSPECrnid_wwpnrb_rootLPORT_ST_RPAfreepages_countutf8data_tablescsi_is_host_deviceBPF_PROG_TYPE_SK_MSGprim_seq_protocol_err_countexe_filefc_lport_inituid_telementsd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_datafc_fc4_add_lportdef_flagssrcu_n_lock_retriesraw_lockmodule_putsrcu_structprovinner_map_metaFC_FID_MGMT_SERVis_guestli_link_failure_countio_minnf_skip_egresstarget_attrsrtpoll_wakeupsplice_eofs_sync_lockproganon_vma_chainfc_tgtid_binding_typei_mtime_nsecseq_opsrseq_event_maskem_pdi_fsnotify_maskshared_pending__int128FC_EOF_RTI__mce_reservedwriteback_controlmax_write_lenmm_struct__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEbuild_idhost_statss_export_opCONST_PTR_TO_MAPBPF_CGROUP_INET4_GETSOCKNAMElen_descseg_boundary_maskanon_namesched_dl_entitypp_ref_countactivest_othercall_get_stackstartparentlookupkernel_siginfoadisc_port_idwritten_stamp_sigpollSKB_CONSUMEDprlo_obs__UNIQUE_ID___addressable_fc_rport_logoff662initializedSDEV_CANCELkill_sb__bi_remainingnum_bugskmalloc_cachescftypesecurity_supportedsock_fprog_kernklistusercntSKB_DROP_REASON_OTHERHOSTirq_delay_totalstate_entry_ptrfc_non_bls_respstatsdev_loss_tmousersactive_basesresp_taskDEV_DMA_COHERENTswap_slot_free_notifyELS_EXPL_INSUF_RESstart_databoolcompact_order_failedbv_len___GFP_RECLAIMABLE_BITinquirymodsctimernid_atypedestroy_inodecma_pagesfutex_pi_statercu_read_unlockSKB_DROP_REASON_TCP_OLD_SEQUENCESKB_DROP_REASON_PKT_TOO_SMALLi_mutex_dir_keyrescue_workrestartsSKB_DROP_REASON_UDP_CSUMdevice_physical_location_vertical_positionget_aclset_aclac_exe_devencapsfc_rport_enter_adiscmemory_tiers_voppercpudescpoll_bioiterate_sharedmemswsym_vdso32_sigreturn_landing_padfc_fpin_statscma_areafeaturesfc_rport_recv_adisc_reqrcu_tasks_exit_cpulink_fdmigrate_from_cpubd_size_lockwriteerror_codebuddy_listref_ctr_offsetsldt_structprog_attach_flagsfcp_control_requestscred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_nameVTIME_INACTIVEmg_src_cgrpeh_target_reset_handlerclass_preempt_is_conditionallink_createtimeouturing_cmdshrinker_idnr_dirtiedgetattrBPF_SK_SKB_STREAM_PARSERsetattrsystem_long_wqPTR_TO_TCP_SOCKvmstats_percpufixupblockMQ_RQ_IDLEdevtlast_cpufor_backgroundnr_wakeups_localcn_sig_warnuidhash_nodemax_ratioalloc_cpupost_attachworker_privatepoll_eventFC_FID_FLOGIalloc_factorlinelinkbi_pooleffectivecompact_blockskip_flushmoderead_char___GFP_NOWARN_BITatomic_setFC_FID_ALIASESnode_idPTR_TO_STACKtargetget_nextdqblkrcu_tasks_idxBPF_PROG_TYPE_NETFILTERjournal_inforefcount_inc_not_zerobi_inline_vecstqheadlast_used_atrq_end_io_retline_offhres_activeold_subtree_controllesb_link_failmod_namenotes_attrsdelay_workFC_VPORT_NO_FABRIC_SUPPblock_device_operationsoffset_ctxbi_blkgseq_nexttail_call_reachablelast_switch_timefcp_output_requestscompact_init_free_pfnwakeup_countwait_indexsystem_freezable_power_efficient_wqlog_sizerunnable_weightSKB_DROP_REASON_NEIGH_DEADFC_VPORT_FAILEDmap_push_elemtarget_busyclass_releaselast_sum_exec_runtimeSKB_DROP_REASON_PACKET_SOCK_ERRORdd_key_trueFC_RCTL_ELS4_REPFC_RCTL_ELS4_REQsa_handlerfree_countcg_listscsi_transport_templatelocked_vmqueue_rqaddressmq_hctxstart_timeRPORT_EV_STOPzone_wplugs_hashkprobe_multicookielistWORKER_DESC_LENfreezer__pptrsig_okextabledma_data_directionmax_entriesi_sizeentry_eipcgroup_atypesplice_pipexstate_headerinquiry_lenrtpoll_timerdma_addrELS_TESTem_perf_domaind_flags___GFP_HIGHMEM_BITdying_tasks_large_mapcountnode_present_pagespid_namespaceliveclock_was_set_seqspc_warnlimitseqcount_tmin_fltblock_devicethreadedfp_fidMEMORY_DEVICE_GENERICpkruBPF_MAP_TYPE_PERF_EVENT_ARRAYattribute_containerELS_AUTH_ELSprojid_tvendorvport_idmemcg_nodeBPF_CGROUP_UNIX_SENDMSGdma_lengthcn_clearkey_payloadadd_linksrdata_argnbp_th_start__empty_insnsiuse_10_for_msELS_QSABPF_RB_NODE_dummy_bndWQ_FREEZABLErefcount_saturation_typeexception_cb__WQ_ORDEREDBPF_TRACE_UPROBE_MULTIper_cpu_pagesetfcp_cmndsaved_stateparent_exec_idutil_sumdd_key_falsesigvalfsnotify_mark_connector__ubuf_iovecsize_is_constantcputime_atomicdeadlinebio_integrity_payloadlun_in_cdbmodel_descriptionexit_requeste_d_tovwait_queue_upperclass_write_lock_irq_is_conditionalcgroup_fileswap_readahead_infovtimeexpecting_cc_uas_rootli_device_specificstack_refcountgrpmaskdevice_attributes_remove_countBPF_SK_LOOKUPlru_genwrite_newuser_namespaceclass_rwsem_write_is_conditionalpids_active_resethlist_nodeblk_features_tsuper_operationsautosleep_enabledwrite_file_infoload_sumaddress_spacecpus_maskdl_yieldedstarget_dataextension_progfile_dispread_newd_spc_softlimitfc_discuse_10_for_rwkrefrseq_csspp_flagss_lock_keydqi_flagsmq_ctxjump_entrypi_top_taskhlist_nulls_nodefc_els_lesbpacct_structRPM_REQ_RESUMEpathnameuser_sizelast_queue_ramp_upkref_getbd_statsshow_fdinfoFC_RCTL_DD_DATA_DESCFAULT_FLAG_MKWRITEput_budgetfadviseclass_read_lock_irq_is_conditionallesb_inv_crclinenoMODULE_STATE_LIVEtask_listtc_at_ingressasync_scanPTR_TO_CTXFAULT_FLAG_RETRY_NOWAITBPF_CGROUP_SOCK_OPSread_foliosc_data_directionhas_elevatordtordq_countvpd_pg0nlinksignalnr_wakeups_passiveself_exec_idstate_syncedrjt_dataws_activef_epfc_rport_recv_prlo_reqctl_tablercu_specialprog_fdscsi_device_handlerentryold_subtree_ss_maskbackWORK_STRUCT_FLAG_BITSBPF_MAP_TYPE_LRU_HASHcgwb_domaincntsmsecs_to_jiffiessock___GFP_THISNODE_BITidr_rtsdev_bflagsdispatch_fromWORK_STRUCT_PWQ_SHIFTnr_linfomq_freeze_wqstart_prevent_timepgd_tsigset_twq_offLPORT_ST_DNSmap_btf_idbucket_idELS_PRLIFC_RCTL_LCRELS_PRLOrstat_flush_nextignored_r_a_p__vgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64prog_id__list_del_entry_validreserved_tailroomi_inoserver_has_tasks_killRPORT_ST_PRLIpgdati_spc_warnlimitunderflowf_posBPF_MAP_TYPE_HASH_OF_MAPSperformancesoftac_pidowner_trapnoload_weightBPF_PROG_TYPE_SOCK_OPSfc_fh_typesleepablevport_statesymlinkclass_rwsem_write_try_is_conditionalkmalloc_noprofbd_queueerror_framesin_iowaitfc_els_flogiDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclbdi_writebackrb_leftmostSKB_DROP_REASON_TCP_AUTH_HDRdst_neededbug_addr_dispmigration_pendingscan_mutexhosttd_real__msecs_to_jiffiesns_commonmap_ifindexdevice_get_match_dataELS_GAIDs_max_linksctl_table_rootfc_rport_eventscatterlistverified_insnsthread_headacquire_dquotclockid_tfifo_timetarget_destroyzone_capacityFORTIFY_FUNC_strlenfc_els_rtv_accpgdval_td_managedevice_attrsmax_ctx_offsetmax_device_blockedback_padMIGRATE_SYNCwcharRQ_END_IO_FREEexplanseq_filefcp_output_megabytesonline_cntBPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATEDrestoreSKB_DROP_REASON_IPV6_BAD_EXTHDRline_infoseq_ptrHPROBE_LEASEDBPF_LSM_MACthaw_superspp_type_extalt_lenseq_operationslesb_prim_errfallocatelog_true_sizefc_rport_enter_plogi__retdst_pending_confirm_call_addrwriteback_sync_modesi_mmap_rwsemSKB_DROP_REASON_TCP_INVALID_SYNundo_listattribute_groupdma_poolsFC_SPP_RESP_RESpersonalityprintk_index_sizeuprobe_task_stateWB_REASON_BACKGROUNDstimestatic_priotmpfileattach_func_namedata_indqi_formatnvcswcp_init__list_add_rcu_nr_pages_mappedfrequencycp_classrtpoll_totaldev_pm_ops__refcount_sub_and_test__kmalloc_indexpfmemallocblk_mq_ctxno_updateiter_typeDEVICE_PANEL_BOTTOMrtv_r_a_tovscsi_pkt_lockencap_hdr_csumtransporttmap_get_next_keyspp_lenBPF_SK_REUSEPORT_SELECT_OR_MIGRATEnr_wakeupsquerymaxval_spp_resvdbpf_prog_typeenabledki_filpmultiple_queueswork_func_tmemcg_vmstats_percpupp_magicfpu_state_permer_reason__refcount_dec_and_testfwnode_reference_argsdevres_headused_maps_mutexRPM_REQ_IDLEfilenameex_lockbaseRPORT_ST_ADISCac_ppidd_prunerestore_noirqr_ctlsysfs_registeredDumpedFramesSKB_DROP_REASON_TCP_TOO_OLD_ACKrlockBPF_PROG_TYPE_SCHED_CLSi_rt_spc_warnlimitqueuertv_cmd__compiletime_assert_82__compiletime_assert_83BPF_PROG_TYPE_CGROUP_SOCK__compiletime_assert_85__compiletime_assert_86__compiletime_assert_87__compiletime_assert_88__compiletime_assert_89bytesfc_fill_reply_hdrnuma_migrate_retryMEMORY_DEVICE_COHERENTenclavefiltersaved_dst_prog_typeroot_blkgd_revalidateLPORT_ST_SCRsystem_power_efficient_wq__compiletime_assert_90WB_REASON_PERIODICcgrpwatermark_boosttracepoints_incoredqsi_opsubtree_controlquota_syncsrcu_have_cbsmemory_peaksInvalidTxWordCountasync_in_progresssignumdqi_dirty_listpi_lockdirtied_stamptm_donetimespec64BPF_WORKQUEUEscan_finishedlesb_sig_lossreplace_bpf_fdmax_ct_payloadnr_forced_migrationsdst_mutexumount_beginchannelbadblocksnr_descendantsbootbios_statell_nodeport_idkernfs_nodearch_atomic_readcpumaskptrace_messagehton24lengthrport_event_queueFC_RCTL_ACK_1__rcu_read_locktag_listbio_alloc_cachepdt_1f_for_no_luni_wb_frn_avg_timeBPF_LIST_HEAD_pincountreclaim_statecur_imageruntime_errori_sb__poll_tbpf_jit_poke_descriptorsubvolon_dispatchdirty_inodesymtabd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structELS_LIRRfs_parameter_specSKB_DROP_REASON_MAXrcu_data0real_blockedruntime_suspendcp_open_seqspp_params__s16BPF_CGROUP_UNIX_GETPEERNAMEwifi_ackedbacktraceschedule_delayed_workoffline_alreadys_umountn_nodeon_listcn_lost_creditmax_descendantsrefaultsdata_vmneeds_force_resumeblk_eh_timer_returnbtf_recordcsum_levelrpm_statusscsi_host_statedeferred_split_queue__s32p_sizechildrenbpf_local_storage_map__mono_tc_offsetcheck_eventsmarkfc_rport_fcp_initdqi_bgracei_wbhost_nof_inoderx_framesnext_rport_numberserialburstname_offpermissionsgraph_rootkernel_load_data_strELS_RJT_UNABcgroup_rootscsi_target_statehostmsi_device_dataslave_destroykallsymsmap_alloc_checki_ino_timelimitinit_timer_keybi_issuebd_holder_opsBPF_KPTR_REFlink_idscgwb_frnsrcu_idxSTARGET_CREATEDutil_est__s64ipc_nshugetlb_usagebpf_cookiesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenacct_rss_mem1fc_exch_mgr___orig_eipsrcu_datadevice_physical_location__keycgtimebypass_spec_v1pagefault_disabledELS_CSUindexs_time_max__mutex_initucount_maxdelayed_workprog_flagsopen_partitionssa_maskkswapd_lockmmappedElf64_Wordold_dom_cgrpjited_imageactive_timeatomic_flagscallernum_jump_entriesextra_lenPIDTYPE_PGIDbtf_vmlinux_value_type_idmnt_namespaceelemwb_completionSKB_DROP_REASON_IP_LOCAL_SOURCEend_ioquotalensrcu_data_have_cbsnivcswoffdev_tidlinfo_idxmce_vaddrBPF_CGROUP_UNIX_GETSOCKNAMEdl_dev_stateFC_RCTL_ENDshowrb_subtree_lasts_listBPF_MAP_TYPE_CGROUP_STORAGEhigh_workmq_pollsender_cpunr_segssame_target_siblingssp_plogitailcall_targetof_match_table_entryBPF_PROG_TYPE_CGROUP_DEVICEfc_tm_flagsino_timelimitalternative_gpt_sectori_readcountELS_ABTXFC_RCTL_IFRHblkcg_polsincrfreeseq_offloadrange_cyclicprog_cntlock_countthrotl_datalist_lru_onei_pagesmxcsrWQ_POWER_EFFICIENTclass_rcu_is_conditionalarchdataptrace_entryuid_mapguest_permwait_queue_headfdmi_versionnum_srcu_structsnr_activeprev_sum_exec_runtimei_flagsgendisku_flagstag_set_listlogical_block_sizesubtree_ss_maskinvalidate_lock_keyinfol1d_flush_kill__UNIQUE_ID___addressable_fc_rport_recv_req663ctx_outFC_VPORT_ACTIVEtimestampsfc_els_sppcp_reciprlimit_maxwrite_beginSHOST_CANCELbpf_prog_offloadwrite_infohrtimer_restarts_encoding_flagssessionids_time_minSKB_DROP_REASON_UNHANDLED_PROTOfc_rport_recv_prli_reqWORK_STRUCT_PWQ_BITvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrbpf_iter_aux_infos_stack_depthnode_offsetkprobe_override__vm_flagsresid_lenqueue_depthbpf_tramp_imagecsum_offsetpm_messagememcg_lrufred_cschangedvportcur_ktimeinitfop_flags_tgroupsoffstty_structnotify_nextvirtual_dr6dma_opsdma_addressmmap_basebd_devsyscall_workinit_cmd_privelowbpf_trampolinelockdep_mapnum_trace_evals_addr_bndcgroup_base_statELS_RDFfl_wwnnELS_RDPset_dbd_for_msnumberzone_device_dataquota_readloss_of_sync_countplenvolnamecsp_flagshlistpinned_vmfunc_cntELS_RECwritepagesnuma_faults_localityqrwlockELS_RESPTR_TO_FLOW_KEYS__write_overflow_fieldrw_semaphoreattach_bpf_fdfirst_minori_blockstask_fragWB_REASON_LAPTOP_TIMERsource_listsum_block_runtimeBPF_NETKIT_PRIMARYnuma_scan_period_max__compiletime_assert_654__compiletime_assert_655total_timepowerfromnum_ei_funcsi_generationFC_FID_NONEfcp_input_requestsflushBPF_PROG_TYPE_PERF_EVENTtask_fd_querymg_dst_cgrponlinecp_con_seqrnid_ip_addrBPF_PROG_TYPE_RAW_TRACEPOINTno_vpd_sizeformatlast_switch_countlast_wakee__cloned_offsetswapuint32_tssize_tRQ_END_IO_NONEvtime_statetry_vpd_pagesSKB_DROP_REASON_TCP_OFO_DROPparent_could_setfcapper_cpu_nodestats_blocksizequeue_numprevent_sleep_timeBPF_MAP_TYPE_CGROUP_ARRAYclass_spinlock_irqsave_try_is_conditionals_readonly_remounti_io_listrefaultedspp_resp_pachild_countBPF_MAP_TYPE_ARRAY_OF_MAPSrelease_agent_workVTIME_IDLEBPF_PROG_TYPE_STRUCT_OPSwb_domaincgroup_subsysnbp_th_nr_candip_summedcompat_uptr_tresp_wqcgwb_treeDEVICE_HORI_POS_LEFTfc_plogi_fill_hugetlb_subpoolend_pfnuclamptgidlimits_lockreleasenr_wakeups_migrateserial_nrstack_vmi_fieldmaskupidBPF_CGROUP_INET_SOCK_CREATEprotection_supportkcompactd_highest_zoneidxfreeze_mutextrace_evalsELS_RLSia_vfsuidbtf_mod_pairquota_format_opsi_datarescue_listfsverity_infocore_threadclosidsched_avgRPORT_ST_PLOGIcodearch_atomic_fetch_addBPF_LSM_CGROUPu64_stats_syncsyscorenr_reserved_highatomic__i_nlinkpmd_tinumli_invalid_tx_word_countsrcu_barrier_cpu_cntbatchedreadaheadfc_rport_erroropt_sectorsFC_VPORT_FABRIC_REJ_WWNhrtimer_cpu_baseirq_domainwait_liststatic_call_trampac_etimefsverity_operationscoublockbug_tablemigrate_modesecmarkusing_gplonly_symbolswb_listremovedhandleremulatednr_writeback_throttledsym_vvar_pageELS_RPLmembarrier_stateELS_RPSBPF_PROG_TYPE_LWT_INdma_pad_maskfc_seq_els_dataELS_RPSCBPF_KPTR_UNREFbin_sizeFORTIFY_FUNC_strlcatrcu_read_lock_nestingreg_typecb_accessrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_tio_bitmapDEVICE_VERT_POS_CENTERELS_RRQretry_countsbitmap_wordmanaged_pageslong unsigned intmax_timelast_queue_full_countread_file_infoELS_RSSexec_startia_sizeema_listRPM_RESUMINGunpinned_netfs_wbMODULE_STATE_COMINGsym___kernel_sigreturnZONE_DEVICEfunc_info_cntuser_cpus_ptrSKB_DROP_REASON_TCP_MD5FAILUREuser_scand_opstate_initializedrelease_dquotELS_RTVplugsoftirq_activatedkey_sizeinv_weightfc_set_rport_loss_tmosecuritykernel_symboldl_timerlockdep_map_pmodule_param_attrsdirty_ratelimitno_read_capacity_16scsi_host_template__user_state_sizechainedVTIME_GUESTretriessdtrsysvsemdisconnectstasheduser_xfeatures__kmalloc_cache_noprofdisc_mutexuse_memdelaynr_cached_objectshas_timeoutcgroup_namespacecommcallback_headhead_fragexception_table_entryin_hrtirqctl_table_set_overruncondhash_lenDEV_DMA_NON_COHERENTcoredumpd_sbio_lock_cls_keySKB_DROP_REASON_IPV6_NDISC_FRAGksetsleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsPTR_ERRnodesysvshmno_highmemdata_outREFCOUNT_ADD_UAFfirstSKB_DROP_REASON_TCP_FASTOPENELS_EXPL_UNAB_DATA_nfctSecondsSinceLastResetFC_CLASS_2FC_CLASS_3FC_CLASS_4WORK_OFFQ_BH_BITactive_countRPORT_ST_RTVFC_CLASS_Fnr_active_requests_shared_tagsnum_tracepointsvpd_pgb7ueventfc_pri_tasp_usharednext_cpu_batchmemcg_completionsdisk_eventss_sysfs_namesigval_trqst_qFC_FID_CLOCKfc_rport_destroySDEV_QUIESCEmap_pop_elembitsbase_pfnclass_mutex_try_is_conditionaler_vendorsem_undo_listcompat_rmtpclass_local_lock_is_conditionalELS_ESTCELS_ESTSstatic_key_trueno_fcs_stimeSKB_DROP_REASON_TCP_AONOTFOUNDinsns_sp_r_a_tovperf_event_ctxpprogsOutputBytescostxcomp_bvio_contextPIDTYPE_PIDwakee_flipsreject_putvlagufdsvlansegment_boundary_maskattach_tracing_progioctlprev_cputimectx_inbtf_flagshorizontal_positionem_perf_tablebi_crypt_contextprivateswp_entry_tcharFC_PORTSTATE_BYPASSEDmatchnr_failed_migrations_hotreg_offsetBPF_TRACE_KPROBE_MULTIqueue_stoppedFORTIFY_FUNC_UNKNOWNwrite_charbin_attrscpu_itimerdevres_lockfiles_structblk_zoneSDEV_RUNNINGicq_treePTR_TO_BTF_ID_OR_NULLFC_CLASS_NONEvfsuid_tf_lockexec_vmkernel_parambtf_fieldfh_f_ctlget_lesbvertical_positionbtf_dtor_kfunc_traw_atomic_fetch_add_relaxedshutdown_prerelease_folioftrace_managedbi_io_vecvendor_idmtimearchrobust_listasync_probe_requestedthaw_earlyac_btimevectors_securityfc_rport_enter_rtvsplice_writeparam_lockreq_listi_opflagstot_write_bandwidthdentry_operationsstats_sectorss_blocksize_bitsexp_hintclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapsw_hash_head_2asym___kernel_vsyscallopen_mutexfortify_funcsk_buff_fc_frame_alloccan_forklow_usageget_timeki_flagss_inode_wblist_lockFC_FID_FCTRLpermwriteback_inodesERR_PTRdestroy_worklockableuprobes_statemm_counttrace_overrunargsargvuclamp_reqswap_info_structs_qcopwb_tcand_bytesblk_mq_queue_mapFC_VPORT_INITIALIZING__kernel_long_tsrcu_usagefaultablerport_opsperf_event_mutexfctsFC_FID_BCASTexit_hctxqueue_delayed_work_onfc_xid_not_foundsync_modemap_gen_lookupfc_rport_recv_rls_reqin_execverlim_maxFC_PORTSTATE_MARGINALsimple_tagstarget_listmutex_lockVLinkFailureCountbpf_kfunc_btf_tabrtpoll_next_updatecoherent_dma_mask__data_lendriver_flagsscsi_residfile_ra_statek_sigaction_hugetlb_hwpoisoninsn_offshrinker_infocompletionslld_event_callbackreadahead_controlfwnode_operationsprocs_fileswait_queue_headmemory_typevm_userfaultfd_ctxTT_NONEmap_pagesBPF_PROG_TYPE_TRACEPOINTSKB_DROP_REASON_TCP_ABORT_ON_DATAmod_tree_nodelocal_watermarkprobe_offsetxfer_ddpcmd_flagss_bdev_filerequest_queuedev_pagemaptarget_private_offsetRPORT_ST_INITcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fsELS_RJT_BUSYhost_eh_scheduled___psoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLErb_nodefc_rport_logo_respELS_EXPL_PLOGI_REQDreturn_consumerround_robinksymi_private_dataroot_csetused_btfsptracer_credWORK_STRUCT_COLOR_BITSsrcu_barrier_headleadercheckTT_COMPATcap_effectivenetfilterexit_statefc_fcp_pktfaultscan_startprogs_hlistWORK_STRUCT_COLOR_SHIFTnuma_pages_migratedidr_nextsched_tagssupported_modeer_explanfiltersnr_frozen_descendantssbitmap_queueno_cgroup_migrationsched_databpf_func_info_auxprintk_index_startindex_keybreserved_tags__bi_nr_segmentsLPORT_ST_FDMIforce_scanintervalavgs_lockbug_entryzswap_maxtimers_activenum_classesprotocolbpf_cgroup_storagevma_lockrtpoll_untilkswapd_waitdl_throttledbpf_progseccompDEVICE_VERT_POS_UPPERrolesblk_holder_opsfprop_local_percpustatic_key_modextensionsspp_orig_pafilter_countpsi_filesmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodecreate_work_queuerport_delete_workumode_t__init_workdestroy_workqueueinitial_nsno_pmGRPQUOTAia_vfsgidioctx_locktimer_slack_nss_bdixarrayjited_linfocan_wakeuptime_namespacepdeath_signalexpected_attach_typedst_regnr_wakeups_idledqi_igraceqf_nextBPF_MAP_TYPE_LPM_TRIEmaple_treensproxyFC_SPP_RESP_INITELS_EXPL_OXID_RXIDslave_dir__write_overflow_pkeykernfs_rootfc_els_adiscFC_TYPE_ELSucountsget_next_idDD_CLASS_TYPE_LEVEL_NUMhooknumwrite_syscallslistscore_relo_rec_sizerefcount_tslow_grocmd_lenDEVICE_PANEL_TOPmemtierrxidmax_hw_discard_sectorsint32_txol_areadefault_lockguess_capacitysrcu_gp_mutexdebugfs_dirwakee_flip_decay_tsprio_listnext_vport_numberlast_timerequestblk_unique_idwpcopy_delay_totalSDEV_DELrprivfc_destroy_rportmax_payloadcontextSKB_DROP_REASON_TCP_ZEROWINDOWhost_lockrwlock_tvm_fault_tskb_extuse_autosuspendfc_rport_createclass_spinlock_irq_try_is_conditionalfc_disc_eventcfs_rqtree_reclaimednr_requestsfc_exchvirt_boundary_maskSKB_DROP_REASON_TCP_INVALID_ACK_SEQUENCEcgroupscore_occupationget_policycore_cookiepcrefrefcount_struct__kernel_ulong_tkf_opsfwnodeZONE_DMABPF_CGROUP_GETSOCKOPTcgroup_storagestatic_call_keycsum_startsysnamenamespaceSKB_DROP_REASON_IP_TUNNEL_ECNparametersbtf_sizeSKB_DROP_REASON_IP_INHDRgroup_leaderdma_channelrunnable_avglookaheadiowait_countli_loss_of_signals_countshstkioac__kernel_clock_t___GFP_DMA32_BITwas_resetgp_seqscsi_device_stateuuidmaj_fltWB_REASON_FORKER_THREADcached_requested_keyfp_flagsdqb_rsvspaceSKB_DROP_REASON_SUBSYS_MASK___GFP_NOMEMALLOC_BITmap_lookup_and_delete_batch__s8inode_operations__kernel_size_tdma_configurefile_leasepage_counterarg_flagsclass_local_lock_nested_bh_is_conditionalWQ_BHgpl_symsallowed_attachsrecursion_detectedpercpu_rw_semaphoresymbolic_namearch_spinlock_tseqcount_raw_spinlock_tbpf_iter_init_seq_priv_tfc_rport_login_completehighthread_pidmap_lookup_batchcss_idrrtpoll_min_periodemindl_non_contendinglso_maxcurr_ret_stackpgtable_t__u8q_usage_counterwakeirqi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyssdev_targetcore_forceidle_sumfc_rport_terminate_ioget_offset_ctxreleasedFC_SPP_RESP_INVLexport_operationsqc_stateELS_LCLMget_budgetrx_fpBLK_INTEGRITY_CSUM_IPmempool_smempool_timplicit_on_dflFC_PORTSTATE_LOOPBACKd_inodespecial_vecpageset_batchworkqueue_structBPF_MAP_TYPE_SOCKMAPi_lock_keyuevent_suppressgraveyard_linkbi_opfscsi_cmndfail_io_workfs_superscall_get_func_iptcp_tsorted_anchorwce_default_on__rcu_icq_cache___GFP_KSWAPD_RECLAIM_BITcompact_cached_free_pfncap_ambientqstrtaskss_d_opBPF_MAP_TYPE_TASK_STORAGEno_report_lunsi_rcu__countFREEZE_HOLDER_KERNELadisc_wwnninit_requestFC_PORTTYPE_NPORTio_optspanned_pagespcountbio_listwlockedrtpoll_trigger_lockdevicemodule_kobjectmap_releaseELS_SCNPTR_TO_PACKET_METAELS_SCRmg_tasksBPF_TRACE_ITERpercpu_count_ptrnr_ia_rangesthawmap_update_batchlink_attach_flagsadisc_wwpntlbflush_unmap_batchremoveoffload_fwd_markbvec_iteroom_mmfcp_abort_iobpf_local_storagename_linkSKB_DROP_REASON_PROTO_MEMrnid_vend_idcompat_long_tcnivcswmap_freeInvalidCRCCountPTR_TO_SOCKET_OR_NULLshort intkswapd_highest_zoneidxtrc_reader_specialgtimedisk_events_disable_depththread_group_cputimertransport_headersizemigrate_to_ramUTASK_SSTEP_ACKloginuiddesc_structi_wb_lists_umount_keyquota_typenameSKB_DROP_REASON_SKB_UCOPY_FAULTcgrp_ancestor_storagespp_typesetleasebitmap_tagsmnt_rootBPF_MAP_TYPE_SK_STORAGEpsi_flagsFC_SPP_RESP_CONDFC_SPP_RESP_CONFsubsys_masksighandbtf_key_type_idavgs_workaddrELS_EXPL_NONE__rcu_headac_utimeFC_PORTSTATE_DELETEDksm_zero_pagesBPF_MAP_TYPE_LRU_PERCPU_HASHqueuedataSKB_DROP_REASON_TCP_OFO_QUEUE_PRUNEprivate_dataBPF_MAP_TYPE_CPUMAPfc_exch_poolgid_mapFC_RCTL_F_BSYpageset_high_minfs_structnuma_nodedev_archdatanr_perf_statess_flagsrcu_nodeorig_pmdrb_rightclock_baseBPF_SK_REUSEPORT_SELECTclass_irq_is_conditionallaunder_foliowake_batchis_funcs_vfs_rename_mutexElf64_Xwordf_ctlflockSKB_DROP_REASON_BPF_CGROUP_EGRESSiter_createFC_RCTL_DD_UNSOL_DATAhandler_datavalue_type_btf_obj_fd__paddingoffline_waitqnr_reclaim_startstatus_codeio_lockdep_mapatomic_write_hw_boundarymap_nr_maxiowait_sumdescriptionfolio_batchbi_nextblk_status_tUSRQUOTABPF_CGROUP_ITER_SELF_ONLYdriver_private__flush_workqueueWORK_OFFQ_POOL_BITSpm_onlyd_rt_spc_warnsset_read_onlypgmapSKB_DROP_REASON_TAP_FILTERactive_refmap_owner_storage_ptrhctx_tablefc_xid_busykernfs_open_filelowmem_reserves_iflagsprintednr_hw_queuescodetagstate_mutexallowed_mapsctx_arg_infoinner_network_headerex_listlast_queue_full_depthBPF_PROG_TYPE_SK_LOOKUPfc_frame_header_getcid_worki_versionswap_deactivateflogisr_lockattachclass_rwsem_read_is_conditionalqueue_limitsunitil_weightstarved_listdma_parmsbdi_idKOBJ_NS_TYPEStstampcmin_fltchunksSKB_DROP_REASON_VXLAN_INVALID_HDRarch_uprobe_tasklicensewrite_protect_seqclearedkobj_ns_type_operationsshutdownevent_countsched_statisticslru_lock__kernel_uid32_tnode_zonelistsallocfc_rport_error_retrySKB_DROP_REASON_TCP_AOUNEXPECTEDb_attachedorig_pterq_timeoutkeysinit_nameper_cpu_zonestattc_indexfile_lockstatfsrw_semswappinessdevice_privatevm_policydl_deadlineLPORT_ST_RSNN_NNtracepoint_extELS_SRLclass_mutex_is_conditionalELS_SRRfpregs_stateWORK_STRUCT_PENDING_BITmemcg_datadqb_curinodesBPF_XDPfileattr_seteh_actionac_tgetimeRPORT_EV_NONEpage_linkno_write_samebtf_log_sizedn_timeoutDEVICE_PANEL_UNKNOWNFC_VPORT_FABRIC_LOGOUTPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetmce_ripvDL_DEV_NO_DRIVERbpf_arenafree_after_mult_rcu_gpret_stacknbp_rl_nr_candreal_timeri_privatealloc_tagextended_state_areanum_kprobe_blacklistaccessmap_seq_show_elemfp_resvdsubdirsdev_releasecgroup_freezer_statemlock_countBPF_PROG_TYPE_LWT_SEG6LOCALget_next_child_nodemempolicyfc_rportcacheline_padding_bandfd_arraypollfdblinding_requestedFC_RCTL_BA_RJTlaptop_mode_wb_timerdev_tplatform_dataf_refprev_posenv_endfileattrs_subtypeusage_countpr_opsstate_in_sysfsdqb_ihardlimitSKB_DROP_REASON_TCP_MD5NOTFOUNDunlocked_ioctluprobebd_mappingFC_RCTL_DD_UNSOL_CMDkmem_cachenuma_next_scanLPORT_ST_FLOGIbudget_mapbsg_devsrcu_last_gp_endxfer_lentnodeclass_local_lock_irq_is_conditionalpage_listinner_ipprotoproperty_read_int_arraywdtrmq_rq_stateholders_dirMODULE_STATE_UNFORMEDst_value__warn_flushing_systemwide_wqlist_headptrace_bpsFC_RCTL_BA_RMCfc_port_states_user_nsfc_rport_state_entercan_attachhost_attrsmap_lookup_elem_sys_onlytagset_refcntqueuecommand_may_blockmin_usagearch_tlbflush_unmap_batchquick_threadsELS_EXPL_INPROGdefer_syncBPF_TASK_ITER_TIDmissedfc_no_free_exch_xidusernsndisc_nodetypeBPF_UPTRvlan_allBPF_PROG_TYPE_CGROUP_SKBsum_sleep_runtimecleanup_rqd_spc_timerd_ino_hardlimitchange_cookiebi_statuscss_allocdl_periods_dquotErrorFrameswq_flagsfsnotify_sb_infomap_fd_get_ptrrecent_cida_opsftrace_opsprocnamepad_untilSKB_DROP_REASON_TCP_MINTTLmap_redirectperf_event_listinterval_expinsnlist_add_rcuBPF_CGROUP_UDP4_SENDMSGrstat_css_list___GFP_LAST_BITvm_node_stat_difftagski_completepgprotrnid_node_mgmtread_syscallstimespec_typebd_devicevmstatsdquot_operationsSKB_DROP_REASON_TC_INGRESSposix_cputimers_workgsbase__lruvecBPF_CGROUP_INET_EGRESScompact_delay_totalio_tlb_memseq_showFC_RCTL_DD_UNSOL_CTLcpusfilesinblockbd_claimingtails_magicFC_RCTL_BA_NOPcontainersnuma_faultsmem_dqblktarget_ifindexnos_countstgt_delete_workstatusBPF_PROG_TYPE_CGROUP_SOCKOPTWRITE_LIFE_NONEread_countlink_speedBPF_CGROUP_INET6_CONNECTlport_listHRTIMER_NORESTARTscsi_privlast_update_timeSKB_DROP_REASON_IP_INVALID_SOURCEfc_rport_fcp_prlisas_ss_spold_map_fddisc_startpanel___GFP_ZEROTAGS_BITac_padfc_rport_operationswatermarknode_start_pfnmax_allowed_capacityfc_statsopen_modeFC_RCTL_ELS_REPread_pos___GFP_ACCOUNT_BITclass_cpus_read_lock_is_conditionalmg_dst_preload_nodecpu_run_real_totalD_REAL_METADATAgpl_crcstimes_prevclass_raw_spinlock_try_is_conditionalfc_frame_headerkiocbmg_node___GFP_MEMALLOC_BITexecute_only_pkeyreturn_instancesma_lockblk_mq_queue_datacss_offlineattach_btf_tracedockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsELS_NACTFC_RCTL_DD_SOL_CTLwb_tcand_idFC_PORTTYPE_OTHERdentrysequential_iowait_pidfdprli_countcdb_statusInputRequestsSKB_DROP_REASON_SECURITY_HOOKs_writersgroup_stop_countavg_next_updateswap_lockvm_opswb_reasonpartial_bufread_before_msget_unmapped_areamkobjsym_VDSO32_NOTE_MASKfrozenactive_uprobeunregisteringget_parentmin_vruntimestoragesdebug_dirhost_resetfc_els_rnid_genclass_disable_irq_is_conditionalsyscrnr_mapssyscwsync_ionum_bpf_raw_eventswork_qcp_resv1orig_nentski_pose_csetsavx512_timestampfh_typeend_io_datae_freezeBPF_GRAPH_ROOTfree_cached_objectstaints_BoolFC_RCTL_DD_UNCATmax_tp_accessxol_vaddrb_dirtylist_lru_nodeuclamp_ses_time_granvm_statblk_integritykuid_tdev_pm_qosbd_holdersper_cpu_zonestats_sifieldstaskBPF_CGROUP_INET6_BINDresetsched_reset_on_forkcompound_headnr_retrieswake_irqbranchi_cdevfunc_infoi_fsnotify_marksin_thrashingdl_deferBPF_MODIFY_RETURNvpd_pg80waitersvpd_pg83vm_startvpd_pg89mprotectquota_ond_automountDEVICE_REMOVABLE_NOT_SUPPORTEDrnid_genELS_EDCcsum_not_inetctl_table_headeratimeget_ownershipf_task_workfc_host_attrsmy_q__refcount_add_not_zerofc_lport_stateBPF_SK_SKB_STREAM_VERDICTeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalFC_TYPE_FCPsectorinner_mac_headers_wb_errflush_listattach_prog_fdcloseiopl_warnelevator_queueptraced__MAX_BPF_MAP_TYPEWORK_NR_COLORSdonesym___kernel_rt_sigreturnsrcu_struct_ptrsskip_ms_page_3fbinfmt_miscinodesencapsulationmemcg_awarezonehost_waitFC_PORTSTATE_LINKDOWNmanage_shutdownac_schedqsize_t__fpstatemap_poke_track__rcu_read_unlockBPF_MAP_TYPE_SOCKHASHqf_ownerqueue_delayed_worksuspend_noirqd_inamePTR_TO_MAP_VALUEbi_flagslinks_countprealloc_pterdevd_ino_countarg_lockskb_drop_reasonclass_rcu_tasks_trace_is_conditionalDEVICE_REMOVABLE_UNKNOWNprlo_cmddoes_npivignore_childrenpoint_to_multipointframe_sendBPF_CGROUP_UDP6_RECVMSGdirty_exceededfreeze_fsin_eventfdresume_earlymax_dev_sectorsdup_xol_workalimititemsooo_okaynuma_groupblk_independent_access_rangeskmap_ctrlfscrypt_operationsrangesevents_lockfs_contextmnt_idBPF_CGROUP_INET6_POST_BINDretry_hwerrorfc_els_csspdrop_inodeBPF_MAP_TYPE_REUSEPORT_SOCKARRAYk_lockorc_unwindgraph_get_next_endpointfrom_ingresslast_sector_bugmq_mapprojid_mapkprojid_t__u16PTR_TO_XDP_SOCKsaved_end_ioBPF_MAP_TYPE_STACKsyscall_dispatchdl_densityon_rqlru_gen_mm_walkaltmapmin_perf_statercu_tasks_exit_listlro_xidsp_regdma_drain_buffc_flogi_filllast_resets_master_keysflagsbd_holder_locknr_threadsvm_mm__u32query_flagsmax_secure_erase_sectorsenable_statss_quota_typesvm_lockswapin_countdisc_stop_final_ddebugFAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitrcuwaitoffload_l3_fwd_markSKB_DROP_REASON_NOT_SPECIFIEDdelayskcompactd_max_ordercp_ee_credmnt_nstimerqueue_head_cp_resv2BLK_INTEGRITY_CSUM_CRCsdev_groupskioctx_tableprioritybtf_func_modelksm_rmap_itemsclass_read_lock_is_conditionalKMALLOC_RECLAIM__u64revoked_at_folio_nr_pagesfcp_packet_abortswritepageis_dirty_writebackpkey_allocation_mapLPORT_ST_DHBAdq_iddisable_depthem_perf_statethread_shstkTxWordsposix_timerswait_chldexitTxFramessas_ss_flagsunreadableunmap_limit_for_wspresent_early_pagesSKB_DROP_REASON_IP_INNOROUTESinsn_idxELS_RNFTPTR_TO_MEMbi_itersrcu_cblist_invokingiopollcsum_complete_swline_coliov_lenlatency_recordfc_lportdirty_limit_tstampsector_sizeskb_mstamp_ns__BPF_REG_TYPE_LIMITd_releaseavg_totalfh_cs_ctldev_dma_attrBPF_NETKIT_PEERzswap_writebackexpiresnuma_scan_seqmnt_sbfl_wwpnblkcg_csshashnodemask_tref_cntsize_poke_tabsignalfd_wqhhang_detecteddevice_driverSKB_DROP_REASON_ICMP_CSUMlast_zone_capacitystatisticsfsindexout_batchraw_spinlock_ter_resvs_cops_active__WQ_DESTROYINGnum_argspidlist_mutexsp_bb_datatag_sizeBPF_MAP_TYPE_PERCPU_HASHlast_old_flushs_uuidclear_child_tidruntime_statusdqb_btimedq_opBPF_MAP_TYPE_DEVMAPELS_ADVCshow_pathdl_serverVTIME_USERquota_disablesched_delayedWORK_OFFQ_DISABLE_BITSsrcu_gp_seq_neededtask_structtimer_delaycurrent_may_mountREFCOUNT_ADD_OVFpushpeaks_lockbpffs_fdpath_fdis_noirq_suspendedfwnode_endpointPTR_TO_TP_BUFFERcounterunique_idsuspendsupported_eventsoom_score_adj_minlast_bdp_sleepzone_wplugs_poolzone_typedomain_datacopy_file_rangesrcu_gp_startreport_zones_cbxa_flagsattach_btf_idlru_gen_foliobtf_idbpf_insntv_nsecmax_zone_append_sectorssas_ss_sizeeh_eflagss_inode_list_lockUTASK_SSTEPraw_tracepointfc_prov_mutexFC_RCTL_F_RJTehandlerdq_sbexpecting_lun_changescsi_targets_mountselem_flagsBLK_EH_DONEvm_stat_diffsym_pvclock_pageswapin_delay_totalfree_listBPF_CGROUP_UDP6_SENDMSGput_unaligned_be64page_fraginfo_lenrun_workfsuidRPM_REQ_AUTOSUSPENDsrcversiontrace_event_callwakeup_sourceis_partially_uptodatehost_faileddl_runtimemay_splitio_uring_cmdprogs_cntread_dqblkpeekedrtpoll_nr_triggerssrcu_parentinit_seq_privatebi_cookiesuppliersfile_operationsRxFramesSKB_DROP_REASON_TAP_TXFILTERbpf_ctx_arg_auxblist_flags_tmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotLPORT_ST_RESETis_preparedpgprotval_tmemoryfc_rport_recv_plogi_reqtrc_holdout_listELS_CSRasync_suspendq_nodezone_pgdatclass_mutex_intr_is_conditionalstrtabpage_freeftopdepends_onHPROBE_CONSUMEDi_mmapnr_cgrpsdirty_paused_whenirq_getrport_priv_size___GFP_COMP_BITcss_resetcapacitymax_channelversionlink_failure_count__WQ_BH_ALLOWSget_reference_argsllisthiwater_vmmax_perf_statebi_idxSKB_DROP_REASON_IP_RPFILTERcookiesfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntrtv_toqrseqattach_typetarget_knlimit0limit1pi_blocked_onpid_tac_exe_inodevmemmap_shiftbpf_attach_typeELS_FARP_REPLusage__kernel_time64_tSKB_DROP_REASON_IPV6DISABLEDrq_qos_mutexkernel_read_file_strscsi_data_bufferSKB_DROP_REASON_IP_LOCALNETcapabilitiesi_securitydevice_physical_location_panellimitsq_lock_cls_keyenvpactive_memcg__targetsElf64_Halfallow_reinitSKB_DROP_REASON_IP_OUTNOROUTEStimer_autosuspendsadiscratelimitSHOST_DELslave_configurestat_threshold_softexpiresautosuspend_delayline_info_rec_size_zonerefsi_flctxFC_PORTSTATE_ONLINEli_invalid_crc_countlist_lockvm_faultELS_RJT_INPROGip_epilogueoptimistic_spin_queuepermissionSKB_DROP_REASON_IP_NOPROTObpf_prog_array_itemin_fptransport_containerpreallocreap_refsystem_unbound_wqDEVICE_FIXEDlast_statusfdmi_enabledSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsslice_maxFC_RCTL_P_BSYIS_ERRmap_namebi_max_vecsthaw_noirqsched_debugfs_diraccounting_timestampserial_numbercan_matchtime_archcmd_sizechunk_sectorshlist_bl_headqc_dqblkLPORT_ST_RFT_IDcalledpasid_activatedancestorsmap_fd_sys_lookup_elem__fortify_panicbvec_integrity_poolBPF_XDP_DEVMAParch_data_oldshrink_controlegidsupported_fc4sthreaded_csetsmax_rdonly_accessmap_direct_value_addrnet_deviceenvp_idxcrypto_kobjectcdb_cmd___GFP_NO_OBJ_EXT_BITf_modetagged_supportedoffloadsvpd_pgb0vpd_pgb1vpd_pgb2ff_type_mapzone_idxfolioruntime_autopref_node_forklru_zone_sizeclassipc_namespaceBPF_SK_SKB_VERDICTarenaprev_scan_seqfc_dl_perfpsi_group_cpufc_rport_recv_reqwait_queue_head_talloc_hintfc_rport_lookupELS_RJT_FIPtask_cputimeFAULT_FLAG_INSTRUCTIONdeferred_splituser_nsfc_cdbnohdrclass_raw_spinlock_irqsave_is_conditionalrsppsyms_flagscgwb_release_mutexSKB_DROP_REASON_TCP_OLD_DATASKB_DROP_REASON_TCP_MD5UNEXPECTEDFC_PORTTYPE_NPIVsyncprli_cmdmq_freeze_locksg_prot_tablesized_childrenucountELS_EXPL_SPP_ICTL_ERRmap_local_storage_unchargectl_table_size__UNIQUE_ID___addressable_fc_set_rport_loss_tmo660bpf_map_opsfc_rport_identifierseh_host_reset_handlerddebug_class_mapdfl_cftypesprealloc_bufFC_TGTID_BIND_BY_IDaudit_contextfl_owner_tipi_listBPF_MAP_TYPE_DEVMAP_HASHpersistent_keyring_registeri_pipehardware_versionmachined_waitllist_headsense_buffernr_phys_segmentstask_itersnode_spanned_pagesavg_refaultedFC_RCTL_ENCHwait_page_queuecn_credit_stallbpf_line_infoBPF_SK_MSG_VERDICTFAULT_FLAG_REMOTEdl_bwhierarchy_idunaccepted_pagesi_dir_seqignore_dfheaderwatchdog_stamprefcount_setstate_startlist_op_pendingdatasrcu_cb_mutexsysfs_lockBPF_CGROUP_UNIX_CONNECT__refcount_inc_not_zerorls_lesballowed_progsno_callbackssaved_trap_nrclock_listbpf_func_infofolioq_slotMODULE_STATE_GOINGxattr_handlerac_utimescaledrqos_debugfs_dirprot_sdbidr_baseunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_locknextentseventkeytypeMissDiscAdvCount__kernel_gid32_tevicteddev_pm_domainnentsstart_time_nsuaddr2f_securityprot_opdefparamdiscard_granularitySKB_DROP_REASON_TC_RECLASSIFY_LOOPiotmo_cntclass_raw_spinlock_irq_is_conditionalFC_PORTSTATE_BLOCKED__bi_cntstate_remove_uevent_sentattributes_maskcloneddl_defer_runningnpiv_enabledlru_gen_mm_listqueuecommandevents_filetagged_writepagesia_validsrculog_bufinstrument_atomic_writesp_bb_credreq_flagsiorequest_cntsrcu_size_jiffiesclassesstatic_call_sitecputimeis_seenupdated_nextfh_s_idsrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitmap_fdfc_remote_port_deleterchari_verity_info_addr_pkeyfpin_statsELS_TPRLOrw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countBPF_PROG_TYPE_XDPbpf_ksymSTARGET_RUNNINGFC_SOF_C4atomic_opennapi_idload_time__mptrsigactionrlimfc_rport_adisc_respbtf_token_fdmce_addrf_freeptrSKB_DROP_REASON_TCP_OVERWINDOW__sighandler_tclass_spinlock_try_is_conditionallesbzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMESlrugenmax_target_blockedfs_flagsvm_filei_countuser_structmap_idaddress_space_operationsELS_LSTSFAULT_FLAG_USERkey_perm_tused_btf_cntbtf_log_bufeh_strategy_handlertimer_listverifier_zextmemory_eventscgwb_listrun_delayarch_atomic_setnum_ftrace_callsitesfc_frame_sidchange_queue_depthsrcu_cblistoffload_requestedblk_independent_access_rangeavg_write_bandwidthtlb_ubcpgtables_bytesi_lrufirmware_versionfh_parm_offsetGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackFC_FID_MCAST_SERVtrc_ipi_to_cpuparm_offsetscsi_luncss_onlinePTR_TO_FUNCmemory_events_local__WQ_LEGACYallow_restartmin_sliceSKB_DROP_REASON_XFRM_POLICYSKB_DROP_REASON_IPV6_NDISC_BAD_CODEcommit_rqssysfs_opsinq_periph_qualcore_relo_cntFcpPktAbortsatomic_write_hw_unit_maxFC_SOF_I2cmaj_fltFC_SOF_I4bio_integrity_poolnf_tracekparam_arrayFORTIFY_FUNC_strscpyesb_statFcpFrameAllocFailspercpu_refevict_inodeignore_media_changertpoll_statesthread_keyringmap_nrcgroup_nscpumask_trstat_css_noderb_leftRPORT_ST_DELETEgfp_maskdma_addr_tinactive_timerattributeinner_protocolinit_hctxperiod_timemm_lock_seqFORTIFY_FUNC_memchrELS_FANkernfs_elem_symlinkBLK_UID_T10FC_TGTID_BIND_NONEer_cmdwb_lcand_idFC_RCTL_DD_CMD_STATUS__kernel_dev_tcrypt_keyslotprog_namepm_domainBPF_CGROUP_INET4_BINDfc_rport_logoffmax_rdwr_accessmax_prop_fracfsgidsector_tcompact_cached_migrate_pfnnode_name_sys_privatesignal_structactive_mmFC_SOF_N2FC_SOF_N3FC_SOF_N4kernfs_iattrsshow_devnamecn_oversubscriptionthread_infoi_mmap_writabledata_size_outattach_btf_obj_fdreadWORK_OFFQ_DISABLE_SHIFTr_a_tovnum_portsvalue_recsecondarydevicesatomic_write_max_sectorsgroup_exit_code__UNIQUE_ID___addressable_fc_rport_flush_queue664tx_framesFORTIFY_FUNC_memcmpopc1REFCOUNT_SUB_UAFvalue_btf_idplogiexec_maxrecvsync_statedev_groupsuts_namespacefcloneDMA_FROM_DEVICEzone_start_pfnvalue_sizefc_rport_enter_readykernfs_elem_dirport_namepercpu_counter_printkDMA_BIDIRECTIONALcgroup_subsys_statesequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startELS_EXPL_SIDfc_els_resp_typeUTASK_RUNNINGopenseglenBPF_MAP_TYPE_QUEUEFORTIFY_FUNC_memcpy__kernel_ssize_tvdso_imagesi_signounused_hctx_lockatomic_readrseq_signpiv_vports_inuseresultrefsdelayed_calltime_slicefunc_info_rec_sizenr_rangemax_seqSKB_DROP_REASON_DEV_READYspc_timelimituid_gid_mapnr_freeresumeset_ownershipELS_RNCWQ_CPU_INTENSIVEbpf_iter_task_typeFC_PORTSTATE_NOTPRESENTregsbi_write_hinterrorSKB_DROP_REASON_PKT_TOO_BIGpassiverq_nextsyscall_user_dispatchshort_inquiryattrd_aliasis_suspendedseq_priv_sizerp_mutexdqio_semrestore_sigmaskrequeue_lockSKB_DROP_REASON_CPU_BACKLOGkcsan_check_accessevent_worknr_deferredmem_cgroup_idsrcu_sspi_lockELS_NDACTuser_event_mmbtrace_seqfc_rport_plogi_resps_devsiblingcdl_supportedia_rangetarget_sizemap_lookup_elemldt_usr_semrec_dataposix_cputimerslink_supported_speedstry_rc_10_firstRPM_INVALIDdd_datafreeze_kcountrequest_key_authblocksSKB_DROP_REASON_IPV6_NDISC_HOP_LIMITpercpu_ref_datad_spc_warnssrcu_supnbp_thresholdfreeptr_tLPORT_ST_DPRTns_typeRPM_REQ_NONEFC_RCTL_VFTHprog_btf_fdforce_runtime_start_on_system_startsg_timeoutixoldevloss_work_qELS_LS_ACCfasyncarg_startLPORT_ST_DISABLEDkprobes_text_sizekfunc_tabELS_TPLSblk_crypto_profileSKB_DROP_REASON_SKB_GSO_SEGfop_flagswork_lockoptionrom_version_addr_lsb_addrpfn_mkwritentimedriver_versionELS_RJT_UNSUPuaddrrtpoll_waitBPF_STRUCT_OPSKMALLOC_DMAfunc_proto_unreliableioerr_cnt__compiletime_assert_84_uidmm_states_fs_infomm_stats__rb_parent_colorWRITE_LIFE_EXTREMEicq_list__MAX_NR_ZONESmm_users_pp_mapping_padimagekey_serial_tno_uld_attachfolioqfoliosadisc_resv1adisc_resv2shost_groupssiblingscputimernrpageswake_q_nodeFC_PORTTYPE_NOTPRESENT__compiletime_assert_91blk_flags_tmap_fd_put_ptr__news_maxbyteshd_geometryioctx_tabledma_io_tlb_memfc_cmdrefKMALLOC_CGROUPeh_cmd_qfc_rport_flush_queuefree_after_rcu_gpget_unique_idkasan_check_readNR_KMALLOC_TYPESexpire_countcompact_init_migrate_pfnfor_syncwake_cpujited_lenPTR_TO_SOCKETlinfobio_split___GFP_DMA_BITfreeze_superELS_RSItick_dep_maskadisc_hard_addrsp_e_d_tovvmpressurelruvecmap_check_btfiter_infoqc_infoobjcg_listfault_flagmodnameia_ctimeFC_VPORT_NO_FABRIC_RSCStrace_eval_mapcompact_defer_shiftorig_objcgrespasync_put_workresvnum_static_call_sitesZONE_MOVABLEl4_hashvm_lock_seqFORTIFY_FUNC_strncatroot_listBPF_TRACE_FENTRYElf64_Addrwait_queue_entry_tseqlock_tlatency_record_countnr_integrity_segmentshost_blockedmay_skip_resumeprot_flagsVTIME_SYSalloc_tag_countersbase0base1base2SHOST_CREATEDbio_setfh_seq_idCONST_PTR_TO_DYNPTRBPF_MAP_TYPE_RINGBUFalignment_offsetlinksbasesfutex_staterseq_lenkobj_completionlesb_inv_wordi_spc_timelimitf_opnargsbindcpuhp_onlineproc_ns_operationsold_prog_fdnum_discovered_portsBPF_PROG_TYPE_SK_REUSEPORTmm_mtgid_trelease_workSDEV_CREATEDavg_nr_triggersno_report_opcodesELS_RSCNBPF_PROG_TYPE_LWT_OUTrcu_read_unlock_specialBPF_CGROUP_UNIX_RECVMSGtls_arrayipvs_propertyELS_EXPL_UNSUPRtask_io_accountingcss_rstat_flushf_raDEVICE_PANEL_FRONTmodule_memorynetkitsitescompat_robust_list_headcss_releasedthread_nodestatic_call_mods_shrinkgp_countRxWordsnr_sectorsbpf_raw_eventsiommutimer_expiresbpf_storagekset_uevent_opsf_ownerqfull__state_permDEVICE_PANEL_BACKELS_RJT_INVALmax_retry_countfc_els_rls_respoffsetswb_switch_rwsemdisc_syscalldiskSHOST_DEL_RECOVERYjit_requestedsrcu_lock_count__compiletime_assert_332trc_blkd_cpugp_waitWORK_OFFQ_FLAG_ENDiommu_mmfuncSKB_DROP_REASON_TCP_OFOMERGEget_unaligned_be64io_uring_task__WQ_DRAININGshared_tagsrepeatjit_keyringLinkFailureCounts_fsnotify_infofunctionlinkagedisc_recv_reqBPF_PROG_TYPE_CGROUP_SOCK_ADDRprojidmce_kill_mema_external_lockWORK_OFFQ_FLAG_BITSpid_linkskfree_skb_reasonconv_zones_bitmapscsi_target_ids_dio_done_wqRPORT_EV_FAILEDfor_kupdaternid_ip_verstart_all_reasonsystem_wqhlist_head_pad3_ioc_nodethrottle_diskrls_resvELS_FDISCbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACErunningrw_hintblk_integrity_checksumdestroy_rworkdma_skip_syncpartition_meta_infotstamp_type_accessDEVICE_VERT_POS_LOWERBPF_CGROUP_ITER_ANCESTORS_UPnr_dying_subsysfc_well_known_fidclass_spinlock_irqsave_is_conditionalutf8datakref_get_unless_zerohlist_nulls_headrequeue_workof_node_reuseddyndbg_infoFORTIFY_FUNC_strncpyfc_seq_els_rsp_sendElf64_Symreclaim_waitsaved_errd_rt_spc_softlimitpollsk_skb_reason_dropfree_file_infoin_lru_faultsp_lo_versched_contributes_to_loadtlb_genruntime_idlemap_counthost_scribblei_rt_spc_timelimitqc_type_states_dentry_lruac_comms_bdevrls_port_idskip_vpd_pagescrcssense_lenrun_listuevent_opsabort_workmax_cmd_lenbpf_func_statebpf_reg_typesched_classret_sizeutil_avganon_vmaFC_VPORT_LINKDOWNdevice_private_offset_pidsigcntDD_CLASS_TYPE_LEVEL_NAMEShas_callchain_bufELS_EVFPtailcall_target_stablebpf_cgrp_storagemodinfo_attrsst_spaceclass_map_typekparam_stringd_real_typemaxrsspoolcredBPF_MAP_TYPE_ARRAYkernfs_open_nodearch_atomic_try_cmpxchgf_wb_errmm_cid_activeSKB_DROP_REASON_VXLAN_ENTRY_EXISTSkzalloc_noprofWQ_MEM_RECLAIMdecryptedmodule_sect_attrsreq_flags_truntime_resumeac_stimescaledgroup_exec_taskrestrict_linkirq_countget_inode_usagekmalloc_typeFC_TYPE_IPxarray_startbpf_ctxpm_domain_dataserver_pick_taskbw_dworkattach_btfmap_lookup_and_delete_elemload_avgrecordi_private_lockget_dqblktail_callmq_listrnid_phys_portprli_spp_lenphysical_block_sizepgoffportnetdevBPF_LIST_NODEdefault_setmodelfreeze_latemf_statsZONE_NORMAL__list_del_entrycount_objectsvma_numab_statedma_map_opsdq_dirtyREFCOUNT_ADD_NOT_ZERO_OVFlnodemax_lunexit_cmd_privfd_typeatomic_write_boundary_sectorsboot_time__UNIQUE_ID___addressable_fc_rport_lookup656wpcopy_countmax_queue_depthwrite_bytescssp_seqSKB_DROP_REASON_SOCKET_BACKLOGeh_entryDISC_EV_FAILEDpending_eventsoom_reaper_listnumab_statefutex_offsetbpf_fdsubsys_fmt_prefixdq_lockintegritypte_tnr_scannedSKB_DROP_REASON_TCP_ACK_UNSENT_DATA__stateBPF_MAP_TYPE_UNSPEC_sp_rel_offnr_iosk_listn_io_portslicecgroupdrv_groupstrack_queue_depthtruesizecustom_slicenext_target_idper_cpu_pagesstart_idbdi_listmq_freeze_depthprlo_lenpadding1RPORT_ST_READYnestedatomic_write_segments_maxinsn_cnt__compiletime_assert_216__compiletime_assert_217__compiletime_assert_219map_set_for_each_callback_argsnr_dirtied_pausequeue_kobjdst_progreal_addressbd_holder_dirac_tgidinvalidate_locknum_exentriesfcp_cmd_sendfix_capacitycss_local_stat_showio_portvport_last_stateblk_mode_tpmdval_tSKB_DROP_REASON_NEIGH_FAILEDhost_tagsetBPF_GRAPH_NODEkveceh_noresumefree_areaset_latency_tolerancedepthd_ino_timerprobenetlink_nsnr_argstokenSKB_DROP_REASON_TCP_CSUMdev_ueventfc_rport_workELS_RJT_NONEfc_vportdep_mappage_mkwritelast_busyfc_rport_loginvm_flags_toffloadnregFC_SPP_RESP_NO_PAnr_failed_migrations_affinelro_enabledd_in_lookup_hashdom_csetptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLERreschedule_countmax_hang_timeFC_PORTSTATE_UNKNOWNcmd_per_lunopt_failedcdl_enablecutimelockrefELS_RLIRnew_map_fdmap_meta_equaltlb_flush_batcheddev_priv___GFP_HIGH_BITia_uidautogroupsequencefc_rport_enter_logorcu_syncarg_endclass_spinlock_irq_is_conditional_dummy_pkeyvruntimehostdataBPF_CGROUP_ITER_DESCENDANTS_POSTscanned___GFP_HARDWALL_BITSCALAR_VALUEnr_extentsstart_stop_pwr_condpidlistsWB_REASON_VMSCANfeatures_locked__kernel_pid_tdev_statedevice_blockedfile_flagsPIDTYPE_SIDcinblockdma_alignmentprot_typeBPF_TCX_INGRESS__kernel_loff_tset_performance_stateserial_nodelist_del_rcuELS_EXPL_AH_REQlru_gen_mm_statenotify_countsrc_regupdated_childrenactive_fc4sspin_lock_offBPF_CGROUP_SYSCTLsingle_lunhprobesg_reserved_sizeswap_activatedqb_isoftlimitsp_flogi_accsaved_auxvnoinstr_text_sizeELS_SBRPdl_overrunfc_no_free_exchiattrdetachedbootbios_versionloff_toom_flag_originfreepages_delay_totaldesc_lendma_devSKB_DROP_REASON_NETFILTER_DROPoom_score_adjwb_waitqSHOST_RECOVERYrq_end_io_fnksm_merging_pagestest_runDISC_EV_SUCCESSSKB_DROP_REASON_TC_COOKIE_ERRORgraph_parse_endpointrmidptp_rdataoxidFC_RCTL_P_RJTlist_lrudevice_removablefc_seq_not_foundfxsavedev_pagemap_opsbv_offsetBPF_MAP_TYPE_XSKMAPset_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETfc_get_host_statsd_lockrefbtf_typenr_populated_domain_childrenSCSI_EH_DONEsession_keyringseeksshost_devbtf_log_true_sized_deleteuts_nsd_ino_softlimitfc_els_prlifc_els_prlod_weak_revalidateraw_atomic_setalloc_time_nsrcu_read_locki_devicesSKB_DROP_REASON_NEIGH_CREATEFAILFC_PORTSTATE_ERRORdqb_curspaceSKB_DROP_REASON_XDPSKB_DROP_REASON_NO_SOCKETBPF_TRACE_KPROBE_SESSIONELS_FDACDTalloc_lockearly_inittotal_numa_faultswritable_sizemax_segmentsdma_need_drainobj_cgroupem_tableBPF_PROG_TYPE_TRACINGmq_sysfs_init_doneactive_queues__UNIQUE_ID___addressable_fc_rport_create657compact_consideredfc_debug_logging__lstatepercpu_drift_mark__BPF_REG_TYPE_MAXinodesubtree_bstatbd_fsfreeze_mutexhrtimeratomic_write_unit_maxrtv_e_d_tovFAULT_FLAG_UNSHARErp_arg__compiletime_assert_658LossOfSignalCountlocal_fwnodetask_sizemust_resumeRPM_ACTIVEend_codePTR_TO_SOCK_COMMON_OR_NULLuintnr_free_highatomicpreempt_notifierstlb_flush_pendingmigration_flagsDEVICE_PANEL_RIGHTfast_io_fail_tmomap_poke_untracktx_wordscap_inheritablebpf_cgroup_iter_orderkobj_sigvaleh_timeout__stack_chk_failwritecntBPF_KPTR_PERCPUsrcu_n_exp_nodelayin_batchseqcount_spinlock_textra1extra2write_s64graph_get_remote_endpoints_rootstree_scanned__int128 unsignedverifiedcpu_countcgroup_rstat_cpuevent_callbackwb_lcand_byteswait_sumuprobe_xol_opssg_suppmin_align_masknextevtthis_idrcu_segcblistread_s64reported_split_lockreturn_instancewait_countconfirm_switchnr_wakeups_affine_attemptspud_ti_ino_warnlimitmax_open_zonesrmtpnext_offsetFC_PORTTYPE_LPORTio_statuslp_mutexSKB_DROP_REASON_FRAG_REASM_TIMEOUTblindedacpi_device_iddev_scratchctx_idutaskpoweroff_noirqactive_modesdev_datais_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangsSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcss_setfwnode_handleELS_EXPL_NOT_NEIGHBORgfp_ttypeqf_fmt_idlink_updatepagepageset_high_maxatomic_write_unit_minrls_cmdsleep_startmap_mem_usagememalloc_noiobegintypetabuse_192_bytes_for_3fnr_reserved_tagsBPF_PROG_TYPE_RAW_TRACEPOINT_WRITABLEi_crypt_infoFC_TYPE_NVMEretry_workDEVICE_HORI_POS_CENTERio_start_time_nsaudit_ttyrecov_retrybatch_sizedns_rdatanr_zonesmutex_unlockrejectjobctlsi_errnonr_leaves_on_treequeue_ctxmin_shallow_depthfc_seq_sigchlddqb_itimeHPROBE_STABLEatomic_try_cmpxchg_relaxedquota_format_typebio_crypt_ctxpercpu_ref_func_tpm_message_tsplit_queueac_memBPF_CGROUP_INET4_POST_BINDpprevlip_countino_warnlimitremcsum_offloadexception_boundarybroken_fuabpf_iter_seq_infozone_wplugs_lockmnt_flagsfc_setup_rportac_stimemem_cgroup_reclaim_iterrange_endlast_mergememcg_nr_pages_over_highsw_reservedbpf_tokenwbt_flagsbpf_iter_fini_seq_priv_tcss_freecpu_delay_totalobjcgfh_r_ctlno_read_disc_infoblock_startvm_area_structnum_gpl_symsselect_no_atnSKB_DROP_REASON_TCP_INVALID_SEQUENCEBPF_CGROUP_INET6_GETPEERNAMEis_extendednr_charged_byteslong long unsigned intWRITE_LIFE_MEDIUMBPF_MAP_TYPE_CGRP_STORAGEtmf_in_progressnext_addrSDEV_CREATED_BLOCKhuge_faulti_fopautasklast_task_numa_placementfc_els_ls_rjtSKB_DROP_REASON_IP_INADDRERRORSrnid_prot_portip_after_callrefcntfreeze_holderqueue_work_onpsi_groupcdevperf_eventSKB_DROP_REASON_VXLAN_VNI_NOT_FOUNDcp_rdfsELS_RJT_LOGICunregfuncoom_groupseqcountBPF_XDP_CPUMAPclass_idbitsetWORK_STRUCT_LINKED_BITallowed_cmdsbtf_field_typeinquiry_mutexcan_swapof_device_iddisk_statsmanage_runtime_start_stopadisc_cmdclass_migrate_is_conditionalnetwork_headermin_ratioclass_write_lock_is_conditionals_xattrpart__pkt_type_offsetb_dirty_timeli_loss_of_sync_countfc_rport_recv_flogi_reqBLK_EH_RESET_TIMERil_prevPTR_TO_SOCK_COMMONd_initget_name_prefixused_mapsspan_seqlockfc_soffileattr_get__kmalloc_noprofthreaded_csets_nodeclass_groupsSDEV_TRANSPORT_OFFLINE__ret_warn_on__call_single_nodeunicode_mappathhigh_maxrstat_cpuSKB_DROP_REASON_DEV_HDRrecent_used_cpuruntimeold_time32_tsocket_pressurefc_remote_port_addenforce_expected_attach_typeprli_len__state_sizeBPF_CGROUP_INET6_GETSOCKNAMEvportsunsigned int_fl_resvdsbitmapclass_irqsave_is_conditionalfc_rport_recv_logo_reqcore_kallsymsscsi_deviceSKB_DROP_REASON_IPV6_NDISC_BAD_OPTIONSs_fsnotify_maskraw_atomic_try_cmpxchg_relaxedscan_objectsbi_privatewb_idDD_CLASS_TYPE_DISJOINT_BITSevent_liststartupkeyring_index_keyiov_iterd_rcustatic_key_false___GFP_DIRECT_RECLAIM_BITuintptr_twake_entryrcu_tasks_holdoutfreezefprop_globalassoc_array_ptrbatchcacheBPF_TRACE_RAW_TPold_timespec32rcu_blocked_nodejiffies_at_allocfunc_idxfcp_frame_alloc_failuressubsys_datast_namegroup_nodei_mtime_secbus_dma_regionrp_statefh_rx_idSKB_DROP_REASON_TCP_OLD_ACKstatic_rqsstarget_sdev_usercsp_seqac_majfltdn_device_specificmce_kflags___GFP_NORETRY_BITFORTIFY_FUNC_memset__oldscheduledbus_dma_limitubufbtimefc_rport_enter_deleteSKB_DROP_REASON_QUEUE_PURGEia_gidmigrate_foliohigh_minrq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrnext_posix_timer_idmq_ops_mapcounti_atime_secstarttimefile_costreschedule_jiffies__list_delWORK_BUSY_RUNNINGhprobe_statei_sb_listquota_offmap_poke_runmap_delete_batchshm_clistmap_delete_elemwait_for_compcb_headpages_skippedzone_wplugs_hash_bitspi_offsetac_flagfh_df_ctlpt_regsmmap_missexpires_nextblk_opf_tSKB_DROP_REASON_IP_INVALID_DESTreport_zoneskeyring_name_list___GFP_ZERO_BITnum_trace_bprintk_fmtiter_seq_infoSKB_DROP_REASON_TCP_AOKEYNOTFOUNDcdrom_device_infolruvec_stats_percpuaccess_statebpf_prog_statssdev_gendevwork_structtruelast_queuedreverseSKB_DROP_REASON_VXLAN_NO_REMOTEri_timernr_populated_threaded_childrenex_refcntfc_active_provpipe_bufsavg_last_updatebp_offsetkmalloc_cache_typeswap_events_filefc_frame_freeprotectedbsyncrequestedsaved_scratch_registertracepoints_ptrsfcp_cleanupwifi_acked_validblock_maxstatic_keyqueue_rqsout_rjtdev_boundlibfc_function_templatecsum_validFAULT_FLAG_VMA_LOCKtotalreserve_pageskswapd_order_sp_tot_seqdma_range_mapvaluesKOBJ_NS_TYPE_NONEctl_table_pollfc_els_rjt_explanmin_slab_pages_dataFAULT_FLAG_WRITEshow_optionswait_queue_entryexpirei_uidtagset_freedmax_sectorsexpiryfc_frame_payload_opperiodbmaprescue_workqueuerx_wordsmap_allocdispatch_wait_lockscsi_levelfsaveBPF_TRACE_UPROBE_SESSIONi_write_hintfl_csspels_datasuspended_timeread_byteszone_wplugs_worksum_sched_runtimes_writers_keySYSCTL_TABLE_TYPE_DEFAULTbpf_callback_tRPORT_EV_READYstart_boottimetimer_offentriesi_modecap_permittedfc_rport_priv_flags_2aBLK_UID_NAAstart_coderet_flagsvm_flagststamp_typesi_codeseqcount_spinlockBPF_PERF_EVENTheadHPROBE_GONElast_siginfosched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorsdworkdevice_dma_parametersdir_contextsaved_dst_attach_typeiopl_emulconsumersratelimit_statepower_statedq_flagsis_late_suspendedfieldsswap_plugcapture_controlPTR_TO_MAP_VALUE_OR_NULLraw_atomic_fetch_sub_releaseoffline_nodequeue_offsetclass_device_is_conditionalnon_rcuput_superwrite_endshostbpf_exception_cbxdp_has_fragsdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_statctx_arg_info_size__kmalloc_large_noprofrtv_zeroddp_setupfc_rport_recv_rtv_reqjitedopen_flagslegacy_namemap_lookup_percpu_elemfc_frame_payload_getFAULT_FLAG_INTERRUPTIBLEmap_token_fds_inodes_wbvport_delete_worksubsysfolio_queuedurationrefcount_readinner_transport_headerinit_fs_contextuprobe_taskELS_RPBCf_mappingFcpPktAllocFailstailcall_bypassstart_stackBPF_MAP_TYPE_STRUCT_OPSprog_array_member_cntfh_ox_idDL_DEV_PROBINGfc_rport_prli_respi_linkWB_REASON_MAXfc_frame_allocstack_vm_areatgtid_bind_typefc_lund_hashBPF_SPIN_LOCKdl_server_pick_frefcount_dec_and_testtty_old_pgrpst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquotaorc_entrydma_drain_len__MAX_BPF_ATTACH_TYPESCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listutimemmapshrinker__UNIQUE_ID___addressable_fc_rport_destroy659alloc_dquotbw_time_stampmappingdl_defer_armedfc_ns_ftsmap_pollrunnable_sumatomic_fetch_sub_releasecpu_scaled_run_real_totalshort unsigned inteventsget_rq_budget_tokenqueue_ramp_up_perioddevice_nodemm_walkgpl_compatiblefc_gpn_ft_resprequeue_listlocal_portFC_PORTSTATE_DIAGNOSTICSp_size_fieldpkt_typelong long intsym_vvar_start_hugetlb_cgroup_rsvdSKB_DROP_REASON_ARP_PVLAN_DISABLEsival_ptrproc_namepercpu_sizefc_vport_stateFC_PORTTYPE_UNKNOWNBPF_TASK_ITER_ALL__wsuminvalidate_foliofc_rport_compatible_rolesis_vallocdrop_nsNOT_INITELS_RJT_VENDORWORK_STRUCT_INACTIVE_BITnr_queuesgenerationno_pm_callbackscountELS_RJT_PROTddp_targetd_parentpagessched_task_group__compiletime_assert_328BPF_TIMERupdate_timetc_skip_classifymemcg_idpidsof_noderun_nodedata_sourcesubmit_bio___GFP_UNUSED_BITs_instancesvm_rcu__compiletime_assert_331bd_start_sect__compiletime_assert_333ctl_nodepage_table_locksysv_semquota_infoquota_enable__kernel_timer_twork_listresp_activeBPF_MAP_TYPE_PROG_ARRAYPTR_TO_PACKETdomain_tagmax_integrity_segmentscmaxrssit_real_incrprobestubextable_lenlast_arrivalwake_index_watermarkSKB_DROP_REASON_SOCKET_FILTERswap_rwrdatareservemap_extrasplit_queue_lockFC_RCTL_DD_SOL_DATAseq_idevents_local_filesrcu_gp_seq_needed_expDEVICE_HORI_POS_RIGHTSKB_DROP_REASON_HDR_TRUNCSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOia_mtimenr_thpslegacy_cftypesrnid_vend_specsysv_shmfopssuppress_bind_attrsinsnlen__page_1__page_2WORK_CPU_UNBOUNDi_mutex_keykey_restrictionstatquota_writedomainget_linkFC_PORTTYPE_NLPORTmax_depthctl_table_argdata_lenpriv_stack_ptr___GFP_NOFAIL_BITfl_vendblkcg_nodefc_rport_flogi_respforksa_flagsno_start_on_addcancelled_write_bytesdispatch_busyfcp_packet_alloc_failuresnbp_rl_startFC_RCTL_ACK_0task_worksmm_cidatomic_write_hw_maxFC_SPP_RESP_ACKdfl_cgrp_ddebug_infoaddrsshrinker_info_unitstats_locknum_kpfc_fill_fc_hdrSTARGET_CREATED_REMOVEshost_gendevcsumMEMORY_DEVICE_PRIVATE__bd_flagssuper_blockbi_bvec_donemap_get_unmapped_areabus_typeget_named_child_nodeBPF_MAP_TYPE_PERCPU_CGROUP_STORAGE_DEPRECATEDassoc_array__UNIQUE_ID___addressable_fc_rport_login661actorBPF_CGROUP_ITER_DESCENDANTS_PREbpf_offload_devkobj_ns_typedeferred_resumeFC_SPP_RESP_MULTsched_shared_tagsfp_wwpnlong intcore_nodebdi_nodecn_device_specifictarget_btf_idmem_dqinfodevnodesaved_sigmaskac_uidBLK_UID_EUI64FC_TGTID_BIND_BY_WWNNMEMORY_DEVICE_PCI_P2PDMAac_nicedq_offpinsblkcg_mutexis_visiblecgrp_linksdisk_nameuuid_t__kernel_clockid_twritabledqb_bsoftlimit__fc_fill_fc_hdrvfork_donetask_cputime_atomicki_waitqra_pagesgroupmmap_compat_legacy_basedevice_dma_supportedsysfs_dir_lockscsi_cmnd_submitterFC_TGTID_BIND_BY_WWPNignored_posix_timerslockedsival_intia_filecancel_attachio_pagesSKB_DROP_REASON_TC_EGRESSwakeup_cntrequest_pendingdl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsfabric_nameclass_read_lock_irqsave_is_conditionalfc_els_rjt_reasonblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startavg_triggersctl_dirFC_PORTTYPE_PTProbust_list_headfc_rport_enter_prliunsigned charwake_qfc_adisc_fillrange_startrethookspermanent_port_namenuma_scan_periodelem_countnr_tagssda_is_staticwakeup_pathresult_maskFORTIFY_FUNC_memscanscsi_timeout_actionei_funcs__func__fc_passive_provBPF_NETFILTERtablesRPORT_ST_PLOGI_WAITpipe_inode_inforaw_spinlockmemcg_cgwb_frnblkio_delay_totaldomainnameinstrument_atomic_readktyperesp_codebpf_attrBPF_PROG_TYPE_CGROUP_SYSCTLhost_sizemigration_disabledSKB_DROP_REASON_FRAG_TOO_FARsystem_hostnameext_mutexRPM_REQ_SUSPENDcancel_forkpgprot_ttracepoint_ptr_tfor_reclaim_skb_refdstphysical_locationELS_PDISCchildren_low_usagenum_vfPIDTYPE_MAXbi_sizemg_dst_csetvlan_protothrashing_countwatcherscrypt_ctxstopwait_maxclass_write_lock_irqsave_is_conditionalioveca_flagsiomapd_dnameScsi_Hostnr_migrations_coldbtf_value_type_idmnt_idmapfc_rport_t0_prli___GFP_FS_BITWORK_OFFQ_LEFTquotactl_opski_iopriovport_typesched_remote_wakeuptag_alloc_policysock_filterBPF_LIRC_MODE2tracing_graph_pauseread_itersuspend_latefront_padFC_TYPE_CTsdev_devmaxframe_sizerecoveredi_rwsembi_integrityfc_plogi_get_maxframeexitio_uringeh_device_reset_handlerchild_ns_typeorderslave_bdevscommit_dqblkclass_local_lock_irqsave_is_conditionalmark_dirtyFC_PORTSTATE_OFFLINEnr_ctxkernfs_opsfc_rport_t0_provnr_dying_descendantsoom_reaper_timermodulewb_bytesbd_securitynodeinfoqueue_lockf_pathstatic_call_siteself64_symunlinkmap_queuescpumask_var_trefcount_warn_saturatetime64_tdrivers_diri_gidfc4_provtype_idFORTIFY_FUNC_strnlenrq_qosmark_deadREFCOUNT_DEC_LEAKicq_hintrmdirdq_dqbdropspeedmemory_failureblkcg_gqdma_flagsbtf_field_kptrSUBMITTED_BY_BLOCK_LAYERmax_hw_sectorsselectors_mtdmod_kallsymss_typefield_maskjits_use_priv_stackprog_bind_mapli_failure_unknownfini_seq_privateremount_fsbd_holdernext_idtask_delay_infopi_senew_utsnamejit_datarelative_fdin_useforwardrq_countMIGRATE_SYNC_LIGHTerrseq_tms_rdatakstatfslruvec_statsreclaimedmems_allowed_seqmax_user_discard_sectorsinsnsitarget_allocbug_listBPF_CGROUP_INET4_CONNECTmax_nr_cidmod_arch_specificDMA_NONEtransfersizepp_recyclesplit_queue_lensharebpf_net_contextprobe_addrno_cgroup_ownerSKB_DROP_REASON_DUP_FRAGdisc_stopftrace_timestampbi_iopriobypass_addrd_ino_warnsstack_depthkernfs_elem_attrBPF_PROG_TYPE_SK_SKBi_ctime_nsecrelative_idrbnodei_private_listbinfmtftrace_sleeptimedata_size_inBPF_CGROUP_ITER_ORDER_UNSPECi_statebv_pagedestructorpcpu_cidsupported_speedssched_migratedfcp_parmZONE_DMA32FC_TYPE_ILScgroup_tasksetdup_xol_addrdevice_configurePROBE_PREFER_ASYNCHRONOUSrcu_node_entryreverse_orderingBPF_MAP_TYPE_BLOOM_FILTERcgroup_bpffile_system_typeorig_ret_vaddrelsct_sendbtf_log_levelELS_RCSmmu_notifier_subscriptionsswap_iocbBPF_RB_ROOTfc_rport_recv_els_reqdefault_groups__sifieldsb_ionr_watchesfind_special_pageDL_DEV_DRIVER_BOUNDELS_EXPL_SPP_OPT_ERRadj_offcurr_ret_depthstarved_entryfc_flags__fillerdestroy_dquot__task_fpstatefilldir_tSKB_DROP_REASON_TCP_AOFAILUREget_reserved_spaceioprioKMALLOC_NORMALunreliablecreateBPF_PROG_TYPE_SCHED_ACTdirtied_time_whenstart_scan_seqperf_rdpmc_allowedmin_seqfc_rctlsym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerSKB_DROP_REASON_QDISC_DROPbd_openersdq_inuseofflinedev_pm_infomremaptime_nsin_memstallhost_self_blockednode_size_lockcss_extra_stat_showkptrpoweroff_latei_nlinkwakeupcb_list___GFP_IO_BITcpu_iditer_info_lenpushable_tasksraw_atomic_readtty_audit_bufkref_putmaxlenkernel_cap_t__be16bpf_funcpoke_tabmems_alloweds_inode_lrucached_rqse_cset_noderecov_seqSKB_DROP_REASON_SKB_CSUMkf_rootmmap_compat_baseretvalpreparenr_threaded_childrenclock_op_might_sleepf_sb_errneed_mbd_namecheck_flagsi_sequencert_prioritykretprobe_instancescrypto_profile__be32token_createiov_basecpus_ptrq_lockdep_mapb_more_ioloadfuncscpu_bitmapSTARGET_DELatomic_write_lensaved_tfxa_headdetachprog_ifindexmm_listSKB_DROP_REASON_NOMEMproperty_read_string_arrayget_statetracepoint_funcd_seqnuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmt__be64blkg_listnum_symtabexec_update_lockfscrypt_inode_infosplice_readSKB_DROP_REASON_SOCKET_RCVBUFFBPF_PROG_TYPE_SOCKET_FILTERSKB_DROP_REASON_TCP_RFC7323_PAWSSKB_DROP_REASON_MAC_INVALID_SOURCEFC_FID_TIME_SERVneed_qsctx_mapFC_VPORT_UNKNOWNfc_rport_state_namesbd_diskuid_gid_extentnumberszone_wplugs_wqWRITE_LIFE_SHORTsigpendingpi_entryBPF_MAP_TYPE_ARENAs_inodesdirtied_whenfc_prli_fillmap_direct_value_metaMIGRATE_ASYNCBPF_MAP_TYPE_PERCPU_CGROUP_STORAGEnext_scangsindexwrite_bandwidthcompletewatch_listli_prim_seq_err_counteh_abort_listBPF_CGROUP_UDP4_RECVMSGd_sibsleepable_refcntmodule_attributemax_host_blocked__builtin_memsetneed_tsin_dpm_listwordwork__list_add_valid_or_reportmultiprocessquiesce_depthfbatchclass_task_lock_is_conditionalBPF_CGROUP_INET_INGRESStask_groupf_pos_lockperiod_timerBPF_FLOW_DISSECTORsk_buff_data_texpected_revisionbio_pooltimeout_workBPF_PROG_TYPE_LWT_XMITmac_lensrcu_barrier_completionBPF_MAP_TYPE_STACK_TRACEpacctblk_mq_tag_setSKB_DROP_REASON_TUNNEL_TXINFOcurr_targettemp_sppvm_page_protbalanced_dirty_ratelimitbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatPTR_TO_PACKET_ENDperf_event_contextatomic64_tnoinstr_text_startctx_size_outddp_doneac_btime64HRTIMER_RESTARTqueue_workrpm_autosuspend_delayac_gidELS_LINITnotify_timercorememfh_d_idBPF_MAP_TYPE_USER_RINGBUFLPORT_ST_LOGObusystack_canaryuser_keyring_registermax_write_zeroes_sectors_utimedn_unable_to_routetmf_work_q__fortify_size_flags_1_flags_2FC_TYPE_BLS__ptrtaskstatsport_stateproactive_compact_triggerELS_FLOGIposix_acli_dio_countarch_rwlock_tdriversym_timens_pagerport_event_callbackprog_token_fdsysctlsoffsetrtpoll_taskprot_guard_typedev_iommuWB_REASON_SYNCmap_typeclass_rwsem_read_intr_is_conditionalcompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_usersSDEV_BLOCKbacking_dev_infoi_mappingheadersdiscard_alignmentbsg_deviceshow_statsnr_populated_csets_ress_vfs_rename_keysubmitteretypekfree_skbi_bytes___GFP_WRITE_BITnormal_prioWQ_UNBOUNDblkio_countshost_datadispatch_waitBPF_MAP_TYPE_INODE_STORAGEsrcu_nodelast_mm_ciddelayedhdr_lenper_cpu_nodestats__refcount_addSKB_DROP_REASON_TC_CHAIN_NOTFOUNDvaddrscsi_vpdis_softnext_cpugrab_current_nsclass_namesdisc_worknr_taskslock_class_keypriv_stack_requestedsum_exec_runtimememory_failure_statssetupdev_pin_infolesb_sync_losspoll_table_structmce_whole_pageELS_QOSRia_modercu_tasks_holdout_listsched_rt_mutexfl_cmds_pinsswap_peaksnon_seqbpf_prog_arrayattach_func_protoSKB_DROP_REASON_IP_CSUMpresent_pageshctx_listtmp_rdatarenamecontiguousthrashing_delay_totalmajorktime_tonstackPRJQUOTAlink_idzswap_lruvec_stateBPF_CGROUP_INET_SOCK_RELEASEkprobe_blacklistjump_entriesdio_offset_alignELS_LKAreserved_tagsdma_masksa_restorerqueuelistdatalenfc_rport_libfc_privmkdirnextrelax_countrestore_earlyPIDTYPE_TGIDilencpu_run_virtual_totalmax_active_zonesdevice_physical_location_horizontal_positionattach_flagskfunc_btf_tabrportkobj_uevent_env___GFP_MOVABLE_BITkprobes_text_startkref_initpid_typefown_structi_default_aclBPF_PROG_TYPE_LIRC_MODE2fregs_statemap_flagsBPF_PROG_TYPE_LSMzonerefshift__devicesFORTIFY_FUNC_strcpypendingfc_classfc_rport_timeoutBPF_MAP_TYPE_PERCPU_ARRAYdma_boundarybd_nr_sectorsnr_eventssdev_statekmemcg_idkstatanon_vma_namedq_hash__iovgp_stategrphiFC_RCTL_ELS_REQntabInputBytesiommu_mm_datamap_for_each_callbackinvalid_crc_countnr_disk_swapinszone_wplugs_err_listma_flagsarch_uprobebio_issueSKB_DROP_REASON_IPV6_NDISC_NS_OTHERHOSTDL_DEV_UNBINDINGKMALLOC_RANDOM_ENDrefcountmmap_lockuprobe_multidevice_sizeLPORT_ST_RFF_IDzonelistELS_LS_RJTsrcu_reader_flavorbtf_fddumped_framespeerstimerqueue_nodeELS_FARP_REQreal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_alloweduse_16_for_syncrt_mutex_waitermem_cgroup_per_nodekcompactd_pad_page_pooldq_dqb_lockf_flagsblk_qc_tshow_infoinner_map_fdslave_allocflush_requiredWB_REASON_FS_FREE_SPACEsg_tablememcg_vmstatskeyring_semattributesblk_queue_statsgrplomax_rport_retry_countkgid_tkey_userreadlinkoffline_disabledd_comparetime_ns_for_childreni_wb_frn_winnerqspinlocksighand_structELS_FACTstart_brkELS_RNIDfl_cspdisc_callbackfc_rport_enter_flogimap_mmapdio_completeshost_statelocked_pendinglockdep_keyrnid_resvdextentfile_offsets_idstate_maskcore_statelink_upalignsym_int80_landing_padfc_rport_rtv_respngroupsmajor_retriessp_offset__sigrestore_tRPM_SUSPENDEDsystem_highpri_wqDMA_TO_DEVICEmutexn_refattrsexch_mgr_resetBPF_TCX_EGRESSFC_VPORT_DISABLEDbi_sectoreh_deadlinefsbaseinactivelport_set_port_idsrcu_barrier_mutexloss_of_signal_countdirty_limitswregs_state__kernel_timespecchildren_min_usageeh_should_retry_cmdpglist_dataWQ_HIGHPRId_lruwaitqmax_pkt_offsetd_fieldmaskcountersfaults_disabled_mappingnameidataarg_sizefailedpoweroffbpf_prog_opsbpf_verifier_envminorsnonresident_ageControlRequestselemsizerlim_curFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagscan_workdebugfs_entrywait__list_add_validshow_rqcan_queuest_shndxreservedi_wb_frn_historyELS_EXPL_AHctxsprocess_keyringset_dqblkrestart_blocks_opbi_end_iokobjectposix_cputimer_basenr_memcgsleveluser_definedcow_pageFC_SOF_Fnanosleepinvalid_tx_word_countfalsemax_npiv_vportscn_sig_alarmpi_state_listtv_secac_exitcodeBPF_KPTRsuidFC_SOF_I3prog_typeKMALLOC_RANDOM_STARTkey_typedismissi_hashmm_cid_next_scanfreeze_noirqoublockcancel_delayed_work_syncdisc_idia_atime_timerfifovm_private_dataskip_ms_page_8work_bitsfc_frame_alloc_fillFC_RCTL_BA_PRMTrtpoll_scheduledWB_SYNC_NONEBPF_PROG_TYPE_KPROBEorig_progadisc_resvdq_freeSHOST_RUNNINGrootLPORT_ST_RNN_IDDISC_EV_NONEsupported_classespolicycpu_baseBPF_PROG_TYPE_SYSCALLcap_bsetnr_to_writerportsnr_itemsSKB_DROP_REASON_NEIGH_QUEUEFULLanon_costseq_startfcp_input_megabytesbp_regbvec_poolkern_versionrb_root_cachedfc_host_statisticsWB_REASON_FOREIGN_FLUSHmac_headeri_blkbitswritervm_pgoffvirtmem_refcounttarget_fdcsum_typeFC_RCTL_F_BSYLSKB_DROP_REASON_TCP_CLOSEbin_attributesuccessELS_LOGOmath_emu_infopushable_dl_taskswrite_u64kvfree_call_rcutestWB_SYNC_ALLsched_infogroup_infotailsport_typedqi_fmt_idPTR_TO_ARENAactive_extensionsmemcg_csssoftirq_next_timerrevisionis_child_subreapersg_tablesizeexit_codefile_lock_contexttracingnr_pagesntoh24writeback_indexread_u64fc_els_spp_respfiemap_extent_infofilemempool_free_tPTR_TO_TCP_SOCK_OR_NULLfree_foliort_spc_warnlimitcmndatomic_write_hw_unit_mincompact_count_sk_redirtimer__empty_rangessbq_wait_statedev_namebpf_mapBPF_PROG_TYPE_EXTBPF_PROG_TYPE_FLOW_DISSECTORnotified_atrport_bindingsWORK_OFFQ_POOL_SHIFTn_klistwb_errbudget_tokenfc_framevlan_tcikswapdwrite_dquotrefcount_offpercpu_pvec_drainedf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachewwnnstorebi_bdevELS_PLOGIst_infodispatchdescsquiesced_bydqi_max_ino_limitllseeknet_nsRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleget_projidfunc_info_aux__sectorpart0cnvcswwwpncallskqidmem_cgroupPTR_TO_BUFfree_inodenext_keysiglockwait_queue_func_tperf_recursionnr_wakeups_remoted_spacei_ctime_secdebugfs_idreal_func_cntnext_timer_typeBPF_TASK_ITER_TGIDTT_NATIVEused_map_cnt__empty_insnshlist_bl_nodenum_descsSKB_DROP_REASON_TCP_FLAGS_head_1_head_2clockiddelayed_work_timer_fnFREEZE_MAY_NESTsym_hvclock_pageremap_file_rangemmap_legacy_basepfmemalloc_waitend_dataxa_lockfutex_exit_mutexuse_16_for_rwiommu_groupmap_peek_elemnr_isolate_pageblockmempool_alloc_tdevice_get_dma_attrtarget_blockeddev_loss_worksp_hi_veralloc_inodepayloadbtf_field_graph_rootdirty_foliodn_unknownnode_zonesseq_countfscrypt_keyringis_hardasync_sizeSKB_DROP_REASON_INVALID_PROTOtrap_nrf_iocb_flagsctx_size_in__flagsRPORT_EV_LOGOkcompactd_waitnodenametotal_vm_entire_mapcountiteratorlastpool_dataqf_opsforce_atomic_pad1_LPORT_ST_RHBAreal_credno_difblkcnt_td_rt_spaceprog_idsBPF_MAP_TYPE_HASHsigned charmap_local_storage_chargehas_child_subreapermount_pad2_reasonblk_flush_queuesched_entitydev_links_infoinner_protocol_types_uuid_lenpcpufh_seq_cnt___GFP_RETRY_MAYFAIL_BITdqi_privINIT_LIST_HEADfc_els_cmdfmode_trpm_autosuspendrnid_att_nodessweventactivatefxregs_state_lowerpaddingDEVICE_REMOVABLEpid_ns_for_childrenSKB_DROP_REASON_FULL_RINGtimestimer_rand_statelru_gen_memcgopcodellist_nodeELS_EXPL_INV_LENbpf_run_ctxbio_slabstate_add_uevent_sentLPORT_ST_RSPN_IDenv_startmodule_notes_attrsio_cqsystem_freezable_wqlower_firstrangeSKB_DROP_REASON_TCP_RESETbvecacct_vm_mem1on_cpumanage_system_start_stopmg_src_preload_noderefcount_incstringSHOST_CANCEL_RECOVERYatomic_fetch_add_relaxednuma_preferred_nidmemsetELS_FPINfree_diskPTR_TO_MAP_KEYvmem_altmapbiotailwait_startelevatorspinlockmin_unmapped_pagessrcu_barrier_seqi_aclssb_statnofaultbpf_map_typeia_rangesis_reltablepteval_tFC_FID_DIR_SERVfc_els_csplog_levelblk_mq_tagsDEVICE_PANEL_LEFTorc_unwind_iprel_deadlinexfer_contig_endkobj_typeskip_settle_delaysb_writersdma_cleanupeh_timed_outdriver_datai387FC_FID_QOSdma_iommumax_idirq_safeLPORT_ST_READYrescue_lockdefault_timer_slack_nsxregs_statedelays_statecompletion_cntSKB_DROP_REASON_LOCAL_MAC_deferred_listcurr_nrset_child_tidSKB_DROP_REASON_UNICAST_IN_L2_MULTICASTbio_vecacpi_match_tablenfdsrlimitBPF_TRACE_FEXITmap_update_elemlast_subtree_bstatnr_frozen_tasks__list_del_entry_valid_or_reportiterrelease_agent_pathidle_notificationmodule_stateWORK_OFFQ_FLAG_SHIFTrtpoll_triggersPTR_TO_BTF_IDwait_lockf_pipegetgeocset_linkswrite_iterD_REAL_DATAsp_featuresacct_timexpdclock_mutexFC_FID_SEC_KEYnr_failed_migrations_runninguserfaultfd_ctx__UNIQUE_ID___addressable_fc_rport_terminate_io665event_flagsthread_structoldpcore_relosbuf_lenfc_rport_statemm_context_tbd_stampELS_RVCSdio_mem_aligncstimeRPORT_ST_FLOGIprot_capabilitiesFC_RCTL_BA_ABTSatomic_long_trpm_request__refcount_incpositionMQ_RQ_COMPLETEio_comp_batchline_info_cntSKB_NOT_DROPPED_YETcftsf_credtrace_eventsfc_port_typed_iputlast_bstatnew_prog_fdnr_wakeups_syncklist_nodeELS_ADISCstackmap_release_urefBPF_REFCOUNTblockedvm_numa_eventdst_trampolineallowedmce_countweighttotalblk_plugOutputRequeststrc_reader_nestingfpstatetag_setis_roxno_scsi2_lun_in_cdbprevseqcount_raw_spinlockinstrument_atomic_read_writebios_paramnum_orcskswapd_failuresFORTIFY_FUNC_kmemdupbuflenbpf_kfunc_desc_tabfc_exch_seq_senddeadBPF_CGROUP_DEVICEWRITE_LIFE_LONGcrc_offloadexpiry_activeeh_bus_reset_handlermtd_infois_confidentialvendor_identifieri_dentryfixupsFC_RCTL_BA_ACCwq_misc_constsvm_endvm_structproc_handlerprlimemcgfsyncsgid__fc_frame_header_getcompat_robust_listnuma_workELS_ECHOprioprivvaluercu_workBPF_CGROUP_INET4_GETPEERNAMEredirectedcurrent_stack_pointerac_minfltbpf_prog_aux_hugetlb_cgroup_msecs_to_jiffiesset_policyinternal_tagthreadftrace_callsitesmmlistservice_paramsBPF_CGROUP_SETSOCKOPTforceidle_sumusedpage_typeclass_spinlock_is_conditionaluserskb_iifmynodeseq_stopWORK_BUSY_PENDING__MAX_BPF_PROG_TYPEblk_tracealloc_workqueueactionseconds_since_last_resetlink_detachpi_waitersdom_cgrpqueue_mappingscsi_comp_flagsprlolportfile_name_offbstatfailcntatomic_tpcp_listqueue_flagsBPF_PROG_TYPE_UNSPECrb_rootLPORT_ST_RPAfreepages_countutf8data_tableBPF_PROG_TYPE_SK_MSGprim_seq_protocol_err_countexe_fileuid_telementsd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_datadef_flagssrcu_n_lock_retriesraw_locksrcu_structprovinner_map_metaFC_FID_MGMT_SERVis_guestli_link_failure_countio_minnf_skip_egresstarget_attrsfc_els_rlsrtpoll_wakeupsplice_eofs_sync_lockproganon_vma_chainfc_tgtid_binding_typei_mtime_nsecseq_opsrseq_event_maskem_pdi_fsnotify_maskshared_pending__int128kasan_check_write__mce_reservedwriteback_controlmax_write_lenmm_struct__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEbuild_idhost_statss_export_opreject_lenCONST_PTR_TO_MAPBPF_CGROUP_INET4_GETSOCKNAMElen_descseg_boundary_maskWQ_SYSFSanon_namesched_dl_entitypp_ref_countactivest_othercall_get_stackstartparentlookupkernel_siginfowritten_stamp_sigpoll__compiletime_assert_109SKB_CONSUMEDinitializedfc_fcp_ddp_setupSDEV_CANCELfc_fcp_pkt_sendkill_sb__bi_remainingnum_bugsnr_requestscftypesecurity_supportedsock_fprog_kernklistusercntSKB_DROP_REASON_OTHERHOSTirq_delay_totalfc_fcp_errorstatexsk_tx_metadata_compl_entry_ptrfc_non_bls_respstatsQUEUEDdev_loss_tmo__compiletime_assert_118usersactive_basesresp_task_fr_resvd2DEV_DMA_COHERENTswap_slot_free_notifyELS_EXPL_INSUF_RESstart_databoolcompact_order_failedbv_len___GFP_RECLAIMABLE_BITinquirymodsctimernid_atypedestroy_inodecma_pagesfutex_pi_state__compiletime_assert_127SKB_DROP_REASON_TCP_OLD_SEQUENCESKB_DROP_REASON_PKT_TOO_SMALLi_mutex_dir_keyrescue_workrestartsSKB_DROP_REASON_UDP_CSUMdevice_physical_location_vertical_positionget_aclset_aclac_exe_devencapsmemory_tiers_voppercpudescpoll_bioiterate_sharedmemswsym_vdso32_sigreturn_landing_padfc_fpin_statscma_areafeatures__compiletime_assert_133rcu_tasks_exit_cpulink_fdmigrate_from_cpubd_size_lockwriteerror_codebuddy_listref_ctr_offsetsldt_structprog_attach_flagsfcp_control_requestscred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_namemempool_free_slabVTIME_INACTIVEmg_src_cgrpeh_target_reset_handlerclass_preempt_is_conditionallink_createtimeouturing_cmdshrinker_idnr_dirtiedFAST_IO_FAILgetattrBPF_SK_SKB_STREAM_PARSERsetattrPTR_TO_TCP_SOCKvmstats_percpufixupblockMQ_RQ_IDLEdevtlast_cpufor_backgroundnr_wakeups_localcn_sig_warnuidhash_nodemax_ratioalloc_cpupost_attachworker_privatepoll_eventalloc_factorlinelinkbi_pooleffectivecompact_blockskip_flushmoderead_char___GFP_NOWARN_BITatomic_setnode_idPTR_TO_STACKtargetget_nextdqblkSOFT_ERRORrcu_tasks_idxBPF_PROG_TYPE_NETFILTER__ret_do_oncejournal_infobi_inline_vecstqheadlast_used_atrq_end_io_retline_offhres_activeold_subtree_controllesb_link_failmod_namenotes_attrsdelay_workFC_VPORT_NO_FABRIC_SUPP__UNIQUE_ID___addressable_fc_eh_host_reset670block_device_operationsoffset_ctxbi_blkgFREEZE_HOLDER_KERNELarch_test_bittail_call_reachablelast_switch_timefcp_output_requestscompact_init_free_pfnwakeup_countwait_indexSKB_DROP_REASON_IP_INVALID_SOURCElog_sizerunnable_weightSKB_DROP_REASON_NEIGH_DEADFC_VPORT_FAILEDmap_push_elemtarget_busyclass_releaselast_sum_exec_runtimeSKB_DROP_REASON_PACKET_SOCK_ERRORfc_fcp_cleanup_each_cmddd_key_trueFC_RCTL_ELS4_REPFC_RCTL_ELS4_REQsa_handlerfree_countcg_listscsi_transport_templatelocked_vmqueue_rqaddressmq_hctxstart_timeRPORT_EV_STOPzone_wplugs_hashkprobe_multicookielistfreezersig_okextabledma_data_directionmax_entriesi_sizeentry_eipcgroup_atypesplice_pipexstate_headerinquiry_lenrtpoll_timerdma_addrgso_typeELS_TESTem_perf_domaind_flags___GFP_HIGHMEM_BITdying_tasks_large_mapcountnode_present_pagespid_namespaceliveclock_was_set_seqspc_warnlimitseqcount_tmin_fltblock_devicethreadedfp_fidMEMORY_DEVICE_GENERIC__preempt_count_dec_and_testpkruBPF_MAP_TYPE_PERF_EVENT_ARRAYattribute_containerELS_AUTH_ELSprojid_tvendorvport_idmemcg_nodeBPF_CGROUP_UNIX_SENDMSGdma_lengthcn_clearkey_payloadadd_linksnbp_th_start__empty_insnsiuse_10_for_msELS_QSABPF_RB_NODE_dummy_bndrefcount_saturation_typeexception_cbBPF_TRACE_UPROBE_MULTIper_cpu_pagesetfcp_cmndsaved_stateparent_exec_idutil_sumdd_key_falsesigvalfsnotify_mark_connector__ubuf_iovecsize_is_constantcputime_atomicdeadlinebio_integrity_payloadlun_in_cdbexit_requeste_d_tovFC_BA_RJT_VENDORwait_queue_upperclass_write_lock_irq_is_conditionalcgroup_fileswap_readahead_infovtimeexpecting_cc_uas_rootli_device_specificstack_refcountgrpmaskdevice_attributereca_rfids_remove_countBPF_SK_LOOKUPlru_genwrite_newuser_namespaceclass_rwsem_write_is_conditionalpids_active_resethlist_nodeblk_features_tft_data_rosuper_operationsautosleep_enabledPG_foreignwrite_file_infoload_sumaddress_spacecpus_maskdl_yieldedstarget_datafc_fcp_send_dataextension_progfile_dispread_newd_spc_softlimitfc_discuse_10_for_rwkrefrseq_csDID_ERRORs_lock_keydqi_flagsmq_ctxjump_entrypi_top_taskset_host_bytehlist_nulls_nodefc_els_lesbpacct_structac_padpathnameuser_sizeBPF_TASK_ITER_ALLlast_queue_ramp_upbd_statsfc_rp_infoshow_fdinfoFC_RCTL_DD_DATA_DESCFAULT_FLAG_MKWRITEput_budgetfadviseclass_read_lock_irq_is_conditionallesb_inv_crclinenoMODULE_STATE_LIVEtask_listtc_at_ingressasync_scanPTR_TO_CTXFAULT_FLAG_RETRY_NOWAITBPF_CGROUP_SOCK_OPSread_foliosc_data_directionhas_elevatordtordq_countvpd_pg0nlinksignalnr_wakeups_passiveself_exec_idstate_syncedws_activefr_max_payloadf_epctl_tablercu_specialprog_fdscsi_device_handlerentryold_subtree_ss_maskbacksda_is_staticBPF_MAP_TYPE_LRU_HASHfr_flagscgwb_domaincntsmsecs_to_jiffiessock___GFP_THISNODE_BITidr_rtsdev_bflagsdispatch_fromdqio_semnr_linfoRPM_REQ_RESUMEmq_freeze_wqstart_prevent_timepgd_tsigset_twq_offLPORT_ST_DNSmap_btf_idbucket_idELS_PRLIFC_RCTL_LCRELS_PRLOrstat_flush_nextignoredgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64prog_id__list_del_entry_validreserved_tailroomi_inoserver_has_tasks_killRPORT_ST_PRLIpgdati_spc_warnlimitunderflowf_posBPF_MAP_TYPE_HASH_OF_MAPSperformancesoftac_pidowner_trapnoload_weightBPF_PROG_TYPE_SOCK_OPSfc_fh_typesleepablevport_statesymlinkclass_rwsem_write_try_is_conditionalkmalloc_noprofbd_queueerror_framesin_iowaitDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclbdi_writebackrb_leftmostSKB_DROP_REASON_TCP_AUTH_HDRdst_neededbug_addr_dispmigration_pendingscan_mutexhosttd_real__NR_PAGEFLAGS__msecs_to_jiffiesns_commonmap_ifindexdevice_get_match_dataELS_GAIDs_max_linksctl_table_rootfc_rport_eventscatterlistverified_insnsthread_headacquire_dquotclockid_tfifo_timetarget_destroyzone_capacityFORTIFY_FUNC_strlenpgdval_td_managedevice_attrsmax_ctx_offsetis_late_suspendedfc_fcp_recvmax_device_blockedback_padMIGRATE_SYNCwcharRQ_END_IO_FREEseq_filefcp_output_megabytesonline_cntBPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATEDrestoreSKB_DROP_REASON_IPV6_BAD_EXTHDRline_infoseq_ptrHPROBE_LEASEDBPF_LSM_MACthaw_superalt_lenpage_ref_incseq_operationslesb_prim_errfallocatelog_true_size__retdst_pending_confirmgranted_mac_call_addrwriteback_sync_modesi_mmap_rwsemSKB_DROP_REASON_TCP_INVALID_SYNundo_listnr_fragsattribute_groupdma_poolsretrypersonalitykmem_argsprintk_index_sizescsi_sglistuprobe_task_statePG_vmemmap_self_hostedWB_REASON_BACKGROUNDstimestatic_priotmpfileattach_func_namedata_indqi_formatnvcsw_nr_pages_mappedfrequencyrtpoll_totaldev_pm_ops__refcount_sub_and_test__kmalloc_indexpfmemallocblk_mq_ctxno_updateiter_typePG_reclaimDEVICE_PANEL_BOTTOMscsi_pkt_lockencap_hdr_csumtransporttmap_get_next_keygso_segsspin_lock_bhnr_wakeupsquerybpf_prog_typeenabledki_filpmultiple_queueswork_func_tmemcg_vmstats_percpupp_magicfpu_state_permer_reason__refcount_dec_and_testfwnode_reference_argsdevres_head_SLAB_RED_ZONEused_maps_mutexremainingRPM_REQ_IDLEfilenameex_lockbaseRPORT_ST_ADISCac_ppidd_prunePG_lrurestore_noirqr_ctlsysfs_registeredDumpedFramesSKB_DROP_REASON_TCP_TOO_OLD_ACKrlockfc_fcp_recv_dataBPF_PROG_TYPE_SCHED_CLSi_rt_spc_warnlimitqueueBPF_PROG_TYPE_CGROUP_SOCKbytesnuma_migrate_retryMEMORY_DEVICE_COHERENTenclavefiltersaved_dst_prog_typeroot_blkgd_revalidateLPORT_ST_SCRWB_REASON_PERIODICcgrpwatermark_boosttracepoints_incoredqsi_opsubtree_controlquota_syncsrcu_have_cbsmemory_peaksInvalidTxWordCountasync_in_progresssignummempool_destroydqi_dirty_listpi_lockdirtied_stamptm_donetimespec64BPF_WORKQUEUEscan_finishedlesb_sig_lossreplace_bpf_fdnr_forced_migrationsdst_mutexumount_beginchannelbadblocksnr_descendantsll_nodeport_idkernfs_nodecpumaskptrace_messagehton24lengthFC_RCTL_ACK_1tag_listbio_alloc_cachepdt_1f_for_no_luni_wb_frn_avg_timeBPF_LIST_HEAD_pincountreclaim_statecur_imagefc_remote_portruntime_errori_sb__poll_tbpf_jit_poke_descriptorsubvolticks_lefton_dispatchdirty_inodesymtabd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structuse_16_for_rwELS_LIRRfs_parameter_specSKB_DROP_REASON_MAXrcu_data0real_blockedruntime_suspend__s16BPF_CGROUP_UNIX_GETPEERNAMEfc_fcp_respwifi_ackedbacktracerefcount_incoffline_alreadys_umountn_nodeon_listcn_lost_creditrefaultsdata_vmneeds_force_resumeblk_eh_timer_returnbtf_recordcsum_levelrpm_statusscsi_host_statedeferred_split_queuefc_fcp_srr_error__s32p_sizechildrenbpf_local_storage_map__mono_tc_offsetcheck_eventsmarkdqi_bgracei_wbhost_nof_inoderx_framesserialburstname_offpermissionsgraph_rootkernel_load_data_strELS_RJT_UNABcgroup_rootscsi_target_statehostmsi_device_datashinfomaskslave_destroykallsymsmap_alloc_checki_ino_timelimitbr_vendorinit_timer_keybi_issuebd_holder_opsBPF_KPTR_REFlink_idscgwb_frnsrcu_idxSTARGET_CREATEDutil_est__s64ipc_nshugetlb_usagebpf_cookiesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenacct_rss_mem1fc_exch_mgr___orig_eipsrcu_datadevice_physical_location__keycgtimebypass_spec_v1pagefault_disabledELS_CSUindex__preempt_count_adds_time_maxskb_frag_fill_netmem_descfragucount_maxdelayed_workprog_flagsopen_partitionssa_maskkswapd_lockmmappedElf64_Wordold_dom_cgrpjited_imageactive_timeatomic_flagst_blennum_jump_entriesextra_lenPIDTYPE_PGIDbtf_vmlinux_value_type_idmnt_namespaceelemwb_completionSKB_DROP_REASON_IP_LOCAL_SOURCEend_ioquotalensrcu_data_have_cbsnivcswoffdev_tidlinfo_idxmce_vaddrBPF_CGROUP_UNIX_GETSOCKNAMEdl_dev_stateFC_RCTL_ENDshowrb_subtree_lasts_listpage_addrBPF_MAP_TYPE_CGROUP_STORAGEhigh_workmq_pollsender_cpunr_segssame_target_siblingstailcall_targetof_match_table_entryBPF_PROG_TYPE_CGROUP_DEVICEfc_tm_flagsino_timelimit__UNIQUE_ID___addressable_fc_slave_alloc671cpu_numberalternative_gpt_sectori_readcountELS_ABTXFC_RCTL_IFRHblkcg_polsincrfreeseq_offloadrange_cyclicprog_cntlock_countthrotl_datalist_lru_onei_pagesmxcsrclass_rcu_is_conditionalarchdataptrace_entryfc_fcp_pkt_abortuid_mapguest_permPG_arch_1PG_arch_2wait_queue_headnum_srcu_structsnr_activeprev_sum_exec_runtimei_flagsgendisku_flagstag_set_listlogical_block_sizesubtree_ss_maskinvalidate_lock_keyinfousersizel1d_flush_killctx_outPG_swapbackedtimestampsrlimit_maxwrite_beginSHOST_CANCELbpf_prog_offloadwrite_infohrtimer_restarts_encoding_flagssessionids_time_minSKB_DROP_REASON_UNHANDLED_PROTOvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrbpf_iter_aux_infos_stack_depthnode_offsetkprobe_overridestart_offset__vm_flagssdev_statequeue_depthbpf_tramp_imagecsum_offset__dummy2pm_messagememcg_lrufred_cschangedPG_mappedtodiskvportpao_ID__cur_ktimeinitfop_flags_tgroupsoffstty_structnotify_nextvirtual_dr6dma_opsdma_addressmmap_basebd_devsyscall_workinit_cmd_privelowbpf_trampolinelockdep_mapnum_trace_evals__UNIQUE_ID___addressable_fc_fcp_init673_addr_bndPG_isolatedcgroup_base_statELS_RDFELS_RDPset_dbd_for_msnumberzone_device_dataquota_readloss_of_sync_countplenhlistpinned_vmfunc_cntELS_RECwritepagesnuma_faults_localityqrwlockELS_RESPTR_TO_FLOW_KEYS__write_overflow_fieldrw_semaphoreattach_bpf_fdfirst_minor__UNIQUE_ID___addressable_fc_eh_device_reset669i_blockstask_fragWB_REASON_LAPTOP_TIMERsource_listsum_block_runtimeBPF_NETKIT_PRIMARYnuma_scan_period_max__compiletime_assert_656_fr_resvdtotal_timepowerrequest_queuenum_ei_funcsi_generationfcp_input_requestsflushBPF_PROG_TYPE_PERF_EVENTtask_fd_querymg_dst_cgrponlinernid_ip_addr__compiletime_assert_662BPF_PROG_TYPE_RAW_TRACEPOINT__compiletime_assert_666no_vpd_sizeformatlast_switch_counthardirq_stack_ptrlast_wakee__cloned_offsetswapuint32_tssize_tRQ_END_IO_NONEvtime_statetry_vpd_pagescancel_forkSKB_DROP_REASON_TCP_OFO_DROPparent_could_setfcapper_cpu_nodestats_blocksizequeue_numprevent_sleep_timeBPF_MAP_TYPE_CGROUP_ARRAYclass_spinlock_irqsave_try_is_conditionals_readonly_remounti_io_listrefaultedchild_countBPF_MAP_TYPE_ARRAY_OF_MAPSrelease_agent_workVTIME_IDLEBPF_PROG_TYPE_STRUCT_OPSwb_domaincgroup_subsysnbp_th_nr_candrestartip_summedcompat_uptr_tresp_wqcgwb_treeDEVICE_HORI_POS_LEFT_hugetlb_subpoolend_pfnuclamptgidlimits_lockreleasenr_wakeups_migrateserial_nrstack_vmi_fieldmaskupidBPF_CGROUP_INET_SOCK_CREATEprotection_supportkcompactd_highest_zoneidxfreeze_mutextrace_evalsELS_RLSia_vfsuidbtf_mod_pairquota_format_opsi_datarescue_listfsverity_infocore_threadclosidsched_avgRPORT_ST_PLOGIcodearch_atomic_fetch_addBPF_LSM_CGROUPu64_stats_syncsyscorenr_reserved_highatomic__i_nlinkpmd_tinumli_invalid_tx_word_countsrcu_barrier_cpu_cntbatchedreadaheadopt_sectorsFC_VPORT_FABRIC_REJ_WWNhrtimer_cpu_baseirq_domainwait_liststatic_call_trampac_etimefsverity_operationscoublockbug_tablemigrate_modesecmarkusing_gplonly_symbolswb_listremovedhandleremulatednr_writeback_throttledsym_vvar_pageELS_RPLmembarrier_stateELS_RPSBPF_PROG_TYPE_LWT_INdma_pad_maskELS_RPSCBPF_KPTR_UNREFbin_sizeFORTIFY_FUNC_strlcatrcu_read_lock_nestingsam_statuscrc_errcb_accessrcu_tasks_nvcswfred_sshrtimer_clock_basefc_fcp_abort_done__signalfn_tio_bitmapDEVICE_VERT_POS_CENTERELS_RRQretry_countsbitmap_wordmanaged_pageslong unsigned intmax_timeout_unlocklast_queue_full_countread_file_infoELS_RSSexec_startia_sizeema_listRPM_RESUMINGunpinned_netfs_wbMODULE_STATE_COMINGsym___kernel_sigreturninit_completionfc_fcp_pkt_holdZONE_DEVICEfunc_info_cntuser_cpus_ptrSKB_DROP_REASON_TCP_MD5FAILUREuser_scand_opstate_initializedrelease_dquotELS_RTVplugsoftirq_activatedkey_sizeresid_leninv_weight_raw_spin_lock_irqsavesecuritykernel_symboldl_timerlockdep_map_pmodule_param_attrsdirty_ratelimitno_read_capacity_16scsi_host_template__user_state_sizechainedVTIME_GUESTretriessdtrsysvsemdisconnectstashedsc_cmduser_xfeatures__kmalloc_cache_noprofdisc_mutexuse_memdelaynr_cached_objectshas_timeoutcgroup_namespacecommcallback_headhead_fragpagefault_disabled_decexception_table_entryin_hrtirqctl_table_set_overruncondhash_lenDEV_DMA_NON_COHERENTcoredumpd_sbio_lock_cls_keySKB_DROP_REASON_IPV6_NDISC_FRAGksetsleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsPTR_ERRnodesysvshmno_highmemdata_outREFCOUNT_ADD_UAFFC_BA_RJT_INVL_CMDfirstSKB_DROP_REASON_TCP_FASTOPENELS_EXPL_UNAB_DATA_nfctSecondsSinceLastResetFC_CLASS_2FC_CLASS_3FC_CLASS_4active_countRPORT_ST_RTVFC_CLASS_Fnr_active_requests_shared_tagsnum_tracepointsskb_fill_page_descvpd_pgb7ueventfc_pri_tasrr_rx_idsharedtimer_delete_syncnext_cpu_batchmemcg_completionsdisk_eventss_sysfs_namesigval_trqst_qSDEV_QUIESCEmap_pop_elembitsbase_pfnclass_mutex_try_is_conditionalskb_frager_vendorsem_undo_listcompat_rmtp_SLAB_CONSISTENCY_CHECKSclass_local_lock_is_conditionalELS_ESTCget_currentELS_ESTSstatic_key_trueno_fcs_stimeSKB_DROP_REASON_TCP_AONOTFOUNDfcp_resp_rsp_codesinsnsperf_event_ctxpprogsOutputBytescostxcomp_bvio_contextPIDTYPE_PIDwakee_flipsvlagufdsvlansegment_boundary_maskattach_tracing_progioctlprev_cputimectx_inbtf_flagshorizontal_positionem_perf_tablebi_crypt_contextprivateswp_entry_tcharFC_PORTSTATE_BYPASSEDmatchnr_failed_migrations_hotreg_offsetBPF_TRACE_KPROBE_MULTIskb_frag_size_setqueue_stoppedFORTIFY_FUNC_UNKNOWNwrite_charbin_attrscpu_itimerl_yesdevres_lockfiles_struct__ret_onceblk_zoneSDEV_RUNNINGicq_treePTR_TO_BTF_ID_OR_NULLFC_CLASS_NONEvfsuid_tf_lockexec_vmkernel_parambtf_fieldfh_f_ctlget_lesbvertical_positionbtf_dtor_kfunc_traw_atomic_fetch_add_relaxedshutdown_prerelease_folioftrace_managedbi_io_vecpage_to_netmemvendor_idmtimearchrobust_listasync_probe_requestedthaw_earlyac_btimevectors_securitysplice_writeparam_lockreq_listi_opflagstot_write_bandwidthfreeptr_offsetdentry_operationsstats_sectorss_blocksize_bitskfreeexp_hintfc_fcp_cleanupbr_resvdclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapsw_hash_head_2asym___kernel_vsyscallopen_mutexfortify_funcsk_buff_fc_frame_alloccan_forklow_usageget_timeki_flagsunlock_outs_inode_wblist_lockget_fsp_rec_tovpermwriteback_inodesdestroy_workskb_frag_tlockableuprobes_statemm_counttrace_overrunargsargvuclamp_reqswap_info_structs_qcopwb_tcand_bytesblk_mq_queue_mapFC_VPORT_INITIALIZING__kernel_long_tsrcu_usagefaultableperf_event_mutexfctsSAM_STAT_BUSYexit_hctxfc_xid_not_foundsync_modemap_gen_lookupin_execverlim_maxFC_PORTSTATE_MARGINALsimple_tagstarget_listVLinkFailureCountbpf_kfunc_btf_tabrtpoll_next_updatecoherent_dma_mask__data_lendriver_flagsscsi_residfile_ra_statek_sigaction_hugetlb_hwpoisoninsn_offshrinker_infocompletionslld_event_callbackreadahead_controlfwnode_operationsprocs_fileswait_queue_headmemory_typevm_userfaultfd_ctxTT_NONEmap_pagesBPF_PROG_TYPE_TRACEPOINTSKB_DROP_REASON_TCP_ABORT_ON_DATAmod_tree_nodelocal_watermarkprobe_offsetxfer_ddpcmd_flagss_bdev_filedev_pagemaptarget_private_offsetRPORT_ST_INITcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fsELS_RJT_BUSYhost_eh_scheduledsoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLErb_nodeELS_EXPL_PLOGI_REQDreturn_consumerround_robinksymi_private_dataroot_csetused_btfsptracer_credsrcu_barrier_headleaderchecksrr_ox_idTT_COMPATtop_of_stackcap_effectivenetfilterexit_statefc_fcp_pktfaultscan_start_SLAB_POISONprogs_hlistnuma_pages_migratedidr_nextfcp_srrsched_tagssupported_modeer_explanfiltersnr_frozen_descendantssbitmap_queueno_cgroup_migrationPG_private_2_SLAB_SKIP_KFENCEsched_databpf_func_info_auxprintk_index_startPG_writebackindex_keybreserved_tags__bi_nr_segmentsscsi_change_queue_depthLPORT_ST_FDMIforce_scanintervalavgs_lockbug_entryzswap_maxtimers_activenum_classesprotocolbpf_cgroup_storagevma_lockrtpoll_untilkswapd_waitdl_throttledbpf_progseccompDEVICE_VERT_POS_UPPERrolesblk_holder_opsfprop_local_percpustatic_key_modextensionsfilter_countpsi_filesmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodecreate_work_queuerport_delete_workumode_tinitial_nsno_pmGRPQUOTAia_vfsgidioctx_locktimer_slack_nss_bdixarrayjited_linfocan_wakeuptime_namespacepdeath_signalexpected_attach_typedst_regnr_wakeups_idledqi_igraceqf_nextBPF_MAP_TYPE_LPM_TRIEPG_savepinnedfr_retry_delaymaple_treensproxyELS_EXPL_OXID_RXIDslave_dir__write_overflow_pkeykernfs_rootFC_TYPE_ELSucountsget_next_idDD_CLASS_TYPE_LEVEL_NUMframe_offsethooknumwrite_syscallslistscore_relo_rec_sizefc_eh_device_resetrefcount_tslow_grocmd_lenDEVICE_PANEL_TOPmemtierrxidmax_hw_discard_sectorsint32_txol_areadefault_lockguess_capacitysrcu_gp_mutexSAM_STAT_RESERVATION_CONFLICTdebugfs_dirwakee_flip_decay_tsfc_fcp_destroyprio_listlast_timerequestblk_unique_idwpcopy_delay_totalSDEV_DELrprivDID_PARITYskb_end_pointermax_payloadcontexthost_lockrwlock_tvm_fault_tskb_extuse_autosuspendclass_spinlock_irq_try_is_conditionalfc_disc_eventcfs_rqtree_reclaimedfc_exchPG_owner_2virt_boundary_maskSKB_DROP_REASON_TCP_INVALID_ACK_SEQUENCEcgroupscore_occupationget_policycore_cookiepcrefrefcount_struct__kernel_ulong_tkf_opsfwnodeZONE_DMABPF_CGROUP_GETSOCKOPTcgroup_storagestatic_call_keycsum_startsysnamenamespaceSKB_DROP_REASON_IP_TUNNEL_ECNFC_VPORT_ACTIVEparametersbtf_sizeSKB_DROP_REASON_IP_INHDRgroup_leaderdma_channelrunnable_avglookaheadiowait_countli_loss_of_signals_countshstkioac__kernel_clock_t___GFP_DMA32_BITwas_resetgp_seqscsi_device_stateuuidmaj_fltWB_REASON_FORKER_THREADcached_requested_keyfp_flagsmeta_lendqb_rsvspaceSKB_DROP_REASON_SUBSYS_MASK___GFP_NOMEMALLOC_BIT_SLAB_OBJECT_POISON__s8inode_operations__kernel_size_tdma_configurefile_leasepage_counterarg_flagsclass_local_lock_nested_bh_is_conditionalgpl_symsraw_atomic_incallowed_attachsrecursion_detectedpercpu_rw_semaphoresymbolic_namearch_spinlock_tseqcount_raw_spinlock_tbpf_iter_init_seq_priv_thighthread_pidmap_lookup_batchPG_large_rmappablertpoll_min_periodemindl_non_contendinglso_maxcurr_ret_stackpgtable_t__u8q_usage_counterwakeirqSCSI_RETURN_NOT_HANDLEDi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyssdev_targetcore_forceidle_sumget_offset_ctxreleasedexport_operationsqc_stateELS_LCLMget_budgetBLK_INTEGRITY_CSUM_IPmempool_smempool_timplicit_on_dflFC_PORTSTATE_LOOPBACKd_inodespecial_vecpageset_batchworkqueue_structBPF_MAP_TYPE_SOCKMAPi_lock_keyuevent_suppressgraveyard_linkbi_opfscsi_cmndfail_io_workfs_superscall_get_func_ip__read_overflow2tcp_tsorted_anchorwce_default_on__rcu_icq_cache___GFP_KSWAPD_RECLAIM_BITcompact_cached_free_pfncap_ambientqstrtaskss_d_op_raw_spin_lock_bhBPF_MAP_TYPE_TASK_STORAGEno_report_lunsi_rcu__count__already_doneinit_requestFC_PORTTYPE_NPORTio_optspanned_pagespcountskb_shared_hwtstampslast_can_queue_ramp_down_timebio_listwlockedrtpoll_trigger_lockdevicemodule_kobjectmap_releaseELS_SCNPTR_TO_PACKET_METAELS_SCRmg_tasksBPF_TRACE_ITERpercpu_count_ptrnr_ia_rangesthawmap_update_batchlink_attach_flagstlbflush_unmap_batchremoveoffload_fwd_markbvec_iteroom_mmfcp_abort_iobpf_local_storagefr_crcname_linkSKB_DROP_REASON_PROTO_MEMrnid_vend_idcompat_long_tcnivcswmap_freeInvalidCRCCountPTR_TO_SOCKET_OR_NULLshort intkswapd_highest_zoneidxtrc_reader_specialgtimepscr_ret__disk_events_disable_depththread_group_cputimertransport_headersizemigrate_to_ramUTASK_SSTEP_ACKloginuiddesc_structi_wb_lists_umount_keyquota_type__init_swait_queue_headnameSKB_DROP_REASON_SKB_UCOPY_FAULTcgrp_ancestor_storagespp_typesetleasereca_resvd1bitmap_tagsmnt_rootBPF_MAP_TYPE_SK_STORAGEpsi_flagspage_offset_basesubsys_masksighandbtf_key_type_idavgs_workaddrELS_EXPL_NONE__rcu_headac_utime_SLAB_HWCACHE_ALIGNFC_PORTSTATE_DELETEDksm_zero_pagesBPF_MAP_TYPE_LRU_PERCPU_HASHqueuedataSKB_DROP_REASON_TCP_OFO_QUEUE_PRUNEprivate_dataBPF_MAP_TYPE_CPUMAPfc_exch_poolgid_mapFC_RCTL_F_BSYpageset_high_minfs_structnuma_nodedev_archdatanr_perf_statess_flagsrcu_nodereca_resvd2orig_pmdrb_rightclock_baseBPF_SK_REUSEPORT_SELECTclass_irq_is_conditionallaunder_foliowake_batchis_funcs_vfs_rename_mutexElf64_Xwordf_ctlflockSKB_DROP_REASON_BPF_CGROUP_EGRESSiter_createFC_RCTL_DD_UNSOL_DATAhandler_datavalue_type_btf_obj_fd__paddingoffline_waitqnr_reclaim_startstatus_codeio_lockdep_mapatomic_write_hw_boundarymap_nr_maxiowait_sumdescriptionfolio_batchbi_nextblk_status_tUSRQUOTABPF_CGROUP_ITER_SELF_ONLYdriver_privatecore_relospm_onlyd_rt_spc_warnsset_read_onlypgmapSKB_DROP_REASON_TAP_FILTERactive_refmap_owner_storage_ptrhctx_tablefc_xid_busykernfs_open_filelowmem_reserves_iflagsprintednr_hw_queuescodetagstate_mutexallowed_mapsctx_arg_infoft_burst_leninner_network_headerex_listlast_queue_full_depthBPF_PROG_TYPE_SK_LOOKUPfc_frame_header_getcid_worki_versionswap_deactivatesr_lockattachclass_rwsem_read_is_conditionalqueue_limitsunitil_weightstarved_listdma_parmsbdi_idKOBJ_NS_TYPEStstampSAM_STAT_GOODcmin_fltchunksSKB_DROP_REASON_VXLAN_INVALID_HDRarch_uprobe_tasklicensewrite_protect_seqclearedkobj_ns_type_operationsshutdownevent_countsched_statisticslru_lock__kernel_uid32_tnode_zonelistsallocSKB_DROP_REASON_TCP_AOUNEXPECTEDb_attachedorig_pterq_timeoutkeysinit_nameper_cpu_zonestattc_indexfile_lockstatfsfcp_resp_extrw_semswappinessdevice_privatenetmem_refhost_bcodevm_policydl_deadlineLPORT_ST_RSNN_NNtracepoint_extELS_SRLclass_mutex_is_conditionalELS_SRRfpregs_statefc_fcp_send_abortmemcg_datadqb_curinodestx_flagsBPF_XDPfileattr_seteh_actionac_tgetimeRPORT_EV_NONEpage_linkno_write_samebtf_log_sizedn_timeoutDEVICE_PANEL_UNKNOWNFC_VPORT_FABRIC_LOGOUTPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetmce_ripvDL_DEV_NO_DRIVERbpf_arenafree_after_mult_rcu_gpret_stacknbp_rl_nr_candreal_timeri_privatealloc_tagextended_state_areanum_kprobe_blacklistaccessmap_seq_show_elemfp_resvdsubdirsdev_releasecgroup_freezer_stateba_donemlock_countfc_seq_sendBPF_PROG_TYPE_LWT_SEG6LOCALget_next_child_nodemempolicyfc_rportcacheline_padding_bandfd_arraypollfdblinding_requestedFC_RCTL_BA_RJTlaptop_mode_wb_timerdev_tplatform_dataf_refprev_posDID_TRANSPORT_FAILFASTenv_endfileattrs_subtypeusage_countpr_opsstate_in_sysfsdqb_ihardlimitSKB_DROP_REASON_TCP_MD5NOTFOUNDunlocked_ioctluprobebd_mappingrp_exFC_RCTL_DD_UNSOL_CMDkmem_cachenuma_next_scansg_pageLPORT_ST_FLOGIbudget_mapbsg_devsrcu_last_gp_endxfer_lentnodeclass_local_lock_irq_is_conditionalpage_listinner_ipprotoproperty_read_int_arraywdtrmq_rq_stateELS_LS_RJTholders_dirMODULE_STATE_UNFORMEDmsleepst_valuelist_headptrace_bpsFC_RCTL_BA_RMCfc_port_states_user_nscan_attachhost_attrsmap_lookup_elem_sys_onlytagset_refcntqueuecommand_may_blockmin_usagearch_tlbflush_unmap_batchquick_threadsELS_EXPL_INPROGdefer_syncfc_ba_rjtBPF_TASK_ITER_TIDmissedfc_no_free_exch_xidusernsndisc_nodetypeBPF_UPTRvlan_allBPF_PROG_TYPE_CGROUP_SKBsum_sleep_runtimecleanup_rqd_spc_timerd_ino_hardlimitchange_cookiebi_statuscss_allocdl_periods_dquotErrorFramesfsnotify_sb_infomap_fd_get_ptrrecent_cida_opsftrace_ops_dev_printkprocnamefr_rsp_lenpad_untilSKB_DROP_REASON_TCP_MINTTLmap_redirectperf_event_listinterval_expinsnBPF_CGROUP_UDP4_SENDMSGrstat_css_list___GFP_LAST_BITvm_node_stat_difftagski_completepgprotrnid_node_mgmtread_syscallstimespec_typebd_devicevmstatsdquot_operationsSKB_DROP_REASON_TC_INGRESSPG_waitersposix_cputimers_workgsbase__lruvecBPF_CGROUP_INET_EGRESSfc_lun_resetcompact_delay_totalio_tlb_memseq_showFC_RCTL_DD_UNSOL_CTLcpusfilesinblockbd_claimingtails_magicFC_RCTL_BA_NOPcontainersnuma_faultsmem_dqblktarget_ifindexnos_countfc_fcp_internalstgt_delete_workstatusBPF_PROG_TYPE_CGROUP_SOCKOPTWRITE_LIFE_NONEread_countlink_speedBPF_CGROUP_INET6_CONNECTlport_listwait_for_completion_timeoutHRTIMER_NORESTARTscsi_privlast_update_timefc_fcp_abts_respsas_ss_spold_map_fddisc_startpanel___GFP_ZEROTAGS_BITfc_rport_operationswatermark_SLAB_CMPXCHG_DOUBLEnode_start_pfnmax_allowed_capacityfc_statsopen_modeFC_RCTL_ELS_REPread_posDID_REQUEUE___GFP_ACCOUNT_BITclass_cpus_read_lock_is_conditionalmg_dst_preload_nodecpu_run_real_totalD_REAL_METADATAgpl_crcstimes_prevclass_raw_spinlock_try_is_conditionalfc_frame_headerkiocbnetdev_datamg_node___GFP_MEMALLOC_BITexecute_only_pkeyreturn_instancesma_lockblk_mq_queue_datacss_offlineattach_btf_tracedockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovesync_fssecurebitsELS_NACTFC_RCTL_DD_SOL_CTLwb_tcand_idFC_PORTTYPE_OTHERdentrysequential_iowait_pidfdprli_countcdb_statusInputRequestsSKB_DROP_REASON_SECURITY_HOOKs_writersgroup_stop_countavg_next_updateswap_lockvm_opsscsi_pkt_queuewb_reasonpartial_bufread_before_msrecoveredget_unmapped_areamkobjsym_VDSO32_NOTE_MASKfrozenactive_uprobeunregisteringget_parentmin_vruntimestoragesdebug_dirhost_resetfc_els_rnid_genclass_disable_irq_is_conditionaldel_timer_syncsyscrnr_mapssyscwsync_ionum_bpf_raw_eventswork_qorig_nentski_pose_csetsavx512_timestampfh_typeend_io_datae_freezeBPF_GRAPH_ROOTfree_cached_objectstaints_BoolFC_RCTL_DD_UNCATmax_tp_accessxol_vaddrb_dirtylist_lru_nodeuclamp_ses_time_granvm_statblk_integritykuid_tdev_pm_qosmempool_alloc_slabbd_holdersper_cpu_zonestats_sifieldstaskBPF_CGROUP_INET6_BINDresetsched_reset_on_forkcompound_headnr_retriesshost_privwake_irqbranchi_cdevfunc_infoi_fsnotify_marksin_thrashingfc_fcp_timer_setdl_deferBPF_MODIFY_RETURNvpd_pg80waitersvpd_pg83vm_startvpd_pg89mprotectquota_ond_automountDEVICE_REMOVABLE_NOT_SUPPORTEDlast_can_queue_ramp_up_timernid_genELS_EDCcsum_not_inetctl_table_headeratimeget_ownershipf_task_workmy_qfc_lport_stateBPF_SK_SKB_STREAM_VERDICTeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalFC_TYPE_FCPsectorinner_mac_headers_wb_err__q_sizeattach_prog_fdget_pagecloseiopl_warnelevator_queueptraced__MAX_BPF_MAP_TYPElibfc_cmd_privdonesym___kernel_rt_sigreturnsrcu_struct_ptrsskip_ms_page_3fbinfmt_miscinodesencapsulationmemcg_awarezonehost_waitFC_PORTSTATE_LINKDOWNmanage_shutdownac_schedqsize_t__fpstatemap_poke_trackfc_block_scsi_ehBPF_MAP_TYPE_SOCKHASHqf_ownersuspend_noirqd_inamePTR_TO_MAP_VALUEbi_flagslinks_countprealloc_pterdevd_ino_countarg_lockskb_drop_reasonclass_rcu_tasks_trace_is_conditionalscsi_is_fc_rportDEVICE_REMOVABLE_UNKNOWNdoes_npivignore_childrenpoint_to_multipointframe_sendBPF_CGROUP_UDP6_RECVMSGdirty_exceededfreeze_fsreca_e_statin_eventfdresume_earlymax_dev_sectorsdup_xol_workalimititemsooo_okaynuma_groupblk_independent_access_rangesdeferred_resumekmap_ctrlfscrypt_operationsrangesevents_lockfs_contextmnt_idBPF_CGROUP_INET6_POST_BINDretry_hwerrordrop_inodeBPF_MAP_TYPE_REUSEPORT_SOCKARRAYk_lockorc_unwindgraph_get_next_endpointfrom_ingresslast_sector_bug__UNIQUE_ID___addressable_fc_fcp_destroy672mq_mapresplprojid_mapmap_lookup_and_delete_batchkprojid_t__u16PTR_TO_XDP_SOCKsaved_end_ioBPF_MAP_TYPE_STACKsyscall_dispatchdl_densityon_rqlru_gen_mm_walkaltmapmin_perf_statercu_tasks_exit_listlro_xidsp_regdma_drain_buflast_resets_master_keysflagsbd_holder_locknr_threadsvm_mm__u32query_flagsmax_secure_erase_sectorsseq_nextenable_statss_quota_typesvm_lockswapin_countfc_fcp_cleanup_cmddisc_stop_final_ddebug__compiletime_assert_659FAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitoffload_l3_fwd_markSKB_DROP_REASON_NOT_SPECIFIEDdelayskcompactd_max_ordermnt_nstimerqueue_headBLK_INTEGRITY_CSUM_CRCsdev_groupskioctx_tableprioritybtf_func_modelksm_rmap_itemsclass_read_lock_is_conditionalKMALLOC_RECLAIM__u64revoked_at_folio_nr_pages__compiletime_assert_665fcp_packet_abortswritepageis_dirty_writebackpkey_allocation_mapLPORT_ST_DHBAdq_iddisable_depthem_perf_statethread_shstkfr_devTxWordsposix_timerswait_chldexitTxFramessas_ss_flagsunreadableunmap_limit_for_wspresent_early_pages_compound_headSKB_DROP_REASON_IP_INNOROUTESinsn_idxELS_RNFTPTR_TO_MEMbi_itersrcu_cblist_invokingiopollPG_swapcachecsum_complete_swline_coliov_lenlatency_recordPG_anon_exclusivefc_lportreca_zerodirty_limit_tstampsector_sizeskb_mstamp_ns__BPF_REG_TYPE_LIMITd_releaseavg_totalfh_cs_ctldev_dma_attrBPF_NETKIT_PEERzswap_writebackexpiresnuma_scan_seqmnt_sbblkcg_csshashnodemask_tref_cntsize_poke_tabsignalfd_wqhhang_detecteddevice_driverSKB_DROP_REASON_ICMP_CSUMlast_zone_capacityfc_fcp_abort_iostatisticsfsindexout_batchraw_spinlock_tPG_lockeds_cops_activenum_argspidlist_mutextag_sizeBPF_MAP_TYPE_PERCPU_HASHlast_old_flushs_uuidclear_child_tidruntime_statusdqb_btimedq_opBPF_MAP_TYPE_DEVMAPELS_ADVCshow_pathdl_serverVTIME_USERquota_disablesched_delayedsrcu_gp_seq_neededtask_structtimer_delaycurrent_may_mountkmalloc_cachesREFCOUNT_ADD_OVFpushpeaks_lockbpffs_fdpath_fdis_noirq_suspendedfwnode_endpointPTR_TO_TP_BUFFERcounterunique_idsuspendsupported_eventsoom_score_adj_minlast_bdp_sleepzone_wplugs_poolzone_typedomain_datacopy_file_rangesrcu_gp_startreport_zones_cbxa_flagsattach_btf_idlru_gen_foliobtf_idbpf_insntv_nsecmax_zone_append_sectorssas_ss_sizeeh_eflagss_inode_list_lockUTASK_SSTEPraw_tracepointFC_RCTL_F_RJTehandlerdq_sbexpecting_lun_changescsi_targets_mountselem_flagsBLK_EH_DONEvm_stat_diffsym_pvclock_pageswapin_delay_totalfree_listPG_reservedpage_fragfc_eh_host_resetinfo_lenrun_workfsuidRPM_REQ_AUTOSUSPENDfc_els_rec_accsrcversionlist_add_tailtrace_event_callwakeup_sourceis_partially_uptodatehost_faileddl_runtimemay_splitio_uring_cmdprogs_cntread_dqblk_raw_spin_unlock_irqrestorepeekedrtpoll_nr_triggerssrcu_parentinit_seq_privatebi_cookiesuppliersfile_operationsRxFramesSKB_DROP_REASON_TAP_TXFILTERbpf_ctx_arg_auxDID_ABORTblist_flags_tmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotLPORT_ST_RESETis_preparedpgprotval_tmemorytrc_holdout_listELS_CSRasync_suspendq_nodezone_pgdatclass_mutex_intr_is_conditionalstrtabpage_freeftopdepends_onHPROBE_CONSUMEDfc_fcp_pkt_releasei_mmapnr_cgrpsdirty_paused_whenirq_getrport_priv_sizefc_copy_buffer_to_sglist___GFP_COMP_BITcss_resetcapacitymax_channelversionlink_failure_countget_reference_argsllisthiwater_vmmax_perf_statebi_idxSKB_DROP_REASON_IP_RPFILTERcookiesfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntInputBytesrseqattach_typetarget_knfc_fcp_unlock_pktlimit0limit1pi_blocked_onpid_tac_exe_inodevmemmap_shiftbpf_attach_typeELS_FARP_REPLusage__kernel_time64_tSKB_DROP_REASON_IPV6DISABLEDrq_qos_mutexkernel_read_file_strscsi_data_bufferSKB_DROP_REASON_IP_LOCALNETcapabilitiesi_securitydevice_physical_location_panellimitsq_lock_cls_keyenvpactive_memcg__targetsElf64_Halfallow_reinitSKB_DROP_REASON_IP_OUTNOROUTEStimer_autosuspendsratelimitfc_exch_doneSHOST_DEL_test_bitslave_configurestat_threshold_softexpiresautosuspend_delayline_info_rec_size_zonerefsi_flctxFC_PORTSTATE_ONLINEli_invalid_crc_countlist_lockvm_faultELS_RJT_INPROGip_epilogueoptimistic_spin_queuepermissionSKB_DROP_REASON_IP_NOPROTObpf_prog_array_itemtransport_containerflush_listpayloadreap_refDEVICE_FIXEDlast_statusfdmi_enabledSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsslice_maxFC_RCTL_P_BSYIS_ERRmap_namebi_max_vecsthaw_noirqsched_debugfs_diraccounting_timestampcan_matchtime_archcmd_sizechunk_sectorshlist_bl_headpageflagsqc_dqblkLPORT_ST_RFT_IDcalledpasid_activatedancestorsmap_fd_sys_lookup_elem__fortify_paniccallerbvec_integrity_poolBPF_XDP_DEVMAParch_data_oldshrink_controlegidthreaded_csetsmax_rdonly_accessfree_internalmap_direct_value_addr_SLAB_NO_USER_FLAGSnet_deviceenvp_idxcrypto_kobjectcdb_cmd___GFP_NO_OBJ_EXT_BITf_modetagged_supportedoffloadsvpd_pgb0vpd_pgb1vpd_pgb2ff_type_mapzone_idxfolioruntime_autopref_node_forklru_zone_sizeclassipc_namespaceBPF_SK_SKB_VERDICTarenaprev_scan_seqfc_dl_perfpsi_group_cpufr_seqhardirq_stack_inusewait_queue_head_talloc_hintELS_RJT_FIPtask_cputimeFAULT_FLAG_INSTRUCTIONdeferred_splituser_nsfc_cdbnohdrFCP_TMF_REJECTEDclass_raw_spinlock_irqsave_is_conditionalsyms_flagscgwb_release_mutexSKB_DROP_REASON_TCP_OLD_DATASKB_DROP_REASON_TCP_MD5UNEXPECTEDFC_PORTTYPE_NPIVfc_io_complsyncmq_freeze_locksg_prot_tablesized_childrenucountELS_EXPL_SPP_ICTL_ERRmap_local_storage_unchargectl_table_sizebpf_map_opsfc_rport_identifierseh_host_reset_handlerPG_fscacheddebug_class_map__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115__compiletime_assert_116__compiletime_assert_117dfl_cftypes__compiletime_assert_119prealloc_bufSAM_STAT_INTERMEDIATEint_to_scsilunaudit_contextfl_owner_tipi_listBPF_MAP_TYPE_DEVMAP_HASHpersistent_keyring_register__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126i_pipe__compiletime_assert_128__compiletime_assert_129machined_waitllist_headsense_buffernr_phys_segmentstask_itersnode_spanned_pagesavg_refaultedFC_RCTL_ENCHwait_page_queuecn_credit_stallbpf_line_infoBPF_SK_MSG_VERDICTFAULT_FLAG_REMOTE__compiletime_assert_130dl_bw__compiletime_assert_132hierarchy_id__compiletime_assert_134__compiletime_assert_135__compiletime_assert_136unaccepted_pages__compiletime_assert_138i_dir_seqignore_dfheaderwatchdog_stamprefcount_setstate_startlist_op_pendingdatasrcu_cb_mutexsysfs_lockBPF_CGROUP_UNIX_CONNECTallowed_progsno_callbackssaved_trap_nrclock_listbpf_func_infofolioq_slotMODULE_STATE_GOINGxattr_handlersrr_resvdTIMEOUT_ERRORac_utimescaledrqos_debugfs_dirprot_sdbidr_baseunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_lockfromnextentseventkeytypeMissDiscAdvCount__kernel_gid32_tevicteddev_pm_domainnentsstart_time_nsuaddr2f_securityprot_opvariable_test_bitdefparamdiscard_granularity_SLAB_ACCOUNTSKB_DROP_REASON_TC_RECLASSIFY_LOOPiotmo_cntclass_raw_spinlock_irq_is_conditionalq_sizefr_sofFC_PORTSTATE_BLOCKED__bi_cntrcuwaitattributes_maskcloneddl_defer_runningnpiv_enabledlru_gen_mm_listqueuecommandevents_filetagged_writepagesia_validsrcu_SLAB_NO_OBJ_EXTlog_bufinstrument_atomic_writereq_flagsiorequest_cntsrcu_size_jiffiesSAM_STAT_CONDITION_METclassesDID_BAD_TARGETstatic_call_sitecputimefc_lun_reset_sendis_seenupdated_nextfh_s_idsrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitmap_fdrchari_verity_info_addr_pkeyfpin_statsELS_TPRLOrw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countBPF_PROG_TYPE_XDPbpf_ksymSTARGET_RUNNINGFC_SOF_C4atomic_opennapi_idload_timetskey__mptrsigactionrlimfc_rpbtf_token_fdmce_addr__q_size_fieldf_freeptrSKB_DROP_REASON_TCP_OVERWINDOW__sighandler_tclass_spinlock_try_is_conditionalzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMESlrugenmax_target_blockedfs_flagsvm_filei_countuser_structmap_idaddress_space_operationsFC_BA_RJT_LOG_BUSYELS_LSTSFAULT_FLAG_USERkey_perm_tused_btf_cntbtf_log_buf__skb_fill_netmem_desc_noacceh_strategy_handlertimer_listverifier_zextmemory_eventscgwb_listrun_delayarch_atomic_setnum_ftrace_callsiteschange_queue_depthsrcu_cblistoffload_requestedblk_independent_access_rangeDID_BUS_BUSYavg_write_bandwidthreca_rx_idtlb_ubcpgtables_bytesi_lrufh_parm_offsetGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacktrc_ipi_to_cpuparm_offsetscsi_luncss_onlinePTR_TO_FUNCmempool_alloc_noprofmemory_events_localkmap_atomicallow_restartmin_slicePG_checkedSKB_DROP_REASON_XFRM_POLICYSKB_DROP_REASON_IPV6_NDISC_BAD_CODEcommit_rqsfragssysfs_opsinq_periph_qualcore_relo_cntFcpPktAbortsatomic_write_hw_unit_maxFC_SOF_I2cmaj_fltFC_SOF_I4bio_integrity_poolnf_tracekparam_arrayFORTIFY_FUNC_strscpyesb_statFcpFrameAllocFailspercpu_refevict_inodeignore_media_changertpoll_statesfc_fcp_recNEEDS_RETRYthread_keyringmap_nrcgroup_nslist_delcpumask_tpcpu_hotrstat_css_noderb_leftreca_ofidRPORT_ST_DELETEgfp_maskdma_addr_tinactive_timerattributeinner_protocolinit_hctxperiod_timemm_lock_seqFORTIFY_FUNC_memchrELS_FANkernfs_elem_symlinkBLK_UID_T10er_cmdwb_lcand_idFC_RCTL_DD_CMD_STATUS__kernel_dev_tcrypt_keyslotPG_owner_priv_1prog_namepm_domainBPF_CGROUP_INET4_BINDmax_rdwr_accessmax_prop_fracfsgidsector_tcompact_cached_migrate_pfnnode_name_sys_privatesignal_structactive_mmFC_SOF_N2FC_SOF_N3FC_SOF_N4kernfs_iattrsshow_devnamecn_oversubscriptionthread_infoi_mmap_writabledata_size_outPG_has_hwpoisonedattach_btf_obj_fdreca_cmdreadr_a_tovvalue_recpto_tmp__secondarydevicesatomic_write_max_sectorsgroup_exit_codetx_framesFORTIFY_FUNC_memcmpopc1REFCOUNT_SUB_UAFfc_fcp_srrvalue_btf_idrecpexec_maxsync_statedev_groupsuts_namespacefcloneDMA_FROM_DEVICEzone_start_pfnvalue_sizekernfs_elem_dirport_namepercpu_counter_printkDMA_BIDIRECTIONALcgroup_subsys_statesequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startELS_EXPL_SIDUTASK_RUNNINGopenseglenBPF_MAP_TYPE_QUEUEFORTIFY_FUNC_memcpy__kernel_ssize_tvdso_imagesi_signoconst_test_bitunused_hctx_lockrseq_sigresultrefsdelayed_calltime_slicefunc_info_rec_sizenr_rangenetmem_is_net_iovmax_seqSKB_DROP_REASON_DEV_READYspc_timelimituid_gid_mapnr_freeresumeset_ownershipELS_RNCbpf_iter_task_typeFC_PORTSTATE_NOTPRESENTregsbi_write_hinterrorSKB_DROP_REASON_PKT_TOO_BIGrq_nextsyscall_user_dispatchshort_inquiryattrd_aliasis_suspendedseq_priv_sizerp_mutexspin_unlock_irqrestorerestore_sigmaskrequeue_lockSKB_DROP_REASON_CPU_BACKLOGkcsan_check_accessevent_worknr_deferredSAM_STAT_TASK_ABORTEDmem_cgroup_idlist_emptysrcu_sspi_lockELS_NDACTuser_event_mmbtrace_seqs_devsiblingcdl_supportedia_rangetarget_sizemap_lookup_elemldt_usr_semrec_dataposix_cputimerslink_supported_speedstry_rc_10_firstRPM_INVALIDfc_frame_crc_checkdd_datafreeze_kcountrequest_key_authblocksSKB_DROP_REASON_IPV6_NDISC_HOP_LIMITpercpu_ref_datad_spc_warnssrcu_supnbp_thresholdfreeptr_tLPORT_ST_DPRTns_typemempool_freeRPM_REQ_NONEFC_RCTL_VFTHprog_btf_fdforce_runtime_start_on_system_startsg_timeoutixolsrr_r_ctlELS_LS_ACCfasyncarg_startLPORT_ST_DISABLEDkprobes_text_sizekfunc_tabELS_TPLSblk_crypto_profileSKB_DROP_REASON_SKB_GSO_SEGfop_flagswork_lock_addr_lsb_addrpfn_mkwritentimeELS_RJT_UNSUPuaddrrtpoll_waitBPF_STRUCT_OPSKMALLOC_DMAfunc_proto_unreliablefc_seq_exch_abortioerr_cnt__UNIQUE_ID_x_654__UNIQUE_ID_x_657_uidmm_statemod_timerhwtstampss_fs_infomm_stats__rb_parent_colorWRITE_LIFE_EXTREMEicq_list__MAX_NR_ZONESmm_users_pp_mapping_pad__UNIQUE_ID_x_660__UNIQUE_ID_x_663imagekey_serial_tno_uld_attachfolioqfolios_slab_flag_bitsshost_groupssiblingscputimernrpageswake_q_nodeFC_PORTTYPE_NOTPRESENTblk_flags_tmap_fd_put_ptrs_maxbyteshd_geometryioctx_tabledma_io_tlb_memfc_cmdrefKMALLOC_CGROUPeh_cmd_qfree_after_rcu_gpget_unique_idkasan_check_readPG_workingsetNR_KMALLOC_TYPESexpire_countcompact_init_migrate_pfnfor_syncfc_slave_allocwake_cpujited_lenPTR_TO_SOCKETlinfobio_split___GFP_DMA_BITfreeze_superELS_RSItick_dep_maskFC_BA_RJT_LOG_ERRcall_depthvmpressurelruvecmap_check_btfiter_infoqc_infoobjcg_listfr_sns_lenfault_flaglist_is_headDID_TIME_OUTmodnamesg_nextia_ctimeFC_VPORT_NO_FABRIC_RSCStrace_eval_mapcompact_defer_shiftorig_objcgrespasync_put_workresvnum_static_call_sitesZONE_MOVABLEl4_hashvm_lock_seqFORTIFY_FUNC_strncatFCP_TMF_FAILEDroot_listPG_hwpoisonBPF_TRACE_FENTRYElf64_Addrwait_queue_entry_tseqlock_tlatency_record_countnr_integrity_segmentshost_blockedmay_skip_resumeprot_flagsVTIME_SYSalloc_tag_countersbase0base1base2SHOST_CREATEDbio_setfh_seq_idCONST_PTR_TO_DYNPTRFCP_TMF_CMPLBPF_MAP_TYPE_RINGBUFalignment_offsetlinksbasesFAILEDusing_sgfutex_staterseq_lenkobj_completionlesb_inv_wordi_spc_timelimitf_opnargsbindcpuhp_onlineproc_ns_operationsold_prog_fdBPF_PROG_TYPE_SK_REUSEPORTmm_mtgid_trelease_workSDEV_CREATEDavg_nr_triggersno_report_opcodesELS_RSCNBPF_PROG_TYPE_LWT_OUTrcu_read_unlock_specialBPF_CGROUP_UNIX_RECVMSGtls_arrayipvs_propertyBPF_SK_REUSEPORT_SELECT_OR_MIGRATEELS_EXPL_UNSUPRfr_eoftask_io_accountingcss_rstat_flushf_raDEVICE_PANEL_FRONTmodule_memorynetkitsitescompat_robust_list_headcss_releasedthread_nodestatic_call_mods_shrinkgp_countRxWordsnr_sectorsfc_fcp_pkt_allocbpf_raw_eventsxdp_frags_sizeiommutimer_expiresbpf_storagekset_uevent_opsf_ownerqfull__state_permDEVICE_PANEL_BACKELS_RJT_INVALmax_retry_countpagefault_enableoffsetswb_switch_rwsemdisc_syscalldiskSHOST_DEL_RECOVERYjit_requestedsdevsrcu_lock_counttrc_blkd_cpugp_waitcopy_len__compiletime_assert_131iommu_mmfuncSKB_DROP_REASON_TCP_OFOMERGEio_uring_taskshared_tagsrepeatjit_keyringLinkFailureCounts_fsnotify_infofunctionlinkagedisc_recv_reqBPF_PROG_TYPE_CGROUP_SOCK_ADDRprojidmce_kill_mema_external_lockpid_linkskfree_skb_reasonconv_zones_bitmapscsi_target_ids_dio_done_wqRPORT_EV_FAILEDfor_kupdaternid_ip_verstart_all_reasonSKB_DROP_REASON_TCP_ZEROWINDOWhlist_head_pad3_ioc_nodethrottle_diskELS_FDISCbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACErunningrw_hintblk_integrity_checksumdestroy_rworkdma_skip_syncpartition_meta_infotstamp_type_accessDEVICE_VERT_POS_LOWERBPF_CGROUP_ITER_ANCESTORS_UPnr_dying_subsysclass_spinlock_irqsave_is_conditionalutf8datahlist_nulls_headrequeue_workof_node_reuseddyndbg_infoFORTIFY_FUNC_strncpyprog_token_fdElf64_Symreclaim_waitsaved_errd_rt_spc_softlimitpollsk_skb_reason_dropfree_file_infoin_lru_faultsched_contributes_to_loadtlb_genruntime_idlemap_countspin_unlock_bhhost_scribblei_rt_spc_timelimitqc_type_states_dentry_lruac_comms_bdevvmemmap_baseskip_vpd_pagescrcssense_lenrun_listuevent_opsabort_workmax_cmd_lenbpf_func_statebpf_reg_typesched_classret_sizeutil_avganon_vmaFC_VPORT_LINKDOWNdevice_private_offset_pidsigcntuse_freeptr_offsetDD_CLASS_TYPE_LEVEL_NAMEShas_callchain_bufELS_EVFPtailcall_target_stablebpf_cgrp_storagemodinfo_attrsst_spaceclass_map_typekparam_stringd_real_typemaxrsspoolcredBPF_MAP_TYPE_ARRAYfc_fcp_timeouter_resvkernfs_open_nodefc_lport_resetf_wb_errmm_cid_activeFCP_TMF_INVALID_LUNSKB_DROP_REASON_VXLAN_ENTRY_EXISTSkzalloc_noprofdecryptedmodule_sect_attrsreq_flags_truntime_resumeac_stimescaledfc_fcp_retry_cmdunlockgroup_exec_taskrestrict_linkirq_countget_inode_usagekmalloc_typeFC_TYPE_IPxarray_startbpf_ctxpm_domain_dataserver_pick_taskbw_dworkattach_btfmap_lookup_and_delete_elem__p_size_fieldload_avgrecordi_private_lockget_dqblktail_callmq_listrnid_phys_portphysical_block_sizePG_unevictablepgoffportnetdevBPF_LIST_NODEdefault_setmodelfreeze_latemf_statsZONE_NORMAL__list_del_entrycount_objectsvma_numab_statedma_map_opsdq_dirtyREFCOUNT_ADD_NOT_ZERO_OVFlnodemax_lunexit_cmd_privfd_typeatomic_write_boundary_sectorsboot_timewpcopy_countmax_queue_depthwrite_bytesSKB_DROP_REASON_SOCKET_BACKLOGFCP_DATA_LEN_INVALIDeh_entryDISC_EV_FAILEDpending_eventsoom_reaper_listnumab_statefutex_offsetbpf_fdsubsys_fmt_prefixdq_lockintegritypte_tnr_scannedSKB_DROP_REASON_TCP_ACK_UNSENT_DATA__stateBPF_MAP_TYPE_UNSPECPG_readaheadpto_val__nr_iosk_listn_io_portslicecgroupdrv_groupstrack_queue_depthtruesizecustom_sliceper_cpu_pagesstart_idbdi_listmq_freeze_depthpadding1_SLAB_TRACEnestedatomic_write_segments_maxfc_fcp_lport_queue_readyinsn_cntmap_set_for_each_callback_argsnr_dirtied_pausequeue_kobjdst_progreal_addressbd_holder_dirac_tgidinvalidate_lockfolio_getnum_exentriesfcp_cmd_sendfix_capacitycss_local_stat_showio_portvport_last_stateblk_mode_tpmdval_tSKB_DROP_REASON_NEIGH_FAILEDhost_tagsetBPF_GRAPH_NODEkveceh_noresumefree_areaset_latency_tolerancedepthd_ino_timerprobefcp_resp_rsp_infonetlink_nsnr_argstokenSKB_DROP_REASON_TCP_CSUMdev_ueventELS_RJT_NONEfc_vportdep_mappage_mkwritelast_busyvm_flags_toffloadnregnr_failed_migrations_affinelro_enabledd_in_lookup_hashdom_csetptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLER_SLAB_KMALLOCreschedule_countmax_hang_timeFC_PORTSTATE_UNKNOWNcmd_per_lun__dummyopt_failedcdl_enablecutimelockrefELS_RLIRnew_map_fdmap_meta_equaltlb_flush_batcheddev_priv___GFP_HIGH_BITia_uidautogroupsequencercu_syncarg_endclass_spinlock_irq_is_conditional_dummy_pkeyvruntimehostdataBPF_CGROUP_ITER_DESCENDANTS_POSTscanned___GFP_HARDWALL_BITSCALAR_VALUEnr_extentsstart_stop_pwr_condpidlistsWB_REASON_VMSCANfeatures_locked__kernel_pid_tdev_statedevice_blockedfile_flagsPIDTYPE_SIDconst_pcpu_hotcinblockdma_alignmentprot_typeBPF_TCX_INGRESS__kernel_loff_tset_performance_stateserial_nodeELS_EXPL_AH_REQlru_gen_mm_statestate_remove_uevent_sentnotify_countsrc_regupdated_childrenspin_lock_offBPF_CGROUP_SYSCTLsingle_lunhprobesg_reserved_sizeswap_activatedqb_isoftlimitsaved_auxvnoinstr_text_sizeELS_SBRPdl_overrunfc_no_free_exchiattrdetachedloff_toom_flag_originfreepages_delay_totaldesc_lendma_devSKB_DROP_REASON_NETFILTER_DROPoom_score_adjwb_waitqSHOST_RECOVERYpage_fixed_fake_headrq_end_io_fnksm_merging_pagestest_runDISC_EV_SUCCESSSKB_DROP_REASON_TC_COOKIE_ERRORgraph_parse_endpointrmidptp_rdataoxidFC_RCTL_P_RJTsoftirq_pendingPG_reportedPG_xen_remappeddevice_removablefc_seq_not_foundfxsavedev_pagemap_opsbv_offsetBPF_MAP_TYPE_XSKMAPset_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETd_lockrefPG_mlockedbtf_typeDID_TRANSPORT_DISRUPTEDnr_populated_domain_childrenSCSI_EH_DONEsession_keyringshost_devbtf_log_true_sized_deleteuts_nsd_ino_softlimitd_weak_revalidateraw_atomic_setalloc_time_nsi_devicesSKB_DROP_REASON_NEIGH_CREATEFAILFC_PORTSTATE_ERRORdqb_curspaceFCP_DATA_PARAM_MISMATCHSKB_DROP_REASON_XDPSKB_DROP_REASON_NO_SOCKETBPF_TRACE_KPROBE_SESSIONELS_FDACDTalloc_lockearly_inittotal_numa_faultswritable_sizemax_segmentsdma_need_drainobj_cgroupem_tableBPF_PROG_TYPE_TRACINGmq_sysfs_init_doneactive_queuescompact_consideredfc_debug_logging__lstatepercpu_drift_mark__BPF_REG_TYPE_MAXkmem_cache_argsinodesubtree_bstatbd_fsfreeze_mutexhrtimeratomic_write_unit_maxFAULT_FLAG_UNSHARELossOfSignalCountlocal_fwnodetask_sizemust_resumeRPM_ACTIVEend_codePTR_TO_SOCK_COMMON_OR_NULLuintnr_free_highatomicpreempt_notifierstlb_flush_pendingmigration_flagsDEVICE_PANEL_RIGHTfast_io_fail_tmomap_poke_untracktx_wordscap_inheritablebpf_cgroup_iter_orderkobj_sigvaleh_timeout__stack_chk_failwritecntBPF_KPTR_PERCPUsrcu_n_exp_nodelayin_batchseqcount_spinlock_tlowmem_page_addressextra1extra2write_s64graph_get_remote_endpoints_rootstree_scanned__int128 unsignedverifiedcpu_countcgroup_rstat_cpuevent_callbackwb_lcand_byteswait_sumuprobe_xol_opssg_suppmin_align_masknextevtthis_idskb_fill_netmem_descrcu_segcblistread_s64reported_split_lockreturn_instancewait_countconfirm_switchnr_wakeups_affine_attemptspud_ti_ino_warnlimitlibfc_privpreallocmax_open_zonesrmtpnext_offsetFC_PORTTYPE_LPORTio_statuslp_mutexSKB_DROP_REASON_FRAG_REASM_TIMEOUTblindedacpi_device_iddev_scratchctx_idutaskpoweroff_noirqactive_modesdev_datais_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangsSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcss_setfwnode_handleELS_EXPL_NOT_NEIGHBORgfp_ttype__vpp_verifyqf_fmt_idlink_updatepagepageset_high_maxatomic_write_unit_minsleep_startmap_mem_usagememalloc_noiobegintypetabuse_192_bytes_for_3fnr_reserved_tagsBPF_PROG_TYPE_RAW_TRACEPOINT_WRITABLEi_crypt_infoFC_TYPE_NVMEretry_workDEVICE_HORI_POS_CENTERio_start_time_nsaudit_ttyrecov_retrybatch_sizedns_rdatanr_zonesjobctlsi_errnonr_leaves_on_treequeue_ctxmin_shallow_depthfc_seq_sigchlddqb_itimeHPROBE_STABLEmax_can_queuequota_format_type__ret_condbio_crypt_ctxpercpu_ref_func_t_SLAB_TYPESAFE_BY_RCUpm_message_tsplit_queueac_memBPF_CGROUP_INET4_POST_BINDtx_timestamppprevlip_countino_warnlimitremcsum_offloadexception_boundarybroken_fuabpf_iter_seq_infozone_wplugs_lockmnt_flagsac_stimemem_cgroup_reclaim_iterrange_endlast_mergememcg_nr_pages_over_highsw_reservedbpf_token__le32wbt_flagscrc32_lebpf_iter_fini_seq_priv_tcss_freecpu_delay_totalobjcgfh_r_ctlno_read_disc_infoblock_startvm_area_structnum_gpl_symsselect_no_atn__compiletime_assert_0__compiletime_assert_1__compiletime_assert_2__compiletime_assert_3__compiletime_assert_4SKB_DROP_REASON_TCP_INVALID_SEQUENCEBPF_CGROUP_INET6_GETPEERNAMEis_extendednr_charged_bytesDID_OKdata_dirlong long unsigned intWRITE_LIFE_MEDIUM__builtin_memcpyBPF_MAP_TYPE_CGRP_STORAGEtmf_in_progressnext_addrSDEV_CREATED_BLOCKhuge_faultRPORT_ST_READYi_fopautasklast_task_numa_placementfc_els_ls_rjt__compiletime_assert_137fortify_memcpy_chkSKB_DROP_REASON_IP_INADDRERRORSrnid_prot_portip_after_callrefcntfreeze_holderpsi_groupcdevperf_eventSKB_DROP_REASON_VXLAN_VNI_NOT_FOUNDELS_RJT_LOGICunregfuncfc_remote_port_chkreadyoom_group_SLAB_STORE_USERseqcountBPF_XDP_CPUMAPclass_idbitset__skb_fill_netmem_desclist_lruallowed_cmdsbtf_field_typeinquiry_mutexfrag_listcan_swapof_device_iddisk_statsmanage_runtime_start_stopclass_migrate_is_conditionalnetwork_headermin_ratioclass_write_lock_is_conditionals_xattrpart__pkt_type_offsetb_dirty_timeli_loss_of_sync_countBLK_EH_RESET_TIMERil_prevPTR_TO_SOCK_COMMONd_initmax_slack_shiftatomic_incfc_fcp_initget_name_prefixused_mapsspan_seqlockfc_soffileattr_get__kmalloc_noprofthreaded_csets_nodeclass_groupsSDEV_TRANSPORT_OFFLINE__ret_warn_on__call_single_nodeunicode_mappathhigh_maxSKB_DROP_REASON_DEV_HDRpreempt_countrecent_used_cpuruntimeold_time32_t_SLAB_CACHE_DMA32socket_pressurespinlock_checkenforce_expected_attach_type__state_sizeBPF_CGROUP_INET6_GETSOCKNAMEvportsfc_ba_rjt_reasonunsigned intsbitmapclass_irqsave_is_conditionalcore_kallsymsscsi_deviceSKB_DROP_REASON_IPV6_NDISC_BAD_OPTIONSfc_eh_aborts_fsnotify_maskscan_objectsbi_privatewb_idgso_sizeDD_CLASS_TYPE_DISJOINT_BITSevent_liststartupkeyring_index_keyiov_iterd_rcustatic_key_false___GFP_DIRECT_RECLAIM_BITuintptr_twake_entryrcu_tasks_holdoutfreezefprop_globalassoc_array_ptrbatchcacheBPF_TRACE_RAW_TPreca_fc4valueold_timespec32rcu_blocked_nodejiffies_at_allocfunc_idxfcp_frame_alloc_failuressubsys_datast_namegroup_nodei_mtime_secbus_dma_regionrp_statefh_rx_idSKB_DROP_REASON_TCP_OLD_ACKdatarefstatic_rqsstarget_sdev_userac_majfltdn_device_specificmce_kflags___GFP_NORETRY_BITFORTIFY_FUNC_memsetscheduledbus_dma_limitubufbtimeSKB_DROP_REASON_QUEUE_PURGEia_gidmigrate_foliohigh_minrq_listextable_baseblksizenum_symssrcu_gp_seqmin_nrnext_posix_timer_idmq_ops_mapcounti_atime_secstarttimefile_costreschedule_jiffies__list_delhprobe_statei_sb_listquota_offmap_poke_runmap_delete_batchfc_fcp_complete_lockedshm_clistmap_delete_elemwait_for_compcb_headarch_atomic_incpages_skippedzone_wplugs_hash_bitspi_offsetac_flagfh_df_ctlpt_regsmmap_missexpires_nextSAM_STAT_TASK_SET_FULLblk_opf_tSKB_DROP_REASON_IP_INVALID_DESTreport_zoneskeyring_name_list___GFP_ZERO_BITnum_trace_bprintk_fmtiter_seq_infoSKB_DROP_REASON_TCP_AOKEYNOTFOUNDcdrom_device_infolruvec_stats_percpuaccess_statebpf_prog_statssdev_gendevwork_structtruelast_queuedreverseSKB_DROP_REASON_VXLAN_NO_REMOTEri_timernr_populated_threaded_childrenex_refcntpipe_bufsavg_last_updatebp_offsetkmalloc_cache_typeswap_events_filefc_frame_freeprotectedbsyncrequestedsaved_scratch_registertracepoints_ptrsfcp_cleanupwifi_acked_validblock_maxstatic_keyqueue_rqsdev_boundlibfc_function_templatecsum_validFAULT_FLAG_VMA_LOCKtotalreserve_pageskswapd_orderdma_range_mapvaluesKOBJ_NS_TYPE_NONEctl_table_pollfc_els_rjt_explanmin_slab_pages_datafc_fcp_recoveryFAULT_FLAG_WRITEshow_optionswait_queue_entryexpirei_uidtagset_freedmax_sectorsexpiryfc_frame_payload_opperiodbmapPG_dirtyrescue_workqueuerx_wordsmap_allocdispatch_wait_lockscsi_bufflenscsi_levelfsaveBPF_TRACE_UPROBE_SESSIONi_write_hintsuspended_timeread_bytesskb_shared_infozone_wplugs_worksum_sched_runtimes_writers_keySYSCTL_TABLE_TYPE_DEFAULTbpf_callback_tRPORT_EV_READYstart_boottimetimer_offentriesi_modecap_permittedfc_rport_priv_flags_2aslab_flags_tfcoe_rcv_infoBLK_UID_NAAstart_coderet_flagsvm_flagststamp_typesi_codeseqcount_spinlockBPF_PERF_EVENTheadHPROBE_GONElast_siginfosched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorsdworkdevice_dma_parametersdir_contextsaved_dst_attach_typeiopl_emulconsumersratelimit_statepower_statedq_flagsrstat_cpufieldsswap_plugcapture_controlPTR_TO_MAP_VALUE_OR_NULLraw_atomic_fetch_sub_releaseSAM_STAT_COMMAND_TERMINATEDPG_headfc_setup_fcpoffline_nodequeue_offsetclass_device_is_conditionalnon_rcuput_superwrite_endshostbpf_exception_cbxdp_has_fragsdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_statctx_arg_info_size__kmalloc_large_noproffcp_respddp_setupjitedopen_flagslegacy_namemap_lookup_percpu_elemfc_frame_payload_getFAULT_FLAG_INTERRUPTIBLEmap_token_fds_inodes_wbvport_delete_worksubsysfolio_queuescsi_cmd_privdurationinner_transport_headerinit_fs_contextuprobe_taskELS_RPBCf_mappingconstant_test_bitFcpPktAllocFailstailcall_bypassstart_stackBPF_MAP_TYPE_STRUCT_OPSprog_array_member_cntfh_ox_idDL_DEV_PROBINGi_linkWB_REASON_MAXfc_frame_alloce_statstack_vm_areafc_lund_hashBPF_SPIN_LOCKdl_server_pick_frefcount_dec_and_testtty_old_pgrpst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquotaorc_entrydma_drain_len__MAX_BPF_ATTACH_TYPESCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listDID_PASSTHROUGHutime__UNIQUE_ID___addressable_fc_eh_abort668mmapshrinkeralloc_dquotbw_time_stampmappingdl_defer_armedfc_ns_ftsmap_pollrunnable_sumatomic_fetch_sub_releasecpu_scaled_run_real_totalshort unsigned inteventsget_rq_budget_tokenqueue_ramp_up_perioddevice_nodemm_walkgpl_compatiblefc_gpn_ft_resprequeue_listlocal_portFC_PORTSTATE_DIAGNOSTICSp_size_fieldpkt_typelong long intSAM_STAT_CHECK_CONDITIONsym_vvar_start_hugetlb_cgroup_rsvdSKB_DROP_REASON_ARP_PVLAN_DISABLEsival_ptrproc_namepercpu_sizefc_vport_stateFC_PORTTYPE_UNKNOWNdestructor_arg__wsuminvalidate_folioexpected_lenis_valloc__compiletime_assert_313__compiletime_assert_314drop_nsNOT_INITELS_RJT_VENDORnr_queuesgenerationno_pm_callbackscountELS_RJT_PROTddp_targetd_parentpagessched_task_groupscsi_doneBPF_TIMERupdate_timetc_skip_classifymemcg_idpidsof_noderun_nodedata_sourcesubmit_bio___GFP_UNUSED_BITs_instancesvm_rcubd_start_sectctl_nodepage_table_locksysv_semquota_infoquota_enable__kernel_timer_twork_listresp_activeBPF_MAP_TYPE_PROG_ARRAYPTR_TO_PACKETdomain_tagmax_integrity_segmentscmaxrssit_real_incrprobestubextable_lenlast_arrivalwake_index_watermarkSKB_DROP_REASON_SOCKET_FILTERswap_rwseq_blenreservemap_extrasplit_queue_lockFC_RCTL_DD_SOL_DATAseq_idevents_local_filesrcu_gp_seq_needed_expPG_privateDEVICE_HORI_POS_RIGHTSKB_DROP_REASON_HDR_TRUNCSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOia_mtimenr_thpslegacy_cftypesrnid_vend_specsysv_shmfopssuppress_bind_attrsinsnlen__page_1__page_2i_mutex_keykey_restrictionstatquota_writedomainget_linkFC_PORTTYPE_NLPORTmax_depthctl_table_argdata_lenpriv_stack_ptrPG_referenced___GFP_NOFAIL_BITblkcg_nodeforksa_flagsno_start_on_addcancelled_write_bytesdispatch_busyfcp_packet_alloc_failuresnbp_rl_startFC_RCTL_ACK_0task_worksFC_BA_RJT_PROTO_ERRmm_cidatomic_write_hw_maxdfl_cgrp_ddebug_infoaddrsshrinker_info_unitstats_locknum_kpfc_fill_fc_hdrSTARGET_CREATED_REMOVEshost_gendevcsumMEMORY_DEVICE_PRIVATE__bd_flagssuper_blockbi_bvec_donemap_get_unmapped_areabus_typeget_named_child_nodeBPF_MAP_TYPE_PERCPU_CGROUP_STORAGE_DEPRECATEDassoc_arrayactorBPF_CGROUP_ITER_DESCENDANTS_PREpagefault_disabled_incbpf_offload_devkobj_ns_typemax_descendantsscsi_dispositionsched_shared_tagsfp_wwpnlong intcore_nodebdi_nodecn_device_specifictarget_btf_idmem_dqinfodevnodesaved_sigmaskac_uidBLK_UID_EUI64MEMORY_DEVICE_PCI_P2PDMAac_nicedq_offpinsblkcg_mutexis_visiblecgrp_linksdisk_nameuuid_t__kernel_clockid_twritabledqb_bsoftlimitwait_tmo__fc_fill_fc_hdrvfork_donetask_cputime_atomicki_waitqra_pagesgroupmmap_compat_legacy_basedevice_dma_supportedsysfs_dir_lockcss_idrscsi_cmnd_submitterignored_posix_timerslockedsival_intia_filecancel_attachio_pagesSKB_DROP_REASON_TC_EGRESSwakeup_cntrequest_pending_raw_spin_unlock_bhFC_BA_RJT_NONEdl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsclass_read_lock_irqsave_is_conditionalfc_els_rjt_reasonblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startavg_triggersctl_dirFC_PORTTYPE_PTProbust_list_headunsigned charwake_qrange_startrethooksnuma_scan_periodsdev_idelem_countnr_tagswakeup_pathresult_maskFORTIFY_FUNC_memscanscsi_timeout_actionei_funcs__func__pfo_val__BPF_NETFILTERtablesRPORT_ST_PLOGI_WAITpipe_inode_inforaw_spinlockmemcg_cgwb_frnblkio_delay_totaldomainnameinstrument_atomic_readktypebpf_attrBPF_PROG_TYPE_CGROUP_SYSCTLhost_sizemigration_disabledlen_errSKB_DROP_REASON_FRAG_TOO_FARext_mutexfr_fspRPM_REQ_SUSPEND_SLAB_FLAGS_LAST_BITpgprot_ttracepoint_ptr_tfor_reclaim_skb_refdstphysical_locationELS_PDISCchildren_low_usagenum_vfPIDTYPE_MAXbi_sizemg_dst_csetvlan_protothrashing_countwatcherscrypt_ctx__kmem_cache_createstopwait_maxclass_write_lock_irqsave_is_conditionalioveca_flagsiomapd_dnameScsi_Hostnr_migrations_coldbtf_value_type_idmnt_idmapPG_partially_mapped___GFP_FS_BITseeksquotactl_opski_ioprioADD_TO_MLQUEUEvport_typesched_remote_wakeuptag_alloc_policymemcpysock_filterBPF_LIRC_MODE2tracing_graph_pauseread_itersuspend_latefront_padFC_TYPE_CTsdev_devmaxframe_sizePG_uptodatersp_codefc_seq_start_nexti_rwsembi_integrityexitio_uringeh_device_reset_handlerchild_ns_typeorderslave_bdevscommit_dqblkclass_local_lock_irqsave_is_conditionalmark_dirtyFC_PORTSTATE_OFFLINEnr_ctxkernfs_opsnr_dying_descendantsoom_reaper_timermodulewb_bytesbd_securitynodeinfoPG_idlequeue_lockf_pathstatic_call_siteself64_symunlinkmap_queuescpumask_var_trefcount_warn_saturatetime64_tdrivers_diri_gidtype_idFORTIFY_FUNC_strnlenrq_qosmark_deadREFCOUNT_DEC_LEAKicq_hintrmdirdq_dqbmemory_failureblkcg_gqdma_flagsbtf_field_kptrSUBMITTED_BY_BLOCK_LAYERfcp_txrdymax_hw_sectorsselectors_mtdmod_kallsymss_typefield_maskjits_use_priv_stackprog_bind_mapli_failure_unknownfini_seq_privateremount_fsbd_holdernext_idtask_delay_infopi_senew_utsnamejit_datarelative_fdin_useforwardrq_countMIGRATE_SYNC_LIGHTerrseq_tms_rdatakstatfslruvec_statsreclaimedmems_allowed_seqmax_user_discard_sectorsinsnsitarget_allocbug_listBPF_CGROUP_INET4_CONNECTmax_nr_cidmod_arch_specificDMA_NONEtransfersizepp_recyclesplit_queue_lensharebpf_net_contextprobe_addrno_cgroup_ownerfolio_ref_incSKB_DROP_REASON_DUP_FRAGdisc_stopftrace_timestampbi_iopriobypass_addrd_ino_warnsstack_depthkernfs_elem_attrBPF_PROG_TYPE_SK_SKBi_ctime_nsecrelative_idFCP_CMND_FIELDS_INVALIDrbnodei_private_listbinfmtftrace_sleeptimedata_size_inBPF_CGROUP_ITER_ORDER_UNSPECi_statebv_pagedestructorpcpu_cidsched_migratedZONE_DMA32FC_TYPE_ILScgroup_tasksetdup_xol_addrdevice_configurePROBE_PREFER_ASYNCHRONOUSrcu_node_entryreverse_orderingBPF_MAP_TYPE_BLOOM_FILTERcgroup_bpffile_system_typeorig_ret_vaddrelsct_sendbtf_log_levelELS_RCSmmu_notifier_subscriptionsswap_iocbBPF_RB_ROOTdefault_groups__sifieldsb_ionr_watchesfind_special_pageDL_DEV_DRIVER_BOUNDELS_EXPL_SPP_OPT_ERRadj_offcurr_ret_depthstarved_entryfc_flags__fillerdestroy_dquot__task_fpstatefilldir_tSKB_DROP_REASON_TCP_AOFAILUREget_reserved_spaceioprioKMALLOC_NORMALunreliablecreateBPF_PROG_TYPE_SCHED_ACTdirtied_time_whenstart_scan_seqperf_rdpmc_allowedmin_seqfc_rctlsym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerSKB_DROP_REASON_QDISC_DROPbd_openersdq_inusescsi_pkt_cachepofflinedev_pm_infomremappage_is_pfmemalloctime_nsin_memstallhost_self_blockednode_size_lockcss_extra_stat_showkptrpoweroff_latei_nlinkwakeupcb_list___GFP_IO_BITcpu_iditer_info_lenpushable_taskstty_audit_bufmaxlenconf_framekernel_cap_t__be16bpf_funcpoke_tabmems_alloweds_inode_lrucached_rqse_cset_noderecov_seqSKB_DROP_REASON_SKB_CSUMkf_rootmmap_compat_baseretvalpreparenr_threaded_childrenclock_op_might_sleepf_sb_errneed_mbd_namecheck_flagsi_sequencert_prioritykretprobe_instancescrypto_profile__be32token_createfc_tm_doneiov_basecpus_ptrq_lockdep_mapb_more_ioload__kmem_cache_create_argsfuncscpu_bitmapSTARGET_DELatomic_write_lensaved_tfnetmem_to_pagemempool_create_node_noprofxa_headdetachprog_ifindexmm_list__UNIQUE_ID___addressable_fc_queuecommand667SKB_DROP_REASON_NOMEMproperty_read_string_arrayget_statefc_fcp_ddp_donetracepoint_funcd_seqnuma_scan_offsetcpus_allowed_lock_statusnetmemlocklinux_binfmtDID_NO_CONNECTsrr_resvd2__be64blkg_listnum_symtabexec_update_lockfscrypt_inode_infosplice_readSKB_DROP_REASON_SOCKET_RCVBUFFBPF_PROG_TYPE_SOCKET_FILTER_SLAB_RECLAIM_ACCOUNTSKB_DROP_REASON_TCP_RFC7323_PAWSSKB_DROP_REASON_MAC_INVALID_SOURCEneed_qsctx_mapFC_VPORT_UNKNOWNbd_diskuid_gid_extentnumberszone_wplugs_wqWRITE_LIFE_SHORTsigpendingpi_entryBPF_MAP_TYPE_ARENAs_inodesdirtied_whenmap_direct_value_metaMIGRATE_ASYNCBPF_MAP_TYPE_PERCPU_CGROUP_STORAGEnext_scanfc_fcp_srr_respBPF_CGROUP_UDP6_SENDMSGgsindexwrite_bandwidthcompletewatch_listli_prim_seq_err_counteh_abort_listBPF_CGROUP_UDP4_RECVMSGd_sibsleepable_refcntmodule_attributemax_host_blockedneed_tsin_dpm_listwordwork__list_add_valid_or_reportmultiprocessquiesce_depthfbatchclass_task_lock_is_conditionalBPF_CGROUP_INET_INGRESStask_groupf_pos_lockperiod_timerBPF_FLOW_DISSECTORsk_buff_data_texpected_revisionbio_pooltimeout_workBPF_PROG_TYPE_LWT_XMITmac_lensrcu_barrier_completionBPF_MAP_TYPE_STACK_TRACEpacctblk_mq_tag_setSKB_DROP_REASON_TUNNEL_TXINFOcurr_targetvm_page_protbalanced_dirty_ratelimitbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatPTR_TO_PACKET_ENDrvalperf_event_contextatomic64_tnoinstr_text_startctx_size_outddp_doneac_btime64HRTIMER_RESTARTrpm_autosuspend_delayac_gidELS_LINITnotify_timercorememfh_d_idBPF_MAP_TYPE_USER_RINGBUFLPORT_ST_LOGObusystack_canaryuser_keyring_registermax_write_zeroes_sectors_utimedn_unable_to_routetmf_work_q__fortify_size_flags_1_flags_2FC_TYPE_BLStaskstatsport_stateproactive_compact_triggerELS_FLOGIposix_acli_dio_counttlenarch_rwlock_tpao_tmp__driversym_timens_pagerport_event_callbackhugetlb_optimize_vmemmap_keysysctlsoffsetrtpoll_taskprot_guard_typedev_iommuWB_REASON_SYNCmap_typeclass_rwsem_read_intr_is_conditionalcompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_usersscsi_sg_countSDEV_BLOCKbacking_dev_infoi_mappingheadersfc_fcp_rec_respdiscard_alignmentbsg_deviceshow_statsnr_populated_csets_resbr_reasons_vfs_rename_keysubmitteretypekfree_skbi_bytes___GFP_WRITE_BITnormal_prioFC_BA_RJT_UNABLEblkio_countshost_datadispatch_waitBPF_MAP_TYPE_INODE_STORAGEsrcu_nodelast_mm_ciddelayedhdr_lenpagefault_disableper_cpu_nodestats__refcount_addSKB_DROP_REASON_TC_CHAIN_NOTFOUNDvaddrscsi_vpdis_softnext_cpugrab_current_ns__UNIQUE_ID_y_655scsi_pkt_pool__UNIQUE_ID_y_658class_namesdisc_worknr_taskslock_class_keypriv_stack_requestedsum_exec_runtimememory_failure_stats__UNIQUE_ID_y_661setup__UNIQUE_ID_y_664dev_pin_infolesb_sync_losspoll_table_structmce_whole_pageELS_QOSRia_modercu_tasks_holdout_listsched_rt_mutexs_pinsswap_peaksnon_seqbpf_prog_arrayattach_func_protoSKB_DROP_REASON_IP_CSUMpresent_pageshctx_listrenamecontiguousscsi_queue_lockthrashing_delay_totalmajorktime_tPRJQUOTAlink_idzswap_lruvec_stateBPF_CGROUP_INET_SOCK_RELEASEkprobe_blacklistjump_entriesdio_offset_alignELS_LKAreserved_tagsdma_masksa_restorerqueuelistdatalenfc_rport_libfc_privmkdirnextrelax_countrestore_earlyPIDTYPE_TGIDilencpu_run_virtual_totalmax_active_zonesdevice_physical_location_horizontal_position_SLAB_CACHE_DMAattach_flagskfunc_btf_tabkmem_cache_destroy__list_addrportkobj_uevent_env___GFP_MOVABLE_BITkprobes_text_startpid_typefown_structi_default_aclBPF_PROG_TYPE_LIRC_MODE2fregs_statemap_flagsBPF_PROG_TYPE_LSMzonerefshift__devicesFORTIFY_FUNC_strcpypendingfc_destroy_fcpfc_classBPF_MAP_TYPE_PERCPU_ARRAYdma_boundarybd_nr_sectorsnr_eventskmemcg_idkstatanon_vma_namedq_hash__iovgp_stategrphiFC_RCTL_ELS_REQntabiommu_mm_datamap_for_each_callbackinvalid_crc_countnr_disk_swapinszone_wplugs_err_listma_flagsarch_uprobebio_issueSKB_DROP_REASON_IPV6_NDISC_NS_OTHERHOSTDL_DEV_UNBINDINGcurrent_taskKMALLOC_RANDOM_ENDrefcountmmap_lockuprobe_multidevice_sizeDID_TRANSPORT_MARGINALLPORT_ST_RFF_IDzonelistsrcu_reader_flavorbtf_fddumped_framespeerstimerqueue_nodeELS_FARP_REQreal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_alloweduse_16_for_syncrt_mutex_waitermem_cgroup_per_nodekcompactd_pad_page_pooldq_dqb_lockctorf_flagsblk_qc_tshow_infoinner_map_fdslave_allocflush_requiredWB_REASON_FS_FREE_SPACEsg_tablememcg_vmstatskeyring_semattributesblk_queue_statsgrplomax_rport_retry_countkgid_tkey_userreadlinkoffline_disabledd_comparetime_ns_for_childreni_wb_frn_winnerqspinlock__compiletime_assert_451sighand_structELS_FACTstart_brkELS_RNIDdisc_callbackreg_typeSAM_STAT_ACA_ACTIVEDID_BAD_INTRmap_mmapdio_completeshost_statelocked_pendinglockdep_keyrnid_resvdextentfile_offsets_idstate_maskcore_statelink_upalignsym_int80_landing_padngroupsmajor_retriessp_offset__sigrestore_tRPM_SUSPENDEDvolnameDMA_TO_DEVICEmutexn_refattrsexch_mgr_resetBPF_TCX_EGRESSFC_VPORT_DISABLEDbi_sectoreh_deadlinefsbaseinactivelport_set_port_idsrcu_barrier_mutexloss_of_signal_countdirty_limitswregs_state__kernel_timespecchildren_min_usageeh_should_retry_cmdpglist_datad_lruwaitqmax_pkt_offsetd_fieldmaskcountersfaults_disabled_mappingnameidataarg_sizefailedpoweroffbpf_prog_opsbpf_verifier_envminorsnonresident_ageControlRequestselemsizerlim_curFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagscan_workdebugfs_entrywait__list_add_validshow_rqcan_queuest_shndxreservedi_wb_frn_historyELS_EXPL_AHctxsprocess_keyringset_dqblkrestart_blocks_opbi_end_iokobjectposix_cputimer_basenr_memcgsleveluser_definedcow_page__warn_printkFC_SOF_Fnanosleepinvalid_tx_word_countfalsecn_sig_alarmpi_state_listtv_secac_exitcodeBPF_KPTRsuidscsi_host_statusFC_SOF_I3prog_typeKMALLOC_RANDOM_STARTSAM_STAT_INTERMEDIATE_CONDITION_METjiffieskey_typedismissi_hashmm_cid_next_scanfreeze_noirqoublockdisc_idia_atime_timerfifopscr2_ret__vm_private_dataskip_ms_page_8fc_fcp_rec_errorfc_fcp_can_queue_ramp_downfc_frame_alloc_fillFC_RCTL_BA_PRMTfr_statusrtpoll_scheduledWB_SYNC_NONEBPF_PROG_TYPE_KPROBEorig_progdq_freeSHOST_RUNNINGrootLPORT_ST_RNN_IDDISC_EV_NONEsupported_classespolicycpu_basePG_activeBPF_PROG_TYPE_SYSCALLcap_bsetnr_to_writerportsnr_itemsSKB_DROP_REASON_NEIGH_QUEUEFULLanon_costseq_startfcp_input_megabytesbp_regbvec_poolkern_versionrb_root_cachedfc_host_statisticsWB_REASON_FOREIGN_FLUSHmac_headeri_blkbitswritervm_pgoffvirtmembr_explan_refcounttarget_fdcsum_typeFC_RCTL_F_BSYLfc_fcp_pkt_destroySKB_DROP_REASON_TCP_CLOSEbin_attributeELS_LOGOmath_emu_infopushable_dl_taskswrite_u64testWB_SYNC_ALLsched_infogroup_infoSUCCESStailsDID_IMM_RETRYdqi_fmt_idPTR_TO_ARENAactive_extensionsmemcg_csssoftirq_next_timerrevisionis_child_subreapersg_tablesizeexit_codefile_lock_contexttracingnr_pageswriteback_indexread_u64fiemap_extent_infofilemempool_free_tPTR_TO_TCP_SOCK_OR_NULLfree_foliort_spc_warnlimitcmndatomic_write_hw_unit_mincompact_count_sk_redirtimer__empty_rangessbq_wait_statedev_namebpf_mapi387__p_sizeBPF_PROG_TYPE_EXTBPF_PROG_TYPE_FLOW_DISSECTORnotified_atn_klistwb_errbudget_tokenfc_framevlan_tcikswapdwrite_dquotrefcount_offpercpu_pvec_drainedf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachewwnnstorebi_bdevELS_PLOGIst_infodispatchdescsquiesced_bydqi_max_ino_limitllseeknet_nsRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleget_projidfunc_info_aux__sectorpart0cnvcswwwpncallskqidparo_tmp__mem_cgroupPTR_TO_BUFfree_inodenext_keysiglockwait_queue_func_tperf_recursionreca_ox_idnr_wakeups_remoted_spacei_ctime_secdebugfs_idreal_func_cntnext_timer_typeBPF_TASK_ITER_TGIDTT_NATIVEused_map_cnt__empty_insnshlist_bl_nodeoldbitnum_descsSKB_DROP_REASON_TCP_FLAGS_head_1_head_2clockid__read_overflow2_fieldFREEZE_MAY_NESTsym_hvclock_pageremap_file_rangemmap_legacy_basepfmemalloc_waitend_dataxa_lockfutex_exit_mutexPG_youngiommu_groupmap_peek_elemnr_isolate_pageblockmempool_alloc_tdevice_get_dma_attrtarget_blockeddev_loss_workalloc_inodefr_residPG_pinnedbtf_field_graph_rootdirty_foliodn_unknownnode_zonesseq_countfscrypt_keyringis_hardasync_sizeSKB_DROP_REASON_INVALID_PROTODID_SOFT_ERRORtrap_nrf_iocb_flagsctx_size_in__flagsRPORT_EV_LOGOkcompactd_waitnodenametotal_vm_entire_mapcountiteratorlastpool_dataqf_opsforce_atomic_pad1_LPORT_ST_RHBAreal_credno_difblkcnt_td_rt_spaceprog_idsBPF_MAP_TYPE_HASHsigned charmap_local_storage_chargehas_child_subreapermount_pad2_reasonblk_flush_queuesrr_opsched_entitydev_links_infoinner_protocol_types_uuid_lenpcpufh_seq_cnt___GFP_RETRY_MAYFAIL_BITdqi_privINIT_LIST_HEADfc_els_cmdfmode_trpm_autosuspendrnid_att_nodessweventactivatefxregs_state_lowerpaddingDEVICE_REMOVABLEpid_ns_for_childrenSKB_DROP_REASON_FULL_RINGtimestimer_rand_stateDID_RESETlru_gen_memcgopcodefr_encapsllist_nodeELS_EXPL_INV_LENbpf_run_ctxbio_slabstate_add_uevent_sentLPORT_ST_RSPN_IDenv_startmodule_notes_attrsio_cqlower_firstrangeSKB_DROP_REASON_TCP_RESETbvecacct_vm_mem1on_cpumanage_system_start_stopmg_src_preload_nodestringSHOST_CANCEL_RECOVERYatomic_fetch_add_relaxednuma_preferred_nidELS_FPINfree_diskPTR_TO_MAP_KEYvmem_altmapbiotailwait_startelevatorspinlockfc_queuecommandmin_unmapped_pagessrcu_barrier_seqi_aclssb_statnofaultbpf_map_typeia_rangesq_size_fielduseroffsetis_reltablepteval_tfc_fcp_can_queue_ramp_uplog_levelblk_mq_tagssrr_rel_offDEVICE_PANEL_LEFTorc_unwind_iprel_deadlinexfer_contig_endkobj_typeskip_settle_delaysb_writersdma_cleanupeh_timed_outdriver_dataphys_addr_tdma_iommumax_idirq_safeLPORT_ST_READYrescue_lockdefault_timer_slack_nsxregs_statedelays_statecompletion_cntSKB_DROP_REASON_LOCAL_MAC_deferred_listcurr_nrset_child_tidSKB_DROP_REASON_UNICAST_IN_L2_MULTICASTbio_vecacpi_match_tablenfdsrlimitBPF_TRACE_FEXITmap_update_elemlast_subtree_bstatnr_frozen_tasks__list_del_entry_valid_or_reportarch_static_branchiterrelease_agent_pathidle_notificationmodule_statesnslrtpoll_triggersPTR_TO_BTF_IDwait_lockf_pipegetgeocset_linkswrite_iterD_REAL_DATAsp_featuresacct_timexpdclock_mutexnr_failed_migrations_runninguserfaultfd_ctxevent_flagsthread_structoldpbuf_lenfc_rport_statemm_context_tbd_stampELS_RVCSdio_mem_aligncstimeRPORT_ST_FLOGIprot_capabilitiesFC_RCTL_BA_ABTSatomic_long_trpm_request__refcount_incfc_fcp_lock_pktpositionMQ_RQ_COMPLETEio_comp_batchline_info_cntSKB_NOT_DROPPED_YETcftsf_credtrace_eventsfc_port_typed_iputlast_bstatnew_prog_fdnr_wakeups_syncklist_nodeELS_ADISCstackmap_release_urefBPF_REFCOUNTblockedvm_numa_eventdst_trampolineallowedmce_countweighttotalblk_plugOutputRequeststrc_reader_nestingfpstatetag_setis_roxno_scsi2_lun_in_cdbprevseqcount_raw_spinlockinstrument_atomic_read_writebios_paramnum_orcskswapd_failuresFORTIFY_FUNC_kmemdupbuflenbpf_kfunc_desc_tabfc_exch_seq_senddeadBPF_CGROUP_DEVICEWRITE_LIFE_LONGcrc_offloadexpiry_activeeh_bus_reset_handlermtd_infois_confidentiali_dentryfixupsFC_RCTL_BA_ACCvm_endvm_structproc_handlerfc_fcp_cmd_sendmemcgfsyncsgid__fc_frame_header_getcompat_robust_listnuma_workELS_ECHOpriofc_fcp_frame_alloc_SLAB_NOLEAKTRACEprivvaluesg_bytesrcu_workBPF_CGROUP_INET4_GETPEERNAMEredirectedcurrent_stack_pointerac_minfltxsk_metabpf_prog_aux_hugetlb_cgroup_msecs_to_jiffiesset_policyinternal_tagthreadftrace_callsitesmmlistservice_paramsBPF_CGROUP_SETSOCKOPT_SLAB_PANICforceidle_sumusedpage_typeclass_spinlock_is_conditionaluserskb_iifmynodeseq_stop__MAX_BPF_PROG_TYPEblk_traceactionseconds_since_last_resetlink_detachpi_waitersdom_cgrpqueue_mappingscsi_comp_flagsrelease_pktlportfile_name_offbstatfailcntatomic_tpcp_listqueue_flagsBPF_PROG_TYPE_UNSPEChwtstamprb_rootLPORT_ST_RPAfreepages_countutf8data_tableBPF_PROG_TYPE_SK_MSGprim_seq_protocol_err_countexe_fileuid_telementsd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_datadef_flagssrcu_n_lock_retries__kunmap_atomicraw_locksrcu_structprovinner_map_metais_guestli_link_failure_countio_minnf_skip_egresstarget_attrsrtpoll_wakeup_ft_resvdsplice_eofs_sync_lockproganon_vma_chaini_mtime_nsecseq_opsrseq_event_maskem_pdi_fsnotify_maskshared_pending__int128kasan_check_write__mce_reservedwriteback_controlmax_write_lenmm_struct__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEbuild_idhost_statss_export_opCONST_PTR_TO_MAPBPF_CGROUP_INET4_GETSOCKNAME_SLAB_NO_MERGElen_descseg_boundary_maskanon_namesched_dl_entitypp_ref_countactivest_othercall_get_stackstartparentlookupkernel_siginfowritten_stamp_sigpollinitializedSDEV_CANCELkill_sb__bi_remainingnum_bugsnr_requestscftypesecurity_supportedsock_fprog_kernklistusercntirq_delay_totalstatefc_non_bls_respstatsfc_vports_linkchangedev_loss_tmousersactive_basesDEV_DMA_COHERENTswap_slot_free_notifystart_databoolcompact_order_failedbv_leninquirymodsctimefc_vport_set_staternid_atypedestroy_inodecma_pagesfutex_pi_staterport_priv_sizei_mutex_dir_keyrescue_workrestartsdevice_physical_location_vertical_positionget_aclset_aclac_exe_devmemory_tiers_voppercpudescpoll_bioiterate_sharedmemswsym_vdso32_sigreturn_landing_padfc_fpin_statscma_areafeaturesrcu_tasks_exit_cpulink_fdmigrate_from_cpubd_size_lockwriteerror_codebuddy_listref_ctr_offsetsldt_structprog_attach_flagsfcp_control_requestscred_guard_mutexbus_groupsd_timeUTASK_SSTEP_TRAPPEDget_nameVTIME_INACTIVEmg_src_cgrpeh_target_reset_handlerclass_preempt_is_conditionallink_createtimeouturing_cmdshrinker_idnr_dirtiedgetattrBPF_SK_SKB_STREAM_PARSERsetattrPTR_TO_TCP_SOCKvmstats_percpufixupblockMQ_RQ_IDLEdevtlast_cpufor_backgroundnr_wakeups_localcn_sig_warnuidhash_nodemax_ratioalloc_cpupost_attachworker_privatepoll_eventFC_FID_FLOGIalloc_factorlinelinkbi_pooleffectivecompact_blockskip_flushmoderead_charserver_pick_taskFC_FID_ALIASESnode_idPTR_TO_STACKtargetget_nextdqblkrcu_tasks_idxBPF_PROG_TYPE_NETFILTERjournal_infobi_inline_vecstqheadlast_used_atrq_end_io_retline_offhres_activeold_subtree_controllesb_link_failmod_namenotes_attrsdelay_workFC_VPORT_NO_FABRIC_SUPPblock_device_operationsoffset_ctxbi_blkgseq_nexttail_call_reachablelast_switch_timefcp_output_requestscompact_init_free_pfnwakeup_countwait_indexlog_sizerunnable_weightFC_VPORT_FAILEDmap_push_elemtarget_busyclass_releaselast_sum_exec_runtimedd_key_truesa_handlerfree_countcg_listscsi_transport_templatelocked_vmqueue_rqaddressmq_hctxstart_timeRPORT_EV_STOPzone_wplugs_hashkprobe_multicookielistfreezersig_okextabledma_data_directionmax_entriesi_sizeentry_eipcgroup_atypesplice_pipexstate_headerinquiry_lenrtpoll_timerdma_addrem_perf_domaind_flagsdying_tasks_large_mapcountnode_present_pagespid_namespaceliveclock_was_set_seqspc_warnlimitseqcount_tmin_fltblock_devicethreadedfp_fidMEMORY_DEVICE_GENERICpkruBPF_MAP_TYPE_PERF_EVENT_ARRAYattribute_containerprojid_tvendorvport_idmemcg_nodeBPF_CGROUP_UNIX_SENDMSGdma_lengthcn_clearkey_payloadadd_linksnbp_th_start__empty_insnsiuse_10_for_msBPF_RB_NODE_dummy_bndexception_cbBPF_TRACE_UPROBE_MULTIper_cpu_pagesetfcp_cmndsaved_stateparent_exec_idutil_sumdd_key_falsesigvalfsnotify_mark_connector__ubuf_ioveccputime_atomicdeadlinebio_integrity_payloadlun_in_cdbexit_requeste_d_tovwait_queue_upperclass_write_lock_irq_is_conditionalcgroup_fileswap_readahead_infovtimeexpecting_cc_uas_rootli_device_specificstack_refcountgrpmaskdevice_attributes_remove_countBPF_SK_LOOKUPlru_genwrite_newuser_namespaceclass_rwsem_write_is_conditionalpids_active_resethlist_nodeblk_features_tsuper_operationsautosleep_enabledwrite_file_infoload_sumaddress_spacecpus_maskdl_yieldedstarget_dataextension_progfile_dispread_newd_spc_softlimitfc_discuse_10_for_rwkrefrseq_css_lock_keydqi_flagsmq_ctxjump_entrypi_top_taskhlist_nulls_nodefc_els_lesbpacct_structRPM_REQ_RESUMEpathnameuser_sizelast_queue_ramp_upbd_statsshow_fdinfoFAULT_FLAG_MKWRITEput_budgetfadviseclass_read_lock_irq_is_conditionallesb_inv_crclinenoMODULE_STATE_LIVEtask_listtc_at_ingressasync_scanPTR_TO_CTXFAULT_FLAG_RETRY_NOWAITBPF_CGROUP_SOCK_OPSread_foliosc_data_directionhas_elevatordtordq_countvpd_pg0nlinksignalnr_wakeups_passiveself_exec_idstate_syncedws_activef_epctl_tablercu_specialprog_fdscsi_device_handlerentryold_subtree_ss_maskbacksda_is_staticBPF_MAP_TYPE_LRU_HASHcgwb_domaincntssockidr_rtsdev_bflagsdispatch_fromdqio_semnr_linfomq_freeze_wqstart_prevent_timepgd_tsigset_twq_offLPORT_ST_DNSmap_btf_idbucket_idrstat_flush_nextignoredgraph_get_port_parentremovableBLK_INTEGRITY_CSUM_CRC64prog_idreserved_tailroomi_inoserver_has_tasks_killRPORT_ST_PRLIpgdati_spc_warnlimitunderflowf_posBPF_MAP_TYPE_HASH_OF_MAPSperformancesoftac_pidowner_trapnoload_weightBPF_PROG_TYPE_SOCK_OPSfc_fh_typesleepablevport_statesymlinkclass_rwsem_write_try_is_conditionalbd_queueerror_framesin_iowaitDEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclbdi_writebackrb_leftmostdst_neededbug_addr_dispmigration_pendingscan_mutexhosttd_realns_commonmap_ifindexdevice_get_match_datas_max_linksctl_table_rootfc_rport_eventscatterlistverified_insnsthread_headacquire_dquotclockid_tfifo_timetarget_destroyzone_capacitypgdval_td_managedevice_attrsmax_ctx_offsetmax_device_blockedback_padMIGRATE_SYNCwcharRQ_END_IO_FREEseq_filefcp_output_megabytesonline_cntBPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATEDrestoreline_infoHPROBE_LEASEDBPF_LSM_MACthaw_superalt_lenseq_operationslesb_prim_errfallocatelog_true_sizedst_pending_confirm_call_addrwriteback_sync_modesi_mmap_rwsemundo_listattribute_groupdma_poolspersonalityprintk_index_sizeuprobe_task_stateWB_REASON_BACKGROUNDstimestatic_priotmpfileattach_func_namedata_indqi_formatnvcsw_nr_pages_mappedfrequencyrtpoll_totaldev_pm_opspfmemallocblk_mq_ctxno_updateiter_typeDEVICE_PANEL_BOTTOMscsi_pkt_lockencap_hdr_csumtransporttmap_get_next_keyBPF_SK_REUSEPORT_SELECT_OR_MIGRATEnr_wakeupsquerybpf_prog_typeenabledki_filpmultiple_queueswork_func_tmemcg_vmstats_percpupp_magicfpu_state_permfwnode_reference_argsdevres_headused_maps_mutexRPM_REQ_IDLEfilenamebaseRPORT_ST_ADISCac_ppidd_prunerestore_noirqsysfs_registeredDumpedFramesrlockBPF_PROG_TYPE_SCHED_CLSi_rt_spc_warnlimitqueueBPF_PROG_TYPE_CGROUP_SOCKlibfc_host_allocnuma_migrate_retryMEMORY_DEVICE_COHERENTenclavefilterroot_blkgd_revalidateLPORT_ST_SCRWB_REASON_PERIODICcgrpwatermark_boosttracepoints_incoredqsi_opsubtree_controlquota_syncsrcu_have_cbsmemory_peaksInvalidTxWordCountasync_in_progresssignumdqi_dirty_listpi_lockdirtied_stamptm_donetimespec64BPF_WORKQUEUEscan_finishedlesb_sig_lossreplace_bpf_fdnr_forced_migrationsdst_mutexumount_beginchannelbadblocksnr_descendantsll_nodeport_idkernfs_nodecpumaskptrace_messagelengthtag_listbio_alloc_cachepdt_1f_for_no_luni_wb_frn_avg_timeBPF_LIST_HEAD_pincountreclaim_statecur_imageruntime_errori_sb__poll_tbpf_jit_poke_descriptorsubvolon_dispatchdirty_inodesymtabd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structfs_parameter_specrcu_data0real_blockedruntime_suspend__s16BPF_CGROUP_UNIX_GETPEERNAMEwifi_ackedbacktraceoffline_alreadys_umountn_nodeon_listcn_lost_creditmax_descendantsrefaultsdata_vmneeds_force_resumeblk_eh_timer_returnbtf_recordcsum_levelrpm_statusscsi_host_statedeferred_split_queue__s32childrenbpf_local_storage_map__mono_tc_offsetcheck_eventsmarkdqi_bgracei_wbhost_nof_inoderx_framesserialburstname_offpermissionsgraph_rootkernel_load_data_strcgroup_rootscsi_target_statehostmsi_device_dataslave_destroykallsymsmap_alloc_checki_ino_timelimitbi_issuebd_holder_opsBPF_KPTR_REFlink_idscgwb_frnsrcu_idxSTARGET_CREATEDutil_est__s64ipc_nshugetlb_usagebpf_cookiesect_attrssilence_suspendsrcu_size_statewrite_inodelast_queue_full_timei_rdevborkenacct_rss_mem1___orig_eipsrcu_datadevice_physical_locationcgtimebypass_spec_v1pagefault_disabledindexs_time_maxucount_maxdelayed_workprog_flagsopen_partitionssa_maskkswapd_lockmmappedElf64_Wordold_dom_cgrpjited_imageactive_timeatomic_flagsnum_jump_entriesextra_lenPIDTYPE_PGIDbtf_vmlinux_value_type_idmnt_namespaceelemwb_completionend_ioquotalensrcu_data_have_cbsnivcswoffdev_tidlinfo_idxmce_vaddrBPF_CGROUP_UNIX_GETSOCKNAMEdl_dev_stateshowrb_subtree_lasts_listBPF_MAP_TYPE_CGROUP_STORAGEhigh_workmq_pollsender_cpunr_segssame_target_siblingstailcall_targetof_match_tableBPF_PROG_TYPE_CGROUP_DEVICEfc_tm_flagsino_timelimitalternative_gpt_sectori_readcountblkcg_polsincrfreeseq_offloadrange_cyclicprog_cntlock_countthrotl_datalist_lru_onei_pagesmxcsrclass_rcu_is_conditionalarchdataptrace_entry__UNIQUE_ID___addressable_libfc_vport_create654uid_mapguest_permwait_queue_headnum_srcu_structsnr_activeprev_sum_exec_runtimei_flagsgendisku_flagstag_set_listlogical_block_sizesubtree_ss_maskinvalidate_lock_keyinfol1d_flush_killctx_outFC_VPORT_ACTIVEtimestampsrlimit_maxwrite_beginSHOST_CANCELbpf_prog_offloadwrite_infohrtimer_restarts_encoding_flagssessionids_time_minseq_ptrvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrbpf_iter_aux_infos_stack_depthnode_offsetkprobe_override__vm_flagsresid_lenqueue_depthbpf_tramp_imagecsum_offsetpm_messagememcg_lrufred_cschangedvportcur_ktimeinitfop_flags_tgroupsoffstty_structnotify_nextvirtual_dr6dma_opsdma_addressmmap_basebd_devsyscall_workinit_cmd_privelowbpf_trampolinelockdep_mapnum_trace_evals_addr_bndcgroup_base_statset_dbd_for_msnumberzone_device_dataquota_readloss_of_sync_counthlistpinned_vmfunc_cntwritepagesnuma_faults_localityqrwlockPTR_TO_FLOW_KEYSrw_semaphoreattach_bpf_fdfirst_minori_blockstask_fragWB_REASON_LAPTOP_TIMERsource_listsum_block_runtimeBPF_NETKIT_PRIMARYnuma_scan_period_maxtotal_timepowerfromnum_ei_funcsi_generationFC_FID_NONEfcp_input_requestsflushBPF_PROG_TYPE_PERF_EVENTtask_fd_querymg_dst_cgrponlinernid_ip_addrBPF_PROG_TYPE_RAW_TRACEPOINTno_vpd_sizeformatlast_switch_countlast_wakee__cloned_offsetswapuint32_tssize_tRQ_END_IO_NONEvtime_statetry_vpd_pagesparent_could_setfcapper_cpu_nodestats_blocksizequeue_numprevent_sleep_timeclass_spinlock_irqsave_try_is_conditionals_readonly_remounti_io_listrefaultedchild_countBPF_MAP_TYPE_ARRAY_OF_MAPSrelease_agent_workVTIME_IDLEBPF_PROG_TYPE_STRUCT_OPSwb_domaincgroup_subsysnbp_th_nr_candip_summedcompat_uptr_tcgwb_treeDEVICE_HORI_POS_LEFT_hugetlb_subpoolend_pfnuclamptgidlimits_lockreleasenr_wakeups_migrateserial_nrstack_vmi_fieldmaskupidBPF_CGROUP_INET_SOCK_CREATEprotection_supportkcompactd_highest_zoneidxfreeze_mutextrace_evalsia_vfsuidbtf_mod_pairquota_format_opsi_datarescue_listfsverity_infocore_threadclosidsched_avgRPORT_ST_PLOGIcodeBPF_LSM_CGROUPu64_stats_syncsyscorenr_reserved_highatomic__i_nlinkpmd_tinumli_invalid_tx_word_countsrcu_barrier_cpu_cntbatchedreadaheadopt_sectorsFC_VPORT_FABRIC_REJ_WWNhrtimer_cpu_baseirq_domainwait_liststatic_call_trampac_etimefsverity_operationscoublockbug_tablemigrate_modesecmarkusing_gplonly_symbolswb_listremovedhandleremulatednr_writeback_throttledsym_vvar_pagemembarrier_stateBPF_PROG_TYPE_LWT_INdma_pad_maskFC_FID_DIR_SERVBPF_KPTR_UNREFbin_sizercu_read_lock_nestingreg_typecb_accessrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_tio_bitmapDEVICE_VERT_POS_CENTERretry_countsbitmap_wordmanaged_pageslong unsigned intmax_timelast_queue_full_countread_file_infoexec_startia_sizeema_listRPM_RESUMINGunpinned_netfs_wbMODULE_STATE_COMINGsym___kernel_sigreturnZONE_DEVICEfunc_info_cntuser_cpus_ptruser_scand_opstate_initializedrelease_dquotplugsoftirq_activatedkey_sizeinv_weightsecuritykernel_symboldl_timerlockdep_map_pmodule_param_attrsdirty_ratelimitno_read_capacity_16scsi_host_template__user_state_sizechainedVTIME_GUESTretriessdtrsysvsemdisconnectstasheduser_xfeaturesdisc_mutexuse_memdelaynr_cached_objectshas_timeoutcgroup_namespacecommcallback_headhead_fragexception_table_entryin_hrtirqctl_table_set_overruncondhash_lenDEV_DMA_NON_COHERENTcoredumpd_sbio_lock_cls_keyksetsleep_maxmq_kobjxmm_spaceprobe_typenum_trace_eventsnodesysvshmno_highmemdata_outfirst_nfctSecondsSinceLastResetactive_countRPORT_ST_RTVnr_active_requests_shared_tagsnum_tracepointsvpd_pgb7ueventfc_pri_tasharednext_cpu_batchmemcg_completionsdisk_eventss_sysfs_namesigval_trqst_qFC_FID_CLOCKSDEV_QUIESCEmap_pop_elembitsbase_pfnclass_mutex_try_is_conditionalsem_undo_listcompat_rmtpclass_local_lock_is_conditionalstatic_key_trueno_fcs_stimeinsnsperf_event_ctxpprogsOutputBytescostxcomp_bvio_contextPIDTYPE_PIDwakee_flipsvlagufdsvlansegment_boundary_maskattach_tracing_progioctlprev_cputimectx_inbtf_flagshorizontal_positionem_perf_tablebi_crypt_contextprivateswp_entry_tcharFC_PORTSTATE_BYPASSEDmatchnr_failed_migrations_hotreg_offsetBPF_TRACE_KPROBE_MULTIqueue_stoppedsaved_dst_prog_typewrite_charbin_attrscpu_itimerdevres_lockfiles_structblk_zoneSDEV_RUNNINGicq_treePTR_TO_BTF_ID_OR_NULLvfsuid_tf_lockexec_vmkernel_parambtf_fieldget_lesbvertical_positionbtf_dtor_kfunc_tshutdown_prerelease_folioftrace_managedbi_io_vecvendor_idmtimearchrobust_listasync_probe_requestedthaw_earlyac_btimevectors_securitysplice_writeparam_lockreq_listi_opflagstot_write_bandwidthdentry_operationsstats_sectorss_blocksize_bitsexp_hintclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapsw_hash_head_2asym___kernel_vsyscallopen_mutexsk_buffcan_forklow_usageget_timeki_flagss_inode_wblist_lockFC_FID_FCTRLpermwriteback_inodesdestroy_worklockableuprobes_statemm_counttrace_overrunargsargvuclamp_reqswap_info_structs_qcopwb_tcand_bytesblk_mq_queue_mapFC_VPORT_INITIALIZING__kernel_long_tsrcu_usagefaultableperf_event_mutexfctsFC_FID_BCASTexit_hctxfc_xid_not_foundsync_modemap_gen_lookupin_execverlim_maxFC_PORTSTATE_MARGINALsimple_tagstarget_listmutex_lockVLinkFailureCountbpf_kfunc_btf_tabrtpoll_next_updatecoherent_dma_mask__data_lendriver_flagsscsi_residfile_ra_statek_sigaction_hugetlb_hwpoisoninsn_offshrinker_infocompletionslld_event_callbackreadahead_controlfwnode_operationsprocs_fileswait_queue_headmemory_typevm_userfaultfd_ctxTT_NONEmap_pagesBPF_PROG_TYPE_TRACEPOINTmod_tree_nodelocal_watermarkprobe_offsetxfer_ddpcmd_flagss_bdev_filerequest_queuedev_pagemaptarget_private_offsetRPORT_ST_INITcheck_quota_fileMEMORY_DEVICE_FS_DAXi_writecountdevice_typemax_segment_sizehiwater_rssunfreeze_fshost_eh_scheduledsoftirq_expires_nextnr_to_scanFAULT_FLAG_KILLABLErb_nodereturn_consumerround_robinksymi_private_dataroot_csetused_btfsptracer_credsrcu_barrier_headleadercheckTT_COMPATcap_effectivenetfilterexit_statefc_fcp_pktfaultscan_startprogs_hlistnuma_pages_migratedidr_nextsched_tagssupported_modefiltersnr_frozen_descendantssbitmap_queueno_cgroup_migrationsched_databpf_func_info_auxprintk_index_startindex_keybreserved_tags__bi_nr_segmentsLPORT_ST_FDMIforce_scanintervalavgs_lockbug_entryzswap_maxtimers_activenum_classesprotocolbpf_cgroup_storagevma_lock__fc_vport_setlinkrtpoll_untilkswapd_waitdl_throttledbpf_progseccompDEVICE_VERT_POS_UPPERrolesblk_holder_opsfprop_local_percpustatic_key_modextensionsfilter_countpsi_filesmknodnode_listmax_discard_sectorstuple_sizelatch_tree_nodecreate_work_queuerport_delete_workumode_tinitial_nsno_pmGRPQUOTAia_vfsgidioctx_locktimer_slack_nss_bdixarraycan_wakeuptime_namespacepdeath_signalexpected_attach_typedst_regnr_wakeups_idledqi_igraceqf_nextBPF_MAP_TYPE_LPM_TRIEmaple_treensproxyslave_dir_pkeyFC_TYPE_ELSucountsget_next_idDD_CLASS_TYPE_LEVEL_NUMhooknumwrite_syscallslistscore_relo_rec_sizerefcount_tslow_grocmd_lenDEVICE_PANEL_TOPmemtiermax_hw_discard_sectorsint32_txol_areadefault_lockguess_capacitysrcu_gp_mutexdebugfs_dirwakee_flip_decay_tsprio_listlast_timerequestblk_unique_idwpcopy_delay_totalSDEV_DELmax_payloadcontexthost_lockrwlock_tvm_fault_tskb_extuse_autosuspendclass_spinlock_irq_try_is_conditionalfc_disc_eventcfs_rqtree_reclaimedvirt_boundary_maskcgroupscore_occupationget_policycore_cookiepcrefrefcount_struct__kernel_ulong_tkf_opsfwnodeZONE_DMABPF_CGROUP_GETSOCKOPTcgroup_storagestatic_call_keycsum_startnamespaceparametersbtf_sizegroup_leaderdma_channelrunnable_avglookaheadiowait_countli_loss_of_signals_countshstkioac__kernel_clock_twas_resetgp_seqscsi_device_stateuuidmaj_fltWB_REASON_FORKER_THREADcached_requested_keyfp_flagsdqb_rsvspacemap_lookup_and_delete_batch__s8inode_operations__kernel_size_tdma_configurefile_leasepage_counterarg_flagsclass_local_lock_nested_bh_is_conditionalgpl_symsallowed_attachsrecursion_detectedpercpu_rw_semaphoresymbolic_namearch_spinlock_tseqcount_raw_spinlock_tbpf_iter_init_seq_priv_thighthread_pidmap_lookup_batchcss_idrrtpoll_min_periodemindl_non_contendinglso_maxcurr_ret_stackpgtable_t__u8q_usage_counterwakeirqi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyssdev_targetcore_forceidle_sumget_offset_ctxreleasedexport_operationsqc_stateget_budgetBLK_INTEGRITY_CSUM_IPmempool_smempool_timplicit_on_dflFC_PORTSTATE_LOOPBACKd_inodespecial_vecpageset_batchworkqueue_structBPF_MAP_TYPE_SOCKMAPi_lock_keyuevent_suppressgraveyard_linkbi_opfscsi_cmndfail_io_workfs_superscall_get_func_iptcp_tsorted_anchorwce_default_on__rcu_icq_cachecompact_cached_free_pfncap_ambientqstrtaskss_d_opBPF_MAP_TYPE_TASK_STORAGEno_report_lunsi_rcu__countFREEZE_HOLDER_KERNELinit_requestFC_PORTTYPE_NPORTio_optspanned_pagespcountbio_listwlockedrtpoll_trigger_lockdevicemodule_kobjectmap_releasePTR_TO_PACKET_METAmg_tasksBPF_TRACE_ITERpercpu_count_ptrnr_ia_rangesthawmap_update_batchlink_attach_flagstlbflush_unmap_batchremoveoffload_fwd_markbvec_iteroom_mmfcp_abort_iobpf_local_storagename_linkrnid_vend_idcompat_long_tcnivcswmap_freeInvalidCRCCountPTR_TO_SOCKET_OR_NULLshort intkswapd_highest_zoneidxtrc_reader_specialgtimedisk_events_disable_depththread_group_cputimertransport_headersizemigrate_to_ramUTASK_SSTEP_ACKloginuiddesc_structi_wb_lists_umount_keyquota_typenamecgrp_ancestor_storagespp_typesetleasebitmap_tagsmnt_rootBPF_MAP_TYPE_SK_STORAGEpsi_flagssighandbtf_key_type_idavgs_workaddr__rcu_headac_utimeFC_PORTSTATE_DELETEDksm_zero_pagesBPF_MAP_TYPE_LRU_PERCPU_HASHqueuedataprivate_dataBPF_MAP_TYPE_CPUMAPgid_mappageset_high_minfs_structnuma_nodedev_archdatanr_perf_statess_flagsrcu_nodeorig_pmdrb_rightclock_baseBPF_SK_REUSEPORT_SELECTclass_irq_is_conditionallaunder_foliowake_batchis_funcs_vfs_rename_mutexElf64_Xwordflockiter_createhandler_datavalue_type_btf_obj_fd__paddingoffline_waitqnr_reclaim_startstatus_codeio_lockdep_mapatomic_write_hw_boundarymap_nr_maxiowait_sumdescriptionfolio_batchbi_nextblk_status_tUSRQUOTABPF_CGROUP_ITER_SELF_ONLYdriver_privatecore_relospm_onlyd_rt_spc_warnsset_read_onlypgmapactive_refmap_owner_storage_ptrhctx_tablefc_xid_busykernfs_open_filelowmem_reserves_iflagsprintednr_hw_queuesstate_mutexallowed_mapsctx_arg_infoinner_network_headerlast_queue_full_depthBPF_PROG_TYPE_SK_LOOKUPcid_worki_versionswap_deactivatesr_lockattachclass_rwsem_read_is_conditionalqueue_limitsunitil_weightstarved_listdma_parmsbdi_idKOBJ_NS_TYPEStstampcmin_fltchunksarch_uprobe_tasklicensewrite_protect_seqclearedkobj_ns_type_operationsshutdownevent_countsched_statisticslru_lock__kernel_uid32_tnode_zonelistsallocb_attachedorig_pterq_timeoutkeysinit_nameper_cpu_zonestattc_indexfile_lockstatfsrw_semswappinessdevice_privatevm_policydl_deadlineLPORT_ST_RSNN_NNtracepoint_extclass_mutex_is_conditionalfpregs_statememcg_datadqb_curinodesBPF_XDPfileattr_seteh_actionac_tgetimeRPORT_EV_NONEpage_linkno_write_samebtf_log_sizedn_timeoutDEVICE_PANEL_UNKNOWNFC_VPORT_FABRIC_LOGOUTPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursionsoft_resetmce_ripvDL_DEV_NO_DRIVERbpf_arenafree_after_mult_rcu_gpret_stacknbp_rl_nr_candreal_timeri_privateextended_state_areanum_kprobe_blacklistaccessmap_seq_show_elemfp_resvdsubdirscgroup_freezer_statemlock_countBPF_PROG_TYPE_LWT_SEG6LOCALget_next_child_nodemempolicyfc_rportcacheline_padding_bandfd_arraypollfdblinding_requestedlaptop_mode_wb_timerdev_tplatform_dataf_refprev_posenv_endfileattrs_subtypeusage_countpr_opsstate_in_sysfsdqb_ihardlimitunlocked_ioctluprobebd_mappingkmem_cachenuma_next_scanLPORT_ST_FLOGIbudget_mapbsg_devsrcu_last_gp_endxfer_lentnodeclass_local_lock_irq_is_conditionalpage_listinner_ipprotoproperty_read_int_arraywdtrmq_rq_stateholders_dirMODULE_STATE_UNFORMEDst_valuelist_headptrace_bpsfc_port_states_user_nscan_attachhost_attrsmap_lookup_elem_sys_onlytagset_refcntqueuecommand_may_blockmin_usagearch_tlbflush_unmap_batchquick_threadsdefer_syncBPF_TASK_ITER_TIDmissedfc_no_free_exch_xidusernsndisc_nodetypeBPF_UPTRvlan_allBPF_PROG_TYPE_CGROUP_SKBsum_sleep_runtimecleanup_rqd_spc_timerd_ino_hardlimitchange_cookiebi_statuscss_allocdl_periods_dquotErrorFramesfsnotify_sb_infomap_fd_get_ptrrecent_cida_opsftrace_opsprocnamepad_untilmap_redirectperf_event_listinterval_expinsnBPF_CGROUP_UDP4_SENDMSGrstat_css_listvm_node_stat_difftagski_completepgprotrnid_node_mgmtread_syscallstimespec_typebd_devicevmstatsdquot_operationsposix_cputimers_workgsbase__lruvecBPF_CGROUP_INET_EGRESScompact_delay_totalio_tlb_memseq_showcpusfilesinblockbd_claimingtails_magiccontainersnuma_faultsmem_dqblktarget_ifindexnos_countstgt_delete_workstatusBPF_PROG_TYPE_CGROUP_SOCKOPTWRITE_LIFE_NONEread_countlink_speedBPF_CGROUP_INET6_CONNECTlport_listHRTIMER_NORESTARTscsi_privlast_update_timesas_ss_spold_map_fddisc_startpanelac_padfc_rport_operationswatermarknode_start_pfnmax_allowed_capacityfc_statsopen_moderead_posclass_cpus_read_lock_is_conditionalmg_dst_preload_nodecpu_run_real_totalD_REAL_METADATAgpl_crcstimes_prevclass_raw_spinlock_try_is_conditionalkiocbmg_nodeexecute_only_pkeyreturn_instancesma_lockblk_mq_queue_datacss_offlineattach_btf_tracedockcpuset_mem_spread_rotorsync_fssecurebitswb_tcand_idFC_PORTTYPE_OTHERdentrysequential_iowait_pidfdprli_countcdb_statusInputRequestss_writersgroup_stop_countavg_next_updateswap_lockvm_opswb_reasonpartial_bufread_before_msget_unmapped_areamkobjsym_VDSO32_NOTE_MASKfrozenactive_uprobeunregisteringget_parentmin_vruntimestoragesdebug_dirhost_resetfc_els_rnid_genclass_disable_irq_is_conditionalnew_statesyscrnr_mapssyscwsync_ionum_bpf_raw_eventswork_qorig_nentski_pose_csetsavx512_timestampend_io_datae_freezeBPF_GRAPH_ROOTfree_cached_objectstaints_Boolmax_tp_accessxol_vaddrb_dirtylist_lru_nodeuclamp_ses_time_granvm_statblk_integritykuid_tdev_pm_qosbd_holdersper_cpu_zonestats_sifieldstaskBPF_CGROUP_INET6_BINDresetsched_reset_on_forkcompound_headnr_retriesshost_privwake_irqbranchi_cdevfunc_infoi_fsnotify_marksin_thrashingdl_deferBPF_MODIFY_RETURNvpd_pg80waitersvpd_pg83vm_startvpd_pg89mprotectquota_ond_automountDEVICE_REMOVABLE_NOT_SUPPORTEDrnid_gencsum_not_inetctl_table_headeratimeget_ownershipf_task_workmy_qfc_lport_stateBPF_SK_SKB_STREAM_VERDICTeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionalFC_TYPE_FCPsectorinner_mac_headers_wb_errflush_listattach_prog_fdcloseiopl_warnelevator_queueptraced__MAX_BPF_MAP_TYPEdonesym___kernel_rt_sigreturnsrcu_struct_ptrsskip_ms_page_3fbinfmt_miscinodesencapsulationmemcg_awarezonehost_waitFC_PORTSTATE_LINKDOWNmanage_shutdownac_schedqsize_t__fpstatemap_poke_trackBPF_MAP_TYPE_SOCKHASHqf_ownersuspend_noirqd_inamePTR_TO_MAP_VALUEbi_flags__UNIQUE_ID___addressable_fc_vport_setlink656links_countprealloc_pterdevd_ino_countarg_lockscsi_host_allocclass_rcu_tasks_trace_is_conditionalDEVICE_REMOVABLE_UNKNOWNdoes_npivignore_childrenpoint_to_multipointframe_sendBPF_CGROUP_UDP6_RECVMSGdirty_exceededfreeze_fsin_eventfdresume_earlymax_dev_sectorsdup_xol_workalimititemsooo_okaynuma_groupblk_independent_access_rangeskmap_ctrlfscrypt_operationsrangesevents_lockfs_contextmnt_idBPF_CGROUP_INET6_POST_BINDretry_hwerrordrop_inodeBPF_MAP_TYPE_REUSEPORT_SOCKARRAYk_lockorc_unwindgraph_get_next_endpointfrom_ingresslast_sector_bugmq_mapprojid_map__UNIQUE_ID___addressable_fc_vport_id_lookup655kprojid_t__u16PTR_TO_XDP_SOCKsaved_end_ioBPF_MAP_TYPE_STACKsyscall_dispatchdl_densityon_rqlru_gen_mm_walkaltmapmin_perf_statercu_tasks_exit_listlro_xidsp_regdma_drain_buflast_resets_master_keysflagsbd_holder_locknr_threadsvm_mm__u32query_flagsmax_secure_erase_sectorsenable_statss_quota_typesvm_lockswapin_countdisc_stop_final_ddebugFAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitrcuwaitoffload_l3_fwd_markdelayskcompactd_max_ordermnt_nstimerqueue_headBLK_INTEGRITY_CSUM_CRCsdev_groupskioctx_tablepriorityksm_rmap_itemsclass_read_lock_is_conditional__u64revoked_at_folio_nr_pagesfcp_packet_abortswritepageis_dirty_writebackpkey_allocation_mapLPORT_ST_DHBAdq_iddisable_depthem_perf_statethread_shstkTxWordsposix_timerswait_chldexitTxFramessas_ss_flagsunreadableunmap_limit_for_wspresent_early_pagesgpl_compatibleinsn_idxPTR_TO_MEMbi_itersrcu_cblist_invokingiopollcsum_complete_swline_coliov_lenlatency_recordfc_lportdirty_limit_tstampsector_sizeskb_mstamp_ns__BPF_REG_TYPE_LIMITd_releaseavg_totaldev_dma_attrBPF_NETKIT_PEERzswap_writebackexpiresnuma_scan_seqmnt_sbblkcg_csshashnodemask_tref_cntsize_poke_tabsignalfd_wqhhang_detecteddevice_driverlast_zone_capacitystatisticsfsindexout_batchraw_spinlock_ts_cops_activenum_argspidlist_mutextag_sizeBPF_MAP_TYPE_PERCPU_HASHlast_old_flushs_uuidclear_child_tidruntime_statusdqb_btimedq_opBPF_MAP_TYPE_DEVMAPshow_pathdl_serverVTIME_USERquota_disablesched_delayedsrcu_gp_seq_neededtask_structtimer_delaycurrent_may_mountpushpeaks_lockbpffs_fdpath_fdis_noirq_suspendedfwnode_endpointPTR_TO_TP_BUFFERcounterunique_idsuspendsupported_eventsoom_score_adj_minlast_bdp_sleepzone_wplugs_poolzone_typedomain_datacopy_file_rangesrcu_gp_startreport_zones_cbxa_flagsattach_btf_idlru_gen_foliobtf_idbpf_insntv_nsec__fc_linkupmax_zone_append_sectorssas_ss_sizeeh_eflagss_inode_list_lockUTASK_SSTEPraw_tracepointehandlerdq_sbexpecting_lun_changescsi_targets_mountselem_flagsBLK_EH_DONEvm_stat_diffsym_pvclock_pageswapin_delay_totalfree_listBPF_CGROUP_UDP6_SENDMSGpage_fraginfo_lenrun_workfsuidRPM_REQ_AUTOSUSPENDsrcversionlist_add_tailtrace_event_callwakeup_sourceis_partially_uptodatehost_faileddl_runtimemay_splitio_uring_cmdprogs_cntread_dqblkpeekedrtpoll_nr_triggerssrcu_parentinit_seq_privatebi_cookiesuppliersfile_operationsRxFramesbpf_ctx_arg_auxblist_flags_tmanufacturerpagesizepart_tblselfdirect_completexsavekernel_siginfo_tdquotLPORT_ST_RESETis_preparedpgprotval_tmemorytrc_holdout_listasync_suspendq_nodezone_pgdatclass_mutex_intr_is_conditionalstrtabpage_freeftopdepends_onHPROBE_CONSUMEDi_mmapnr_cgrpsdirty_paused_whenirq_getcss_resetcapacitymax_channelversionlink_failure_countget_reference_argsllisthiwater_vmmax_perf_statebi_idxcookiesfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntInputBytesrseqattach_typetarget_knlimit0limit1pi_blocked_onpid_tac_exe_inodevmemmap_shiftbpf_attach_typeusage__kernel_time64_trq_qos_mutexkernel_read_file_strscsi_data_buffercapabilitiesi_securitydevice_physical_location_panellimitsq_lock_cls_keyenvpactive_memcg__targetsElf64_Halfallow_reinittimer_autosuspendsratelimitSHOST_DELslave_configurestat_threshold_softexpiresautosuspend_delayline_info_rec_size_zonerefsi_flctxFC_PORTSTATE_ONLINEli_invalid_crc_countlist_lockvm_faultip_epilogueoptimistic_spin_queuepermissionbpf_prog_array_itemtransport_containerpreallocreap_refDEVICE_FIXEDlast_statusfdmi_enabledSCSI_EH_NOT_HANDLEDSDEV_OFFLINExfeaturesrq_flagsslice_maxmap_namebi_max_vecsthaw_noirqsched_debugfs_diraccounting_timestampcan_matchtime_archcmd_sizechunk_sectorshlist_bl_headqc_dqblkLPORT_ST_RFT_IDcalledpasid_activatedancestorsmap_fd_sys_lookup_elembvec_integrity_poolBPF_XDP_DEVMAParch_datashrink_controlegidthreaded_csetsmax_rdonly_accessmap_direct_value_addrnet_deviceenvp_idxcrypto_kobjectcdb_cmdf_modetagged_supportedoffloadsvpd_pgb0vpd_pgb1vpd_pgb2ff_type_mapzone_idxfolioruntime_autopref_node_forklru_zone_sizeclassipc_namespaceBPF_SK_SKB_VERDICTarenaprev_scan_seqfc_dl_perfpsi_group_cpuwait_queue_head_talloc_hinttask_cputimeFAULT_FLAG_INSTRUCTIONdeferred_splituser_nsfc_cdbnohdrclass_raw_spinlock_irqsave_is_conditionalsyms_flagscgwb_release_mutexFC_PORTTYPE_NPIVsyncmq_freeze_locksg_prot_tablesized_childrenucountmap_local_storage_unchargectl_table_sizebpf_map_opsfc_rport_identifierseh_host_reset_handlerddebug_class_mapdfl_cftypesprealloc_bufaudit_contextfl_owner_tipi_listBPF_MAP_TYPE_DEVMAP_HASHpersistent_keyring_registeri_piped_waitllist_headsense_buffernr_phys_segmentstask_itersnode_spanned_pagesavg_refaultedwait_page_queuecn_credit_stallbpf_line_infoBPF_SK_MSG_VERDICTFAULT_FLAG_REMOTEdl_bwhierarchy_idunaccepted_pagesi_dir_seqignore_dfheaderwatchdog_stampstate_startlist_op_pendingdatasrcu_cb_mutexsysfs_lockBPF_CGROUP_UNIX_CONNECTallowed_progsno_callbackssaved_trap_nrclock_listbpf_func_infofolioq_slotMODULE_STATE_GOINGxattr_handlerac_utimescaledrqos_debugfs_dirprot_sdbidr_baseunlock_native_capacityclass_preempt_notrace_is_conditionaldqb_bhardlimittag_list_locknextentseventkeytypeMissDiscAdvCount__kernel_gid32_tevicteddev_pm_domainnentsstart_time_nsuaddr2f_securityprot_opdefparamdiscard_granularityiotmo_cntclass_raw_spinlock_irq_is_conditionalFC_PORTSTATE_BLOCKED__bi_cntstate_remove_uevent_sentattributes_maskcloneddl_defer_runningnpiv_enabledlru_gen_mm_listqueuecommandevents_filetagged_writepagesia_validsrculog_bufreq_flagsiorequest_cntsrcu_size_jiffiesclassesstatic_call_sitecputimeis_seenupdated_nextsrcu_unlock_countma_rootbi_vcntregfuncerror_remove_foliodevice_is_availabled_rt_spc_hardlimitmap_fdrchari_verity_info_addr_pkeyfpin_statsrw_copybi_iocost_costcpuhp_deadmax_discard_segmentsbd_fsfreeze_countBPF_PROG_TYPE_XDPbpf_ksymSTARGET_RUNNINGFC_SOF_C4atomic_opennapi_idload_time__mptrsigactionrlimbtf_token_fdmce_addrf_freeptrBPF_MAP_TYPE_CGROUP_ARRAY__sighandler_tclass_spinlock_try_is_conditionalzone_write_granularitybd_meta_infoDD_CLASS_TYPE_DISJOINT_NAMESlrugenmax_target_blockedfs_flagsvm_filei_countuser_structmap_idaddress_space_operationsFAULT_FLAG_USERkey_perm_tused_btf_cntbtf_log_bufeh_strategy_handlertimer_listverifier_zextmemory_eventscgwb_listrun_delaynum_ftrace_callsiteschange_queue_depthsrcu_cblistoffload_requestedblk_independent_access_rangeavg_write_bandwidthtlb_ubcpgtables_bytesi_lruGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackFC_FID_MCAST_SERVtrc_ipi_to_cpuscsi_luncss_onlinePTR_TO_FUNCmemory_events_localallow_restartmin_slicedecryptedcommit_rqssysfs_opsinq_periph_qualcore_relo_cntFcpPktAbortsatomic_write_hw_unit_maxFC_SOF_I2cmaj_fltFC_SOF_I4bio_integrity_poolnf_tracekparam_arrayFcpFrameAllocFailspercpu_refevict_inodeignore_media_changertpoll_statesthread_keyringmap_nrcgroup_nscpumask_trstat_css_noderb_leftRPORT_ST_DELETEgfp_maskdma_addr_tinactive_timerattributeinner_protocolinit_hctxperiod_timemm_lock_seqkernfs_elem_symlinkBLK_UID_T10wb_lcand_id__kernel_dev_tcrypt_keyslotprog_namepm_domainBPF_CGROUP_INET4_BINDmax_rdwr_accessmax_prop_fracfsgidsector_tcompact_cached_migrate_pfnnode_name_sys_privatesignal_structactive_mmFC_SOF_N2FC_SOF_N3FC_SOF_N4kernfs_iattrsshow_devnamecn_oversubscriptionthread_infoi_mmap_writabledata_size_outattach_btf_obj_fdreadr_a_tovvalue_recsecondarydevicesatomic_write_max_sectorsgroup_exit_codetx_framesopc1value_btf_idn_portexec_maxsync_statedev_groupsuts_namespacefcloneDMA_FROM_DEVICEzone_start_pfnvalue_sizekernfs_elem_dirport_namepercpu_counterDMA_BIDIRECTIONALcgroup_subsys_statesequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startUTASK_RUNNINGopenseglenBPF_MAP_TYPE_QUEUEconfirm_switch__kernel_ssize_tvdso_imagesi_signounused_hctx_lockrseq_sigresultrefsdelayed_calltime_slicefunc_info_rec_sizenr_rangemax_seqbtf_func_modelspc_timelimituid_gid_mapnr_freeresumeset_ownershipbpf_iter_task_typeFC_PORTSTATE_NOTPRESENTregsbi_write_hintrq_nextsyscall_user_dispatchshort_inquiryattrd_aliasis_suspendedseq_priv_sizerp_mutexrestore_sigmaskrequeue_lockevent_worknr_deferredmem_cgroup_idsrcu_sspi_lockuser_event_mmbtrace_seqs_devsiblingcdl_supportedia_rangetarget_sizemap_lookup_elemldt_usr_semrec_dataposix_cputimerslink_supported_speedstry_rc_10_firstRPM_INVALIDdd_datafreeze_kcountrequest_key_authblockspercpu_ref_datad_spc_warnssrcu_supnbp_thresholdfreeptr_tLPORT_ST_DPRTns_typeRPM_REQ_NONEprog_btf_fdforce_runtime_start_on_system_startsg_timeoutixolfasyncarg_startLPORT_ST_DISABLEDkprobes_text_sizekfunc_tabblk_crypto_profilefop_flagswork_lock_addr_lsb_addrpfn_mkwritentimeuaddrrtpoll_waitBPF_STRUCT_OPSfunc_proto_unreliableioerr_cnt_uidmm_states_fs_infomm_stats__rb_parent_colorWRITE_LIFE_EXTREMEicq_list__MAX_NR_ZONESmm_users_pp_mapping_padimagekey_serial_tno_uld_attachfolioqfoliosshost_groupssiblingscputimernrpageswake_q_nodeFC_PORTTYPE_NOTPRESENTblk_flags_tmap_fd_put_ptrs_maxbyteshd_geometryioctx_tabledma_io_tlb_memfc_cmdrefeh_cmd_qfree_after_rcu_gpget_unique_idexpire_countcompact_init_migrate_pfnfor_syncwake_cpujited_lenPTR_TO_SOCKETlinfobio_splitfreeze_supertick_dep_maskvmpressurelruvecmap_check_btfiter_infoqc_infoobjcg_listfault_flaglist_is_headmodnameia_ctimeperf_rdpmc_allowedFC_VPORT_NO_FABRIC_RSCStrace_eval_mapcompact_defer_shiftorig_objcgasync_put_workresvnum_static_call_sitesZONE_MOVABLEl4_hashvm_lock_seqroot_listBPF_TRACE_FENTRYElf64_Addrwait_queue_entry_tseqlock_tlatency_record_countnr_integrity_segmentshost_blockedmay_skip_resumeprot_flagsVTIME_SYSbase0base1base2SHOST_CREATEDbio_setCONST_PTR_TO_DYNPTRBPF_MAP_TYPE_RINGBUFalignment_offsetlinksbasesfutex_staterseq_lenkobj_completionlesb_inv_wordi_spc_timelimitf_opnargsbindcpuhp_onlineproc_ns_operationsold_prog_fdBPF_PROG_TYPE_SK_REUSEPORTmm_mtgid_trelease_workSDEV_CREATEDavg_nr_triggersno_report_opcodesBPF_PROG_TYPE_LWT_OUTrcu_read_unlock_specialBPF_CGROUP_UNIX_RECVMSGtls_arrayipvs_propertytask_io_accountingcss_rstat_flushf_raDEVICE_PANEL_FRONTmodule_memorynetkitsitescompat_robust_list_headcss_releasedthread_nodestatic_call_mods_shrinkgp_countRxWordsnr_sectorsbpf_raw_eventsiommutimer_expiresbpf_storagekset_uevent_opsf_ownerqfull__state_permDEVICE_PANEL_BACKmax_retry_countoffsetswb_switch_rwsemdisc_syscalldiskSHOST_DEL_RECOVERYjit_requestedsrcu_lock_counttrc_blkd_cpugp_waitiommu_mmfuncio_uring_taskshared_tagsrepeatjit_keyringLinkFailureCounts_fsnotify_infofunctionlinkagedisc_recv_reqBPF_PROG_TYPE_CGROUP_SOCK_ADDRprojidvn_portmce_kill_mema_external_lockpid_linksconv_zones_bitmapscsi_target_ids_dio_done_wqRPORT_EV_FAILEDfor_kupdaternid_ip_verstart_all_reasonhlist_head_pad3_ioc_nodethrottle_diskbin_attrs_newmax_hw_zone_append_sectorsresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACErunningrw_hintblk_integrity_checksumdestroy_rworkdma_skip_syncpartition_meta_infotstamp_type_accessDEVICE_VERT_POS_LOWERBPF_CGROUP_ITER_ANCESTORS_UPnr_dying_subsysfc_well_known_fidclass_spinlock_irqsave_is_conditionalutf8datahlist_nulls_headrequeue_workof_node_reuseddyndbg_infoElf64_Symreclaim_waitsaved_errd_rt_spc_softlimitpollfree_file_infoin_lru_faultsched_contributes_to_loadtlb_genruntime_idlemap_counthost_scribblei_rt_spc_timelimitqc_type_states_dentry_lruac_comms_bdevskip_vpd_pagescrcssense_lenrun_listuevent_opsabort_workmax_cmd_lenbpf_func_statebpf_reg_typesched_classret_sizeutil_avganon_vmaFC_VPORT_LINKDOWNdevice_private_offset_pidsigcntDD_CLASS_TYPE_LEVEL_NAMEShas_callchain_buftailcall_target_stablebpf_cgrp_storagemodinfo_attrsst_spaceclass_map_typekparam_stringd_real_typemaxrsscredBPF_MAP_TYPE_ARRAYkernfs_open_nodef_wb_errmm_cid_activemodule_sect_attrsreq_flags_truntime_resumeac_stimescaledgroup_exec_taskrestrict_linkirq_countget_inode_usageFC_TYPE_IPxarray_startbpf_ctxpm_domain_databw_dworkattach_btfmap_lookup_and_delete_elemload_avgrecordi_private_lockget_dqblktail_callmq_listrnid_phys_portphysical_block_sizepgoffportnetdevBPF_LIST_NODEdefault_setmodelfreeze_latemf_statsZONE_NORMALcount_objectsvma_numab_statedma_map_opsdq_dirtylnodemax_lunexit_cmd_privfd_typeatomic_write_boundary_sectorsboot_timewpcopy_countmax_queue_depthwrite_byteseh_entryDISC_EV_FAILEDpending_eventsoom_reaper_listnumab_statefutex_offsetbpf_fdsubsys_fmt_prefixdq_lockintegritypte_tnr_scanned__stateBPF_MAP_TYPE_UNSPECpriv_sizenr_iosk_listn_io_portslicecgroupdrv_groupstrack_queue_depthtruesizecustom_sliceper_cpu_pagesstart_idbdi_listmq_freeze_depthpadding1RPORT_ST_READYnestedatomic_write_segments_maxinsn_cntmap_set_for_each_callback_argsnr_dirtied_pausequeue_kobjdst_progreal_addressbd_holder_dirac_tgidinvalidate_locknum_exentriesfcp_cmd_sendfix_capacitycss_local_stat_showio_portvport_last_stateblk_mode_tpmdval_thost_tagsetBPF_GRAPH_NODEkveceh_noresumefree_areaset_latency_tolerancedepthd_ino_timerprobenetlink_nsnr_argstokendev_ueventfc_vportdep_mappage_mkwritelast_busyvm_flags_toffloadnregnr_failed_migrations_affinelro_enabledd_in_lookup_hashdom_csetptrace_dr7SUBMITTED_BY_SCSI_ERROR_HANDLERreschedule_countmax_hang_timeFC_PORTSTATE_UNKNOWNcmd_per_lunopt_failedcdl_enablecutimelockrefnew_map_fdmap_meta_equaltlb_flush_batcheddev_privia_uidautogroupsequencercu_syncarg_endclass_spinlock_irq_is_conditional_dummy_pkeyvruntimehostdataBPF_CGROUP_ITER_DESCENDANTS_POSTscannedSCALAR_VALUEnr_extentsstart_stop_pwr_condpidlistsWB_REASON_VMSCANfeatures_locked__kernel_pid_tdev_statedevice_blockedfile_flagsPIDTYPE_SIDcinblockdma_alignmentprot_typeBPF_TCX_INGRESS__kernel_loff_tset_performance_stateserial_nodelru_gen_mm_statenotify_countsrc_regupdated_childrenspin_lock_offBPF_CGROUP_SYSCTLsingle_lunhprobesg_reserved_sizeswap_activatedqb_isoftlimitsaved_auxvnoinstr_text_sizedl_overrunfc_no_free_exchiattrdetachedloff_toom_flag_originfreepages_delay_totaldesc_lendma_devoom_score_adjwb_waitqSHOST_RECOVERYrq_end_io_fnksm_merging_pagestest_runDISC_EV_SUCCESSlport_set_port_idgraph_parse_endpointrmidptp_rdatalist_lrudevice_removablefc_seq_not_foundfxsavedev_pagemap_opsbv_offsetBPF_MAP_TYPE_XSKMAPset_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETd_lockrefbtf_typenr_populated_domain_childrenSCSI_EH_DONEsession_keyringshost_devbtf_log_true_sized_deleteuts_nsd_ino_softlimitd_weak_revalidatealloc_time_nsi_devicesFC_PORTSTATE_ERRORdqb_curspaceBPF_TRACE_KPROBE_SESSIONalloc_lockearly_inittotal_numa_faultswritable_sizemax_segmentsdma_need_drainobj_cgroupem_tableBPF_PROG_TYPE_TRACINGmq_sysfs_init_doneactive_queuescompact_considered__lstatepercpu_drift_mark__BPF_REG_TYPE_MAXinodesubtree_bstatbd_fsfreeze_mutexhrtimeratomic_write_unit_maxFAULT_FLAG_UNSHARELossOfSignalCountlocal_fwnodetask_sizemust_resumeRPM_ACTIVEend_codePTR_TO_SOCK_COMMON_OR_NULLuintnr_free_highatomicpreempt_notifierstlb_flush_pendingmigration_flagsDEVICE_PANEL_RIGHTfast_io_fail_tmotx_wordscap_inheritablebpf_cgroup_iter_orderkobj_sigvaleh_timeoutwritecntBPF_KPTR_PERCPUsrcu_n_exp_nodelayin_batchseqcount_spinlock_textra1extra2write_s64graph_get_remote_endpoints_rootstree_scanned__int128 unsignedverifiedcpu_countcgroup_rstat_cpuevent_callbackwb_lcand_byteswait_sumuprobe_xol_opssg_suppmin_align_masknextevtthis_idrcu_segcblistread_s64reported_split_lockreturn_instancewait_countnr_wakeups_affine_attemptspud_ti_ino_warnlimitmax_open_zonesrmtpnext_offsetFC_PORTTYPE_LPORTio_statuslp_mutexblindedacpi_device_iddev_scratchctx_idutaskpoweroff_noirqactive_modesdev_datais_bin_visibleset_rq_budget_tokeniodone_cntcompat_ioctls_countnr_wakeups_affinefutexauprobeMQ_RQ_IN_FLIGHTperiod_contribnr_hangsSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcss_setfwnode_handlegfp_ttypeqf_fmt_idlink_updatepagepageset_high_maxatomic_write_unit_minsleep_startmap_mem_usagememalloc_noiobegintypetabuse_192_bytes_for_3fnr_reserved_tagsBPF_PROG_TYPE_RAW_TRACEPOINT_WRITABLEi_crypt_infoFC_TYPE_NVMEretry_workDEVICE_HORI_POS_CENTERio_start_time_nsaudit_ttyrecov_retrybatch_sizedns_rdatanr_zonesmutex_unlockjobctlsi_errnonr_leaves_on_treequeue_ctxmin_shallow_depthfc_seq_sigchlddqb_itimeHPROBE_STABLEquota_format_typebio_crypt_ctxpercpu_ref_func_tpm_message_tsplit_queueac_memBPF_CGROUP_INET4_POST_BINDpprevlip_countino_warnlimitremcsum_offloadexception_boundarybroken_fuabpf_iter_seq_infozone_wplugs_lockmnt_flagsac_stimemem_cgroup_reclaim_iterrange_endlast_mergememcg_nr_pages_over_highsw_reservedbpf_tokenwbt_flagsbpf_iter_fini_seq_priv_tcss_freecpu_delay_totalobjcgno_read_disc_infoblock_startvm_area_structnum_gpl_symsselect_no_atn__compiletime_assert_0__compiletime_assert_1__compiletime_assert_2BPF_CGROUP_INET6_GETPEERNAMEis_extendednr_charged_byteslong long unsigned intWRITE_LIFE_MEDIUMBPF_MAP_TYPE_CGRP_STORAGEtmf_in_progressnext_addrSDEV_CREATED_BLOCKhuge_faulti_fopautasklast_task_numa_placementrnid_prot_portip_after_callrefcntfreeze_holderpsi_groupcdevperf_eventunregfuncoom_groupseqcountBPF_XDP_CPUMAPclass_idbitsetallowed_cmdsbtf_field_typeinquiry_mutexcan_swapof_device_iddisk_statsmanage_runtime_start_stopclass_migrate_is_conditionalnetwork_headermin_ratioclass_write_lock_is_conditionals_xattrpart__pkt_type_offsetb_dirty_timeli_loss_of_sync_countBLK_EH_RESET_TIMERil_prevPTR_TO_SOCK_COMMONd_initget_name_prefixused_mapsspan_seqlockfc_soffileattr_getthreaded_csets_nodeclass_groupsSDEV_TRANSPORT_OFFLINE__call_single_nodeunicode_mappathhigh_maxrstat_cpurecent_used_cpuruntimeold_time32_tsocket_pressureenforce_expected_attach_type__state_sizeBPF_CGROUP_INET6_GETSOCKNAMEvportsunsigned intsbitmapclass_irqsave_is_conditionalcore_kallsymsscsi_devices_fsnotify_maskscan_objectsbi_privatewb_idDD_CLASS_TYPE_DISJOINT_BITSevent_liststartupkeyring_index_keyiov_iterd_rcustatic_key_falseuintptr_twake_entryrcu_tasks_holdoutfreezefprop_globalassoc_array_ptrbatchcacheBPF_TRACE_RAW_TPold_timespec32rcu_blocked_nodejiffies_at_allocfunc_idxfcp_frame_alloc_failuressubsys_datast_namegroup_nodei_mtime_secbus_dma_regionrp_statestatic_rqsstarget_sdev_userac_majfltdn_device_specificmce_kflagsscheduledbus_dma_limitubufbtimeia_gidmigrate_foliohigh_minrq_listextable_baselibfc_vport_createblksizenum_symssrcu_gp_seqmin_nrnext_posix_timer_idmq_ops_mapcounti_atime_secstarttimefile_costreschedule_jiffieshprobe_statei_sb_listquota_offmap_poke_runmap_delete_batchshm_clistmap_delete_elemwait_for_compcb_headpages_skippedzone_wplugs_hash_bitspi_offsetac_flagpt_regsmmap_missexpires_nextblk_opf_treport_zoneskeyring_name_listnum_trace_bprintk_fmtiter_seq_infosubsys_maskcdrom_device_infolruvec_stats_percpuaccess_statebpf_prog_statssdev_gendevwork_structtruelast_queuedreverseri_timernr_populated_threaded_childrenpipe_bufsavg_last_updatebp_offsetswap_events_fileprotectedbsyncrequestedsaved_scratch_registertracepoints_ptrsfcp_cleanupwifi_acked_validblock_maxstatic_keyqueue_rqsdev_boundlibfc_function_templatecsum_validFAULT_FLAG_VMA_LOCKtotalreserve_pageskswapd_orderdma_range_mapvaluesKOBJ_NS_TYPE_NONEctl_table_pollmin_slab_pages_dataFAULT_FLAG_WRITEshow_optionswait_queue_entryexpirei_uidtagset_freedmax_sectorsexpiryperiodbmaprescue_workqueuerx_wordsmap_allocdispatch_wait_lockscsi_levelfsaveBPF_TRACE_UPROBE_SESSIONi_write_hintsuspended_timeread_byteszone_wplugs_worksum_sched_runtimes_writers_keySYSCTL_TABLE_TYPE_DEFAULTbpf_callback_tRPORT_EV_READYstart_boottimetimer_offentriesi_modecap_permittedfc_rport_priv_flags_2aBLK_UID_NAAstart_coderet_flagsvm_flagststamp_typesi_codeseqcount_spinlockBPF_PERF_EVENTheadHPROBE_GONElast_siginfosched_rt_entityFAULT_FLAG_TRIEDorig_axs_encodingexit_signalmax_user_sectorsdworkdevice_dma_parametersdir_contextsaved_dst_attach_typeiopl_emulconsumersratelimit_statepower_statedq_flagsis_late_suspendedfieldsswap_plugcapture_controlPTR_TO_MAP_VALUE_OR_NULLoffline_nodequeue_offsetclass_device_is_conditionalnon_rcuput_superwrite_endshostbpf_exception_cbxdp_has_fragsdebugfs_mutexsuspend_timerdumperunix_inflighterror_injection_entryrss_statctx_arg_info_sizeddp_setupjitedopen_flagslegacy_namemap_lookup_percpu_elemFAULT_FLAG_INTERRUPTIBLEmap_token_fds_inodes_wbvport_delete_worksubsysfolio_queuedurationinner_transport_headerinit_fs_contextuprobe_taskf_mappingFcpPktAllocFailstailcall_bypassstart_stackBPF_MAP_TYPE_STRUCT_OPSprog_array_member_cntDL_DEV_PROBINGi_linkWB_REASON_MAXstack_vm_areafc_lund_hashBPF_SPIN_LOCKdl_server_pick_ftty_old_pgrpst_sizevfsgid_tneed_parent_lockseccomp_filternr_migrationsrm_xquotaorc_entrydma_drain_len__MAX_BPF_ATTACH_TYPESCSI_EH_RESET_TIMERblk_mq_opsunused_hctx_listutimemmapshrinkeralloc_dquotbw_time_stampmappingdl_defer_armedfc_ns_ftsmap_pollrunnable_sumcpu_scaled_run_real_totalshort unsigned inteventsget_rq_budget_tokenqueue_ramp_up_perioddevice_nodemm_walkfc_gpn_ft_resprequeue_listlocal_portFC_PORTSTATE_DIAGNOSTICSpkt_typelong long intsym_vvar_start_hugetlb_cgroup_rsvdsival_ptrproc_namepercpu_sizefc_vport_stateFC_PORTTYPE_UNKNOWNBPF_TASK_ITER_ALL__wsuminvalidate_foliois_vallocdrop_nsNOT_INITnr_queuesgenerationno_pm_callbackscountddp_targetd_parentpagessched_task_groupBPF_TIMERupdate_timetc_skip_classifymemcg_idpidsof_noderun_nodedata_sourcesubmit_bios_instancesvm_rcubd_start_sectctl_nodepage_table_locksysv_semquota_infoquota_enable__kernel_timer_twork_list__fc_linkdownBPF_MAP_TYPE_PROG_ARRAYPTR_TO_PACKETdomain_tagmax_integrity_segmentscmaxrssit_real_incrprobestubextable_lenlast_arrivalwake_index_watermarkswap_rwreservemap_extrasplit_queue_lockevents_local_filesrcu_gp_seq_needed_expDEVICE_HORI_POS_RIGHTSUBMITTED_BY_SCSI_RESET_IOCTLdirect_IOia_mtimenr_thpslegacy_cftypesrnid_vend_specsysv_shmfopssuppress_bind_attrsinsnlen__page_1__page_2i_mutex_keykey_restrictionstatquota_writedomainget_linkFC_PORTTYPE_NLPORTmax_depthctl_table_argdata_lenpriv_stack_ptrblkcg_nodeforksa_flagsno_start_on_addcancelled_write_bytesdispatch_busyfcp_packet_alloc_failuresnbp_rl_starttask_worksmm_cidatomic_write_hw_maxdfl_cgrp_ddebug_infoaddrsshrinker_info_unitstats_locknum_kpSTARGET_CREATED_REMOVEshost_gendevcsumMEMORY_DEVICE_PRIVATE__bd_flagssuper_blockbi_bvec_donemap_get_unmapped_areabus_typeget_named_child_nodeBPF_MAP_TYPE_PERCPU_CGROUP_STORAGE_DEPRECATEDassoc_arrayactorBPF_CGROUP_ITER_DESCENDANTS_PREbpf_offload_devkobj_ns_typedeferred_resumesched_shared_tagsfp_wwpnlong intcore_nodebdi_nodecn_device_specifictarget_btf_idmem_dqinfodevnodesaved_sigmaskac_uidBLK_UID_EUI64MEMORY_DEVICE_PCI_P2PDMAac_nicedq_offpinsblkcg_mutexis_visiblecgrp_linksdisk_nameuuid_t__kernel_clockid_twritabledqb_bsoftlimitvfork_donetask_cputime_atomicki_waitqra_pagesgroupmmap_compat_legacy_basedevice_dma_supportedsysfs_dir_lockscsi_cmnd_submitterignored_posix_timerslockedsival_intia_filecancel_attachio_pageswakeup_cntrequest_pendingdl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsclass_read_lock_irqsave_is_conditionalblk_crypto_keyslotbio_end_io_td_spc_hardlimitblk_mq_hw_ctxSTARGET_REMOVEcpu_id_startavg_triggersctl_dirFC_PORTTYPE_PTProbust_list_headunsigned charwake_qrange_startrethooksnuma_scan_periodelem_countnr_tagswakeup_pathresult_maskjited_linfoscsi_timeout_actionei_funcsBPF_NETFILTERtablesRPORT_ST_PLOGI_WAITpipe_inode_inforaw_spinlockmemcg_cgwb_frnblkio_delay_totalktypebpf_attrfc_vport_setlinkBPF_PROG_TYPE_CGROUP_SYSCTLhost_sizemigration_disabledext_mutexRPM_REQ_SUSPENDcancel_forkpgprot_ttracepoint_ptr_tfor_reclaim_skb_refdstphysical_locationchildren_low_usagenum_vfPIDTYPE_MAXbi_sizemg_dst_csetvlan_protothrashing_countwatcherscrypt_ctxstopwait_maxclass_write_lock_irqsave_is_conditionalioveca_flagsiomapd_dnameScsi_Hostnr_migrations_coldbtf_value_type_idmnt_idmapseeksquotactl_opski_iopriovport_typesched_remote_wakeuptag_alloc_policysock_filterBPF_LIRC_MODE2tracing_graph_pauseread_itersuspend_latefront_padFC_TYPE_CTsdev_devmaxframe_sizerecoveredi_rwsembi_integrityexitio_uringeh_device_reset_handlerchild_ns_typeorderslave_bdevscommit_dqblkclass_local_lock_irqsave_is_conditionalmark_dirtyFC_PORTSTATE_OFFLINEnr_ctxkernfs_opsnr_dying_descendantsoom_reaper_timermodulewb_bytesbd_securitynodeinfoqueue_lockf_pathstatic_call_siteself64_symunlinkmap_queuescpumask_var_ttime64_tdrivers_diri_gidtype_iddev_releaserq_qosmark_deadicq_hintrmdirdq_dqbmemory_failureblkcg_gqdma_flagsbtf_field_kptrSUBMITTED_BY_BLOCK_LAYERmax_hw_sectorsselectors_mtdmod_kallsymss_typefield_maskjits_use_priv_stackprog_bind_mapli_failure_unknownfini_seq_privateremount_fsbd_holdernext_idtask_delay_infopi_sejit_datarelative_fdin_useforwardrq_countMIGRATE_SYNC_LIGHTerrseq_tms_rdatakstatfslruvec_statsreclaimedmems_allowed_seqmax_user_discard_sectorsinsnsitarget_allocbug_listBPF_CGROUP_INET4_CONNECTmax_nr_cidmod_arch_specificDMA_NONEtransfersizepp_recyclesplit_queue_lensharebpf_net_contextprobe_addrno_cgroup_ownerdisc_stopftrace_timestampbi_iopriobypass_addrd_ino_warnsstack_depthkernfs_elem_attrBPF_PROG_TYPE_SK_SKBi_ctime_nsecrelative_idrbnodei_private_listbinfmtftrace_sleeptimedata_size_inBPF_CGROUP_ITER_ORDER_UNSPECi_statebv_pagedestructorpcpu_cidsched_migratedZONE_DMA32FC_TYPE_ILScgroup_tasksetdup_xol_addrdevice_configurePROBE_PREFER_ASYNCHRONOUSrcu_node_entryreverse_orderingBPF_MAP_TYPE_BLOOM_FILTERcgroup_bpffile_system_typeorig_ret_vaddrelsct_sendbtf_log_levelmmu_notifier_subscriptionsswap_iocbBPF_RB_ROOTdefault_groups__sifieldsb_ionr_watchesfind_special_pageDL_DEV_DRIVER_BOUNDadj_offcurr_ret_depthstarved_entryfc_flags__fillerdestroy_dquot__task_fpstatefilldir_tget_reserved_spaceiopriomap_poke_untrackunreliablecreateBPF_PROG_TYPE_SCHED_ACTdirtied_time_whenstart_scan_seqmin_seqsym_vdso32_rt_sigreturn_landing_padspinlock_teh_abort_handlerbd_openersdq_inuseofflinedev_pm_infomremaptime_nsin_memstallhost_self_blockednode_size_lockcss_extra_stat_showkptrpoweroff_latei_nlinkwakeupcb_listcpu_iditer_info_lenpushable_taskstty_audit_bufmaxlenkernel_cap_t__be16bpf_funcpoke_tabmems_alloweds_inode_lrucached_rqse_cset_noderecov_seqkf_rootmmap_compat_baseretvalpreparenr_threaded_childrenclock_op_might_sleepf_sb_errneed_mbd_namecheck_flagsi_sequencert_prioritykretprobe_instancescrypto_profile__be32token_createiov_basecpus_ptrq_lockdep_mapb_more_ioloadfuncscpu_bitmapSTARGET_DELatomic_write_lensaved_tfxa_headdetachprog_ifindexmm_listproperty_read_string_arrayget_statetracepoint_funcd_seqnuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmt__be64blkg_listnum_symtabexec_update_lockfscrypt_inode_infosplice_readBPF_PROG_TYPE_SOCKET_FILTERsleepable_refcntFC_FID_TIME_SERVneed_qsctx_mapFC_VPORT_UNKNOWNbd_diskuid_gid_extentnumberszone_wplugs_wqWRITE_LIFE_SHORTsigpendingpi_entryBPF_MAP_TYPE_ARENAs_inodesdirtied_whenmap_direct_value_metaMIGRATE_ASYNCBPF_MAP_TYPE_PERCPU_CGROUP_STORAGEnext_scangsindexwrite_bandwidthcompletewatch_listli_prim_seq_err_counteh_abort_listBPF_CGROUP_UDP4_RECVMSGd_sibmodule_attributemax_host_blockedneed_tsin_dpm_listwordwork__list_add_valid_or_reportmultiprocessquiesce_depthfbatchclass_task_lock_is_conditionalBPF_CGROUP_INET_INGRESStask_groupf_pos_lockperiod_timerBPF_FLOW_DISSECTORprivsizesk_buff_data_texpected_revisionbio_pooltimeout_workBPF_PROG_TYPE_LWT_XMITmac_lensrcu_barrier_completionBPF_MAP_TYPE_STACK_TRACEpacctblk_mq_tag_setcurr_targetvm_page_protbalanced_dirty_ratelimitbitmapplist_nodefile_ref_tdqi_max_spc_limitPTR_TO_PACKET_ENDperf_event_contextatomic64_tnoinstr_text_startctx_size_outddp_doneac_btime64HRTIMER_RESTARTrpm_autosuspend_delayac_gidnotify_timercorememBPF_MAP_TYPE_USER_RINGBUFLPORT_ST_LOGObusystack_canaryuser_keyring_registermax_write_zeroes_sectors_utimedn_unable_to_routetmf_work_q_flags_1_flags_2FC_TYPE_BLStaskstatsport_stateproactive_compact_triggerposix_acli_dio_countarch_rwlock_tdriversym_timens_pagerport_event_callbackprog_token_fdsysctlsoffsetrtpoll_taskprot_guard_typedev_iommuWB_REASON_SYNCmap_typeclass_rwsem_read_intr_is_conditionalcompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_usersSDEV_BLOCKbacking_dev_infoi_mappingheadersdiscard_alignmentbsg_deviceshow_statsnr_populated_csetss_vfs_rename_keysubmitteretypei_bytesnormal_prioblkio_countshost_datadispatch_waitBPF_MAP_TYPE_INODE_STORAGEsrcu_nodelast_mm_ciddelayedhdr_lenper_cpu_nodestatsvaddrscsi_vpdis_softnext_cpugrab_current_nsclass_namesdisc_worknr_taskslock_class_keypriv_stack_requestedsum_exec_runtimememory_failure_statssetupdev_pin_infolesb_sync_losspoll_table_structmce_whole_pageia_modercu_tasks_holdout_listsched_rt_mutexs_pinsswap_peaksnon_seqbpf_prog_arrayattach_func_protopresent_pageshctx_listfc_vport_id_lookuprenamecontiguousthrashing_delay_totalmajorktime_tPRJQUOTAlink_idzswap_lruvec_stateBPF_CGROUP_INET_SOCK_RELEASEkprobe_blacklistjump_entriesdio_offset_alignreserved_tagsdma_masksa_restorerqueuelistdatalenmkdirnextrelax_countrestore_earlyPIDTYPE_TGIDilencpu_run_virtual_totalmax_active_zonesdevice_physical_location_horizontal_positionattach_flagskfunc_btf_tab__list_addrportkobj_uevent_envkernfs_rootkprobes_text_startpid_typefown_structi_default_aclBPF_PROG_TYPE_LIRC_MODE2fregs_statemap_flagsBPF_PROG_TYPE_LSMzonerefshift__devicespendingBPF_MAP_TYPE_PERCPU_ARRAYdma_boundarybd_nr_sectorsnr_eventssdev_statekmemcg_idkstatanon_vma_namedq_hash__iovgp_stategrphintabiommu_mm_datamap_for_each_callbackinvalid_crc_countnr_disk_swapinszone_wplugs_err_listma_flagsarch_uprobebio_issueDL_DEV_UNBINDINGrefcountmmap_lockuprobe_multidevice_sizeLPORT_ST_RFF_IDzonelistsrcu_reader_flavorbtf_fddumped_framespeerstimerqueue_nodereal_parentdiskseqdev_msi_infoiov_offsetnr_cpus_alloweduse_16_for_syncrt_mutex_waitermem_cgroup_per_nodekcompactd_pad_page_pooldq_dqb_lockf_flagsblk_qc_tshow_infoinner_map_fdslave_allocflush_requiredWB_REASON_FS_FREE_SPACEsg_tablememcg_vmstatskeyring_semattributesblk_queue_statsgrplomax_rport_retry_countkgid_tkey_userreadlinkoffline_disabledd_comparetime_ns_for_childreni_wb_frn_winnerqspinlocksighand_structstart_brkdisc_callbackmap_mmapdio_completeshost_statelocked_pendinglockdep_keyrnid_resvdextentfile_offsets_idstate_maskcore_statelink_upalignsym_int80_landing_padngroupsmajor_retriessp_offset__sigrestore_tRPM_SUSPENDEDvolnameDMA_TO_DEVICEmutexn_refattrsexch_mgr_resetBPF_TCX_EGRESSFC_VPORT_DISABLEDbi_sectoreh_deadlinefsbaseinactivesrcu_barrier_mutexloss_of_signal_countdirty_limitswregs_state__kernel_timespecchildren_min_usageeh_should_retry_cmdpglist_datad_lruwaitqmax_pkt_offsetd_fieldmaskcountersfaults_disabled_mappingnameidataarg_sizefailedpoweroffbpf_prog_opsbpf_verifier_envminorsnonresident_ageControlRequestselemsizerlim_curkey_tagscan_workdebugfs_entrywait__list_add_validshow_rqcan_queuest_shndxreservedi_wb_frn_historyctxsprocess_keyringset_dqblkrestart_blocks_opbi_end_iokobjectposix_cputimer_basenr_memcgsleveluser_definedcow_pageFC_SOF_Fnanosleepinvalid_tx_word_countfalsecn_sig_alarmpi_state_listtv_secac_exitcodeBPF_KPTRsuidFC_SOF_I3prog_typekey_typedismissi_hashmm_cid_next_scanfreeze_noirqoublockdisc_idia_atime_timerfifovm_private_dataskip_ms_page_8rtpoll_scheduledWB_SYNC_NONEBPF_PROG_TYPE_KPROBEorig_progdq_freeSHOST_RUNNINGrootLPORT_ST_RNN_IDDISC_EV_NONEsupported_classespolicycpu_baseBPF_PROG_TYPE_SYSCALLcap_bsetnr_to_writerportsnr_itemsanon_costseq_startfcp_input_megabytesbp_regbvec_poolkern_versionrb_root_cachedfc_host_statisticsWB_REASON_FOREIGN_FLUSHmac_headeri_blkbitswritervm_pgoffvirtmem_refcounttarget_fdcsum_typebin_attributemath_emu_infopushable_dl_taskswrite_u64testWB_SYNC_ALLsched_infogroup_infotailsdqi_fmt_idPTR_TO_ARENAactive_extensionsmemcg_csssoftirq_next_timerrevisionis_child_subreapersg_tablesizeexit_codefile_lock_contexttracingnr_pageswriteback_indexread_u64fiemap_extent_infofilemempool_free_tPTR_TO_TCP_SOCK_OR_NULLfree_foliort_spc_warnlimitcmndatomic_write_hw_unit_mincompact_count_sk_redirtimer__empty_rangessbq_wait_statedev_namebpf_mapBPF_PROG_TYPE_EXTBPF_PROG_TYPE_FLOW_DISSECTORnotified_atn_klistwb_errbudget_tokenfc_framevlan_tcikswapdwrite_dquotrefcount_offpercpu_pvec_drainedf_llistbd_writersuring_cmd_iopollpudval_tpi_state_cachewwnnstorebi_bdevst_infodispatchdescsquiesced_bydqi_max_ino_limitllseeknet_nsRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleget_projidfunc_info_aux__sectorpart0cnvcswwwpnkqidmem_cgroupPTR_TO_BUFfree_inodenext_keysiglockwait_queue_func_tperf_recursionnr_wakeups_remoted_spacei_ctime_secdebugfs_idreal_func_cntnext_timer_typeBPF_TASK_ITER_TGIDTT_NATIVEused_map_cnt__empty_insnshlist_bl_nodenum_descs_head_1_head_2clockidFREEZE_MAY_NESTsym_hvclock_pageremap_file_rangemmap_legacy_basepfmemalloc_waitend_dataxa_lockfutex_exit_mutexuse_16_for_rwiommu_groupmap_peek_elemnr_isolate_pageblockmempool_alloc_tdevice_get_dma_attrtarget_blockeddev_loss_workalloc_inodepayloadbtf_field_graph_rootdirty_foliodn_unknownnode_zonesseq_countfscrypt_keyringis_hardasync_sizetrap_nrf_iocb_flagsctx_size_inRPORT_EV_LOGOkcompactd_waittotal_vm_entire_mapcountiteratorlastpool_dataqf_opsforce_atomic_pad1_LPORT_ST_RHBAreal_credno_difblkcnt_td_rt_spaceprog_idsBPF_MAP_TYPE_HASHsigned charmap_local_storage_chargehas_child_subreapermount_pad2_reasonblk_flush_queuesched_entitydev_links_infoinner_protocol_types_uuid_lenpcpudqi_privINIT_LIST_HEADfmode_trpm_autosuspendrnid_att_nodessweventactivatefxregs_state_lowerpaddingDEVICE_REMOVABLEpid_ns_for_childrentimestimer_rand_statelru_gen_memcgllist_nodebpf_run_ctxbio_slabstate_add_uevent_sentLPORT_ST_RSPN_IDenv_startmodule_notes_attrsio_cqlower_firstrangebvecacct_vm_mem1on_cpumanage_system_start_stopmg_src_preload_nodestringSHOST_CANCEL_RECOVERYnuma_preferred_nidfree_diskPTR_TO_MAP_KEYvmem_altmapbiotailwait_startelevatorspinlockmin_unmapped_pagessrcu_barrier_seqi_aclssb_statnofaultbpf_map_typeia_rangesis_reltablepteval_tlog_levelblk_mq_tagsDEVICE_PANEL_LEFTorc_unwind_iprel_deadlinexfer_contig_endkobj_typeskip_settle_delaysb_writersdma_cleanupeh_timed_outdriver_datai387FC_FID_QOSdma_iommumax_idirq_safeLPORT_ST_READYrescue_lockdefault_timer_slack_nsxregs_states_statecompletion_cnt_deferred_listcurr_nrset_child_tidbio_vecacpi_match_tablenfdsrlimitBPF_TRACE_FEXITmap_update_elemlast_subtree_bstatnr_frozen_tasksiterrelease_agent_pathidle_notificationmodule_statertpoll_triggersPTR_TO_BTF_IDwait_lockf_pipegetgeocset_linkswrite_iterD_REAL_DATAsp_featuresacct_timexpdclock_mutexFC_FID_SEC_KEYnr_failed_migrations_runninguserfaultfd_ctxevent_flagsthread_structbuf_lenfc_rport_statemm_context_tbd_stampdio_mem_aligncstimeRPORT_ST_FLOGIprot_capabilitiesatomic_long_trpm_requestpositionMQ_RQ_COMPLETEio_comp_batchline_info_cntcftsf_credtrace_eventsfc_port_typed_iputlast_bstatnew_prog_fdnr_wakeups_syncklist_nodestackmap_release_urefBPF_REFCOUNTblockedvm_numa_eventdst_trampolineallowedmce_countweighttotalblk_plugOutputRequeststrc_reader_nestingfpstatetag_setis_roxno_scsi2_lun_in_cdbprevseqcount_raw_spinlockbios_paramnum_orcskswapd_failuresbuflenbpf_kfunc_desc_tabdeadBPF_CGROUP_DEVICEWRITE_LIFE_LONGcrc_offloadexpiry_activeeh_bus_reset_handlermtd_infois_confidentiali_dentryfixupsvm_endvm_structproc_handlermemcgfsyncsgidcompat_robust_listnuma_workprioprivvaluercu_workBPF_CGROUP_INET4_GETPEERNAMEredirectedcurrent_stack_pointerac_minfltbpf_prog_aux_hugetlb_cgroupset_policyinternal_tagthreadftrace_callsitesmmlistservice_paramsBPF_CGROUP_SETSOCKOPTforceidle_sumusedpage_typeclass_spinlock_is_conditionaluserskb_iifmynodeseq_stop__MAX_BPF_PROG_TYPEblk_traceactionseconds_since_last_resetlink_detachpi_waitersdom_cgrpqueue_mappingscsi_comp_flagslportfile_name_offbstatfailcntatomic_tpcp_listqueue_flagsBPF_PROG_TYPE_UNSPECrb_rootLPORT_ST_RPAfreepages_countutf8data_tableBPF_PROG_TYPE_SK_MSGprim_seq_protocol_err_countexe_fileuid_telementsd_fsdatakey_restrict_link_func_tepoll_watchesrandompm_subsys_datadef_flagssrcu_n_lock_retriesraw_locksrcu_structprovinner_map_metaFC_FID_MGMT_SERVis_guestli_link_failure_countio_minnf_skip_egresstarget_attrsrtpoll_wakeupsplice_eofs_sync_lockproganon_vma_chaini_mtime_nsecseq_opsrseq_event_maskem_pdi_fsnotify_maskshared_pending__int128__mce_reservedwriteback_controlmax_write_lenmm_struct__restorefn_ttrc_blkd_nodeBLK_INTEGRITY_CSUM_NONEbuild_idhost_statss_export_opCONST_PTR_TO_MAPBPF_CGROUP_INET4_GETSOCKNAMElen_descseg_boundary_maskanon_namesched_dl_entitypp_ref_countactivest_otherlinelinkstart_timekernfs_nodedev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchreschedule_countvfsmountextable_basenoinstr_text_sizeattributesset_child_tid_overruntmpfilercu_read_lock_nestingtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugrefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tUTF8_NMAXfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqia_vfsgidsize_tcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workatomic_long_tpreallocclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicdelayed_callmax_nr_cid_statusd_sibbin_attributepercpu_counternuma_pages_migratedgsindexexpires_nexti_io_listf_epsrcu_barrier_seqreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tHRTIMER_BASE_BOOTTIMEclass_srcu_is_conditionalnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionHRTIMER_BASE_REALTIME_SOFTstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registers_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrstate_in_sysfstty_structUTASK_SSTEP_TRAPPEDbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollnr_wakeups_idleio_cqelf64_symlatch_tree_nodedestroy_work__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerma_external_lockuid_tflush_requiredsum_block_runtimepgmapdq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditional_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitnuma_groupdescriptionclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinei_inodyndbg_infoindexthread_headmap_typef_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenHRTIMER_RESTARTMOD_MEM_NUM_TYPESsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxcpu_basedquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_events_sys_privateUTF8_NFDIinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authHRTIMER_BASE_TAIvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherscompletionsw_reservedUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treequota_onvm_operations_structbin_attrs_newiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdatanrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupwake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlinedup_xol_worktotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramd_spc_softlimitreported_split_lockgfp_tseccomp_filterstimei_mmapthaw_superd_lrusignal_structperf_event_mutexcrcspgdval_tSB_FREEZE_WRITEsetattrf_mappingnoinstr_text_startbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activei_opldt_usr_semkobj_ns_type_operationsDQST_FREE_DQUOTSseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tis_dirty_writebacktrace_bprintk_fmt_startkstatfssitesptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutex_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupseqcount_spinlock_ti_wbclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedpagetrc_holdout_listget_inode_usagenormal_priodestroy_inoderelease_folioi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inameHRTIMER_BASE_MONOTONIC_SOFTi_mappinginblockrmidrseq_siglimit0limit1dqi_max_ino_limitmigrate_modeftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksd_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrDQST_SYNCSstack_vm_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalcg_listsrcu_barrier_completionrw_semaphoremnt_sb_ddebuginfofiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypeinit_modulemembarrier_statepage_poolinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_mempathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwrcu_syncvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstateueventlock_countrefcount_tplugsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttableslist_headtgidwrite_protect_seqcompat_robust_list_head_tids_inode_wblist_lockend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutask__UNIQUE_ID_srcversion473sched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextgpl_symsseq_showswait_queue_headblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfds_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceobjcgnodeDQST_READSvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvstatic_prioshrinkerdl_yieldeddqi_formatexec_update_lockDQF_PRIVATEDQF_SYS_FILE_Bl1d_flush_killi_versionprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symboltv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskSB_FREEZE_PAGEFAULTactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlock__rcu_headmce_vaddrquota_offdq_inusedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmod_tree_nodef_sb_errwritepagecodegtimesigactionclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listktypelockrefsrcu_struct_ptrsmm_structvlagi_uidspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesvm_mmmod_mem_typedebugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipMOD_INIT_RODATAqc_dqblkmmappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCi_write_hintfxsaveprocess_keyringlist_op_pendingllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyioveci_private_lockVTIME_IDLEstatic_keys_magicdl_overrunDQST_ALLOC_DQUOTSd_parentpayloadac_minflti_sbd_sbcommPIDTYPE_PIDatomic_write_segments_maxatomic_openreadahead_control__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupblockedi_securitystats_lockD_REAL_DATApt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colorbitsiopriocap_inheritablegp_waitlookupDD_CLASS_TYPE_LEVEL_NAMESvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vec__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATElf64_Symd_automountparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcestack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkDQST_CACHE_HITScmaxrsstimer_slack_nspolicysharedd_real_typelookahead_bandseq_startraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamerun_delaytailslinenoget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseattrscpumask_tswregs_statedqb_isoftlimitorig_axsched_rt_entitytimerqueue_nodeil_weightmem_dqblknr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pause_sigchldreservedlatency_record_countcgroupsprev_scan_seq_DQST_DQSTAT_LASTrcu_usersoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockUTF8_NFDICFcpu_bitmapstatic_call_keyutil_estucountsMOD_RODATAqc_statesoftirq_next_timercheck_flagsswp_entry_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aMOD_INVALIDmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalautogroupnr_threads__i_nlinkpushdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magicfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsMOD_INIT_DATAnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_infoshared_pendingi_gidmin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idHRTIMER_MAX_CLOCK_BASESkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsxa_flagsbin_sizegrphid_spc_timerjump_entriesassoc_array_ptrsuper_block_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_array__UNIQUE_ID_depends472mnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpref_node_fork__int128dqi_privrss_statmems_allowed_seqrefcntD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxresult_maskdquot_operationsmappinggrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizescheduledclass_raw_spinlock_nested_is_conditionalworker_privateis_relqstrma_flagsfutex_stateHRTIMER_BASE_TAI_SOFTacct_timexpd__rcu_icq_cacheDQST_WRITESsizef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tdl_server_has_tasks_frunnable_sumreal_credepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgcstimecfs_rq_uidst_spacemm_cid_next_scanac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysMOD_TEXTdqb_curinodesload__s8invalidate_lock_keyprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_marksdio_mem_alignbtime__u8is_roxlockrlim_maxruntime_deferred_listd_waitlist_lru_oneseq_stopkiocbclass_rwsem_read_intr_is_conditionalfsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeshrinker_idrootoom_reaper_listsym_VDSO32_NOTE_MASKbpf_storage__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingfsindexshstksrcu_ssp__page_1__page_2__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEi_sequencedqb_ihardlimitd_lockrefnum_bpf_raw_eventsaddr_perfi_dir_seqkqidKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typef_iocb_flagscmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagshrtimer_base_typestart_boottimevm_starts_flagsiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listhrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendings_listdqb_rsvspaceversionserialalloc_locks_dquotfolioqprev_posseqcount_spinlocks_umountis_bin_visiblesyscall_user_dispatchrcu_tasks_exit_listia_uidchildrenrb_subtree_lastbuild_idvfork_donenanosleeprt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelayquotalenf_pipei_wb_frn_historylast_wakeenextarch_spinlock_ti_mtime_nsecmmlistutf8_normalizationset_dqblkreg_offsetgsbases_quota_typesf_llisti_nlinkwrite_beginpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedHRTIMER_BASE_BOOTTIME_SOFTfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tquota_enablesched_avgntabmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextprealloc_bufprojiddrop_inodenum_trace_evalsllseeknext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeunfreeze_fsintervallast_mm_cidcookietargeta_flagstrace_overrunsession_keyringfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributerestrict_linkMOD_DATAi_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackloff_tthread_pidsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringma_locksched_delayedmodule_statelast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimemigrate_from_cpusrcu_barrier_mutexi_private_dataElf64_Halfnsproxyxol_areacleanup_modulerlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_datasignumfscrypt_keyrings_mountsuse_memdelay__state_sizethread_structcached_requested_keyenvpctimereleasesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_datasysv_semanon_vma_namefileattrDQST_DROPSlong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionali_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_ts_iflagsmce_kflagstotal_numa_faultss_countd_revalidates_opsysv_shmdq_countutf8data_tablefoliowake_entryxa_headsuidi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_lockiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_t_flagsnotify_nextshort intmynodeclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_ownerbp_regVTIME_USERsa_flagstesti_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivaltrace_event_callis_guestpoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keyGRPQUOTAi_private_listia_validi_rcuHRTIMER_BASE_REALTIMEi_atime_secqc_type_statekey_serial_tsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsi_wb_listxarray_startfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectordefault_timer_slack_nssource_listswap_readahead_info__fpstateactive_refgroup_infovdso_imagefile__user_state_sizemce_kill_meuuid_tcount_objects_stimezone_device_dataf_wb_errdefparamfred_cskprojid_tptracer_credtlb_genstorekobjectaudit_ttymce_ripvstatfsnumab_statefeatureson_listkgid_ton_cpufregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisti_mmap_rwsemwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadd_realexpiry_activedqi_max_spc_limitexception_table_entryfallocateHRTIMER_BASE_MONOTONICi_spc_warnlimitbuddy_listi_ino_timelimitSB_FREEZE_FSi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infotracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevfs_structclockiduint32_targ_startblocksset_infofileattr_getvectortimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrrenamevm_area_structsb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextiommu_mmcutimepersonalityget_statetask_sizes_inodes_addrbinfmtsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filercu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataki_posexecute_only_pkeysetleasepacct_structlong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typein_iowaitunregfuncegiddq_hashput_superMOD_INIT_TEXTpushable_dl_tasksf_flagsf_inodemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infoTT_NONEVTIME_INACTIVEcancelled_write_bytessrcu_usagebitmapmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_cold__UNIQUE_ID_name470ssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenDQST_LOOKUPSclass_spinlock_irq_try_is_conditionaloom_mmsrcu_reader_flavortv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idsrcu_structrlim_curnofaultmm_countSB_FREEZE_COMPLETEstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infodatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountki_filpcap_ambientatomic64_tanon_vmarlimread_folionr_eventsprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keysrcu_gp_startopenit_real_incrmodert_prioritymm_lock_seq__UNIQUE_ID_intree471KMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksrb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionexit_statesysvsemMOD_RO_AFTER_INITDQF_ROOT_SQUASH_Bfs_supersSB_UNFROZENdqb_bsoftlimitpendingf_task_workiowait_countstringread_countfutex_offsetlong long intatomic_flagssysvshmtrace_evalsactive_basessecurityxmm_spacef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesclass_rwsem_read_intr_is_conditionalclass_mutex_is_conditionalclass_preempt_notrace_is_conditionalMOD_INIT_RODATAMOD_TEXTclass_srcu_is_conditional_nameclass_rcu_is_conditionalclass_migrate_is_conditionallong long unsigned intNR_KMALLOC_TYPESclass_rwsem_read_is_conditionallong long intsigned charPIDTYPE_SIDclass_preempt_is_conditionalElf32_Wordorc_headerPIDTYPE_TGIDlong intclass_raw_spinlock_irq_is_conditional_descclass_local_lock_nested_bh_is_conditionalHRTIMER_BASE_MONOTONIC_SOFT__UNIQUE_ID_retpoline471class_rwsem_read_try_is_conditionalUTF8_NFDIDQST_LOOKUPSclass_spinlock_irqsave_is_conditionalclass_spinlock_try_is_conditionalclass_local_lock_is_conditionalhrtimer_base_typeMOD_RO_AFTER_INITn_descsz__u8DQST_ALLOC_DQUOTSSB_FREEZE_FSKMALLOC_NORMALDQST_WRITESunsigned int__int128class_irqsave_is_conditionalHRTIMER_BASE_REALTIMElong unsigned int__u32HRTIMER_MAX_CLOCK_BASESclass_spinlock_irqsave_try_is_conditionalclass_spinlock_is_conditionalshort unsigned intHRTIMER_BASE_TAIclass_local_lock_irqsave_is_conditionalclass_read_lock_is_conditionalelf32_noteboolDQST_DROPSclass_local_lock_irq_is_conditionalMOD_RODATAKMALLOC_CGROUPclass_rwsem_write_is_conditionalclass_spinlock_irq_try_is_conditionalclass_spinlock_irq_is_conditionalclass_write_lock_is_conditionaln_typeMOD_DATAclass_write_lock_irqsave_is_conditionalHRTIMER_BASE_BOOTTIMEn_nameszSB_FREEZE_COMPLETESB_FREEZE_WRITEclass_raw_spinlock_nested_is_conditionalMOD_MEM_NUM_TYPESDQST_SYNCSDQST_FREE_DQUOTSmod_mem_typeHRTIMER_BASE_MONOTONICclass_mutex_intr_is_conditionalclass_task_lock_is_conditionalUTF8_NMAX_nhdrPIDTYPE_PGID_Boolunsigned charKMALLOC_RECLAIMHRTIMER_BASE_BOOTTIME_SOFTcurrent_stack_pointershort int_note_18_note_19utf8_normalizationKMALLOC_RANDOM_STARTDQST_CACHE_HITSclass_irq_is_conditionalDQF_PRIVATEPIDTYPE_PIDDQST_READSMOD_INIT_DATAclass_raw_spinlock_try_is_conditionalclass_raw_spinlock_irqsave_is_conditionalPIDTYPE_MAXcharGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackSB_FREEZE_PAGEFAULTUTF8_NFDICFclass_mutex_try_is_conditional_DQST_DQSTAT_LASTclass_write_lock_irq_is_conditionalKMALLOC_RANDOM_ENDMOD_INIT_TEXTclass_raw_spinlock_irqsave_try_is_conditionalpid_typeHRTIMER_BASE_REALTIME_SOFTKMALLOC_DMAclass_read_lock_irq_is_conditionalHRTIMER_BASE_TAI_SOFTSB_UNFROZENclass_raw_spinlock_is_conditionalkmalloc_cache_typeclass_read_lock_irqsave_is_conditionalclass_rwsem_write_try_is_conditionalDQF_SYS_FILE_Bclass_raw_spinlock_irq_try_is_conditionalDQF_ROOT_SQUASH_B__UNIQUE_ID_vermagic470__int128 unsignedMOD_INVALID/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc/fc_libfc.c/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc./include/scsi./include/linux./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/device./include/scsi/fc./include/uapi/scsi/fcfc_libfc.cfc_libfc.cfc_frame.hfortify-string.hskbuff.hscatterlist.hhighmem-internal.hpreempt.huaccess.hcurrent.hmm.hlist.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hasm.hinit.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hstatic_call.hbug.hcache.hsched.hpreempt.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hatomic-long.hmmzone.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hpage_64.hrange.hptrace.hmath_emu.htypes.hshstk.hseq_file.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hlist_nulls.hwait.hosq_lock.hmutex_types.hmutex.hseqlock_types.hnodemask_types.htlbbatch.hmm_types_task.hrefcount_types.hkref.hrbtree_types.hrcupdate.hmaple_tree.hrwsem.hswait.hcompletion.htime64.hpid_types.hsem_types.hshm.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcred.hkey.hnsproxy.hsignal.hbio.hblkdev.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hbpf.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hzswap.hpercpu-refcount.hshrinker.hdcache.hslab.hlist_bl.hlockref.hmount.hpath.hstat.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hsysctl.hstddef.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hwriteback.huio.hbacking-dev-defs.hblk_types.hkobject.hidr.hkernfs.hkobject_ns.hfwnode.hdevice.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.henergy_model.hklist.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hattribute_container.htransport_class.hdma-direction.hmempool.hblkzoned.hsbitmap.hblk-mq.hscsi_proto.hscsi_host.hscsi_cmnd.hscsi_device.hscsi_transport.hbpf.hfilter.hbtf.hrcupdate_trace.hcpuhplock.hns_common.hutsname.hcgroup.hinterrupt.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.hpagevec.hkernel_read_file.hsecurity.hscsi_transport_fc.hfc_fcp.hfc_ns.hfc_els.hfc_fs.hfc_encaps.hlibfc.hutsname.hfc_libfc.hcrc32.h/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc/fc_disc.c/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc./include/linux./include/scsi./arch/x86/include/asm./include/linux/atomic./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/uapi/scsi/fc./include/linux/device./include/net./include/scsi/fcfc_disc.cfc_disc.clist.hlibfc.hatomic.hrefcount.hkref.hatomic-instrumented.hatomic-arch-fallback.hjiffies.hworkqueue.herr.hfc_frame.hskbuff.hslab.hunaligned.hfortify-string.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hbug.hcache.htime64.htime_types.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hsched.hprocessor.hcpumask_types.hmath_emu.hstatic_call_types.hstatic_call.hatomic-long.hstddef.hgfp_types.hmmzone.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hblkdev.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hbpf.hspinlock.htracepoint-defs.hlist_nulls.hwait.hmutex.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hasm.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hpercpu-refcount.hfc_gs.huio.huio.hbvec.hxarray.hlist_lru.hidr.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hdevice.hklist.hpm.hpm_wakeup.hbus.hdriver.hclass.hsysctl.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hwriteback.hbacking-dev-defs.hblk_types.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hdevice.hfwnode.hattribute_container.htransport_class.hdma-direction.hmempool.hblkzoned.hsbitmap.hblk-mq.hscatterlist.hscsi_proto.hscsi_host.hscsi_cmnd.hscsi_device.hscsi_transport.hdropreason-core.hbpf.hfilter.hbtf.hrcupdate_trace.hcpuhplock.hns_common.hcgroup.hinterrupt.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.hpagevec.hkernel_read_file.hsecurity.hscsi_transport_fc.hfc_fcp.hfc_ns.hfc_els.hfc_fs.hfc_encaps.hfc_libfc.htimer.hinstrumented.hkcsan-checks.hkasan-checks.hdrivers/scsi/libfc/fc_exch.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc./include/linux/atomic./arch/x86/include/asm./include/scsi./include/scsi/fc./include/linux./include/asm-generic/bitops./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/net./include/uapi/scsi/fcfc_exch.cfc_exch.catomic-instrumented.hatomic-arch-fallback.hatomic.hfc_frame.hfc_encaps.hskbuff.hspinlock.hcurrent.hcpumask.hinstrumented-non-atomic.hbitops.hfortify-string.hlist.hslab.hkref.hrefcount.herr.hfind.hjiffies.hworkqueue.hlog2.hbitops.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hbug.hcache.htime64.htime_types.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hasm.hpercpu.hsched.hprocessor.hcpumask_types.hmath_emu.hstatic_call_types.hstatic_call.hatomic-long.hstddef.hgfp_types.hmmzone.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hblkdev.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hbpf.htracepoint-defs.hlist_nulls.hwait.hmutex.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hpercpu-refcount.huio.huio.hbvec.hxarray.hlist_lru.hidr.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hdevice.hklist.hpm.hpm_wakeup.hbus.hdriver.hclass.hsysctl.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hwriteback.hbacking-dev-defs.hblk_types.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hdevice.hfwnode.hattribute_container.htransport_class.hdma-direction.hmempool.hblkzoned.hsbitmap.hblk-mq.hscatterlist.hscsi_proto.hscsi_host.hscsi_cmnd.hscsi_device.hscsi_transport.hdropreason-core.hbpf.hfilter.hbtf.hrcupdate_trace.hcpuhplock.hns_common.hcgroup.hinterrupt.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.hpagevec.hkernel_read_file.hsecurity.hscsi_transport_fc.hfc_fcp.hfc_ns.hfc_els.hfc_fs.hlibfc.hfc_libfc.hpercpu.htimer.hspinlock_api_smp.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc/fc_elsct.c/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc./include/scsi./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/uapi/scsi/fc./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/net./include/scsi/fcfc_elsct.cfc_elsct.cfc_encode.hfc_frame.hfortify-string.hunaligned.hdevice.hkobject.hskbuff.herr.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfc_gs.hfc_ns.hfc_els.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hbug.hcache.htime64.htime_types.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hsched.hprocessor.hcpumask_types.hmath_emu.hstatic_call_types.hstatic_call.hatomic-long.hmmzone.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hblkdev.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hbpf.hspinlock.htracepoint-defs.hkref.hrcupdate.hmaple_tree.hrwsem.hwait.hswait.hmutex.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.huio.huio.hbvec.hxarray.hlist_nulls.hlocal_lock.hzswap.hlist_lru.hidr.hkernfs.hkobject_ns.hstat.henergy_model.hklist.hpm.hpm_wakeup.hbus.hdriver.hclass.hsysctl.hstddef.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hwriteback.hbacking-dev-defs.hblk_types.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hdevice.hfwnode.hattribute_container.htransport_class.hdma-direction.hmempool.hblkzoned.hsbitmap.hblk-mq.hscatterlist.hscsi_proto.hscsi_host.hscsi_cmnd.hscsi_device.hscsi_transport.hdropreason-core.hbpf.hfilter.hbtf.hrcupdate_trace.hcpuhplock.hns_common.hutsname.hcgroup.hinterrupt.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.hpagevec.hkernel_read_file.hsecurity.hscsi_transport_fc.hfc_fcp.hfc_ms.hfc_fs.hfc_encaps.hlibfc.hutsname.hasm.hsprintf.hdrivers/scsi/libfc/fc_frame.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc./include/scsi./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/sched./include/net./include/scsi/fc./arch/x86/include/asmfc_frame.cfc_frame.cfc_frame.hskbuff.hfortify-string.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hstddef.hgfp_types.hirqflags.hpreempt.hllist.hrbtree_types.hrefcount_types.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hdevice.hpkt_cls.hflow_dissector.hblk_types.hblk-mq.hscsi_device.hfc_encaps.hcrc32.hasm.h/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc/fc_lport.c/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc./include/scsi./include/linux./include/linux/atomic./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/uapi/scsi/fc./include/linux/device./include/net./include/uapi/scsi./include/scsi/fcfc_lport.cfc_lport.cscsi_host.hfortify-string.hfind.hmath64.hlibfc.hscsi_transport_fc.hfc_frame.hskbuff.hrcupdate.hlist.herr.hkref.hrefcount.hatomic-instrumented.hatomic-arch-fallback.hatomic.hslab.hjiffies.hworkqueue.hunaligned.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hbug.hcache.htime64.htime_types.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hasm.hpercpu.hsched.hprocessor.hcpumask_types.hmath_emu.hstatic_call_types.hstatic_call.hatomic-long.hstddef.hgfp_types.hmmzone.hsysfs.hcpumask.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hblkdev.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hbpf.hspinlock.htracepoint-defs.hdelay.hstat.hlist_nulls.hwait.hmutex.hmaple_tree.hrwsem.hswait.hworkqueue_types.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hsysctl.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hwriteback.hbacking-dev-defs.hblk_types.hkobject.hcompat.helf.hidr.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hfc_gs.henergy_model.hdevice.hklist.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hfwnode.hattribute_container.htransport_class.hdma-direction.hmempool.hblkzoned.hsbitmap.hblk-mq.hscatterlist.hscsi_proto.hscsi_cmnd.hscsi_device.hscsi_transport.hbsg-lib.hdropreason-core.hbpf.hfilter.hbtf.hrcupdate_trace.hcpuhplock.hns_common.hutsname.hcgroup.hinterrupt.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.hpagevec.hkernel_read_file.hsecurity.hscsi_bsg_fc.hfc_fcp.hfc_ns.hfc_ms.hfc_els.hfc_fs.hfc_encaps.hutsname.hfc_encode.hfc_libfc.hsprintf.htimer.hinstrumented.hbitops.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc/fc_rport.c/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc./include/linux./include/linux/atomic./arch/x86/include/asm./include/scsi./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/device./include/net./include/scsi/fc./include/uapi/scsi/fcfc_rport.cfc_rport.cslab.hkref.hrefcount.hatomic-instrumented.hatomic-arch-fallback.hatomic.hlist.hrculist.hrcupdate.hfc_frame.herr.hskbuff.hworkqueue.hjiffies.hunaligned.hfortify-string.hfc_encode.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hstatic_call.hcache.hsched.hpreempt.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hbug.hatomic-long.hstddef.hgfp_types.hmmzone.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hseq_file.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hblkdev.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hbpf.htime64.htracepoint-defs.hmutex.hworkqueue_types.hasm.hextable.hinterrupt.hlist_nulls.hwait.hmaple_tree.hrwsem.hswait.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hpercpu-refcount.huio.huio.hbvec.hxarray.hlist_lru.hidr.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hdevice.hklist.hpm.hpm_wakeup.hbus.hdriver.hclass.hsysctl.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hwriteback.hbacking-dev-defs.hblk_types.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hdevice.hfwnode.hattribute_container.htransport_class.hdma-direction.hmempool.hblkzoned.hsbitmap.hblk-mq.hscatterlist.hscsi_proto.hscsi_host.hscsi_cmnd.hscsi_device.hscsi_transport.hdropreason-core.hbpf.hfilter.hbtf.hrcupdate_trace.hcpuhplock.hns_common.hutsname.hcgroup.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.hpagevec.hkernel_read_file.hsecurity.hscsi_transport_fc.hfc_fcp.hfc_ns.hfc_els.hfc_fs.hfc_encaps.hlibfc.hutsname.hfc_libfc.hrcutree.htimer.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc/fc_fcp.c/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc./include/linux./include/linux/atomic./arch/x86/include/asm./include/scsi./include/asm-generic/bitops./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/net./include/scsi/fc./include/uapi/scsi/fcfc_fcp.cfc_fcp.cspinlock.hfortify-string.hrefcount.hatomic-instrumented.hatomic-arch-fallback.hatomic.hlist.hscsi_host.hslab.hscsi_device.hscsi_transport_fc.hscsi_cmnd.hjiffies.htimer.hfc_frame.hcompletion.herr.hskbuff.hcurrent.hscatterlist.hmm.hpage-flags.hjump_label.hpage_ref.hhighmem-internal.hpreempt.huaccess.hinstrumented-non-atomic.hbitops.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hcache.htime64.htime_types.hfs.hmodule.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hstatic_call.hatomic-long.hstddef.hgfp_types.hmmzone.hsysfs.hasm.hpage_64.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcred.hkey.hnsproxy.hsignal.hbio.hblkdev.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hbpf.htracepoint-defs.hstat.hlist_nulls.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hzswap.hsysctl.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hwriteback.hbacking-dev-defs.hblk_types.hkobject.hcompat.helf.hidr.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hdelay.hfwnode.hdevice.hdma-direction.henergy_model.hklist.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hmempool.hblkzoned.hsbitmap.hblk-mq.hscsi_proto.hscsi_status.hscsi.hscsi_transport.hattribute_container.htransport_class.hdropreason-core.hnetmem.hbpf.hfilter.hbtf.hrcupdate_trace.hcpuhplock.hns_common.hutsname.hcgroup.hinterrupt.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.hpagevec.hkernel_read_file.hsecurity.hfc_fcp.hfc_ns.hfc_els.hfc_fs.hfc_encaps.hlibfc.hutsname.hfc_libfc.hcrc32.hscsi_common.hdev_printk.hspinlock_api_smp.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc/fc_npiv.c/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc./include/scsi./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/scsi/fc./include/uapi/scsi/fcfc_npiv.cfc_npiv.clibfc.hscsi_host.hlist.hscsi_transport_fc.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hbug.hcache.htime64.htime_types.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hsched.hprocessor.hcpumask_types.hmath_emu.hstatic_call_types.hstatic_call.hatomic-long.hmmzone.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hblkdev.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hbpf.hspinlock.htracepoint-defs.hkref.hrcupdate.hmaple_tree.hrwsem.hwait.hswait.hmutex.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.huio.huio.hbvec.hxarray.hskbuff.hlist_nulls.hlocal_lock.hzswap.hlist_lru.hidr.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hdevice.hklist.hpm.hpm_wakeup.hbus.hdriver.hclass.hsysctl.hstddef.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hwriteback.hbacking-dev-defs.hblk_types.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hdevice.hfwnode.hattribute_container.htransport_class.hdma-direction.hmempool.hblkzoned.hsbitmap.hblk-mq.hscatterlist.hscsi_proto.hscsi_cmnd.hscsi_device.hscsi_transport.hbpf.hfilter.hbtf.hrcupdate_trace.hcpuhplock.hns_common.hcgroup.hinterrupt.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.hpagevec.hkernel_read_file.hsecurity.hfc_fcp.hfc_ns.hfc_els.hfc_fs.hfc_encaps.hfc_frame.hasm.h/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc/libfc.mod.c/home/thomas/Documents/kernels/stagingdrivers/scsi/libfc./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/schedlibfc.mod.cint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hirqflags.htypes.hshstk.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hquota.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hlibfc.mod.c/home/thomas/Documents/kernels/stagingscripts/module-common.c/home/thomas/Documents/kernels/stagingscripts./include/uapi/asm-generic./include/linux./include/linux/sched./include/uapi/linux./arch/x86/include/asm./include/asm-genericmodule-common.cint-ll64.htypes.hirqflags.hpreempt.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hpid_types.hhrtimer_defs.hslab.hunicode.hquota.hquota.hfs.helf.hmodule.hasm.hmodule-common.cint-ll64.h UvSv{Us U Pss U %ss U s 1 PPQUvSvy|xy~U:\: 3 3\3V\V 1CPUASAUUUWU T BVBGTGUVUWTU?S?aUahU T QVQZTZaVahTP 'PE0EQSZh0Ub\bgUT`V`gTpx1SPP"PU>V>KUKLU(T(:S:KTKLT(Q(E\EKQKLQ(R(G]GKYKLR UMUM\UU\U\MTMVTTVTVQ_Q_+R+QQQ@MXMXXXXXMYM\^\YYYY^SS]]PbhPp3 PP p3 $0.  33    33333 833    33333 82U Ts  QU%\T%P     ?U?V^l^U^?T?TTT?Q?VVlVPVQV?R?RRR?X?V]VlXl]XX]?Y?YYY?T?V\l\|s\T\?0?VXlXXX0X'Q'9v }"'sp#|#-(/v  p#|#-((0v  }#|#-((SSSS&P&f\\\\spSBv  }  r P{ r{  r_SuSSS_ u   _ u   _ u   _ u    S   8VP11111P0PSPS&P&/S/4P8DUDySy~pDu8Dys8y~pp!PP u8S\u8 U UU&V&v}uUUVu8&v8&vp}XuXU#8u8v8nvp~U#8c^s^~:P~p~ S:FSpS S:FSpS 0:F0p0 1:F1p1 0:F0p0 S:FSpSPAMPp|P 1 S1S S PP P~S9ESUYSS1=SMQSS1=SMQS01=0MQ011=1MQ101=0MQ0S1=SMQSQr1:rMOQOQrSS S SSFJSFJRFJRSFJSFJRFJRSFJSFJRFJR &\l QPFJP  R*3RFJRSFJSnUnUUUUUUU!U!0U0DUDSUSfUnTnVTTVTVTTV!V!:T:DVD\T\fVAQASupSupQSupQQSfSAQASupSupQSupQQSfSP&][\[s|\\q|\f\|8s]]|8]|8!|8!f]-qqqqt#v##5q5;t#;?v#q(N]]!]TT@0qT TVVV20U01Q#UQ# $UUQ# $UUQ# $00 $11 $00 $UUQ#&PP 1 U 1 U   U  Pq(q(UUU T STSTSS Q V|XuXQV|XuXQVV Q V|XuXQV|XuXQVV/}h}"}=b}O]T]]]00200TCPTPWp jTTTp T"Q(@T@D}8$  #%! J[T[_}8$  #%! eT}8$  #%! *qhT]qh]hsH{qhqhqhqX s( qh "sH(:qh:DsHJ_qhezqhzsH00P0P00PE0H s0.r s0. s0. p $0. s0. s0." s0.(D s0.J_ s0.e s0.  SSSSS:q G,dmq G,mx sG,q G,q G,q G,q G, sG, q G, " sG,(:q G,:D sG,J_q G,ezq G,z sG,  SSSS2V*V * vH*vH0*0S@0}U's0',u0,-Uu(V(,uX,-UXU's0',u0,-UvUv_UU_U_U_U_6_vTv]TTTT]TT]T]T6TvQvQ~|"^0Q^Qq^QQQSs|"|"^S^6^;P;HU8PHPHPHH67T7HZZ|~]T]TZZTZZZHTHe]e}|T|]T]TtpYT]T]}||T|,Q7H$q#r#-(e^Q^Q@|0@@|QQSs|"|"X\\\\\00000)6 S-~SSSP P|#+|#+|#+|#+   ev     @|0)ce @|0)   0\^1   j  $q#r#-(N[^0QQSSW    W     R000W    Y1Y1909Y1 1   $q#r#-(0QQS        R000  8888^G^^^ G    G   @G@@@ G   ^  @ 8 U aUa_UU_U_U_U_6_'U'mSmnv8nsUsySy~U~US P .QdVdiU8ipVptuHtuU8uyV u>.V U'U'mSmnv8nsUsySy~U~USVDP+U+V|puXUVUUU U V+T+DTTD_uU8_uHU8__P^PTUT^U^P P U+U+V|puXUVUUU U V~Nd~~ SNZSS SNZSS 0NZ00 1NZ11 0NZ00 SNZSSPUaPP 1 S1S S P~SIUSSSAMSSSAMSS0AM001AM110AM00SAMSSQtACtQtSS S SSSTTSSTTSSTT *p QPP  T:<TTSSU9V9BU$T$8S8;|;AuABTt8=]=AuXABT#8SUSy\yUU\\UU\U\d\drUr\UUSTSTTT#T#22dTd|T|YTPFUP$u8$J|8JUU#8Udu8d|8#8|8U#8#8U#8|8U#8|8d|8dru8r|8U#8#8U#8TUYT p T 1 0pT T0Y0Y0Y12|8#8|8#8U#8|8U#8|8d|8U#8#8U#8#<Y\\\\ \\\Ipp___F_B11PDD 1 1E1ED1B00]]010 ] 0E0E]0 VV  vG, vG,? vG,  V S| USSss sU[SFS[VFVUSNSFSNVFVSss sVTQ^PV"VS"SSVVV2V<0pV VSssspp ʟ0XXSS S S SGSSVV V V VGVVP\P\ \ \%\\P\RP Q |YsY]] s%s s0 <PSSsssWSGSsW]G]Sss s]TQsP]"]S"S \ \r G,. |G, r G,     \\  \ \  < <  0P 0< < <%< <  s(]]%]SSS%SSX]00]]\\ I@$EQEHRQ}}[00[\\[X#sXT#sT[00)Q),RQKP\\# |G, |G,  \C0CPCX sT sC0QRppp SVVV2S\\\299#933#3VV#VPTPTPPTRPP Q]]#]\\#\r @$r 8$!r !"r @$r 8$!r ! &r @$r 8$!r ! HC$' OQ\4PPP pG,+ tG, tG, pG,   P VV vG, vG,  VL L  T40QT T3  333 83  333 8r  p  QPR R   ʟ 0XXt# 9^G]^9\G]\t9vG]vSs"S'Q@KQSs"SSSjVV V0]jVV VEv v P UU} a00] 0\  p!+ @$ !q! \P V V N vG, vG,  v# |@B$ $0) p!@B$ $0)+! @$ !q!@B$ $0) |@B$ $0)  s0s0 s0s<s<s<-\-ZPZu\P\ P \ \%\uVVV V T T V V%V v l000S 0 S%0 l000] 0 ]%0PPP V V) vG, vG,  v#4SSVV VV%Vv] ] ]%]P\\ \\%\_^9SSSs PSS%S V V vG, vG,  U\\^s0s0s0VVV2\\UV<vxP 1 U  1  U  1  U 1PIUIPvxUIuIpvU#RRJQ6R6vU#Rq(q(q(q,q,q,q0q0q0q4q4q4q8q8q8q<q<q<0U0^U^G^0T0_T_G_0Q0G0R0@G@0X0]uX]XGX0Y0\Y\G\2P2SSSPSGS0]]]0]G]VV00V011PV1V1G1__A G, G,  _vvS P R s Qv SS`SSGS`\\G\Sss s\TQsP\BB\"\SBBS"S___20U0gUgnUnUUUfU9T9gTgtTtTTTfT5Q5SSSXUXYQYgSglQlSQQQS#Q#WSWfQ5Q5SSSXUXYQYgSglQlSQQQS#Q#WSWfQv+9v9G0"vTT"RTTT p T 1 0pT T T T9FTFGT T T9FTFGT T T9FTFGT 29G2AUAV@8VTVT^T^T^AQA_Q_T_PPT QPQTPX p p X # P t  q X]]]T]P;P;\QPQ\\T\ Q P<Qu>?U?DUDHS)U)9S9>u>?U?DUDHS)u)9s9>U>?U\?DuDHs u u uu!s!&U&'U\,0sV(,Vs\@I$ $0)u8@I$ $0)s\@I$ $0)7U7q]qvUvU7T7mVmvTvT4S4>SUYS t(u.    t00.]d t00.   SUYSS*U*^U^U^"^")U.T.STSTSS)T5P5_TPP$_.P.@]]*u*~U\~U\~"~")U\ uTp @$p 8$!p !"p @$p 8$!p ! v@$p 8$!p ! v@$q8$!p ! v@$p 8$!p ! *"p @$p 8$!p ! *TV*U*^U^U^"^")U t 0PPP pG, pG,  PSSF sG, sG,  Sp r VIUIJUJSUSUUSUUSUUSUUSUSU SSUSITIJTJTTTTTTTTTTTTT TTTRTIQIJQJQQQQQQQQQQQ QQQQSSUUSUSSUSSS ~s(~]s(]]]U]]]P\\P\PP+\PZ-Z-;@vvvvUvvvPP3333U333;-;GQGGUGGGXRRRlR@TTT Tj^^8$  #%!^^U^^^j\\\\*\p\\ S <0vS S%vs(+]]+TT P +PPP+xxP]HPP\P\HH0P0P PHH H  33    33333 8p Qp QSUUSUUSUSS#SxS s(s(u(s(R000P^U0^^#^x^z}}}}#}x}e\\\\#\x\CVVVFVz-zG--GEGV-EE#ExG S < 0}S S}%s(s(%VV P %PPP%rrPP^~~~^^+^__^#^^KK^#^~~~U]U]UU]U]U]UUU]UU]UhTh\T\T\T\9Q9VQVQV____0_PSPSS0PS0P0SPSPSPS0]0P]000]P@0}0}<00]0<0=0;0^^^TTT8$  #%! ~@B$ $0.~@B$ $0.~@B$ $0.  , s}. s}.,]]  /QQkr G,r G,r G,r G,  Q VV VV1100|4|4|4SSS|8|8|8|0|0|0 S\\ ] UUUVV P SSvQVvVV* vG, vG,Vqqq SsssS|0|0|0UCSCDvDKUKLSLPvPVuVWU4V4;U\;@V@FUFGU\P\!(\UCSCDvDKUKLSLPvPVuVWUVVcUcVUUUKUgTgSTTTKS]]]K]K\bw\&\l0lV0VV0%0%KV P OXXX\ uv v0$s0$.AEv0$s0$.  p  x p  x  X X  X\\qv   &<|Sh|&|V v vv\6U6U6T6TVVV_//00VV]]](P(+R+___P P ^^T^p^SSS000(P(+R+___P        P  X }S|3$s"#@0.|3$s"#@0.S^ss  _ _S^_-\Q))\)VQ)\VQ1.P_PSPS},},},|3$s"#@0.|3$s"#@0.S^s  S^shss}(}(}($U$xSxv|uUSS:\:>U>\UU\U\\ufsfzVz|uULssVskVs?11PV11$U$xSxv|uUSSs~s~s~VS\ v\s~\\h\VV"V?PPTPTTs5Q59X9=sss $0-(QV<PPTPT<<0P0P P<< <  ps\00\TT\""Q X $sss $0-(Q)U),QU\11\>$>$RPTT$ tG, tG,  TG0GPG"Q X sss $0-(UQG1G>$p p\O\F\ ss\s~s~ s~TSP\"\\\USUSUTVTVTQ\Q\Q\^c^T_Y{_u0u]P]PUSUSSS GUGeSemUmSS GTGfVfmTmVFVF`T`V \&\\F\PpQQP u\ s F\ U| S F|||PX\\RSSFSRVVFVSss sVTQsPV"VS"Ss0 0P<0TX0<QTXQ<TXXsTXX T sTXT<0TX0<B?$TXB?$;P QTXQ qG,TX qG,  Q303P3X sT s303B?$pp!U!^U^lTlGQG_Q_~U\~~~~~UISIOPOOS%SuIsIOpOOs%sus#S55S%S/s/5p55s%ssXSsU@V@IU#T#7S7D}DIT#Q#B\BIQU%]%*T\PSPU]].U.^U^U^WTWVTVTV*Q*SQSQS<U<vT\vUv4P4HsPv vP  J\cw\]]]$T$VTVTVq@J$ $0)t\@J$ $0)0v\@J$ $0)t\@J$ $0)  'QQ qG,  Qp s# SSS2USUUS4PpP p0$0)  v0) p0$0)PPP000s U5s s Us s U s  1 PPQ2U2\S\aUakUkkS"S[1ak1"1S##S"SsssUSUS^T^TTUTT#Q#\Q\QaVjVp3PFFPF]4p p3 $0.7; p3 $0.  *TTKp G,KM tG,p G, tG, uG,p G, Tssv ] P+U+>S>CUCDUDIUIMS u u  uU'S',U,-U26S$V.2Vs8@I$ $0)u8@I$ $0)s8@I$ $0)Ue|xeuUTDVDuT S 2SUVS SS)|x).UVvx.TUS*USUS USSU0s06UT(V(6TS%U\P V PU0s06UuSSn EuJuu q /u#U UURt G,Wt G,t G,  UU U @ 0qU q U 1 0qUVUVUVUVUUV U V U V U VUVUVUV&VTPT TQRTT TT T TTT T&T!Q!SQS&SRRQRRQRRQRQR Q R R Q R R Q p R Q R Q R R Q R Q R Q R RQRQRQRQRQRQpRQRQRQRQRRQRQRRQRRQRQRQRQRQRQRR&RX\X\X\X\XX\ X \ X\X\&\Y]Y]Y]Y]YY] Y ] Y]Y]Y]&] &900PPTT T TPUPVUV U V U U V USS S SoRoRQRRQRR Q R R Q p R Q Q R R Q R Q R Q R R Q R Q R Q R Q R QRQpRQRQRQR     U V US S1qqQS St t0Q 0S St t  vqTqvPqFq U V US SqqcQS St t0Q 0S Sct t  vq;qvPq(qRUURSS>QSS@@0Q0S S>@ @  quoUUoSS[QSSLL0Q0S S[L L  uq:quq,qqu<U<`VU`SSHP]rrXRRSS<<0P0S SH< <  pv%UU%SSQSS440Q0S S4 4  -UU-SSQSS880Q0S S8 8  AUUASS-QSSDD0Q0S S-D D  33 U VUSSQHq/qSStt 0Q0S St t  vqkqvPq]qUVUVUV UVUVUV&VTPTTTTT TTTT&TSSS SS&SWQWRRQRQR Q R R Q RQRRQRRQRQRQRQRQRQRR&RR &X & &  P    & UVUV UVUVUV&V}T}PTTT TTTT&TSS SS&SKQKRRQR Q R R Q RQRRQRRQRQRQRQRQRQRR&R & &Q^ Q Q PQ^ P _ P _MSSM  M44MM22;QMDDSSDD0Q0S S;D D  q u## u U*  *   PP_jSj  p jjj2^>P>_SP0^S S+P+ P  Q _         Q    8 ~vPSSP  P<<PP22cQPLLSSLL 0Q0S ScL L  quuqqDSSD r rD44DD224QDDDSSDD 0Q0S S4D D  ISSI  I88II22tPIHHSSHH0P0S StH H  pUSSU  U$$UU22QU44SS440Q0S S4 4  qv u## u U*   *    PPP_lSl 9 p  l ll2|^@P@aSP0^S S-P-| P  Q _         Q    8v~.~>$>$>$000SSSRR+  QQRQP PP SSS sG, sG, sG,     SS >$>$ 00 PPR QQ r $0)  ppp >$SSS2rUr S U S U SU&SSUSaTaP T P T T P T P T T P TPTPT&TTkQk Q Q Q Q Q Q QQQQQQQQ&QQ/R/ ] R ] R R ] R ]R&]]X \ X \ X X \X&\\VQ Q V~y$VV~yV   <8 @DHL L L4$4848484 4 4<4<4 48484<4$48484 8 8 8 H D @ H  ȟ    H        H     4 < 4 D 4 D4D4D4D4D4D4D4484D48484<4D484< L 8 !D!! !"D"# #$D$% %%D%% : :D D D<D   5v5NvNavasvsvvvvvvvvvvvv v( v4 v vvvvvvvvvvvvvv~vv4vvvvvvv v !v!!v!"v""v""v""v""v""v"#v4##v##v##v##v#$v$$v$$v$$vv:v:MvM`v`svsvvvvv4vvvvv v v$~yvv$ v !v$!"v"#v$##v#$v$$$v:v:v$vv$vv$~yv$vN0Nk6 0 0 ;6;0u#0P0lTl ll@VV !V""V$$V%%V:VVVV)P)0VP P  vvv v!"v##v$$v:vvvv s Pvvv v!"v#$v$$v:vvvv1vvv v!"v##v$$v:vvvv$vvv v!"v##v$$v:vvvv    !" ## $$ :        !" ## $$ :        !" ## $$ :        !" ## $$ :    !    !" ## $$ :    #, #, #,8 2 vvv v!!v"#v#$v:vvvv 8 vvv v!!v"#v#$v:vvvv s##<vvv v!!v"#v#$v:vvvv 3 v vv v!!v"#v##v:vvvv 8 vvv v!!v"#v##v:vvvv s Pvvv v!!v"#v##v:vvvv 4 v vvv !v"#v##v:vvvv 8 vvvv !v"#v##v:vvvv s##@vvvv !v"#v##v:vvvv 5 v vvv !v""v##v:vvvv vvvv !v""v##v:vvvvpp U     PP_pp;vT;_'PPT_  p "p "  6 vvvv v!!v""v:vvvv     vvvv v!!v""v:vvvv s## U-   PPP s## U'   '       !! "" :     PP s## U*  *   PP_vv vv U s@@ @@ T __ __!P!Hqq q P 7 U 7@@ T 7__7  7  PQ  U @@  T __         PPp "7 q $ & " q $ & " q $ & "p "  7 vvvv vv  <  vvvv vv#s##&P-vvvv vvovvvvvo_____o     "P+^^^+___+   +   +   PQ ___              PPPp/QQQQp  8 v vvvvv < vvvvvvsPvvvvvv 9 v vvvvv   vvvvvv : vv  8  vv s## "vv ; v v 8 vv s##vv < v v < vv s## %vv = v v $ vv     $ $ $8   v^v 8 v^v s## "v^v   v <v 8 v<v s##Pv<v   v v 8 vv s## vvPTETPTE  E88EE@@<QEHHPTPTHH 0Q0P P<H H  sqqPETPTE  E88EE@@:QEHHPTPTHH 0Q0P P:H H  sqq0P0sTs ss@V~yVVVVLV_rVV~yV)P)0VP P  v$ v$ ~yv$v$v$v$Lv$_rv$v$~yv$wv4v4v4v4_,T_w@@@@!PP-_,T_-@@-  -@@PQ __ @@ @@     L _r   PP ?p /QQQ?p sPv v ~yvvvvLv_rvv~yv1v v ~yvvvvLv_rvv~yv  s P v  v ~yvvvvLv_rvv~yv1v( v( ~yv(v(v(v(Lv(_rv(v(~yv(<v* v* ~yv*v*v*v*Lv*_rv*v*~yv*sPv, v, ~yv,v,v,v,Lv,_rv,v,~yv, 2 v4  v4 ~yv4v4v4v4Lv4_rv4v4~yv4 D v6 v6 ~yv6v6v6v6Lv6_rv6v6~yv6 3 v v ~zvvvvvLv_rvv~zv D v v ~zvvvvvLv_rvv~zvuvvvv_,T_u@@@@!PP-_,T_-@@-  -@@PQ __ @@ @@       L _r   PP ?p /QQQ?p  4 v v ~zvvvvvvLv_rv~zv  D  v v ~zvvvvvvLv_rv~zvzvvvv$_$1T_z@@@@!PP2$_$1T_2@@2  2  PQ __ @@           L _r   PP ?p /QQQ?p  5 v v ~{ vvvvvvLv_rv~{v  D  v v ~{ vvvvvvLv_rv~{vzvvvv$_$1T_z@@@@!PP2$_$1T_2@@2  2  PQ __ @@            L _r   PP ?p /QQQ?p  6 vv ~| vvvvvv&v9Lv_rv~|v  D  vv ~| vvvvvv&v9Lv_rv~|vwvvvv_,T_w@@@@!PP-_,T_-@@-  -@@PQ __ @@ @@         & 9L _r   PP ?p /Q QQ?p  7 vv~| vvvvv&v_rv~|v  D  vv~| vvvvv&v_rv~|vwv vvv_,T_w@ @@@!PP-_,T_-@@-  -@@PQ __ @@ @@       & _r   PP ?p /Q QQ?p  8 vv~} v v vvvv&v_rv~}  D  vv~} v v vvvv&v_rv~}ev vve   e@ @@!P_ @ 878 8 8 8888&8_r88 @ 87 7 7 7777&7_r77 ?p /Q QQ?p  9 vv~} v vvv&v_rv~}  D  vv~} v vvv&v_rv~}wv vvv_,T_w@ @@@!PP-_,T_-@@-  -@@PQ __ @@ @@       & _r   PP ?p /Q QQ?p  : vv~~ vv&v~~    vv~~ vv&v~~ ; vv~ vv&v~  8  vv~ vv&v~ s##Hvv~ vv&v~ < vv~ vv&v~  D  vv~ vv&v~qv vvvq_ ___q@ @@@!P.^^.__.@@.  .  PQ __ @@        &   PP ?p 1Q Q Q Q?p  = vv~` v v vv~` 8 vv~b v v vv~b0vv~d v v vv~d">"v v~h v v vv~h$!8$!v'v~j v v vv~jqv v v vvq_ _ _ __q@ @ @ @@!P.^^.__.@@.  .  PQ __ @@             PP ?p 1QQ Q Q?p  s##Lvv~l v v vv~l ? v v~p v v vv~p < vv~r v v vv~r s## %vv~t v v vv~t @ v v~| v v vv~| D vv~~ v v vv~~ A vv~~  8  vv~~ s##Tv%~v~~nSSn883P)VV)SS)88)  )88PQ SS 88 88n   PP7pQ7p   <vv vv U%2T     *P,___U+T,   ,   ,AAAPQU    AAA     PPPp5QQQp UsU0T0mSmsT2P27`t3(V(,P,nV2VV Uu)U)oU#osUPS+P+8S8>P) u30.)o U30.os u30. ^ ^@/ /@uU v  P`PS U 6S6=U=ASp  sp'  Pusp   u0. U U\#U#VUV\\\I]]]}S}~oS~oS~oS~oS~oSl^^^ p~p~pXs{PpXPPg glP P SP P P Q-\a|@$|8$!|!Q\ RRLRLU:VVVSSSS SSVP| VeiVP|$U.6U $U.2U $U.2U 20 21 20 $U.2UQ$,Q 1 U 1 U   U  QUSUS+T+\TT\+Q+yVyQQQVQ+R+]RR]PDVkyPyzVV^^[P Q%RS0z00PDVkyPyzVV0 0 0 S6z66 0 1 T \T\ UUT^P^R0Q^ ^^^$ ~G, ~G,  ^pp^^^2USUS.T.\TT\.Q.VQQQVQ.R.]RR]PDVrPVV^^[P Q2s(s(S000PDVrPVV0 0 0 S666 0 1T\T\UUT^P#^^#RR#0##Q0  ^^u G,u G,   ^^^$ ~G, ~G,  ^pp^^^2;U;UUU?T?STSTS?Q?VQVQVUQV?Q?VQVQVUQV^^^z]]]\qx|yxuy|y\|y _s  p H p HUIUUQS S10T SSt G,p G,*t G,Zp G,t G,p G,     SS  SS  000U0SSS2 USUS P        DUDSU!P4S40U8us U#UDSDIUISUUSUUS:SP;QV\P\cQS1 S tPS RU}S}USUUS:SP0QS? S @P S R'U'hShiv0iqu0qrUrSv0u0USv0u0USv0u0USv0u0USv0u0USeSW\W]uy]^U X^y\yuyU X\uyU X\uyU X\uyU X\uyU X\e\?]Da]f]]]]]e]'U'hShiv0iqu0qrUrSv0u0USv0u0USv0u0USv0u0USv0u0USeS \ RUkSkn|nsUsySy|||UUS:SPV U!(VS8S R|U|SUSUUSS|T|TTTT"T"VsTVsVsVsVsVs P ;VX`V   & &Q\   |@@@@Y@@    HDL\ܟ  \     <8(,04 4 4 HDL\ܟ  \      &KX<8(,04 4 4  4;6; ;6;6W\Yd\\\\\\\\\\\USSTTV SPS XUkSkn|nsUsySy|||UUS:SPV U!(VS2S RUSUSUUSWSTTTTWTEVV  FT 9O@@U@U@W@ PnPPSSV6SFHSPFHPVP s## U''  P s## U''  P S XUuSuzUzSUUS:SP0QS= S 8PS R.U.UUUU.T.STSTSS.Q.V|yuyQVQVQVV.Q.V|yuyQVQVQVV sm^s^N^^s#a~0~N~~]]]]  SS1q G,vq G,q G,q G,q G,% sG,    SS   SS   @@   0s#0SSSS2V RUdSdiqyijUjnSnsUstUtuSu{U{{SSSTeVejTjoVotTtvVv{T{{TITISVP0PiRj{0S0 ssQU#RsQU#RS XTUSUSUUS:SQ4SelS@el@ Q 3 S R U SUUSUSUUU UUU UUU 000 111 000 UUUPPP 1 U 1 U   U  P2S26U67U70U<S<=vy=BU0U0nVnyUyVUVUUV&V0T0mSmyTySTSTS&SJ]Q]]]&]D\Mz\zU\\&\2^2^(TS tG,  TSSS2 U S|yuyU SS9T9VT VV"VV10V VS S SSV V VVPYPYP"P vQ] ] ]c] A8$@$!!h^ ^ 8$@$!!RYRd^   ' 's    V-VVV & 8VV 8tt800 S tPPYPYtt0Q0P Pq4qSqQqqtt t  sqIqsPq3q'Y+#pG, yG,   p p^VVV2S R!S:S!V:V V V V 2S RVSS=SVV=V`]R$Q$__^^ RV r  q 0^V VSS__]P]_0R] ]=_= = = = _  8S RSSSUSVVVUVP^rQrph__P]PVV8800V V S ]PP'^']'0Q^ ^] ]  O4O O O4O44 8VVV2S RSVVVV2U>S>D|yDHuyHIUIYSY\|y\`uy`aU T BVBITIZVZaTUWSW\U\gSgrTrsUssS:S!S!> P 1S RUYVY[|y[`U`qV T /S/2s 2>S>KTKMs Xs  X,(H`gTgjs Xs  X,(HjoSoqT$Q9@QCJQG GM0`j0jq USvyUUkSklvylqU%U%cScdvydhuyhiU'SS%U%]S]^vy^buybcU!SSUBSBFUFSvySXUX]S]_vyG GRSRXPX_ S@3U3S}lpl]P^p|0PQPz0z\z0zV   PP sU r  T q \ @B | @B\ @BV @B v @BV @B"uUOSOPviPTuiTUUuOsOPvyPTuyTUU#US}UUSS}!u!"U&T&^T^^"T&Q&\Q\\"Q&R&VRVV"RUUU UUU UUU 000 111 000 UUU Pw{P~P 1 U 1 U   U  PpU`iUluUU\eUhqUU\eUhqU0\t01\t10\t0U\eUhqU QR[Q^gQ 1 U  1  U  1  U 1Q$U$XVX\}y\`uy`aUaV}yuyUV}yuyUVUUMV$T$Z\ZaTa\T\T\TTM\$Q$;S;SsSaQaSQSQ Q MSUUTTTTTTTT2UDSDKUKLULMSMUUUUSSTEVEKTKLTLNVNUTUUTTVQG\GKQKLQLP\PUQUUQQ\ U UUUjU T fSfqTqSTSjS Q jVjl|ylpuypqQqVQQVjVQ[V[]|y]auyabQbVQQVjV~UUjU@S@KTK~SSjSDVDF|yFJuyJKQK~VVjVpHUpp"s#SSSS2Sp S 1 0pS S.V5VVV00V R&U&UUUU&T&wSwTSTSS&Q&xVxz|yzuyQVQQVVQgVgi|yiouyopQpVQQVVUUUGSGQTQSSSHVHJ|yJPuyPQQQVVV -]s]]L]}0}!0!L} pr! Ppr(s#@$s#8$!s#!rPPTP}@$}8$!}!!%P%F}@$}8$!}!?RXXQ%}(H0H%$!0)(8/^QQ=QQQ%RSSSS2 SSJt G,t G,t G,t G, sG,!8t G,8< sG,Bct G,cg sG,   SS SS }s#SpxS}SprS1pr10pr0rr} SS tt 0}0}4#}4}48}4SS},},V R U UUU5U T fSfqTqSTS5S Q jVjl|ylpuypqQqVQQV5VQ[V[]|y]auyabQbVQQV5VzUU5U@S@KTKzSS5SDVDF|yFJuyJKQKzVV5VpHOpSSSS2Sp S 1 0pS SV R U UUU5U T STSTS5S Q V|yuyQVQVQVUVUV5VQV|yuyQVQVQVUVUV5VUUU5USTSS5SV|yuyQVVUVUV5V sdQsQQQQQs#Xq0qqqqq  SSq G,0 sG,m sG,q G, sG, sG, sG, sG, sG,    SS   SS   @@   0s#0SSSS2V R'U'*S*0U0>S>DUDDSSUSSSTvyTXuyXYUDTTT:T:YT 1   6S67vy7;uy;<U+U+,UUUU&U&2S26U67USUU*U*9S9HU u#V#'U T oT`XY%q H0H%$!0)(8/ U\UUU\U\U\ U \ U \U\U\U\U\U\U\U\!U!!\!!UNUNXUX\U\U\U\U\TST!SS!TvT10vT T,U,\ \ \\\\\\ U \\,T,S S SSSSSS SSs#PPV VPVVVVV8V,T,S S SSSP^SSP^ SS QQ ~Tv S t 0s#S S-  v,U,-vUv (U()vU (U()vU )00 )11 )00 (U()vUPP1U 1 U U PUvVV \ tP\\P^P^Mq7qQP^P^tt0Q0P Ptt t  |qrq|Pqcq^t0P^ ^V2+ vU+v U U 0 1 0 UP 1 U  1  U   U  PUvVVV RSSS2 U \\\:\\SSS:SSPO]P]:]P]VVV SSps#  }UU} UU UU 00 11 00 UU PP 1 U  1  U   U  PU}]]] R;U;\\\ \ \ \ \\\\!\\U\\\\\SSS S S S SSSS!SSSSSSS|8|8 |8 |8 |8 |8|8|8|8!|8|8|8|8|8 P P ^^SSSSP V S S SSPVS!SSSSSSSv~vPX]]] ]]PY]]Sv SS tt 00vS S%\\\%]]]P^P^^ ( (  (  (  (  (  ( ( (! ( ( ( ( (/  p)U)/~ U ~ %U%&~ U %U%&~ U &0 0 &1 1 &0 0 %U%&~ UP P 1 U  1  U   U  PU~^^.^.\R:QQRQp .RRQp  \ tP2 2\ \PV P VQVq7qPV P Vt t0Q 0P Pt t  |qq|PqlqSSS2 ^ r 3$"&U&\U\\\ U \ U\U\\U\U\U\U\UUUNU\U\U\\\\U\SSSS S SSSSSNSSSSSSSSP__P___ _____N____P___P_Sv"S{S10{S Sg___gSSSd]]] P A\P\"P ] @PP\@0P\ \SSS2 S S S 2/  )U)/U %U%&U %U%&U &00 &11 &00 %U%&UPP 1 U  1  U   U  PU__    UU U  UU U  UU U  00 0 11 1 00 0 UU U PP P 1 U  1  U   U  PU__SqS10qS S_ _ _ _6_mr___S S S S6SmrSSSR~ ~ ~ ~6~mr~R~~!P!4U4   6mrP#q{{#] ] ] #6]mr]]\ \ \6\mr\\ qh 7QR  6mrQ p ^ ^ ^ ^6^mr^^r0rXY0Y 00mrXYQ->PP Q PP SS DD 00{S S~ Q PPU0PU U  ) q )    Q Q  (0(-P->X X 00_0_Y 0Y_ R___K_SSSKS\\\K\Pz^P^s#\]]TC}T}Y|SSS2 S S 8 8 0 0s#S S \ LPP^PLL0]0P P\LL L  _ R    UUU UUU UUU 000 111 000 UUUPPP 1 U  1  U   U  PU_____7_SSS7S]]]7]P\\PPs# S S L L 0 0s#S S ] LP_]]P_\PjQQP\PLL0Q0P PjLL L  }qWqq}qIqqq}\\LL0P0\ \___N_SSSNS\\\N\.P.]P p# Q{T qhDD sH SS DD 00{S S\DPPD0p#P P p )   \D D  _ RSSS2_XXp3$"SS pps# S 1 0pS SSS tt  S  1  0tS SSs#US}pUSUUS}pupUS}pTUS5S\\\\\5\P^VgyPzVVPVS7 \ LPs!]]]]]]001100]]RRR 1 ]  1  ]  1  ] 1R& Jd s!]!%U%&U#JZsZ_]_ctcdU# !]!%U%&U#JJ] !]!%U%&U#JJ] &0JJ0 &1JJ1 &0JJ0 !]!%U%&U#JJ]P@YP  1  ] 1 ]   ]  Ps]tU#STUSTUS R U UU U U T VTVTVTVTTV Q SupSTQSupQSQQS Q SupSTQSupQSQQS#r^rrTVVVV2$  s$UUstQ#UQ# UUUQ# UUUQ# 000 111 000 UUUQ#PPP 1 U  1  U   U  P U stQ#STQSTQ"V rV10rV VVL0rr1r "r r r(r(r(V S RUwSwUS}pupUS}pTUS5Si\p\\\5\PMVVnV|V \ @Ps]w]]s]]s]0s01s10s0]s] PiuPxP 1 ]  1  ]  1  ] 1P& D^ s!]!%U%&U#DTsTY]Y]t]^U# !]!%U%&U#DD] !]!%U%&U#DD] &0DD0 &1DD1 &0DD0 !]!%U%&U#DD]P:SP  1  ] 1 ]   ]  Ps]tU#STUSTUS RUUU\TOVOXTXiVirTryVyTTVQNSNXupXhShqTqrQrsSsupQQSQNSNXupXhShqTqrQrsSsupQQS qVVVV2L s.U.2s2;t;<Q#$>$G00_VV0U0:s(UR" |## R7PVV" vG, vG,  V2"212>$202PU s(R |## pp]]]]]]00 11 00]]PPP  1  ]  1  ] 1 ] 1P& Qo s!]!%U%&U#Qesej]jntnoU# !]!%U%&U#QQ] !]!%U%&U#QQ] &0QQ0 &1QQ1 &0QQ0 !]!%U%&U#QQ]PGdP  1  ] 1 ]   ]  Ps]tU#STUSTUS RGUGUUUUGTGVTVTVVGQGSQSQSSQSQSQSS4}4F0m}}(}}}}*}(Q=0000~@I$ $0.1$P000=0000Q#~H0H%$!0)(8/*~~H0H%$!0)(8/000 }}}"}(~al~~~(~2@ @VVVV2   sUUsUs UUUs UUUs 000 111 000 UUUsPPP 1 U  1  U   U  PUsSSVrxV}V10}V VV80}VD0}0VS R8U8MSMWUWS}pUSUUS}pupUS}pTUSzS<\C\\\\\z\ P iVrPVVVP'VUCNS\CN\S2S3\tP]]]]]]001100]]PPP  1  ]  1  ] 1 ] 1P& Jh s!]!%U%&U#J^s^c]cgtghU# !]!%U%&U#JJ] !]!%U%&U#JJ] &0JJ0 &1JJ1 &0JJ0 !]!%U%&U#JJ]P@]P  1  ] 1 ]   ]  Ps]tU#STUSTUS R'U'UUU~U'T'VTVTVTTV~V'Q'SupSTQSupQQS~S'Q'SupSTQSupQQS~Su]|]]]~]=0|000~0~040P p q -( ,~$8$  #%! q -(Q~~ ~*~V80~VVVV2( u  s(UuUstQ#UQ# UqqUUQ# UqqUUQ# 0qq00 1qq11 0qq00 UqqUUQ#PgPP 1 U  1  U   U  P U stQ#STQSTQV\bV~V10~V VVVtt00~~,~,~,~4~4~4+~KS~R+QKOQOSR Q p R?CRCEQEGp VS R-U-S}pUSUUSUUS}pupUS}pTUS5S\\u\\\\5\PZVn}V}PVPVS1 \ tPs]ix]]]et]]]et]]0et001et110et00]et]]R[gRR 1 ]  1  ]  1  ] 1R& 8V s!]!%U%&U#8LsLQ]QUtUVU# !]!%U%&U#88] !]!%U%&U#88] &0880 &1881 &0880 !]!%U%&U#88]P.KP  1  ] 1 ]   ]  Ps]tU#STUSTUS R(U(UUUUUUTVTVTVTVV(Q(SupSTQSupQSQSSQS(Q(SupSTQSupQSQSSQS T =]~]]T]]]]]&R]W]T] p v#pPPPrv#%v#=0~000 0]00]RR%v#0vO+( V 8 0RVVV2*  s*UUstQ#UQ# UUUQ# UUUQ# 000 111 000 UUUQ#PPP 1 U  1  U   U  PUstQ#STQSTQ$VVpRV10pV VVVtt0p0V VS2 VV S R-U-PUPUPUPPU*T*TTuSUSpUUpUpU U U_q|qqq T##R%q(H0H%$!0)(8/R7Tg{TTT T## 8$  #%! T t 0qT TTqqaeqU+TTVTaeU TRHJRUWTU0S07U78U8SvpUSvpupUSvpTUS9ST1V17T78T8TVTTV9VP\q\v\\\9\uV^mVVV^mVVV^mVV0^m001^m110^m00V^mVV PT`P{P  1  V  1  V 1 V 1P s Qs\ s Qs\$ 3K sV#U#$U#3CsCDVDJtJKU# V#U#$U#33V V#U#$U#33V $0330 $1331 $0330 V#U#$U#33VP)@P  1  V 1 V   V  PsVtU#STUSTUS XU2S27U78U8YSY^U^_U_`S`fUfjSjoUopUptStyUyzUzzS=STzTzzT3T37r7=T&V+MVRTVY^VchVmmV=VS XUiSiquqSu~USuUS8S]\]bupb\TUh\upUh\8\UiSiquqSu~USuUS8S 4L jx s U4@U@DsDKu~KLUXjwUwxUX U00UfsUstUX U00UfsUstUX 0000ft0 1001ft1 0000ft0 U00UfsUstUXP&=P\iP 1 U  1  U   U  P U su~UX\TUh\TUh\ R+U+YSYZvpZ_U_S SU6sVrVVnVVnV0n01n10n0VnV PdpPsP 1 V  1  V  1  V 1P sQs" @Y "s@Ys  V@@V  V@@V  0@@0  1@@1  0@@0  V@@VP6IP  1  V 1 V   V  PsSS U S|US@SmVvV@Vm]r]@]%U%DSDLULSUS*S%T%EVELU#LVTVTT*VSS88s\\k\\\Xg\\\Xg\\0Xg001Xg110Xg00\Xg\\ PNZPvP 1 \  1  \  1  \ 1P sQs" 6O "s6Os  \66\  \66\  0660  1661  0660  \66\P,?P  1  \ 1 \   \  PsSSU_S_`v`eUexSxyvy~U~SvUSvUSvUSS S R@U@_U __P   P]~U ]]PP^^^^ ^^ \\\\\ | \ \\ P PVVPVV V VPVPWPWxVVV Q p1U_U __3  3~~ .~~ .~~ .00 .11 .00 .~~PP 1 ~1~ ~ P~]] ~010 P 11  P]]~ P (PPPPP000111000PPRRR 1 P  1  P  1  P 1R ~010 P 1 1  P ~010 1 1  / Ic /~Ic~ *0II0 *1II1 *0II0P;OP 1&1( + P~]]pU-ppUppU p 1 PPQTTUmVmtUtVUVUVTo\otTt\T\T\c0clSltPt{0{SP0SP0 p~ PSPXPk~S~PSP PsR>GRGHsY]RR7@R@AsRVRR7@R@AsRVR07A0RV017A1RV107A0RV0R7@R@AsRVRQt79tRTQTVtRR R RRKORKOTKOTRKORKOTKOTRKORKOTKOT 0O QPKOP T02TKOTRKORUu~U#UupTU@#TUu~U#UupTU@#T#U#]U]~UTVTVTJPJSPSPJPJSPSP   Ppp1p1p1 p 1PU%\T%^U%\T%^%VU\T^V1!P\pU%V%+U+,U,KVKRURfVfmUmyVT'\'+T+,T,M\MRTRh\hmTmy\P P 2S2:P:MSMUPUaSsUs#p#*U*6s6>p>GUGJs UU:CUCDs UU:CUCDs 00:D0 11:D1 00:D0 UU:CUCDs P#P09P 1 U  1  U   U  PUsSPSPH?U?VUUV PcSS00PcSS8 8 8 66 8 1 0X`0 PSZPPD0bb0 0  2 2 202@#U#=S=CUCCSS/V44VVvUISINUNiSipUpwSp~"9p~P"9PSsUup~%p~0)U)UUUUqSWS]SVjsjjVVWs]sGV:V?kVS"ss?Js+U+VUVU(U(_V_~U||||~|PSS(SNYPY~Su]us]7]  \  ~   P \ v##@vv#uu#\|||(|_~|SS(S_~S^^(^_~^]]QQ(]_~]~VV(V_~VVSS_SSP%U%SUUSSVvxVVV\\\\\]]]]PZ]0p0p0p0p0p0p0p0p0p0p0p0p%U%ESU\7vU4sUsUs 1PPQVT]d]]S]dVVSVPT\\S\RQ3R }#8}#8\Ss U sS.U.SUSoUSoS,S2T2{V{TVTV}TVTV,VufsftU#ts_U#s_s,s.\C\\\\,\P]]10h000,000 U0,0 v##@vv#$1 }  Q$1 }  Q1U t t# \CR\\\0sARsps_s]]VV P ddhPhSP4\\    @@  :1 \\    @@    88:1*0*:11  v U &^ Q &@ U &^&\ Q &@ U ^ \ Q @  1 3PvU5^U^U^1PPQvTS(U(\U\U\UU\U\UU,T,VTTVTVTVTVV,Q,SQSUQSQSQSSQSQSUQSQSQSS PUYvPvTQ3SSSSQS!SSSUUsUsUUsUs000111000UUsUsPPP 1 U  1  U  1  U 1PS VfhV.q G,\iq G,q G,    VV VpV10pSS V TT V TT V TT2 S UQSQSQSSSTVTVVVQ3SSSSQS!SSSUUsUsUUsUs000111000UUsUsPPP 1 U  1  U  1  U 1PSSS-S-80p0s\S P s# UU5S p SU0S06U6:S:?U?@U@@SRST1V1@T@@TT8Y8RV0pUUU'T'VTTVTVTVV'Q'SQSQSUQSS'Q'SQSQSUQSS>\\\\@\\\\\\\P/%|H0H%$!0)(8/P%|H0H%$!0)(8/P%|H0H%$!0)(8/P%|H0H%$!0)(8/PPP|v#v#1v#v#v#v#%Q%(%|H0H%$!0)(8/(1PQQQFRRRR T1T17 P0 r s\0p0 r s\pP/S/< TQSUQSSSSSSSTVTVVVVVVVTVTVVVVVVVQ0SSSS QS!SSSUUsUsUUsUs000111000UUsUsPPP 1 U  1  U  1  U 1PSTSS-S-80p0p0pQ0SSSSQS!SSSUUsUsUUsUs000111000UUsUsPPP 1 U  1  U  1  U 1PSVp \V10pV V V H 0\SS V TT V TT V TT2V80\'S P s# UU5S p S/U/7S7@U@AUASUSUUSu|USu(PQ0Q)V)1u2VVVVV\#\\\\<< PPQ <P8< 81vQQv""BvvB|#|#v11v>$>$v00JP3QQB qG, qG,QCPC"v|#C1C>$C0pp'S P s# UUSRyS p R_ p S$S$-u|-.U)U)*U#)U)*U#*0*1*0)U)*U#P 1 U  1  U  1  U 1PUSvuUSvuUSSVUUVUUVVupt\\\\\USvuUSvuUSS0p0p sx\,VVVVUUVVVVUUsUsUUsUs000111000UUsUsPu~PP 1 U  1  U  1  U 1PV U U V UUV%V s, $ &% | $ & V s, $ & | $ & U !UU\U\U\*T*VTTVTV*Q*SQSQS*Q*SQSQS  vLVPTQ(SSSSQSSp|SSUluUuxsUsUluUuxsUs0lx001lx110lx00UluUuxsUs PbkPP 1 U  1  U  1  U 1PS VswV vG,R\ vG,sw vG,   VSS V TT V TT V TT2UASABvBIUISvuUSvuU+V+2U2VUUVUUUUASABvBIUISvuUSvuU+VtVVVUUVVbnVVU^gUgjsUsU^gUgjsUs0^j001^j110^j00U^gUgjsUs PT]PP 1 U  1  U  1  U 1PV U U#V P sp# UUV&GV p &3 p  V V UUVUVUVUVUVU!T!STS!Q!\Q\PT0TP*sssDPDRsP^^^0V0               000     8 T   0PT T T 7SSS  T S!SS]]]]001100]]PPP 1 ]  1  ]  1  ] 1P SVV   PPT V  P8 8V 81kTTk66-X-7s#XR#~#RW88W>$>$W00FPTT# tG, tG,  TBPB6Xs#R~#B8B>$B0p pSSS]]]]]]000111000]]]PPP  1  ]  1  ] 1 ] 1PSS'S P s# UU-S p S U !U.U.XSXcUcdUdSUUSTSu(u('VqsVVhvv@<$hI@$I@$0 q P bQ0PP] ^u^ 0u0PmtPtQ^0P707^ 71  P ^QP ^33 3vtvt 3vpvp ^88 ^I@$I@$ ^00BP  PP pG, 3 qG, pG,  P>P>3vtvp>8>I@$>0 ppNUNSUUSUSu~USSUSUDTDVTTVTVTVTVVTVTi^p^^^^^X~~~~~~~1~$~$~$~$~$~0s~0~0~0~0]^}hz]}h]]]]C_n______t0000Y00t000Pp ` -(<~(H0H%$!0)(8/ ` -(<~(H0H%$!0)(8/ ` -(0<~(H0H%$!0)(8/ ` -(O00 707t\0\\\\\\\O\\ p ` -(  (B~(H0H%$!0)(8/ ` -( SYB~(H0H%$!0)(8/ ` -( B~(H0H%$!0)(8/ ` -( K S  K S  K S  K S   p ` -(   80!p0 r s\0 r s\0 p s\U3SUR'S P s# UU4S p SoUoUUZ~UUUUU~U~U~UUUZUZUoToTTVTVTTVTVTVTVTVTVTVTVTVTVVTVoQoQQSQSUQQSQSQSQSQSQSQSQSQSUQSSQS@Q@qQq|Q|SQSUQQSQSQSQSQSQSQSQSQSUQSSQS@Pq|PPPP q( +s(s(\P\\\\\\\\\\\\\\\\ v# P]D]]]]]]]]]]]]y]~]]]@0q00P0000 q0p v1 v1 v1 v1 v15 v1 v1 v1 v1   v )   Pq G,P| G,| G,q G,| G,| G,q G,| G,w| G,| G,   v1 v1  0p T TT, tG,]h tG, tG, tG,+ vG, vG,  T$V$0T$V$0T$V$0T12Q4SSSSQS!SSSUUsUsUUsUs000111000UUsUsPPP 1 U  1  U  1  U 1PSQqSq~U~QSSSSUQTrVrTVVVVTTrVrTVVVVTQ3SSSSUQQS!SSSUUsUsUUsUs000111000UUsUsPPP 1 U  1  U  1  U 1PS%U%&Q$S$1U12QS-S-8QQ]SSS]VVV/11 q Qv VVMr G,r G,r G,    VVV40q.SSS SSSSSwSSSV VVVVVwVVV  ss  s(s( Tv]0 0_00_00W0r0  q H q HB_ ___P_W_r_,[[~0 00000w000 VVq G,q G,    VV 000_0711 1pPPP 1P ppp UU4S/^V00PV V0p0p0 p s\ V <  0v#V VSQ Q Q S Q S Q QQQSSSSSSdZPS S S S S SSSZZPZHZHe~Z~Z~Z~] ] ] ] ] ] ]]]]]]]]]d[[[[H[He~[~[[ssss?\\_P___ _ _ _ __0\0\0\ 0 0 \\000000P_s(_~ ~ ~s(~s(~s(5s(5~s(~s(~s(~fQQQQQQQ Q["~"n[nVV V V V V VV~ s P4MRMQPQ s  PP]n0n^^^ ^ ^ ^ ^ ^^0'p}#~#-( PPPPP P Pn]n~Y~Y~Y~Y ~ ~~]n]n~~R~~~ ~~]mTm }"TTTPP 0~X~P~XX~ X ~ X X 0 ~ 0 ~ XX~000000 R UU U   U   UURZ8Z  8O{0){0){0){0)H{0)He ~0){0) ~0){0){0)  [ [I[I]~[~ ~#  P~#  p  y > y  y Zp0)Zs0)s0) s0) s0) s0) s0) s0)s0)p0)  \Q1 u11111Q 'p}#~#-(6 r6a t at  }"  r r t  t   r  r^^^^^ ^ ^p} P_QQQQQQRRRrQQ/1006Q6Q6QU rr4 r4 r4\G\\\{Buuu#QQQGPPPG\\\{Buuu#QQQGPPP/\\\{/uuu#QQQ/PPPQQQR | |"{uQP  {#4$r" u#4$r" u#4$| "|"  {#4$r" u#4$r" u#4$| "|" Q PPQQQRRRQQ,1006Q6Q6QRt\\Q\\Q11ZstZTspTQ88QQQ~QGPCPC1Z stT spC8C Q C~p pp\\ |G, |G,  \P VVV V~^\P  \\M |G, |G,   \_PrPPPP_ r    _ r    _ r    _ r    P  81  0p0$p0pUSUrVP\Tpp1&Q]0]t\tyP p8 s#8 TUQSQWUW\UGTGPVPWTW\Tu(W\u(QQ4U4ASAFUFlSlqUqSUUS1SP0+pa1&S&+U+7S U EU3T37U78T8=T=@U@Dq|DET3T37U78T8=T=@U@Dq|DET Q(4Q45T# Q(4Q45T# 0(50 1(51 0(50 Q(4Q45T#P*P 1 Q  1  Q   Q  P  T UT t(#0 PUVUVTTu0.P.pSp}P}S.P.pSp}P}Sg     s1s1s1s1P0U01U19U9=q|=>U Q(4Q45U# Q(4Q45U# 0(50 1(51 0(50 Q(4Q45U#P*P 1 Q  1  Q   Q  P UUu(#0UaVaUU P S@V@UUUVVV,ppsxsxsxuxsxsxsxsxS"P"\\P\P\\  p#!VVV]]]]]]000111000]]]QQQ 1 ]  1  ]  1  ] 1Q S \/VVVVVVVV]]]]]]000111000]]]PPP  1  ]  1  ] 1 ] 1P V5VZVVVVV0  Z            P%SSS>SSS&v&+SVV0p0p0p0p0pVV S UP\.T.STS.Q.\Q\.R.U^ux^__Q/CQThQPPP@P@> uQQQ!%6Q66qq"__UUUUUU001100UUUQQQ 1 U  1  U  1  U 1Q ~ R__~UPU_"_U_1U1]S]jUjkUkSUSu|US1T1kTkT^T^T^T^1Q1kQkQ]u]uQ]u(H_M___9VFVVV|M|||||P>s>LuLUPsu>PPT@0@T\M\\\\\,S,9U9:U:<@@ PPT@P;@ ;1PT@0PT T@@ @  \TT\22*Q*-Q'U'*QUO88O>$>$O009PTT tG, tG,T5P52Q U Q585>$50pp'S P s# UUS(u|uSu|U(UuUU#(UuUU#(0u0 (1u1 (0u0(UuUU##PpP 1 U 1 U1U1P U ASAFUFKUU,U\}~UpySPPUV|yUuSpsiuis]uySUUUUUUTTTTTTtQQtQt4Q3Q5<U<VUV!T!@tw@T4\\4||s]4@|M[p[s]A[P[SMMP[lPsP^Q@^VQ@^VQ@1PUV}yUVUT\T\TUVVT\\SSSPuvuP$")  --  0- :u%4P%  = &-;G!bxbnbiIUIU0    uyhl O(jn",1",1",1d +.2L "%)C "%).#  e      "%1  f$$,1$$6#'. %%  29%,LGcc^^  $Zp $ZfZa9EUY9EUYFJ  *!B  %  7;37"      EENS:: K  AE;?)ei   **57?(^g$OX     5afI 02@  02@  ',tx|&)5  !"* 0&)3CO%/?Kk" $"" f 9@BG 9@BG 9@BG#*#      mo[]]h]aT#   T   T'//   !%0!;EOAK   #x "/1 6    #x   0 +##O% #% ( # &i!dd `   RF " #D\`\` \`RV3  \c A[&)C,0,, )) #        1 #9G]s j       z     %       %        G  $ `G "        & &)036=AC\!(,.G11""OF"+/#)7#)7 !S !!, !&) !&) !&) eh&68l1=@NN*15       -''**  S<<9  #- V VVmVVVm1     "    % 9CJ  "     E !E 02DIs  ,2<_bpp{: E--8   P558   P558   K33:     K33:   e :     K33:          H113   !!! k   kkkkk3     %    % 33\3H333H   ? ! !C&     +  RRWoot``e%%* --2AAF #)7 & &AJM  '**aej  5"'>P *DI #U +**FI^bl  (+74K%   "    > 48)-fj^b     G     &)MX/2=HUs:!&   &-;G!*4##  -"`x\t  7<JY !$#    7<JY !$: ei (127:ekkr{S"::: ::j?@CF~j35?CFL  px pr  !),.!! 5?@CFz5    W''''Me 8A55     DY57<   (+.58#*- (+.58#&  ## -5cfjmq * ' !$  x:=U[:? ]elpz :=A +.2  >HY]>HY]KO.3  5``ko"17<=BGL889>CH#2>J:F  rn"@Y"@@5ws!&DSY^!&DD* \kXg'6O'66@zCN  $!&J]ch!&JJz=9 fu^m^m^m^m  $3BFK$335!!&JY_d!&JJ5!!&JY_d!&JJ4Wfjopux}SSkklqty f ff5ixet!&8KQV!&88  "   $r1 99 2CG 2 ,I!&Qdjo!&QQ~uqq"";V  J  7[_84CGLjjkpsx00ffglot!>-     - )  +: /+    ! %/ +   F   *  N/+         %(-    6mr)K    7  _N       ..  3+S7S7@/Ic/II&)- m] 5 ??EJC&BG(5, CRVg4\   #*$  6.7>J-   % +tbn^j  /U[eh,69G    @ S`"(4#i  >FJYxT ~ 77:>A^ !> !%(( 51#+31@R $$$$$>&&!/ 5Z+   $> :BFUZt %? 8#*4JQUX\a~#*4;!&C ))!%'yXfiy!#).%* 6    %      <W "&)B ,,"(('-3AD -!'5:   ;"'O 5 -T * " " " " <(5 ",1",1",1; !impz3!!& #-2]]d  ]d  ]d. %!  !| $B $B (-J         !    /29  G /   &*NSWZ]`{ 8NSWZ]`{ EJSWos /3(,    ;r    %J 6=AMVVVVVo!--2  9 "'D0!       '17EH !5% 99>!&&&&&G $$$$$>9!Sm!a!4be[bel    !#$%&'(*,./013579:<>?ACDFHIJLL%=]% 13G5p00( KZl&+` B@0 X[ -5>00q O=.p O0B `bK0wf:f96<  @, p  ,  ,' ,0 P; ,D ,N ,X @,b ,l x ,  , `, ,  , @, , , , @, p , 77&747B7 P7(^70l78z7@7H7P7X7`7h7p7x7777"0'M--E^7>D>W Kq/iV)~($@ 0!>BiF`$M$p&k"`'f4(ST>P%5>B(NP7`YDs81 P G$   , 0 @, p , ' ,0 0; `,D ,N ,  b @, ,  , ,6   , ` ,B ,L  ,X 0  @ ,d p  ,p , ,z P  ` ,  ,  , , ` , ,  , , P  ` ,  ,& 2 ,< H @,R p^ ,h t ,~ @, p , ,  @,7777777 7.7<7J7X7f7t7777 7(70787@7H7P 7X 7` 7h* 7p8 7xF 7T 7b 7p 7~ 7 7 7 7 &g K-  A  &" & kpnU  ns D( < :B  pW v & 0<j > uqvr  "2wbL yvg}~p  :~{  S K :@ :pL  =: +d  w@ P 1- :2 E :^ +jv  75 l{   W @ uM e '5 \Y 8   , ,  @, ,' ,S  ,\  0D `,N ,  b , @,  p, ,6  ,g  0B `, ,s   ,  0 `, ,  ,z 0 `,  , ,  ,  `, ,   ,  0  `, ,    ,    @,  p  ,    ,#  0/  `,9  E  ,t ,~ @, p ,O   [  ,e   q  ,{  P  `,    ,  ,  0  `,    ,    ,  P  ,t7777777777 7 77  7( 70* 788 7@F 7HT 7Pb 7Xp 7`~ 7h 7p 7x 7%737B7Q7`7o7~77777777777#727A7 "P2V!`/!oa>G!zs>#з6#d!0}!!p !`&5 `5H!P[*@!#"0z, ."z8?=L|97"0*k"qf5P"p*"[~54"@A"9S5"P"P@'L2@~~Y8o4O  ` ,  ,   @ , p ' ,0 ; !,D @!, p!X !,b !, ",  P", ", ", " #,B `#, #, #, $, `$, $, $, % @%, %, %  %, &, 0&  @&, &, &, ', @', p' ', ',  (, `(, ( (,& (2 ),< P)H ),R )^ ),h *t @*,~ *, * *,O  +[  @+, +,q  +, ,,  @,,  p,  ,, , -,  @-, -,  -, .,  @., ., . /,' 0/3 `/,= /I /,S /_ 0,i P0u `0, 0 0, 1, @1, 1, 1, 2, 02 `2, 2 2, 2, 3, `3, 3, 3,% 4,0 `4,; 4,F 4,Q 5,7(70787@7H7P7X\7`7hk7p7x7#727A7z777777777777.7=7L7[7j7 y7(70787@7H7P7X7`7h7p7x7-7<7K7Z7i7x777777777777,7;7J7 Y7(h70w787@7H7P7X7`7h7p7x J# k#d")"=>$}~$!$P!#> %p M9`#,#0H$`#Pu0## 7'T#'1#p@'R>($%@!$ ")6$`I*Y$P +~$}%I,$E$Y:,K0E`2 5 5, 6, `6,  6, 6 7,' @7,S  7,; 7,D 8,N @8,  p8b 8, 8,x 9,, @9, 9, 9,g  9B :, @:, :, :,  :  ;,r 0;p @;,~ p; ;, ;,  <, P<  `<,  <, < =, @=, p= =, =,  >, `>,  >, >,  ?,2 `?,  ?,H ?,R @ ^ @,E  `@,t @,~ @, A, `A, A,[  A,e  Bq  B, `B, B B,  C,  @C, C,  C, D,  @D,  pD  D, D,, E @E, E, E,3 F, @F,I F,S F_ F,i G u G, `G, G, G, H, `H, H, H, I, `I, I, I, J, `J, J, J, K,% `K,0 K,; K,F L,Q `L, L,  L, M! @M,, pM9 M,D M,O N \ N,g `N,r N,} N, O, `O, O O,z777777777777.7=7L7[7j7y7777 7(70787@7H7P7X7`-7h<7pK7xZ7i7x777777777777,7;7J7Y7h7w77 7(70787@7H7P7X7`7h7p7x7777.7=7L7[7j7y777777777777 -7(<70K78Z7@i7Hx7P7X7`7h7p7x777Ok 3%a (` < U k P   0  P'?Xkp0  !P$$`&P'.(H@7cFyJk`nnpuv,wFya|}~~`0` @, F ^ u  0   p  !P)!A!К^! |!!`!P!@!"" 1" J"`e"}"0"""@"@"#0#D#e#|## #@###` $$0$PB$PS$@x$$@$p$$$%`%0-%F%W%h%t%&%&% %&%&$& 8&&%9&&7W& Ds&&8&&I& &&J&&c' 1'&dV'&}' '&'&' '&(&( $6(&L(&d( z(&(&( (&(&( )&.)&J) d)&{)&) l)&)&) *&*& 9* Q*&j*&* *&*&0* *&1+&B,+ G+&Cf+&X+ +&Y+&i+ +&j,&z,, F,&{g,&, ,&,&, -&-&9- T-&k-&- -&-&- x-&-&. `,.&D.&^. Tv.&.&. \.&.&/ /&=/&+]/ P{/&,/&C/ h/&D/&V0 t60&WR0&ip0 0&j0&z0 0&{0&1 1&01&H1 ^1&y1&1 1&1&1 2&2&02 E2&e2&2 2&2&2 2& 3&%3 >3&[3& z3 3& 3&!3 3&" 4&2)4 C4&3[4&Au4 4&B4&W4 4&X5&h"5 p<5&iV5&yr5 45&z5&5 @5&5&!6 A6&Z6&u6 X6&6&6 d6&6&7 |47&S7&t7 L7&7&7 7&8&+8 (E8&[8&!s8 08&"8&58 <8&68&G9 H59&HN9&Wi9 9&X9&g9 9&h9&t9 ,:&u0:&O: l:&:&: :&:&: ;#2;I; _; s;; ;5;%;%;',5p;;>P<k<+3<B<PIZ<u<<< </<<<k==%=6=C=`j4`rY=<9Cg=/lUz=s!=5p#( I.jA=$9p00_=pBИ7==J==5,/u&_>.>p5%pcM>f>`}>.+%>@>D> >, 5>>0^?6@DE ?$AF!?0?.34q}8>M?_?%10i??)4O??)(~?58SB=86?.??UHBi?О=@*@G@]@l>p{n@@@@o@@@@7DA`A-A`oIAbAuAGhAA4>CA%An(>@II6AAjBB1 /3B3(B1`H(JC7Bq$0k"MB7H_BqB.@^ BT)BB/g/ksBBBB1qH<`I CCG l%C:Cp@KNC`CiC+60'WtCЀ6,P.C z0plCpC1 C`l2poa"7CCpD-8 "D)&W:2q1DDD`a&L[DhD1HxD4DD/pjsDs9wD&DD:E"EHC,h.J,1o7E>EC-/ASE3lE'EEEEE:p EEFF=#FC:FRFgFC*@+FFFF*+]FFY:FhGj.G>?GOGaG`sGGGGG 2pGG`GpJHJ!H'H1 8HOH]H0+qHH8HzHI~F \6+C?)/HH@.H+~7HI*I`AI1 &gSI'h4z1tI0IIIIPrII|5yIJ*HHJ"J7JLJdJkJ-,zJJC cfc_libfc.cfc_local_ports__UNIQUE_ID___addressable_cleanup_module661__UNIQUE_ID___addressable_init_module660__UNIQUE_ID_debug_logging658__UNIQUE_ID_debug_loggingtype657__param_debug_logging__param_str_debug_logging__UNIQUE_ID_license656__UNIQUE_ID_description655__UNIQUE_ID_author654.LC0fc_disc.c__key.0fc_disc_done.coldfc_disc_error.coldfc_disc_restart.coldfc_disc_recv_req.coldfc_disc_gpn_id_resp.cold__already_done.40fc_disc_gpn_ft_parse.coldfc_disc_gpn_ft_resp.cold__func__.1_entry.2__func__.3_entry.4__func__.5_entry.6_entry.7__func__.8_entry.9_entry.10_entry.11_entry.12_entry.13__func__.14_entry.15__func__.16_entry.17_entry.18_entry.19__func__.20_entry.21_entry.22_entry.23_entry.24_entry.25_entry.26__func__.27_entry.28_entry_ptr.29_entry_ptr.30_entry_ptr.31_entry_ptr.32_entry_ptr.33_entry_ptr.34_entry_ptr.35_entry_ptr.36_entry_ptr.38_entry_ptr.39_entry_ptr.41_entry_ptr.42_entry_ptr.43_entry_ptr.44_entry_ptr.45_entry_ptr.46_entry_ptr.47_entry_ptr.48_entry_ptr.49_entry_ptr.50.LC5.LC27fc_exch.cfc_cpu_orderfc_quarantine_exchfc_exch_find.coldfc_seq_send_ack.coldfc_seq_ls_rjt.coldfc_seq_ls_acc.cold__key.33fc_exch_done_locked.coldfc_exch_rrq_resp.coldfc_exch_mgr_reset.coldfc_exch_workqueuefc_seq_els_rsp_send.coldfc_seq_start_next.coldfc_em_cachepfc_exch_mgr_alloc.coldfc_exch_abort_locked.coldfc_exch_recv.coldfc_exch_rctl_namesfc_exch_seq_send.coldfc_exch_timeout.cold__func__.0_entry.1__func__.2_entry.3__func__.4_entry.5__func__.6__func__.12_entry.14__func__.15_entry.16__func__.17_entry.20__func__.21__func__.23__func__.25_entry.27__func__.29_entry.30__func__.31_entry.32__func__.34_entry.35_entry.36_entry.37_entry.38__func__.39_entry.40_entry.41__func__.42_entry.43__func__.44_entry.45__func__.46_entry.47__func__.48_entry.49__func__.50_entry.51__func__.52_entry.53_entry.54__func__.55_entry.56_entry.57__func__.58_entry.59_entry_ptr.60_entry_ptr.61_entry_ptr.62_entry_ptr.63_entry_ptr.64_entry_ptr.65_entry_ptr.66_entry_ptr.67_entry_ptr.68_entry_ptr.70_entry_ptr.71_entry_ptr.72_entry_ptr.73_entry_ptr.74_entry_ptr.75_entry_ptr.76_entry_ptr.77_entry_ptr.78_entry_ptr.79_entry_ptr.80_entry_ptr.81_entry_ptr.82_entry_ptr.83_entry_ptr.84_entry_ptr.87_entry_ptr.88_entry_ptr.89_entry_ptr.90_entry_ptr.91_entry_ptr.92_entry_ptr.93_entry_ptr.94_entry_ptr.95_entry_ptr.96_entry_ptr.97_entry_ptr.98.LC1fc_elsct.cfc_ct_ms_fill.constprop.0.coldfc_elsct_send.coldfc_frame.cfc_lport.cfc_lport_set_port_id.coldfc_lport_enter_ready.coldfc_lport_state_namesfc_lport_recv.cold__key.3fc_lport_ptp_setup.coldfc_lport_enter_reset.coldfc_lport_error.coldfc_lport_enter_flogi.coldfc_lport_enter_logo.coldfc_lport_enter_scr.coldfc_lport_enter_ms.coldfc_lport_rport_opsfc_lport_enter_dns.coldfc_lport_enter_fdmi.coldfc_lport_logo_resp.coldfc_lport_flogi_resp.coldfc_lport_scr_resp.coldfc_lport_ms_resp.coldfc_lport_enter_ns.coldfc_lport_rport_callback.coldfc_lport_timeout.coldfc_lport_ns_resp.coldfc_lport_disc_callback.coldfc_lport_recv_els_req.cold_entry.8__func__.9__func__.19__func__.22__func__.24_entry.31_entry.33_entry.34__func__.36__func__.38_entry.39__func__.41_entry.42__func__.43_entry.44__func__.45_entry.46__func__.47_entry.48__func__.49_entry.50__func__.51_entry.52__func__.57_entry.58__func__.59_entry.60__func__.61_entry.62__func__.63_entry.64_entry.65__func__.66_entry.67__func__.68_entry.69__func__.70_entry.71__func__.72_entry.73_entry_ptr.85_entry_ptr.86_entry_ptr.99_entry_ptr.100_entry_ptr.101_entry_ptr.102_entry_ptr.103_entry_ptr.104_entry_ptr.105_entry_ptr.106_entry_ptr.107_entry_ptr.108_entry_ptr.109_entry_ptr.110_entry_ptr.111_entry_ptr.112_entry_ptr.114_entry_ptr.116_entry_ptr.117_entry_ptr.118_entry_ptr.119_entry_ptr.120.LC62fc_rport.crport_event_queue__key.105fc_rport_login_complete.coldfc_rport_enter_ready.coldfc_rport_enter_logo.coldfc_rport_state_namesfc_rport_enter_delete.coldfc_rport_logoff.coldfc_rport_enter_plogi.cold__func__.73fc_rport_error.coldfc_rport_error_retry.coldfc_rport_enter_rtv.coldfc_rport_enter_adisc.coldfc_rport_rtv_resp.coldfc_rport_enter_flogi.coldfc_rport_adisc_resp.coldfc_rport_login.coldfc_rport_flogi_resp.coldfc_rport_prli_resp.coldfc_rport_enter_prli.coldfc_rport_plogi_resp.coldfc_rport_timeout.coldfc_rport_recv_req.coldfc_rport_work.cold__func__.11__func__.18_entry.29__func__.30__func__.33_entry.61__func__.65_entry.66_entry.68_entry.70_entry.72__func__.74_entry.75__func__.76_entry.77__func__.78_entry.79__func__.80_entry.81__func__.82_entry.83__func__.84_entry.85_entry.86_entry.87_entry.88_entry.89_entry.90__func__.91_entry.92__func__.93_entry.94_entry.95_entry.96_entry.97_entry.98_entry.99_entry.100_entry.101_entry.102_entry.103_entry.104_entry_ptr.113_entry_ptr.115_entry_ptr.121_entry_ptr.122_entry_ptr.123_entry_ptr.124_entry_ptr.125_entry_ptr.126_entry_ptr.127_entry_ptr.128_entry_ptr.129_entry_ptr.130_entry_ptr.131_entry_ptr.132_entry_ptr.133_entry_ptr.134_entry_ptr.135_entry_ptr.136_entry_ptr.137_entry_ptr.138_entry_ptr.139_entry_ptr.140_entry_ptr.141_entry_ptr.142_entry_ptr.143_entry_ptr.144_entry_ptr.145_entry_ptr.146_entry_ptr.147_entry_ptr.148_entry_ptr.149_entry_ptr.150_entry_ptr.151_entry_ptr.152_entry_ptr.153_entry_ptr.154_entry_ptr.155_entry_ptr.156_entry_ptr.157_entry_ptr.158_entry_ptr.159_entry_ptr.160_entry_ptr.161_entry_ptr.162_entry_ptr.163_entry_ptr.164_entry_ptr.165_entry_ptr.166_entry_ptr.167_entry_ptr.168_entry_ptr.169_entry_ptr.170_entry_ptr.171_entry_ptr.172_entry_ptr.173_entry_ptr.174_entry_ptr.175_entry_ptr.176_entry_ptr.177_entry_ptr.178_entry_ptr.179_entry_ptr.180.LC57.LC82fc_fcp.cfc_eh_host_reset.coldfc_fcp_destroy.coldscsi_pkt_cachep__already_done.188fc_queuecommand.coldfc_io_compl.coldfc_fcp_complete_locked.coldfc_fcp_send_abort.coldfc_fcp_recovery.cold__key.38fc_eh_abort.coldfc_fcp_timeout.coldfc_fcp_resp.coldfc_eh_device_reset.coldfc_fcp_srr_resp.coldfc_fcp_recv.coldfc_fcp_rec_resp.coldfc_setup_fcp.cold__func__.26__func__.28__func__.32__func__.35_entry.55__func__.62_entry.63_entry.74_entry.76_entry.78_entry.84_entry.91_entry.93_entry.105_entry.106__func__.107_entry.108__func__.109_entry.110_entry.111__func__.112_entry.113_entry.114_entry.115_entry.116_entry.117_entry.118__func__.119_entry.120_entry_ptr.181_entry_ptr.182_entry_ptr.183_entry_ptr.184_entry_ptr.185_entry_ptr.186_entry_ptr.189_entry_ptr.190_entry_ptr.191_entry_ptr.192_entry_ptr.193_entry_ptr.194_entry_ptr.195_entry_ptr.196_entry_ptr.197_entry_ptr.198_entry_ptr.200_entry_ptr.201_entry_ptr.202_entry_ptr.203_entry_ptr.204_entry_ptr.205_entry_ptr.207_entry_ptr.208_entry_ptr.209_entry_ptr.210_entry_ptr.211_entry_ptr.212_entry_ptr.213_entry_ptr.214_entry_ptr.215_entry_ptr.216_entry_ptr.217_entry_ptr.218_entry_ptr.219_entry_ptr.220_entry_ptr.221_entry_ptr.222_entry_ptr.223.LC11.LC42fc_npiv.c__pfx_fc_disc_done__pfx_fc_disc_error__pfx_fc_disc_gpn_ft_req__pfx_fc_disc_timeout__pfx_fc_disc_restart__pfx_fc_disc_start__pfx_fc_disc_recv_req__pfx_fc_disc_gpn_id_resp__pfx_fc_disc_gpn_ft_parse__pfx_fc_disc_stop__pfx_fc_disc_stop_final__pfx_fc_disc_gpn_ft_resp__pfx_fc_exch_setup_hdr__pfx_fc_seq_send_locked__pfx_fc_exch_find__pfx_fc_seq_send_ack__pfx_fc_seq_ls_rjt__pfx_fc_seq_ls_acc__pfx_fc_invoke_resp__pfx_fc_exch_alloc__pfx_fc_exch_release__pfx_fc_exch_delete__pfx_fc_exch_done_locked__pfx_fc_exch_rrq_resp__pfx_fc_seq_lookup_recip__pfx_fc_exch_abort_locked__pfx_fc_exch_timeout__pfx_fc_ct_ms_fill.constprop.0__pfx_fc_lport_els_prli__pfx_fc_lport_set_port_id__pfx_fc_lport_enter_ready__pfx_fc_frame_drop__pfx_fc_lport_bsg_resp__pfx_fc_lport_ptp_setup__pfx_fc_lport_ct_request__pfx_fc_lport_els_request__pfx_fc_lport_reset_locked__pfx_fc_lport_enter_reset__pfx_fc_lport_error__pfx_fc_lport_enter_flogi__pfx_fc_lport_enter_logo__pfx_fc_lport_enter_scr__pfx_fc_lport_enter_ms__pfx_fc_lport_enter_dns__pfx_fc_lport_enter_fdmi__pfx_fc_lport_scr_resp__pfx_fc_lport_ms_resp__pfx_fc_lport_enter_ns__pfx_fc_lport_rport_callback__pfx_fc_lport_timeout__pfx_fc_lport_ns_resp__pfx_fc_lport_disc_callback__pfx_fc_lport_recv_els_req__pfx_fc_rport_t0_prli__pfx_fc_rport_fcp_prli__pfx_fc_rport_create.part.0__pfx_fc_rport_login_complete__pfx_fc_rport_logo_resp__pfx_fc_rport_enter_ready__pfx_fc_rport_enter_logo__pfx_fc_rport_enter_delete__pfx_fc_rport_enter_plogi__pfx_fc_rport_error__pfx_fc_rport_error_retry__pfx_fc_rport_enter_rtv__pfx_fc_rport_enter_adisc__pfx_fc_rport_rtv_resp__pfx_fc_rport_enter_flogi__pfx_fc_rport_adisc_resp__pfx_fc_rport_flogi_resp__pfx_fc_rport_prli_resp__pfx_fc_rport_enter_prli__pfx_fc_rport_plogi_resp__pfx_fc_rport_timeout__pfx_fc_rport_work__pfx_fc_fcp_can_queue_ramp_down__pfx_fc_fcp_pkt_alloc__pfx_fc_fcp_pkt_release__pfx_fc_lun_reset_send__pfx_fc_io_compl__pfx_fc_fcp_complete_locked__pfx_fc_fcp_send_abort__pfx_fc_fcp_recovery__pfx_fc_fcp_rec__pfx_fc_fcp_timeout__pfx_fc_fcp_resp__pfx_fc_tm_done__pfx_fc_fcp_cleanup_each_cmd.isra.0__pfx_fc_fcp_cleanup__pfx_fc_fcp_abort_io__pfx_fc_fcp_srr_resp__pfx_fc_fcp_cmd_send__pfx_fc_fcp_srr.constprop.0__pfx_fc_fcp_pkt_destroy__pfx_fc_fcp_recv__pfx_fc_fcp_rec_resp__pfx___fc_vport_setlink__pfx_libfc_init__pfx_libfc_exitlibfc.mod.c__kstrtab_fc_lport_notifier_head__kstrtabns_fc_lport_notifier_head__ksymtab_fc_lport_notifier_head__kstrtab_fc_fill_hdr__kstrtabns_fc_fill_hdr__ksymtab_fc_fill_hdr__kstrtab_fc_fill_reply_hdr__kstrtabns_fc_fill_reply_hdr__ksymtab_fc_fill_reply_hdr__kstrtab_fc_lport_iterate__kstrtabns_fc_lport_iterate__ksymtab_fc_lport_iterate__kstrtab_fc_fc4_register_provider__kstrtabns_fc_fc4_register_provider__ksymtab_fc_fc4_register_provider__kstrtab_fc_fc4_deregister_provider__kstrtabns_fc_fc4_deregister_provider__ksymtab_fc_fc4_deregister_provider__kstrtab_fc_disc_config__kstrtabns_fc_disc_config__ksymtab_fc_disc_config__kstrtab_fc_disc_init__kstrtabns_fc_disc_init__ksymtab_fc_disc_init__kstrtab_fc_cpu_mask__kstrtabns_fc_cpu_mask__ksymtab_fc_cpu_mask__kstrtab_fc_seq_send__kstrtabns_fc_seq_send__ksymtab_fc_seq_send__kstrtab_fc_seq_start_next__kstrtabns_fc_seq_start_next__ksymtab_fc_seq_start_next__kstrtab_fc_seq_set_resp__kstrtabns_fc_seq_set_resp__ksymtab_fc_seq_set_resp__kstrtab_fc_exch_done__kstrtabns_fc_exch_done__ksymtab_fc_exch_done__kstrtab_fc_seq_els_rsp_send__kstrtabns_fc_seq_els_rsp_send__ksymtab_fc_seq_els_rsp_send__kstrtab_fc_seq_assign__kstrtabns_fc_seq_assign__ksymtab_fc_seq_assign__kstrtab_fc_seq_release__kstrtabns_fc_seq_release__ksymtab_fc_seq_release__kstrtab_fc_exch_mgr_reset__kstrtabns_fc_exch_mgr_reset__ksymtab_fc_exch_mgr_reset__kstrtab_fc_exch_seq_send__kstrtabns_fc_exch_seq_send__ksymtab_fc_exch_seq_send__kstrtab_fc_exch_update_stats__kstrtabns_fc_exch_update_stats__ksymtab_fc_exch_update_stats__kstrtab_fc_exch_mgr_add__kstrtabns_fc_exch_mgr_add__ksymtab_fc_exch_mgr_add__kstrtab_fc_exch_mgr_del__kstrtabns_fc_exch_mgr_del__ksymtab_fc_exch_mgr_del__kstrtab_fc_exch_mgr_list_clone__kstrtabns_fc_exch_mgr_list_clone__ksymtab_fc_exch_mgr_list_clone__kstrtab_fc_exch_mgr_alloc__kstrtabns_fc_exch_mgr_alloc__ksymtab_fc_exch_mgr_alloc__kstrtab_fc_exch_mgr_free__kstrtabns_fc_exch_mgr_free__ksymtab_fc_exch_mgr_free__kstrtab_fc_exch_recv__kstrtabns_fc_exch_recv__ksymtab_fc_exch_recv__kstrtab_fc_exch_init__kstrtabns_fc_exch_init__ksymtab_fc_exch_init__kstrtab_fc_elsct_send__kstrtabns_fc_elsct_send__ksymtab_fc_elsct_send__kstrtab_fc_elsct_init__kstrtabns_fc_elsct_init__ksymtab_fc_elsct_init__kstrtab_fc_frame_crc_check__kstrtabns_fc_frame_crc_check__ksymtab_fc_frame_crc_check__kstrtab__fc_frame_alloc__kstrtabns__fc_frame_alloc__ksymtab__fc_frame_alloc__kstrtab_fc_frame_alloc_fill__kstrtabns_fc_frame_alloc_fill__ksymtab_fc_frame_alloc_fill__kstrtab_fc_get_host_port_state__kstrtabns_fc_get_host_port_state__ksymtab_fc_get_host_port_state__kstrtab_fc_get_host_speed__kstrtabns_fc_get_host_speed__ksymtab_fc_get_host_speed__kstrtab_fc_get_host_stats__kstrtabns_fc_get_host_stats__ksymtab_fc_get_host_stats__kstrtab_fc_fabric_login__kstrtabns_fc_fabric_login__ksymtab_fc_fabric_login__kstrtab_fc_linkup__kstrtabns_fc_linkup__ksymtab_fc_linkup__kstrtab_fc_linkdown__kstrtabns_fc_linkdown__ksymtab_fc_linkdown__kstrtab_fc_fabric_logoff__kstrtabns_fc_fabric_logoff__ksymtab_fc_fabric_logoff__kstrtab_fc_lport_destroy__kstrtabns_fc_lport_destroy__ksymtab_fc_lport_destroy__kstrtab_fc_set_mfs__kstrtabns_fc_set_mfs__ksymtab_fc_set_mfs__kstrtab_fc_lport_set_local_id__kstrtabns_fc_lport_set_local_id__ksymtab_fc_lport_set_local_id__kstrtab_fc_lport_recv__kstrtabns_fc_lport_recv__ksymtab_fc_lport_recv__kstrtab_fc_lport_reset__kstrtabns_fc_lport_reset__ksymtab_fc_lport_reset__kstrtab_fc_lport_logo_resp__kstrtabns_fc_lport_logo_resp__ksymtab_fc_lport_logo_resp__kstrtab_fc_lport_flogi_resp__kstrtabns_fc_lport_flogi_resp__ksymtab_fc_lport_flogi_resp__kstrtab_fc_lport_config__kstrtabns_fc_lport_config__ksymtab_fc_lport_config__kstrtab_fc_lport_init__kstrtabns_fc_lport_init__ksymtab_fc_lport_init__kstrtab_fc_lport_bsg_request__kstrtabns_fc_lport_bsg_request__ksymtab_fc_lport_bsg_request__kstrtab_fc_rport_lookup__kstrtabns_fc_rport_lookup__ksymtab_fc_rport_lookup__kstrtab_fc_rport_create__kstrtabns_fc_rport_create__ksymtab_fc_rport_create__kstrtab_fc_rport_destroy__kstrtabns_fc_rport_destroy__ksymtab_fc_rport_destroy__kstrtab_fc_set_rport_loss_tmo__kstrtabns_fc_set_rport_loss_tmo__ksymtab_fc_set_rport_loss_tmo__kstrtab_fc_rport_login__kstrtabns_fc_rport_login__ksymtab_fc_rport_login__kstrtab_fc_rport_logoff__kstrtabns_fc_rport_logoff__ksymtab_fc_rport_logoff__kstrtab_fc_rport_recv_req__kstrtabns_fc_rport_recv_req__ksymtab_fc_rport_recv_req__kstrtab_fc_rport_flush_queue__kstrtabns_fc_rport_flush_queue__ksymtab_fc_rport_flush_queue__kstrtab_fc_rport_terminate_io__kstrtabns_fc_rport_terminate_io__ksymtab_fc_rport_terminate_io__kstrtab_fc_queuecommand__kstrtabns_fc_queuecommand__ksymtab_fc_queuecommand__kstrtab_fc_eh_abort__kstrtabns_fc_eh_abort__ksymtab_fc_eh_abort__kstrtab_fc_eh_device_reset__kstrtabns_fc_eh_device_reset__ksymtab_fc_eh_device_reset__kstrtab_fc_eh_host_reset__kstrtabns_fc_eh_host_reset__ksymtab_fc_eh_host_reset__kstrtab_fc_slave_alloc__kstrtabns_fc_slave_alloc__ksymtab_fc_slave_alloc__kstrtab_fc_fcp_destroy__kstrtabns_fc_fcp_destroy__ksymtab_fc_fcp_destroy__kstrtab_fc_fcp_init__kstrtabns_fc_fcp_init__ksymtab_fc_fcp_init__kstrtab_libfc_vport_create__kstrtabns_libfc_vport_create__ksymtab_libfc_vport_create__kstrtab_fc_vport_id_lookup__kstrtabns_fc_vport_id_lookup__ksymtab_fc_vport_id_lookup__kstrtab_fc_vport_setlink__kstrtabns_fc_vport_setlink__ksymtab_fc_vport_setlink__UNIQUE_ID_srcversion473__UNIQUE_ID_depends472__UNIQUE_ID_intree471__UNIQUE_ID_name470module-common.c__UNIQUE_ID_retpoline471__UNIQUE_ID_vermagic470_note_19_note_18orc_header__pfx_fc_rport_flush_queue__pfx_fc_lport_iterate__pfx_fc_get_host_speed__pfx_fc_exch_mgr_resettry_module_get__pfx_fc_setup_exch_mgr__list_add_valid_or_reportalloc_workqueue__pfx_fc_seq_send__pfx_fc_linkup__pfx_fc_seq_els_rsp_sendwait_for_completion_timeoutskb_put__pfx_fc_get_host_port_state__rcu_read_lock__msecs_to_jiffies__kmalloc_noprofbsg_job_done__pfx__fc_frame_alloc__this_modulefc_remote_port_addsnprintfqueue_work_on__SCT__preempt_schedule__pfx_fc_seq_set_resp__init_swait_queue_head__pfx_fc_elsct_initfinish_wait__pfx_fc_exch_mgr_alloc__pfx_fc_fc4_register_provider__pfx_fc_fc4_conf_lport_params__pfx_fc_vport_id_lookup__pfx_fc_fc4_del_lport__stop_alloc_tags__pfx_fc_copy_buffer_to_sglist__pfx_fc_set_mfs__pfx_fc_set_rport_loss_tmoprepare_to_waitmemcpy__pfx_fc_elsct_sendkfree__pfx_fc_fcp_destroyint_to_scsilun__pfx_fc_exch_mgr_list_clonetimer_delete_sync__wake_up_raw_spin_lock_irqsave__per_cpu_offsetmempool_free__pfx_fc_rport_recv_req__fentry____start_alloc_tags__x86_indirect_thunk_raxfc_block_scsi_eh__pfx_fc_rport_create__pfx_fc_fcp_ddp_doneblocking_notifier_call_chainfc_remote_port_delete__stack_chk_failrefcount_warn_saturatequeue_delayed_work_on_raw_spin_unlock_bh__pfx_fc_lport_destroy__pfx_fc_lport_resetstrnlen__alloc_skb__pfx_fc_lport_logo_resp__pfx_fc_rport_lookupconst_pcpu_hot__pfx_fc_lport_set_local_id__x86_indirect_thunk_rdxfc_host_post_eventmodule_putpage_offset_basesized_strscpy__pfx_fc_exch_mgr_addhugetlb_optimize_vmemmap_keymempool_alloc_noprof__pfx_fc_frame_crc_check__pfx_fc_lport_flogi_respfc_prov_mutexfc_active_prov__pfx_fc_lport_config__pfx_init_module__pfx_fc_eh_abortsynchronize_rcumempool_free_slab__pfx_fc_exch_init__pfx_fc_exch_mgr_free__rcu_read_unlock__x86_indirect_thunk_r14init_uts_ns__pfx___fc_linkdownsk_skb_reason_dropmod_timer__pfx_fc_slave_alloc__pfx_fc_lport_recvdestroy_workqueuecrc32_lemutex_lock__pfx_fc_fabric_logoff__pfx_fc_fabric_login__pfx_fc_linkdownfc_lport_els_prov__pfx_fc_get_host_stats__pfx___fc_linkup__pfx_fc_fill_hdr__list_del_entry_valid_or_report_find_next_bit__pfx_fc_setup_fcp__pfx_fc_eh_host_reset__mutex_initfc_passive_prov__pfx_fc_seq_start_next__fortify_panic_raw_spin_unlock_irqrestore__pfx_fc_queuecommand__pfx_fc_exch_done__pfx_cleanup_modulecancel_delayed_work__cpu_possible_mask__pfx_fc_seq_releasememset__pfx_fc_destroy_fcp__x86_indirect_thunk_r10scsi_is_host_device__flush_workqueuemempool_alloc_slab__x86_return_thunknr_cpu_ids__init_waitqueue_head__pfx_fc_rport_terminate_io__kmem_cache_create_argsskb_trimfree_percpu__pfx_fc_exch_seq_send__pfx_fc_fill_reply_hdr__pfx_fc_rport_login__pfx_libfc_vport_create__pfx_fc_destroy_rport__pfx_fc_exch_update_stats__pfx_fc_fcp_ddp_setupvmemmap_base__pfx_fc_disc_initfc_get_event_number__pfx_fc_els_resp_type__pfx_fc_frame_alloc_fillfc_debug_loggingkvfree_call_rcupcpu_alloc_noprof__pfx_fc_fcp_initmutex_unlockcancel_delayed_work_syncmempool_create_node_noprofinit_timer_key__pfx_fc_vports_linkchangesg_next__pfx_fc_vport_setlink__pfx_fc_destroy_exch_mgrmempool_destroyfc_rport_t0_prov__kmalloc_cache_noprof__warn_printk__pfx_fc_seq_assigndelayed_work_timer_fn__pfx_fc_exch_recv__pfx_fc_lport_bsg_request_raw_spin_lock_bhscsi_is_fc_rport__pfx_fc_exch_mgr_delscsi_done__x86_indirect_thunk_r12autoremove_wake_function__pfx_fc_rport_destroyfc_rport_fcp_init__pfx_fc_fc4_deregister_provider__pfx_fc_rport_logoff__pfx_fc_seq_exch_abort__pfx_fc_fc4_add_lport__pfx_fc_lport_init__pfx_fc_eh_device_resetparam_ops_int_dev_printkscsi_host_allocsg_copy_to_buffer__pfx_fc_setup_rport__pfx_fc_disc_configscsi_change_queue_depthmsleepkmalloc_cacheskmem_cache_destroysystem_wq-! X+w28 Ma k Xs- Xw [  X-( X-w< G XLSb[ [--)U-H NKv]H%@- - Xw  #. C &J:Q XZu- Xw &: X-6I ` ^ @s 0  -    & 1-PW> 3& w+ 1A >q -      ? ! -P o ` 3  - w  -  G, K e - w  -  @ oT wZ }   ,& n   G  b  o$G 013d>oi><5-wo !wAHU]ewp{1>w1-1:rR#` o #E-pw>> 5-?e-}w8}o (0SXo-- --3o%-@X@e-H @86J@mr<-S (& &0@>NT[,-}3R-,H3W^{m- 3  ! A -Y i H @ j  @  %!1!-u!3!U!! (!("I""@"&" &B" "# %# FF#\#d#@u#*a$-$3$*$$-$$& % &2%c%@%-%$%%1&;&>K&U&>q&-&&&&&&&-''@)'e7'e'-'o''' 'o''.'''(-()@2)))=*@+@E+-+3++-,&, +,1,T, (_,,@,,,,OD-@-e--@-..~9.U.-_.......>./-3/M/{f/q//-/&|//{//-001152;2B22@2@23a<334304<4V4d4k44444-4445@ 5%5-V5Sr5,|55S5&5 d5 696[6 (66 6666>666777%7.767Q7-`7g7777@77&|7?78d88-89 !9o99 p:|:; ;$ /;oo;;;<= =@a=p=@=====b 3>:>YD>X>>> >>&|>?>>U?\?4?@ @0@b@@@@@ @@&|@?@@@@A-AoHAZA@uAAwAoB@B%B24BoFB>C3ICUCT[CgC{C-D3E@E(E:E3KEt]E@EE EE&|E?EE EoF-)F0F 8F]F@FeFF@F@FG `'GGGGG H H&|H?(H/Hh KH@tH@HF H-H3H*HI-%I9I@BIeI-zI II&II J&J "JS'J.J&|NJUJ&ZJfJ<J-J&|JuJ&JJ-JJ cJLCL LOLMCM M >MCMM vMCM4 MOdNCsN NOXPPQCQm QO\RCiR RORC S &SOSCS SOFTCST! kTOTCT UOtU |UOUCVG VOV kV kV VVCW WOWCW XOXCX XO8Y kADYC]Y kAkYOYZ E^-aaaCb bcogCg whh<h-i C0i Ci lJi SiZi U_ifi |i <i i ii +i vi ii i Ci Uij->jvIjuj-jDjjk--k`kokk-kk-kl-lwQlul-ll m (m mmGnWnqn-n n3nn-nn8 +oq8oJo Oo3uo-owooo- pw(p p-p{w>w>w-wwfx,kxx  uxxxhxox!y-Kyyy,y(z  u8zLzWzh|zozz-zz${wT{{||&|||>|}-})}b}3u}3}3}}}>~-~"~ m~~~K~q~~-~~ )3F?Wq-{G  A-KR tq~ Z3-3w (w8DMq-{9ˁ ځ3-*1s Ȃ3ׂQ-^ew 1-+w8CS _1-w҄ل'o9AMN 0`5kr\qŅ-ۅw +o=Mˆ ݆5D S5-шw3o EMMZ Xl5-ӉwKRjozhŠMϊ 5X_- 3/SC_y-C͌h+-E-Y`qowōӍ5-_wƎ%+AIh-w #+o7@M H55-Iw{-uÑ̑ґّX-wQ\-wŒΒ-&w} 3/oYC˕3֕ݕLdv3֖Ɨؗ3hq<vC-՘-35-Ge-{-3ԙ3-[u--&- % &, Y  з› ,Vu-Ԝii>i1-ĝѝ؝-'Bod~>M 5-.=IS>q-˟ҟ&>>%>;a-sz" ̠3ݠ>>>;Q-jqW&ɡ>>)>E-awgn33ˢѢآ-$CT[ƣ 3J>W>i>-;1-Bjqx?>> >1-CJh 3Ҧ>%>7>Vq- 3X>e>w>-Ũިw o3>M 5A-biO ܪ3>M>Z>}-Ϋwܫo':>۬-&w,Xhqy7wĭ̭Wԭݭ-6wDK"cok\l>t{bVM Hį5ޯ U-wҰoڰX>˱Mձ 5 ò3)<.3 Q-H<*3ȴ PӴC>P>b>-յwzo 2lζ>ֶM 5շ-w=i>-DK~wι>.=odswԺ>+27KwVwλջ, nwdv3o>޽!>5QX`?=*3:Io]q}3DOVl  X"w9 [V3f 3>CPXt{0!38?R33o 0X>q<$ Q}E XJaw3V - w%,!by!3P!333w,4;<weo+6=!M[b jw(!&-"=3LS c3> >%8"5BHO [wd> Xw J H X+>EY>s<-  &-&u!-<'Wm-U/Ku-`"Y~""-/"8@Ou-,& d &1 R c Pp-*>-Wl ') p.3?'Y#I#\ (f (l#r- 5-> `Z3u} 0@>p >1@Q-3$T[j#''9Yf@r$z,#$+2^&]d$&{L%%%%#R$ &!-i3')[~ 2 L-T%-?F'Q[q-~'-4'U](H(@ &  @(3LS (j>|>(>>)@-[ @3FW>p 2 L%-Cz)@>)   p>>@a-3*\?+*E* pe-@o >)>:@Q-{'(0B@R'@>>-U--4 +*,f m &~ @$@ +O]d&,-@%:oH@`>m,@>;Rdpv}E,>>@@-.c 8m  ~@p>>, 23 LE\>u>@-1 8 = 2 L>-4D*Q>u-@. o.@".*@E>$,T)|&.H?NNxHh>>1J->KR4/3/v1mv.@@"<'v/,60E-d @CoM>]d1 2"@@>0\2&8pR1q0{>>@@%-d3sx-3-  LS&\2w|<-&-lw-"5:Mu-ww- wD R   - w  -F&n1\<AI 5W7 (B5G R X]5b m |5 5   5 5  B5G V d5i  85 5H X5 5  5& X+58GC N5Sm (x5} 5 5 5 H5 0'5,>> `M5R[b {5 5 5 5& 0 5 h)5.'? O5f t5~, 5u- 5k4 54  50. Z5aB2| 53 X5 P50 540 ;5@6Q ` _5d7s 58 57 57 8 /548B T5Y\?h v5{:> 5Q= 59 8 59 5 > ` -52>A O5T%Bd r5w ; H 5 ;    5= 5 @ `  5$ @4  @ O x ] 5b  ;q  5 =  5 9 5 9 5 E `  5 E3 p A 5F 0FU c 5h Gw 5 /H ` 5 G     ! 4 G Z m          ( 3 58 nF R b H m 5r n 5 Gq 5    5 "~  7 (B 5G ~U a q h| 5  -  5 w l    ) 459RG S c n5s   P 5! ,51   5e   "5'/ ; L `W5\لm (t 5ry   5 `5 5 .53; G X c5hx P52[   5R 5 _ [-; G V P^ l5q 5` (5 5I    5͎! -+ 7 H xS5Xh u5 5w ~   x5   0 ;5CݕQ ] m 8x5}   05  ړ" 25CړP x[5` - 5w ~3 5؝ H5"- `59 G pR5Wzd r5|qx 5 5n `5  x5[ 85$! .( 65;J `5V f s5x `5  (5q `5  `5J `5   5# `5/ < J5OZ `5f t P5i 5 5 `5  5 85۬$ 257XD `R5Wyd r5wy 5 `5  5y 85 5"* `56 C xQ5VK] br 5 h5 `5  5 5j  P5 u0 C5H S `5_ j u5z `5  0 5 x 5 5 `5  +508 `5D S $^5hy~ !5K "5ջ  #5P %5 `5 ) `%45>LQHe $}5 0%5 `5  (#5  "5ջ, ":5?F p 0$~5X `5  H!5 h#5. `5  p$ 5). D !O5kr !5 #5> `5  `" 5$ V: !H 5M ջa `5h %z 5  @' 5 O h' 5  `& 5 b! &!5(!S=! &K!5P!h! &v!5!! &!5!,! 8&!5!=! &!5"" &,"58"-M" '["5`"%n" 'y"5~"" '" I""" '" I"" ("5#/# X(# L'#,#`# .e#5j## /#5#[# ,#5#+# /#5#[# p,$5$+@$ ,E$5R$$ )$5$$ -$5$$ 8/$5$$ H*$5$$ `+$5%% + %5%B% 80G%5L%% p-%5%% 0%5%% @)%5% & 0&5&& )&5$&T& .Y&5^&d& *&5&2& .&5&d&& )& L&'I' H1 '5'' -'5"')' +.'53'2c' 1h'5n'}' 1'5'' X2'5'F' 2'5'( 2(5 (>( h4C(5H(Sx( 3}(5(( x3(5(S( 04(5(( 3(5(S) 3)5)M) 4R)5W)a) H3f)5k)r) 4w)5|)S) 5)5)) H5)5)* 5*5*(* 5-*52*;* (6@*5E*z* 6*5** 7*5** H7*5*1+ `86+5?+j+ h6}+5+ 8+5++ 8+5++ 6+5+ 9+5+, 9,5, , @9!,5&,O5, h9@,5E,du, 0:z,5,}, 9,5,, x:,5,}, :,5,$- h<.-5J-o- =-5-!- <-5-o- p=-5.!6. 8;;.5@."t. :y.5.. ;.5.". ?.5."/ ;/5 /*/ ?//54/"h/ 0?m/5v/R/ >/5/\/ x?/5/R/ :/5// =/50 0 >050(0 <-0560u0 H>0500 >0500 0@0501 PA*1531@1 x@E15J1S1 A^15d11 A1511D1 B1511 @B252 2DA2 @F25L2\2d2 C2522 A2522 B2522 HC2522 C253^de S%&  $,(",#0#48<0@DHLPTX^\_`cd[h\lp1t2x|XYFGOP{IJRS LM=>UV@ACDstm|}y  $(,048 <@DHLPhTgXh\`adbhljpkt^xm|n}pq6yzvw"Z&  Y $(.,048<@DHLPTX1\`dhlptx|`78:;()e./)+,x  45@ (H P 0 p 0 X 0  (0 0 P 0 P 0 HP 0@ HPP 0 P 0 X 0  (0 0` Xhp 0  0  0@ HP 0  0  0 8 0@ HP 0 p 0  @ H0P  p   ` h0p  H 0  0 @ HP    x   (  0  `   h  p   8        @  H 0 P   0 p   h p   ( p 0  `  h P p   p    P    (  0  `  h  p       0    `(  0  `  h P p          @ XHP  p  `  @ HP  p  p @ HP   2  2@ HP 2  2 P 2  2` Ph0p 2 0 2 X 2@ HP 2 p 2  2` Hh0p 2 x0 2 P 2` h0p 2 (0 2  2` h0p 2 0 2 `0 2  (00 2` h0p 2 0 2  2` 0h0p 2 `0 2  2@ xHP 2 8p 2  2` h0p 2 0 2 x 2@ HP 2 p 2  2  (0 2` (hPp 2  2  2` H h0p 2 h 2  (0 2 P 2 P Y _ c j r z   -    ( 0 8 (@  %`  `% @  0%H  P    $ p  ! p$! ! @! $H! P! ! #!p!! ! #!p!!  " 0$("p!0" " (#"P"" " h#"P""  # !(#"0# `# !h#"p# # !#"# # "#"#  $ `"($"0$ `$ "h$"p$ $ %$"$ $ "$"$ @% !H%%P% % H!%%% % %%% & &%& @& `H&0&P& & &0&& & &0&& ' '0&' @' H'0&P' ' 'p'' ' 'p''  ( ((p'0( `( 8h(p'p( ( (((  ) ()(0) ) H)P)) ) ())) @* H**P* * *** * `*** @+ H++P+ + +++ + +++ , P,+, @, H,+P, , ,p,, - -,- @- 0 H-,P- - x -,- - -,- . 8... @. xH..P. . ... / /./ `/ h/0/p/ / p///  0 (0/00 `0 h0P0p0 0 H000 1 x101 @1 H10P1 1 101 1 8101 2 h202 `2 Ph202p2 2 &222 2 8&222  3 `&(3203 `3 &h32p3 3 &323 3 &323  4 &(4204 `4 &h42p4 4 '424 4 @'424  5 h'(5205 `5 h5 p5 "x5 5 -5 25 65 <5 B5 9555 O 6 :(6506 O`6 0:h65p6 O6 x:656 O7 0@767 O@7 x@H76P7 O7 @767 O7 A767 O8 PA868 O@8 AH86P8 O8 A8p88 O8 @B8p88 O9 B9p89 O@9 BH9p8P9 O9 C9p89 O9 HC9p89 O: H5:9: O@: 5H:9P: O: 5:9: O: (6:9: O; C;:; O@; (H;0;P; O; ';p;; O; ';p;; O; I<  < '(<p;0< O<< ID< `< h9h<P<p< O< 9<P<< O= 9=<= O@= @9H=<P= O= 3=p== O= H3=p== O > x3(>p=0> O`> 3h>p=p> O> 3>p=> O> 04>p=> O ? h4(?p=0? O`? 4h?p=p? O? 4?p=? O? 5?p=? O @ h6(@@0@ O`@ 6h@@p@ O@ 6@@@ O@ H7@@@ O A 7(A@0A O`A 8hA@pA OA `8A@A OA 8A@A O B 2(BB0B O`B 2hBBpB OB =BBB OC >CBC O@C H>HCBPC OC >CBC OC >CBC OD 0?DBD O@D x?HDBPD OD X2DpDD OD CDpDD O@E ;HEEPE OE <EEE OE h<EEE OF <FEF O@F =HFEPF OF p=FEF OF )FFF OF LG  G @)(GG0G O`G )hGGpG OG )GGG OG H*GGG O H *(HG0H O`H +hHGpH OH `+HGH OH +HGH O I ,(IG0I O`I p,hIGpI OI ,IGI OI -IGI O J p-(JG0J O`J -hJGpJ OJ .JGJ OJ .JGJ O K .(KG0K O`K 8/hKGpK OK /KGK OK /KGK O L 80(LG0L O`L 0hLGpL OL 0LGL OL H1LGL O@M 2HMMPM O\M LdM M 1MpMM OM 1MpMM O N :(NN0N O`N :hNNpN ON 8;NNN ON ;NNN O O ?(ON0O O`O ?hONpO OO X(OOO OO LO  (0T8@HtPX`0hp p x  d  4D4d$@ 0! `$($0%8p&@&Hd'P(XD+`+hT.p/x//4$5P78CFHIdIJJD^hjtjkkkl tl(pn0n8to@oHpPpXq`drh$upvxw yz}~~p @pPąD4 (408@HPX`Ԙh4pdxtt0p`PD00p@ (0T8P@HԷPX`hp xtt4P p$`dPT (08@tHDP$X`hpxt  F (" h#$>$(e$,&0&4(8G)< *@+D+H,L-P-TM-X.\2`o4d6h7le:p;t=xy>|>f@@AEGHvw|:}ɜO֡-ǥ}; 0x& * $m(+,e04 8s<l@DHL6PpTwXZ\`dhlEpNtex%|3C{|G nNo}ә K$ ( ,004 8t!<$@+D4H=CLDP9ETHX;p\Jp`]pd#qha}lt}ptx|فǂ ʕuחˠ۪²)u)U v<b-Y c  5  $ ( ,+ 0J 48q<@DHLPdTlX=\M`dhll p t!x[#|$0&J&&&&6''1)+8.e/p//1 567EHAIMJJJWPPaRi^iiiiHjjnkk kVnn7ozp p$wq(Kr,t0x4Kz8%|<}@~DVHLPLTXւ\8`dDhl.p?tx‘|ˑߑ[͒FzZUߜ Ýc-HʟܠʢBѦ2&p íܭ $(1,<0c48<@DJHNL%PTkX\` dthlpt,xP|ZVN3rwv9Q   H"* ,K $(,0T4J8$<@DHLIPtTX\`dhlp0tx|* @ p   O     d    S % m   Fc4   T\ d$o(z,048<@DHL0PZTX\D`odhlpt x4|9d|yk$?MW5Iq/& +@ X $ ( , 0 40!8!<!@'"DH"H"L"PE#Tc#Xt#\`$`$d$h1%lb%p%t%x%|:&T&p&&&'''('d''''((()y))))<*V*+D+++*,^,,,,7-C-`-t- ----- T.$^.(.,.0.4.8/<2/@L/D/H/L/P/T 2X42\2`2d2h2l2p;3t3x$4|U4445$5{5686666777$7-757P777 8888E:`::.;n;;;<;<==H= `=o==== >$>(C>,W>0>4>8><?@?D/@Ha@L@P@T@X@\@`@dAhAl,ApGAtOAxYA|iAAA BB3BEBCCDD'EJERE\EEEEEEF7F\FrFFFFFFFGGHH6H@H JHZHsH{HH I$$I(.I,8I0dI4I8&J<YJ@eJDJHJLJPLTLXL\M`=MduMhMlcNpNtQxQ|[RRR%SSSETjTT U{UUVVVWWXXXCYjYD^ aaabcgvhhhj=jtjj jk,k_kk k$l(l,tl0m4Fn8pn<n@*oDtoHoLoPoToXp\,p`ipdqphplppptpx q|q9qUqqq rCrdrAt$u[uuu*v2vdvvvvwAwJw_wkwzwwwwwjxxxxx yJy yy7zVz{z z$z(z,z0#{4S{8{<{@{D|H|LY|P~|T|X|\|`}d}h(}l}p}t~xl~|}~~~~(p@s}'/7CpP*7B-@ _ą $*(,0܆4҇8ڇ<@8DRHLPЈTX9\L`kdxhlptBxi|,>sߋRDnč4^Ԏ]*x   ʐ ܐ    4 H$ r( z, 0 4 8 P< c@ D H L P ĒT X %\ ` d h l .p t x | K c  Ֆ ŗ    _ p  Ԙ  4 d   t    X  + t  Ӝ    0  A     < R p  $ ( $, :0 `4 8 < @ PD ȡH L P T (X D\ `` d h l p t #x V| h  0 A    0 g  $ 6 p  1 d v  ݨ   g    @   & Y  ͫ       % _ g $ ( , 0 ӭ4 8 5< b@ jD H L P ïT үX '\ T` d Ѱh ٰl p t x ʱ|  3 K Z   ( P  Ҵ  O a  Ե    ն     Է    N p z   ~  Ź ͹  - < r  $ ˺( Ӻ, 0 J4 U8 l< @ D H mL P  T cX \ ` d  h 4l _p <t x 1| 9 H \        C k      !  B W      Q     / H W p  I `    a $ ( +, 30 ;4 d8 n< *@ LD iH L P T X \ ` d ,h 4l Ap Zt cx |    * D X r     ;    . t    7 ? t   o    V    >X $q(,0448|<@DHLPPTX\`dhXlepqtyx |hZs$4pT\'2i{ZE $B $( ,0,4`8<@dDHLPT X\(`9dPhzl'p/tAxI|QTe,8 $G_l :c $(,048<-@bD7H}LPTX\` dDh[ltptx|<t)1D#rS{0O]n0l !Dc '$/(L,04!8)<?@vDHLPT7X^\z`dhlpt$x|K{kt C     %0;@A\{ Ac $(,*0M4w8<@DH&LLPT(Xs\`dhlYptx|:^.Su,Nq \ ~     @ b         3 F Y l    $ ( , 0 4 8 <2 @l D H L PA T{ X \ ` d h3lmpt+x|!V~-b,kR:w1ZQq 5r $(,I0~48<@D1HQLqPTX\`PdhlptxB|t*]3|9}N G y    !J!u!!!!+" Z"x"""" &#$d#(#,#0#4$8D$<$@$D$H$L$P %TF%X%\%`%d &h&lX&p&t&x&| ''-'g''''(B(|(((()Q)e)v)))*,*?****5++++, ,?,y,,,, -----:. x.$.(.,/0./4l/8/</@/D/H0L,0P0T0X0\)1`D1d]1h1l1p2tE2x2|2222P pI`IJh $И(,0 48<@ & *hprw $(,048<@DHQLRPWTgXp\`dhlptx|*.57<@[]_abcgfp  V$W(Y,^0`4z8<@DHLPTX \7`=d?hAlBpFtJx |   ! # % * N R S U W Y [ v z              & + z           $ ( , 0 4 8 <+ @0 DE HO LP Pk Tq Xv \} ` d h l p t x |      + 6 7 9 ; = ? D !#((6 ;=?@A  $(,048<@DHL P"T'X(\)`0dghhlipktmxo|qv%0KMOPT CPkmry   $(,048<@DHLP TX\`dhlptx|+15<_`bdipbcdfhjlqv89;= BEIKM R$g(p,048<@DHrLsPtTvXx\z`|dhlptx|>?ACEGLcdfhjlq     % 0 G $I (K ,M 0Q 4U 8 < @ D H L P T!X!\!` !d !h!l!p !t7!x; @; B; D; I; ? ? @ @ @ @ @  @ C C C C C C C C C E  E  E$ E( E, E0 E4 E8 E< F@ FD #FH $FL FP FT FX F\ H` Hd Hh Hl Hp Ht Hx H| I I I @I AI FI PI mI MJ RJ jJ pJ J J J J K K  K K K K K HP NP OP QP SP UP WP \P P P P P P P P P -^ 0^ K^$ P^( R^, T^0 X^4 \^8 e^< a@ aD aH aL aP aT aX a\ h` hd ih jl jp Fjt Mjx Qj| `j zj {j j j j j j  k k k lk mk nk sk k k k k k  l l Ol Pl Ul `l {l l l l l On Pn Rn Tn Vn [n `n wn {n ~n n$ n( n, n0 n4 n8 n< n@ nD nH 7oL l@pBtGxݣ|<@GINҤӤؤ    78; `$a(c,h048<¥@֥DߥHLPTX\ `d h7l9p:t;x|Ʀ̦ͦϦѦ֦ߦ PQSUZ`wyz{   " $)JNU W$\(,048<@DHL/P0T2X7\~`dhlptx|!0GIJKӪ?CJLQwxz| #$&+ $(,048<@DHLPoTpXu\`dhlpt­xí|ȭۭܭ  VWY[`agikp9@[]_`dh "7@ W$Y(Z,[0ݴ4޴8<@DHLPTX \ ` dhl5p9t@xB|G*+-/16Ƕɶ˶ͶҶ۷9:< Aefhm $(,048<@D¸HøLǸPYTZX[\]`_dahclhptx|w'()0IJO]`z { $M(N,S0`4z8~<$@%D*H{LPTX\`dhlpt_xb|cegikp  ;CHqrty*. 05@WY Z$[(b,048<@DHL3P5T7X8\9`xdyh{l}ptx|,1P_`vy GHJL Q$( ,Q0R4T8V<[@dDeHgLiPnTX\`dhlp+t,x1|7;=BPgikmnr Px $(,0#4@8W<Y@^DdHkLpPvTnXu\v`xdzh|l~ptx|1@qAEFHJLNSp-379>PQSU Z        $ ( , #0 *4 8 < @ D H L P T X \ ` d h l p t x |      ~                  U ` { }      !!! !! ! !! !$!(!,! 0! 4! 8!t!Bx!G|!2!3!5!:!!!0!1!q!r!|!!!!!!!v!{!!!!!!!!!!!!!!""" """"Q"` "{$"}("~,"0"4"8"<"@"D"H"L"P"T" X"L \"M `"O d"Q h"V l"` p" t" x" |" " " " " " " " " " " " """H"M""#"""K"f"""<"V"p"q"r"t"v"x"z### ##### #$#(#,#0#4#8#<#@#D#DH#EL#SP#T#RX#`\#`#d#h#l#p#t#x#|###D#8# #$ # # # #< #v # # # # # # # #K # # # # # # ##w##7#l##u#'$\$m$n $y$$$$d $p$$($,$0$4$8$&<$[@$D$?H$|L$P$T$SX$\$`$d$h$Ll$~p$t$4x$ |$d"$"$"$"$"$"$#$0#$7'$^'$m'$'$'$($)$*$*$*$*$I*$r*$w*$*$*$*$*$*$*$*$*$&+$(+$,+%>+%d+%t+ %v+%x+%z+%|+%+ %+$%+(%+,%+0%+4%+8%+<%+@%+D%+H%+L%I,P%,T%-X%4-\%-`%-d%-h%-l%-p%-t%o.x%.|% /%/%r0%z0%0%0%0%0%0%1%%1%)1%21%P1%c1%1%1%1%1%:2%>2%R2%T2%2%2%2%2%2%3e= ==$(=0 4<@HLT?X`dlpx|    c   # # $ % *  !*  (*$ ,"+0 8+< D+H P8T \:` h<l t @x @ @ "@  A B kC tC {C C E H H &`Ca (h,4i8@MjDLjPX|q\d{vhpxt|czjzǑikv 2$>(0e4<@HLTX`Ydllpx|;FRR (p08@@pHP`X`h p` x   P   0 Ppp0  !(P$0$8%@`&H&PP'X(`0+h+p@.x.//45@78CFHIPIpJJJ0^hj`jjk k(k0`l8`n@nH`oPoXp`phqpPrxuvwyz|~~`0Ѐ`@0  (p0 8@HPX`h pPx`К` О`P@0  `0 (0@8@@HPX`hpx`` @`PP@@ p(08@`H0PX`hpx`  p`&&XX  ( 0 8 @ H P X 0 "8 * 2 ?  L( T0 ^@ tH P  ( 0 8 @ H P X h @k`/`  @(08@ HP@X`hp@x@ `   ` `     `   @   (0@8@HPX``h@p@x   @@` `` (0`8@HP@X`hpx@``@ ` @` `("0"8 @@!H!P$X$``$h $p#x#`# # "!!@ (`( (''/`/**@*,@, ,(+0+8@+@.H@.P.X-`-h@-p-x%@%`2211@110/)`0 ))&% 0@''&& @&( 50484@`4H 4P3X3``3h 3p2x2;@; <;;@==LL`L LKK`K KJJ`J JI I(`I0 I8H@HH`HP HXG`Gh`Gp GxO6`6 65`B B@8877@7799@9988:: @:(:0<8`<@?H?P`?X ?`>h>p`>x >==MMAA`A A@@`@ @`O ONN`N NF@F F(E0E8@E@@DHDPCXC`@ChCpBx@MFDD? P/ ( 0V (`p (  (>J  (b jF (C7Pk`  (s   ( d" (6 (B*V ( ) , -' - /' *. ,=0T ,&6` ,m ,E{ , ,G , , ,BK , f , , ,f ,\ ,4 ,Nh ,Kr ,x ,ٺ , : , ,D ,G ,Q ,4} ,E , ,Ƥ ,r ,D  , ,t( ,/ ,n4 ,@ ,"L ,8X ,d , p ,| ,UU ,@ ,\r , ,\ ,_ ,a , , , ,hS ,\* , ,IB) ,:*5 ,A ,M ,WY ,ԇe ,q ,7} ,F ,l , ,l ,H ,V , ,m ,b ,3 , ) ,6 ,F^ ,2k ,x ,; , ,N ,#L , ,\ ,|D ,  ,z. ,< ,J ,HX ,r f , Lt ,| , ,mH , ,% , ,a , ,A ,#L ,t ,K^ , - ,q; ,oI ,VW ,xe ,s ,Ǹ ,/8 ,. , ,F ,b\ ,. ,N ,7 , ,U% ,&D ,7S ,_b ,q , ,. , ,J ,  ,? ,9 ,O ,z ,S , ,3% ,4 ,$C ,bR , _a ,+p ,2 ,! ,O ,4 ,C ,Y3 ,, ,r' , ,v ,X ,$ ,!3 ,TB ,Q ,` ,o ,>~ ,( ,: ,} , ,! ,) , , ,R ,! ,. ,iZ\ ,p ,_F ,I ,* ,* ,( , , , ,f' ,} ,# ,.k/ ,]< ,&I , ?V ,_c ,Op ,W} ,f , , ,; , , ,Z ,4 , , ,) , 6 ,<-C ,wc ,?m ,ǻz , , 5 , ,| , ,ng ,, , ,% ,), ,|; ,J ,fg ,"w ,} ,A , , ,y , ,6 ,k ,v ,. , , ,R ,~* ,7 ,>?i ,v ,f ,$ ,o , ,( ,v ,Ɖ , ,  ,  ,i. ,d< ,EJ ,UX ,Xf ,t ,Z ,.) ,&, , ,֎ ,& ,9^ , ,;N ,"8 ,x ,n ,GL* ,]8 ,F ,DmT ,Jb ,Dp ,~ , ,~ ,L , , , , , ,( ,OD5 ,;I ,?V ,c ,, p ,} ,f ,9 , , , , ,G/ , , ,U ,y ,;] , ,, ,) ,b , , ,6 ,T3 ,`@ ,M ,#Z ,̑g ,=t ,* ,ɦ ,sw ,Rl , ,i ,  , ,r ,f , , ,* ,v58 ,BF ,*T ,b ,p ,^f~ , ,1 , , ,k ,\ , ,C ,C- ,3< ,9K ,,Z ,j ,+y ,X , ,[ , ,? ,0 ,  ,! , ,O ,\/ ,- , < ,jK ,/Z ,i ,x ,a ,1 , ,f ,/ , ,cK ,p ,N , , ,q ,f^ ,E2 ,n ,d ,u , ,` ,! , ,, ,,, ,; ,J ,Y ,ih ,Dw ,}b ,e$ ,F , ,ؕ , , ,k , ,  ,+ ,vK+ ,5: , I ,X ,ig ,y"v , , ,Z  ,*E , ,Y ,= ,F ,R ,JE  ,2 ,+ ,2: ,o3I ,)X ,u ,OZ , ,lA ,5 ,L , , , , ,k[  ,m ,"i) ,8 ,zG ,KV ,%e ,?t ,Bf ,  ,Z ,X , , ,U ,  ,Nr ,  ,I ,:1( ,7 ,_5F ,U ,`d ,s ,D ,}L ,  ,w , ,8 , ,#] ,C ,  ,- ,' ,76 ,E ,T ,c ,r , ,K ,/5 ,/: ,X ,T , ,P ,v ,j , ,(& ,5 ,D ,S ,Ӳb ,fq , ,d ,Z ,n ,( ,> ,%r ," ,Ë , , ,& ,5 ,D ,zPT ,uc ,r ,{( ,g ,  , ,>q ,A ,i ,@ , ,F , ,S& ,5 ,=D ,9S ,b ,oSq ,8 ,*s , ,} , ,] , ,e , ! ,/!! ,&! ,P5! ,D! , S! ,e1b! ,Nq! ,! ,m! ,"! ,4! ,S! ,S! ,! ,! ,ӗ! , " ," ,)" ,'%9" ,JH" ,o" ," ," ," ," ,|" ," ," ,u" ,C# ,f# ,"# ,0# ,5?# ,KL# ,@rY# ,f# ,t# ,# ,Gr# ,# ,$ ,b$ ,$ ,&'$ ,pJ$ ,Xm$ ,-y$ ,jY$ ,jY$ ,+$ ,$ ,q$ , G% ,,% ,f(% , 5% ,RH% ,ZX% ,>% ,k% ,% , % ,Y% ,V% ,'% ,% , & ,& ,/'& ,I5& ,dbE& , S& ,a& ,7o& ,D& ,X& ,4& ,6& ,k& ,ٱ' ,f ' ,4' ,B' ,ݒP' ,Ig^' ,-4m' ,{' ,z' , ^' ,' ,$' ,^' ,' , ' ,ER' ,' ,;"( ,3( ,O( ,`( ,p( ,\( ,Q( ,R( ,( ,[( , ( ,z( ,b( ,|?( ,l) ,) ,.$) ,N3) ,!B) ,Q) ,0`) ,LKo) ,~) ,g) ,,) ,) ,`) ,) ,) ,2) ,s) ,1* ,* ,$* ,S3* ,NB* ,O Q* ,+`* ,Yo* ,f~* ,* ,&* ,* ,)* ,_* ,*B* ,* ,* ,#L+ ,M+ ,*+ ,>/*+ ,C+ ,MP+ ,-]+ ,Ym+ ,;s+ ,y+ ,=+ ,^+ ,f+ ,+ ,bu+ ,o}+ ,+ ,4+ ,[ , ,, ,m,, ,[9, ,F, ,mb, , o, ,, ,j, ,5, ,, ,d2, ,, ,m, ,T, ,, ,- ,E- , - ,vY- ,Le- ,q- ,l~- ,- ,&- ,/- ,^. ,8!. ,/. ,J. ,/X. ,. ,&. ,/. ,/ ,۾/ ,f/ ,G/ , / ,/ ,\0 ,i0 ,Z1 ,1 ,Q/1 ,ow1 ,V$1 ,a1 ,1 ,D31 ,1 ,NI2 ,V2 ,qc2 ,&p2 ,D}2 ,2 ,d2 ,"%2 ,2 ,2 ,t2 ,V5 3 ,,3 ,<3 ,GK3 ,v{Z3 ,Sz3 ,R3 ,23 ,3 ,3 ,ap3 ,N3 ,B3 ,K3 , 4 ,t4 ,+254 ,E4 ,U4 ,:e4 ,]u4 ,4 ,4 ,x4 ,4 ,14 ,z4 ,@_4 ,B4 ,M5 ,V95 ,z$#5 ,Kc85 ,hE5 ,.R5 ,K5 ,@5 ,5 ,5 ,5 ," 6 ,@6 ,/6 ,)6 ,f66 ,7'C6 ,Z^6 ,zk6 ,3y6 ,6 ,6 ,$6 ,6 ,T6 ,q7 ,7 ,)07 ,E7 ,S7 ,4C_7 ,NGl7 ,\y7 ,7 ,}7 ,%7 ,w7 ,7 ,7 ,7 ,7 ,`C7 ,8 ,* 8 ,/h8 ,L'8 ,48 ,<A8 , N8 ,[8 ,Ùh8 ,3v8 , 8 ,8 ,F8 ,$8 ,8 ,f8 ,68 ,;8 ,8 ,9*9 ,$79 ,&D9 ,R9 ,w^9 ,+tk9 ,iZy9 ,9 ,9 ,9 ,.9 ,{R9 ,49 ,p9 ,y9 ,n9 ,O : ,r: ,y&: ,oF2: ,{?: ,yM: ,b: ,yo: ,&}: ,7: ,4: ,j: ,W: ,X: ,n: ,,: ,Y: ,K ; ,J; ,7&; ,3; ,A; ,CN; ,Ӌ\; ,Ah; ,e u; ,m; ,E=; ,؏; ,M; ,; ,; ,E=; ,; ,; ,< ,< ,1&< ,\2< ,ߗ?< ,aAR< ,0_< ,r< ,K(< ,< ,< ,< ,.< ,P< ,a< ,< ,d < ,y< ,; = ,&= ,%= ,2= ,b?= ,M= ,Y= ,f= ,s= ,m= ,k= ,j5= ,= ,"= ,z= ,= , = ,= ,= ,4= ,= ,= ,> ,> ,B> ,'@*> ,7> ,j3E> ,jS> ,g`> ,n> ,%~> ,>[> ,> ,~> ,j3> ,s> ,> ,.> ,> ,> ,J> ,? ,/(? ,5? ,B!B? , \? ,i? ,v? ,09? ,Y? ,Á? ,? ,j? ,? ,f? ,?? ,7@ , @@ ,"@ ,,@ ,9@ ,YF@ ,:T@ ,ia@ ,n@ ,{@ ,bu@ ,w@ ,+@ ,@ ,@ ,@ ,/ A ,A ,@'A ,8A , EA ,YQA ,f^A ,n4sA ,A ,A ,"A ,2A ,A ,A ,A ,A ,B ,B , B ,-B ,h:B ,"5QB , ^B ,|kB , B ,B ,AB ,B ,B ,xB ,%B ,<B ,'B ,~C ,XwC ,F:C ,T^C ,kC ,ՖxC ,guC ,C ,C ,RC ,C ,aC ,@C ,pGC ,C ,o D ,sD ,8`&D ,#:D ,gpFD ,ASD ,j3yD ,D ,XyD ,D ,D ,AD ,5D ,7D ,D ,ND ,gE ,!E ,?;*E ,?7E ,DE ,Y^E ,3lE ,]yE ,jE ,E ,^E ,^E ,mE ,ўE ,gE ,<E ,E ,E , F ,F ,0?$F ,BF ,YOF ,H]F ,jF ,ixF ,%rF ,OF ,F ,j F ,fF ,bF ,G , `*G ,;6G ,5DG ,RG ,+`G ,&oG ,s*G ,G ,s+G ,G ,lG ,1G , G ,yG ,G ,G ,G ,+H ,vKH ,H ,I,H ,:H ,HH ,޺WH ,-eH , sH ,Z1H ,#-H ,Z[H , H ,`H , H ,H ,sH ,DH ,qI ,S I ,QI ,-I ,;I ,<II ,«WI ,DeI ,NsI ,XI ,23I ,)XI ,ͱI ,I ,(I ,RI ,tI ,3I ,=I ,! J ,G6J ,)J ,Y7J ,EJ ,.,SJ ,aJ ,ZoJ ,m}J ,VJ ,<J ,(AJ ,GJ ,J ,`J ,J ,9 J ,^J ,T K ,·K ,^f)K ,l7K ,EK ,ڟSK ,}0aK ,oK ,$}K ,K ,5K ,K ,K ,K ,K ,CK ,aK ,L ,CL ,(L ,6L ,DL ,}{RL ,`L ,^fnL ,8|L ,L ,L ,L ,E=L ,toL ,ORL ,XL ,>{ M ,SfM ,'M ,9 5M ,fCM ,?SM , cM ,FsM ,ťM ,kM ,`M ,>M ,!~M ,|1M ,߇M ,M ,Q N ,6N ,CCN ,_QN ,`N ,oN ,~N ,`N ,N ,N ,8N ,N ,N ,O ,O ,e!O ,\0O ,TO ,M^O , lO ,zO ,N$O ,O ,ˇO ,O ,\O ,.qO ,O ,\O ,XO ,fP ,P ,"P ,'0P ,>P ,n=^P ,kP ,ZxP ,&P ,#2P ,Z ,MZ ,[)\Z ,kZ ,zZ ,2Z ,Z ,Z ,AZ , Z ,{Z ,Z ,5Z ,T[ ,d%[ ,m/[ ,&I[ ,q[ ,p[ ,E[ ,^[ ,l[ ,#[ ,&?[ ,xj[ ,ב[ ,o[ ,+R\ ,\~\ ,"\ ,M0\ ,Y>\ ,܁L\ ,&Z\ ,h\ ,v\ ,\ ,\ , \ ,O\ ,\ ,\ ,1 \ ,\ ,\ ,}] ,] ,)] ,6] ,:P] ,$]] ,j] ,f(w] ,)] ,c] ,] ,N] ,Cp] ,] ,] ,] ,M] ,] ,f^ ,^ ,8#^ ,!?^ ,M^ ,tA[^ ,i^ ,w^ ,_^ ,R^ ,^ ,j^ ,^ ,չ^ ,ذ^ ,m^ ,_ ,_ ,x_ ,:_ ,bU_ ,f'c_ ,q_ ,[_ ,z_ ,l_ ,_ ,_ ,\_ ,m^_ ,_ ,__ ,` ,p` ,J` ,)` ,m3` ,JL` ,Y` ,;f` ,{s` ,` ,lR` ,!` ,e` ,%:` ,` ,#L` ,OD` ,.` ,a ,ta ,eVh ,ULh ,U_h ,̲lh ,;h ,dh ,h ,,h ,sh ,;h ,h ,_h ,1i , ri ,*i ,SBi ,M=Oi ,:xi ,9i ,QBi ,QBi ,ϊi ,&i ,i ,Ai ,i ,i ,j ,j ,f)j ,&6j ,%Cj ,Pj ,E]j ,hjj ,\xj ,j ,j ,{j ,Kj ,8j ,j ,~j ,Uj ,Bj ,.k ,nk ,9k ,+k ,Q^8k ,0Ek ,bRk ,8_k ,Ilk ,yyk ,k ,k ,6k ,qTk ,k ,k ,B! l ,g%l ,68l ,6Ol ,hl ,ul ,l ,l ,pl ,w`l ,Ol ,'l ,g<l ,tfl ,b m ,m ,f#m ,or=m ,Jm ,m ,2m ,m ,m ,6m ,6m ,qT#n ,60n ,5*Hn ,f\n ,6jn ,B!~n ,n , n ,Rn ,,n ,n ,n ,n , o ,oo ,&o ,_hEo ,^o ,lo ,zo ,+o ,Go ,Qo ,K;o ,%o ,8o ,o , p ,v0p ,%Bp ,Pp ,iU^p ,67lp ,vzp ,Yp ,xp ,Mp ,Fp ,p ,p ,<p ,p ,p ,v} q ,jq ,{(q ,6q ,Vq ,;sq ,>}q ,q ,e q ,#Lq ,f?q ,&q ,Cq ,q , q ,q , r ,Dw$r ,a2r ,iQr ,jr ,^wr ,W&r ,"r ,zr ,r ,Zr ,^br ,or ,_s ,as ,>s ,+s ,;9s ,:pGs ,Us ,Lcs ,&Tqs ,#Ls ,Ws ,Cs ,s ,s ,bus ,Xt ,9t ,A)t ,7t ,Zt ,ht ,&'vt ,[t ,zt ,t ,Ωt ,.t ,t ,t ,t ,u ,u , u ,},u ,:u ,Hu ,vVu ,du ,ru ,<u ,qu ,u ,u ,'u ,Xu ,=7u ,K,u ,u ,DQv ,cv ,I%v ,4v ,QCv ,|Rv ,pv ,v ,ݎv ,v ,&v ,xUv ,v ,v ,6v ,"Cv ,fw ,@w ,$w ,3w ,wBw ,XQw ,`w ,Vow ,~w ,jw ,=w ,Bw ,9w ,i w ,w ,2w ,Zw , hx ,Lx ,C Ix ,+Sx , h]x ,U kx ,r$xx ,?Mx ,ex ,x ,Zx ,x ,x ,fx ,*x ,=x ,9y ,y ,Wz$y ,H?y ,QMy ,A[y ,g!iy ,d%wy ,by ,y ,y ,?~y ,Yy ,&y ,=Cy ,ty ,f/z ,m=z ,,gz ,cvz ,z ,z ,&z ,Bz ,z ,1=z ,ʾz ,`z ,,{z ,wz ,z ,z ,vgz , z ,4z ,^Vz ,z ,E { ,{ , &{ ,3{ ,n@{ ,=^{ ,ml{ , z{ ,{ ,N%{ ,h{ ,S{ ,z{ ,Gj{ ,^{ ,E}{ ,#+{ ,+| ,A| ,| ,| ,iZ| ,V>} ,<} ,dfJ} ,f} ,t} ,S} ,Ϗ} ,-} ,˳} ,>} ,} ,A} ,Q} ,_} ,~ ,0~ ,O~ ,f+~ ,9~ ,H~ ,W~ ,~ ,~ ,P~ ,Y~ ,& , ,&# ,1 ,F? ,M ,~[ ,>i ,fw , , , ,A ,Q ,n ,s , ,*' ,s5 ,GYT ,.me ,!Dk ,q ,w ,Ȓ} ,0 , ,c , , ,g-Ā ,Ҁ ,O ,j3 ,p , ,&` ,UM& ,14 ,9HB ,P ,/0^ ,Il ,z ,Mi , ,#L , , ,b΁ ,1ށ , ,Q{ ,f ,& ,* ,39 ,IH ,W ,^f ,u , , ,a , , ,mЂ ,_߂ ,9 ,G ,cU ,vi ,w ,s ,w , , ,Wσ ,݃ , , , , ,Lj ,=t , ,4 ,, , ,$ ,C„ ,Qτ ,݄ ,. , ,/ , ,b ,fˆ ,m؆ ,b ,M ,A ,& ,#L3 ,@ , q ,]~ , , ,. ,$ , ,%Ḣ ,cه ,1 ,3 ,m ,p ,l! ,. ,MyY ,;i ,^o ,u ,<{ , , , ,q ,K ,< ,# ,/eI ,lu ,\ ,U ,ˇ ,ѝ ,͉ ,Ϡ ,Q ,M= ,uJ ,3X ,e ,r ,F ,& , ,*$ɋ , ,j ,2 ,7I0 ,#LL ,X ,zu ,̌ ,e ,ܶ ,X , ,C8nj ,Ռ , ,$ ,V , , ,) ,/7 ,rE ,Y , g ,|u , ,ͷ ,t ,0G , ,ɍ ,)׍ ,C , , ,Q ,r( ,x+ ,h9 ,AG ,U ,c ,+q ,9 , , , , ,eǎ ,Lގ ,P , ,, , ,<) ,#? ,sN ,,^ ,t , ,` ,ڮ ,p ,SՏ ,a8 , , ,. ,e ,է# ,̴0 ,=j= ,JJ ,]W ,!d ,(aq ,/~ ,D , ," ,c ,8А ,*ސ , , ,% ,k ,9$ ,2 ,M@ ,ON ,nZ\ , j ,(x ,e ,Ck ,8 ,\ ,=k ,f̑ ,Iڑ , ,% ,Y ,qn , ,[<. ,@= ,L ,[ ,;gj ,Xy ,] ,ŏ ,_ ,% ,\!Œ ,dԒ ,~ , ,k , ,a4 ,w. ,N= ,UL ,BI[ ,j ,& y ,+ ,=b , ,W , Wē ,Κӓ ,E ,l9 ,y ,-& ,m/ ,8> ,B9M , b ,?r ,x ,R\N ,[ ,\Lh ,ju , ,X ,sÕ ,] , ,, ,79 ,/F ,S ,` , ~ ,c ,K ,{aȖ ,7Ֆ , , ," ,Me , ,?# ,bX0 ,,= ,BJ ,W ,6e ,@s , ,rm , ,٦ ,j3 ,Aʗ ,ח ,b ,A$ ,A ,V ,&& ,_@ ,VS ,`, , ,.И ,d֘ ,uܘ , ,2 ,Y ,^ ,{ ,( ,Lp7 ,fE ,ZS ,a ,-o ,;} ,g ,i , , ,љ ,; ,\~ ,@ , ,$ ,+ ,: ,)I ,X ,g ,v ,8_ ,` ,! , ,8Y ,jњ , ,d , ,5 , ,Uk+ ,N: ,`+g ,Fv , ,u , ,zߛ , ,X ,{ ,  ,7 ,z- ,E: ,'G ,._ ,dl ,}y , , ,j3 ,v{ ,jaΜ ,{^ۜ , , , ,j3 ,b) ,E ,R ,zy_ ,l ,y ,8 , , ,Ɲ ,ԝ , ,L ,n ,2 ,~/ ,i< ,v{J ,Ǟ ,Ԟ , ,x ,. ,F ,p ,, ,r9 ,.P ,] ,V , ,j , ,= ,N̟ , ,9 , ,{ ,yT ,a ,={ ,} ,H , ,ݼ ,Th֠ ,j , , ,= ,N! ,>= ,JK ,Qd ,(w , ,B ,4 ,xI , ,cġ ,)ѡ , , , ,ls , ,r- ,__ , ,- ,& , ,/ â ,Ѣ ,2ߢ ,j ,?1 ,g) ,p ,`# ,0 ,Ԣ= ,J ,W ,=d ,q ,M , ,ʣ ,ף ,$ ,L , ,0 , ,6& ,j3 ,#A ,N ,[ ,+h ,v ,K ,* ,- ,B` , ,0ˤ ,fؤ ,\ , ,&" ,d< ,J ,qW ,d ,q ,-~ , , , , ,Qg ,nͥ ,?\ڥ , ,ۚ ,:c ,  , ,* ,7 ,BD ,8Q ,/._ ,Ll ,y ,0 , , , ,< ,qǦ ,<Ԧ ,6 ,Y ,A ,m ,ў ,g$ ,i2 ,y"@ ,M|N ,\ ,mj ,x , , , ,| , , Z̧ ,ڧ ,R ,2 ,br , ,B! ,/ ,C ,M ,~Z ,B`h ,wu , , ,! , ,=Fƨ ,[Ө , ,` ,d ,؋G ,mS ,h ,pt ,I ,t ,L ,Zթ ,f ,( ,M ,  , ,+ ,9 ,QG ,l&U ,Ӌc ,Oq ,O ,G ,3 ,N ,s ,HŪ ,-Ӫ , ,u ,ޖ ,<3 ,s( ,7 ,cOF ,U ,d ,r , , ,v , ,:̫ ,3۫ ,w , ,# , ,?& ,A5 ,j3D ,S ,b ,ԙq , ,t ,{ , ,,ʬ ,٬ , , ,2 ,$ ,,y3 ,JB ,$Q ,B` ,1uo ,\|~ ,@ , ,Xȭ ,-7 ,i , ,Y ,Z , ,b ,% ,5 ,C ,O ,g\ ,qi ,v ,R , , ,\Ů ,Ӯ ,1_ ,^Y ,6 ,99 ,u) ,]5 ,,K ,W ,@d ,q ,z~~ ,) ,0 ,I ,S ,<ί ,c ,xp , ,B , ,_( ,F6 ,zD ,R ,Jn` ,hn ,5| ,y ,5 , ,fȰ ,Lذ ,&Oް ,@ , ,Cc ,̗% ,8 ,F ,ZS ,|` ,m ,2z ,hE ,U , ,R ,k ,ɱ ,ֱ ,^ , ,~ ,} ,. ,8A$ ,1 ,d> ,.L ,ίZ ,h ,v ,zc ,CA ,, ,< ,n0² , в ,J޲ ,o , , ,Ag ,Yu , , ,? , ,,1 ,ɳ ,%׳ ,f , , ,A ,u , ," ,? ƴ ,RXԴ , ,l ,c ,ǡ ,FX ,( ,96 ,PD ,2R ,`` ,Rn ,kO} , ,f ,# ,# ,gõ ,A ѵ ,Vߵ , ," , } ,G& , 4 ,S ,a ,T,o ,$} ,I , , , ,wö ,Ҷ ,h ,a ,o , , l ,,& ,94 ,B ,~P , ^ ,l ,C ,Q ,f_ ,~m ,OZ{ ,"%Ӹ , , ,z! ,G/ ,h= ,K ,'Y ,Eg ,-u ,o% ,^ , , ,7 ,ɹ ,I׹ , ,M ,Ro ,h ,) ,+ ,P9 ,f ,s ,C ,ǹ , ,# ,`: ,9ú ,Һ ,h~ ,E ,$ ,w ,0 ,, ,9 ,AF ,S ,B!a ,(| ,X , ,] ,v] ,h» ,л ,9D ,;' ,Ӷ4 ,A ,eN ,[ ,% ,9l ,y ,~- ,J ,rI ,Ʋž , ,sz ,` , ,b{' ,;1 ,; ,EK ,Y ,g ,Atu , ,K , , , ,qɿ ,׿ ,/ ,!@ , ,7 , ,&+ ,9 ,NG ,U ,=c ,"q ,* ,R , ,G , , ,k ,_ , ,V ,{ , t* ,[97 ,D ,(R ,` ,2n ,| ,a ,1 , ,t; ,ud ,Q ,2 , , ,5 , ,$ ,C42 ,@ ,jN , \ ,>j ,Qx ,ӿ ,9 , ,e ,- ,t , ,& ,k ,a ,w- ,1;; ,I ,KW ,e ,s , ,oU , , ,a , , ,k ,*z ,, ,f^: ,H ,qV ,$R| , , , , ,? , ,}e ,: , ,P] , ,d$ , 2 ,<@ ,RN , \ ,j ,x ,i ,k ,^ ,' , ,t ,R2 ,}_ ,vQ ,G ,?|3 ,eB ,qL ,d.` ,b n ,{ ,9 , , , , ,t ,0' ,U ,7 , ,]Z , , $ ,f1 ,`> ,ܠK ,X ,le ,׀r , ,q ,Y , ,E= , , ,y , ,r ,2 ,# ,ֈ0 ,M8= ,mW ,.e ,+s ,"x , ,5 ,6 , ,@U ,^ ,1 ,X ,\\ ,'j , ,& ,$ ,:82 ,/@ , ,X ,R ,EI ,c ,Kp ,|} , ,X ,B! ,[ ,& , , ,6j ,o ,u ,U , , ,# , ,Ϙ ,) , ,Be , ,4 ,#L , , ,-3 ,8 ,e E ,1T ,Uc ,r , ,xH ,O ,9 ,H ,c , , ,pX , ,i( ,*5 ,B ,O , \ ,i ,6v ,p , ,u ,} ,7 ,  , ,] ,v| ,3> , ,HT( ,5 ,P ,LZ ,=g ,6ru ,L , , , ,#L ,j ,f ,7 , ,6 ,P ,Z] ,Kj ,&x , ,Z ,&, ,,Z ,i ,%g , ,Ɖ , , , ,E ,. ,vG ,jf ,qr ,nj ,[ ,O , , , , ,8 ,} ,A ,z , ,!. ,G> , ^N ,Z^ ,Rd ,qj ,Qq ,^Q~ , ,jl ,[ ,١ ,@ , ,X , ,#L ,75 ,6A ,N ,9\ ,njj ,Kx ,6 ,x ,Ɖ ,6 , ,K ,v , ,s( ,"6 ,3 ,-3 ,A , t , , , ,&, ,s , , ,rD ,a ,< ,9 ,%s ,vv ,& ,Z3 ,@ ,#LM ,3 ,[j , ,2 ,* , , ,o ,S+ ,fC ,;j ,<w ,a , , ,=G ,V , , ,Ӵ ,^ ,T , ,q ,e ,?- ,: ,G ,T ,Pqa ,E y ,I , , ,Q , , ,[U ,: , , ! ,(0 ,? ,N ,<l ,'{ ,^ ,: ,s ,= ,P , , , ,\$ ,y ,D ,pM/ ,uL ,6[ ,j ,wy ,& ,&, , ,: ,] ,2 ,T ,K , ,g ,Xu# ,3 ,RN ,l[ ,םt , , ,D ,^ ,9z , ,R ,Y ,v ,' ,% ,T , ,[} ,&_ , - ,6: ,iM ,Z ,6g ,i , , ,r ,a ,@ , ,Y , ,v , ,03 ,J , e ,4#q , |} , ,9 ,3 ,& , , ,i ,%*- ,~= ,wM ,] ,om ,2} , ,L , ,iZ , ,{ ,џ , ,? ,J ,+, ,: ,I ,U ,Asa ,!m ,)Ny , , ,A ,  , ,V ,a , ,E7 ,#L. ,V9; ,ZH ,f ,1 , , , ,P ,C"> ,J ,P@W ,j3w ,q ,L , ,$ , , ,e ,I , ,) ,+7 ,1A , N ,nj[ ,"h ,3u , ,q ,$! ,2 ,8 ,0> ,,|D ,VK ,<g ,j3w , ,. , ,R ,K , ,K ,I ,p , ,n1R ,\ ,Gu ,3o ,p ,h , , ,( ,Q5 ,f ,5 ,e ) ,F ,S ,ƨ` ,Mm ,{fz ,q ,f ,JZ , ,e , , , ,1 ,3 ,&@ ,}N , Z ,h ,v , ,l ,E , ,ZJ , , , ,d , ,7 , ,, ,c: ,H ,,V ,&ud ,r ,R , , , , , , ,0 , , , ,| ," ,( ,o. ,5 ,C ,&Q ,m_ ,m ,{ ,| ,8m ,& ,S ,m ,@ ,p ,7 ,p ,Ԍ ,l ,T) ,@8 ,cG ,QpV ,;d ,&r , , , , ,_- , ,e ,ة ,y ,N ,@ ,H' ,x 5 ,(GC ,UQ ,9+_ ,ho , , ,e ,` ,v ,.d ,{ ,c ,PC ,Ys ,r ,c- ,B; ,kI ,tW ,e ,ss , ,! ,^ ,Cu , , ,Do ,#L , ,& ,(G* ,7 ,@D ,(Q ,O0^ ,Bk ,x ,* ,Q ,3 , ,Q , , , ,` ,`% ,M}A ,O ,] ,fk ,Fxy , ,֤ , ,#L ,6 ,b ,k , ,A6 ,3, ,ӡ9 ,`F ,JS ,vQ` ,g)m ,Kz ,l ,E , ,E ,! ,r ,j ,#L ,' ,64 ,A ,N3N ,a#[ ,h ,ӡu ,` ,J ,vQ ,l ,E ,& ,k ,3; ,wH ,#LU ,"b ,ko ,| , ,X ,PT ,7 ,t ,rD ,aJ ,<W ,#Ld ,&q ,3~ , ,&, ,N3 , , ,PS ,Գ ,ݬ ,IO ,zM* , 7 ,njD ,"Q ,3 , ,< , ,5 ," ,S , , ,O , ,4a , d% ,t+ ,2 ,@ ,oN ,S\ ,Wj ,Zy , , ,{ , ,r ,B , , ,_ , , ,$S , ,? ,/ ,Q , ,+% ,+ ,2 ,!@ ,[N ,n7\ ,5j ,] ,6R , ,S ,ٷ ,!Z , , ,| , ,  ,j3+ ,Z9 ,wS ,` ,A6m ,f ,wt ,k ,] ,ފ , , ,6 ,J , , ,q( ,6 ,M ,W ,?e ,s ,Fx , ,ZJ ,* ,%E , ,O ,E , ,& , ,o) ,>; ,KE ,O ,B ^ ,l ,z ,  ,D ,1 , ,ކ ,u ,y ,{ ,, ,  , ,= ,] ,y ,G ,& ,ܸ , ,g , ,Q ,$ , ,G , ,6 ,B ,O ,2\ ,ii ,]`v , ,{q , ,"0 ,C ,VQ ,^ ,% , , ,w( ,]=B ,wU ,'b ,p ,t> ,N , ,t , , , , ,\ ,G ,g  ,< ,_ ,f, , 9 ,E@F ,S ,Y` ,ckn ,Wz ,n , ,[ ,Z ,&, ,5 ,X ,  ,| , ,zO ," ,;0 ,0> ,L ,CZ ,h ,Uv ,# , ,U4 , ,# ,d , ,f ,MJ , ,  ,ѐ" ,P0 ,> ,fL ,Z ,Ch ,v ,d ,vu ,Ѽ , ,< , ,$ , ,= ,I ,1@ ,2B ,, , g: ,OH ,V ,md ,}r ,A , , , ,N , , ,B , , ,  ,H  ,(  ,6  ,D  ,R  ,"/`  ,No  ,bm  ,D  ,  ,%b  ,  ,nb  ,  ,  ,h  ,һ)  ,G7  ,9E  ,9S  ,a  ,o  ,E}  ,  ,  ,E:  ,I  ,c  ,;X  ,'  ,  ,  ,  ,B)  , 6  ,C  ,Q<P  ,tj  ,bw  ,  ,;  ,  ,  ,d  ,  ,a}  ,  ,g  ,s8  ,z  ,V&  ,3  ,@  ,Z  ,9  ,.)  ,  ,V"  ,Y_  ,  ,  ,  ,  ,  ,  ,  ,PL  ,><  ,J  ,VX  ,&l  ,v  ,  ,5$  ,  ,^  ,O  ,l&  ,P  ,mu  ,pM , ,f$ ,:2 ,YY@ ,NN ,|\ ,j ,~~ , , ,iZ ,B ,Q , ,=n , ,U , ,d* , ,M , ,V ,j , ,  ,s , ,j# ,5z8 ,E=E ,-Hh , ,"f ,2 ,n ,X ,R ,44 ,f  ,> ,5 ,:C ,Q ,p` ,}o ,~ , , , , ,  ,YY ,<> ,pM ,* ,$ ,i# ,2 ,A ,BP ,1u_ ,t ,~ ,s ,n , ,& ,I , ,9 ,e , ,% ,\@ , , , , ! ,' ,- ,t4 ,1A ,muN ,O~[ ,hh ,au ,#L ,"% ,5 ,X ,D' ,v ,& , , , ,y , , ,s+ ,8 ,E ,S ,a ,>o ,} , ,!# , , ,| , ,% ,- , ,^  ,p ,) ,8 ,"G ,;yV ,Ѽe ,<t , ,, ,C , , , ,G> ,. , ,R ,u ,gW/ ,> ,oM ,g\ ,7 ,) , ,7s ,P ,ZB ,*C ,3 , ,(  ,An ,R& , c4 ,>B ,P ,YW^ ,ļl ,Jz ,l ,ho ,< ,> , ,f ,q ,\ ,n ,l ,4 ,. ,= ,L ,"[ ,;yj ,Ѽy ,- ,< , ,, ,C ,O ,^ , ,z , ," ,2 ,B ,RR ,ub ,gWr , ,Y ,w3 ,_ , , , ,l ,. ,>  , ,D8 ,G ,LW ,g ,v , , , ,H ,I ,ݞ ,) ,m , ,{ ,2! ,. ,}; ,H ,U ,b ,Bo ,| , ,m| , ,? ,b& ,  ,z ,f , ," , ,̋w ,X , ,( ,| ,<# ,+V ,` , , t , ,l&  ,  ,?P!  ,X0.  , ;  ,H  , a  ,{  ,-p  ,j  ,  ,  ,'  ,}  ,  ,  ,}  ,  ,! ,'%! ,`3! ,`A! , aO! ,v]! ,vk! ,vy! ,3! ,xG! ,d! ,! ,! ,! ,*c! ,! ,2! ,& " ,'" ,y9)" ,R8" , G" ,2V" ,Se" , 2t" ,V" ,v" ,:" ,E" , " ,W " ,k " ,'" ,*^ # ,# ,R)# ,8# ,,G# ,nV# ,be# ,t# ,*# ,# ,W# ,F# , # ,S# ,# ,# ,B# ,oe $ ,e$ ,($ ,17$ ,ߍF$ ,U$ ,Md$ ,Hs$ ,P$ ,$ ,X $ ,:i$ ,?$ ,F$ , $ ,)$ ,q$ , % ,6% ,%% ,K3% ,lA% ,O% ,]% ,k% ,fz% ,~% ,M% ,% ,}% ,% ,5% ,ԙ% ,.% ,cN& ,& ,f!& ,Ǝ0& ,z?& ,6VN& ,]& ,Pl& ,z{& ,X& , ' ,en' ,'' ,|5' ,R' ,ta' ,~' ,' ,h' ,' ,cI' ,Pn' ,L' ,' ,' , ( ,'( ,(( ,7( , f) ,w) ,}) ,) ,{%) ,vs) ,>) ,) ,) ,) ,5W) ,S) ,8) , 1) ,) , * ,* ,s<%* ,3* ,`@B* ,V* ,pb* ,Er* ,ɔx* ,6~* ,n* ,B* ,~4* ,t* ,/* ,* ,* ,A* ,{* ,* ,S* ,+ ,C + ,+ ,@ + ,5&+ ,vp+ ,kvz+ ,+ ,+ ,+ ,m+ , + ,A, ,<, ,Q), ,jA, ,QO, ,}, ,H, ,, ,_D, ,&, ,Y, ,, , - ,X*- ,7- ,)#O- ,\- ,tt- ,- ,V- ,i- ,+- ,l{- ,u- ,+- ,d- ,. ,g. ,. ,Z-. ,d<. ,iK. ,Z. ,i. ,Ւx. ,8. ,. ,. ,5. ,b. , . ,. ,W. ,H. ,/ ,J/ ,g,/ ,;/ ,eJ/ ,DY/ ,^h/ ,Bw/ ,\a/ ,/i/ , R/ ,/ ,h/ ,/ ,j/ ,.0 ,E0 ,*P#0 ,,b10 ,J??0 ,KM0 ,#[0 ,0 ,_D0 ,&0 ,Y0 ,0 ,0 ,X1 ,'1 ,)#?1 ,L1 ,td1 ,q1 ,V1 ,i1 ,+1 ,l{1 ,u1 ,+1 ,d1 ,1 ,g1 ,2 ,Z2 ,d,2 ,i;2 ,J2 ,Y2 ,Ւh2 ,8w2 ,2 ,2 ,52 ,b2 , 2 ,2 ,W2 ,H2 ,2 ,J 3 ,g3 ,+3 ,e:3 ,DI3 ,^X3 ,Bg3 ,\av3 ,/i3 , R3 ,3 ,h3 ,3 ,j3 ,.3 ,E4 ,*P4 ,,b!4 ,J?/4 ,K=4 ,#K4 ,4 ,94 ,HC4 ,4 ,Y4 ,$Q4 ,{ 5 ,r,5 ,m95 ,<-F5 , AT5 ,/5 ,5 ,[5 ,/O5 ,5 ,ȣ5 ,g5 ,m5 ,q5 ,t5 ,W5 ,5 , 5 ,lk5 ,5 ,5 ,u5 ,5 ,L6 ,KA 6 ,E+6 ,6 ,k6 ,XH"6 ,+M(6 ,%.6 ,dc46 ,:6 ,"@6 ,eF6 ,L6 ,rR6 ,fX6 ,/f^6 ,eLd6 ,>zj6 ,p6 ,v6 ,|6 ,II6 ,)6 ,6 ,t6 ,%6 ,b6 ,u6 ,6 ,6 ,6 ,6 ,6 ,<6 ,6 ,4)6 ,X6 ,6 , /6 ,6 ,G7 ,97 , 7 ,p#7 ,'7 ,)7 ,$7 ,}T*7 ,07 ,67 ,g<7 ,B7 ,H7 ,ZN7 ,ϨT7 ,~+Z7 ,U`7 ,f7 ,UPl7 ,$r7 ,x7 , 7 ,}r7 ,7 ,Y7 ,e,7 ,7 ,7 ,a7 ,7 ,{7 ,7 ,G`7 ,7 ,[7 ,+7 ,Te7 , Y7 ,n7 ,7 ,7 ,V8 ,8 ,]d8 ,*D8 ,8 ,J 8 ,&8 , ,8 ,`28 ,88 ,-J>8 ,D8 ,J8 ,P8 ,V8 ,v\8 ,b8 ,h8 ,5 n8 ,Rt8 ,+wz8 ,M8 ,68 ,8 ,k68 ,A-8 ,p8 ,D8 ,8 ,8 , 8 ,{8 , 8 ,&8 ,8 ,"8 ,(8 ,hj8 ,?8 ,88 ,8 , 9 ,Q19 ,'9 ,p59 ,C9 ,Q9 ,pM_9 ,um9 ,U{9 ,9 ,L9 ,F9 ,"9 ,9 ,pN9 ,9 ,9 ,(: ,c5: ,fN: ,]: ,$kl: ,Q{: ,K: ,: ,c: ,zn: ,f: ,Ob: ,: ,; ,P; ,)5; , ,6%> ,f+> ,=D> ,Q> ,U^> ,@k> ,mx> ,> ,> ,> ,-> ,n> ,"%> ,? ,Z? ,!$%? ,C? ,*rQ? ,g_? ,m? ,k? ,*? ,( ? ,pJ? ,? ,#L? ,? ,:@ ,@ ,D+@ , S9@ ,yG@ ,çU@ ,5c@ ,F@ ,f@ ,h@ ,U@ ,@ ,;<@ ,}A ,A ,c*A ,7A ,ZPA ,_A ,xA ,w A ,fA ,xA , A ,qA ,A ,:B ,A'B ,h5B ,fNB ,Q[B ,yB ,B ,sB ,B ,B ,qB ,fC ,QC ,.C ,HC ,ZC ,@gC ,-uC ,KC ,=C ,C ,C ,*rC ,fC ,o D ,(!D ,.D ,u[FD ,ZD ,fyD ,D ,D ,D ,fD ,D ,cD ,fE ,fE ,l%E ,>E ,>[E ,qnE ,"%|E ,dE ,nE ,M)E ,E , E ,IE ,.gE ,ANE ,E ,) F ,|F ,];)F ,8F , {FF ,];TF ,bF ,pF ,iF ,F ,<-F ,KF ,F ,vF ,eF ,"%G ,? G ,-.G ,=G ,LG ,ai[G ,/jG ,yG ,TG ,լG ,NG ,G&G ,ћG ,ʵG ,G ,HG ,>H ,[H ,H , A9H ,UH ,cH ,qH ,&H ,H ,H ,H ,HH ,H ,H ,H ,I ,cI ,\(I ,K5I ,#2OI ,-\I ,jI ,vyI ,vI ,#LI ,wI ,AI ,wI ,5"I ,@I ,p2I ,w J ,AJ ,}=+J ,8J ,3EJ ,`RJ ,iJ , vJ ,J ,dJ ,J ,1J ,bK ,^,K ,P-3K ,C@K ,MK ,?5[K ,fiK ,^wK ,K ,K ,K ,qK ,dL ,^wL ,P ,cNP ,G^P ,o {P ,#LP ,P ,P ,FP ,7P ,zP ,dP ,qQ ,'Q ,~"Q ,0Q ,X?Q ,MQ ,h[Q ,iQ ,dwQ ,^Q ,)Q ,7Q ,~Q ,\TQ ,Q ,e_Q ,^>Q ,<R ,'R ,r5R ,sCR ,D{QR ,nR ,}R ,(LR ,5qR ,fR ,rR ,#LR ,R ,#LR ,6 S ,(S ,f(S ,CS ,j3QS ,D_S ,ZmS ,&,{S ,lS ,S ,,ZS ,iS ,%gS ,S ,gS ,5S ,S ,ET ,U ,PU ,E^U ,rkU ,1yU ,FU ,~WU ,mU ,R'U ,&9U ,oU ,[U ,+<U ,U ,U ,,#V ,F=V ,PV ,ב]V ,jV ,wV ,aV ,CV ,PV ,V ,6eV ,HV ,!V ,V ,V ,nV ,?W ,W ,"W ,&0W ,^@W ,FW ,&LW ,RW ,XW ,(^W ,dW ,2EjW ,pW , wW ,H"W ,W ,W ,OW ,W ,hX ,X ,$X ,v+X ,:X ,+GX ,&TX ,t;aX ,nX ,{X ,iX ,BX ,,X , X ,X ,X ,LX ,Y , Y ,Y ,f;'Y ,15Y ,BY ,QY , w_Y ,mnY ,xY ,Y ,Y ,PY ,kY ,bY ,A Z ,5*Z ,s%Z ,?Z ,mZ ,ýZ ,FZ ,&Z ,Z ,B`[ ,z.[ ,;[ ,H[ ,oU[ ,b[ ,u[ ,y[ ,[ , [ ,J[ ,K[ ,%[ ,[ ,@W[ ,F[ ,I[ ,uE\ ,_J\ ,\ ,+\ ,8\ ,E\ ,>R\ ,4_\ ,l\ ,y\ ,X\ ,ݐ\ ,j:\ ,u\ ,-T\ ,\ ,Uc\ ,\ ,y\ ,Uv\ ,N] ,] ,W"] ,0] ,>] ,_yL] ,OZ] ,Xh] ,3v] ,] ,] ,d] ,] ,e] ,?] ,^ ,e1^ ,!^ ,Q1/^ ,=^ ,pK^ ,Y^ ,t^ ,|^ ,pM^ ,L^ ,F^ ,"^ ,^ ,#L^ ,,^ ,_ ,_ ,ʪ#_ ,1_ , !?_ ,f^M_ ,S[_ ,1i_ ,w_ ,a ,:a ,a ,a ,{a ,Eb ,b ,_b ,9b ,'Gb ,Ub ,cb ,mqb ,b ,Cvb ,ƈb ,>b ,Pb ,/b ,b ,Ơb ,b ,b ,3 c ,΁c ,ܻ'c ,25c , ]Cc ,5Qc ,_c ,mc ,2{c , c ,tc ,.c ,c ,c ,c ,c ,>wc ,*Fc ,d ,Ed ,;#d ,H1d ,/?d , Nd ,]d ,jld ,i=d ,d ,d ,=d ,d ,d ,&d ,d ,e ,@De ,#L!e ,!0e ,e1?e ,Ne ,0le ,`{e ,e ,e ,@e ,0e ,e ,"e ,e ,Uf ,lg ,vg ,@g ,g ,5g ,Dg ,//g , g ,Ӫg ,g ,g ,g ,h ,y h ,h ,n_h ,h ,$h ,W,h ,78h ,^Rh ,a_h ,lh ,mh ,0h ,Eh ,;&h ,Ӊh ,h ,zh ,R7h ,Yh ,K i ,8i ,H[i ,ii ,&wi ,i ,i ,2i ,Oi ,i ,i ,i ,i ,ci ,i ,ji ,Ji ,/i ,#i ,#(i ,j , j ,?j ,lj ,fj ,#j ,yi)j ,/j ,5j ,;j ,ГAj ,EGj ,Nj ,,KUj ,\j ,cj ,7kj ,(juj , j ,lj ,%j ,j ,ܝj ,"j ,T k ,vk ,V'k ,5k ,!Ck ,Rk ,J\k ,jk ,hxk ,Tk ,k ,k ,Ek ,k ,k ,#Lk ,h l ,XVl ,Ql ,H_l ,x&ol ,@}l ,Kl ,i=l ,Cl ,l ,tl ,l ,Ll ,7m ,W'm ,'!m ,/m ,=m ,Km ,fgm ,;um , m ,>m ,om ,m ,Xm ,>m ,m ,n ,un ,Wn ,en ,sn ,Q#n ,n ,n ,n ,n ,n ,pin ,pn ,Yo ,/"o ,m6o ,,Ro ,alo ,Ho ,So ,o ,:o ,]o ,Ho ,p ,Wp ,p ,P*p ,{8p ,FFp ,e1|p ,p ,)5p ,\ p ,p ,q ,q ,@D"q ,w Eq ,S?Jq ,WtXq ,|q ,Zq ,q ,Wq ,q ,q ,q ,q ,q ,P r ,r ,]r ,r ,I$r ,*r ,0r ,q6r ,5x=r ,WMr ,Sr ,mYr ,s_r ,er ,}kr ,+6qr ,wr ,c}r ,r ,Hr ,Lr ,:r ,r ,r ,>%r ,r ,r ,9r ,Vr ,Xr ,9Sr ,-r ,.r ,r ,er ,F s ,s ,Ŋ%s ,?2s , ?s ,Ls ,QFYs ,fs ,ss ,s ,'s ,fs ,s ,s ,ys ,s ,Ŋs ,Ds ,? t ,&t ,Q4t ,SBt ,oPt ,!kt ,yt ,'t ,t ,Dt ,t ,-t ,st , t ,0 t ,@u ,zu ,v u ,/u ,T?u ,>Mu ,[u , iu ,wu ,u ,Ŋu ,Du ,?u ,u , u ,ru ,u ,u ,'v ,fv ,/v ,>v ,Mv ,H\v ,Zkv ,r@zv ,w4v ,v ,0v ,"v ,v ,Nv ,v ,Lv ,Zv ,w ,w ,q$w ,'2w ,-@w ,<Nw ,\w ,jw ,)xw ,w ,<w ,sw ,w ,w ,ohw ,w ,Хw ,Ww ,O:x ,Ox , x ,.x ,LWy ,+ey ,ksy ,jy ,?y ,-+y ,y ,^y ,Jy ,y ,y ,Oy ,qYz ,Ez ,!z ,n)/z ,=z ,sLz , Zz ,'hz ,vz ,z ,Oz ,;z ,oz ,rz ,z ,vz ,)z ,mz ,z ,+{ ,\{ ,){ ,6{ ,QjC{ ,~P{ ,Q_]{ ,\7j{ ,Ɠw{ ,{ ,#{ ,{ ,{ ,{ ,{ ,_{ ,{ ,5Z{ ,c]{ ,MN{ ,{ ,U{ ,i{ ,{ ,[| , | ,| ,| ,#| ,z#| ,vZ)| ,/| ,W5| ,Z;| ,TA| ,}G| ,}M| ,S| ,Y| ,3n_| ,ue| ,GMk| ,*q| ,w| ,"~| ,P| ,| ,A| ,| ,b| ,*| ,| ,| ,| ,| ,Ԇ| ,| ,| ,Q| ,=| ,G| ,| , } ,m} ,m} ,k\} ,S"} ,Y(} ,.} ,4} ,{m;} ,\} ,/i} ,hv} ,lw} ,} ,J} ,~} ,}} ,V} ,} ,} ,} ,i} ,~ ,0~ ,H$~ ,2~ ,@~ ,P[N~ ,Ж\~ ,j~ ,&~ ,;~ ,r~ ,5~ ,~ ,~ ,}~ ,~ ,0~ ,D , ,., ,; ,p J ,ˉY ,Sah ,ګx ,$ , ,Y ,$d ,2~ ,>d ,t , ,% ,$ ,[3 ,ɍB ,fQ ,F` ,@:o ,̬~ ,A , ,  ,3[ ,ۀ ,\ ,  ,= ,) ,j7 ,&S ,An ,| ,] ,N ,w ,¬ ,~ ,&;Ё ,OVށ ,v , ,C ,H< ,6$ ,%2 ,@ ,N ,^l\ ,1j ,hx , ,a , ,V , ,Ă ,[Rʂ ,Ђ ,uւ ,܂ ,> ,8 , ,h ,f , ,l ,  ,~p ,C# ,) ,u/ ,6 ,pF ,<L ,R ,YX ,--^ ,d ,3j , p ,3v ,} , ,R ,ҽ ,) , , ,[ , , , ,6  ,e  ,0 ,f= , J ,AW ,>d ,2q ,g~ ,p  ,ˉ , , ,}̄ ,ل , , ,] , ,>L+ ,;D ,[Q ,3^ ,ik ,hx ,p , ,X ,w , ,Ʌ ,ׅ ,m , ,R ,K ,] , + ,@9 ,rG ,E5U ,:c ,#} , ,Rd ,n ,Ɇ ,s׆ , ,e7 , , ,. ,+ ,9 ,JG ,U ,[c ,q ,^gˆ ,O Ј ,0ވ , ,n ,g ,h ,A$ ,O2 ,@ ,:2N ,^\ ,wj ,z ,0 ,٭ , ,k ,lj ,Չ , ,[ ,aM ,<Z ,jDg ,t ,&, ,q ,zz , ,Ȋ ,Ԋ ,* ,%n ,* , ,% ,1 lO ,[ Zy , K ,Kɋ , ..D ,OP .bT .^f .|j .voXX ,˓ ,~Փ .ٓ . . . , . ./ ,0# .' .-QB ,0L .P .V/kXvQwX ,Ɣޔ , , ,O . .  ,}2 .+6 .#; ,qtE .TI .LN ,`X .}\ .ua ,k .o .} . .<Е ,Օ . . ,qt .-  . ,` .p .h$ ,5N. .2 .7 ,[A .E .J ,T .X .f ._j .[o ,kty .z} .v . . ,  . . ,FƖ .ʖ .ϖ , . . /? , .   . ,L .' .#$ ,Fb. .F2 .B7 ,dA .eE .aJ ,\T .X .~]n , ,I , ,6 ,F ,ȗї . . . . . . . . .! .* .. .6K ,U .Y .^ ,Lh .l .q ,Fb{ .  . ,d .+ .' ,\ .H .D ,̘ ,Iؘ , ,6 ,F ,6 .c: .aC .sG .qP .sT .q] .ca .aj .cn .aw .{ . /  . . /Ǚ .˙ .ՙޙ /, . . . .  /O .# ., .0 .5 /O> .B .Le .i .r{ .- .+ .G .E .G .Eؚ ,XqP .` .V . .) .- .2 ,[}< . @ .E ,YO .< S .. b .~ f .v k ,u . y . ~ ,) .  .  /_ .P  .L  , .  .r  ,"ƛ .? ʛ .7 ϛ /z؛ ,. .o  .g  ,b .  .  ,{) /" ,S. ,8 . < . AR ,)\ /e ,o . s . x ,L .C  .;  ,Fb .v  .n  ,d .  .  ,\ .  . Ĝn՜ , ,I , ,6 ,F ,/n8nP . T . ] . a . j . n . w . { .  .  .  .)  .'  ,)ȝ /؝ .9 ܝ .7   .H  .F != .W A .U K` .m d .e oxמ .  .  /&/KTmvʟO) ,Lt*8#G ,Rr . v . | ,@ ,F;*5@͠E۠ , ,o ,mPO ,^ ,j ,Lw ,: ,, ,V , ,,ա ,ݡ , ,2 ,3 , ,A ,# ,/ ,< ,$H ,U ,;a ,mm ,z ,r ,%o , ,+ ,m͢ ,ڢ ,Y ,] ,  ,m ,' ,C ,mO ,h ,  ,H! ,& ,  ,ʣ ,݉ڣ ,4 ,|K ,  ,:  ,:2 ,:@ ,:P ,b ,Ko ,| ,} , , ,; ,+ä ,CѤ ,[ߤ ,s , , , ,- ,Kx8 ,dxH ,}xV ,xd ,xr ,x ,x ,x ,y ,I ,yǥ ,yԥ ,z ,K , , , ,* ,8 ,F ,U ,5d ,Ms ,e , , )  , -  -  / *WǦ ,k9 ,P@ , ,Q , ,$S$ ,. ,&< ,WA ,sO ,TT ,'m ,ty ,) , ,dv ,a , # ,5 ,DC ,H ,oOT ,` ,^l ,x ,Q , ,P ,2 ,P ,Z ,Ө ,,$ڨ ,Կߨ , , , , ,% ,' ,b3 ,K? ,K ,W , j ,Hmo ,"{ ,I , , ,` ,U3 ,^ȩ ,~Mԩ ,L3 , , ,_ , , ,|1 ,2{? ,*"Y ,2{g ,s ,#d ,G , , ,,= ,0ͪ ,Gڪ ,  ,; ,G , O ,w x ,1 ,X ,7 , ,)P ,̫ ,ګ , ,G ,T , ,sX  ,. ,< ,TJ ,WX ,I.f , u , ,'  ,f ,X ,$ ,kˬ ,٬ , ,D} ,c ,@ , ,5- ,gBJ ,Y ,h ,"Rw ,i ,7 , ,B ,"­ ,ѭ ,%0 , B ,Am , ,, ,7; ,(J ,Y ,)h ,3w ,D ,  ,x , ,D® ,=Ѯ ,u ,- ,~p ,l  ,ڧ ,+ ,%+: ,I ,X ,fg ,<v ,5 ,0 , ,  ,. ,&Я ,߯ ,a ,2 ,9  ,  ,I* ,29 ,LEH ,/W ,pf ,u ,p2 ,Q , , ,ΰ ,g , ,pR% ,V2 ,uY ,k ,1~ , ,Z , ,0 , ,>#ñ ,jyϱ ,rܱ , ,J ,g( ,\ ,e ,t* ,%8 ,WT , b ,/p , ~ ,  ,l , , ,Gβ ,E۲ ,z6 ,U ,J , ,!3 ,>P ,w , ,p ,?u ,ǣ , ,d"ij ,3ѳ ,/ , ,t  , ," ,L( ,. ,25 ,^B , \ ,*i ,v ,M% ,m" , , ,´ ,Ύϴ ,ܴ ,TJ ,$ ,tB ,%-U , ~c ,q ,z ,+ , ,  , ,ŵ ,wӵ ,3  , ,c ,  , ,ʛ' ,25 ,\5C ,Q ,_ ,m ,k{ , ,Z ,ZB ,a ,# ,X϶ ,Wݶ , ,{ ,5 , , # ,8 ,2JE ,R ,_ , l ,tz ,7b , ,x , ȷ ,|ַ ,x$ ,  ,| ,04 ,8\ ,x ,HB , ,^# , ,, ,0 ,8& ,u ,  ,t, ,]X9 ,рF ,1S ,7a , ,؀պ ,= ,: , , , ,~7 ,Z ,6f ,ft ,f , ,qϻ ,ܻ ,S , ,t , " ,`0 ,Q= ,J ,W ,te ,# s , , ,z , ,Ų ,Lʼ ,ؼ ,, ,t ,y , ,! ,?, ,M: ,,3H ,YV ,d ,8tr ,6  ,b  , ,ս ,:z ,׭ ,  ,MO ,2O! ,f0 ,(D? ,D5N ,H ^ ,vm ,b| ,  ,=i ,  , ,3:Ǿ ,־ , ,w , ,8 ,! ,0 ,? ,8N ,,] ,jl ,*&{ , ,  ,dt ,T ,ƿ ,Wտ ,~ ,$ , ,: ,pU  ,s/ , M ,^\ ,k ,Hz , , ,L , ,  ,n , ,t ,r , ,E% ,p5 ,ɝE ,U ,Ie ,lu ,; , ,xr , ,~ ,an ,+ ,<  ,K5 ,e  ,/ ,)> ,'M ,s\ ,VPk ,5pz ,- ,R , , , , ,y ,  , ,K  ,W ,?. ,g= ,dL , [ ,+j ,(y , , , Q ,Þ ,Og ,H ,N ,֮ ,)Q ,; ,  ,m;. ,<= ,3L ,i ,gx ,4 ,L , ,Y , ,& ,R , ,h ,(| ,8w ,], ,; ,TXJ ,.Y ,Jh ,tw ,X , , ,Z$ ,# ,! ,P ,߀ , ,V  ,: ,%+ ,v?: ,I ,>%X ,g ,Pv ,Y ,* , ,  , ,x ,j ,*O , ,Z6  , ,B* , 9 , H ,W ,xf ,u , ,8? ,D ,cf ,$b ,4 ,] ,, ,x ,?  ,E2 ,h) ,4#8 ,G ,V ,e ,# u ,r ,g , ,v1 ,5I , , ,? ,# ,h  ,l , ) , 8 ,i]H ,W ,f ,1u ,u ,  ,ʳ , , ,w ,K ,- , S ,  ,4a ,z) ,8 ,DG ,V ,`e ,t , ,4 , , ,k ,g ,r ,Z ,Y*  ,< ,) ,8 ,G ,:V ,e , t ,, ,+ , ,j ,` , ,G$ ,ҩ ,% , ,6 ,b.- ,T< , b ,_r ,ڦ ,Xy , , ,dg ,-d ,Y0 , ,% , 3 ,9A ,^O ,p_ ,m , { ,з ,P ,6% ,|> ,v$ ," ,r, ,t: ,N ,\ ,]j ,ux ,> ,# , ,k ,  ,@ ,  ,% ,S ,_ ,L ,}F, , 9 ,*F ,Y ,֎f ,=Y , ,  ,n , ,G ,n ,O ,  ,FC ,]% ,+ ,1 ,97 ,8= ,lC ,iI ,O ,U ,j[ ,a ,eg ,Rm , s ,y , ,@ ,× ,g , ,@ ,2 ,P , ,  , ,P ,  , , , ,-U$ ,* ,.0 ,@6 ,< ,B ,aQ ,}` ,o ,4~ ,kg ,t , ,/ , , ,m ,_M , , ,X! ,. ,; ,8H ,a ,n ,# ,Z , ,  , ,4h ,i , ,& ,x-3 ,o@ ,M ,<Z , ,k , ,] , 0  ,|P- ,!F ,rS ,].` , , , ,m? ,  ,D , ,]  ,la* ,_: ,>G ,ʺU ,b ,~p ,3[ ,g ,0X , , ,; , ,g# , ,% ,5 ,!C ,'Q ,_ ,:; ,b  ,l ,g ,M ,C ,- ,q ,v ,m" ,0X0 ,:= ,#J ,W ,Gd ,, , ,9 ,\ ,t ,/ ,ǣ ,  ,d" , ( ,5 ,B ,O ,,=] ,8j ,G ,. , ,  ,3 ,g ,F ,x ,H ,0 ,t= ,J ,cW ,:s , ,> , ,  ,| , , ,x ,?  , ,;% , 2 ,|@ ,XbS ,*_ , k ,x ,<  , , ,t ,0 ,4h ,  ,.# ,( ,baB ,U ,Ae ,?k ,fq ,@+w ,} ,< ,t ,9 , ,> ,  , ,1 ,g ," , ,w# ,>#1 ,\N= ,J ,W ,q ,g7 ,D ,6  ,M ,1K ,%H ,, ,WZ ,ܗ ,]" ,%H  ,A  ,]"# ,1 ,> ,<L ,xZ ,ug ,]"u ,. ,h , ,ɽ ,< , , ,m" ,'  ,- , ,l" ,8/ , < ,t*I ,c ,3p ,D%} ,C , ,ב ,u ,x , ,t ,J , ,K ,f#) ,*< ,|>Z ,xf ,_Os ,O ,2M , ,v  ,E ,w ,' ,9 ,c  ,Ά ,K & ,3 ,KX ,wd ,9p , ,$ , ,} , ,d ,A> ,& ,  ,+  ,@< ,% ,C< ,&I , V ,m ,&z ,  , , , ? , , , , ,L  ,z ,_' ,E> ,J ,V ,0b ,n , , ,Ib , , ,h , ,` ,  ,Y+ ,o7 ,TC ,SY ,f ,s , ,m ,7 ,~ ,L ,< ,9 , , ,L ,f( ,6 ,NC ,P ,] ,#j ,*x ,E ,[ ,` , ,% ,d ,6% ,} ,  , ,0X$ ,V1 , B> ,K ,Y ,f ,ws ,g ,l ,l ,y , , ,a  ,W , ,Þ , ,FJ ,b/ ,Og< ,J ,W ,e ,r , ,^ , ,t ,@ ,h , ,ݶ , , , ,R+ ,8 ,F ,l[ ,h ,v , ,m ,* ,? , ,K  , ,l3 ,y  ,4 ,$ ,Dz* ,T;1 ,g? ,M ,[ ,' w , ,K  ,W ,: , V , , , , ,/ ,: ,a6" ,h0 ,> ,L ,gZ ,Hh ,rv ,oP , ,w) ,^ , , , ,( ,P ,[ , ,<! ,_e/ ,f= ,K , 2Y ,g ,u , , ,& ,q@ ,$ ,! , ,d5 ,z  , , , ,+ ,>L9 ,SH ,X ,f ,u , ,4l ,P , ,8t ,]z , ,, ,9 ,K ,- ,% ,?+ ,9 ,9G ,U ,)c ,Nq ,Bo ,( ,N , , ,  ,d ,a ,8t ,B' ," ,H ,'%V ,%He ,}s ,_ ,e , ,-t ,i , ,t ,J , ,R ,_ ,:z% ,nn5 ,E ,5U ,:d , ,D ,# , , ,|m ,@  , ,D% , * ,8 ,F ,BT ,d ,M ,ء ,G ,r ,׭ ,  ,EZ , ,(  ,p- ,( ,6 ,D ,R ,}` ,Сn ,| ,f ,t ,C , , , ,bH ,9 ,   , ,;2 ,pU? ,pL ,+kg ,$ , ,_p ,  ,֮ ,, ,  , ,o ,5 ,*}, ,9 ,jF ,S ,` ,Hm , z ,_U ,` , ,  , , ,: ,]! , ,L ,E( ,,5 ,`(I ,wc ,]!p ,: , ,C ,+ ,9 ,'  ,t ,  ,  , Z ,@) ,?3 ,L@ ,9M ,ĻZ ,)g ,ut , ,2 , ,^ , ,P ,+ , ,t ,d ,  ,!w , $ ,$1 ,> ,KK ,X ,e ,kr ,t ,; , , ,Q ,w , ,Ma , ,ǡ ,Þ ," ,d0 ,> ,HZ ,Ӷh ,v , ,K  ,o , ,W ,C* ,? ,  ,+ , ,~W , , Q, ,^: ,H ,gV ,s d ,r ,7 ,Ϯ , ,P , ,X , ,H  , , ,  , ,]{( ,W6 ,9 D ,/X ,e ,r ,9 ,x ,! , ,+ ,V , ,g ,< , ,  ,0 ,) ,+7 ,!E ,S ,Hg ,%q ,v?~ ,D ,n\ , , ,)A , ,Q ,O , ,  , ,D# ,0 ,= ,K ,pUY ,}Vg ,Eu , , ,: , ,J1 , , ,i ,4j ,   ,2 ,P' ,/6 ,;L ,V ,td ,fr ,X , ,!  , ,$b ,r , , ,- ,~D ,$R ,` ,zn ,S,| ,r ,,~ , ,g ,z ,= ,~ , ,  ,D ,~- ,: ,sj ,ީ ,wL ,( ,; ,1H ,9U ,o ,| ,g7 ,] ,o , , ,& ,`F , ,H ,!  ,  ,)  ,u6  , D  , T  ,_Z  ,`  ,*/f  , l  ,r  ,Ix  ,H~  ,%  ,  ,~=  ,  ,  ,  ,kz  ,&  ,A  ,\  ,  ,Pp  ,F  ,z!  ,  ,k  ,*  ,  ,,  ,aT6  ,F C  ,l  ,~  ,g  ,  ,P  ,P  ,ϛ  ,t  ,*  ,%  , 2  ,?  ,M  ,:Z  ,zg  ,lt  ,w  ,?  ,  ,H  ,j!  ,  ,b  ,  ,$  ,+(  ,l5  ,}B  ,O  ,fb  ,G#o  ,^)  ,f  ,t  ,D  ,<  ,   ,)  ,  ,  ,M  ,>  ,z  ,l+  ,{8  ,scE  ,R  ,*#_  ,Pl  ,cy  ,  ,7  ,  ,7  ,  ,  ,  ,: ,B ,f# ,9 ,=0F ,sS ,yj ,w ,s ,@ ,s ,8n ,i ,z , ,1  ,J^ ,^' ,4 ,JB ,$ R ,X ,P|^ ,DXd ,\ k ,{ ,  ,l , ,m , ,'  ,^) ,%c ,%c , , ,r ,1 ,> ,K , X ,e ,Br ,L; , ,G ,h ,AH ,_ ,C ,M ,M ,*' ,4 ,9A ,fN ,e ,r , , ,t , ,>/ , ,8 ,v ,Pj ,  ,  , ,0X3 ,2@ , M ,Z ,g ,t ,8 ,| ,$ ,o ,k ,: ,dp ,%C ,T ,H  ,S ,# ,60 ,aX , d ,3"z ,t* ,& , ,<@ ,! ,r ,  ,7%  ,_  ,n7 ,M\D ,1R ,:G_ ,Nty ,_p , ,t , , , ,; ,5! ,lE ,D@\ ,6j ,a ,<@ ,G3 ,t , ,t* ,l  ,  ,`6 ,O ,] ,k ,Qy , ,  ,% ,uv ,4 , , ,+5 ,  ,-! ,E: ,1H ,CV ,z ,= , , ,/ ,b ,QA ,ȅ , , ,Y! ,N(/ ,u= ,K ,_Y ,2m ,{ ,A , , ,{ ,> ,}F ,C ,A ,  ,X% ,|J3 ,B ,BP ,^ ,l ,z ,) ,v ,n , ,  ,s ,/ , ,. ,8 ,Q&F ,ʛT ,pb ,}p ,~ ,n ,I , ,F ,~ ,n , ,a ,X ,   ,BO ,; ,hI ,ce , f ,C ,f ,= , ,C ,y0 ,F ,1 ,D ,9 ,,8G ,iU ,kc ,U q ,  , , , , ,) ,M ,  ,F ,G ,9  , ,* ,P19 ,r'H ,XAW ,5f , #u ,c^ ,q ,^ ,: ,  ,g , ,# ,   , ,) ,b8 ,9G ,V ,e ,+Nt ,t ,K ,3 , , ," ,5 ,Bc , ,x  , ,( ,C7 ,)F ,U ,d ,s ,&v ,yY , , ,v , ,- ,Y  ,s  ,)  , )  ,6  ,1O  ,t\  ,3i  ,w  ,  ,  ,܈  ,  ,  ,L  ,*  ,.  ,p ! ,r! ,q,! ,S:! , H! ,W! ,eNi! , }! ,t! , ! ,! ,q! ," , " ," ," ,v" ,H#" ,)" ,/" ,}5" ,ۆ<" ,CC" ,J" ,GuQ" ,Y" ,>e" ,cq" ,}" ,Q" ," ," ,Դ" ,|" ,Μ" ,{" ," ,K# ,.# ,"# ,1# ,.@# ,\xO# ,D^# ,m# ,S4|# ,!# ,f?$ ,[$ ,i$ ,gw$ ,lI$ ,H $ ,>t$ ,}$ ,$ ,% ,#% ,7% ,N*% ,J9% ,}G% ,MU% ,^c% , q% ,% ,M % ,i'% ,t% ,% ,% ,t% ,& , 2& ,u @& , N& ,& ,9& ,& ,9& ,R& ,& ,.& ,b& ,t& , ' ,' ,' ,M>' ,9_L' ,|Z' ,h' ,' ,3' ,' ,f' ,{' ,O' ,' ,' ,H' ,:( ,Z( ,p( ,&( ,#4( ,6B( ,cP( ,\^( ,<l( ,!z( ,3( ,m( ,Y( ,( ,ST( ,( ,]9( ,U( ,>( ,cw) , ) ,X") ,0) ,>) ,~L) ,)\) ,Դk) ,z) ,t) ,) ,) ,~) ,GU) ,) ,) ,) ,Q* ,* ,  * ,/* ,]>* ,N* ,m]* ,* ,* ,p* ,* ,* ,Ȃ+ ,"+ ,I0+ ,>+ ,M+ ,\[+ ,6i+ ,w+ , + ,x+ ,+ , + ,+ ,> , ,<5, ,7&, ,%-3, ,N@, ,^M, ,v[, ,\7o, ,, ,a, ,V, ,, ,X, ,9, ,\5, ,, ,, ,$>- ,J- ,[- ,a- ,( g- ,1m- ,Tvs- ,ߠy- ,b- ,Ϣ- ,7c- ,- ,P- ,- ,- ,<- ,G- ,. ,t. ,. ,). ,6. ,C. ,WP. ,n. ,C~. ,. ,N. ,+. ,5. ,tC. ,J. ,l. ,. ,. ,. ,>. ,7. ,s. ,. ,<. ,[. ,;. ,/ ,/ ,/ ,w0/ ,ô=/ ,J/ ,wf/ ,Wr/ ,ô~/ ,/ ,/ ,K/ ,/ ,/ ,X/ , / ,/ ,0 ,K0 ,p#0 ,{10 ,ST0 ,9k0 ,0 ,p,0 ,0 ,0 ,0 ,!0 ,0 ,0 ,0 ,.j1 ,!1 ,l#1 ,f11 ,<@?1 ,CM1 ,]l1 ,SC1 ,b=1 ,1 ,1 ,1 ,!1 ,73 2 ,.2 ,*2 ,Қ:2 ,}J2 ,<Z2 , j2 , z2 ,w2 ,g2 ,2 ,2 ,#2 ,[ 2 , K 3 ,3 ,<%3 ,f23 , ?3 ,pg3 ,t3 ,u3 ,II3 ,3 ,a3 ,'3 ,L 3 ,L3 ,n3 ,ǀ3 ,%4 ,94 ,D%4 ,)*4 ,XP4 ,x]4 ,tj4 ,4 ,; 4 ,z4 ,4 ,ʛ4 ,0X4 ,M04 ,5 ,ʛ5 ,\5#5 ,g15 , ?5 ,M5 ,q![5 ,i5 ,9w5 ,5 , 5 ,5 ,5 ,+5 ,5 ,5 ,6 ,6 ,)6 ,0X66 ,k2C6 ,9P6 ,1f]6 ,t*j6 ,miw6 ,6 , 6 ,/6 ,<@6 ,\6 ,/6 ,6 ,; 6 ,7 ,B7 ,#7 ,f17 ,?7 ,9M7 ,*]7 ,Sm7 ,kK8 ,8 ,8 ,88 ,8 ,^8 ,}^8 ,8 ,z8 ,8 ,8 ,K8 ,.9 ,B9 ,;O9 ,}\9 ,i9 ,v9 ,-9 ,9 ,9 ,q9 ,0X9 ,"o9 ,B: , : ,: ,,,: ,'s9: ,F: ,S: ,e`: ,%m: ,z: ,ѽ: ,: ,: ,X: ,: ,@: ,ת: , : ,: ,0X ; ,<@; ,%; ,3; ,A; , O; ,]; ,+k; ,; ,Y ; ,X; ,u; ,); ,<; ,B< , < ,o:,< ,b;< ,iJ< ,Y< ,Th= ,v= ,,= ,= ,<= ,f= ,> , > , > ,-> ,\5:> ,G> ,T> ,Ua> ,Pn> ,(o> , ? ,#D? ,"? ,>? ,~? , ? ,f#? ,X? ,=@ ,v@ ,,@ , 9@ ,e2F@ ,h?S@ ,ta@ ,@|@ , @ ,' @ ,@ ,@ ,.Z@ ,Ut@ ,D@ ,t@ ,g A ,8VA ,*A ,)DA ,/_RA ,nA ,h|A ,bA ,A ,A ,A ,e2A ,A ,$A ,A ,e0B ,B ,E,B ,;B ,#JB ,]YB ,hB ,w wB ,?B ,-B ,B ,OB ,ZB ,] B ,@B ,;"B ,I C ,60C ,\5*C ,9C ,HC ,WC ,fC ,CvC ,C ,BC ,C ,YC ,hC ,C ,C ,sC ,.D ,;D ,;HD ,;'UD ,hD ,K7vD ,D ,a D ,D ,D ,(<D ,xD ,:D ,2D ,D ,$n E ,WE ,*$E ,1E ,T>E ,GKE ,XE ,`ZE ,/E ,E ,E , E ,IE ,E ,D{E ,֜E ,>F ,VF , F ,,F ,:F ,rHF ,VF ,4BdF ,+rF ,XF ,]qF ,F ,f F ,'F ,F ,"F ,&F ,F ,(G ,':G ,@G ,/FG ,9LG ,RG ,9YG ,jG ,pG ,W"vG ,|G ,0}G ,G ,#G ,G ,DG ,fG ,G ,G ,{G ,G ,H ,H ,K#H , 2H ,AH ,~PH ,_H ,znH ,}H ,KH ,H ,~H ,EH ,H ,uH ,H ,AH ,qI ,6I ,) I ,2$0I ,#@I ,PI ,_I ,mI ,{I ,I ,9SI ,bI ,]4I ,vI ,uI ,I ,I ,z'J ,J ,r#J ,3J , CJ ,xNSJ ,PcJ ,sJ ,qJ ,MJ ,yJ ,J ,%J ,J ,{J ,+J ,jJ ,DK ,K ,޴1K ,n}>K ,XWK ,udK ,qK ,9S~K ,K ,K ,Z2K ,}9K ,MK ,^K ,3K ,^K ,=K ,LL , L ,'L ,D%6L ,iKL ,/noL ,myL ,L ,#L ,[L ,L ,L ,F L ,`M ,=%M ,X2M ,?M ,J LM ,YM ,fM ,k@sM ,=M , M ,M ,VM ,^M ,2M ,M ,D{M ,֜M ,5M ,QN ,N ,GN ,yTN ,XnN ,{N ,*N ,N ,<N ,,N ,N , N ,N ,VN ,^N ,D{N ,֜ O ,60O ,0O ,l<O ,IO ,XO ,O ,O ,EO ,JO ,}O ,aO ,A P ,P ,P#P ,(oP ,GP ,XP ,60P ,=P ,JP ,\5Q ,QQ ,C^Q ,(fkQ ,xQ ,Q ,Q ,Q ,Q ,Q ,Q ,JQ ,Q , Q ,  R ,<R ,]'R ,o;R ,lHR ,UR ,L oR ,)|R ,<R ,pR ,R ,CR ,R ,0!R ,9R ,S , S ,`'S ,x4S ,BS ,0OS ,ݜ\S ,v(oS ,2<|S ,S ,S ,]S ,L +T ,8T ,,=FT ,ST ,G`T , T ,T ,9T ,L-T ,vT ,xT ,N< U ,kUU ,X:U ,FU ,cU ,oU ,Ե{U ,U ,kU ,*U ,U ,U ,WU ,U ,?TU ,kqU ,j:U ,u< V ,U V ,"%V ,?9V ,BFV ,ՇlV ,|V ,V ,{BV ,V ,V ,.V ,V ,dV ,#V ,%V ,W ,W ,>*W ,)8W ,FW ,vTW ,bW ,/pW ,AS~W ,#W ,W ,}2W ,CW ,W , W ,]W ,1W ,PW , X ,|X ,&X ,N 4X ,I4BX ,A(PX ,s^X ,%lX , zX ,X ,X ,iXX ,r]X ,X ,HX ,IX ,GX ,-Y ,҂ Y ,-60Y , GY , $VY ,PneY ,tY ,}Y ,XaY ,BY ,#Y ,Y ,Y ,TY ,Y ,^Z ,RxZ ,"Z ,*Z ,7Z ,nDZ ,QZ ,iZ ,yZ ,0,Z ,mZ ,BZ ,3Z ,Z ,|Z ,J Z , zZ ,DDZ ,$[ ,=Z[ ,\![ ,g/[ ,}=[ ,2'K[ ,Y[ ,yg[ ,OBu[ ,[ ,y[ ,t[ , [ ,[ ,.[ ,[ ,|[ ,k[ , G\ ,K\ ,i\ ,.\ , u=\ ,eL\ ,xk\\ ,k\ ,mz\ ,.\ ,z*\ ,O\ ,}\ ,+\ ,y\ ,%\ ,4>\ ,l] ,Z] ,b] ,vU.] ,=] ,L] ,64[] ,oj] ,Sy] ,] ,Fd] ,V] ,] ,C] ,#] ,/] ,>|^ ,s^ ,C ^ ,i5^ ,îE^ ,K^ ,i!_ ,H&._ ,X;_ ,xH_ ,|U_ , |_ ,)_ ,k_ ,_ , ` ,F9` ,[F` ,]h` ,&u` ,` ,H` ,` ,` ,` ,4` ,~` ,b` ,` ,ta ,Da ,_p-a ,Y:a ,fSa ,;`a ,Xma , za , a ,c-a ,fa , a ,a ,nma , b ,5sb ,b ,7b ,b ,4b ,Zb ,<b ,fb ,F b ,b ,b ,~b ,tc , c , c ,$.c ,j ,;Kj ,tXj ,ej ,j ,B0j ,Ӷj ,j ,j , j ,cj ,j , k ,$k ,"&k ,3k ,"u@k ,|Mk ,iZk ,xgk ,ctk ,qk , ik ,`k , k ,k ,"k ,?Bk ,7k ,[Yk ,k , l ,fl ,( l , -l ,G:l ,9Gl ,$Tl ,@al ,fnl , M{l ,yl ,l ,l , l ,+l ,Ll ,l ,:l ,r"l ,m ,gm ,h"m ,0m ,>m ,gLm , Zm ,J`im , wm ,m ,ͱm ,Nm ,ͯm , m ,m ,rum ,mm ,m ,]n ,n ,ͨn ,-+n ,NRFn ,hhSn , `n ,nmn ,L {n ,Tn ,n ,Gn ,n ,U o ,o ,PY#o ,Uo ,tco ,,Gso ,Yo ,o ,eo ,6o ,<"o ,_o ,/o ,Oo ,\o ,\o ,)S p ,z<p ,h[)p ,7p ,Ep ,Sp ,'ap ,op ,}p ,<p ,p ,'p ,(\p ,H p ,p ,aq ,Nq ,q ,.q , =q ,mLq ,=[q ,jq ,Qyq ,-q ,#q ,q ,q ,<q ,ٝq ,q ,5q ,!r ,or ,,r ,q;r ,P5Jr ,Yr ,"hr ,Yr ,;r ,Qr ,r ,r ,.r ,Mr ,2r ,[r ,w s ,"'s , Hs ,HAks ,ws ,;s ,,s ,Xhs ,;s ,xs ,Fs ,>s ,ps ,Os ,s ,s ,ls ,t ,#t ,";t ,̶Gt ,6]t ,it ,Kvt ,zt ,t ,t ,9t , t ,t ,ϣt ,t ,~u ,Ou ,u ,6 ,u ,^:u ,~Hu ,iVu ,du ,t|ru ,vu ,u ,u ,u ,=u ,su ,Xu ,[u ,Ku ,u , q*v ,˩7v ,Jv ,Xv ,gev ,rv ,v ,Gv ,GQv ,bv ,*v ,`v ,zv ,bv ,?v , v ,_w ,K$w ,4w ,6()w ,NL6w ,ZCw ,Pw ,Y^w ,lw ,zw ,w ,Aqw ,YLw ,6w ,jGw ,9w ,{w ,Ҭw ,}w ,u x , x ,Lyx ,#gx ,px ,x ,?x ,x ,:x ,x ,.x ,x ,y ,ׯy ,Ly ,y ,y ,y ,y ,ey ,˻y ,'z ,qz ,z ,e,z ,:z ,hHz ,]Vz ,dz ,hrz ,&z ,0\z ,Hz ,tz ,z ,,z ,auz ,z ,z ,f { ,,{ ,׌*{ ,S8{ ,#F{ ,Ve{ ,s{ ,5{ ,.{ ,ܥ{ , ){ ,5{ ,z{ ,{ ,"{ ,P{ ,n| ,| ,M| ,Oz*| ,#8| , F| ,T| ,\b| ,# p| ,~| ,GU} ,Bc} ,tq} ,} ,g} ,].} ,} ,~ ,<3~ ,mA~ ,vO~ ,]~ ,k1k~ ,0y~ ,7~ ,.~ ,H~ ,~ ,~ ,A~ ,[~ ,~ ,~ ,Z ,|} ,v! ,6/ ,= ,|]K ,)x ,V$ ,  ,5 ,* , ,D ,q ,k  ,| , ,6- ,  ,9/ ,G> ,K ,fX ,e ,t*s , , , , ,jƀ , Ԁ , ,KDV ,1F ,3D+ ,98 ,6Q ,^ ,Uw , , , ,?n˃ ,u؃ ,I , ,? ,Q  ,0 ,& ,G4 ,B ,:P ,^ , l ,Uz , ,A , ,+K ,V , ΄ , ܄ ,m/ ,S , ,) ,n " , 0 , > ,3`L ,Z ,Ss , ,'  ,y ,fm ,… , υ ,܅ , ,C ,s , ,b$ ,F- ,; ,uI ,;W ,$e ,Fs ,_r , , ,k ,  ,4dž ,Ն ,p ,> , ,x  ,V ,) , _7 ,S ,] ,g ,@q ,@6{ ,X ,/ , ,Aχ ,o݇ ,D$ ,E ,# ,0X ,t$ ,(2 ,}@ ,bY ,f , ,6o , ,A ,Έ ,ۈ , ,l ,  ,~ ,d_; ,XI ,W , e ,s ,& ,) ,Ws ,l ,> ,jlj ,OՉ ,nr ,' ,G ,]_  , ,$) ,7 ,E ,0zS ,a ,'1o ,x} ,=& ,; ,-m ,^ʊ ,Sي ,> ,r ,\  ,7 ,- ,: ,G , T ,Za ,n ,{ , ,0 ,,c , ,  ,gɋ ,֋ ,1) ,t ,m ,  , ,$ ,1 ,> ,K ,g_ ,oy ,%H ,P ,( , ,p ,Ȍ ,Ռ ,  , ,B ,o{ ,7$ , 52 ,L@ ,lN ,j ,x , ,rb ,Jl , ,e܍ ,\ ,<) ,F ,*0Վ ,* ,rB ,{ ,  ,S_ ,Qq ,} , ,b ,zʔ , ,w ,U  , ,• ,Y ,s ,o& ,[ , ,T ,q+ ,8 ,#E ,eR ,_ ,ws ,O  , , ,() , ,+@ ,"Η ,&ܗ , , ,A ,  ,# ,pW/ ,4; , I ,GX ,d ,p ,*| ,Z ,K , , ,K% , ɘ ,d֘ , ,  ,`A ,X= ,CJ , W ,t ,ə ,֙ ,2 ,, ,m / ,u+L ,ZKY ,<y , ,=Y , , , ,|Ț ,s ,?V , ,+ ,9 ,:C ,YP ,] ,,j ,w ,q ,) ,%-# ,4 ,6: ,9@ ,+F ,dM ,Fi ,<y ,Y ,m" , , ,0XϜ ,oݜ ,& ,$ ,L ,+ ,:T ,j^ ,w ,]} , ,< , , ,`ǝ ,W֝ , ,\ ,!Z ,, ,9 ,,F , ,& ,G ,HĞ ,?Ӟ ,, ,a ,f , ,  , ,n ,q ,  ,/E' ,5 ,~C ,hQ ,d_ ,4hn ,| , , ,( ,ȁ ,NM ,%! ,jƟ ,̟ ,Fҟ ,4؟ ,`ߟ ,  ,J ,9 , , ,5 ,  ,' ,$*5 ,hC ,AQ , @_ ,j| ,}_ ,w ,R ,̠ ,g֠ , , ,  ,~! ,h. ,tF ,P ,_ ,l ,y ,< ,g ,I , ,k@ȡ ,t , ,My& ,qF6 ,< ,G#B ,{GH ,N ,uU ,Ѻb ,So ,5X| , , , s ,F ,T ,аb ,p , ,_ ,NZ , ,A , ,ٚ ,  ,W ,# ,H0 ,S= ,K ,b ,dl ,Jz , , ,> ,V ,vʥ ,Qץ , ,[ , ,@  , ,}2 , ~> ,IP ,Z ,d ,s ,Q ,` , ,h ,d ,* Ǧ ,զ , ,Q ,! ,46 ,  ,. ,R ,r ,4 ,T , ,J ,§ ,"ϧ , ܧ ,^ ,%- ,  ,T ,]%$ ,A1 ,#W ,d ,I<q ,~ ,m ,- , , Ө ,P9 , ,u^ ,k  , ,# ,0 ,= ,QHW ,j ,w ,  ,I ,Z ,ĩ ,%ѩ ,@ީ ,^ , ,C ,$ ,S ,u  ,' ,m4 ,tA , N ,OK[ ,Yh ,sfu ,y ,w ,b , ,*  ,ʛǪ ,\5ժ ,? , ,$( ,~  , ,?\) ,7 , E ,S ,Ja ,o ,} ,b ,, , ,(> ,3ǫ ,$ѫ ,r߫ , ," ,V  , ,I* ,7 ,]E , S ,ta , %o ,N} ,Q ,r ,w , ,ì ,GѬ ,߬ ,&. , ,#  ,U ,;K% ,gM3 ,A ,tO ,] ,k ,|y ,r , ,ܐ ,o ,2 ,w[ͭ ,ۭ ,| , ,ږ ,ѽ ,ܼ! ,/ ,͏= ,K ,Y ,(g ,Z8u , ,{ ,X® ,Ю ,oޮ ,ϧ ,&p , ," ,0 ,> ,SL ,Z ,h ,nv ,  , , ,0 ,D ,Uʯ ,د ,qe ,` ,\ ,  ,!% ,M> ,>K , X ,Ge , ,  ,  ,E , ,Ӱ , , ,, , , ,B! ,. ,֤; ,H ,U ,' o , ,2 , ,+ , mѱ ,۱ , ,K ,M ,[  ,H ,C' ,X5 ,IQ ,I_ ,cm , ,! , ,W- ,ɲ ,lײ ,\ ,/ ,  ,n ,Z , + ,t9 ,G ,fU ,Mc ,Ɍq ,T% , , , ,g ,Mϳ ,ճ ,g۳ ,R ,' ,b ,px ,z ,W< ,n  ,CFߵ ,I ,M ,\ , ,NS  ,c- ,: ,p G ,eT ,)la ,bn ,F{ ,  ,s , , ,q ,ɶ ,ֶ , ,{ ,ְ , ' ,%"4 ,OA ,N ,D ," ,c`/ ,< ,M%I ,m0V ,yc ,q , ,& ,l , ,]3 ,mȹ ,  ,| ,c ,R   ,8 ,  ,/, ,SB ,xN ,c ,%Hp ,GT ,; Ǻ ,sں , ,!} ,6%  , ,>) ,t7 ,IE ,#` ,n ,| , ,( , , , ǻ , ֻ ,9 , ,f ,RI ,Z! ,30 ,-? ,N ,] ,l ,M{ ,2 ,L , ,' ,| ,!Ҽ , , ,'  ,ZD ,s ,, , P ,{jk , ,  ,< ,L ,oR ,X ,̓_ ,';l ,ny ,c , , ,X ,]. ,?ǿ ,Կ ,0 , , ,= ,  ,p" ,H/ ,< ,I ,wV ,(c ,p ,~ ,$ ,I ,' ,\ ,], , , ,~ , ,.  , ,' ,Tl6 ,nE , T ,_c ,r ,Ç , ,G ,( , ,N ,M , , ,]I  ,7 ,* ,m`: ,J ,dZ ,ji ,x ,u ,A , , , ,] ,M ,RN  ,  ,' ,q5 ,k|C ,@`Q ,p_ ,m ,V!{ ,d , , , ,} ,G ,F( ,  ,t , , ,, ,:{; ,J ,_Y , h ,Mw , ,Ç , ,'7 ,G ,( , ,N ,\ ,l  , ,- ,= ,M ,`] ,ȴm ,m`} , ,d ,q , ,= ,l , ,j ,  , ,m"' ,^6 ,E ,cPc ,r , , ,. , , ,. ,T ,8V , , ,4|% ,J2 ,? ,`;L ,Y ,Lf ,6s ,  , ,FM , ,w ,l , , ,/ , , ,t ,' + ,6+9 ,'G ,H , ,( ,,G , ,x, ,`c , ,   , ,% ,/2 ,ڱ? ,']L ,9Y ,)f ,s , ,$ ,t~ ,#x ,. , ,3 , ,@ , ,  ,F( ,B ,P ,n^ ,nl ,nz , , , ,= ,S ,  , , ,o ,p  ,ğ ,' , 06 ,`E ,CT ,c ,)r ,u; ,` ,h; ,c ,υ ,@E ,P ,m ,  , ,1' ,k6 ,yE ,m`T ,c ,r ,  ,p ,r ,x3 ,3 , ,B , , , ,= ,M& ,Is5 ,sD ,TS ,;b ,q , , ,U ,X ,N , ,Pw , ,x ,) ,3 ,{% ,d4 ,@B ,"'P ,W^ ,L{l ,-z , , ,> , , , , ,u , ,5 ,7 ,[. ,[= ,tL ,[ , j ,kcy ,Y ,\ ,& ,  ,4 ,|D ,TR ,` ,*} , ,$ , , ,m% ,U ,z| ,q , , & ,$5 ,3D ,' S ,.b , ,' ,C ,>  ,. ,m , ,9 , , ,[d ,# ,"  ,`: ,d& ,4 ,B ,FGP ,m^ ,jKm ,Ñ ,f~ ,P ,\ ,A , ,N ,b> , , ,d , , , ,a ,( ,(9 ,g)? ,E ,K ,Q ,- ,q ,F ,] ,u ,h ,j  ,, ,  ,  ,ǹ , ,& ,=P ,Z , ,Z ,R ,m ,IW  , ,b ,| ,A:$ ,?* ,^0 ,6 ,z< ,B ,H ,FN ,3NT ,_Z ,` ,f ,l ,I r ,x ,O~ , , ,  ,2= , ," , ,Y ,3 ,1 ,Z ,D , , ,  ,8 , ,Zk , , ,T ,4g , / , ,^ ,X ,A  ,& ,, ,w2 ,8 ,S\> ,9~D ,yJ ,P ,3V ,ww\ ,+b ,h ,n ,t ,7z ,W ,V , ,;f , ,< ,3 ,v ,( , , ,Q , , , ,(^ , , ,. , , P , ,m ,B  ,& ,TQ ,% ,CI ,a ,Go , , ,f , % ,^ ,/x , ,`( ,T5 ,M ,O[ ,/t , ,\ ,` ,=e ,5 ,e, ,1( ,, ,!, ,cD ,R ,a ,Sp ,u ,4 ,r ,( ,| ,R , ,+ ,w ,' , ,U# ,C2 ,A ,&P ,?_ ,pn ,G!} , ,%e , ,# ,V ,zu ,l  ,s ,# ,` ,=M" ,o1 ,Ew@ ,J_N , b ,vp ,b!~ ,x ,7 , ,] ,o ,`J ,X , ,{ = ,OK ,/d , ,\ ,` ,=e ,5 ,e, ,1( ,, ,! ,c4 ,B ,Q ,S` ,uo ,4~ ,r ,( ,| ,R , ,+ ,w ,' , ,U ,C" ,1 ,&@ ,?O ,p^ ,G!m ,| ,%e , ,# ,V ,zu ,l  ,s ,# ,` ,=M ,o! ,Ew0 ,J_> , R ,v` ,b!n ,x ,7 , ,] ,o ,`J ,X , ,{ 2 ,O ,pN] ,pk ,y ,!^ , ,n ,{ ,z6 ,6L ,- ,= ,3C ,[I ,O ,7U ,\ , m ,Ͳs ,y ,ۮ ,u , ,y , , ,3 , ,Y ,aL ,i4 , ,z ,rT ,Y , ,+q , ,7, ,bs ,[ , ,֛ , t  ,X ,È ,/ ,w! ,G' ,}U- , 3 ,89 ,? ,`E ,=pL ,!] ,H"c ,i , o ,"u ,{ ,F , ,2 ,Fe ,# ,E8 , ,z , , ,, ," ,2 , ,a ,r ,( , ,Q ,Y ,;h ,  ,4 ,  , ,=] ,  ,x# ,!* ,; ,A ,tgG ,5M ,S , Y ,no_ ,4e ,jk ,˘q ,mw ,} ,~h , ,.s ,f ,| , ,0 , ,* ,Gr ,O , ! ,n , , ,wn , ,V ,O  , ,$ , , ,  , , ,+` ,]% ,kZ+ ,r!1 ,7 ,@= ,6C ,РI ,O ,@U ,[ ,a ,g ,am ,¦s ,&y ,+ ,22 ,}x , ,D ,i , ,: , , , , ,Z  , ,A& ,4 ,#YB ,P ,M+^ ,?l ,[z ,\ ,@  , ,p ,t ,c ,`y ,*_& ,15 ,9C ,pQ ,|_ ,tx ,p ,ߙ ,  , ,2? ,[^ ,C , , ,4  ,* ,- ,b; ,!LI ,W ,le ,Fnt ,%: , , ,8 ,{ , ,Ob ,r ,M ,a  ,# ,2 ,e@ ,N ,zg , t ,h , , ,1 , , ,$ ,R ,Y ,B* ,&8 ,љF , U ,=d ,Yr , , , ,? ,q. ,t , ,G ,   ,f ,{# ,A ,O ,h ,ev ,} ,]. ,  ,h ,C- ,9 , ,t  , ,s- , < ,L)K ,VZ ,s ,X ,Y ,_ , ,4P ,{` ,\ , ,? ,]B ,tP ,}m , { , ,F ,< ,Y ,p ,  ,h ,  ,e# ,)< ,tX ,@g ,v ,v ,1 ,_ ,M ,v ,t , ,$ ,R= ,)L ,d[ , j ,v ,t , , ,R ,1 , ,R  ,- ,HG ,WU ,gy , ,t , , , ,h ,  ,t$ , = ,V , d ,t} ,Y ,p ,t ,t ,z ,H ,b ,) ,].' ,!5 ,\|H ,2V , d ,q ,!~ ,t ,[ , , , ,E , ,\ ,E ,"  , ,w* ,7 ,z6q ,0X} , ,I ,m( ,]. ,J ,` , , , ,8 ,$ ,_b3 ,yB ,ZQ ,/` ,Lo ,~ , ,T , , , ,!L , ,H  ,D% ,8 ,, M ,'g ,t ,ٸ , , ,| , ,q ,i ,7 ,; ,6 ,9 , $ ,Ě. ,O8 ,g+B ,LL ,;g ,u ,L ,qH , ,,= , ,9 , ,  ,# ,= ,œa ,p{ ,ol ,6 ,& ,  ,H? ,t ,Al , ,p ,O8 ,U ,r , ,pU ,0 ,  , ,i , ,)" ,!/ ,(J< ,0I ,\xV ,c ,kp ,3Y} , ,i ,6 , , ,Ġ ,# ,  ,$V , ,}# ,1 ,R? , M ,E[ ,J ,G , , ,S ,  ,p ,s$ ,'1 ,͗J ,tW ,w5d ,q ,C~ ,Z ,) ,$ ,4 ,e , ,j , , ,  ,1 ,% ,J3 ,PdA ,O ,]] , k ,kCy , , ,/ ,\5 , , ,T , ,X  ,  ,L & ,R4 ,ZB ,oP ,^ ,b ,0 , ,"! , , ,N ," , , , ,ȸ" ,1 ,a? ,>M ,m[ ,tIi ,, ,( ,) ,Y ,NJ ,~ ,# ,X  , ,t+ ,b: ,Xc ,q ,X ,<@ ,h$ ,t , ,< ,O ,ʛ ,\5 ,  ,u ,g& , 4 ,B ,q!P ,^ ,l , z , , , ,Q ,, ,) ,R ,d ,! ,0. ,C; ,"H ,$iU ,Fb ,""o ,} ,5 ,R ,) ,r ,X ,n ,ǿ ,N ,] ,g, ,s9 ,G ,ET ,ga ,n ,ݶ| ,J ,g , , ,k ,6  , , ,# ,1 , ,Q ,c  ,| ,z+ ,( ,O@ ,[d ,q , , ,  ,. , ,4 , ,F ,# ,: ,x  ,_ ,,> ,K ,X ,f ,;t , ,E ,a ,F ,) ,} , ,; ,] ,E ,a , + ,]8 ,Q ,_pg ,f ,G3 ,B  , ,! ," ,RL ,w/h ,v ,m , ,Y ,# ,} , , ,' ,( , ,NV* ,W7 ,a!D ,Q ,fd^ ,Rk ,Hx ,Q ,V , , ,  , ,c ,o> , , ,e , ,D! ,̈́. ,a; ,H ,qU ,ξb ,o ,q| , , , ,' , , ,y\ ,Vf , ,  ,  , !  ,/  ,\  ,x  ,X#  ,:  ,  ,:  ,  ,  ,?  ,  ,{  ,Z  ,#Y  ,-  ,M+I  ,4W  ,Xe  ,5s  ,p  ,  ,7  ,  ,J*  ,l  ,a  ,  ,H  ,P;  , K  ,pY  ,g  ,u  ,/  ,  ,Nm  ,  ,Z1  ,F  ,  ,{  , ,I , ,=* ,]8 ,F ,$T ,b ,p ,m#~ ,H , , ,F ,j ,? , , ,i ,  ,; ,:& ,4 ,6B ,GP ,^ ,pl ,;Rz , ,v  ,  , , ,8 , ,x ,]H  ,u ,G"* ,{H9 ,#H ,]!W ,=f ,u , ,O ,X ,X ,: ,& , ,Fn ,  ,0 ,K) ,%:8 ,;G ,+e ,"t ,[ ,' ,5  ,= ,1M ,S ,Y ,8_ ,?)e ,@k , q ,%w ,} , , , ,m , ,$ ,4e ,A ,) , , ,{ , ,' ,/4 ,K ,&W ,(d ,mAq ,~ ,0X , , , , , , ,i. ,ʭ? ,E ,K ,kQ ,$W ,sq] ,c ,Hi ,bVo ,u ,{ ,1 ," ,K ,'  ,!{ ,s , ,w ,j , ," ,c , , ,W ,C ,C ,2A ,=x ,(  ,8G ,.U ,#c ,۰q ,+ , , , ,Y ,* , , ,v , ,i , , $ ,QC ,S ,#o ,X} , ,c ,# , ,/ , ,0X ,]H ,YO, ,b; ,%] ,k ,=Yy ,A ,0 ,J1 , , ,p ,t ,  , ,I ,}" ,%1 ,f` ,In ,| , , , , ,% ,, , ,4 ,gB ,P ,^ ,wm ,V~{ , ,8 ,{ ,6 , , ,a' ,1 ,uEZ ,h ,v ,p ,e ,$ ,\ ,ԋ ,+R ,: , ,2?: ,H ,{ ,f , ,O ,) ,iJ ,m ,# , , ,d ,e. ,#< ,cU ,w ,( ,s , ,k , ,U , ,' , , ,8d ,8 , ,ڂ , , ,U@ , ,p ,4  ,)T ,dY ,E ,. ,4 ,y.: ,@ ,F ,kDL ,JR ,أX ,`^ ,37d ,Sk ,]y , ,f ,9 ,  ,J ,M ,g ,bR , ,R ,$ ,1 ,t" ,= ,uL ,3Z ,9h , v ,% ,J ,i  ,< ,` , ,p ,  ,p#  ,   ,P+  ,9  ,6G  ,U  ,p  ,~  ,J'  ,L  ,  ,  ,.b  ,  ,n   ,N   ,  ,9 ! , ! ,%)! ,J7! ,E! ,DS! ,a! ,o! ,$}! ,1! ,t! ,! ,! , ! ,T! ,h! ,|K" ,J>" ,P  " ,!." ,[<" ,߾J" ,V(X" , f" ,t" ,h" ,c" ," ," ,21" ,J" ,"" , " ," ,2# ,# ,$ # , *# ,8# ,6F# ,vT# ,b# ,jp# , e~# ,D# ,\# ,# ,8 # , # , # ,C# ,# ,X$ ,=$ ,,$ ,-+$ , 8$ ,F$ ,*hV$ ,]$ , d$ ,k$ ,Dr$ ,Z?y$ ,$ ,$ ,$ ,$ ,$ ,$ ,$ ,{$ ,S$ ,r$ ,=$ ,$ ,$ ,$ ,>Q % ,% ,a&% ,4% ,yyA% ,P_% ,qo% ,u% ,{% ,% ,5% , % , -% ,j% ,1% ,9% ,\% ,>% ,>% ,'z% ,:% ,5% ,- % ,% ,/9% ,c1% ,_% ,{% ,n% ,0% ,0% ,& , & ,ZV& ,B& ,& ,S#& ,c)& ,/& ,5& ,j;& ,JA& ,G& ,M& ,S& ,ͪY& ,_& ,e& ,k& ,q& ,=8w& ,$8}& ,& ,f& ,& ,uV& ,w& ,& ,l*& ,& ,& ,& ,~& ,f&& ,_& ,V& ,w8& ,& ,^& ,& ,0& ,s' ,P' ,F ' ,' ,G' ,?' ,($' ,*' ,0' ,†6' ,=' ,YM' ,BYS' ,Y' ,_' , e' ,k' ,q' ,Lw' ,d}' ,-H' , ' ,O=' ,' ,C' ,' ,' ,' ,ۻ' ,|' ,:' ,' ,V( ,T( ,4( ,o#( ,)( ,0( ,_l>( ,cWL( , Z( ,h( ,v( ,f( ,}( ,S( ,2( , ( ,( ,m( ,( ,( ,$) ,I) ,Υ) ,".) ,;) ,4H) ,M%V) ,f) ,8l) ,r) ,) ,j) ,K) ,0) ,fx) ,) ,m) ,wA) ,Y) ,k* ,5* ,]* ,** ,8* ,H* ,N* ,LT* ,Z* ,o`* ,f* ,l* ,s* ,* , * ,* ,* , * ,|* ,h* ,r* ,* ,W* ,D* ,w* ,* , + ,8W+ ,/#+ ,0+ ,=+ ,J+ ,.W+ ,e+ ,xs+ ,(+ ,9+ ,+ ,P+ ,+ ,h+ ,|+ ,+ ,0, ,F, ,!, ,?-, ,' <, ,ñK, ,$Z, ,H i, ,D9x, ,%, ,, ,, , , , , ,, ,n, ,@, ,*-- ,V- ,ȵ!- ,r1- ,FA- ,(rQ- ,p- ,T- ,- ,- ,sh- ,Ӟ- ,xt- ,S- ,D- ,M- ,f. ,. ,S#$. ,h9. ,RT. ,p. ,. ,H. ,9!. ,x. ,. ,f. ,' . ,Ak/ ,\[/ ,!/ ,9-/ ,;/ ,EI/ ,cW/ ,e/ ,s/ ,N/ ,/ ,/ ,/ ,/ ,/ ,z/ ,/ ,/ ,p$0 ,_o%0 ,+0 ,Qc10 ,70 ,Q =0 ,_C0 ,I0 ,O0 ,pU0 ,J[0 ,0a0 ,e"g0 ,vm0 ,s0 ,#y0 ,0 ,R0 ,~0 ,N0 ,a 0 ,A0 ,0 ,0 ,\G0 ,0 ,0 ,k60 ,f0 ,=0 ,r0 ,r"0 ,0 ,|1 ,1 ,U)1 ,%71 ,G1 ,U`M1 ,S1 ,aY1 ,3_1 ,f1 ,is1 , 1 ,#1 ,1 ,1 , 1 , 1 ,t1 ,2 , 2 ,2 ,`;+2 ,r82 , E2 ,R2 ,_2 ,l2 ,2 ,2 ,2 ,n 2 ,6k2 ,2 ,X2 ,F2 ,Ri 3 ,h=3 ,/w&3 , w33 ,0~@3 ,ǧM3 ,eZ3 ,"h3 ,v3 ,͖3 ,N3 ,l3 ,3 ,$3 ,W3 ,Lk3 ,E3 ,] 3 ,4 ,N?4 ,cE4 ,-4 ,g8;4 ,I4 ,|w4 ,4 ,c9 ,z9 ,9 ,N9 ,<9 ,9 ,w9 ,: ,;(: ,D: ,BW: ,ry: ,9: ,: ,XE: ,79:: ,": . : . : ,|: .: .: /4; ,=*;; /J,; .=0; .;9;N;a;v; ,=*;&; ; ;&;;; .L; .J; <<H< ,- N<f< ,"s< ,; < ,|< .]< .Y< ,?<0< ,"< .y< .u<><C< ,)<@ = ,"= .= .= ,|)= .-= .6=t@= /Q= .MU= .IZ= /c= .mg= .ip=z= /= .= .== /= .= .== /= .= .= .= .== / > . > .> ./> .)%> .Q)> .K.> /7> .p;> .jD>N> /_> .c> .l> .p> .y>> /> .> .> .> .>> /> .> .> .> .> /> .> .>?(?tA? .E? .P?i? .m? .w?? /? .,? .$?? / ? .R? .L?? / ? .q? .k? .? .?? / @ . @ .@ .@ .!@ .%@ .*@ / 3@ .7@ .@@J@ /#Z@ .D^@ .Bg@q@ /#}@ .S@ .Q@@ /#@ .b@ .`@@ /#@ .q@ .o@@ /3@ .@ .~@ .A . A . A .A A /3-A .1A .:A .>A .GA .KA . TA^A /3kA .&oA ."xA .>|A .:A .`A .\A /3A .zA .tA .A .A .A .AA .A .A BBt7BRBhB ,:zB ,"B ,1B ,B ,"B ,1B ,B /3B .C .C .C .C ,#C .3'C .,C ,17C .;C .@C ,KC .'OC .#TC ,"_C .KcC .;hC ,|sC .wC .C .C .C .jC .hC , C .C .yCC ,v_CC ,C ,aCC ,,D  D ,- D"&D ,,3D`^ .3B^ .3K^ .4O^ .4X^b^ /o^ .74s^ .34|^ .Q4^ .M4^ .u4^ .q4^^ /^ .4^ .4^ .4^ .4^ .4^ .4^ /^ .4^ .4^ .5^ .5^ .:5_ .45 __ .Y5#_ .U5-_K_c_ |_ _* _/ _` __ ` ,`` )` ,3` .u57` .o5<` ,"F` .5J` .5P` ,|Z` .5^` .5c` {` ` ` ,$` ,|` ,`` ,,`` ,- `"`a ,Y a /+a ,"5a .69a .5Ia .6Ma .6]a .N7aa .J7ga ,|qa .7ua .b7za ,a ,,aa ,- a"ha a / a .Z8a .V8a / a .p8a .n8a a /b .8 b .8b .8b .8b /%b .8)b .82b ;c .;c .;c .)<c .<c .<c .<c d d /d .<"d .<+d .</d .<4d /=d . =Ad .=Jd Td /`d .G=dd .C=md wd /d .h=d .d=d d /d .=d .=d .=d .=d /d .=d .=d d .=d .=e .=e .=e e 2e .=6e .=?e . >Ce .>Le .>Pe .>Ye .->]e .+>fe pe e .?>e .=>e .P>e .N>e e .b>e .`>e e e .r>e .p>e .>e .>f* &fm 0f /@f .>Df .>Mf .>Qf .>Zfm df /pf .>tf .>}f .>f .>f .>f .>fm f /%f .>f .>f .?f .?f .)?f .'?f /%f .:?f .6?fr g #gJ -g /;=g .Q?Ag .O?Lg Vg rg .b?vg .`?g g g .s?g .q?g g g .?g .?g .?g .?g h /Nh .?h .?)h /h6h .?:h .?DhNh /^h .?bh .?kh .?oh .?th /}h .@h . @hh /h .5@h ./@h /h .T@h .P@h?h /h .r@h .h@hCh /i .@ i .@iCi /+i .@/i .@8i .@ ,l ,1S ,g , ,[ω ,މ ,S ,^ , ,4* ,97 ,e ,8y ,u ,z ,EŠ ,w8Ԋ ,R ,N ,)- ,N0  ,Q ,r  ,=W. ,: ,SG ,&T ,ma ,yHn ,M{ , , ,- ,' ,$͋ ,Aۋ ,+ ,= , ,  ,, ,29 ,5F ,WS ,k,s ,m} ,; ,@ ,a ,  ,. ,2 ,z , ," ,gA/ ,NT< ,6K ,Z ,w , , , p ,6 , ,' ,+Ǎ ,*-ԍ ,/0 ,D ,xA ,- ,  ,C- ,޸: ,EG ,9my ,] , ,M ,Ύ ,b:܎ , ,C ,( ,) ,c" ,O0 , > ,(L ,Z ,fh ,v , , ,S ,V ,|S ,ʏ ,&؏ ,A ,$ ,A ,d ,& ,W, ,|: ,>H ,c6V , d ,.Fr ,6 ,* ,yC ,m ,; ,X5ʐ ,+א , ,@  ,N ,:& ,=3 ,A ,CN ,=[ ,i ,P ,ZǑ ,I ,d , ,B ,%( ,W ,P ,Z ,X ,w , ,k| ,ب , ,"̓ , ,ߨ@ ,(O ,UL[ ,Og ,Cs ,< ,Ŧ ,(Ŕ ,RXє ,ߔ , ,p ,9: ,G ,vY ,f , ,Z@ , , ,9 ,• ,Е ,?ޕ , ,7  ,le" ,=6/ ,>< ,_MI ,MV ,kc ,gTp ,f} ,> , , ,] ,2Ŗ ,OQӖ ,3 , , ,K  ,B ,a' ,p5 ,yTC ,LQ ,_ ,]m ,S{ , ? ,./ ,$З ,ߗ , , ,r  ,r , + ,}f: ,VI ,&Y ,dh ,w ,8? ,i ,7 ,.% ,[˜ ,'5ј ,; , , ,UZ  , ,+ ,: ,~ZI ,MX ,,g , Fv ,0 ,[) , ,Q ,| ,{Й ,ئߙ ,X , ,@  ,Cy ,#* ,@H ,W ,X;f ,ku ,A , ,o , ,> ,К , ,x , ,$1 ,yg  ,;0 ,9@ ,P ,kl` ,np ,T] , # , , , ,BЛ ,iKߛ ,< ,V  ,F, ,6* ,i%9 ,GH ,W ,sf ,2u ,IN ,Wv ,' , ,  ,MϜ ,@ޜ ,+ , ,?  ,{ ,a) ,38 ,-G ,C?V ,#Le ,m/t , ,1 ,\t ,> , ,4kϝ ,OHޝ ,K ,|t ,]  ,p; ,]) ,^8 ,UTG ,-d ,s , ,o ,7 ,5} ,sQ ,~F͞ ,$ܞ ,4 ,Ҏ ,  ,s ,' ,F6 ,b|E ,OT ,mc ,Ar ,2 ,7 , ,C ,z ,U̟ ,5۟ , ,, ,z ,2\ ,E& ,sa5 ,D ,DS ,b , tq ,} ,YJ ,J ,NO ,$ ,Jˠ ,ڠ ,r ,/ ,W ,D ,5d% ,S4 ,=C ,CR ,qFa ,p ,D ,Ca , g , ,- ,0ʡ ,`١ ,Ů , , ,bS ,lK$ ,vB3 ,.B ,Q ,.` ,Sp ,̙ ,Ս , ,R ,k ,ʢ ,٢ ,j ,+X , ,/ ,v)$ ,}3 ,C ,R ,0a ,Sp , ,* ,n ,r , ,3ʣ ,n٣ ,RM ,v ,-! , ,m$ ,3 ,efB ,OQ ,` ,o , ~ ,; , , ,v ,ɤ , ,N. ,J , ,$ ,3 , 4B ,]\Q ,` ,vo ,~ ,@L , , ,Ņ ,0˥ ,tXۥ , ,Q ,$  , ,!O( ,7 ,Tx , , , ,Oɦ , ,  ,r( ,u:( ,6 ,D ,)QR ,n ,G| ,) ,Z ,? , ,@1ħ ,9)ҧ , ,t ,D% ,X`= ,XT ,s%x ,h ,  ,* ,: ,H˨ ,U٨ ,_ ,W ,# , ,?@  ,v. ,d>< ,lYJ ,3X ,9f ,t ,h ,@ ,sJ , ,ǩ ,W} , ,w' ,Y , ,27 ,YO ,As\ ,$p ,e ,j ,q ,< ,  ,0Z ,D+ ,T , , ,  ,ª ,Ȫ ,XΪ ,;Ԫ ,iRڪ ,4 ,b , ,)$ ,mP= , C ,{0I ,#tO ,3U ,X'[ ,a ,u#g ,m ,Ys ,5 y , ,y ,/ ,*, ,7I ,G , , , ,t ,% ,8 ,ǫ , ͫ ,Kӫ ,W߫ ,; ,@G ,Z  ,  ,(#+ ,Z: ,0I ,ѳX ,V,g ,wmv ,PF , ,Y , ,%K ,2CЬ ,߬ ,{ ,YR ,  ,3W ,G* ,]79 ,,H ,W ,Kf ,&u ,:H ,G , ,  , ,1Э ,>V߭ ,  , ,   ,P ,H+ ,/: ,I ,pX ,h ,>u ,| , , ,Z ,9î ,Ю ,-ܮ ,J ,c% ,~ ,  ,]4 ,  ,2 ,> ,[ ,I ,N ,t , ʰ ,{^װ ,I ,:v ,  ,B ,P ,s ,?ñ ,б ,Oݱ ,/ , 0 ,&, ,ja: ,y<Y ,iMi , Mx ,  ,B , ,IJ ,Ҳ ,V:߲ , ,  ,Q ,>|* ,68 ,&F ,#]b , r ,wW ,S , , ,@ ,Aγ ,ܳ ,\ ,Q+  ,T ,Q& ,t!4 ,fB ,^NP ,e ,3r ,xA ,>| ,= ,c%Ǵ ,:Դ ,2 ,L: ,? ,ZI ,bV ,c ,6p ,} , ,gA ,w* ,d ,µ ,ϵ ,^ݵ ,5J ,2 ,N ,v ,, ,*j ,z ,h ,ZE ,wk , , ,ʶ ,׶ ,  , ,` , ,=+ ,G ,ET ,g ,~ ,a ,N ,s] ,= , ,aӷ , ߷ ,F= , ,< ,> ,K ,X ,aQe , ,  ,^B ,D ,8¸ ,O;ո , 4 ,~a ,3 ,K , , ,0  ,  ,>$ ,`. ,z; ,qI ,OV ,m , Bz ,K ," ,=W ,q ,9ʹ ,b:׹ ,N ,X ,+  ,S ,q& ,n4 ,jA , N ,~[ ,n ,KV{ ,j ,? ,KV ,W; ,6 ,^̺ ,ں ,  ,KV ,O ,  ,+ , ,^- ,: ,G ,xAT ,}&a ,M ,Z ,i , v ,9 ,I> ,b , ,% ,"w ,D ,$ ,i ,_  ,w% ,) ,o6 ,^\ , i ,v ,#N ,' ,/ ,7 , ,/ ,i ,2 ,K ,4h  , ,2' ,-A ,EO ,K\ ,Dj ,w , ,- ,>| ,z ,0d ,7 , ,  , ,= , , ,V" ,/ ,= ,<J ,8W ,,e ,>r , ,+m ,R , ,<) ,9 , , ,) ,# ,5 ,! ,V,. ,X ,e ,s ,0 ,R , ,u ,q , ,Z , ,& , ,7 ,T8C ,aQ ,_ ,?m ,&| ,T ,D* ,V , , ,\ ,3 , , ,}& , ,? ,{ ,@+ ,z9 ,GG ,< U ,d ,p:r ,Q ,R\ ,W , ,5 ,N  ,2 ,2 , ,s ,  ,I ,/, ,K: ,?H ,V , d ,sr , , ,i^ , ,\ ,1 ,=S , ,9 , ,c  ,O ,hb( ,7D6 ,o@D ,*QR ,V` ,i+n ,D| , , ,7 ,Bo ,6w ,H ,O% ,  ,03 ,  , ,( ,]6 ,áD ,LR ,` ,N[n ,r0| ,N , ,a , ,x , ,i% ,7r ,A ,8. ,7r' ,5 ,C ,*Q ,>_ ,m ,]{ ,3G ,18 ,G ,vY ,j ,Y ,C ,p  ,k ,R& ,\4 ,03B ,P ,m` ,15p ,v , , ,O ,,  , ,t\ , ,9  , ,& ,Q ,_ ,Sn ,49} ,Y ,= ,sQ ,' ,e ,$ ,7 , ,2( ,0 ,? ,)c ,~m ,5{ ,H ,N , , , ,M ,b , ,A ,‹ , , C# ,1 ,? ,_>M ,kn , { ,= ,& ,] ,Cy , , ,' ,. ,\! ,H<4 ,KA ,3h ,=u ,S ,o , ,Ȥ ,= ,* , , ,k ,^? ,2y ,u ,S ,<+ ,8 ,E ,]\R , U_ ,l ,oy ,@ ,3 ,rH , , U ,]\ ,,' ,f4 ,LA ,2N ,}&[ ,t ,) ,p; ,V~ ,c ,F ,o ,  , ,I , ,I ,C  ,# ,8% ,8 ,~F ,S ,0` ,m ,ez ,P< ,\ ,* ,QX ,\) , ,a , ,ۑ , ,[9  ,iA ,H' ,4 ,OA ,N ,\ , u , ,> ,  ,- ,: ,jk , ,D , ,? ,4 ,5P+ ,{9 ,JG ,aU ,C?c ,#Lq ,tD ,{ ,1 ,\t , , , ,> , ,Y ,?  ,  , t' ,r5 ,C ,*Q ,&_ ,m ,#{ ,[ , ,Ģ ,{ ,) ,& ,8 ,D ,  ,H  ,}U ,F& ,970 ,z> ,L ,` ,Qn ,| ,'$ ,P ,y , ,@ ,j7 ,m# ,E ,sa ,]6 , ,!" ,&/ ,>c< ,I ,.V ,Oi ,x , ,} ,]6 , , ,E0 ,Cy ,z ,0 ,Ƴ ,2$ ,խ ,, ,VR; ,J ,"KY ,h ,zw ,S* ,T , ,R ,] ,[ ,_ ,/ , ,f ,'+ ,j+5 ,-? ,̙^ ,bh , ,D ,Ѧ ,nC ,O1 ,; ,L ,!m  , ,X% ,3 ,A ,WO , ] ,k ,ƌy ,/ , , ,)5 ,; , , ,+ ,= ,k8 ,I ,G& ,%5 ,J ,W ,[d ,vSq ,< ,N ,1 ,R ,; , ,  ,O ,b ,nD ,  ,>B ,~' ,4 ,B ,}&P ,e^ , Kz , ,o , , W , ,  ,< , ,B , ,! ,/ ,/= ,5K ,aY ,'u ,V, ,Q ,6 , ,L , ,}& , ,  ,u ,J# ,ѓ0 ,C ,_SM ,){X ,QJe ,o ,y ,w ,6 ,. , ,P ,ï ,D ,U , , ,r ,+ ,wU9 ,pG ,6U ,c ,q ,3 ,H ,?& ,$ ,v ,S ,` ,R , ,g  ,)C ,|3 ,As@ ,XM ,HZ ,& g ,m% ,y ,Re ,# , , ,d ,1 ,^  ,5 ,2$ ,!< ,H ,YU ,b ,3bo ,$| ,8 ,D ,iN ,& , ,R ,w ,f`  , ,P2& ,, ,%2 ,^8 ,> ,E ,5R ,]6` ,'Ns ,}\ , , ,{o ,5 ,B ,R ,  ,b: ,N ,X# ,./ ,; ,-G ,4S ,:_ ,hl ,&y ,6 ,@ , ,v ,8 ,$ ,> , ,C  ,O ,  ,68  ,k ,Ak ,8 ,N# ,a_) ,/ ,5 ,-; ,ѡA ,BG ,M ,T ,ISd ,Mj ,q ,=Uw , } ,/ ,J ,<) ,gB ,x ,S ,<) , ,wu ,K/! ,C2' ,- ,;3 ,T9 ,cY? ,NE ,L ,TU ,v2^ ,g ,n ,{ ,9 ,* ,ͫ ,J ,B , . ,r , , A ,>t , ,Z ,Jh ,u ,0 ,6 ,& , , ,  , ,?- ,<) ,Xk ,-U  ,/4E ,/R ,&_ ,`Cl ,Ly ,  , ,88 ,o5 ,FW ,I ,, , ,f ,^ ,=! ,J. ,{; ,&H ,pU ,b ,o , | , ,؈ ,̸ ,)W ,> , ,K ,: ,n* ,vX ,  , ,<)) ,R ,)ei ,+u , , Q ,!3 , ,3S ,!3 ,b ,!3 ,Ӕ ,5 ,6) ,5P ,_ ,ςl ,y ,ǵ ,% ,> , , ,R| ,* ,2 ,= ,u , ,R , ,}& ,I  ,u ,u. ,; ,/T ,b , , , ,$ ,OQ ,;  ,\ , ,2 ,I ,j ,/G ,NfT ,pb ,pl ,Uy ,& ,  ,/ ,O; , , ,) , ,& ,P ,9 ,U", ,9 ,G ,)Q ,9^ ,vk ,>| ,= ,b ,0  ,/ ,f  ,Y ,f ,F ,>- ,Y ,[ ,a! ,}e. ,t9; ,)H ,x"` ,Pu ,]! , ,) ,!V ,J , ,$  ,3b ,@7 ,OD ,G0Q ,Y_ ,v7r , ,ˀ ,R ,i ,s ,\ , , ,  ,b: ,N ,]e ,Tq , ,;b ,]! , ,3b ,T ,+ ,$ 9 ,JM ,[ ,Z@i , , ,, ,E ,0 ,G ,I? ,iE , ,- ,,; ,EI ,VW ,NTe ,u s ,@h , ,/. ,M , , ,K ,A ,- ,tc; ,aI ,W ,e ,~s ,NH ,7 ,G ,P , ,*: , ,3 ,t ,$ ,7% ,hB ,OL ,95Z ,5h ,|w ,am ,& , ,h( ,4 ,/; , " , , ,XS  ,S 9 ,TF ,Pl ,L ,# ,0F , , ,d ," , ,k , ,h ,Y ,4$ ,P2 ,k@ ,|N ,pT\ ,rj ,  , , , ,\f ,/ ,+ ,vS) ,C7 ,PQE ,?FS ,i$a ,Do , ,Y ,F ,^ ,= ,7 , ,f& , ,*  ,q  ,f6% ,T3 ,LA ,\jO ,0^ ,Gm ,7/| ,\R ,cG ,{c ,V ,W , , ,? ,( ,,' ,`F! ,8? ,\N ,] ,l ,J{ , , , , ,dq , ,n , ,b: , ,V  ,n/ ,> ,U&M ,\ ,vk ,fz ,Nf ,I ,  , , ,a ,} ,o4 ,&" ,<, ,4: ,VNG ,/~T ,ښa ,i%n ,={ ,b: ,> , ,T ,G ,S, ,8 , ,<) ,- ,o+ ,J9 ,dOG ,[ ,k e ,5~ ,: ,P> ,& ,q ,+ , ,&=  ,7 ,F ,W ,;] ,6c ,i ,!7o ,ju ,{ ,λ ,@ , ,. , , ,} ,` , ,7 ,Mu ,"2 ,5 , , ,/. ,Z< ,J ,h"X ,YOf ,t ,A , , , ,߶ ,U ,@ ,/ ,P , , ,?l ,&  ,c ,c6 ,D ,AR ,` ,Xn ,J| ,l ,c ,;p ,@ ,? , ,; ,ZG , ,S  , , :' ,"2h ,J , = ,P> ,& , ,& ,  ,8v ,Q ,+ ,9 ,G ,+U ,jc , /q ,;p , ,Y , ,{Q ,#U , ,g$ ,5 ,s; ,A ,G ,3M ,[S ,7Z ,ɗj ,T x ,C ,1X ,Q ,5 ,^ , ,2 ,M ,E~ , ,x ,!  ,Z. ,y< ,1J ,X ,'f ,|t ,F ,w ,% ,:H , , , ,& ,H ,N  ,y ,L' ,6 ,-E ,!T ,c ,<'r ,, ,1 , , ,{Q  ,4 ,ɗ% ,9 ,6G ,f ,t ,  , , ,0 ,Q ,m9 ,; ,/ ,; ,(E ,KR ,]`_ ,Vl , y ,M ,n9 ,i ,?D ,X , ,G ,z ,v , ,   ,V- ,: ,-HH ,+| , ,` ,;A ,k , ,~} ,z3 ,q , ,T , , ,S ,9Y ,_ ,  ,l ,' ,t ,E ,  ,[  ,,  ,s:  ,n9H  ,1LV  ,Od  ,dr  ,  ,7  ,  ,!  ,=  ,J6  ,  ,  ,?  ,  ,  , &(  ,p5  ,%%B  ,+U  ,b  ,%%o  ,+  ,`5  ,  ,J  ,  ,n  ,  ,M  ,K  ,Q'  ,  ,,  ,n:  ,iFH  ,:V  ,%y  ,   ,3  ,L  ,  ,i  ,  ,?  ,L  ,   ,7  ,l,  ,@:  ,EH  ,~V  ,3bd  ,er  ,  ,e  ,$_  ,/  ,f*  ,/  ,U!  ,T/  ,?  ,O  , _  ,o  ,]  ,?  ,  ,1A  ,  ,  ,v  ,  ,& ,m+ ,8 ,^E ,/R ,*_ , ,8 ,D ,l ,; , ,G ,? ,o ,t ,Ψ ,D# , 0 ,Y= ,i%J ,|p ,"} , ,, ,S ,4 , , ,>|  ,Q ,' ,5 ,VC ,qQ ,?_ ,-m ,4U{ ,( ,% , ,) , , ,C ,c ,: ,  ,/ ,-=I ,>|V ,Sc , p ,܋} ,J , ,& ,+ ,A ,3b ,$ ,A ,-=  ,S ,9' ,Ce5 ,C ,/Q ,%_ ,%m ,1K} ,Xw ,k ,0 , , , , , , , ,0 , ,n ,# N ,8b ,35o ,| ,, ,7 ,o ,8 , , ,>|  , ,*d% ,|'2 , ? ,L ,0Y ,'Pf ,p2s ,N ,E , , ,, , ,| ,, ,b , ,@  , ,>|) ,3b7 ,E ,(S ,b5a ,)o ,w4} ,C , ,< ,| ,8 ,i%  ,T^ ,0 ,5= , \L ,([ ,fJj ,y ,@x ,] ,L ,C ,T^ ,/ ,!  ,- ,@ ,LM ,VZ ,]g , t ,  ,\s , ,3( ,xf5 ,B ,+^ ,~R ,# ,B ,| ,_2 ,%? ,J:L ,Z?Y ,Sf ,eas , ,b ,5 ,}& ,d0 , ,w~ ,z ,; , ,, ,-z< ,J ,i%d ,r , ,7- , ,M ,9 , ,S , ,;X , ,5Q. ,2= ,gL ,[ ,j ,wy ,> ,0) ,& ,@N ,  , s ,`~ ,L+ ,c ,/A ,, ,Q; ,VJ ,FY ,h ,w ,9 ,m8 ," ,O ,7 , ,x ,M ,E&  , ,N ,:Q[ ,Ch ,,Gu ,9 ,X ,& ,& ,0 ,, ,] ,U ,7\  ,T  ,5  ,*  ,A7  ,D  ,Q  ,6E^  ,jk  ,MAx  ,~  ,P  ,  ,  ,z?  ,$  ,(  ,! ,7! ,_#! ,z1! ,;?! ,}=M! ,z[! ,i! ,w! ,ld! ,P#! ,3! ,Z! ,! , >! ,m! ,! ,A! ,F" ," ,I" ,G[" ,ta" ,g" ,j[m" ,9s" ,Dz" ,{P" ,3" ,ZA" ,=" ,Τ" ,5" ,W" ,&" ,]6" ,$" ,[O" ,յ" , # ,~# ,"'# ,c5# ,nD# ,S# ,+)b# ,q# , # ,W# ,x# ,n# ,# ,p# ,h# ,&# ,8# ,.$ ,f#$ ,!$ ,)X1$ ,q A$ ,CQ$ ,a$ ,q$ ,f$ ,$ ,<)$ ,3$ ,v$ ,$ ,U$ ,$ ,N$ ,% ,% ,kG$% ,4% ,D% ,T% ,.Md% ,qt% ,W% ,% ,% ,&q% ,Z% ,% ,E% ,% ,A% ,]K& ,G& ,$& , 3& ,R& ,_& ,|x& ,8& ,&& ,v& ,gB& ,& ,wS& ,[& ,q& ,8& ,JU& ,#' ,r_' ,2!' ,.' ,-H' ,YW' ,4l' ,ʔ' ,$' ,' ,c%' ,%' ,I' ,a' ,=' ,9( ,F( ,|S( ,B`( ,*m( ,z( ,( ,bb( ,_( ,( ,( ,z( ,( ,T( ,"( ,( ,7 ) ,) ,u#) ,L<) ,Xh) ,cu) ,|) ,b:) ,*-) ,) ,^) ,M) , N) ,) ,) ,z* ,* ,* ,7+* ,Q8* ,Q* ,^* ,* ,|* ,* ,* , * ,+ ,.+ ,Ć+ ,c*+ ,7+ ,\sD+ ,+ ,?j+ ,|+ ,Q+ ,_+ ,, ,V>, ,iSr, ,7, ,Ӌ, ,v, ,#, ,,, ,iS, ,, ,n, ,u, ,, ,- ,H<- ,h ,- ,^:- , H- ,\- ,i- ,!v- ,?- ,i%- ,^- ,- ,- ,7- ,۰- ,T- , . ,^<. ,B. ,JI. ,<V. ,vd. ,p%q. ,>~. ,H. ,]. ,. ,C. , . ,?R/ ,_/ ,^m/ ,Ez/ ,2/ ,!/ ,&/ , / ,M/ ,;/ ,"%0 ,]20 ,>yE0 ,|a0 ,(;m0 ,0 ,0 ,0 ,0 ,o0 ,s00 ,O&0 ,0 , 0 ,$0 ,w 1 ,h1 ,\%1 ,^21 ,*?1 ,VL1 ,`1 ,(m1 ,1 ,1 ,1 ,d1 ,q1 ,c1 ,N1 ,K1 ,642 ,@C2 ,E!2 ,}./2 ,ĩ=2 ,9Q2 ,KJ_2 ,/m2 ,{2 ,*2 ,E2 ,v2 ,X2 ,2 ,S2 ,2 ,/2 ,.@2 ,13 ,S3 ,C#3 ,13 ,(?3 ,"M3 ,=[3 ,Ui3 ,AHw3 ,83 ,;E3 ,<3 ,3 ,?3 ,w|3 ,3 ,$3 ,~4 ,-4 ,2j"4 ,M94 ,H4 ,WX4 ,o4 ,AX~4 ,)4 ,4 ,4 ,.4 ,d4 ,B4 ,4 ,5 ,~85 ,5 ,K+5 ,85 ,AE5 ,QR5 ,_5 ,l5 ,<y5 ,;5 ,5 ,L5 ,5 ,e5 ,4U5 ,5 ,N5 ,<6 ,s6 ,f6 ,X-6 ,~;6 ,DI6 ,W6 ,4e6 ,#Gs6 ,6 ,ؠ6 ,d6 ,6 ,Ҡ6 ,ۛ6 ,(6 ,6 ,O6 ,6 ,9 7 ,7 ,i)7 ,n87 ,;G7 ,G V7 ,Ge7 ,zt7 ,ё7 ,7 ,7 ,O7 ,J7 ,7 ,7 ,K97 ,97 ,I 8 ,`8 , <)8 ,88 , G8 ,IyV8 ,e8 ,R4t8 ,U8 ,і8 ,c8 ,318 ,8 ,r8 ,$8 ,8f8 ,W 9 ,YP9 ,Σ*9 , (99 ,eH9 ,_]9 ,3m9 ,&Os9 ,I: ,'FV: ,|c: ,p: ,}: ,: ,: ,o ; ,1; ,F; ,[ha; , n; ,[; ,; ,; ,j; ,.; ,vS; ,; ,; ,< ,< ,c < ,-< ,]6:< ,\U< ,~b< ,/{< ,E< ,|< ,:<< ,< ,M< ,/< ,z?< ,& = ,'= ,z?:= ,V= ,#= ,9Y= ,7(= ,= ,== ,]= ,+= , += ,v= ,> ,k> ,,> ,=:> ,H> ,DV> ,d> ,JGr> ,.> ,)> ,S> ,$> ,h> ,W> ,n> ,EC> ,N? ,-? ,8!? ,}0? ,?? ,?N? ,O]? ,Ll? ,U{? ,DK? ,? ,H? ,p7? ,\9? , Q? , V? ,a? ,e@ ,@ ,!@ ,UN@ ,/]@ ,l@ ,%@ ,~)@ ,1@ ,?@ ,-@ ,s@ ,e@ ,޻@ ,(<@ ,3@ ,lYA ,#A ,(JA ,WA ,"jA ,wA , A ,!A ,=A ,1A ,tFA ,vA ,VB ,(B ,qkBB ,XB ,dxdB ,4{B ,B ,B ,"B ,HYB ,B , B ,!B ,lC ,B{C ,+C , G>C ,(HC ,[8WC ,dC ,yqC ,V~C ,{C ,|C ,+C ,7/C , C ,jC ,@C ,3C ,9&D ,YD ,5fD ,sD ,=D ,D ,u}D ,D ,7TD ,D ,bD ,D ,MD ,D ,E ,?E ,r0E ,|,E ,!3:E ,WGE ,iTE ,2gE ,[9tE ,E ,tE ,E ,QE ,E ,,E ,ݧF ,= F ,F ,v'F ,5F ,+BF ,V/OF ,\F ,]iF ,wvF ,F ,&3F ,F ,F , F ,2F ,+F ,[:F ,AF ,wdF ,XG ,u}G ,"G ,7T/G ,O ,DO , P ,P ,,P ,G5:P ,"HP ,>VP ,dP ,rP ,7P ,|7P ,P ,P ,~P ,oP ,P ,1P ,Q ,|Q ,NQ ,n Q ,2'Q ,TQ ,aQ ,DtQ ,Q ,Q ,Q ,Q ,%Q ,tQ ,7Q ,Q ,ʄQ ,iQ ,kR ,R ,8?R ,A,R ,C9R ,5FR ,6HSR ,Ro`R ,2+mR ,CzR ,PIR ,R ,R ,&HR ,>R ,]oR ,WR , jR ,7[R ,5 S ,S ,(S ,*6S ,DS ,oS ,ΌS ,9CS , S ,f!S ,\<S ,\S ,_T ,OT ,!!T ,LD/T ,A=T ,oT ,T ,C;T ,T ,k5U ,>U ,U , E,U ,:U ,HU ,2VU ,dU ,rU ,U ,U ,iHU ,EU ,U ,dU ,U ,U ,?MU ,U ,0 V ,1V , B7V ,EV ,TV ,zwbV ,4CpV ,{MV ,V ,VV ,NV ,V ,HIV ,QV ,:V ,V ,+BW ,W ,*W ,I8W , FW ,TW ,UCbW ,pW ,~W ,r,W ,<W ,%&W ,X , X ,X ,0X ,X ,OY ,,Y ,8*Y ,]Y ,kY ,ҝyY ,M7Y ,RY ,)GY ,XY ,oOY ,)Y ,Y , Y ,cY ,BZ ,:Z ,C!Z ,~/Z ,7=Z ,ܝKZ ,ZYZ ,gZ ,uZ ,} Z ,XZ ,g?Z ,Z ,Z ,Z ,`gZ ,Z ,Z+[ ,c[ ,,[ ,M;[ ,J[ ,w[Y[ ,2h[ ,u[ ,/[ ,w)[ ,J[ ,[ ,[ ,[ ,[ ,Q[ ,[ , \ ,f\ ,h^ ,fU^ ,^#b^ ,HX{^ ,*S^ ,y^ ,^ ,D^ ,L^ ,ڔ^ ,_ , _ ,z_ ,-$_ ,t4_ ,p%B_ ,P_ ,e^_ ,;;l_ ,d8z_ ,!_ ,+_ ,_ ,:_ ,2_ ,_ ,n_ ,1_ ,*_ ,*` ,=P` ,G."` , 0` ,M>` ,?L` ,(Z` ,(h` ,v` ,` ,Iw` ,I;` ,}&` ,*` ,ۓ` , ` ,E%` ,a ,!a ,f a ,-a , ;a ,CIa ,%Wa ,z(ea ,ļsa ,\a ,*a ,iha ,\a ,a ,$a , a ,a ,a ,a ,[ b ,_b ,CA)b ,7b ,1Eb ,YSb ,ab ,~b ,Ab ,2b ,&b ,Wb ,!4b ,Ab ,&b , 4b ,oc ,Cc ,&h%c ,c%3c ,>|Ac ,mGOc ,5]c ,kc ,c ,)c ,Oc ,'c ,fCc ,,c ,c ,Td ,Ld ,n$d ,2d ,u@d ,gd ,4ud ,Gd ,'d ,Dd ,Ed ,*Jd ,`d ,Rd ,d ,"d ,e ,ke ,=e ,hj+e ,9e ,Ge ,cDUe ,Lce ,qe ,e ,.e ,)Re ,e ,Fe ,a]e ,e ,e ,awf , f ,-f ,UG7f ,YKf , 1Yf ,Z ff ,5sf ,'f ,:f ,M6f ,Pf ,f ,ZQf ,|f ,"f ,)f ,f ,g ,zIg ,g ,B)g ,6g ,Cg ,Pg ,)]g ,nCjg ,wg ,g ,l.g ,jg ,g ,5g ,g ,[g ,g ,h ,+h ,/h ,d(h ,֢Bh ,dYPh ,uV^h ,lh ,zh ,h ,Bh ,b:h ,h ,h ,Rh ,i ,!Gi ,Ui ,Nri ,Pj ,Pj ,dj ,#)+j ,(9k ,؃k ,+ul ,nn ,Ao ,o ,z-o , p ,b/p ,y5p ,+;p , Fp ,+q ,%q ,NF#r ,90r ,C=r ,sxJr ,Wr ,~dr ,qr ,\~r ,%r ,r ,<r ,r ,-r ,qIr ,׹r ,"br ,r ,Js ,as ,$s ,d2s ,+@s ,,Os ,s{[s ,_Vws ,Ss ,2s ,s , s ,9Ks ,/s , s ,s ,Cs ,Ys ,p<t ,t ,G t ,Et ,cRt ,|yt ,ft ,=t ,t ,%u ,#u ,6K*u ,Du ,;ku ,Ku ,?nu ,^u ,u ,W}u ,/u ,u ,PRu ,Lv ,(v ,4z5v ,Ov ,Whv ,vv ,\v ,)v ,v ,Lv ,Cv ,0v ,@v ,M`w ,Nqw ,6ww ,[}w ,w ,tw ,4iw ,^w ,Dw ,xAw ,Ϲw ,Qw ,>| x ,Ax ,E(x ,&6x ,1Dx ,3Xx ,f\x ,x ,Jx , x ,x ,^x ,x ,x ,zy ,Sy ,h#y ,q3y ,j~]y ,74jy ,wy ,Ly ,Cy ,y ,Kjy ,)z ,az ,fL"z ,΅(z ,.z , 4z ,,6;z ,Lz ,ĕRz ,Xz ,߫^z ,Iez ,Hsz ,z ,Iz ,z ,z ,7z ,z ,vz ,Hz ,ϩz ,ppz ,?z ,L{ , { ,1{ ,N{ ,N{ ,`(.{ ,m4{ ,Z:{ ,A{ ,M3R{ ,VX{ ,^{ , e{ ,Js{ ,{ ,c{ ,b{ ,{ ,*{ ,0{ ,{ ,6 | ,f| , | ,,| ,aS| ,`| ,Im| ,| ,F| ,-| ,| ,c1| ,^| ,ʍ| ,| ,9| ,bb} ,>} ,X} ,f} ,hv} ,|} ,B} ,j} ,*1} ,]} ,} ,8} ,C|} ,$~ ,mB1~ ,W~ ,J~ ,~ ,H~ ,]/~ ,~ ,~ ,~  ,/0 ,l6 ,9< ,B ,I , {V ,_:c ,p ,J} , , ,` ,m ,Ȁ ,aր ,_ ,z ,  ,Wt ,NR* ,A6 ,5C ,SQ ,] ,7r ,إ~ ,l , , ,93 ,< ,]Jρ ,݁ , ,9* ,? , ,V# ,<2 ,FMA ,WP ,2(_ ,n , ,F ,A΂ ,wۂ ,& , ,M ,V ,H ,i) ,M6 ,H<N ,wZ ,Ed ,(cq ,c% , ,] ,Z1 ,˃ ,؃ , ,y< ,Z ,7) ,+ ,9 ,F ,S ,4` ,m ,j ,d ,|B ,H< ,]l΄ ,~ۄ ,I  ,7 ,I ,M , . ,S> ,XD ,wJ ,P ,9W ,d ,q ,n@~ ,4n , , , ,D ,b-ͅ ,* ۅ ,( , ,V ,a ,! ,H/ ,M= , OK ,Y ,Kg ,'u ,: , ,y ,b: ,! ,jMԆ , Jކ ,` , ,xD ,י , ,A+ ,z9 ,M ,4Z ,g ,Nu ,9) , ,QY ,ar ,# ,ɇ ,٬ׇ , , ,Kj ,4 ,N ,w+ ,W9 ,yG , nU ,pc ,[q ,! ,i, , , ,K ,.ň ,ӈ , ,s , ,=  ,6B ,' ,5 ,C ,Q , _ ,m ,{ ,<3 , ,Y , ,* , , , ,, ,#6 ,D ,T/R ,R` ,Fn ,w| ,6 , ,  ,* ,Š ,(Њ ,6ފ ,/g ,y ,l3 ,' ,A,$ ,2 ,^<K ,?U ,&qn ,5{ ,e/ ,i ,0 ,{T ,*ɋ ,h֋ ,eD ,K , , ,* ,7 ,D ,dQ ,^ ,k ,x , ,}& ,03ƌ ,Sӌ ,t< ,L ,m ,(8  , , ,xL- ,; ,PI ,W ,|e ,l ,s , ,& ,cU ,Hō ,Mύ ,* ,  ,U ,P# ,21 ,Ь? ,`~M ,*[ ,i ,Mw ,y ,b , ,E ,~Î ,Zю ,ߎ , ,.q , ,9  ,3 ,J ,!Ő ,ΟՐ ,;ې ,] ,& ,h ,m ,;) ,\6 ,FC ,vP ,4] , &j ,)*w ,] , , , , ,ő ,ґ ,u9ߑ ,/ ,~ , ,1 ,j+ ,ND ,W ,Ad , sq ,~ ,sfE ,5<R ,_ ,-l ,Dy ,DQ ,1 , ,7 ,Ȕ ,:۔ ,, ,T ,= , ,$ ,Q4 ,A+: ,"@ ,PP ,2\ ,r ,"~ ,_ ,j ,wÕ ,S ,!  , ! ,/ ,D= ,0K ,_Y ,g ,lu ,>B ,M ,' ,8 ,ʖ ,ٖ , ,< , ,m/ ,.$ ,y3 ,lB ,`~Q ,@U` ,No ,~ , , ,p ,x ,1ϗ ,ٗ ,~G ,M , ,& ,C ,}&2 ,f@ ,ӚN ,\ \ , , ,H/ ,= ,\ , l ,Fr ,x , ,\ ,Ь ,J ,R , ,|͚ ,Oښ ,a , ,nQ , ," ,( ,_*5 ,RB , O ,7\ ,i ,v ,!I ,{ ,~< ,C ,k ,vț ,֛ ,L , ,ER ,M ,7 ,O* ,L8 ,:G ,V , e ,f<t ,j ,|A , , ,Kj ,Μ ,4ݜ ,ar , ,#  , ,&l* ,|Y: ,LJ ,(Z ,uj ,*z ,) , ,0 , d՝ , ,4 , ,j ,p ,q+ ,;9 ,(G ,NU , c ,q ,Η ,; ,#@ , ,w ,QŞ ,Ԟ ,M ,j ,FH ,i: ,Л ,. ,'M= , L ,[ ,j ,jy ,f< , ,|A , ,ğ ,Xӟ ,Kj , ,4 ,ar ,U , - ,= ,#M ,] ,m , 7} , ,( ,u ,* ,͠ ,Qݠ ,^ ,3 ,,  ,) ,KP) ,-8 ,xAG ,+V ,e ,s ,9 ,| ,i ,b/ ,С ,+ߡ , ,zx ,-z , ,8 ,ģE ,CR ,_ ,\l ,Qy , , , ,. ,hp ,X7Ǣ ,1B ,; , : , ,P ," ,/ ,= ,}&K ,KY ,Cg ,£ ,\У ,Hݣ ,i , ,L ,ň , ,>(+ ,!8 ,F!E ,PR ,r_ ,l ,![y ,6J ,  ,6 ,pDƤ ,LӤ ,h , , , ,g ,<! ,.0. ,o'; ,1H ,b ,7p ,{~ ,j , , , ,ĥ ,_ҥ ,*w ,8 ,  , K  ,k ,) ,U8 ,9G ,PV ,A,e ,Eft , ,RJ ,] , ,] ,Lަ ,h ,g ,4t  ,3 ,5) ,28 ,RG ,2V ,ye ,(t ,F ,)7 ,t> , , ,TΧ ,;ݧ ,r , ,Q  ,r ,( , 7 ,pF ,RU ,Úd ,Js ,\ ,d ,"& , ,x ,YHͨ ,bܨ ,O3 , ,{I  ,^ , J' ,BT6 ,E ,)T ,bb ,Gp ,{~ , , , , ,<ũ ,ԩ , , , , ,! ,B0 ,tY? ,N ,] ,l ,y{ , ,Ј , ,j ,5ƪ ,Cժ ,T ,-d ,~r , ,k ,ī ,pDɫ ,!٫ , ,)E ,|y  , ,.( ,F7 ,f<F ,ZU ,d ,}&s , ,<5 ,G­ ,.ȭ ,>έ ,{Oԭ ,ڭ , ,=K , ,/ , ,W ,<* ,[8 ,}6F ,mT , b ,ip ,~ ,On , ,> ,Et ,\î ,1cɮ ,%Ϯ ,Oqծ ,>`ۮ , , ,a. , ,0 ,v4 ,8> ,.H ,HY ,I_ ,3e ,k ,eq ,% ,˯ ,Pѯ ,%ׯ ,ɜݯ ,F ,( , ,_  ,G( , ,S& ,1  ,s ,Q ,M ,% ,p+ ,&1 ,L{7 ,c;= ,FC ,.I ,[O ,aU ,o[ ,a ,!g ,m ,Es ,iy ,lq ,  ,º ,) ,/' ,' , ,tr ,J ,l> ,@ ,^ ,Wǰ ,AͰ ,9Ӱ ,}ٰ ,T߰ ,8 ,G ,K , ,X ,? ,H.  , , ," ,a! ,2' ,ߌ- ,O3 ,H$9 ,? ,|E ,&K ,Q ,IW ,%] ,c ,рi ,o ,qu ,xG{ , , ,K , , , , ,B ,= , , ,=ñ ,4^ɱ ,ϱ ,.ձ ,h۱ ,6 ,  , ,. ,/ ,m , ,  ,P' , ,* ,fs# ,*) ,M/ , 5 ,`F; ,tE , O ,*s ,w ,2 , R ,̲ ,/ٲ ,D , ,t ,$ ,SR ,x_ ,]Bw ,Qs ,P , ,ɳ ,)C , ,Y  ,L$ ,+H1 ,9I ,'V ,&n ,| ,O  , ,> ,UV ,ÙǴ , Hմ ,] ,6 ,  ,? ,  ,G/ ,I> ,@M ,de\ , k ,Fz ,a , ,@ ,r ,ۊŵ ,Ե , ,z , ,T , ,W. ,= ,_pL ,[ ,j ,σx ,+ ,I ,%U ,"¶ ,FYܶ , , , ,Em ,-|" ,0 ,#@g ,Qsu ,P , , ,)Cҷ , ,Y ,L ,+H! ,99 ,'F ,&^ ,l ,O { , ,> ,UV ,Ù , HŸ ,]Ը ,6 ,  ,? , ,G ,I. ,@= ,deL , [ ,Fj ,ay , ,@ ,r ,ۊ ,Ĺ ,ӹ ,z , ,T , ,W ,- ,_p< ,K ,Z ,σh ,+| ,I ,%U ," ,FY̺ ,ں , , ,Em ,-| ,  ,#@\ ,.y ,q ,[ ,- , ,v ,u ,x ,W ,:o* ,nX ,h ,&n ,Wt ,Tz , , , L ,e ,}H ,P ,  ,E1 , ,4¼ ,*ȼ ,]Uμ ,L8Լ ,}ڼ ,eo ,U ,0: ,y , x ,~ , ,(  ,V= ,L ,k ," ,E(( ,. ,.4 ,}: ,h@ ,hF ,bL ,{/R ,byX , ^ ,,d ,vj ,'p ,:w ,@ ,6V ,& ,> ,B ,! ,h , ,S , ,DBĽ ,Yʽ ,н ,O*ֽ ,|:ܽ , ,M ,V ,%T , , ,D4 ,(  ,B , ,a ,$ ,* , V0 ,B6 ,s4< ,ÁB ,H?H ,,N ,OUU ,f ,)l ,;r ,Wx ,97~ ,* ,U ,R ,- ,  ,n , ,_ , ,7 ,0 ,ƾ ,@̾ ,*Ҿ ,ؾ ,(޾ ,D ,s ,T , ,s ,*N ,X ,= ,z ,S ,  ,Y& ,, ,j2 ,528 ,> ,a4D ,؄J ,P ,~V ,?@\ ,b ,bh ,Wn ,t ,9z , ,: ,2 , ,1 , ,F ,JL ,OS ,۟ ,` ,¿ ,ӿ ,- ,I\ ,0 ,/  ,i4 ,7' ,`~5 ,XC ,;Q ,6_ ,=}m ,{ ,K ,  , ,R ,S ,D ,  ,$ ,Q3 ,B ,Q ,` , n ,| ,B , , ,  ,= ,F ,=a , ,nL ,X. ,. ,?< ,KJ ,X ,%f ,%ot ,I , , ,[ ,Ӫ ,= ,P ,L ,w ,X  ,O ,Ap& , >4 ,t-N , 6] ,k ,y ,O ,d@ , , , ,R ,¨ ,3  ,D  ,'*9 ,7G ,z$U ,c ,q ,0? ,^ ,n , ,G ,+ ,a ,AO , , ,' ,94 ,A ,hN ,2l ,z , , , ,O ,d@ , ,M ,  ,¨' ,5 ,3C ,tHX ,)g ,Iv ,z ,`A ,| ,7 ,/ , ,s ,6 ,U  ,s+ ,a9 ,m ,{ ,O ,9 ,5 ,i ,' ,7 , ,d@  ,& ,x5 ,#N ,Ig , , ,+ ,m , ,/ ,$p ,I  ,$ ,1 ,O ,'*h ,w ,~ ,) ,m , , , ,'* ,0 ,= ,/K ,AX ,kr ,p6 ,R ,¨ , ,Q ,L , , ,n)0 ,O ,n)h , ,n) , ,7 , , , ,F , ,1 ,@D ,OR ,z@` ,s ,S ,* , ,U ,: ,i ,t ,% , ,Rh ,i , ,Rh* ,U8 ,,F ,"U ,4b ,W ,>| , ,  ,H ,O ,m ,  , ," , 1 ,tZ@ ,;O ,h^ ,`m ,| ,sP , , ,T% ,x , ,: , ,%o ,+ ,&9 ,YG ,#c ,>x ,G ,U , , ,9 ,EC , ,͘ , ,;  ,]% ,XX2 , @ ,O ,Y ,c ,Km ,ow ,] , ,o ,k ,' ,^ ,J ,  ,89  ,F4 ,A ,"h ,# , ,ג ,X ,  ,+ ,Sa , ,# ,|:1 ,[? ,Oc ,b1 , ,) ,Cy ,P9 ,J ,Z ,+3 ,p@ ,i%M ,@Z , mg ,'It , , , ,M} ,6 ,i ,Q ,- ,:0 , ,W ,>$ ,z2 ,N@ ,N ,r\ ,{vj ,m?x ,g ,jm ,3 ,B ,+ ,~ ,5 ,[B ,O ,G\ ,u , ,V ,K= ,8f ,j ,i% ,D ,0V ,f , ,Ӑ  ,w ,"& ,4 ,B ,7#P ,^ ,l ,z ,' ,+ ,e ,T ,d , ,V , , ,w  ,1' ,|5 ,C ,?Q ,sv_ ,Pm ,{ ,\ ,G ,Q , ,T ,\ , , , V , Q# ,1 ,JN? ,vM ,\ ,Іj ,_x ,y ,Gl ,]N ,H ,a$ ,)} , ,i ,C) ,|8 ,iG ,V ,Ne ,| ,& ,| ,3b ,X , ,?9 ,^ ,s  , ,V' ,A5 ,C ,qQ ,?_ ,-m ,4U{ ,@ ,| ,) , ,!9 , ,6u  ,3 ,:H% ,v2 ,A? ,:L ,|QY ,ef ,s ,; ,pi ,V ,H , W ,8v ,i% ,X  , ,@# ,0 ,>r= ,J , W ,d ,<)r ,f ,  , , ,m ,  , ,& ,  ,> ,n ,- ,C ,S  ,7 ,dt , @ ,# ,K= ,.;S ,Ol ,- ,RC , ,J> ,> ,@ ,  ,&V ,& ,ih ,) ,@( ,U5 ,:C ,j ,w ,P ,f  ,I7 ,vS , ,3 ,[h ,:H ,c ,H ,Ԯ  ,N ,& ,3K ,X ,e , ~ ,\ ,/ ,T ,( ,8 ,@ ,P ,vz ,GP , ,i ,  ,m ,#X ,ǥ , ,$ ,1 ,8I> ,K ,CzX ,{e ,.@r ,UQ , ,bv , , ,z ,` , ,:N ,{ ,s. ,K` ,F ,( ,5 ,B ,jgO ,/\ ,i ,jv , , ,S , ,!( ,8 ,E  , ,H , ,  , ,W% ,O3 ,5A ,O ,)9] , ,B ,WW ,]\ ,- ,I\ ,0 ,/ ,  ,i4# ,1 ,`~? ,=}M ,[ ,Kw ,; ,| ,MW ,[ ,K& ,% ,b: ,J ,n ,  ,g ,(& ,j ,ATz ,[ ,dE , ,< ,4; ,Ó , ,wR ,(E , ,L! ,/ ,= ,K ,Y ,g ,8u ,LD , ,Q ,B ,) ,! ,P , ,ߐ ,a , ,- ,J+ ,i29 ,OG ,0U ,`c ,]0q , ,, ,  ,u ,q1 ,? ,$ , ,$ , ,3  ,: ,j; ,mJ ,JAY ,*kh ,Ww , U ,a ,A< ,0 ,2s ,| ,9 ,]\ , ,V ,+ ,WD: ,I ,nX ,[g ,8v ,6L , ,/ ,G ,;' ,m ,-} , ,  ,Z ,I ,. ,= ,[E ,Z ,  ,,2 , , ,fQ ,C , ,c , , ,w7 ,h0 ,GJ ,W ,gPd ,W{ ,K# ,H ,c ,- ,>| , ,<)  ,q1 ,&) ,7 ,E ,J^ ,o ,+ u ,9{ ,7 , Y ,p ,K ,^, ,Wz ,  ,X+ ,R , ,8 ,+ , , ,N , ,$A ,D , ,N ,` , ,{ ,1 ,A ,Gc ,& ,;4 ,v ,O ,W ,S ,*L ,x ,y , , ,QK , ,z  ,R ,) ,J7 ,E ,z;S ,Cur ,* ,c% ,| , , ,W ,<) ,P! ,_/ ,>|= ,jL ,r[ ,Mj ,C , ,W} ,d ,Q ,VR , ,9 ,[ , ,$( ,I56 ,kD ,{R ,Ea ,ȋ ,l , ,! , ,  , ,E& ,L4 ,LB ,d ,r ,%! ,H ,О ,. ,- ,kZ ,h ,xW , ,<)C ,߅W ,Ra ,g , ,<) ,[ ,Ԋ ,  ,v , ,u ,]\0 ,E> ,=aj ,2x ,t , ,5& ,2s ,I ,Nm ,  ,W0 ,eA , G ,M ,GE^ ,c%l , , ,H ,P ,  ,] , ,y , , ,K ,P ,Չ ,  ,x , ,j ,η# ,Lb) ,) / ,ؗ5 ,; ,wA ,}G ,gN , ^ ,'d ,IOj ,M:p ,,v ,f| ,J- , ,c ,X ,c. ,X , , ,G ,2 ,# ,: ,3 ,g ,K ,m ,1  ,- ,u: ,G ,3T ,pDa ,Rn ,{ ,6 ,k , ,g ,K ,D ,m ,") ,5G ,C# ,,1 ,L ,Z ,Wh ,v ,s ,( ,]X ,  , 4 ,1 ,;G , , , ,7  ,. ,&?< ,&J ,X ,gf ,Kt ,D ,m ,, ,T , , ,pD ,R , ,6 ,F ,0<. ,x= ,L ,an[ ,*`k ,?y ,U , , ,VH , ,' , ,; ,6 , ,;R ,:! ,V/ ,P== ,5K ,SY ,-g ,)u ,? ,6= , , , ,$ , ,Og , , ,& ,z+ ,|=, ,3: ,gH ,KV ,d ,&?r ,ƭ ,g , ,l= ,(D ,M , ,D , ,L ,  ,Z3 ,* ,b9 ,H ,.W ,Sf ,Cu ,D ,A ,, , , , ,u , ,& ,  , ,s?) ,B8 ,G ,`HV ,e , qt ,s ,3 , ,*` ,yN ,2 , ,5 ,_ ,3M ,T! ,* ,8 ,; E ,c , p ,t} ,#1 , , ,hI ,] , ,C , - ,@ ,M ,c  ,R ,F[ ,% ,` ,` , ,*\  ,fW ,S ,P0 ,Z! ,R' ,- ,K3 ,9 ,Q? ,QE ,>9K ,S9Q ,OzW ,] ,Źc ,wi ,<o ,8u ,y{ ,5 , ,0 ,P , , ,EQ ,L ,6 ,% ,Y ,Y , ,l , ,xz ,ٞ , ,J ,+ ,Ż ,8 ,C ,EF  ,o , ,Y ,$2# ,) ,2/ ,w16 ,C ,UP ,^ ,k ,x ,ʠ ,@ ,5l ,` , , ,` , ,tj ,  ,H ,q ,4 ,o ,4  ,  ,\} ,! , ,<" ,@( ,. ,o4 ,s: ,j@ ,'F ,_L ,R ,@JX ,_ ,&m ,0v{ ,d? ,Mv ,@ ,0 ,X ,S , ,G , ,U ,P ,% ,3 ,A ,KO ,D] ,ؼk ,|y , ,~ ,H4 , ,u ,ǒ ,f{ ,' ,% ,I , ," ,>0 ,T> ,-9L ,k[ ,5i ,-w ,0 , D ,= , ,6 , ,OL ,D , , , , ,\+ ,A8 ,,E ,ğR ,(_ ,el ,cy ,D , ,,I , ,N , ,p" , ,  ,z ,> ,u ,o6 ,  ,  ,u5  ,  ,.  ,.  ,&  ,M,  ,2  ,8  ,]P>  ,ƉD  ,:SJ  ,{P  ,>V  ,E\  ,b  ,Xh  ,n  ,Ct  ,7~z  ,x@  ,G9  ,sL  ,  ,S  ,"g  ,+  , f  ,^L  ,s'  ,fW  ,M  ,G,  ,gO  ,1`  ,j  ,:  ,,  ,o#  ,^)  ,/  ,5  ,;  ,B  ,O  ,h\  ,i  ,Fv  ,g7  ,+  ,  ,  ,  , e  ,.  ,P@  ,XI  ,  ,8  ,^  ,;  ,  ,  ,:/"  ,3)  ,~%:  ,I@  ,UF  , M  ,^  ,d  ,Yj  ,ip  ,v  ,M|  ,*  ,e  ,S  ,D  ,2  ,(  ,  ,a  ,  ,7  ,^  ,  ,2O  ,>  ,G  ,O5  ,n  ,  ,¬  ,O  ,!  ,/"  ,  ,f  ,1  ,A  ,Z  ,0$  ,b*  ,=v0  ,qE6  ,=  ,M  ,==S  ,Y  ,_  ,=e  ,k  ,q  ,w  ,C~  ,  ,o  ,  ,!  ,$  ,  ,<  ,iX  ,C  ,4  ,]c  ,@_  ,K_  ,V_  ,_  , C  ,%  ,@)  ,76  ,6C  ,;{P  ,7]  ,Ƿj  ,w  ,b8  ,+J  ,3>  ,B  ,H  ,a[  ,  ,"  ,I  , , , ,P: ,f9I ,;X ,ag ,}&v ,[ ,X ,& ,Z ,D ,{D ,C ,T ,y3 ,E  , ,!+ ,M; ,RK ,[ , k ,-{ ,% , ,n ,>8 , ,T ,N , ,v ,g" ,41 ,/@ ,O ,RW^ ,xs ,[ ,K ,5 ,k ,@ ,2 ,/  ,/& ,}&4 ,B ,P ,U^ ,*l ,z ,h , ,C ,L ,Xq ,i ,3 ,= ,gB , , ," ,>$0 ,CT ,Fd ,j ,p ,9v , ?| ,O ,|J , ,6 ,l ,AH ,SV , , ,B ,7M ,3, , ,)r ,? , , ,O ,i , , ,\) ,96 ,y3C ,EP ,'] ,j , ,6 , ,&? , ,BO ,| ,uh ,~  ,*_ ,j$ ,G1 ,> ,K ,X ,Af ,t , ,4 , , ,{C ,{ , ,Q ,; , ,Ya ,g ,+ ,Y9 ,HG ,&=V ,‡c ,Yrs ,pA ,r , ,F , ,+ ,}& ,e ,   ,(' ,S5 ,pm ,E{ ,; ,  ,& ,mV , ,S ,B* ,gJ ,F ,:! ,U. ,; ,5H ,U ,ddb ,ro ,& ,"~ ,& , ,? ,@: ,) ,! ,Z% ,93 ,J A ,O ,+] , k ,cy ,9 ,: ,N- , , ,{ , , ,c ,jH ,{5V ,Zd ,4r , ,KG ,O ,8> ,s? ,S ,I] , ,;0 ,8 ,4+S5 ,:K ,W&a ,nm&w ,& ,A ,u ,o ,-4 , ,m ,A/ ,a[ ,bbB ,N W ,#d&m , ,> , ,@ ,2 ,Q ,· , ,Bi3 ,I ,_ ,Hu ,q , , , ,y ,n ,T%! ,34 ,mUW ,o ,1 ,> , , , ,  ,2*  ,/3  ,%b  ,t  ,C  ,e  ,7  ,   ,  ,2]  ,! ,/&(! ,%?! ,_! ,A)! ,t! ,E! ,bI! ,'" ," ,ɴ%" ,3-" ,EE" ,xK" ,/=`" ,F|" ,R" ,o" ,dB" ,mN" ,Px" ,e# ,># ,&6# ,9g\# ,;s# ,# ,# ,1# ,<"# ,d# ,"Q $ ,)$ ,)/$JF$JT$Jc$ ,MMn$`I$RJ$I$ /$ . F$ . F$ .#F$ .!F$ .5F$ .3F$ .EF$ .CF$ .5F$ .3F$ /$I% 2%I<% /M% .WFQ% .SFZ%Id% /p% .oFt% .mF}%I% /% .oF% .mF% /% .F% .|F%I% /% .F% .F%I% /% .F% .F% /& .F & .F&+J'& B& L&^JY&jJh& ,Wds&& ,U& ,v& /& ,U& .N* .2N* .N* .xN* /.* .N* .N* .1O* .-O* .SO* .KO* .O* .}O+ .P+ .O+=+ /`,+ .tP0+ .pP9+ /rF+ .PJ+ .PS+ /\+ .P`+ .Pk+=u+=+ .P+ .P+)@+ /+ .P+ .P+4@+N@+N@, .Q, .Q,a@, /), .Q-, .Q2,f@K,f@U,f@r, .+Qv, .)Q,f@,f@, .:Q, .8Q,f@,f@, .KQ, .IQ,f@,f@- .\Q- .ZQ-@- /-- .qQ1- .kQ:- .Q>- .QG-@Q- /b- .Qf- .Qk-@-@- /- .Q- .Q- .Q- .Q- /-@-@- .R- .R-@.@. .R. .R%.@/.@H. ."RL. . RU.@_.@x. .3R|. .1R.@. /. .DR. .BR.@.@. /. .SR. .QR. .dR. .`R. .zR. .xR/@$/@./ /;/ .R?/ .RH/ .RL/ .RQ/ /Z/@o// /# / ` /@/@/ .R/ .R/@/A0A0 .R#0 .R,0A60AN0 .RR0 .R[0Ae0A~0 .R0 .R0 .R0 .R0A0A0A0 .S0 . S0 .S0 .S0 .0S0 .,S1A1A)1 .NS-1 .LS61A@1AX1 .]S\1 .[Sh1Ar1A1 .lS1 .jS1A1A1 .{S1 .yS1A1A1 .S1 .S1A2A2 .S"2 .S/292V2 .SZ2 .Sc2m22 .S2 .S2 .S2 .S2 .S2 .S2 .T2 .S2=2=2@ 3A#3B83M3 W3 h3 w31>3 /*3 .+T3 .T3 .zT3 .lT3 /*3 .T3 .T3 .%U3 .#U3 .6U3 .2U3 .XU3 .NU38B3?4>> 4>>*4 .U.4 .U74 .U;4 .UD4 .UH4 .UM4H>e4T>o4T>4 .U4 .U4\>4y>4y>4 .U4 .U4y>4y>5 .U5 .U5y>5y>45 .U85 .UA5y>K5y>d5 .Vh5 .Uu5}>5 /X5 .V5 .V5 .3V5 .-V5 /X5>5>5 .WV5 .UV5>5> 6 .fV 6 .dV6> 6>96 .wV=6 .uVF6>P6>i6 .Vm6 .Vz6>6 /r6 .V6 .V6>6>6 /6 .V6 .V6 .V6 .V6 .V6 .V6>7> 7 /-7 .V17 .V:7 .W>7 .VC7 /L7>a7 r7 ~717 ` 7>7 /7 .W7 .W7 /7 .9W7 .3W7 /7 .zW7 .xW7>8 /8 .W8 .W#8>-8 />8 .WB8 .WK8 .WO8 .WT8 /]8 .Wa8 .Wl8 /y8 .X}8 .X8>8>8 .8X8 .6X8 .HX8 .FX8 .HX8 .FX88?8 /8 ._X8 .WX8 /9 .X9 .X9S?9 //'9 .X+9 .X49 .X89 .X=9 //F9 .XJ9 .XR9Xc9 r9`?|9 /B9 .X9 .X9 . Y9 .Y9 .(Y9 .$Y9 .CY9 .?Y9 /B9 .bY9 .ZY9 .Y9 .Y9|?9 /U9 .Y9 .Y: .Y : .Y: .Y: .Y": .Z&: .Y/: .#Z3: .Z<: .DZ@: .@ZI: .bZM: .\ZR: /U[: .Z_: .}Zh:|?r: /m: .Z: .Z: /: .Z: .Z: /: .Z: .Z:?:?: .Z: .Z:?: / ; .Z; .Z; .[; .[$; .[(; .[1; .)[5; .%[>; .C[B; .?[K; .[[O; .Y[X; .m[\; .i[e;?o; /; .[; .[;?; /; .[; .[;?; /; .[; .[;? <?< /%< .[)< .[.<?G<?Q<?n< .[r< .[{<?<?< .[< .[<?<?< .[< .[< .[< .[<B<B= .\= .\=B3=)B==)BZ= .\^= .\g=)Bq=)B= . \= .\=)B=)B= ./\= .-\= .>\= .<\=8B=8B= / > .R\> .L\> .~\> .x\%> .\)> .\.> /;> .\?> .\H> .]L> .]U> .,]Y> .(]b> .E]f> .C]o> .X]s> .R]|> .]> .{]> .]> .]>EB> /> .-^> .+^> .<^> .:^> /> .L^> .J^>JB>VB> /, ? .]^? .Y^? /A'? .{^+? .s^4? /S=? .^A? .^L?`BV? /eb? .^f? .^q?kB{? /u? .^? .^? /? ._? ._? /? .0_? .._?qB?qB? .B_? .@_? / @ .Q_ @ .O_@xB @xB9@ .b_=@ .`_F@ .r_J@ .p_S@ .r_W@ .p_b@Bl@ /}@ ._@ ._@ ._@ ._@ /@ ._@ ._@B@B@ ._@ ._@B@B@ ._@ ._ A /A ._A ._%A ._)A ._2A .`6A ._?A .`CA .`LA .$`PA ."`YABsAB}ABA .5`A .3`A .E`A .C`A .E`A .C`A .5`A .3`A .5`A .3`A .V`A .T`ABB .f`B .d` B .w`B .u`B .`B .`'B .`+B .`4B .`8B .`ABB[BBeBB~B .`B .`B .`B .`B .`B .`B .`B .`B .`B .`B .`B .`BBB /B .`B .`BCC /C .`C .` C .a$C .a.C,C8C,CUC .aYC .a`CBCqCvC CzC CSC CC H C( C( D ..aD .,a D( *D( BD .=aFD .;aOD .LaSD .Ja\D .da`D .baiD .yamD .satD:Da D x D,9D,9D .aD .aDF9D /D .aD .aE .a E .aE .aE .aE /%E .b)E .a2E .!b6E .b?EX9XE .;b\E .5bfEw9E .WbE .UbE9E .fbE .dbE9E /E .ybE .sbE /E .bE .bE9E /+F .bF .bF /+#F .b'F .b0F .b4F .b=F .'cAF .cJF .VcNF .NcWF .c[F .cdF9nF /BF .cF .cF /BF .cF .cF /TF .cF .cF:F:F .cF .cF /fF .dG .d G /xG .dG .dGJ:6Ge:CG;VGe:`Ge:}G .dG .dGe:Ge:G .dG .dGe:Ge:G .dG .dG;G;H .dH .dH;'H;@H .dDH .dMH;WH;pH .dtH .dHI;H /H .eH .eH .peH .^eH /H .eH .eH .eH .eH ./fH .!fH .xfH .rfHI;I /I .fI .f!I /*I .f.I .f7I /@I .fDI .fPIR;ZI /kI .foI .fyI /I . gI . gII;Is;I;I >I!>J @5JAPJaJ pJ#<zJ / J .-gJ .#gJ / J .`gJ .^gJ .wgJ .ogJ .gJ .gJ .gJ .gJ .gJ .gJ .)hJ .!hJ3;K=KU=K#<%K /26K .Th:K .PhCK /2LK .nhPK .jhYK /DbK .hfK .hrKu<|Ku<K<K /VK<K /fK=K /yK .hL .hL =L=(L=EL .hIL .hNL$=gL$=qL$=L .hL .hL=L=L .hL .hL=L=L .hL .hM= M=#M .i'M .i3M"A=M"AZM .i^M .igM"AqM"AM .$iM ."iM"AM"AM .3iM .1iM .BiM .@iM1AMDAMDAN .RiN .Pi$NLA=NYAGN /XN .ai\N ._iaN^AvN@<NM=N=NANTAOnAO&O 1O<IO^O 8 hO }O  O O O ,4O ,;O ,U$P ,}7P ,}FP ,}UP ,=[P/rP ,U}P .viP .niP .iP .iP ,2P .iP .iP /P .iP .iP/P/P ,}P .iP .iQ/Q ,}#Q .i'Q .i-Q/BQ ,}MQ .jQQ . jWQ/fQ ,qQ /|Q ,UQ .%jQ .jQ ,Q .gjQ .WjQ ,Q .jQ .jQ ,ddQ .kQ . kQ ,bbQ .tkQ .dkQ .kQ .kQ ,@Q .kR .kR ,R .olCR ,&MR ,rSR7]R ,V6cR 7qR ,M~R R ,&R"Rd5R ,R .lR .~lR ,.R .lR .lRd5Rd5S .lS .lS .lS .lS .l S .l)S .l-S .l6Sd5@Sd5YS .m]S .mfS .mjS .msSd5S .*mS .&mSd5Sd5S .EmS .CmS .VmS .TmS5S5T ,T .hmT .dmT ,.&T .m*T .m/T6PT /YT ,dT .mhT .mmT ,.xT .m|T .mT=6T ,T /T ,,T .mT .mTN6T ,Y0T .mU .m Uz6U /&'U .m+U .m4Uz6IUz6_U~6iU /6U . nU .nU .nU .nU6U6U6U .9nU .7nU6U6U .JnV .Hn V .[nV .YnV6!V69V .kn=V .inFV .|nJV .znSV6]V6uV .nyV .nV .nV .nV6V6V .nV .nV .nV .nV6V /FV .nV .nV6 W /aW .oW .o&W60W /a=W .'oAW .!oJW .FoNW .BoWW6aW /anW .`orW .\o{W .zoW .voW .oW .oW /aW .oW .oW6W6W .oW .oW .oW .oW6W6 X .oX .oX .oX .o%X6/X6HX . pLX .pUX .pYX .pbX6wX .+p{X .'pX6X7X /qX .JpX .FpX /X .bpX .`pX)7X27X:7Y6+Y 78Y7EY7]Y?nY Y ,'Y ,} Z ,} Z ,}3Z ,}BZ ,}QZ ,oWZP.yZ .p}Z .opZ^.Z /Z .pZ .pZ^.Z^.Z .pZ .pZ^.Z^.[ .q[ .q[ .q[ .q[c.3[n.=[n.U[ .4qY[ .2qb[ .Cqf[ .Aqo[r.[.[ /[ .\q[ .Pq[.[ /[ .q[ .q[.[ /[ .q[ .q\ .q\ .q \.\ /$\ .r(\ .q1\ .$r5\ .r>\ .HrB\ .@rG\ /P\ .nrT\ .hr]\.g\.\ .r\ .r\ .r\ .r\.\.\ .r\ .r\ .r\ .r\.\.\ .r] .r ] .r] .r].-] .r1] .r:].U]._].w] .s{] .s] /] . s] .s].].].].].]. ^ ,܎^ ,53^ ,}C^ ,(N^%e^ ,Up^ .;st^ .-s^ .s^ .{s^ ,bb^ .s^ .s^ .s^ .s^ / ^ ,^ ,.^ .*t^ .t^%^ / ^ .Ut^ .St_ .ft _ .dt_ / $_%._%K_ .xtO_ .vtX_ .t\_ .tb_%_%_ / _ .t_ .t_ .t_ .t_%_ / _ .t_ .t_ .t_ .t_ .t_ .t_%` / ` .t` .t` .u"` . u+` .u/` .u4` / =` ..uA` .*uF`%l`&` &` / ` .Ou` .Cu`&` / ` .u` .}u`&` / ` .u` .u` .u` .u`&a / a .va .va .)v"a .#v+a .Ov/a .Ev4a / =a .|vAa .vvKa&Ua&qa .vua .v~a .va .va&a&a .va .va .va .va&a&a .va .va .va .vb&b .vb .v&b?&=bY&Vb , \bsb ,U~b .wb .wb .Hwb .@wb .~wb .zwb .wb .wb /b ,}b .wb .wbb ,}b .wc .w c]c]4c .w8c .wAc]Kc]cc .wgc .wpc]zc]c .wc .wckckc .xc . xckckc . xc .xdkdk)d .1x-d ./x9dyCdy`d .Bxdd .@xmdywdyd .Sxd .Qxdydyd .dxd .bxddd .uxd .sxe e%e .x)e .x2eg ,&gP g ,,g ,Mg` g ,&h"%h ,R0h /;h ,UFh .yJh . yYh .Ry]h .Hybh ,mh .yqh .yvh ,Sh .yh .yh .yh .yh ,(h .8zh ..zh .xzh .jzh .zh .zh .{h .{h .'{h .{ i ._{ i .O{iBE&i D0i /Ai .{Ei .{Ni / .{_i .{hi /qi .{ui .{iDiDi .|i .|iDi /i .|i .|i8Di /i .&|i .$|jGD jGD*j .7|.j .5|7j .J|;j .D|Dj .g|Hj .e|RjD\jDyj .v|}j .t|jDjDj .|j .|jEj\Ej / j .|j .|jaE kwEk /(k .|,k .|5k .|9k .|>k /KkEUkErk .|vk .|kEkEk .}k .}kEkEk .}k .}kEkEl .&}l .$}lEl /0-l .7}1l .5}6lEOlEYl /@jl .F}nl .D}wl .W}{l .S}l .p}l .n}lElEl /Pl .}l .}}l .}l .}l /PlEl m m 'm ` EnOEnWEnEn ,xn / n .~n .~n .d~n .V~ o .~ o .~o ,o .H!o .,0o .4o .:o ,[@o'Io ,&Ro / fo .jo .to ,Mo o ,&o"o'o'o .o .oo 0o ,Mp p ,&p")p ,M6p ?p ,&Lp"Zpi'dpi'p .&p .$pw'pw'p .5p .3p .Dp .Bpw'pw'p .Up .Sp .dq .b q .vq .rq}'#q}';q .?q .Hq}'Rq}'jq .nq .{q'q / q .q .q'q / q .q .܀q'q / q .q .q .8q .4q'r'9r'Rr'kr-r hrSr r ,Ir ,Us ,H!s ,&=Hs ,pUs ,Sbs ,is ,&ss s ,Ms s ,&s"s ,Ms s ,&s"s ,Mt` t ,&t"%t ,M2t ;t ,&Ht"Wt ,,ft ,,st ,Bt ,ږt ,t ,t ,,t ,yt ,t ,ct ,t ,G u ,U>u ,UKu ,}Zu ,}ju ,rpu /m{u ,Uu .Xu .Nu .u .u .ҁu .ȁu .u .u .Qu .Cu /u ,}u .u .v ,v /v ,,$v .(v .-v /2v ,Y0=v .Av .Hv /Qv ,}\v .`v .jv#,tv /v .v .v . v .v/,v[,v /v .(v .v /v .iv .Wv .ƒv .wg,w[,w[,8w .x,Hx,ax .ʄex .Ȅrx,|x,x .لx .ׄx,x,x /"x .x .x /"x .x .x .7x .)yy-y,y,:y .}>y .{Cy,\y,fy /?wy .{y .y /?y,y /Ty .y .y /Ty-y-y .܅y .څy-y- z .z .z-$z-=z .Az .IzxZz fz,z-z-z . z .z-z-z .z .z-z-{ .' { .%{C-"{ /i3{ .67{ .4<{H-U{H-_{H-|{ .E{ .C{H-{H-{ .T{ .R{H-{H-{ .e{ .c{H-{H- | .v| .t|<-0|e-H|y-n|-|-|| |-|-| .| .|- }-} /y&} .*} ./}-D}-[} ,;i} ,Uv} ,F} ,2} ,MV} ,}} ,}} ,}} ,b%~ ,&/~0 8~ ,@~ ,MM~@ V~ ,&c~"~ ,D~ / ~ ,w~ .~ .~ ,H~ .~ .~ ,&=~ .m~ .]~ ,U~ .‡~ .~ .~ . .  . .I .A ,&- ,M: C ,&P"_ ,}r ,} /  ,, .s .q . . . . . . . .! .% .. .È2 .7OY / j .؈n .Јw .{ . /  . . .3 .1ŀπ .B .@0. ? ,)E / P ,w[ .__ .Od ,Uo .s . . .މ . . .7 ./ ,& ,Ḿ ց ,&" ,} ,} /  ,,' .^+ .\4>W .n[ .ld .~h .|q .~u .| . . . . .ł .ʂ /  .Ê .  . . /  .  .)3K .O .Xbz .-~ .+ у ,0O ,; ,&&0 ,M=F ,&S" ^ ,G ,8v΄ ,Aۄ ,& ,M@  ,&"0! ,M.7 ,&D"(T ,˧ ,ޅ ,; ,&p ,$ ,6 ,}E ,GU ,Mbk ,&x"8 , ,U , ,& ,}# ,M09 ,&F"@Q ,#WHx .F| .: / ,} . .tH / . .Ç /чHۇH . .HH( ., .5H?HX .\ .eHH /( .4 .* /8 .j .f /Kƈ .ʈ .~ӈ /[HH ,@+4 ,U? .ՌC .͌R .V .f .'j .!o /*x , .B .@ /= ,G .Z .X /M , .n .jĉ /]ɉ ,Gԉ .؉ .߉j+ ,} . . + ,}) .- .3+G+b ,<| ,w , ,&ʊ0ӊ ,Mߊ ,M` ,&"X ,M' ,&4"PC ,MPY ,&f"Hq ,, ,) ,w ,H ,&= ,0H ,U ,;  ,&$ ,M1: ,&G"`V ,}i ,}| ,, ,, ,B ,ږ ,Ì ,ь ,, ,y , ,c  , ,G, ,,9 ,BF ,ږS ,` ,n ,, ,y , ,c , ,G , /  .ۍ .ˍ ,w .8 .(& .* ./ ,0H: .ˎ> .ǎM .Q .` . d .i ,Ut .sx .q} ,; . . ,& /  ,} .x .h ,Mʎ@ӎ ,&"h .ǐ .Ő#-O .ؐS .֐\ .` .e} /  . . /  . . / ȏ .?̏ .=׏ .Q .O /1 # .b' .^0 /C = .|A .xJ /U S .W .bl . . /g  .ɑ .ǑƐ /w א .ڑې .ؑ . .+$ / ,.U ,ub ,eo ,; ,} , / .( . ,3ȑ .̑ .ё ,>ܑ . .ԓ ,& ,M@  ,&"p$C0. /)? .C .H /)U . Y .b .f .oo .˕s .Õ| . . .T .P .y .k .і . .+ . .o .gʒ .Β .ג .ے .2!4 4 C0C02 .T6 .R? .cC .aL .uP .qYM0cM0{ . .M0M0 . .j0ē /sՓ .ٓ .0 / .Ƙ .  . . / .! .* /7 .#; .E0^ .Bb .@h2{;3 / .Q .O .` .^ / .p .n@3הP3 / . .} . . / .ə .ÙZ3(Z3@ .D .MZ3WZ3o .s .i3 . .i3i3ɕ .#͕ .!֕ .3ڕ .1 .3 .13  .F .B .c ._% .) .~2 .6 .? .C .L3f3p3 .ٚ .ך . . . . .ٚ .ך .ٚ .ךʖ .Ζ .ږ33 .  . . .}4& /7 .*; .(D .;H .9N2l34!4)4˗  2 Yj P1 / .` .H / .֛˜ .̛˘ .Ϙ .ؘ .ܘ .| .؜ .̜ . . .[ .A2%1/1L .՝P .ӝY .] .f .j .s#1}#1 . .#1#1ę .#ș .!ԙB1ޙ /> .2 .01 /N .E .A% .a) .]. /N7 .}; .wD /cQ .U ._1x .| .%21212Ú .Ξǚ .ʞ̚9222  . .2#2< .@ .I2S2l .p .|22 . .2ś2ϛ2 .& .$2N4 /s) .9- .32 /s;b4E /V ._Z .Y_ /lo4vo4 . .o4o4 .Ü .̜o4֜o4 . .  Z4/1R1v222^ѝ :01  X7 ,4Q , ^ ,Ml , ,;՞ , ,G ,06( ,U! .؟% .4 .8 .{G .٠K .͠Z .^ . m .Wq .1 . . , .{ .c ,; . . . .ӟ)ܟ /= , .Z .T /O ,G  .  . / ,( ., .1 /: ,}E .I .O /T ,G_ .c .n(x / . .  / .. .& /+ . .Ƞ8(Ҡ8( . .?(?(  .$ ..(8 /aI .M .R /a[ .Ԥ_ .Ҥh(r /s~ . . . . /s .% .((ա .P١ .N(( .a  ._((5 .r9 .pE(O /` .d .i())) .Ţ .ʢ)G)G)  . .G)!G): .> .GG)QG)j .Υn .̥z * * .ߥ .ݥ * *ѣ .գ .ޣ * * . .6* /, .0 .5A*NJ*X /i .#m .v .Bz .: .m .i / . . . .g*g*֤ .ڤ .g*g* .Ʀ  .Ħ* // .٦3 .զ< /I .M .V /g*q* . .** ..å .,ͥ*ץ* .? .=* *) .P- .N7+A+^ .ab ._k+u+ .p .n++ . .ʦ+Ԧ+ . .++% .) .. +C[*d+n+ . .++ .ç .ȧ+ҧ+ .ԧ .ҧ(~)')4)I ,[ ,U ,t& .Ĩ .Ө .>ר .4 .s .m /u  ,} . .''8 .ߨ< .ݨA 'Z'd / u .y .~''-'ȩG' ,T /M  . . .O .C ,U* .. .3 ,F> .B .Q .U .e .@i .8n ,&| ,M  ,&" ,Ѫ ,,ܪ .i .g ,Y0 .z .v ,M ( ,&5"x? / H ,S .W .\ / a ,Gl .̪p .ʪ{ . .ܪҫ .֫ . .&  .$#; .5? .3MW /c c .Dg .Bq /c  .S .Qάج /s  .b .` .q .o /s  .  .(!(> .ʫB .ȫK(U(m .٫q .׫z(( . .((ͭ .ѭ .ޭ,, .  . 4#+8 0LQ] `s ,ME~0! ,U . . .9 .5Ǯ .Wˮ .Qڮ .{ޮ .u /  ,} . .y# ,}! .% ./!9 / O .S .X / a .e .ڬn .r .{ .R .F . ."`#!ί .ү .ۯ .ޭ߯ .ҭ!! . . $!.!G .<K .:T .NX .La .Ne .Lp /7 } .e .] /G  . .! . .ɰ!Ӱ! . .! /W  .# .,!6!S .W .` .d .m .q .{ /i  .4 .2"" .F .DDZ"ѱ" .U .S"" .f .d&"0"I .wM .uZ$"d$" . .,",","ʲ .β .ײ .۲ . . .=" /{  .į .¯ .կ .ѯ'="1="I .M .V .Z .c . g . q="{=" .% .# .4 .2 .E .A ._³ .[dzM"b"" /  .v$ .t- .1 .6 / ? .C .N"X / i .m .r" / " &Bȴ / մ7#ߴ7# . .7#>#1`#;`#X .İ\ .°ah#zh#h# .Ӱ .Ѱh#h#ѵ .յ .޵h#h# . . /  ." .+#5#R .<V .:_ .Kc .Il .Zp .Xz /  .l .j$$ .~ .|ƶ .ʶ .Ӷ .׶ .>$>$ .DZ  .ű>$>$8 .ر< .ֱE>$O>$h .l .tJ#y#y!ȷ ,Vڷ ,U  ,J ,F@ ,M ,.` ,,s ,{ , , ,, ,Y0ʸ ,ظ ,G , ,G ,J&B& ,J6 ,?< /eG ,<)R .V .e .ii .Wx .ɲ| . , .* ." .[ .O ,& , ,\Fȹ /|ѹ ,}ܹ . . ,M  ,&"4F&4FC .G .L .G .K .T . X .a .e .n .Tr .P{ .j .h .z .xG / . .ÿGͿ /ڿ .޿ .GG . . G9GC /T .X .a .ݸe .ٸj /wGG . .GG .  . GG . . GG- ./1 .->HH /ZHsH} / .A .? .P .N ._ .]H&H / .p .l /;H % 1 B ` W;Ha;H~ . .pHpH . .xHG`'Hg ' 2wFVFsFEH_HE  p  , @  . . . .# .%' ., ,7 .Y; .UK .rO .n_ .c .lX vX  . .] e e   /  .׺ .Ӻ   = .A .F _ i  . .  ! , ,=Q  ,(& ,4 ,}I ,:1T /i .m . r ,(} .P .B . . . . , .޻ .ܻ ,& ,M ,&" ,M  ,&#"17; /L .P .U /b .(f . o7y / .Y .U .| .x / . . 7 / . . . .ڼ /776 .: .C7M7e .i .r7|7 .$ ."77 .5 .37 / .F .D77 /&. .U2 .S; .f? .bH .L .}Q7r7| /6 . . . . /68 c ` 8 8' .Ƚ+ .ƽ4 .ؽ8 .ֽA .E .J8bN8l /K} . . . . .+ .' .I .C .j .d . . . . /K . .N8 /a .о  .̾ /t .# ., /5 .9 .DP8NP8f .$j ."uW8 / .3 .1 .C .A .R .P .e .a . .{ . . . .t8 / . .p8 /, .ʿ0 .ȿ>8Vk {3  ,W . .ٿ , .  . .* ." .V .P ,H<, ,}>H / Y .] .b| /-    . . . . !%I/ /= @ .D .IN^ :v , / . . . . ,}4 /) .C- .?24K4U /f .cj .]o /| . .4 / . . . . / . . 44 . .5- ,W ,&ao ,}~ ,M@ ,&" ,k ,  ,  ,U' .+ .: .(> . M .RQ .L` .td .ni ,t .x . ,}? / . .DW /  . .\ R, ,7N ,UY .] .l .%p . .e .Y . . . . , . . ,; .= .9 ,e .W .Q / ,} . .u /! ,, .0 .5 /: ,GE .I .T^ /qo .1s .-| / .I .G / .b .`   .t .rK / . ./ .3 .<F^ .b .ku . . . .p ,Ŋ$# .' ., ,F9 ,JD .H .M /A V ,a .4e ..j /S p ,G$ /1 $(% /e  .r .l . .-% /|  . .-%' / 3 .7 .A-%K / [ ._ . d / m .2q ..v6%B%B% .I .G .X .VF%b% / g%q%+ , v9 ,FF ,J` ,Y^r ,F ,J ,4R , /1  .q .e . .& /F  /F &  /`  .  .% /` 2&<&U .Y .b&l& . .&& . . & ,k ,( ,8 ,(E ,&O] ,Mjs ,&" ,M@ ,&" ,,+ ,&p ,M ,& " ,y< ,J ,G[ ,ia .- .% ._ .S ,; . . . . ,* . . /Q , . . /a ,G .F  .D /0 .Z4 .V= /J .|N .pW //h0r /A~ . .DD . .[[ . . ."" . + .5/ .15C , X[ ,Ux , ,OL ,  ,| ,V ,A , ,; ,. ,E ,Ai ,u ,; , , ,G ,4 , ,# ,ہ@ ,M ,G\ ,Sy , , ,D ,A ,! ,? ,jzP ,] ,fR{ , / ,1 ,H , ,>| , ,: ,>|  , ,J) ,?; ,>|H ,3V , ` ,Qr , ,vK ,& ,| ,>| ,n9 , ,7 ,> ,G  , ,uM' ,{n5 ,<)B ,1P ,#a ,5m ,Vz ,D6 ,5 ,3 ,5 ,$ ,A ,O ,? ,O8 ,FR ,Ph ,Ou ,/ ,O ,M ,|8 ,^T  ,4 ,&' ,b@5 ,&C ,U ,&c ,$u ,Py ,VD ,c- ,D ,q ,)  ,X` ,vO: ,VT ,Rn ,[  ,SK ,<, ,^ ,G ,7 ,uQ ,z ,c , ,# ,W  ,> ,B ,Y ,p ,Q ,D ,  ,>| ,G , ,B  ,$L ,$ , ! ,/ ,= ,ϲK ,^ ,m ,| ,3 ,' ,S ,l ,R , ,q ,B) , ,  ,ɴ ,F% ,2 ,<D ,>|Q ,G^ ,B p ,%~ ,8 ,Q ,j , , , ,α , ,& ,Q ,^7 ,0fH ,U ,zf ,W}r ,>|~ ,- ,sE ,N ,CL ,:  ,% ,W}7 ,(RM ,>|_ ,u ,>| , ,>| ,t ,sw ,  ,7) ,-4 ,W}A ,#] ,W}i ,Ev , ,W} ,` ,{ , ,/ ,/ ,/ ,/ ,' ,/4 ,G ,S ,8` ,l ,8y , , R ,2 , , , ,3 , R ,2 , ,9 ,80 , R< ,2J ,M<g , Rs ,2 ,YI ,/ , , ,} ,>| , ,# ,>| ,/ ,>|A`$\ .U` .Ine$xe$ . .e$e$ . .e$e$ . .e$ w$* / 7 .; .@ / I .M .V / c .g .p /! }$$/ .P .J .t .n . . / . ./* .. .8{ ,ܫ ,c ,p2 ,g| , ,}, ,,31 ,A? , ,a ,( , ,=: ,o , ,3 ,_ , ,>  ,;, ,%8 ,D ,-5P ,.;h , {o ,t ,J ,L ,CM ,3 ,Cz , ,˶ , , ,no ,S[ ,{ ,y ,p ,$( ,u4 ,E , Q ,h] ,i ,u ,W ,Q ,vl , , ,am , ,x , ,Q , ,rX ,au0 ,= ,ÑK ,gX ,rXe ,3 , ,rX , , , ,uf ,2 ,o ,m" ,W/ , < ,I ,bV ,c ,p , ,: ,!\ ,-$ , ,i ,t ,7% ,aL ,] , ,D ,<2 ,>^  , ,k ,  ,' ,q. ,5 ,=< ,C ,'J ,ZQ ,X ,M_ ,Rf ,wn ,+{ ,< ,d ,)2 ,k , ,  , ,Ɵ , ,2 ,< ,d* ,7 ,5T ,.a ,v$n ,zd| ,f ,zd ,bV ,} , h ,v$ ,bV ,} ,C ,v$ ,m|  , ,Y:8 ,VmH ,[N ,;T ,QeZ ,S` ,df ,ul ,+r ,>x ,i~ ,R , , ,0 ,M , ,v ,c , , ,D ,ho ,_ , , ,Ql ,fl ,_ , ,+ , ,o ,] ,\W ,  ,Z ,V  ,}s& ,?, ,2 ,t8 ,> ,[D ,J ,P ,V ,h\ ,|b ,h ,zn ,[t ,~z ,~ ,xo , ,] ,c ,z ,! , ,% ,e ,{ , ,] ,* ,1 ,c3 ,@ ,N ,Ap\ ,kj ,x ,  ,r , , ,u , ,n ,Dr ,T , , ,! ,/ ,'{= ,L ,mZ ,=h ,#v , , ,{ , ,7 ,I ,` ,p ,r  ,u# ,81 ,P? ,3{N ,v\ ,j ,#|x ,r ,x , ,d , , , ,9# , ,@! ,b ," ,80 ,> ,ҩL ,Z ,^i ,w ,= ,l ,q , ,  ,\ ,Mw ,V/ ,{ ,H , ,62 ,C ,?I ,d O ,:nU ,i\ ,j ,x ,[ , ,ym ,ڻ ,k ,/  ,Yz , ^ ,7 ,} ,# ,{1 ,? ,pM ,[ , jk , , ,l ,< ,Y ,^ ,ݼ ,o, ,eA ,!N ,u ,k ,6 ,r ,S ,SV ,i ,> ,y ,[ ,- ,1M ,C ,| ,, ,9 ,ZF ,hT ,Np ,~ ,:f ,_ ,a ,:  , ,w, ,rX ,i ,@ ,%`  ,)  ,*6  ,uJ  ,g  ,$  ,~b  ,$f  ,   ,  ,  ,v  ,ȇ  ,j  ,   ,Z!  ,1  ,;$7  ,=  ,C  ,OJ  ,W  ,_q  ,`~  ,4V  ,y  ,v  ,6T  ,8  ,!h  ,O  ,i  ,x#  ,<0  ,ZW  ,j  ,5x  ,^m  ,  ,Eh  ,-  ,]  ,EA  ,r  ,  ,\  ,  ,  ,E  ,1.  ,<  ,TJ  ,X  ,vf  ,Ft  ,1M  ,  ,K  ,  ,  ,M  ,z  ,  ,q  ,zi  ,  ,Bj  ,i*  ,^8  ,gM  ,VZ  ,ng  ,ht  ,_  ,Z  ,l  ,C  ,_  ,b  ,  ,x  ,b , ,I ,q ,m , , ,w ,^  ,77 ,. ,; ,' ,X-! ,ZA ,N ,[ ,7h ,=v , , ,C ,(p ,i  ,g ,o) ,L ,^ o ,c{ , , ,? ,l , ,' , ,Z* ,d7 ,YE ,1R ,^_ ,|)l ,z ,d , ,j , , ,  ,f ,t , ,Z  , ,n% ,$3 ,-A ,O ,] ,"k ,)y , ,v ,q ,^U ,K ,C , ,F: ,M' ,26 ,d4E ,T ,c ,Zs , ,v ,rc ,v ,\ , L , ,th ,n ,?  , ,[' ,6 ,GE ,&%T ,c ,$r ,:` ,z ,V ,H] , ,#u , , , ,\{ , ,Ae& ,j5 ,JD ,eb ,q ,` , ,e ,k- ,F ,= ,q ,G ,  ,G  ,@ ,W* ,x: ,mJ ,Z ,j ,z ,r ,Z ,6J , , , , ,s , ,owM ,oT\ ,k ,Fbz ,v ,0 , , ,! ,L , , , ,z ,  ,U/ ,c]> ,*M ,] ,l ,c{ , , ,^ ,  , , , ,I ,=q  ,  ,H  ,{/  ,F>  ,FM  ,\  ,1Ak  ,%z  ,  ,  ,Z  ,  ,  ,J  ,  ,Y! ,T! , ! , /! ,B>! ,0M! ,Wg\! ,k! ,z! ,! ,E! ,C! ,&! ,! ,@! ,V! ,{! ," ,t" ,K#" ,=2" ,B" ,hQ" ,w" ,Bs" ," ,I" ,(O" ,._" ,X# ,# ,  # , <# ,kJ# ,]X# ,f# ,-t# ,# ,d# ,&]# ,# ,# ,y# ,$ ,D{$ ,z<$ ,Q$ ,z_$ ,hQs$ ,[$ ,v$ ,$ ,$ ,z$ ,$ ,$ ,d$ ,$ ,b% ,{% ,g% ,*% , 8% ,Q% ,d^% ,~k% ,i~% ,W% ,[% ,% ,|[% ,p% ,% ,rX% ,p& , & ,4& ,D& ,J& ,GCP& ,oV& ,B\& ,Fb& ,Qh& ,n& ,"&t& ,*z& ,& ,->& ,& ,h& ,`& ,u& ,Y& ,W& ,& ,B& ,s& ,_ ' ,^k' ,D'' ,:6' ,TJE' ,gT' ,dc' ,^r' ,`' ,' ,dj' ,' ,' ,' ,/' ,{g' ,w*' ,( ,u( ,&( ,5( ,kD( ,_\S( ,eSb( ,d*q( ,o( ,*( ,Pl( ,R|( ,m8( ,( ,( ,[e( ,( ,_) ,Z) ,2&) ,5) ,lE) ,UT) ,c) ,{r) ,) ,q) ,) ,;) ,) ,=) ,^) ,n) ,Y* ,* ,#* ,Y* ,* ,N0+ ,F <+ ,Y+ ,m+ , + ,+ ,+ ,t+ ,m , ,_s, ,, ,, ,, ,, ,r, ,, ,, ,c - ,c- ,)- , 7- ,aV- ,Tqf- ,pu- ,- ,- ,L- ,- ,- ,Rm- ,- , . ,6u. ,W'. ,Ti5. ,C. ,@_. ,4o. ,3z. ,?v. ,D. ,i. ,iu. ,@. ,B#. ,. ,_/ ,#/ ,6u#/ ,H1/ ,H?/ ,GM/ ,b/ ,o/ ,v|/ ,W/ ,p/ ,Y/ ,7@/ ,rX/ ,70 ,p <0 ,F0 ,R^S0 ,`0 ,J!m0 ,*z0 ,Ñ0 ,n0 ,rX0 ,0 ,s@0 ,"0 ,&1 ,%1 ,+1 ,i11 ,A1 ,[1 ,Zh1 , u1 ,1 ,1 ,@1 ,W1 ,%1 ,b1 ,1 ,j1 ,2 ,n)2 ,W62 ,qC2 ,yP2 ,b]2 ,k2 ,~2 ,l2 ,a2 ,2 ,: ,T: ,q: ,~: ,>q: ,: ,: ,>H: ,l: ,b: ,: ,; ,Y; ,(; ,Z5; ,\B; ,,O; ,]; ,Yq; ,}; ,; ,; ,D4; ,D; ,q; ,N; ,Cc; ,j< ,< ,b< ,8,< ,NX9< ,'G< ,Da< ,n< ,C{< ,S< ,kz< ,_< ,y< ,1< ,< ,S< ,W< ,= , = ,\= ,A;(= , 5= ,B= , pO= ,\= ,i= ,+v= , = ,/8= ,aa= ,i= ,`= ,= ,= ,j= ,v= ,C > ,O> ,^&> ,6&4> ,A> ,?=N> ,J[> ,hh> ,Zu> ,`> ,> , > ,> ,gd> ,fu> , > ,u> ,,> , ? ,]? , (? ,1M6? ,Y? ,|? ,:]? ,? ,1? ,q? ,1M? ,!? ,^? ,L? ,-? ,M? , ? ,'g? ,  @ ,&@ ,Z7@ ,1E@ ,qS@ ,b@ ,Aep@ ,~@ ,@ ,5@ ,(@ ,lm@ ,t@ ,u@ ,'@ ,@ ,]h@ ,I2 A ,fA ,(A ,O6A ,xDA , RA ,}aA ,qA ,oA ,<@A ,A ,:A ,A ,A ,3A ,bA ,/A ,{A ,* B ,ˆB ,'B , 5B ,@CB , QB , s_B ,mB , y{B ,tB ,rtB ,B ,&_B ,)iB ,ZB ,B ,jB ,qB ,C ,mC ,VL&C ,45C ,lfCC ,]QC ,_C ,%mC ,{C ,fC ,pC , C ,qC ,VC ,C ,C ,RC , C ,n1D , D ,Y#D ,Т1D ,6?D ,abD ,ТlD ,7-zD ,D ,{^D ,D ,D ,D ,{D ,qkD ,<E ,{E ,%E ,3E ,AE ,OE ,]E ,kE ,"yE ,lfE ,ZE ,žE ,~hE ,E ,:E ,CE ,E ,2F ,F ,$F ,@F ,lNF ,_\F ,DkF ,1F ,F ,wF ,GlF ,|F ,aF ,tF ,-NG ,oG ,K$G ,/kIG ,MWG ,rXkG ,YsG ,G ,EPG ,zG ,fhG ,T}G ,G , G , G ,H ,6H , H ,E.H ,fO ,LO ,5ZO ,hO ,,vO ,O ,QO ,ZO ,O ,JO ,|O ,O ,>O ,2O ,]P ,_MP ,]#P ,i0P ,D4=P ,JP ,\x]P ,gP ,;\qP ,P ,-P ,ݼP , uP ,P ,KP ,̈́P , P ,DP ,/uQ ,jQ ,J%Q ,z/Q ,S ,RS ,[lS ,QvS ,YS ,0S ,>S ,sDS ,hS ,T ,MxT ,(WT ,,T ,:T ,`HT ,^VT ,dT , rT ,ڳT ,T ,N6T ,)T ,T ,zT ,T , #T ,2ZT ,ZT ,' U ,U ,^)U ,8U ,kGU ,}VU ,R|eU ,LtU ,BU ,U ,L U ,vU ,U ,U ,WU ,U ,_`U ,; V ,2V ,6s%V ,2V ,h?V ,7LV ,GwYV ,fV ,PsV ,ZV ,ZV ,V ,V , V ,V ,AV ,yV , W ,:W ,o(W ,+6W , DW ,'RW ,`W ,_nW ,c|W ,ZW ,+W ,mNW ,`W ,iW ,[W ,W ,p X ,G0X ,Z'X , 4X ,|HX ,- UX ,0)bX ,oX ,|X ,vX ,FX ,(nX ,EX ,hX ,lX ,&X ,zTX ,X ,X ,qY ,bhY ,x$Y ,D1Y ,>Y ,KY ,XY ,eY ,"rY ,iY ,<Y ,!Y ,fY ,E@Y ,LY ,Y ,Y ,vY ,Z ,Z , Z ,-Z ,x:Z ,TZ ,aZ ,#nZ ,$l{Z ,5Z ,[LZ ,?Z ,Z ,JZ ,yZ ,[ ,"[ ,h[ ,B[+[ ,=[ , R[ ,^[ ,k[ ,~[ ,Z[ ,[ ,n[ ,D4[ ,^m[ ,r[ ,[ ,ڱ[ , \ ,?T\ ,g\ ,m)\ ,5\ ,+B\ ,ZO\ ,\\ ,i\ ,Wkw\ ,i\ ,R\ ,1M\ ,-\ , \ ,ǚ\ ,1M\ ,3j] ,)] ,*] ,N+] ,?uL] ,(Y] ,f] ,Wks] ,] ,~] ,O] ,f] ,t] , w] ,O^ ,^ ,- ^ ,We-^ ,G^ ,T^ ,Z^ ,~^ ,^ ,^ ,[^ ,1M^ ,^ ,t^ ,`6^ , _ ,`_ ,O$_ ,؜3_ ,.xA_ ,fg|_ ,U_ ,1M_ ,?x_ ,_ ,`6_ ,_ ,]_ ,gZ_ ,z_ ,}` ,; ` ,1` , >` ,K` ,aX` ,5~e` , r` ,1M` ,̡` ,&` ,t` ,`6` ,` ,` ,/` ,y` ,A` ,vka ,oa ,P_a ,P(a ,6a ,'Da , Ra ,O`a ,Xa ,xa ,Wa ,'a ,a ,Xa ,a ,jva ,Xb ,'#b ,X:b ,Fb ,Rb ,_b ,Zb ,Cb ,b ,)b ,Xb ,Lb ,qb ,b ,1b ,kb ,^b ,$'c ,p c ,c ,-c ,c ,)c ,Z6c ,}Cc ,Qc ,dc ,qc ,Vc , c ,HGc ,c ,c ,c ,tc ,Gc ,d ,d ,rX/d ,-Gd ,Td ,n ,Ln ,C Zn ,hn ,ҵvn ,n ,ywn ,Bn ,YHn ,n ,n ,o , o ,Cc.o ,Qz ,z ,f { ,q{ ,-'{ ,)6{ ,pE{ ,T{ ,u{ ,Cc| ,m3| ,-A| ,ݼO| ,]| ,Z| ,| ,| ,| ,f| ,m| ,Nj| ,!} ,8} ,} ,5-} ,*;} ,cI} ,'W} ,f`e} ,{s} ,Z} ,} ,Z} ,m} ,W} ,n ~ ,ua~ ,b&~ ,1M[~ , k~ ,1My~ ,D4~ ,~ ,&~ ,"~ ,$~ ,Z~ ,_~ ,+~ ,b~ ,5 ,$ ,2 ,@ ,to ,m} , , ,p , ,"G ,  ,a ,׎ , ,L ,5 ,w  ,k ,m( ,6 ,D ,CR ,e` , n ,'| ,  ,f ,  ,) ,€ ,gWЀ ,@ހ ,[ , ,j ,1" ,Z$ ,Pl4 , C ,uR ,Za ,1Mp ,l , ,A ,Z , ,kaˁ ,Lځ , ,X[ ,_ ,W ,& ,5 ,t ,Y ,L ,w ,~[͂ , ,M ,"6 , ,E% ,V3 ,uA ,lO ,1`] ,Uk ,A ,\ʃ ,o׃ ,! , ,6 ,  ,g^ ,S% ,h3 ,G ,T ,a ,Ccn ,^{ ,@ ,k , ,`˄ ,4؄ , ,v| ,>c  ,(Y ,$ ,2 ,wy? ,D4L ,|Y ,Yf , , ,Z ,_Ņ ,w҅ ,U ,GF  , ,W' ,5 ,aBC ,Q ,_ ,m ,c{ ,)a ,5x ,- ,wL , ,]φ ,݆ ,1 ,Eh ,# ,m/ ,< ,K ,pe ,Wr , ,D4 , ,~ , ,1Ṁ ,_ه ,:f , ,߰  ,:f ,p' ,w5 ,^C ,Q ,@_ ,Ccm ,{ ,wL ,; ,ʧ , ,Vȉ ,:؉ ,*މ , ,N , , , ,$V , , ,ן9 ,4j ,k~ , ,_ ,j ,& ,]̊ ,s , ,W' ,4 ,A ,[N ,S&[ ,Sh ,u ,s ,X ,v ,dz , ,Ë ,e ы ,-ދ , ,_ ,w , ,d) ,7 ,WE ,S ,S0a ,-o ,h} ,] ,g ,Eh ,1 ,Ya ,  ,Wk ,Y& ,]3 ,>L ,hY ,-h ,Gw ,=n ,Z , ,t , ,g ,]" ,Cc/ ,< ,I ,\ ,pi ,v ,t ,/H ,A ,  ,7 ,YD ,Q , ^ ,z ,u ,"ǐ ,wԐ , ,N ,[ ,Fmh ,]ru , , ,Z ,Ô ,hő ,Z ,c ,  ,c  , ,7# ,Z0 ,H ,=X ,f ,Y , , ,S ,߶ƒ ,pԒ ,^ , , ,  ,z ,:; ,J ,EXY ,h ,@&w ,* ,= ,q ,] ,“ ,)ѓ ,4 , ,B , _ ,* ,fv9 ,H ,W ,f ,ju , ,? ,l ,S] ,J” ,]Ҕ ,j , ,| ,q ,Z% ,2 , j ,tw ,@g ,{ ,^ , ,1M̕ , [ٕ ,Ad ,` ,А , ,Z ,, ,Z9 ,iF ,S ,` ,(m ,hiz ,K ,e ,Ö ,Ж ,@ޖ , ,r ,sK ,@O ,%" ,)0 ,$> ,L ,8`Z ,oph ,OAv , , ,ٖ ,|J ,X ,ʗ ,ؗ ,ab ,T , ,v ,{ ,, ,-d ,7|v , | ,9 , ,^ ,Sh ,s , ,v ,e? ,S ,< ,cL ,44\ ,mxl ,-| , ,. , ,O ,fŚ ,FӚ , , , ,^r ,q< ,:/ ,{? ,O ,_ ,Ko ,q , ,^ ,Z , , ˛ ,ٛ , ,0z , ,P  ,g! ,+0 ,q? ,u%N , m ,z , ,Wk ,1M ,F ,fǜ ,Ԝ , ,I , ,l , ," ,#/ ,wX< ,I ,ac ,|r ,;h , , ,xѝ ,Yߝ ,L ,m ,   ,Ab ,KT ,9a ,n ,f{ ,] , ,  , , , ɞ ,֞ , , , ,J  ,% ,)$ ,?1 ,> ,pW ,N1 , , ,^m ,`ğ ,#7џ ,~ޟ ,  ,q ,  , , ,, ,%9 ,)F ,S ,l ,Р ,ݠ , ,f" , ,  ,: ,8b+ ,8 ,nE ,R , _ ,ߡ , , , , ,:  ,Y ,v ,%k , , ,J ,_΢ ,vۢ , ,~ , ,* ,@" ,`: ,4G ,U ,c ,uw ,D ,7 ,>c ,Y ,ţ ,+ң , ,%k ,f ,w ,D4" , U ,&,[ ,b ,oo ,} ,Y ,0 , } ,ڐ ,pؤ ,|= , ,>cf ,s ,Ñ ,i ,rX ,3 ,1Mɥ ,D4ߥ ,ށ ,[ ,9 ,F ,eY ,u ,_ ,# , ,  ,$Ħ ,CѦ ,cަ ,M , 1 ,U4 ,K ,R ,, ,(9 ,F ,]S ,y` ,Dt ,O ,9 , ,,ŧ , ӧ ,#+ ,C , ,o  ,\Y ,x' ,>z5 ,TC ,Q ,le ,f~s ,c ,& ,% ,Ci ,N ,zǨ ,mFը ,( ,a ,VU ,sd  ,+ ,) ,F7 ,AE ,NS ,XIa ,Ibo ,} ,| ,] ,y , a ,*ĩ ,1'ө , , ,K , ,S& ,5 ,iK ,Z ,j , ,z , , , , ,> ,w , , 1 ,d]" ,/ ,"< ,#I ,vV ,Ttc ,@p ,+} ,o ,n ,Q9 , ,Ϋ ,^ܫ ,~ , ,C ,Ja ," ,0 ,{> ,rL ,Z ,h ,=gv ,{ ,R ,p , ,! ,jʬ ,Lج ,\ ,`- , , , ,, ,: ,I ,CX ,4g ,v , , ,c , ,Ń­ ,~ѭ ,# ,} ,> ,  ,2m ,ؒ+ ,o: ,I , X ,pg ,v ,g , ,R ,A ,!W ,ٸЮ ,s߮ , K ,^  ,z ,;+ ,; ,NJ ,'Y ,/n ,~ ,r ,Z ,zg ,t , , ,@ ,"ϰ ,C ,8+ ,>W ,kr , , , , ȱ ,`ձ ,d  ,v ,1 ,   ,$ ,$$ ,@1 ,Z> ,B[K ,f ,s ,Cc ,Oi , ,` ,> , ,Cc ,c ,1M ,8 ,cK ,O ,J ,dȳ ,Nγ ,DԳ ,o۳ , , ,W ,^  , , * ,9 ,ZG ,aU ,7c ,Iyq ,lB ,{ ,U ,W ,9) ,{KӴ , , ,Q ,$x , ,`- ,]k< ,0K ,Z ,>ci ,rx , ,x ,N ," ,tõ ,i\ӵ ,ol ,[t ,x , , ,- ,< ,9i ,Hcx , , ,P ,9 ,>c¶ ,eж ,$ڶ , ,) ,`  , ,1 ,> ,\e ,}$r , , ,z5 , ,8b ,;eη ,{ڷ , ,y5 ,]7B ,\ ,Fr ,~ ,a ,B+ ,G ,ĸ ,{Ѹ ,޸ ,z5 , , ,_, ,E ,*kX ,IOb ,A]q ,~ , ,y ,/ ,b) ,L_̹ ,bٹ ,NH ,w ,Le , ,^@ ,.r ,/i ,' , b , ,k , ,Rwͺ ,%ۺ , ,n , ,u; ,1 ,q* ,V8 ,0E ,]fS ,` ,&m ,rX ,T^ ,o ,. ,n$ڻ , , ,PS  , , b& ,'3 ,:@ ,N ,J[ ,jUh ,>u , , , ,X , ,ļ ,BѼ ,:߼ ,[R ,Wm ,v , ,! ,k. ,; ,RwH ,%U ,oRb ,do ,!| ,, ,_ ,l , ,& ,+ʽ , ؽ ,/8 ,2r ,& , , ,V2, ,-y: ,H ,@V ,Wd ,*Rr ,f , ,  , ,\ ,Ǿ , վ ,6 , ,Z ,J ,@ ,&* ,7 ,^ZD ,Q ,^ ,'m ,C , ,}d , ,^ , ,'; ,D ,& ,1; ,G ,`U ,n ,Z , , ,o ,& ,w ,x , ,z , ,# ,Ȱ1 ,6? ,"M ,[ ,i ,>Lw , ,B ,O , ,l , ,7| ,a ,Z ,\C ,T3 ,JZB ,KQ ,` ,{^o ,P~ ,H ,+: , , ,w ,JM ,: , ,  ,2 ,P# ,Rx@ ,3QO ,^ ,;m , | ,1 ,c ,6  , ,k , ,>u , ,ڡ ,_! ,0 ,.? ,+Y ,@z , ,E1 , , , , , ,D4 , ,! ,Cl/ ,2x , ,O ,* ,r ,|N ,T ,u , ,L  ,Q ," , ,}Z ,m>& ,60 ,=yH ,T ,j ,u&v , ,U , ,V ,| ,~b , , ,-< , ,PZ , J+ , c9 ,7 G ,L U ,y\c ,jq , , ,: ,- ,|C ,d ,Y , ,$ , ,W  ,7 ,D ,hW ,e ,r , ,J; ,7 ,E ,V , ,d , , ,: ,'r ,ge ,x ,h) ,|6 ,C ,QP ,3h] ,Mmk ,y , ,5 ,- , ,P: ,L  , ,e  , ,e( ,86 ,zD ,W.` ,ej ,8ft ,pM~ , ,PY ,:f ,1M ,GY , ,x ,6 ,Y ,W# ,k1 ,;? ,'M ,f ,PPs ,r , ,g ,C ,  , ,p ,r ,4 ,q" ,ӳH ,*hV ,kd ,[r ,h ,wz ,E~ , , ,. , ,Z , ,p ,-  ,̳ ,VD( ,*y6 ,*D ,R ,9` , Un ,ׅ| ,r7 ,z ,g ,` , ,ӧ , ,c ,sk ,=, ,d: ,4G ,ZT ,NNa ,mn ,qi{ ,ts ,F9 ,3 , ,I ,t] ,Ѽ ,aD ,} ,` ,  ,  ,l$ ,1 ,}> ,gK ,BX ,l ,T , ,-  ,; ,C< ,L  , ,v! ,Y_ ,= ,*  ,P# ,1 ,? ,M ,w[ ,w ,f ,^m , ,s ,6v ,ú ,H( ,-6 ,9S ,܄ ,s , ,O  ,@O ,³ ,~ , ,'f , ,a ,E ,S  , , ,!j ,D ,Q ,z , ,g ,Ĩ* ,7 ,FD ,nQ ,^ ,2Zk , ,Oa , $ ,!a ,} ,= ,є ,A , ,2 ,Q , ,_  ,{`/ ,; ,W ,ve ,rXt , ,' ,C , ,B ,% ,h ,| ,` , ,=1 ,% ,2 ,Y ,Hf ,as ,Z , ,J ,1o  ,$ ,`K ,h ,u , ,/ ,[ ,FU ,qE ,u ,p , ,D ,. ,CG ,U ,_ ,Ol ,y , ,g ,V ,0e ,? ,prP ,!jV ,\ ,b ,i ,D , ,[ ,v ,5 ,Fu ,W ,C ,z ,TM ,n# ,n7 ,p ,ez ,nn ,r , ,~ , ,fG , ,! , ,G ,L; ,ngH ,U ,b ,g ,- , ,Z ,a ,i ,I ,0  ,kH ,1[ ,* ,70 ,b6 ,< ,C ,mQ ,+_ ,-m ,{ ,N ,[ ,7 , ,Y} , ,j ,5s ,op , ,H ,M ,ڴ ,O\  , ,ƍ , ,X0 ,6 ,< ,w6C ,~Q ,<_ ,Km ,{ ,Ŀ ,KB ,V ,+  ,% , ,2 ,  ,X0 ,+= ,-J ,Zb ,jl ,T{ ,. ,d , , , ,^ , ,Z ,4 ,>B ,ؚR ,09X ,w^ ,d ,dj ,:q ,~ ,u ,\ ,C ,f  ,v3 ,nb , p ,~ ,b ,  , , ,fc  ,f ,^ , ,E% ,(2 ,_? ,?L ,FY ,]9g ,=~ ,! , ,cC ,  ,$ , , , ,^ , ,Z ,w- ,(9 ,\N ,!Z ,l ,Cv , ,~f ,W ,4n ,\A ,% ,P ,d , ,u ,o ,1q ,, ,!\; ,i+J ,Ln ,j ,?f , ,1M ,& ,q ,y ,2l ,S , ,`* ,"6 ,y@ ,M ,Ys , , ,3W ,A ,F , ,a , ,O ,ز , ,#" , / ,Y< ,I ,c ,v ,f ,` , ,߮ ,5 ,k , ,hq ,f<  ,W ,j{  ,& ,, ,l3 ,@ ,ZM ,dZ ,g ,'t ,J , ,^  ,` ,4 ,\ , , , ,E ,|  , ,r' ,x5 ,qoC ,2[Q ,8(_ ,:m ,{ ,^m ,@ ,R ,m ,̒ ,( ,?y ,; , ,v , ,) ,h6 ,pC ,Q ,&]_ ,Zm ,{{ , ,C , , ,6+ ,w- , , ,ۂ , ,Rz ,# ,k1 ,? ,EM ,[ ,Ri ,w , , ,T ,f ,8 ,j ,ȯ ,s  ,f , , , ,- ,5; ,WI ,1W ,Xe ,s , ,T  , , , ,: , , ,1  ,b. ,a< ,*J ,X ,if ,&t ,2 ,{^ , ,@O ,F ,D ,ݩ ,f ,A ,R ,B ,`' ,?1 , J ,iW ,bd ,}q , ,w ,{^ , ,h ,o ,! , , , ,  ,P- ,B: ,G ,-@T ,a ,Z{ ,lf ,T ,Y , ,< ,] ,\C , ,cp  , > ,% ,>3 ,A , ] ,%k ,;y ,1M ,Rx ,l , ,$Q , , ,z ,7X  , ,B) ,{^7 ,ZE ,pS ,a ,Mo ,)} ,y , ,& ,- ,ݼ ,( , ,: ,, ,& ,@ ,A , n , ,![ , , ,n ,; ,j ,[, ,S9 ,LF ,^S ,"` ,Rm ,Ez ,9 , , , ,l ,P ,{@ , ,Ge ,  ,  ,3  ,Pv@  ,M  ,Z  ,!  ,9o.  ,;  ,SH  ,yU  ,b  ,'eo  ,C}  ,\  ,  ,   ,`  ,  ,p  ,  ,w  ,p  ,^  ,  ,s,  ,ZX8  ,N  ,Z  ,o  ,|  ,Z  ,w  ,y  ,"=  ,D  ,y  ,V'  ,5  ,ZC  ,НQ  ,Gwl  ,pz  ,5N  ,k  ,E8  ,  ,ZB  ,a  ,+  ,U  ,a , ,i ,B- ,< ,K ,Z ,Li ,x ,ڡ ,_ ,uW ,< ,| , ,! ,1M ,h ,Z ,՘ ,G* ,48 ,d.\ ,w ,-l  , ,H ,B>X ,t^ ,1d ,k ,ߏx , , ,a ,B , , , ,E ,G ,N  ,I ,A ,:^! ,!v. ,; ,\H ,UGU ,b ,i}o ,7E| ,o ,x ,5 , ,B ,Ā , ,|u , ,\ , ,p$ ,_3 ,B ,3Q ,`` ,zo ,e~ ,' ,6+ , , ,Z , ,2 ,@ ,  ,t ,& ,p6 ,F ,| V ,>f ,Ou ,& , , ,@ ,Y , ,0 ,  ,f ,n% ,jO3 ,A ,{O ,] ,Qk ,ny ,s ,0 ,)+ ,>u , , ,9 ,| ,"_ ,A  , ,q) ,F 8 ,G ,V ,ze ,`t ,2 ,e ,' ,6+ ,ً , , ,Z , ,  , ,) ,BJ9 ,GI ,Y ,Kji , y , ,|  ,> , ,Mu , , ,S ,O ,s , T$ ,v3 ,E B , Q ,lo ,]~ ,9 , ,vU , ,ER ,% ,˨ ,= ,   ,$ ,1 ,Og> ,B%K ,X ,te ,r ,! ," , , K ,`X ,łe ,Q~r ,2 ,^i ,7y , , ,% , ,+ ,~ ,   ,c ,t[' ,d4 ,N ,j\ ,j ,x , ,P ,Y ,b , , ,k ,  ,o ,&! ,q ,$ ,l3 ,B ,RQ ,k` ,<o ,m~~ ,- ,5 ,  ,k ,6 , ,ߤ ,-g ,h ,we$ ,3 ,B ,Q ,` ,jo ,+\~ ,b , , ,- ,v ,8 , , , , ,$ # ,2 ,A ,7P ,i_ ,ˏn ,} ,]Z ,; ," ,ol ,t ,f ,- ,im ,  ,%~  ,"  ,1  ,I@  ,IN  ,{\  ,j  ,-x  ,   ,c$  ,3  ,o  ,!  ,:  ,K  ,  ,(  ,qA ! ,P! ,+! ,a:! ,1I! , X! ,g! ,v! ,! ,(! ,! ,'Z! ,'h! ,@" ,P" ,%^" ,3l" ,b" ," ,7y" ,9I" ," ,y" ," ,# ,,b# ,j## ,`2# ,A# ,+P# ,Z_# ,%n# ,h$ ,B|$ ,I$ ,c$ ,q$ ,$ ,$ ,8o$ ,$ ,b$ , $ ,fz% ,o% ,$% ,b[2% ,-@% ,N% ,\% ,Hj% ,y% ,M% ,% ,% ,% ,% ,Z% ,I% ,% ,% ,s"% ,T% ,% , V& , & ,Ck*& ,U4& ,B}E& ,}K& ,Q& ,0=W& ,9]& ,kL& ,-& ,t& ,Z& ,f& ,p& ,[& , & ,5& ,6\& ,& ,Z& ,n& ,F& ,M& ,q& ,!& ,S& ,M& ,i' ,bn ' ,e' ,' ,' ,!' ,Y'' ,{(-' ,H3' , 9' ,i?' ,"E' ,K' ,Q' ,W' ,"]' ,Mc' ,[i' ,o' ,u' ,n{' ,kq' ,d' ,ɑ' ,%' ,v' ,o ' ,' ,;' ,?' ,' ,7' ,' ,n' ,_' ,a' ,L<' ,' ,I' ,' ,\' ,(' ,Ѓ' ,:K( , ( ,( ,"( ,( ,m#( ,L)( ,6/( ,5( ,N;( ,A( ,kG( , M( ,TS( ,Y( ,a_( ,e( ,(k( ,q( ,Ew( ,v}( ,'?( ,( ,wp( ,=( ,Z( ,=( ,#( , [( ,Y&( ,0( ,\b( ,U( ,( ,( ,{ ( ,M( ,8( ,)( ,( ,>Q( ,wq( ,^3) ,z) ,R) ,) ,P?) ,W) ,rXe) ,au) ,F) ,Cc) ,gy) ,\) ,) ,?) ,F* ,+* ,fC* ,Q* ,j* ,+9* , @* ,rg* , * ,* ,̀* ,|* ,l+ ,7"+ ,E:+ ,!H+ ,#3W+ ,f+ ,qu+ ,+ ,'+ ,|+ ,,+ ,=j+ ,4+ ,Q+ ,+ ,,|+ ,m , ,n, ,(, ,)7, ,y{F, ,U, ,2d, ,ss, ,E*, ,, , , ,, ,, ,R, ,1w, ,*, ,', ,[ - ,Y- ,g'- ,"6- ,D- ,c_X- ,f- ,&xt- ,- ,q- , 0- ,C- ,A- ,- ,F- ,g!- ,hd3. ,A. ,Z. ,+9w. , @. ,rg. , . ,. ,̀. ,|. ,l/ ,7/ ,E*/ ,!8/ ,#3G/ ,V/ ,qe/ ,t/ ,'/ ,|/ ,,/ ,=j/ ,4/ ,Q/ ,/ ,,|/ ,m/ ,n 0 ,0 ,)'0 ,y{60 ,E0 ,2T0 ,sc0 ,E*r0 ,0 , 0 ,0 ,0 ,R0 ,1w0 ,*0 ,'0 ,[0 ,Y1 ,g1 ,"&1 ,41 ,c_H1 ,V1 ,&xd1 ,~1 ,q1 , 01 ,C1 ,A1 ,1 ,F1 ,g!1 ,hd(2 ,TE2 ,S2 ,L a2 ,So2 ,}2 ,2 ,a2 ,2 ,@2 ,i2 ,#3 ,./33 ,F93 ,-?3 ,9E3 ,.K3 ,R3 ,oc3 , i3 ,lo3 ,u3 ,T5{3 ,d3 ,3 ,Y3 ,Q3 ,3 ,k3 ,3 ,3 ,3 ,,m3 ,3 ,3 ,3 ,3 ,3 ,Hp3 ,3 ,3 ,93 ,N3 ,3 ,3 , 4 , 4 ,04 ,}4 ,U4 ,w#4 ,G)4 ,R/4 ,w54 ,N;4 ,B4 ,uS4 ,yY4 ,M_4 ,be4 ,wk4 ,@Iq4 , w4 ,~}4 ,Z4 ,4 ,Uw4 ,4 ,4 ,P4 ,xm4 ,XF4 ,4 ,Ly4 ,4 ,4 ,)4 ,jY4 ,O4 ,g4 ,>4 ,4 ,U4 ,4 ,W4 ,f5 ,Y5 ,v 5 ,c5 ,H`5 ,>x 5 ,15 ,-P75 ,h=5 ,TC5 ,yjI5 ,^O5 ,U5 ,u[5 ,a5 ,g5 ,+m5 ,MEs5 ,y5 ,5 ,5 ,\5 ,5 ,"A5 ,hP5 ,5 ,xO5 ,5 ,£5 ,w5 ,%5 ,5 ,r5 ,5 ,p5 ,5 ,w5 ,5 ,{5 ,O#5 ,5 ,W6 ,  6 ,g6 ,r6 ,6 ,!6 ,s'6 , --6 ,236 ,E96 ,&?6 ,_>E6 ,+K6 ,^Q6 ,eW6 ,%]6 ,ec6 ,i6 ,D{o6 ,Mu6 ,݆{6 ,N6 ,6 ,+6 ,16 ,6T6 ,l6 ,6 ,yc6 ,Y6 ,\6 ,B7 ,)7 ,n7 ,[*7 ,A87 ,@F7 ,T7 ,6b7 ,np7 ,/7 ,w7 ,h7 ,7 ,Z7 ,T7 ,Q 8 ,8 ,*+8 ,D498 ,G8 ,U8 ,Zn8 ,w{8 ,8 ,.b8 , 8 ,ғ8 ,8 ,Yp8 ,a8 ,8 ,!d9 , 9 ,#9 ,L19 ,T?9 ,M9 ,[9 ,j9 ,x9 ,9 ,p9 , t9 ,9 ,9 ,9 ,V9 ,;9 , q9 ,S: ,Ki(: ,3 6: ,D: ,]: ,dj: ,: ,D: ,zF: ,{: ,: ,X: ,x: ,P; ,;k; ,lK ; ,F.; , <; ,rK; ,Z; ,Yh; ,0v; ,k; ,R; ,; ,&; ,Z; ,%; ,$ ; ,l; , < ,< ,W7< ,kDE< ,o/^< ,3 l< ,;z< ,< ,d< ,< ,Ձ< ,D4< ,< ,= ,X= ,l#= ,]2= ,}A= ,ΪP= ,ei= ,w= ,;k= , ,8> ,ZF> ,Psc> ,lq> ,\ > ,b> ,E> ,;k> ,> ,d> ,> ,? ,J? ,~2? ,ZN? ,]? ,8l? ,i? ,t:? ,B ,$B ,0eC ,C ,u+C ,=>C ,sLC ,o^ZC ,gC ,|xtC ,C ,?C ,$DC , LC ,qC ,bC ,?CC ,C ,bC ,xD ,`D , D ,A-D ,@gD ,WsD ,D ,ND ,}D ,D ,ϞD ,^4D ,i/D ,D ,2D ,z E ,nE ,)E ,8E ,GE ,UVE ,ieE ,#tE ,YE ,E ,E ,mE ,E ,TE ,2E ,ZF ,|F ,J.F ,bCF ,|]F ,DjF ,wF ,m,F ,(lF ,gF ,.F ,=F ,F ,nF ,8F ,F ,D4 G ,G ,'G ,4G ,\BG ,cG ,mG ,wG ,7G ,G ,\G ,G ,G ,VNG ,ÑG ,nG ,D4 H ,+^H ,z>H ,DKH ,)rH ,H ,H ,H ,TH ,GH ,_H ,H ,Z I ,jI ,5_&I ,L 4I ,vXI ,;WuI ,!I ,I ,jI ,I^I ,mI ,I ,(J ,a 5J ,YBJ ,uOJ ,L\J ,=miJ ,-vJ ,l)J ,J ,QJ ,Y=J ,J ,uJ ,TJ ,cJ ,J ,sz K ,bK ,)'K ,}r5K ,CK ,QK ,_K ,rmK ,{K ,K ,gK ,%gK ,bRL ,xL , *L ,L 7L ,DL ,v|QL ,jL ,ZwL ,0L ,=pL ,^L ,nL ,YL ,IyL ,zL ,L ,L ,L , M ,4M ,)M ,37M ,cJEM ,1 SM ,aM ,5<oM ,ӱ}M ,m_M ,M ,u?M ,8M ,AM ,M , M ,M ,,M ,dN ,*N ,z/8N ,>cFN ,ߦTN ,.tbN ,pN ,6~N ,N ,N ,hN ,wN ,N , N ,)N ,x O ,[tO ,&O ,#r4O ,BO ,xQO ,_O ,$mO ,H{O ,O ,6rO ,6}O ,SKO ,-O ,O ,P ,wP ,׬-P ,W ,>KW ,GXW ,4qW ,W ,CcW ,W ,\W ,\W ,KuX ,@,BX ,lX ,)X , X ,&X ,X ,X ,zX ,X ,EDY ,Y ,u#Y ,0Y ,+=Y ,SJY ,WY ,sdY ,tqY ,~Y ,Y ,%Y ,nY ,Y ,R'Y ,Y ,rY ,m'Y ,aY ,Z ,j Z ,/Z ,Ժ'Z ,|4Z ,iAZ ,DNZ ,ٵ[Z ,hZ ,uZ ,IZ ,E'Z ,Z ,NZ ,]Z ,32Z ,j9Z ,lZ ,KZ ,Z ,- [ ,w[ , %[ ,Z3[ ,LA[ ,[_ ,\wk_ ,L y_ ,i_ ,4_ ,o_ ,__ ,_ ,;F_ ,_ ,Zi_ ,S%` ,` ,D/ ` ,.` ,-<` ,J` ,6X` ,7f` , yt` , ` ,t` ,w` ,-` ,l` ,#*` ,` ,` ,w` ,5a ,2aa ,.a ,e*a ,a8a ,Fa ,DTa ,nVba ,0pa ,T?~a ,a ,0a ,JWa ,ra ,a ,Da ,Ja ,{a ,Ya , b ,,b ,'";b ,rvJb ,Yb ,zhb ,!xwb ,b ,Eob ,cb ,أb ,b ,.b ,b , b ,  c ,c ,h+c ,J:c , Ic ,Xc ,kgc ,9c , c ,^c{d ,| e ,N`e ,]e , me ,1se ,u4ye ,.e ,}e ,1e ,be ,ze ,e ,#He ,ee , e ,Qe ,te ,xe ,e ,]e ,Ce ,Bf ,j f , f ,2k:f ,Gf ,ITf ,Nkf ,wJwf ,}f ,/f ,Sf ,Wf ,f ,Of ,JW g ,1Mg ,&g ,i/4g ,.Mg ,^g ,4dg ,mjg ,Vjpg ,{vg ,|g ,{og ,`g ,gg ,l5g ,Qg ,Fg ,<g ,!g ,^g ,g ,ig ,rg ,Sg ,reg ,hg ,g ,ig ,g ,2.g ,ƫg ,Mg ,Nfh ,ޕ h ,h ,A`#h ,eh ,~sh ,zh ,h ,-h ,h ,Gh ,h ,>h ,[h ,2h ,9h , i ,i ,,&i , 4i ,(`Bi ,֥ai ,qi ,Yi ,i ,@ i ,i ,zi ,Oi ,j ,j ,W+j ,:j ,YIj ,> Xj ,&zj ,j ,[j ,j ,Zj ,j ,7j ,^j ,L j ,Zk ,k ,h#k ,@1k ,?k ,&zNk ,}k ,۝k ,k ,.Ik ,k ,k ,xl ,Lzl ,!l ,n0/l ,#FQl ,_l ,Hml ,l{l ,rl ,kl ,Sl ,ql ,l ,Պl ,B m ,O/m ,ZCm ,uMm ,ܙvm ,m ,Om ,L m ,m , m ,)m ,=m ,m ,n ,i*n ,ғVn ,hedn ,0En ,(n ,pZn ,أn ,~n ,n ,nn ,zo ,>-o ,33o ,9o ,yiJo ,YXo ,Aqo ,o ,!}o ,Gto ,3o ,1o ,Yo ,o ,7o ,Qo ,=o ,o ,˸o ,o ,Qo ,o ,)Lp ,< p ,f=p ,2p ,[p ,$"p ,<(p ,t.p ,5p ,3Ep ,=NKp ,.Qp ,_Wp ,]p ,cp ,Ǧip ,op ,up ,{p ,ap ,zp ,p ,;p ,:p ,p ,$ p ,mp ,M p ,up ,Dp ,p ,dq ,@q ,W!q ,,.q ,.;q ,7yHq ,Uq ,Zbq ,[}q ,/q ,q ,uq ,Dq ,oyq ,q ,]q ,Skq ,ϴ r ,Sr ,&3r ,2DAr ,w ,OvMw ,d\w ,oykw ,]ezw ,ZSw ,w ,Cw ,<w ,Ww ,D?w ,Zw , w ,0x ,cx ,1gx ,l#.x ,|=x , Lx ,[x ,jx ,yx ,,x ,x ,bx ,ex ,1x ,x ,x ,8x ,Hx ,d y ,y ,W$*y ,W1y ,8y ,#?y ,Fy ,`My ,Ty ,D[y ,by , hiy ,egpy ,wy ,xy ,>y ,y , cy ,-By ,3y ,y ,y ,Z y ,y ,!y , Cy ,y ,y ,~7y ,cy ,y ,iy ,y ,y ,t z ,z ,Zz ,1z ,e$z , b*z ,n0z ,)6z , } ,D} ,~J} ,P} ,V} ,s\} ,b} ,qvh} ,n} ,bt} ,yz} ,z8} ,} ,L} ,} ,} ,d} ,Zl} ,v} ,} ,5} ,7} ,_} ,;} ,1p} ,N} ,"z} ,p~ ,` ~ ,r~ ,~ ,%~ ,m5~ ,DS;~ ,A~ ,G~ ,.M~ ,fAS~ ,-GY~ ,`~ ,>"p~ ,av~ ,|~ ,~ ,$b~ ,~ ,~ ,~ ,~ ,Y~ ,~ ,~ , ~ ,~ ,=~ ,\g~ ,,~ ,  , ,^?% ,X2 ,k? ,5L ,Y ,kf ,ns ,2q , ,T} , ,0 ,D ,j ,ܽ , ,l# ,DŽ ,_^+ ,:: ,\I ,ZX , g ,{v ,Z , ,oy ,h ,g ,wЀ ,f߀ ,2 ,V ,R  , ,v- , = ,{M ,] ,m , ,_ ,$] , ,ȁ ,ׁ , , ,2 ,m ,Cc" ,1 ,z@ ,U ,p ,o , ,$ ,s ,̂ ,7 ,Cc ,Z ,l ,- ,x; ,cI ,W ,+e ,s , ,p ,R , ,Y ,pǃ ,fՃ ,}' , , ,0K  ,x1 ,A ,WG ,շM ,/lS ,CcY ,_ ,Sne ,k ,n[q ,*w ,Wl} , y , , ,w ,"q ,R , ,¢ ,Sc , Ą , ˄ ,Xsۄ ,Û ,s ,t> ,1 ,l ,0 ,O  ,v  , ,*o" ,( ,O,. ,O4 ,c: ,kA ,IN ,v ,, ,2 ,Y ,h ,%Ņ ,Z҅ ,߅ ,vb ,zA , ,^ ,f  ,2- ,: ,G ,@a ,[n ,3{ ,`c ,[ ,r ,` ,چ , , ,  , ,E ,( ,5 ,vC ,]0Q ,_ ,mm ,l{ , ,Zx , ,w ,u ,v`χ ,݇ , ,ʙ ,N , ,v& ,X)4 ,O ,] ,Xx ,W ,Z ,4 ,G6 ,\̈ ,ڈ , ,2  ,< ,H5J ,[X ,f ,2 ,F ,P ,~ , ,-* , ,G ,_/ ,!R- ,J4; ,BI ,^W ,>_e ,Ss ,  ,) ,9 , ,' ,ENJ , ,h& ,4 ,YB ,)P ,ik^ ,Psl ,vbz ,c ,w ,O , ,@V ,] ,D , ,l ,( ,5 ,C ,>S , _ ,2 ,g ,| ,< ,W- ,*k; ,ݍP ,f , ,\ , , j , , ,q.֎ ,$ݎ , ,a  ,7- ,eI ,Wa ,Ϡh ,u ,h .^ .X . .h h% .) .3h= /2M .Q .Z / 3g .k .t /$3 i /63 . .i /K3Ɛ .1ʐ ./Ӑ .@א .>ܐ /K3 .R .Nci /[3  .p .n /[3 .  .})ci3 /k3? .C .L .P .U /k3^ .b .w ,/J ,x ,X /A- ,xɑ .͑ .ܑ . . . . .f .  ,2 . .& .* .|/ ,\9 .W= .AB ,vQ ,4i .m .v^ /W- . . ., . . .y . .Ē .]Ȓ .Uђ .Ւ .ޒ^ /y- . . .  . /y- . .% .) .2 .)6 .'?^I /-Z .;^ .7g .Uk .Qp /-y .u} .o^^ . .^^ד .ۓ . /- . .^ ^% .) .2 .6 .? .C .N _X _u .y . . . _ . ._ /-ʔ .Δ .ה .3۔ .1 /- .D .BN` /- .Y .S& .x* .t/ /-8 .< .E .I .R .V ._N`i /-z .~ . . . /- . .[`[`ȕ .̕ .Օ[`ߕ[` ., .*j`! .;% .9.j`8j`Q .LU .J^ .]b .[k .]o .[z` /- .n .l . .} /- . .ǖ`і /-ޖ . . . . /- . .b /.- .1 .: .> .C /.L .P .Ybc /.t ."x . .< .8 /. .Z .Tbb— .yƗ .wϗbٗb . .b . .(b2bK .O .X .\ .e .i .tb~b . . . .c /).Ϙ .Ә .ܘ . . /). . .c />. ./ .+" .I& .E+ />.4 .g8 .aA cK cc .g .p cz c . .c . .əcәc . . . . .  .=c=c: .> .G .K .T=ci .m .xKcKc . . . .Kc͚ .*њ .(ܚkc`c .; .9  .L .Jwc% /P.6 .a: .[C .G .|L /P.U .Y .b .f .o /e.| . .c /u. . . . . /u.ě .ț .ћcۛc .: .8c c" .I& .G3cL .XP .VYccc| .h .f .x .v .x .vccȜ .̜ .՜ .ٜ .c /. . .  . . /. .# .,c6 /.G .K .T . X .] /.f .(j ."sd}d .G .Eddĝ .Vȝ .T՝ /.ޝ .e .cdd .u .s . .( ., .9&dC /.T .X .a .e .j /.s .w .&d /. . . . . /. . . Ǟ0dў0d .2 .00d0d .A .?)?d> .PB .NK?dU?dn .`r .^{ .p .n .p .nXd /. . . .ş .ʟ /.ӟ .ן .Xd /. . . .  . /. . .'bd1bdI .M .Vbd`bdx .,| .*qd .; .9qdqdΠ .KҠ .I۠ .[ߠ .Y .[ .Yd // .n .j .! .* .. .3 //< .@ .I .M .V .Z .cdm /'/~ . . . . /'/ .5 ./dd̡ .TС .R١dd .c .a  /9/ .r .p&d0dI .M .V .Z .c .g .rd|d . . . .dȢ .̢ .עe /L/ . . . . /L/ . .#^_- /\/= .-A .J .N .W ..[ ."d .h .fq .u .~ .( . . . /\/ . .j_ //ţ .Tɣ .>ң .֣ .ߣ .. .$ . ._ . . .  . // .3 .%% .t) .l2_< //L .P .Y .] .f .j .s .w . . .  // .) .' .: .6_ //Ƥ .Vʤ .RӤ .pפ .lܤ // . .__ . .!_+_C .G .T_i .m .v__ . . . . . .å_ͥ //ݥ . .a //  . .  .; .7  /0) .^- .Z; .? .}H ] r    ʦ ߦ    0aI oby /00 . . . . . . . . . .Ƨ /00ϧ .ӧ .ܧ . .b /@0 .- .+ .< .: /@0" .M& .I/b9bQ .iU .g^bhb .x .v /P0 . ."b"bɨ .ͨ .֨ .ڨ . . . /`0 . . . . . .( ., .5 . 9 . Bb`bjb . . .. ., .. ., .. ., .? .=é .Qǩ .OΩbb /s0 .a  ._ .r .p"e, /0< .@ .I .M .V .Z .c .g .p .t .y /0 . . .$ . e /0 .@ .<ê .ZǪ .V̪ /0ժ .x٪ .ree . .ee3 .7 .D /0M .Q .Zede| . . . . . .-f"fͫ .ѫ .ګ .ޫ .4f /0 . . . .4f1 .*5 .(@GfJ /0Z .=^ .9g .Wk .St .wx .s . . . . /0 . . . .GfĬ /0Ԭ .ج . . . /0 .0 .*Qf Qf" .O& .M/Qf9QfQ .^U .\b`fw .m{ .k`f`f .} .{ . . .ĭ .ѭfۭ /0 . . . . .  . . . .# .( /01 ..5 .,> .?B .;KfU /0e .[i .Wr .uv .q{ /0 . .ff . .fʮf . . /1 . . ff+ ./ .8 .< .E .I .Vf` /1p .t .!g //1 . . .. .* .N .Jį .lȯ .hѯ .կ .گ //1 . . . .!g /A1 . .$ .( .- /A16 .: .C+gM+ge .-i .+r+g|+g .< .: /S1 .K .I:gŰ:gݰ .] .[ .n .l .n .lg}g. .2 .}; .? .IgS /c1c .g .p .t .y /1 . . .5 .-  ˱    # 8 M b w g ȲgҲ /1 .` .^ .o .m . .  .  . . . /1( ., .5 .9 .BgL /1\ .` .i .m .r /1{ . .gg .# .!ggٳ .2ݳ .0 /1 .C .?h h" .[& .Y/ .j3 .h< .j@ .hM /1Z .}^ .yg .k .t .x . . . . .dhdhôdh۴ .ߴ . . . . . . . . . .  .'{hFVhPVhh .l .u .+y .)Vh .< .:aص` /1 .Q .K . .z  . . . .& .* .3 .7 . @ .@D .8I /1R .lV .h_`i /2z .~ . /;2 . . /]2 . .(`ö /t2϶ . Ӷ .޶(` /2 .$ .  .F .B .b .^ .z  .x. .2 .@ /2M .Q .ZCao .s .~EaEa . .Ma· /2ӷ .׷ .ma /2 . .  . .c%cA .E .NcXcp .#t .!}cc .2 .0 .A .?c׸ah ,. ,x` ,vm ,4 ,8r ,x ,#S͹ ,Nڹ ,x ,v' ,#S; ,H ,x , ,#S ,t ,xۺ ,#S , ,x ,O# ,#S7 ,AD ,xu ,Sd ,#S ,. ,x߻ ,ű ,#S ,։  ,x. ,U ,#Sd ,ϻu ,x , ,v ,4ۼ ,T ,x , ,v% ,4H ,WkT ,,` ,Rl ,} ,#S ,f ,[ ,@ , ,``ѽ ,é޽ , , ," ,k ,#S' ,f4 ,[A ,@N ,\ ,``n ,é{ , , ," ,k˾ ,x־ ,Wk ,k ,#S ,Ѥ$ ,x0 ,R ,v^ ,4 ,#S ,f ,[ ,@ ,ÿ ,``Կ ,é , , ," ,k ,#S$ ,f0 ,[< ,@H ,U ,``f ,ér ,~ , ," ,k , ,] ,' ,' ,/X  ,#S ,=* ,xA ,qN ,#Sb ,t ,8 ,v , , , ,Y; ,v" ,. ,: ,G ,"T ,kc ,I+ ,/ , ," ,k ,v ,)( ,yH ,LUc ,} ,l ,f ,y , , ,W ,g ,. ,3  ,p ,* ,7 ,"D ,;Q ,T^ ,mp ,~ , , ,[ , , , , , ,/] ,* ,C ,\ ,`{) ,4 ,`D ,WQ ,g^ ,3p ,Y} , , , , ,! ,: ,S ,l ,Z ,q. ,W$ ,g1 ,.] ,qj ,fx ,Ǡ ,t ,xu ,u ,u ,u ,u ,u ,v , v ,8v  ,6( ,gG ,sT ,ta ,tn ,5t{ ,Mt ,et ,}t ,t ,t ,t , ,J ,g ,+% ,q1 ,f> ,ǠQ ,gr\ ,rg ,rr ,r} ,s ,s , ,Is ,as ,ys ," , , ,Pc@ ,f ,Pc , ,Pc /2 .e .O . . . .  .m .U . .% .R) .@2 .6 .? .C .hL .P .Y .] .f .Aj .?}kK /I .W .S .p .n . . . . /I . .kKkK .  .   . $ . -K7KO .: S .8 \KfK~ .I  .G  /YKK .X  .V  .X  .V K /i .i  .g  /i .  .x &K0 /|A . E . N . R . [ /|d .5 h .! sK} / .  .  .  .  / .  . KK .@  .>  .Q  .O K .t  .` % /2 . 6 . ? .p C .\ L . P . Y .l ] .X f . j . sKKK .V .T .g .e .g .e .g .e .V .T .x .v$L  / .  .) .- .6 /? .C .N$LX$Lu .2y .0 .B .@$L .f .R$L / . . . . / . .=L  / . .( ., .5 /> .B .M=LW=Lt .7x .5 .G .E=L .k .W=L / . . . . / .& .PL  / . .' .+ .4 /= .A .LPLVPLs .Fw .D .V .TPL .z .fPL / . . . . / .+ .bL /  . .& .* .3 / < .@ .KbLU / f .Kj .Is .]w .[bL . .mlLlL . .xLxL .  . L // % .) .2 .,6 .(; /D D .OH .KV .rZ .lc x        $ 9 KLd LL . .LL . .LL . ." .& ./ .3 .< .@ .ILSLo .s .| . . .  . ./ .- .@ .>LL .Q .OLL .f .d' .{+ .y4 .{8 .y>LWLa /^ r .v . . . /^  . .L /n  .6 .4 .H .FL .l .XL /~  . .! /~ * .. .7 .9; .3DLN / _ ._c .[l .p .}u / ~ . . . . .E .A      ' < Q f {  M      / H ] r    'M /  .b .^ . . /  . .! .% .. C X m        BM/ UpM_ /!p .t .} .3 .) .o .e /! . .pM /D! . . . . .% . /D! .I .E .j .f  .  .pM  /^!1 .5 .> .B .G /x!P .T .] .a .j .On .Kw8 8 8 8 8 8 8 8 #8 88 M8 _zM~K M /! .p .hMM . . . . . . M* /!; .? .H .L .U /!^ .b .mMw /! .P .N .` .^M .z .pN /! . . . . /! . .`N /!. .>2 .4; .? .}H .L .Q /!Z . ^ . g`Nq / " .  .  .=  .7  .e  ._  / " .  .  .  .  .  . `N /$" . ! .! .5! ./! />" .f! .`! .! .!( .!, .!5 J _ t        hN< XNx /[" ." .!NN .8" .6" .L" .J" .L" .J"4N /" .]" .[" .m" .k" /" ." .}"(4N24NO ."S ."\ ."` ."i4N~ ." ."4N /" .7# .3# .O# .M# /" .i# ._#ON /" .# .# .# .# /" .# .#'ON1ONN .$R .$[ .)$_ .'$hON} .C$ .9$N /" .$ .$ .$ .$ /" .$ .$N /" .$ .$ .$ .$N# .$' .$2N< /"M .$Q .$Z .%^ .%g /"p .%t .%N /" .,% .*% .<% .:% /" .N% .L%NN .a% ._% .q% .o% N" .%& .%1N; /"L .%P .%Y .%] .%f /"o .%s .%~O /# .% .% .% .% /# .% .%OO .& .& .& .& O! .)&% .'&0O: /#K .<&O .:&X .T&\ .R&e /#n .f&r .d&}?O /*# .y& .w& .& .& /*# .& .&?O?O .& .& .& .& ?O  .&$ .&/ /:#< .&@ .&I .&M .&V .'Z .'c .'g .'p .,'t .*'}?O?O?O .>' .<' .O' .M' .O' .M' .O' .M' .>' .<' .`' .^' O /J#& .p'* .n'3 .'7 .'@ /J#I .'M .'XObO .' .' .' .'O .' .'O /Z# .' .' .' .' /Z# .( .( O /m#% .() .(2 .((6 .&(? /m#H .:(L .8(WOaO~ .L( .J( .\( .Z(O .n( .l(O /}# .( .~( .( .( /}# .( .( O /#$ .(( .(1 .(5 .(> /#G .(K .(VO`O} .( .( .) .(O .) .)O /# .%) .#) .=) .;) /# .O) .M)O /## .i)' ._)0 .)4 .)= .)A .)J .)N .)W .)[ .)` /#i . *m . *v .*z .*O /# .<* .4* .b* .^* /# .* .z*OO .* .*OO .* .*+ /#4 .*8 .*APKPc .*g .*p .*t .*} .* .*4P /# .* .* .* .*4P .+ .+\P /$ .'+ .+ .M+ .I+ .m+  .i+) .+- .+6 .+: .+? /$H .+L .+U .+Y .+b\Pl /$| .+ .+ ., ., /$ .6, .0,fPfP .U, .S,fPfP .d, .b,  /($ .s, .q, uP*uPB .,F .,O .,S .,\ .,` .,mPwP ., ., ., .,P ., .,P /8$ ., ., ., .,  .- .- .- .-! /8$* .9-. .#-<PFPb .-f .-t .-x .-QQ .- .-QQ .- .- /K$QQ .- .-$ .-( .-5Q? /a$T .-X .-a /a$j ..n ..yQ /t$ .. .. .. .. .. .. /t$ .*/ .(/Q /$ .=/ .7/ .g/ .a/ ./ ./  /$ ./ ./  ./$ ./- ./1 ./:QD /$U .0Y .0b .#0f .0k /$t .D0x .@0 .q0 .a0 .0 .0q q q q q q q 2q Gq \q qq Q Q /$ .0 .0QQ .1 .1 .)1 .'1( .)1, .'19dQC /%S .<1W .81` .T1d .R1m /%v .y1z .c1yQ /% .1 .1 .1 .1 /% .#2 . 2yQ /.% .2 .2 .2 .2 /.% .2 .2Q' />%7 .L3; .J3D .\3H .Z3Q />%Z .3^ .k3iQsQ .3 .3 .4 .4Q .+4 .4Q /N% .4 .4 .4 .4 /N%  .4 .4Q# /^%4 .T58 .R5A .d5E .b5N /^%W .5[ .s5fQpQ .5 .5 .6 . 6Q .46 .66R /n% .6 .6 .6 .6 /n%  .6  .66R" /~%3 .i77 .g7@ .z7D .x7M6Rb .7f .7qXR{ /% .08 .(8 .k8 .e8 .8 .8 /% .8 .8XR /% .8 .8 .9 .8 .'9 .#9 /%  .H9 .D9 .i9 .e9% .9) .92XR< /%M .9Q .9Z .9^ .9c /%l .9p .9y .:} .9 .r: .n:       * ? T i {`R R /& .: .:RR .:  .: .: .:  .:$ .:1R; /&L .:P .:Y .:] .:f /&o .;s .;~R /.& .; .; .; .;R .; .;R />& .h< .`< .< .<  .< .< />& .<" .<+R5 /f&E .=I . =R .;=V .5=_ ._=c .[=h /f&q .=u .|=~ .= .= .= .=R /& .= .= .= .= /& .> .> .M> .9> .> .>  # 8 M b {     S *S5 /&> .>B .>KSH /&Y .@] .@f .@j .@s .Aw . A| /& .EA .CAS /' .XA .RA .A .|A .A .A /' .A .A .A .A . B .BS  /0' .#B .B' .@B+ . .GG .GK .GT .GX .GeTo /.( .G .G .G .G /.( .H .GT />( .H .H .H .HT .H .H T /N(& .>I* .6I3 .yI7 .sI@ .ID .II /N(R .IV .I_Ti /v(y .I} .I .J . J .5J .1J /v( .VJ .RJ .wJ .sJ .J .JT /( .J .J .J .J /( .J  .J .K . K  .K$ .|K- B W l        T3 NUh /(q .Ku .K~#U#U .K .K .K .K .K .K[U /( .K .K .K .K /(  .%L  .L[U" /(3 .L7 .L@ .LD .LM[Ub .Lf .LqeU{ /( .\M .VM .M .M .M .M /( .M .MlUlU .M .M . N .N .!N  .N .2N .0N .CN# .AN, .gN0 .QN9lUClU` .Nd .Nm .Nq .Nv /) .N .N .O .OU  /%) .~O .vOUU .O .O  .O .O .O .O*U4 /<)E .OI .OR .OV .O_ /<)h .Ol .OwU /L) .hP .fP .yP .wPU .P .PU /\) . Q .Q .FQ .@Q  .nQ  .fQ  /\)  .Q  .Q$ U.  /)>  .QB  .QK  .QO  .QX  .R\  .Qa  /)j  .#Rn  .Rw  .DR{  .@R  .eR  .aR U  /)  .}R  .yR  .R  .R  /)  .R  .R  .R  .R  .BS  .>S K  K  K 1 K F K [ K t K K K K K U ^  "V-  /)6  .cS:  .[SC 4VM 4Ve  .Si  .Sr  .Sv  .S  .S  .S lV  /)  .S  .S  .S  .S  /)  .S  .S lV  /)  .+T  .)T  .) ,|) ,) ,) ,.) ,) ,) ,) ,k* ,| * ,* ,"* ,-* ,:* ,KM* ,eZ* ,+g* ,* ,w* ,c* ,z* ,* ,* ,* ,K* ,+ ,)+ ,3@+ ,[+ ,Kh+ ,K+ ,+ ,#+ ,+ ,Ό+ ,h+ ,I+ ,*, ,;, ,+, ,?$, ,K/, ,.:, ,qE, ,lR, ,], ,h, ,s, ,g~, ,, ,ː, ,, ,), ,}, ,, ,3, ,, ,, ,, ,>, ,|- , - ,- ,.#- ,.- ,9- ,D- ,kO- ,|Z- ,e- ,p- ,{- ,- ,K- ,e- ,+- ,- ,w- ,c- ,z. ,. ,. ,(. ,K5. ,o. ,. ,}. ,a. ,Z. ,. ,. ,G. , . ,. ,. ,/ ,/ ,ō/ ,1)/ ,6/ ,<F/ ,L/ ,nR/ ,څX/ ,<_/ , o/ ,u/ ,{/ ,/ ,M/ ,/ ,#/ ,/ ,Â/ ,U/ ,ٖ/ ,/ ,/ ,8/ ,/ ,/ ,/ ,/ ,k/ ,u/ ,/ ,0 ,0 ,(0 ,150 ,FB0 ,O0 ,֘\0 ,!i0 ,v0 ,0 ,z0 ,f0 ,0 ,0 ,0 ,]0 ,80 ,1 ,ъ$1 ,є;1 ,`C1 ,Ճ[1 ,m1 ,1 ,1 ,1k1 .g1 .g1 ,Z1 .g1 .g 2 . h2 .h2 ,.2 .(h"2 . h'26k<2 ,ՑF2 .LhJ2 .JhS26k\26kt2 .[hx2 .Yh2 .jh2 .hh2 .jh2 .hh21k2dk2 ,2pj2 .h2 .yh3 .h3 .h3 .h3 .h 3 /3)3 ,33 .h73 .h<3 /3A3 ,|M3jb3 ,Rl3 .!ip3 .iu3 ,T3 .2i3 .0i3j3 ,ۇ3j3 ,S3 .Ci3 .Ai3 ,3 .Ti3 .Ri3j3 ,3j4 /34 .ii4 .ci 4 .i$4 .i)4jU4j^4 /3m4 .iq4 .iz4 .i~4 .i4j4j4 .i4 .i4j4 ,i4j4 .i5 .i5 .i5 .i5 ,%"5 .j&5 . j45 .2j85 ..jG5 .LjK5 .JjP5 /3Y5 ,c5 .`jg5 .^jl5 /3u5 ,|5j5j5 .yj5 .wj5j5j5 .j5 .j5Bj5 ,$}6 ,-6 ,AT6 ,q6 ,\6 ,э6 ,e6 ,6 ,э6 ,6 ,6 ,g6 ,6 ,r6 ,7 ,17 ,J7 ,c&7 ,|27 ,:7 ,K7 )45Q7 ,0V7 -n3Z7 -G3^7 /!@j7 *Gq7 ,[7 ,7 ,+m7 ,7 ,d7 ,7 ,7 ,;7 ,j7 ,7 ,}8 ,V8 ,)8 ,78 ,@~<8 ,J8 ,h8 ,8 ,Ds8 ,18 ,څ8 ,8 ,X8 , 9 ,*9 , 9 , ;,9 ,Y89 ,)D9 ,P9 ,\9 ,o9 ,Qv9 ,6a{9 ,B9 ,y9 ,9 ,~9 ,29 ,79 ,9 ,9 ,9 ,9 ,֚: , : ,: ,E#: ,~n/: ,mZ;: ,#L: ,X: ,_d: ,p: , |: ,: ,7: ,5: ,C6: ,$d: ,r: ,: ,: ,: , ; ,; ,$; ,7; ,JD; ,qR; ,_; ,l; ,yf; ,+; ,; ,I; , < ,< ,@'< ,/5< ,{C< ,Q< ,_< ,m< ,Q{< ,< ,< ,< ,(< ,< ,v< ,:< ,Ȃ< ,r< ,Λ= ,F= ,&= ,<4= ,@B= ,P= ,N^= ,Nl= ,z= ,A= ,= ,#= ,M= ,p= ,= ,}= ,g= ,z > ,> ,(> ,`7> ,F> ,TU> ,gd> ,b> ,> ,> ,> ,<> ,> ,s> ,gm> ,7> , ? ,? ,d)? ,~8? ,G? ,ZV? , e? ,^tt? ,? , ? ,'? ,G? ,P? ,Կ? ,r? ,_:? ,? ,& @ ,@ , (@ ,/7@ ,|F@ ,zU@ ,?d@ ,?s@ ,@ ,C@ ,}@ ,@ ,@ ,n@ , @ ,]@ ,i@ ,c A ,A ,tL1A , >A ,UA ,bA ,A ,A ,A ,A ,^A ,aA ,B , B ,`-B ,O6B ,>B ,KB ,1YB ,eB ,xrB ,B ,B ,B ,B ,B ,B ,dB ,B ,IB ,C ,eC ,;"C ,R?C ,*dKC ,!wWC ,dC ,qC ,`~C ,ޟC ,C ,tC ,C ,RC ,Sn D ,ND ,Y%D ,v2D ,D ,.D ,kND ,$D ,jD ,D ,0 E ,E ,g%E ,=E ,9JE ,ͷWE ,,dE ,~qE , E ,E ,E ,.E ,E ,QF ,?F ,"F ,80F ,!>F ,LF ,ZF ,EhF ,yvF ,LF ,F ,wcF ,|F ,:F ,VF ,BF ,F ,d?F ,G ,<G ,#G ,,G ,:G ,HG ,VG ,dG ,CrG ,8G ,ZG ,G ,wG ,#G ,_G ,G ,G ,7G ,eH ,H ,7H ,ߏCH ,.PH ,]H ,kH ,xH ,H ,H ,BH ,H , I ,I ,*d)I ,jDI ,SRI ,I ,BI ,I ,,rJ ,xJ ,J ,J ,J ,DJ ,DJ ,*d*K ,jK ,DyK ,XK ,TK ,pK ,ݰK ,K ,RK ,K , L ,L ,>L , dL ,\bqL ,L ,RdL ,L ,L ,RL ,|L ,6L ,sL ,L ,M ,*dM ,t7M ,CM ,;SM ,D8aM ,SoM ,5}M ,'M ,#M ,M ,A:M ,M ,nM ,M ,"M ,M ,l N ,BN ,J%N ,3N ,MAN ,KON ,JN ,N ,NN ,N ,N ,N ,N ,N ,O ,=O ,_!O ,=0O ,d?O ,NO ,o]O ,lO ,E{O ,O ,O ,4O ,_O ,O ,mFO ,xO ,nO ,P ,nP , P ,/P ,>P ,MP ,\P ,kP ,4zP ,P ,P ,P ,HP ,PP ,#P ,P ,Q ,7Q ,Q ,.Q ,=Q ,xLQ ,9[Q ,ejQ ,yQ ,Q ,'MQ , Q ,KQ ,Q ,Q ,Q ,=Q ,M R ,dR ,o)R ,9R ,zIR ,g YR , iR ,ayR , R ,R ,R ,R ,TR ,CR ,R ,eS ,=S ,S , .S ,=S ,LS ,+J[S ,oGjS ,CyS ,S ,S , S ,|S ,GS ,S ,AS ,S ,BT ,T ,T ,-T ,wiT ,yT ,4T ,$T ,OT ,T ,&T ,T ,T ,DT ,U ,5U ,w,U ,b;U ,JU ,tYU ,hU ,KwU ,U ,NU ,U ,U ,U ,U ,U ,%U , U ,2 V ,V ,.+V ,A:V ,IV ,]XV ,xgV ,vV ,V ,V ,V ,3V ,V ,V ,V ,V ,xV ,i W ,wW ,*W ,9W ,HW ,ھWW ,<fW ,[uW ,W ,W ,W ,W ,@W ,][W ,W ,W ,W ,y X ,KX ,E)X ,̸8X ,GX ,VVX ,eX ,tX ,kX ,X ,"X ,-X ,݉X ,X ,^X ,@X ,KX ,'i Y ,Y ,)Y , 8Y ,GY ,]VY ,eY ,tY ,Y ,*EY ,b;Y ,Y ,Y ,Y ,Y ,POY ,Y ,m0 Z ,Z ,M)Z ,8Z ,9GZ ,>TVZ ,eZ ,6DtZ ,nZ ,Z ,}Z ,pZ ,Z ,Z ,Z ,Z ,Z , [ ,*[ ,(g([ ,7[ ,gF[ ,JU[ ,cd[ ,Ss[ ,/:[ , [ ,[ ,[ ,zR[ ,5[ ,{[ ,[ , \ ,G\ ,` ,I` ,` ,L` , ` ,` ,{5` ,a ,[a ,Ca ,pa , ;a , a ,:&a ,9,a ,62a ,58a ,A>a , Da ,&[a , 6la ,a ,Ma ,Ba ,a ,(a ,ga ,a ,eWa ,a ,a ,ra ,%a ,dna ,a ,:a ,a ,a ,^b ,pb ,N b ,b ,b , Xb ,|%b ,O+b ,1b ,"7b ,LCb ,gSb ,$bb ,qb ,xeb ,b ,b ,Bb ,'b ,ɟb ,^b ,*b ,Lb ,c ,jc ,|%c ,4c ,tCc ,tRc ,1ac ,pc ,c ,c ,c ,c ,tc ,Ŀc ,luc ,c ,Ac ,߃d ,d ,>%d ,4d ,Cd ,Rd ,ad ,}pd ,8d ,d ,d ,d ,d ,>Qd ,زd ,@d ,d ,Ice , e ,&e ,2e ,>e ,Ke ,fe ,te ,Jme ,ɧe ,Ne ,f ,Sf ,Agf ,g ,g ,& g ,N,g ,9g ,pg ,!g ,Ng ,Zg ,Jg , h ,,%h , 2h ,?h ,rh ,h , h ,h ,h ,h ,8h , )h , i ,-i ,Qv&i ,[4i ,EAi ,Oi ,Roi ,i ,i ,i , i ,i ,i ,vi , i ,j ,S<j ,#j ,H1j ,l?j ,L_j ,mj ,d{j ,j ,j ,hj ,j , j ,nj ,gj ,k ,&k ,*k ,v7k ,Dk ,k ,ik , k ,k ,k ,k ,q ,!Kq ,Yq ,iq ,poq ,ӟvq ,_q ,?q ,q ,Iq ,gq ,q ,Kq ,q ,Ir ,r ,k r ,-r ,Gr ,GKTr ,bar ,5nr ,r ,/r ,r ,%r ,Ir ,r ,r ,r ,r ,r s ,Z| s ,>s ,YJs ,Ws ,;es ,qs ,B~s ,,s ,s ,ns ,s ,|s , s ,E#s ,Gt ,|t ,7t ,Ct ,Ot ,.`t ,lt ,@~t ,ft ,t ,~t ,t ,_Nt ,@t ,t ,qt ,u`u ,7u ,_N(u ,@5u ,u`Lu ,_NYu ,@fu ,su ,u ,iu ,ԥu ,u ,lu ,Wu , u ,{uu ,2v ,#v ,W)v ,@5v ,"Av ,S-Mv ,"cv , @v ,v ,v ,bHv , v ,>v ,v ,yv ,e w ,1 w ,G"w ,8w ,<;Ew ,eRw ,w_w ,\mw ,*w ,w ,*w ,?w ,|w ,`$w ,Bw , w ,<x ,tx ,*."x ,/x ,y ,Ey ,y ,z ,z ,)z ,s6z ,:pDz ,Qz ,B^z ,kz ,uxz ,z ,ɟz ,z ,Cjz ,Wz ,z ,z ,Cjz , { ,w{ ,Cj%{ ,`:{ ,CjG{ ,U{ ,,Dx{ ,-{ ,{ ,A{ ,|{ ,G{ ,{ ,*{ ,{ ,z{ ,D| , | ,f| ,| ,Cj,| ,q:| ,V| ,|d| ,Gr| ,| ,P| ,| ,/| ,.| ,]s| ,_| ,| ,| ,G} ,} ,} ,D}+} ,P9} ,cG} ,PU} ,c} ,%Nq} ,} ,} ,} ,{} , b} ,a} ,} ,} ,~d} ,~ ,~ ,g~ ,t*~ ,z8~ ,S9F~ ,$ T~ ,Ҍb~ ,2Vp~ ,d~~ ,~ ,~ ,x~ ,~ ,J~ ,~ ,۸~ ,c~ ,Ab~ ,{  ,y ,' ,7 ,əE ,T ,b ,p ,W4~ ,Xo ,J , , ,vS , , , ,W ,  ,CS ,i|& ,hU4 ,B ,ZP , ^ , ,Z ,w ,M , ,%)À ,;р ,J߀ , , ,r' ,E5 ,D ,R ,` ,nn ,X(| ,? ,l , , ,jā ,ԁ ,V ,2Z , ,  ,}$ ,+4 ,C ,N6_ ,ԭm ,SP{ ,^ ,| , ,҂ ,: ,b ,A  ,K ,& ,w4 ,D ,٫k ,mAy , ,  ,N ,Ƀ ,NӃ , ,P , ,T  ,:6 ,P8' ,U5 ,zC ,eAQ ,N_ ,m ,{ ,ٶ ,P , , ,Ԅ ,| ,; , , ,#" ,B / ,aJ ,m ,@z ,  , ,O ,#΅ ,۰ۅ , ,!  ,! ,' ,7 ,) ,J`6 ,0wC ,P ,] ,j ,lIw ,\ ,Я ,5 ,`> , ,ņ ,x#҆ ,*߆ ,[  ,# ,, ,cF ,S ,f ,V ,h ,^ , , ,ڇ ,O , , ,g  ,KI ,# ,|0 ,\= ,J ,W ,ѽd ,q ,r~ , ,5 ,7 ,dN ,cƈ ,ӈ ,| ,s , , ,B ,! ,8. ,mY; ,OH ,U ,b ,o ,~ , ,p , , ,‰ , ۉ ,\A ,> , ,B ,+|! ,j= ,|WK ,_Y ,|g ,Gu ,W , , ,Ծ ,A ,Ɋ ,׊ ,q ,3 , ,a ,I ,'5+ ,}9 ,GG ,XU ,c ,Oq , , ,v ,4. , ,=ŋ ,MeӋ , ,tZ ,Z ,  , ,' ,Ӛ; ,1H ,U ,|b ,zo ,[ ,% , , ,w ,ƌ ,Ԍ ,P , ,X ,+S  , ,( ,K6 ,ݗJ ,T ,a ,n ,{ ,@ , , ,C ,@ ,Eύ ,xލ ,c ,z , ,kV ,0  ,F. ,#< ,J ,&X ,'f ,t ,! ,l , ,ˆ , ,Ύ ,Fݎ ,Ν , ,<  , ,+/ ,9 ,3GG ,<U ,Rc ,M)w ,W , , , ď ,Ώ ,N , ,) ,07 ,:E ,S ,Fa ,o ,} ,B ,9j , ,$, ,ˁÐ ,tѐ ,ߐ ,/ ,54 ,l  ,o ,g% ,C3 ,&CA ,}P ,/_ ,Un ,} ,A ,! ,b ,^ ,iʑ ,ב ,sh ,2 ,ޥ  ,8 ,% ,ֆ2 ,}? ,L ,yY ,kf ,s , , ,B , , ,Ē ,d ,OT , ,  , ,3 ,xeA ,O ,] ,FJk ,qy ,f ,3 , , ,v ,ۓ ,ɟ , ,O ,,  ,44 ,{A ,N ,hU[ ,to ,v| ,s , ,c ,d , ,J˔ ,Ք ,=ߔ , ,  ,V  ,x+ ,% ,#3 ,A ,T ,.b ,Wp ,&~ ,L , , , ,ĕ ,kҕ ,s , ,d ,I ,])) ,7 ,D ,,Q ,/j^ ,Lm ,z ,@ ,> ,_ , ,Ȗ ,Ι , , ,I$ ,1 ,]D ,lQ , ^ ,kk ,Hy , , , , ,; ,QǗ ,t , ,a ,r ,w ,r$ ,8&2 ,N ,\ ,*j ,Ax , ,6  , ,. , ,nɘ ,p֘ ,~ ,+  ,v 1 ,> , K ,X ,e ,Wpr ,q> ,& , ,] ,L ,S ,hd͙ ,_ڙ ,S ,GL ,q ,  ,- ,yfE ,DQ ,u^ ,k ,x ,I , ,ǚ ,Ԛ , ,w , # ,   , ,)6 ,ߥF ,QL ,tR ,`X ,*9^ ,1e ,pr , , , , ,J ,ԛ ,0 ,, , ,| ,Q( ,5 ,UC ,P ,; ] ,j ,Ww , , , ,Ԫ ,µ͜ ,8sڜ ,]) , ,I , ,: ,> ,g$ ,kj* , 0 ,6 ,A< ,B ,H ,N ,HT ,JZ ,8` ,f ,l ,r ,$y ,N ,  , ,+ ,Cq ,A ,L ,Ý , , , ,* ,J< ,aI ,wV ,fc ,C} ,: ,Ȟ ,֞ ,H ,, , ,  ,0 ,(% ,݁2 ,0? ,L ,[ ,Xj ,x , , ,͟ ,"ڟ ,| ,݁ , , ,! ,E. ,H ,UU ,>h ,Au ,? ,; ,R ,n) , ,à ,pР ,(ݠ ,݁ ,j , ,{, , ,`+ ,8 ,׿E ,R ,_ ,m ,0q{ ,V , ,= ,ס ,  ,E? ,z ,ݦ ,%9* ,87 ,ݦN ,[ ,ݦr ,~ ,.+ , ,F ,a͢ ,{ڢ ,Gt ,) , ,  ,: ,, ,$ ,+ ,Uq; ,A ,eG ,wM ,jT ,Ya ,n ,{ , , , i ,£ , У ,@ ,a ,Y  ,I ,'% ,Δ2 ,^? ,L ,g ,x , ,5 ,¤ ,Ф ,ڤ ,9 , ,| ,< ,% ,c2 ,AM? ,=Y ,f ,s ,{ ,1; , ,* ,b ,M ,1;̥ ,])٥ , , ,p  ," ,g' ,N~4 ,A ,N ,[ ,uh ,Tu , ,  , ,  , ,ԖΦ , ,ו ,D ,2$ ,: ,F ,b , }u , , ,@ ,ߣ ,Uͧ ,ê , ,] ,k , ,m9 , F ,*dS ,` ,z ,Q ,; ,+Ө ,ߨ ,q , ,ו* ,Da ,n , , , } , ,qʩ ,ة ,R ,Rd ,ڠ ,, ,2: ,һH ,V ,d , , , , ,ƪ ,;Ԫ ,]~ , ,Lw  , ,; ,J ,n"n ,V , , , ," ,aEƫ ,){ԫ , , ,٪ ,  , ,v. ,< ,+J ,GX ,GOf , t ,ʫ ,: , ,ɬ ,p׬ ,@ ,H , ,nQ , ,- ,"; ,I ,"b ,F p ,] ,C ,w ,ۭ , ,.N , ,: , # ,1 ,k? ,X M ,[ ,ii ,Uw ,p ,U ,@ , ,@ ,]ˮ ,ٮ ,n ,  , & ,@ ,Y ,<g ,,u , ,E , ,¯ ,Я ,zޯ ,q_ , ,@ ,$ ,)2 ,o@ ,^N ,\ ,u0j ,VMx ,a , , ,6 ,i ,0Ͱ ,ɻܰ ,Ƣ , ,  , ,g' ,6 ,E , T ,pwc ,_r ,˚ ,: ,I ,T{ ,k?̱ ,W۱ , ,# , Z ,y ,& ,5 ,D ,S ,Ab ,Qq ,x# , , , ,z ,-˲ ,_ڲ ,JW , , ,C , I% ,Z4 ,C ,PR ,6 , ,^ , ,ըó ,,ѳ ,߳ , , , ,D ,NR ,Rd| ,i  ,1C ,u ,Y ,\ , , ,w ,k/ƴ ,-(̴ ,R#Ӵ ,zڴ ,&_ , ,t ,  ,!  , ,P$ ,1 , ? ,HUL ,Y ,<w , ,; , , ,?A ,>̵ ,'۵ , ,-t ,* ,* ,D ,<ڶ ,CY ,w , ,8  ,=U ,]c ,B ,h ,> ,@ , ,jŷ ,Է ,B ,m , ,ϲ  ,&q ,( ,ػ6 ,D ,.R ,@a ,p , ,͸ ,1۸ , , ,S. ,< ,|J ,X ,pf ,zlt ,n , ,B ,u , ,mٹ , , , ,S2 ,v@ ,N ,\m ,D~ , , ,TQ ,C ,+ ,@ ,c  ,F ,۷Ϻ ,ݺ ,_ , ,? , ,# ,J1 ,? ,WdM ,[ ,9i ,Mw , , , ,M ,@ ,˻ ,kٻ ,v , ,HU ,( ,$ ,3 ,C ,^R ,a ,7p ,dB ,Z ,d^ ,tC ,ۚ ,ʼ ,ټ ,J , ,SR ,` ,c n ,e" , , ,i# ,˽ ,Kfٽ , , , ,s ,ή  ,. ,5 ,R , , ,  ,}¾ ,.Ͼ ,ܾ ,+ ,< ,J ,nD ,ϫQ ,^ ,])k ,.x , ,n ,L ,` ,`Ŀ ,Kuѿ ,*޿ , ,X ,? , ) , 3 ,@ ,"M ,0g ,t ,? ,B  ,*d ,ϫ ,$ , ,| ,V ,v ,c  ,:- , Q; ,#H ,<U ,h ,cu ,, ,i , ) ,0. ,; ,H ,f[ ,7Uh ,u ,f , ,7U ,վ ,8A ,  ,Rp ,$ ,ޓ ,  ,[# ,z2 , @ ,CN ,\ , ,| , ,c ,) ,/P ,Dn ,6 , ,  ,d$ ,@2 ,@ ,UN ,s\ ,j ,>x ,6 ,  , ,0 ,  , ,' ,5 ,+E ,#U ,9e ,u ,9 , , , , ,w ,]) ,mS ,~  ,! , . ,q< ,pI ,V ,yfw , ,| ,U ,W ,T , , ,@0 ,s< ,U'Y ,<e ,ZVq ,Mn ,L ,  ,t ,{ , , , ,,  ,| , , , ,B\/ ,2< ,U$b ,^r ,)w ," ,u , ,* , , , ,- , ,  ,έ  ,. ,< ,qJ ,coX ,f ,t , ,e ,* ,= ,2 ,Z ,pv ,D ,֓ ,H ,= , ,"* , 8 ,F ,T ,ݹb ,p ,0 ,bq , , ,/ ,$/ ,A ,? , , ,' ,\> ,2M ,\ ,ek ,<-z , ,@ , ,\ ,{ ,߫ ,\ ,k , , ,! ,. ,j ; ,H ,߯` ,Մp ,#~ ,= ,` , ,A ,ِ , , , , ,F  , ,& ,ק4 ,B ,cP ,^ ,l ,=kz , , ,^ , x ,! ,!a , ,M , , ,Ɛ ,7% ,94 ,xC ,S ,@b , q ,< ,  ,m ,I , ,r , ,~ ,. , ,4 ,)% ,G4 ,C , R , a ,gJp ,3 , ,M ,h , , , , ,4  ,G ,z- ,N= ,$C , ,& ,3 ,;@ ,fM ,t ,ul ,L ,L ,e= ,1 ,> ,` ,!m ,:6 , ,R , ,| ,`Q ,m ,n ,\ , ,  , % ,2 ,<K ,X ,@e ,wr ,e= ,[ ,? ,< ,- ,W  , ,< , ,+ ,E ,X ,| ,5 , , , ,9 , ,C ,   , ,])' ,IS7 ,F ,T ,;b ,p ,'~ ,  , , ,U\ ,s , , ,$, ,!  , ,b+ ,: ,I ,zX ,Kg ,0v , ,\ , , ,x ,= , ,b , ,  ,A ,_X+ ,(: ,\I ,gv ,Q ,N ,! , ,P ,0 ,e ,n ,A ,{/ ,` ,#( ,? ,ZL ,ks ,2n ,T ,*d , , , ,i , ,])  ,D ,ԂQ ,qk ,* ,U ,'Y ,u , ,T ,  ,*d , , ,- ,; ,qT ,g ,q , ,6/ ,_ , ,y ,s ,ݞ ,Ƣ ,c ,f ,[ ,# , O ,`yr ,9 , , ,h ,z ,Y , , , ,Z , ,c! ,V. ,>r; ,'H ,U ,޴b ,i ,ש , r ,ư ,Wf ,2 ,f ,$ ,o  ,P ,%% ,)3 ,N@ ,|M ,GZ ,h ,u , ,4 ,f , , , ,y ,#n  , ,|W. ,< ,I ,ưV , rc ,p ,Qa~ ,g ,W ,ڊ ,O , , , ,M ,  , ,\ , ,J) ,{6 ,C ,qQ ,2^ ,fk ,$x ,o , ,t ,i ,0 , ,; , ,^ ,v ,(R , ,$ ,2 ,*@ ,ON ,j}\ ,2j ,Zx ,S ,ȥ ,ȟ , ,5 ,~T , ,G , , R , ,O" , 6 ,@ ,+M ,f[ ,Wh ,u ,G ,H ,q , ,6 ,d ,5  , ,;: ,F ,[ ,g ,| ,J ,' , , , ,| , ,p ,e ,, ,f: ,H ,;V ,d ,r , , , , , ,g ,k , ,H ,  , ,&* ,89 ,=H , W ,Xt , ,j ,! , ,a , , ,@ , ,  , ,( ,?7 ,=F ,}U ,XLd ,Q , ,|) , ,6 ,| ,E; ,S ,+ , ,4$& ,5 ,BD ,S ,c b ,$*q ,y ,C^ , , ,@| ,,f ,5 ,3  ,]). ,>; ,|H ,BU ,bb ,p ,' ,> ,s ,G , , , ,a@ ,A ,FB ,e% ,OK5 ,\; ,&A ,G ,hM ,S ,@c ,iq ,>} ,il , ,Ш , ,>L ,B ,uW ,  ,p ,$ ,MZ1 ,B,> ,W ,d ,pr ,L ,DC , , , ,N , ,Q ,R ,ͪ ,] ,^  ,L. ,< ,xJ ,RY ,| , ,5 , , , ,  ,I , ,*d , ,*  ,- ,=]: ,G ,`T ,Ya ,]n ,{ ,e ,; ,z ,v ,i , , , ,I ,߷ ,=  ,f , ,- ,L ,>  ,y. ,@= ,MK ,Y ,;g ,u , ,z ,f , ,q> ,* ,s , , ,C! ,p/ ,*= ,QEK ,Y ,nMg ,u ,bb , ,) ,a  ,lq , , , ,[ ,P , , ,Z, ,w| ,z , ,=- ,w; , ,b , ,' ,I/ ,  ,.  , , ' , 5 ,C ,ryQ ,u_ ,m ,p{ , ,B ,p , ,k , ,, ,Y , ,o& ,t3 ,@ ,qM ,Z ,gg ,t ,J , ,0, ,ڋ ,? ,}B , ,͒ ,x ,< , ,! ,L< ,^J ,mX ,6f ,.t ,M ,{a , , , ,Η , ,/  ,Y% ,i2 ,_ ,'l ,y ,{ ,( ,i ,7 , ,# , ,W ,. ,ū ,a  ,j ,( ,6 ,D ,LR ,+` ,n ,e| ,D , , , ,. ,Y ,7 ,? ,s ,k , ! ,<< ,I ,cV ,c ,Ip ,} ,\k , ,m , ,| , ,9 ,Ҝ ,Y0 , , ,! ,N / ,J= ,?K ,Y ,:xg ,dPu , ,i ,` ,Դ ,J ,2 ,x ,R ,y ,$  ,z ,  ,&* ,8 ,F ,b ,~ ,!  ,b , , , ,Q ,k ,4r , , ,. , < ,LI ,FV ,^.} , & , ,o ,R> ,u , , , ,? ,# ,f1 ,b? ,bM ,5[ ,hyi ,w ,B ,]  , ,u , ,1 , ,u ,8 , , ,| ,- ,; ,I ,W ,z ,a ,* ,  ,9 ,z , ,J ,L ,Λ ,߮ ,/ ,+ ,Ä8 ,E ,R ,C_ ,l ,y ,< ,½ , ,? ,pT ,- ,^ ,. ,T ,V , ,) ,7 ,SD ,kQ ,4^ ,ik ,x ,k , ,|7 ,, ,$ , , ,# ,MH ,Z ,,( ,Q6 ,D ,X ,b , , ,Vx ,\ ,g , , ,p , ,Ǥ ,v ,. ,b , ,* ,| , , ,F  ,9 ,F ,S , ,' ,w ,+ ,2 ,bZ ,ik , q ,/Kw ,* ,‘ , ,ͺM ,Z ,@g ,t , , , ,p , ,Q ,_ ,TY ,E ,) ,6 ,dC ,E P ,] ,X<j ,Zw , ,( ,  ,m , , ,- , ,P ,, ,L  ,+ ,+ ,o9 ,@H ,%T ,p ,~ , ,D , , , , ,Po , ,i , ,  ,8| ,L3 ,@ ,>*M ,[ ,9h , u ,e ,0 , ,6 , ,U ,| ,b , ,@ ,T) ,6 ,U ,b ,MZ ,? ,: , , , ,: ,B ,T ,ٲ  ,# ,"' ,85 ,C ,rbQ ,!_ ,Lm ,|{ , ,'O , ,< ,8 , , ,b  , ,s% ,3 ,*A ,<O ,%] ,k ,{ , , , ,9u , ," , ,*d ,S ,  ,U ,  ,= ,wQ ,]6^ ,@k , ,F ,J , ,< , , ,){ ,8 ,A ,!  ,> ,' ,|g ,4u , , , ,< , ,p`  ,M ,, ,B9 ,4F ,/S ,` ,am ,  ,W ,  , ,!3 ,Vt ,G ,r ,@ ,4! ,. ,@U ,hb ,;o , ,N ,. ,( ,n5  ,#G ,$d ,Zq ,? ,y , ," ,i ,( , , , ,p`+ ,D ,3ER ,\ ,Ii ,<v , , , ,? ,.< ,M ,ªS ,Y ,)_ ,f , ,? ,G ,g ,s- , , ,̐ ,r ,Ț ,I  ,d4 ,n ,Ox , ,L ,eC ,,/ ,b ,Ȧ , , ,ƽ  ,X ,zU& ,z3 ,(X@ ,;M ,hZ ,[x ,m , , ,l[ ,o ,b ,S ,A ,` ,9 , ,  , , ,s: ,pG ,d ,q ,$^~ ,7 ,t ,; , ,r , ,p` , ,v ,*d, ,n: ,H ,V ,sd ,Er ,  ,<7 ,, , , , ,W ,Dp ,u! ,! ,&! ,5! ,AD! ,S! ,b! , q! , ! ,! ,[! ,#! ,"! ,s! ,B! ,j! ,G" ," ,$" ,Ϋ4" ,WD" ,eLT" ,d" , t" ,|K" ,H" ," ," ,2S" ," ,Ѷ# ,# ,y&# ,-3# ,*A# ,>fM# ,[# ,٘i# ,w# ,# , <# ,n# ,Q# ,ծ# ,# ,׍# ,r # ,2Q# ,$ ,$ ,¦$ , -$ ,K;$ ,:I$ ,X W$ ,$ce$ ,s$ ,$ ,O$ ,IM$ ,&$ ,>>$ ,_$ ,$ ,O$ ,$ ,[ % ,>% ,Q% ,% ,-!% ,Ь(% ,6% ,D% ,R% ,`% ,In% ,)|% ,N% ,DP% ,_% ,x% ,% , % ,x% ,% ,<% , & , & ,+& ,]:& ,I& ,tW& ,e& ,s& ,@& ,֗& ,"& ,& ,l& ,P& ,{_& ,nD& ,y& ,G ' ,' ,L(' ,6' ,>D' ,@R' ,Rb' ,r' ,b' , ' ,' ,t"' , ' ,)' ,Y' ,' ,S( ,d( ,]  ( ,\.( ,<( ,J( ,X( ,f( ,Uu( ,( ,v( ,u ( ,Do( ,RU( ,]( ,@( ,) ,) ,) ,*) ,G7) ,D) ,xQ) ,R^) ,k) ,x) ,) ,) ,) ,WB) ,p) ,b) ,ͨ) ,* ,4* ,*4* ,B* , P* ,^* ,/$l* ,z* ,Y* ,* ,@* ,,* ,* ,x9* ,PS+ ,+ ,4+ ,U,+ ,m99+ ,F+ ,S+ ,`+ ,Wm+ ,z+ , <+ ,!+ , + ,+ ,I|+ ,+ ,@ , ,Q, ,', ,4, ,A, ,N, ,,[, ,Uh, ,m9u, ,, ,, ,, , <, ,s, ,x9, ,3- ,"@- ,@M- ,$lZ- ,x9g- ,Ut- ,F- ,- ,#- ,c- ,>- ,a- , B. ,LO. ,@\. ,si. ,4v. ,F. ,B. ,. ,H:. ,^. , . ,j. ,b. ,. ,*"/ ,// ,< ,> ,> ,;*> ,8> ,F> , T> ,b> ,Jp> ,~> ,7+> ,Ǣ> ,.> , > ,8> ,> ,Q> ,׵> ,hd> ,5 ? ,_? ,]&? ,4? ,-B? ,{bP? ,^? ,Xl? ,Wz? ,R? ,x? ,40? ,p`? ,k ? ,G@ ,  @ ,|@ ,Т'@ ,45@ ,tC@ ,Q@ ,l_@ ,Xcm@ ,}{@ ,@ ,L@ ,@ ,6@ ,y@ ,v@ ,7@ ,%@ ,O@ ,A , A ,!*A ,\CA ,PA ,]A ,jA , A ,hA ,A ,iA ,bA ,A ,EkA ,\A ,*A ,D ,LD ,nZD ,YIhD ,*vD ,D ,K,D ,pD ,wD ,D ,dD ,6D ,cD ,dwE ,AF ,JF ,F , F ,F ,F ,F ,-F ,F , G ,G ,%G ,]2G ,??G ,LG ,kYG ,fG ,lsG , G ,G ,G ,aG ,{G ,H[G ,G ,G ,uG ,H ,QH ,d_,H , 9H , FH ,fESH ,J ,X'J ,4J ,AJ ,NJ ,[J ,UhJ ,|vJ ,[J ,*J ,JJ ,cJ ,J ,LJ ,ZJ ,OJ ,z K ,K ,cK ,%K ,1K ,<GK ,TSK ,&hK ,uK ,K ,K ,K ,%K ,L ,aL , L ,Q.L ,Y ,`MLY ,};Y ,umY ,PY ,Y ,SAY ,kY ,Y ,XZ ,Z ,Z ,*Z ,7Z ,RDZ ,CQZ ,^Z ,nkZ ,}xZ ,Z ,Z ,cZ ,Z ,WZ ,*dZ ,FvZ ,4Z ,j[ ,ƣ[ , [ ,"-[ ,,QG[ ,fU[ ,= c[ ,, q[ ,O [ ,>"[ ,G"[ ,P"[ ,+[ ,[ ,[ ,}`[ ,[ ,j[ , \ ,?\ ,,\ ,J;\ ,OJ\ ,Y\ , h\ ,w\ ,\ ,:\ ,z\ ,u\ ,$"\ ,\ ,9\ ,\ ,b] ,] ,U,] ,-;] ,)FJ] ,Y] ,\h] ,w] ,] ,& ] ,M] ,6] ,d] ,] ,I4] ,KX] ,*A] ,g ^ ,T^ ,+^ ,H:^ ,I^ ,gX^ ,%g^ ,.>v^ ,^ ,^ ,^ ,.^ ,f^ ,^ ,^ ,z^ ,5^ ,B _ ,_ ,=*_ , W9_ ,G_ ,U_ ,c_ ,q_ ,kR_ ,n_ ,Z=_ ,_ ,m,_ ,lc_ ,@_ ,n+_ ,,s_ ,` ,XL` ,$` ,/3` ,|B` ,Q` ,:?`` ,Yo` ,~` ,s` ,` ,d` ,ӷ` ,?c9a ,yIa ,oWa ,SAea ,8a ,a ,a ,aa ,Ya ,a ,Ja ,da , b ,b ,+b ,/:b ,FvIb ,Xb ,Wgb ,c ,1c ,Dc ,"c ,c ,}c ,Zc ,/c ,Hc ,c ,c ,d ,d ,rd ,ȩ+d ,IN9d ,=Gd ,Ud ,"cd ,jrd ,/d ,Ud ,Jd , Fd ,d ,d ,d ,d , d ,1ld ,d ,hd ,e ,])e ,#e ,٢-e ,>>e ,De ,-Je ,3Pe ,Ve ,ߙe ,e ,pe ,e ,\e ,%e ,4e ,e ,e ,f ,};f ,ב!f ,.f ,;f ,J>If ,yVf , cf ,*pf ,2xf , f ,f ,if ,f ,k]f ,f ,Uf ,Qf ,f ,Zf ,f ,f ,f ,Qf ,f ,a4f ,bf ,g , g ,g ,og ,#g ,S"g ,p(g ,1.g ,r4g ,:g ,4R@g ,Fg ,xLg ,Rg ,#Xg ,h.^g ,Idg ,Ljg ,pg ,%hvg ,|g ,g ,g ,ѳg ,wg ,og ,g ,Rg ,g ,Dg ,4g ,g ,;g , ]g ,Tg ,g ,ág ,=g ,g ,(g ,+=g ,W]g ,h ,Gh , h ,?h ,Eh ,lh ,;$h ,*h ,)0h , 6h ,ch ,}4h ,mh ,\h ,xph ,([h ,,h ,ޣh ,K+h ,Yh ,ih ,yh ,^Oh ,qsh ,kh ,ܞh ,i ,~i ,ߺi ,i ,!"i ,7Gi , c_i ,mi ,i ,~i ,<i ,Ei ,0i ,i ,i ,&j ,3j ,Kj ,NYj ,!rj ,j ,Hj , j ,j ,.j ,Xj ,k ,k ,s6*k ,OBk ,JkPk ,7~_k ,)nk ,a}k ,k , k ,k ,wk ,ުk ,k ,fk ,Lk ,l ,ݼl ,C!l ,0l ,{t?l ,vNl ,b]l ,I ll ,"{l ,tl ,l ,Fl ,M5l ,l ,l ,l ,l ,m ,Om , m , /m ,>m ,Lm ,`m ,knm ,|m ,Tm ,m ,zm ,.m ,r m ,,m ,m ,kn ,O;n ,NIn ,!bn ,n ,Hn , n ,n ,.n ,Xn ,n , o ,s6o ,O2o ,Jk@o ,7~Oo ,)^o ,amo ,|o , o ,o ,wo ,ުo ,o ,fo ,Lo ,o ,ݼp ,Cp , p ,{t/p ,v>p ,bMp ,I \p ,"kp ,tzp ,p ,Fp ,M5p ,p ,p ,p ,p ,p ,Oq ,q , q ,.q , ,zgL ,Z ,Fh ,v ,T , ,& , , ,"ʍ ,؍ , ,] ,B ,E ,] ,0 ,M ,@[ ,Jzi ,0w ,7 , ,% ,] ,_؎ ,, ,, , ,@ ,[a ,7t- ,; ,I ,^W ,ie ,Ys ,, ,/ ,n , ,@ ,| ,2 , , ,w(# ,C@ ,ַO ,e^ ,m ,| , ,@ , ,@А ,ސ , , ,լ ,?# ,1 ,:? ,BM ,^[ ,ai ,Tw ,ٲ ,# ," ," ,` ,!ˑ ,Lّ ,ڒ ,1" ,90 ,#= ,K ,QX ,Xe ,@r , ,+ , , , , ,Γ , , ," ,B/ ,X< ,WI ,)aV ,ac ,p ,}} , , ,n ,} ,u ,W͔ ,ڔ ,} ,u , , ,2 ,hX ,ݡ$ ,÷* ,W0 ,6 ,i< ,7B ,{I ,)c ,yy ,E , ,8Õ ,?A , , ,D , , ,' ,4 ,A ,6N ,[ ,i ,q= ,f ,v ,a ,Ɩ ,Ӗ ,r ,ʑ , , ,B ,% ,"3 ,B ,rL ,ʑq ,ˊ~ , , ,  ,<ߗ , , ,d ,εB ,vv , , ,ISʘ ,f٘ ,ag ,f , ,* , 7 ,<J ,$W ,|d ,vq ,~ ,; ,< ,- , ,& ,xP̙ ,ٙ ,V ,q ,= ,Y ,q ,' ,4 ,vA ,VzN ,[ ,Ah ,u ,! , ,C ,  ,0` ,vqÚ ,!К ,yݚ , ,.} , ,p ,}$! ,/ ,= ,;WK ,TY ,g ,du ,/ ,r ,5̛ ,Vڛ , , , ,9 , ,. ,էI ,PW , e ,s , , ,g ,@ ,ǜ ,i՜ , ,` ,Q ,۾ ,o" ,i0 ,&B> ,8L , ,. ,i ,U ,/ʟ ,؟ , , ,3 , , + ,"o9 ,G ,zU ,!c ,l7q ,mP ,! ,9 , ,ZT ,aŠ ,yӠ ,bx ,/ ,t ,"0 , ,'' ,m@5 ,!C ,yQ ,_ ,fm ,gh{ , ,j ,x{ ,t ," ,ϡ ,tݡ ,a ,I ,p ,R ,?$ ,C3 ,lB , a ,kp ,/ ,* , , ,. ,dʢ ,٢ ,/ ,@ ,y , ,U$ ,VB ,Q ,T` ,Bo ,~ ,7 ,Ǭ , ,Tɣ ,g ,nC ,M ,M ,j ,{ , ,} ,н ,` ,Ұǥ ,ͥ ,Qӥ ,#٥ ,ȥ ,(U , ,> , , ,5 ,) ,F6 ,XC ,V ,p ,;9} , ,8 , , ,Ǧ ,Ԧ , ,*d ,3 ,tA ,O ,*d] ,9zk ,y ,N ,& ,3X , , ,4  , ,џ ,ŧ ,Ӏ˧ ,oѧ ,ק ,Bݧ ,k ,m , , , , , , ,)4 ,D ,^ ,x& ,T- ,_4 ,; ,B ,L ,ޮZ ,[ , , , Qƨ ,Ԩ ,\W ,5" ,X ,W , ,B) ,3 ,tA ,NO ,{w] ,Uk ,Ůy ,F ,- ,ĩ ,@ҩ ,Q , ,* ,8 ,H ,AV ,d , s , ,i ,5 ,,Qª ,Ъ ,~ߪ , , , ,s ,i% ,A ,IO ,(] ,k ,y , , ,ū ,Iӫ ,V ,  ,Ha1 ,P? ,;M ,[ ,D{i , ,N , , , Ĭ ,EҬ , , , ,, ,FF ,j ,_~ ,] ,2 ,Mg ,ͭ ,iۭ , ,j , ,) ,! ,W ,be , , ,Ү ,sܮ ,ԙ ,/ ,, ,5% ,3 ,W ,(<h ,~n ,t ,8 , , ,*dί ,ۯ , ,~ ,: ,yA , , ,b ,q ,$ ,, ,V2 ,;<8 ,> ,D ,+J ,P ,~V ,r \ ,*]b ,h ,;n ,u ,~ , , , ,7N , ,ɠ ,MC , ,! ,ޡ° ,Ұ ,6ذ ,ް ,q ,% ,U , ,T ,7 ,9- ,: ,)G ,@T ,a ,J>n ,|y{ , ,d , ,  ,ẕ ,$ڱ ,7 ,9 ,M , ,. ,< ,J ,X ,os ,  , ,ik , , ,Dz ,ղ ,ާ ,` ,ɻ ,' ,8( ,7 ,G ,'U ,Rc ,Xq ,^- ,7 ,9 ,M , ,ų ,XJӳ ,` ,J> , ,d , , 8 ,̺G ,hV ,ue ,t , , ,$ ,b ,9 ,A`˴ ,Ǽٴ ,v ,f , , , ,- ,; ,I ,zW ,xe ,s ,C ,F ,j , ,k ,Ńǵ ,յ ,+o ,=Z , , , ,[) ,-7 ,ўE ,T ,ke ,|k ,Hq ,Ew , } ,7 , , ,r , , ,y , ,  ,Hö , Ѷ ,7߶ ,9 ,ɉ ,R ,! ,% ,'3 ,A ,ڸO ,8] ,Ek ,6y ,  ,c ,,Q ,% ,<' ,#@з ,0߷ ,? , ,\Z ,M ,l* ,9 ,YH ,^W ,f ,u ,d ,X ,^- ,{ , ,ϸ ,$m޸ ,Ѽ ,S ,@ ,k; ,:) ,J?8 ,G ,f ,Os , ,M , , ,M ,#ù ,й ,M ,[ ,a9 ,` , ,M) ,6 ,D ,N Q ,^ ,Mk ,x ,s ,s ,< , ,}ɺ ,ֺ ,H9 ,^ ,38 , , ,. ,s< ,sU ,b ,mo ,| ,r ,n ,i ,]p ,+p ,ͻ ,_ ,l , , ,}; ,ב+ ,t: ,,G ,{T ,Aa ,;n ,{ ,Ε ,# ," , ,7} , ,@iȼ ,߬ϼ ,ּ ,'bݼ ,` ,[ ,g ,4b ,9 ,9 , , ,j ,$ ,]1 ,> ,L ,$}Y ,Y"w ,P ,J- , A , ,q ,}ƽ ,ӽ , , ,҅ ,:v ,+n ,# ,a0 ,= ,^J ,X ,e ,+nr ,^ , ,e ,+n ,\ ,y , ߾ ,+ , ,4) , ,I ,5 ,4 ,J] ,V5' ,. ,5 ,]< ,LD ,KG^ ,7k ,.y ,, ,*d , , ,aȿ ,< ,-u ,, ,Q ,O* ,7 ,QD ,4LR ,V;_ ,Ql ,4Lz ,| ,Q ,q , ,g , ,Y? , ,- , , , , , ,B ,I ,@ , , , , ,& ,,, ,2 ,%8 ,q> , D ,MJ ,=P ,DV ,Y\ ,b ,?h ,i-n ,t ,%z ,@ ,] , ,= , , , ,J , , < ,6 , ,+ , , { ,6 ,NF , , , , , ,b/ ,] ,'W ,ĺ , ,)Z" ,t( ,. ,N4 ,n: , A ,Q ,UW ,'H] ,!jc ,i ,o ,%u ,2@{ ,& ,9# ,/ ,Zu , , ,g$ , ,3Y ,w: , , , , , ,F ,9 ,d , u ,S$ ,= ,J ,YX ,qf ,ںt ,M ,X, ,0 ,6 ,E ,B ,V ,  , , ,j , ,+ ,A9 ,$G ,1V ,d ,,r ,8m ,f ,B ,E ,}v ,p , ,{ , ,} , ,+ ,49 ,0M ,g^ , d ,j ,p , Vv ,| , , ,% ,b) ,, ,4 ,a ,GQ , , ,Ӟ ,ͧ , ,{+ ,(< ,IB ,3I , W ,Ӟe ,ͧs , , ,{ ,  ,: , , , , ,4 ,P , ,+ ,J9 ,iG ,U ,ìc ,lr ,˩ , , , ,5 ,CE , ,z ,R , ,· , ,V ,$5 ,0B ,gO ,\ ,i ,,v ,u , ,D ,r , ,{ ,o ,0 ,̖ , , ,] , , ,D , ,6 ,% ,6+ ,k1 ,Z7 ,>= ,C ,'I ,O ,=U ,[ ,?a ,g ,±m ,s ,y ,x[ ,G ,.  , ,³ ,M , ,K ,7 ,l ,5 ,[ ,a , ,e ,= , ,U , ,3 ,. ,4 ,: ,$P@ ,_ F ,L ,%R , eY ,ki ,eo ,05u ,5{ , ,7 , ,7 ,- ,΄ , , , , , ,Ұ ,Z , , ,Vw ,{ ,"# ,~0 ,= ,J ,+W ,Fd ,Lq ,$~ ,u ,} ,P , ,ne , ,b[ , ,]H ,$m ,R' ,6 ,HE , T ,c ,Rr , ,= ,4 ,M ,x , , ,D ,8 ,  ,a ,3( ,8 ,NVH , X ,+h , x , ,5H , , ,A ,> , ,h ,g ,b ,<- ,e< ,QK ,ee ,e , ,= , , ,d ,0 ,< ,! ,/ ,{= ,K ,bY ,c,g ,u , ,! , , ,O ,Q , , ,q ,G ,We , ,A , Q ,u?W ,] ,"c ,5i ,o ,uu , { ,ԩ , , ,% ,> ,> , ,b ,A , ,L ,E ,[ ,\R , ,  , , ,Q , , ,S ,l ,*6" ,I2 ,8 ,v> ,uJD , J ,Q ,^ ,la ,>w ,~ ,Q ,p ,~o , ,; ,h ,' ,r ,(# ,D0 ,8= ,<J ,eW ,*q , ~ ,Z= ,R , ,0 ,{ , ,# , , , ,+ ,G8 ,E ,S ,3{a ,o ,5} ,xI ,R_ ,= ,D , , , , , ,  ,* ,d& ,4 ,[w ,t ,+  ,ݔ ,/z , , , , ,ۭ , ,T ,ot ,- ,I; ,I ,W ,f ,Z ,4 , ,=t ,/ , ,h , ,& ,4 ,!B ,<P ,mt , ,{ , ,\9 ,F ,d ,Y" ,/ ,B< ,I ,M'W ,f , ,& ,f< , ,5 ,C ,^` ,ul , ,g  ,g6 , ,? ,* , , ,$ ,J: ,lP ,4f ,i| ,t ,' , ,Ѧ  ,kH , ,;F! * ,V@ ,V ,l ,6 ,: , ,k , ,z ,) ,7yE ,qX ,p ,. ,  ,Q ,)# ,# ,1 ,VH ,i ,{ , ,m , ,: ,  , ,p ,: ,$ ,(- ,&6 ,йN ,U ,Wi ,L ,U , ,. ," ,L ,], ,OI ,BR ,x , , , ,ȏ , ,\7 ,C ,j< ,|I ,:a ,4 ,0! , , ,N ,e , ,! z! .j% .j* ,5 .j9 .j> ,I .jM .jR ,|y] .,ka .kf ,q .ku .kz ,Q .k .k ,w .k .k .l .l .l .l .l .l z /7 .m . m z z/ .7m3 .3m< {U .MmY .Km_ zy /7 .^m .Zm { z  { /8 .tm .rm O{ O{ .m .m `{/ .m3 .m9 X{K {U {r .mv .m { /8 .m .m b| .m .m | 1| /"8 .m .m | |0 .m4 .m> |H |d .nh .nq |{ | .n .n .2n .0n | | .Bn .@n .Rn .Pn .dn .`n .|n .xn | |, .n0 .n9 .n= .nF |P |i .nm .nv .nz .n | | .n .n .n .n | .n .n | | ({ {< {` |x ^| | | , w .o . o , .Eo .;o. .o2 .roB .oF .oK ,V .oZ .oi .&pm ."p| .?p .=p .Np .Lp .]p .[p /6 ,m! .pp .jp , .p .p cx /6 .p .p .p .p .p .p .p# .p, cx6 /6C .qG .qP .qT .q] /6f .-qj .'qs cx} cx .Nq .Lq ._q .]q ox w /6 .uq .mq .q .q /6 .q .q w# x= wG wd .qh .qq .qu .q~ .q .q w w .r .r w w .!r .r x /6 .2r ..r /6 .Lr$ .Hr- /66 .xr: .vrE  xO  xg .rk .rv (x /6 .r .r Hx /6 .r .r x x .r .r x x& .r* .r3 x= xV .rZ .rc .rg .rl x x x  u x ,  y, .r0 .r5 ,@ ..sD .$sT .isX .[sh .sl .sq ,| .s .s .t .t .-t .+t . uW .y[ .yd .yh .yq u{ u .y .y .y .y .y .y Du Du .z .z `u /5 .z .z /5& .7z* .+z3 /5< .z@ .zK zuU /5a .ze .zp zuz /5 .z .z .z .z /5 .{ .{ u u .<{ .:{ u u .K{ .I{ u% u> .Z{B .X{K .i{O .g{T uy u u .y{ .w{ `u u u /v 7v( iv@ {vV ,a `rx , .{ .{ ,X .{ .{ r ,ˠ r r .{ .{ .{ .{ .{ .{ #s$ ,ˠ6 #s@ #sY .{] .{f .{j .{s .{w .{~ Ft , q , .| . | /U5 ,ξ q /k5 .2| .0| q! q4 qI ,ξV &_ rw   & r /~5 .A| .?| .P| .N| Cr /5 .`| .^| .o| .m| /5 .| .}| q6 HrP ,lEV /8a ,l .|p .| .$} .} ,l ,  ," "   .D} .B} .S} .Q}  0 .c}4 .a}= .r}A .p}J .}N .}S l K v K .} .} .} .}      "  hH ,{-k ,x , , ,8 ,D ,l 0 , ` ,"( "7 ,D M ,"Z "i ,v  ," " ,   ," " , ` ," " ,  ," "C ,I /9T ,_ .}c .}r . ~v .~{ ,k ,l ,  ," " V V . ~ .~ ./~ .-~ x x0 .?~4 .=~= .N~A .L~J .^~N .\~S k u  .m~ .k~ .|~ .z~ x  Z ̀ 8%  6 ,oY ,f , ,l 0 , ` ," " ,  ," " , /<' ,2 .~6 .~; ,F .J .O ,XZ .^ .c ,ll /<u ,#. .& . ,  ," " ,  ," "  /< . . /< ."" . ) cA Y u  Ď َ    ) E ] )y b       ,Is /9 , .C ./  ,w . . ,l/ c= ,J S ,"` " n  x   . . .΂ .̂   .ނ .܂ . . / <' G@ cM qk &|   ,? /19 , .  . , .{ .U .( ." .Q .A , . . .\  . ,a . .# ,X. .M2 .57 ,lE ,R `[ ,"h "0w ,  ," "( 5 /H9 . . . .ڇ  /d9 . . /d9 . . 1 w; wX .%\ .#e .4i .2o ̂     P  0   3 ,r~9 /t9D ,O .US .AX ,wc .g .l ,l| à ,  ," "8 i i .ш .ψ . .ވ  $ .( .1 .5 .; S t  Ã у    , /; , . .  , .p .f . .+ .Ɖ/ .‰4 ,? .C .S .7W .1\ ,lj ,w  ," "@  /; .V .R .p .l  /< . . . . /< . .  9 <C /*<S .ՊW .ъ` .d .i /=<r .v . . . W  /S< .) .% .I .G /p< .Z .X .l .j  ) > S h       Ō 1 1) 1F .{J .yS .W .]    p  P  , /9 , . . . . ,l- ,: C ,"P "H^ h  . . . .   .& .$ .5 .3 .E .C  = =) .T- .R6 .c: .a@ ށf v  r   , , , ,l " ,/ 8 ,"E "XP ,] @f ,"s "P~ ,G /l; .z .p . . , . . , . . .  . .Q .E ,X . . ,l' n7 _E ,R @[ ,"h "xw ,  ," "p ,  ," "h ,  ," "`   /;& .ώ* .ˎ3 /;@ .D .M /;V .tZ .re o /;{ . .  /; . . . . /; . .ݏ V V . . _ _. .!2 .; _E _] .0a ..j _t _ .? .= .N .L n   .^ .\ .m .k  G< ~X p Ɗ      1 C x9 N  PX m  w     , , , ,l 0 ,# `, ,"9 "D ,Q Z ,"g "r ,rx /8 , . .z . . , .N .F ,l , ` ," " " "$ .x( .v- -? 0I /8Y .] .f .j .s 0} /8 .đ . . . J   /8 . . /8 . .    , .0 .6 TO F `  ( , , ,l  ,  ," " ,\ /n8 , .2 ." ,l% ,2 ; ,"H "V J~` J~} .~ .| . . V~ /8 . . . . ~ ~ .ϒ .͒ .ޒ .ܒ    6 .: .C .G .M q~Z ~v ~ ~ ~     ,| } , . .  5} /580 .\4 .V> 5}H /G8X .\ .ye 5}o /G8| . . .œ . 5} /G8 . . . .  .7 .1 /G8 .Z .T 5} 5}  .y .w . .' 5}1 5}J .N .W .[ .d 5}n 5} . . .Ȕ .Ɣ 5} .ٔ .Ք } } } /^8 .  . . .  .$ .) /^8/ }L }Y -}f f}{ y} ,8O  , .. .&    ɒ+ ,<3 /4> ,I .fM .R\ .ϕ` .o .)s . .d .X ,Q . . ,Y 9q ,l p ,w^ . . p , ,  ,"( "6 p@ /4P .T .] /5j .Җn .Жw /95 . . p p . . p p p q q q* 9q4 9qM >q_ Kqi Kq .  .  Kq Kq . . Kq Kq .* .( .9 .7 Zq q) (qD 9qR oq_  p   ,ȋ k ,w ,M , ,B , /= , .U .G ." .+ 75 7R .ۗV .ٗ_ .c .l 7v 7 . . .  . . . C C .: .8 C C! .I ! .G! !! /=1! .^5! .V>! .B! .G! /=T! .ʘX! .a! .e! .n! .r! .{! .(! .&! .=! .5! .s! .g! .! .ߙ! $! ! /=! .5! .1! ! />! .R" .N " " /(>"" .o&" .k1" ;" /P>K" .O" .X" .\" .a" /P>j" .Кn" .ʚy" Փ" /j>" />" " " ." ." . " ." ." ."  # *# />%# .0)# .(2# .V6# .R;# />D# .vH# .pQ# 7[# 7s# .w# .# 7# 7# .# .# F# /># .# .# .Û# .# .қ# .Л# /># .# .ߛ$ . $ .$ /> $ .$$ .-$ F7$ FP$ .#T$ .!]$ .4a$ .2j$ .4n$ .2y$ s$ />$ .E$ .C$ .V$ .T$ />$ .g$ .e$ $ />$ .z$ .v$ .$ .$ />$ .% .% % />*% ..% .7% /?D% .ҜH% .ΜQ% / ?Z% .^% .i% єs% /2?% .% .% % /B?% .$% ."% .5% .3% % /U?% .F% .D% .W% .U% & /e?& 3& $=& $Z& .f^& .dg& $q& $& .u& .s& $& $& .& .& .& .& & & .' . ' .' .' ;' f' ' $' d' 6'  ' _'  x ( (  0*( 4( /u?D( .ÝH( .Q( .U( .ܝZ( /u?g( $q( $( .( .( $( $( . ( .( $( $( .( .( .(( .&) 3() G2) GO) .8S) .6\) .G`) .Ef) ) |)  8) ]) ]) .V) .T) ]) ]) .e) .c * ԕ* /?$* .z(* .t1* .5* .:* /?G* .ȞK* .ƞT* .ݞX* .՞a* .e* .n* .r* .{* * /?* .** .(* .;* .7* /?* .c* ._* * * .* .}* * + .+ .#+  -+ /?=+ .A+ .J+ .N+ .S+ /?\+ .ӟ`+ .ϟe+ }+ + (+ (+ .+ .+ .+ .+ . + .+ 7+ 7 , .', .%, 7$, 7<, .6@, .4L, Be, .Ei, .Cr, .Tv, .R, .e, .c, .v, .t, ., ., B, B, B, ., ., ., .- .- .- .- .- .- .(- .,- .3- PR-  \-  y- .Ƞ}- .Ơ- .נ- .ՠ- h- z- ?-  - - /? . .. .. .. .!. /?.. .L2. .H;. .c?. .aH. .vL. .r_. .c. .l. .p. .y. . /?. .ҡ. .Ρ. .. .. /?. .. . . . . .;. .9. . / .J/ .H!/ Җ+/ ҖH/ .YL/ .WU/ .hY/ .fb/ .wf/ .uk/ ږ/ / / ./ ./ ./ ./ ./ ./ / / .ˢ/ .ɢ0  0 #0 .ڢ'0 .آ30  L0 .P0 .Y0  c0  |0 .0 .0 .0 .0 .0 .0 i0 .0 .0 .*0 .(0 .;0 .90 .L0 .J0 .]0 .[0 i1 i#1 i<1 .n@1 .lI1 .M1 .}V1 .Z1 .}c1 .ng1 .lp1 .nt1 .l}1 .1 .1 ܗ1 ܗ1 .1 .1 ܗ1 ܗ1 .1 .1 ܗ1 ܗ2 .2 . 2 .ͣ$2 .ˣ02 :2 W2 .ݣ[2 .ۣd2 .h2 .n2 2 ʗ2 ܗ2 2  x2 2 3 .3 .'3 . +3 .43 >3 [3 ._3 .h3 r3 3 .(3 .&3 3 3 .73 .53 .F3 .D3 3  4 *"4 ]>4 \4 ϕv4 u4 ,4 ,4 ,4 ,K4 ,|4 ,G4 ,V5 ,l5 $5 ,15 :5 ,"G5 "V5 ,c5 l5 ,"y5 "5 ,5 @5 ,"5 "5 ,y5 po5 ,5 .f5 .T5 ,M5 .5 .5 o6 o36 oO6 og6 o6 ,6 ,6 ,M6 ,l6 6 ,6  6 ,"6 "6 ,6 /47 ,7 .7 .7 ,l)7 ,67 `?7 ,"L7 "Z7 nd7 /4t7 .3x7 .17 .B7 .@7 o7 o7 .R7 .P7 .a7 ._7 < 7 < 7 .q7 .o8 . 8 .~8 /o(8 So98 J8 q [8  H f8 ,t8 ,8 ,*8 ,l8 8 ,8 8 ,"8 "8 ,8 8 ,"8 "9 ,Hl9 ,99 , D9 [9 ,f9 .j9 .z9 .ԥ~9 .9 ,F9 .N9 .H9 .o9 .g9 !9 U9 h9 ,)9 o: ,: . : .%:  p=: 1pU: @pi: Op}: bp: np: vp: ,$: : ,: .̦: .Ħ: ;  +; 8; P; $]; ,u; 4; <; H; ,b5; ; ,; .; .; ,l; ,< < ,"< ",< 6< S< .(W< .&`< j< < .7< .5< < < <  < < = ,(= ,7= , ==  T= ,_= .Nc= .Dh= ,lv= ,=  = ,"= "=  =  = .|= .z=  =  = .> .>  >  2>  <>  T> > ,> ,> ,r!> 0> ,> .> .> .> .ܧ> \> /=? .? .? .? .? M2? wK? `? ,n? ,? ,? ,? ,? , @ ,1@ ,l;@ I@ ,V@ @_@ ,"l@ "{@ ,ˠ@ ,ˠ@ ,=@ , @ ,P@ ,O.@ ,%@ ,g@ ,f@ ,A ,HlA ,1A ,?A ,LA ,A ,lA A ,A A ,"A "A ,ˠA ,=A , A ,PB ,O.B ,%$B ,g1B ,f>B ,MB ,Hl[B ,mB ,{B ,B ,lB pB ,B B ,"B "B ,bpB ,B ,*dC ,C ,+C ,]C ,ˠvC ,0\C plC ,|yC .-C .%C ,#C .ZC .VC ,C .uC .qC .C .C ,C .C .C , D .ب D .ԨD /24D ,ˠ+D l5D lND .RD .[D ._D .hD .lD .sD /H4|D ,=D .D .D ,/dD /\4D ,D ."D . D lD ,D .1D ./D mD ,E mE ,&E &m;E ,9_EE 1mZE ,~dE 6I .bI .\I vI />6J . J .J .J . J v*J />67J .ά;J .ȬDJ .HJ .QJ .UJ .ZJ />6cJ .=gJ .7pJ vzJ vJ .YJ .WJ .iJ .gJ vJ vJ .xJ .vJ .J .J vJ vK .K .K ."K .+K v@K .DK .MK pwdK dwwK wK /U6K .ܭK .ԭK wK /o6K .K .K wK /o6K .!K .K .>K .:K wK /o6L .X L .TL .rL .n"L .&L .+L /o64L .8L .BL wLL whL .ȮlL .ƮuL .خyL .֮L wL wL .L .L .L .L wL wL .L .L .L .L wM .'M .#M w4M wLM vYM vqM wM FwM OwM _wM  M  M  N , N ,.N ,3N /<>N ,HN .cLN .AQN ,w[N ._N .dN ,*nN .rN .mwN ,lN ,N `N ,"N " N ,N N ,"N "N sN O ɍ,O ׍HO dO O O O  O O  (O ,O pP , P .ٰP .հ P .$P .-P p7P pOP .SP . \P pfP p~P .*P .&P pP pP .EP .AP .^P .\P pP ,SP ,Q ,Q ,u8Q ,mzlQ , Q ,Q ,qQ ,HlQ ,Q ,Q ,tR ,{IR ,xjR ,GR ,(R ,#.R ,R ,#.R ,!R ,RR , S ,('S ,5JBS ,PS ,moS ,#.~S ,S ,|yS ,S ,YS ,8IT ,Y/T ,O@T ,MT ,[T ,ЮlT ,yT ,T ,T ,T ,T ,T ,T ,PT ,T ,ͿT , U ,:xU ,%U , BU ,:xOU ,]U ,kU ,xU ,U ,fU ,\U ,%U ,pU ,BU ,U ,pU ,|U ,EV ,"V ,IV ,dV ,~V ,gV ,V ,ϣV ,V ,fV ,KW ,Q}AW ,EgW ,xW ,FW ,eW ,[W ,MiW ,X ,xX ,+"X ,*~/X ,>_ .G_ .K_ .P_ u_ _ _ . _ ._ ._ ._ _ _ .*_ .(_ .9_ .7_ .K_ .G_  ` !` .i%` .g.` 8` P` .xT` .va` ik` /9{` .` .` /9` ` /9` .` .` .õ` .` ` ` a   a  (a +&a +Ca .Ga .޵Pa .Ta .Za ńra a 2a a [a  `a Ea d b  0b /:+b ./b .8b .Mj .vGj Qj ij .mj .vj j j .j .j .j .j j j j .j .k .Ŀ k .¿k k 7k .տ;k .ӿDk .Hk .Qk .Uk .^k  hk  k .k .k  k  k .#k .!k 7k 7k .2k .0k .Ak .?k Ոl 2l >Pl }hl l gl  l Ql pl  Xl /<l .Xl .Nl .l .m .m .m .m .%m /m /<?m .'Cm .Lm .gPm .]Ym .]m .bm /<tm .%xm .m .xm .hm /m  m ԏm /=m .m .m /3=m .m .m /E=m .m .n  n /W=n .n .&n 0n /l=@n .Dn .Mn .Qn .Vn /l=_n . cn .nn xn n .:n .8n  n  n .In .Gn  n  n .Xn .Vo  o  )o .g-o .e6o .v:o .t?o /do 'no 'o .o .o .o .o o o ;o }p /p ϐLp ip p  p p Wp  xp p p  Hq /=q .q .q .!q .*q ǑCq .QGq .OPq Ǒeq .aiq ._tq y~q /=q .yq .qq /=q q  q q q  r yr  -r Hr .Lr .Ur _r /@lr .pr .vr r Иr .r .r r /@r . r .r r r ,ps ,h s ,`s ,`s )hB"s , ^'s -R@+s -+@/s /W;s *4Bs ,hs , ts ,ls ,|s ,s ,s ,s ,s ,!s ,c?s ,s ,s ,_@s ,t ,> t ,Bt ,t ,#t ,Mt , t ,)t ,st ,t ,4)t ,Xt ,u ,hu ,u ,L*u ,6u ,ԬBu ,Uu ,j\u ,au ,mu ,yu ,u ,u ,u ,Jdu , -u ,,u ,Lu ,u ,Ku ,8u ,u , s v ,Țv ,T!v ,U+2v ,e>v ,Jv ,QVv ,\bv ,nv ,dzv ,v ,}cv ,v ,v ,Fv ,6v ,Fv ,v ,.w ,cw ,r"w ,Rw/w ,Y=w ,=Jw ,cWw ,w ,2w ,cw ,uw ,nw ,0x ,"x ,i\x ,Φ+x , 9x ,JGx ,$Ux ,cx ,cqx ,x ,"x ,"x ,x ,x ,x ,x ,x ,x ,ܺy ,y ,\y ,"*y ,8y ,27Fy ,n{Ty ,Kby ,Ipy ,.~y ,VSy ,`zy ,y , y ,y ,hy ,y ,5z ,z ,z ,~ .z ,=z ,Lz ,lz ,m {z ,8z ,;z ,z ,z ,z ,z ,z ,z ,w { ,{ , { ,/{ ,>{ ,!M{ ,N\{ ,#k{ ,;z{ ,7{ ,~t{ ,{ ,6{ ,{ ,g{ ,W{ ,{ ,| ,r| ,J]| ,.| ,,=| ,nlL| ,[| ,+j| ,py| ,| ,_| ,[| ,| ,| ,| ,Ε| ,K| ,i} ,y} ,&} ,=} ,&J} ,2x} ,} ,P} ,, } ,z} ,} ,R} ,f~ ,S~ ,~ ,f&~ ,3~ ,JA~ ,DM~ ,YZ~ ,g~ ,t~ ,l~ ,?'~ ,/~ ,9@~ ,&~ ,>~ ,u~ ,~ ,~ ,  ,' ,3 ,? ,cL ,>Y ,f ,5 , , ,6 ,\ , , ,t ,@ ,mp( ,Ov5 ,B ,#O ,=^ ,qm ,9@ ,{ ,M , ,2\ ,{ ,T ,ڀ , , , , ,& ,g3 ,@ ,YM ,BZ , ,{ ,9@ ,XӁ ,I , ,l , ,e ,' ,5 ,C ,hCQ ,_ ,ym ,-{ , ,¨ ,g , ,| ,ς ,Kl݂ , , 7 ,p ,3% , # ,"1 ,? ,"M ,[ ,i ,BGw , , , ,G ,Yà ,s# , , ,t ,It ,c3 ,tK ,X ,ul ,, ,?F ,ee , ,P΄ ,܄ ,L ,9@ ,og , ,Қ" ,0 ,> ,<L ,͘Z ,oh ,?v ,- , , ,څ ,E ,z ,2 ,Q ,6& ,5 , D ,dS ,c ,r ,zj , ,i4 ,- , ,Ŭ ,ۆ , ,5 ,ˌ , ,js& ,5 ,?D ,S ,ݚb ,Jq ,  , ,L ,? ,4 ,gaˇ ,!ڇ ,J , ,u , ,% ,P4 ,}R ,ea ,Hp ,r ,P , , , ,Sʈ ,S9ڈ ,y ,u ,, , ,* ,{: ,iJ ,yZ ,*j ,M7z , , ,= ,P ,ʉ ,9ډ ," , ,k ,p% ,4 ,C ,R ,ja ,8p ,; , , ,v ,=t ,Nʊ ,=ي ,E ,} , , ,!$ ,H 3 ,tB ,oQ ,` ,o ,~ , , , ,j ,-2ʋ , ً , ,{ , ,- ,`$ ,3 ,,B ,*Q ,|n ,2} , ,2 , ,Q# ,Ȍ ,׌ ,y , ,3 ,G ,B" ,(1 ,T@ ,h"O ,^ ,Fm ,?| ,\ , , , ,Ǎ ,֍ ,I ,L ,p ,#  ,! ,0 ,? ,N ,] ,l ,{ ,# , ,t , ,Ǝ ,hՎ ,5 ,. , ,z ,D ,r / ,> ,FM ,a\ ,k ,Trz , , ,  ,41 ,,ŏ ,ʗԏ ,K( ,"R ,>D ,ص ,  ,. ,= ,L ,j[ ,_j ,z ,4> ,2 , ,= ,Ő ,yLԐ ,`r ,Fh ,5 ,3 ,p ,g. ,|= ,'M ,]\ ,k ,z ,7A , ,W ,cK ,lqő ,Cԑ , , , ,% ,+ ,j. ,= ,i L ,l[ ,\+j ,y ,M ,, ,mw , ,d6Ē ,]gӒ ,]> ,S ,j ,Z ,˺/ ,> ,M ,\ ,tk ,|z , , ,- ,[ ,w+Ɠ ,֓ , ,v , , ,# ,3 ,ljB ,h ,Vu ,W , ,^ , , ,?Ĕ ,Ҕ , , ,q" ,L ,q& ,q4 ,h ,L ,q ,Õ ,ϕ ,Xە ,7 ,J ,- ,9 ,1G ,1V ,| ,q , , ,ʐΖ ,9@ ,  ,* ,@ ,sH ,DV ,d ,er ,B2 ,. , , ,'Ɨ ,ԗ ,= ,E ,r; , ,+ ,t* ,] ,j ,} , , ,Y͘ ,Y@ۘ , ,: ,q ,@ ,P( ,6 ,zD ,6R ,` ,r\n ,| ,o ,` , * ,j ,͙ ,ڙ , , , ,9@ ,  ,&y% ,+ ,1 ,b7 ,= ,lC ,qI ,KO ,gU ,5[ ,"a ,Qfg ,cm ,s ,y , ,  ,Cc ,AÚ ,ܚ ,o ,( , , ,l ,b ,- , , ,5 , ,A$ ,* ,0 ,6 ,x< ,8B ,p5H ,KN ,JT ,Z ,` ,4f ,!4l ,Qr ,1~ , , ,E) , ,ʛ ,Z4ٛ ,W ,U ,  ,$ ,$ ,Yy3 ,.B ,%Q ,` ,o ,~ ,! , ,>A , ,^ɜ ,q؜ , , ,e ,X ,$ ,3 , B ,+Q ,k` ,o ,~ ,I2 ,9@ ,ѩ , ,Pʝ ,ٝ ,8 ,- ,} ,) ,"! ,. ,Ώ; ,H ,a ,$n ,{ ,1 , , ,P ,'m ,9@Ξ ,z۞ ,`P ,LX ,  , ,* ,T7 ,GJ ,0W ,Td ,G ,v , ,6D , ğ ,џ ,ޟ ,T ,G ,, ,# ,$ ,y1 ,> ,Qw ,O , ,ՠ , , , ' ,5 ,P ,À^ ,ͮ , ,ǡ ,5 ,ף ,9@͢ ,oڢ , ,>i ,b ,|{o ,,3 , ,ړ5 ,-} , ,: ,|{ , ,A ,P ,|{] ,3Kj ,w ,^ ,m ,> , , , ,O , ,V3 ,C ,R ,YVa ,+ ,k* ,+ , , ,fJǦ ,% ,G ,D" , ,O! ,= ,M ,] ,mm , } ,>i , ,t ,; ,rק , ,08 ,G ,b ,  ,+ ,h<@ ,BM ,Z ,D" ,n , ,Q ,c ,8 , ,=% ,ee2 ,9@? ,7L ,,3g ,lUt ,Y , ,c ,d ,ĩ ,~ѩ ,K ,w% ,\9 ,TN ,J\ ,Xh ,Wu ,,5 ,# ,X , ,'S ,ê ,6ժ ,[ , , ,x , ,A# , 0 ,= ,=J ,0W ,_d ,T'q ,9@~ ,= ,mp ,Ov , ,q ,xͫ ,N۫ ,+ ,? ,I , ,$ ,Q* ,0 ,7 ,j< ,I ,W ,a ,n ,ŝ| ,N ,2 ,  , ,fˬ ,٬ ,D ,- , , , ,m( ,$5 ,\cH ,iU ,c ,p ,i} , , ,' ,6D ,dA ,iϭ ,j߭ ,3 , ,΋ ,' ,_N ,Ov! ,. ,; ,H ,U ,| , , , ,v ,wʮ ,׮ ,  , ,\ , ,6D ,Ov+ ,9@N ,F[ ,h ,u , ,7 , ,jD ,cͯ ,hhۯ , , , , ,C! ,. ,; ,`Pf ,Rs , , ,B ,w ,0ʰ ,[۰ , , , , , ,4 ,{A ,mX ,e ,xr ,D ,d ,{ ,m ,DDZ ,{Ա ,m , , ,s , ,:, ,)C ,ӄP ,yg ,gt , ,[S , ,l , ,ZȲ ,R޲ ,l ,, ,, ,5u9 ,ePH ,U ,ka ,y ,Z ,: , ,y , h ,ͳ ,oڳ ,(9 , ,lJ , ,'; ,H ,SU ,h ,3u ,\ , ,v[ , , ,+Ĵ ,Ҵ ,R ,i ,D , ,. ,/; ,I ,HV ,ʐc ,p ,D"~ ,  ,m  , ,% ,s ,Z͵ ,ڵ ,7 ,7 ,w ,~ ,ϯ ,) ,{6 ,D ,jQ ,Nr^ ,k ,A ,-2 , ,  ,e ,yL̶ ,5ٶ ,; , ,9@ ,  ,37 ,YD ,R ,^ ,wk ,Yy ,` ,w ,Y , ,Y· ,з ,bq ,8 ,L" ,H 0 ,> ,L ,[ ,|l ,#r ,x ,q~ ,E , ,t ,Y ,B ,Ѹ ,߸ , ,! , ,  ,0]& ,n4 ,RC ,Q ,_ ,n ,| ,3 , ,B ,k ,A¹ ,M}й ,Q޹ ,z ,| ,) ,H ,V' ,Ǝ5 ,LC ,hQ ,&_ ,m ,{ ,;0 ,M ,| , ,f ,OϺ ,ݺ ,R , ,  ,Y ,# ,1 ,? ,3M ,[ ,i ,w , , , ,n , ,ϻ ,ݻ ,{7 ,a , ,? ,F# ,1 ,V? ,M ,B[ ,>i ,߄w ,  ,# ,F , , ,˼ ,:ټ , , , ,oz" ,0 ,`V> ,zhL ,?Z ,#h ,| ,e ,y , ,\Iͽ ,*۽ ,0 ,!V ,? ,ݘ ,! ,9@/ ,0? ,O ,_ ,o ,E ,9 ,  ,$Y , ,cھ ,Z , } , ,0 ,8> ,7M ,\ ,k , , , ,=  ,a ,c ,qn ,c ,]> ,z ,D ,$N ,\ ,j ,x , ,tc ,qe , ,SK ,in , ,0 ,9@ , ,]} , ,. ,O ,\ ,i ,v , , ,< ,r6 ,  ,  ,; ,% ,{" ,LI ,pV ,c ,:p ,2Q} ,H ,d ,6 , , ,Z , ,s ,"v ,H , ,#c ,Gk& ,3 ,T@ ,SM ,Z , ,L ,e ,> ,T , , ,  ," ,A/ ,< ,9@U ,|i ,`s ,^$} ,X  ,u ,2 , , , ,]A ,Z , , , ,9c ,e' , {4 ,xA ,N@N ,/[ ,h ,Bu , ,[ , ,f ,T ,| ,6 ,9@ ,o ,0 ,6 , ,B" ,/ ,+= ,KV ,`nd ,jr , ,o , ,C ,y , , , , , ,! ,T( ,H 6 ,D ,R ,B` ,!n ,| , ,( ,}b ,2 , ,Å , ,{ ,C , , ,[$ ,2 ,@ ,͑N ,o\ ,[j ,x ,F ,-! , , , , , ,D , ,T ,M ,#  ,- ,2A ,O ,}] ,k ,y ,  , ,F , ,% , , ,f ,& , , ,{  ,ʻ* ,m7 ,sJ ,Y ,}g ,t ,f , ,^ , , ,  ,; ,U , ,FQ ,8 , ,+ ,: ,4I ,h5X ,2g ,v , , ,2 ,g ,t ,\ ,v ,V , , ,, ,4>? ,I ,ռc ,Y ,J , , ,F ,p , ,&D ,%p ,O ,)" ,_Y0 ,> ,L ,1Z ,]h ,av , ,E ,, ,p ,Wp , ,&] , ,Z , ,L ,+ ,ފ8 ,ΕE ,R ,єl ,\y , , , , , ,4 ,HJ ,< , , , $ ,o ,9@# ,1 , ? ,[ ,hi ,^w ,2 , ,7 , , ,D ,v , ,a ,G ,7 ,, ,: ,V , q ,f ,  ,4 , ,ަ , , ,5 ,T7 , ,8 ,)$ ,. ,A!9 ,F ,P ,lji ,fu , ,T ,G , ,u ,V ,- ,1* ,@Z ,E ,  ,[ ,"/ ,< ,I ,V ,Xc , , ,o  , ,4E , , , ,H* , ,K! ,z/ ,I ,V ,}c ,q ,` ,D , , ,0 ,u9 ,P ,Ѓ ,G , ,f , ,$A ,Q ,O~W ,iF] ,Hc ,jfi ,p , } ,f ,V ,A ,V , ,u ,1 ,x* ,C , , , , , ,2! ,3' ,- ,u3 ,v9 ,e? ,FE ,K ,Q ,&X ,h ,;n ,u ,q{ ,t ,a , , ,> , ,= , ,0 , ,% ,+ ,D|1 , 7 ,i= ,fC ,I ,$EP ,vY ,b ,ak ,Kr ,Hw , , ,vO ,/ , , ,J ,Q1 , ,V ,73 ,x@ ,YN ,U[ ,ch , ,Oq , ,9@ ,  ,u , , , , ,* ,R; ,P ,5\ ,vi ,'| , ,0Z , , , ,f , ,( ,; , ,  ,1' ,4 ,A ,VT ,a ,n ,{ , ,g ,9@ ,+ ,du ,Z , ,# ,]0 ,,F= , J ,SCW ,d ,s ,1 ,a , ,f , , , ,  ,I ,0& ,z9 ,SF ,c` ,m ,k ,  ,' , , ,V , ,~ , ,,F ,  ,RG , . ,Y) ,66 ,C ,P ,x] ,j ,w ,  ,V , , ,Rj ,F  ,Q1 ,,l , ,* ,efA ,N ,e , r , ,9 ,fX ,zF , ,U ,( ,7 , W ,' ,q) ,g/ ,G5 ,X"; ,B ,R ,4X ,m^ ,d ,CKk ,x , ,c ,- ,- ,c , ,> , , ," ,u/ ,< ,AI ,V ,cLc ,c~ ,O , ,U ,R  ,Y ,Y , g , , ,\% ,?< ,I ,yV ,jp ,9@} , , ,h ,  ,TB ,5 , ,h ,V ,D" ,f ,$ ,b1 ,> ,LK ,EX ,He ,r ,h ,87 ,$ ,; ,  , , ,0 ,u ,K ,^,/ ,; ,?Q ,] ,y , ,  ,w ,m , , , ,g9 ,& ,) ,6 ,?P ,;] ,j ,9@w ,L , ,h ,2 ,, ,, , 3 ,KA ,^,x ,  ,W ,9@ , , ,, ,  ,* ,ʐ' ,5 ,fC ,GQ ,_ ,m ,{ ,B ,ծ , ,n ,K , ,[ ,^ ,/ , . ,&R ,ޮa ,R ,( , , - ,  ,Q ,r , , $ ,A , ,/# ,P1 , E ,S ,SXa ,to ,{} ,X ,= , , ,U ,  ," , , ,*~( ,6 ,+D ,R ,` ,lRy ,9 , ,S ,Z ,` ,= ,z ,4 ,g, ,l;: ,gIH ,V ,:d ,r ,R ,  ,?J , ,l ,, ," , ,F , ,3! ,`P= ,0W ,` p ,\~ ,= , ,s ,& , , , ,J ,[ ,m- ,[; ,I ,-W ,Ƚe ,s ,] ,y , ,o , ,c ,* ,K ,v , , ,S , / ,> ,,M ,(\ ,=k ,Ez ,k ,@ , , , ,Rl , ,  ,/- , ,. ,= ,'L ,9@[ ,vj ,ny , ,S , , ,- , ,>D , ,G ,R  , ,p- ,u< ,K ,AZ ,#i , , ,A , , ,7$ ,N? , , , ,' ,9@4 ,A ,O ,}] , k ,)Uy , , , , ,* ,; ,q , ,BY ,  ,/ ,aA ,NU ,9@ , ,ʐ ,= ,bp ,m , ,ψ , , ,ƣ ,\ ,V ,R ,I ," ,@) ,Р1 ,*= ,-.I ,KU ,a ,n ,| ,a ,H ,h ,G ,h ,  ,  ,+n ,t ,U ,C' ,6 ,"XE ,cT ,6 ,\ ,C3 ,A ,2O ,] , ,? ,0p ,5 ,t ,m ,5 ,– , ,0p ,- ,+); ,\I ,LW ,e ,Js ,9@ ,O\ ,m , , , , , & ,[ ,rk ,y , , ,Ϝ , , ,9@ , , , , ,)$ ,tH2 ,PN@ ,o ,} ,PN ,1 ,,G , , ,} ,p ,; ,m ,"< , ,K , ,( ,''6 ,'D ,JR ,7` ,9n ,M$| ,ϐ ,x ,f , ,  ,< ,B , ," ,1 , , $ ,4 ,aC ,4VR ,9@a ,p ,P , ,[ ,d ,o , ,V ,p ,P , ,e ,]w& ,85 , , ,"< ,R , ,N ,S ,ϭ ,Ւ ,% ,S3 ,A ,O ,s] ,|k ,ù , ,4 , ,\ , ,X , ,T)& , 4 ,H ,d ,bq , ~ ,V ,k , ,| ,ю , ,M ,k# ,4 ,: ,@ ,SF ,AL ,HmR , oX ,god ,- ,D , , ,C ,P , ,C ,k ,P ,o ,$n ,+ ,}B ,sO ,H\ ,ei , , , , ,pG ,0 , , , ,1W' ,|4 ,A ,wN ,[ ,h ," ,b5 ,> ,!8 ,1 ,  ,  , , 1 ,M ,`[ ,i ,w , ,G ,Y ,!S ,f ,I ,@ ,W , , ,23 ,A ,VO ,M] ,k , ,f ,' ,\ , ,< , ,W , ,g  ,5,- ,: ,U ,_ ,cl ,Lz , , , , ," ,eD ,9@ ,  ,2 ,4; ,U ,gb ,D"o ,} , ,g ,| ,2 ,f ,_ ,h ,e , ,dO  , ,y% ,¨3 ,L ,{k ,)w ,i ,6e , ,D" ,d , ,1 , ,4 , ,! ,. , < ,'U ,b ,o ,2} ,  ,`  ,W ,\ ,T , , , ,6 , ,  ,%& ,RL, ,s(3 ,(@ ,M ,WFZ ,g ,t ,R ,# , ,O , , , , , , Y; ,=b ,D"o ,s:| ,g  , , ,Xk ,> , , ,t0 , , ,֋  ,ʀ ,c& ,"3 ,J ,7 V ,wc ,Pq ,i ,D" ,  , ,e , , , , ,¨: ,G ,"T ,a ,n ,{ , ,  , ,]- , ,X , ,%b ,8 ,u] ,j ,\w ,N ,? ,xz ,; ,| ,%b , , , ,y: ,  ,|  ,M ,Q , ,t , ,"* ,: ,B , , ,^ , ,9@ ,z  ,  ,+ ,8 ,E ,$R ,?_ , Ll ,9@y ,2 ,H  ,? , ,) , ,a ,- ,{ , + ,Hr9 ,^H ,qdW ,Ef ,ڲ , ," , ,o , ,b( ,9 ," ,n  , , ) ,8 ,h$G ,d ,L s , ,?R , ,| , ,t ,ͷ , ,e ,  , y ,+ ,VP; ,xK ,a ,}n ,?{ , , , , , , ,W ,Ȓ ,$" ,&0 ,> ,FL ,hZ ,h , v ,z , , ,= ,} ,  , ,t ,< ,w , ,P ,, ,%: ,H ,{|V ,y , ,%k ,` , , , , ,k , , ,H , , ,  ,f ,C' ,5 ,WC ,6GR ,|\ ,l ,iz , ,J , ,J ,i ,F ,~ ,] , ,VJ ,, ,, ,: , H ,V , f ,v ,q , ,T ,q ,l ,t , , ,1 ,J-  ,y ,|B) ,9 ,UI ,Y ,[i ,Ry ,= ,V , ,t ,N , ,< , ,E ,O , ,lN- ,< ,K ,hZ ,3Pi ,x ,k ,,I ," , , ,1 ,> ,t ,S  , ,% ,^2 ,? ,)L ,Y ,hf ,xos , , ,h ,9 ,9 ,*X ,  ,8 ,$% ,S3 ,A ,~ ,' ," ,b , ,f ,0 ,  ,: , ,f , !  ,) ,' ,4 ,FA ,hN ,[ ,h ,b ,& ,D ," , , , , , ,{" ,/ ,f< , !I ,)V ,Fc ,hp ,} ,f , ,?R ," ,L! ,f. ,˂; ,qH ,QU ,=,b ,) o ,k| , ,y:  ,  ,"# ,0 ,:= ,qJ ,| , ,Y ,0 ,V , , , ,y , ,2 ,7? ,WL ,%d ,q ,' ,YV ,b: ,b7 ,R , , ,' ,< , ,Y% ,7T2 ,'? ,L ,; , ,Y , ,} , ,h ,{ ,j ,Z ,O ,YV , ,P ,Y ,4 ,c , , , ! ,! ," ,dK" ,<X" ,e" ,r" ," ," , " ,6" ,S" ," , " , " , # ,{# ,T)# ,7# ,^E# ,rS# ,a# ,yo# ,M}# ,T# ,# ,# ,6# ,# ,# ,9# , # ,Ͼ$ ,v$ ,[j$ ,+$ ,9$ ,JG$ ,U$ ,@c$ ,͹q$ ,c$ ,$ ,$ ,Y$ ,4$ ,$ ,b$ ,_$ ,]$ ,$ ,}"% ,'&% ,|5% ,z\D% ,GS% ,b% ,&y% ,N% ,M% ,% ,K% ,9% ,% ,Z% ,+& , & ,*& ,7& ,̧D& ,vQ& ,z^& ,k& ,Cx& ,& ,q& ,& ,:& ,@& ,5& ,& ,M& ,j& ,,  ' ,' ,n'' ,`5' ,C' ,EQ' , _' ,m' ,${' ,6'' ,2' ,' ,' , ' ,E' , ' ,]' ,E' ,+@( ,( ,ߣ#( ,z1( ,?( ,THM( ,>z[( ,i( ,x( ,M( ,G( ,@( ,0( ,6( ,m( ,8( ,( ,) ,) ,?v) ,_-) ,E<) ,K) ,Z) ,i) ,%x) ,@-) ,) ,Yt) ,) ,F) ,I;) ,w) ,) , /) ,)z* ,.* ,< =* ,L* ,6[* ,Gk* ,Zz* , * ,o* ,{* ,* ,5+ ,++ ,"+ ,LD+ ,r+ ,Ҹ+ ,+ ,]6N, ,z[, ,8j, ,y, ,%, ,F(, ,#Q, ,tc, ,{- ,- , - ,Ǩ-- ,~:- ,/G- ,T- ,Xa- ,9@n- ,f{- ,;- , $- ,\- ,- ,"- ,- ,8j. ,&. ,\3. ,3@. ,N. ,8h. ,3{. ,. ,. ,. ,. ,$/ , / ,)/ ,QJ*/ ,9@8/ ,F/ ,HT/ ,b/ ,p/ ,:~/ ,/ ,/ ,/ ,./ ,/ ,_Y/ ,/ ,w0 ,0 ,0 ,-0 ,<0 ,xK0 ,Z0 ,~i0 ,(8x0 ,0 ,0 ,0 ,{10 ,{0 ,0 ,x0 ,(0 ,H 1 ,Z1 ,=E1 ,%-1 ,Z1 ,qi1 ,]{x1 ,P1 ,1 ,s1 ,1 ,%1 ,1 , n1 ,\1 ,1 ,L 2 ,"2 ,/2 ,V2 ,|c2 ,eDv2 ,2 ,!2 ,&2 ,2 ,w2 ,x2 ,V2 ,'3 ,43 ,JN3 ,Wd3 ,p3 ,3 ,¡3 , B3 ,eD3 ,K3 ,3 ,!3 ,&3 ,n4 ,S!4 ,)74 ,J4 ,T4 ,Sc4 ,\p4 ,}4 ,4 ,4 ,ǟ4 ,P4 ,4 ,4 ,,N4 ,4 ,L5 ,25 ,e5 ,rr5 ,#5 ,[5 ,5 ,#5 ,5 ,5 ,5 ,A 5 ,6D5 ,S5 ,Y6 ,6 ,6 ,B+6 ,"86 ,F6 ,nS6 ,29`6 ,cs6 ,o6 ,N@6 ,z6 ,t6 ,6 ,y6 ,6 ,K 7 ,[7 ,#&7 ,˲37 ,A7 ,N7 ,&[7 ,¶h7 ,@u7 ,H7 ,47 ,7 ,6z7 ,W<7 ,547 ,7 ,7 ,7 ,7 , 8 ,8 ,#!8 ,.8 ,;8 ,H8 ,3U8 ,b8 ,*o8 ,K|8 ,8 ,, 8 ,18 ,8 ,w8 ,~8 ,ϯ8 ,8 ,8 ,^W9 ,|9 ,h9 ,~-9 ,k;9 ,.I9 ,pW9 ,e9 ,&s9 ,i29 ,9 ,*9 ,9 ,L9 ,~9 ,9 ,|9 ,9 ,o: ,@: ,29: ,+: ,q8: ,btE: ,uR: ,a: ,.|: ,`3: ,: ,9: ,: ,mh: ,  ; ,7; ,J*; ,1?; ,dwK; ,#Y; ,); ,9@; ,; ,#; ,S; ,%; ,7; ,H; ,); ,u < ,hh< ,G''< ,&5< ,!C< ,Q< ,%_< ,Mm< ,{< ,< ,< ,< ,>u< ,< ,M< ,< ,&< , = ,= ,$M7= ,F= ,U= ,Qd= ,s= ,r= ,= ,= ,m= ,H= ,= ,= ,߲= ,'= ,i > ,> ,x'> ,D> ,R;S> ,Vb> ,q> ,p> ,> ,)h> ,> ,2> ,Q> ,S> ,O> ,l? ,? ,!P%? ,mW4? ,^C? ,]? ,Ҹ~? , ? ,? ,w? ,? ,P3? ,"? ,? ,%? ,m? ,Ε? ,O@ ,@ ,K@ ,,@ ,{O@ ,xY@ ,q@ ,r}@ ,%@ ,@ ,l@ ,4@ ,}Y@ ,@ ,@ ,@ ,|A ,upA ,*A ,}J8A ,cFA ,TA ,bA ,F~pA ,~A ,A ,A ,-HA ,vBA ,ӲA ,uA ,ٻA ,'B ,Y?B ," B ,@&&B ,c,B ,3B ,`<`B ,vmB ,TB ,B ,2B ,WB ,.B ,-B ,!B ,l-B ,׆B ,*B ,EC ,cC ,fC ,+C ,8C ,EC ,-RC ,)_C ,lC ,ZyC ,C ,C ,C ,C ,C ,<C , C ,<C ,C , D ,zD ,y&D ,I4D ,>BD ,wPD ,D ,2D ,D ,D ,TD ,D ,E ,sE ,_E ,-E ,;E ,|IE ,E ,PE ,3E ,F ,F ,d0F ,*F ,8F ,=FF ,TF ,X0bF ,pF ,k~F ,oZF ,pyF ,F ,F ,&F ,zF ,9@F ,hF ,F ,@ G ,G ,'G ,CG ,XkQG ,W`G ,nG ,f|G ,G ,OpG ,G ,TG ,rG ,G ,zG ,G , H ,H , (H ,:6H ,DH ,ǬRH ,E`H ,nH ,ƈ|H ,l}H ,<H ,H ,H ,TI ,I ,9@I ,iI ,2I ,J ,m(J , 6J ,UiJ ,\wJ ,7BJ ,J ,2J ,J ,=J ,5J ,/J ,J ,J ,6 K ,K ,rK ,-K ,$;K ,:IIK ,ABWK ,HZeK ,ɆsK ,'K ,K ,K , K ,K ,K ,K ,]K ,w L ,$L ,kY)L ,8L ,iGL ,oVL ,eL ,7tL ,L ,\L ,L ,L ,fyL ,L ,GL ,(dL ,?6L , M ,=M , M ,O , aO ,nO ,O ,O ,O ,]O ,oO ,EUO ,9P ,P ,EVP ,&P ,=0P ,@P ,NP ,,\P ,OjP ,xP ,\P ,P ,P ,/P ,)P ,]P ,ӻP ,P ,^P ,Q ,Q , Q ,L.Q ,U ,DLLU ,)sU ,WU ,U ,U ,oU ,U ,U ,>U ,bU ,%U ,6U ,o V ,=V ,N)V ,67V ,)EV ,SV ,xaV ,~oV ,De}V ,EV ,V ,V ,V , V ,V ,m8V ,)W ,W ,PW*W ,g>9W ,CW ,WW ,eW ,srW ,"W ,W ,eW ,W ,W ,W ,0W ,-W ,W ,xW ,2X ,üX ,6X ,?@(X , 95X ,BX , [OX ,\X ,%\iX ,<vX ,X ,1X ,hX ,X ,X ,vX ,'X ,ΕX ,sMY ,3 Y ,]Y ,d'Y , 4Y , GNY , \Y ,jY ,bSxY , uY ,Y ,bY ,Y ,,Y ,7Y ,dY ,0Z ,qSZ ,#aZ ,~Z , [ ,[ , )[ ,7[ ,E\ ,)\ ,] ,qI_ ,` ,7-` ,La ,%*a ,Օ;a ,Aa ,wGa ,a ,Ib ,>b ,R/c ,+&d ,Ld ,[d ,!gd ,d ,d ,cd ,Dqd ,Md ,d ,!%d ,%d ,d ,d ,e ,Me ,.e ,,e ,OyQe , ^e ,"e , e ,e ,9@f ,{f ,f ,6f ,bPf ,wf ,f ,f ,'f ,f ,s#f ,f ,ӽf ,g ,g ,?4g ,O Ag ,?[g ,otg ,irg ,(g ,Mg ,ig ,8g ,ug ,hg ,g ,Xlh ,&}h ,Dh ,h ,=Wh ,.h ,Rh ,'h ,sh ,h ,Zh ,Wh ,D"i ,S&i ,4i ,Bi ,"KPi ,,di ,i ,]|i ,i ,Ii ,pi ,i ,vgj ,ѿ j ,=+j ,˖ j ,/j ,c&?j ,r$ij ,vj ,ij ,8j ,uj , j ,k ,lk , k ,.k ,+4k ,a:k ,@k ,BGk ,oXk ,$:^k ,]=dk ,Ojk ,Iqk ,{k ,Ik ,Ok ,/k ,,3k ,k ,%k ,Vk ,k ,Mk ,l , l ,l ,یl ,sl ,t"l ,+)l ,U:l ,N@l ,GFl ,TxMl ,^l ,(dl ,jl ,$ql ,5l ,4l , l ,f l ,5l ,)l ,nl ,:~l ,m ,}2!m ,ũ+m ,8m ,e_m ,Ilm ,Oym ,9@m ,m ,m ,m ,m ,'m ,2m ,?Rm ,n , n ,9@In ,POcn ,Dqn ,n ,װn ,n ,n ,n ,n ,n ,)Kn ,I"n ,/o ,Dbo ,Oo ,tco ,}o ,o ,|o ,)o ,$+q ,;q ,7gAq ,Gq ,fMq ,Tq ,#!aq ,Onq ,{q ,Lq ,q ,q ,ؖq ,jq ,q ,Sq ,q , r ,-xr ,"r ,5r ,3&Ar ,Nr ,7\r ,Thr ,}r ,Ir ,r ,r ,r ,r ,qr ,r ,r ,r ,is ,s ,b s ,P.s ,x=s ,Ls ,T[s ,'js ,ys ,Zs ,Fs ,s ,*s ,s , t ,5 t ,t ,'t ,T)4t ,XAt ,%Yt ,4et ,@ot ,e |t ,t ,t ,t ,t ,M9t ,pt ,Kt ,Vu ,r+u ,8u ,(Fu ,6Tu ,au ,nu ,{u ,2cu ,u ,Ru ,Su ,%u ,u ,$u ,{v ,3v ,A)v ,6v ,JIv ,wYv ,_v ,ev ,~Akv , rv ,8v ,9@v ,v ,v ,v ,D1v ,VEv ,v ,4v ,*v ,w ,gw ,| w ,B .w ,*x ,?8x ,9Fx , Tx ,jhx ,Hux ,nx ,9(x ,+x ,9@x ,Tx ,x ,5x ,>x ,tPx ,y ,y ,y ,}*y ,y8y ,7rFy ,Ty , by ,py ,:~y ,yy ,q@y ,y ,wy ,Gy ,oXy ,y ,\y ,:y ,e z ,%z ,~&z , 4z ,Bz ,ZbPz ,֋^z ,Šlz ,,zz ,Zz ,z ,z ,̅z ,z ,z ,`Gz ,] { ,?{ ,1;){ ,stG{ ,|;Q{ ,_{ ,m{ ,b{{ ,{ ,{ ,{ ,ݏ{ ,{ ,{ ,y{ ,{ ,c{ ,,| ,| , #| ,M01| ,k?| ,6M| ,;f| ,bp| ,| ,7| ,| ,| ,O| ,| ,| ,!| ,3 } ,@} ,e+} ,Ӊ8} ,>XE} ,R} ,_} , l} ,Uy} ,q} ,G} ,Yd} ,} ,} ,} ,} ,~ ,I8~ , &~ ,0~ ,l:~ ,H~ ,V~ ,Id~ ,r~ ,"~ ,x~ ,~ ,Q.~ ,~ ,~ ,^~ ,~ , ,7" ,G'0 ,u> ,L ,kPZ ,h$h ,v ,9@ ,{ ,1 ,v ,W ,7 ,Y ,؜ , ,2 , ,d ,& ,9΀ ,ne ,V- , D , , , ,* ,[Z7 ,eD ,Q ,V^ ,Fk ,i.x ,j , , ,p7 ,, ,0Ƃ ,Kӂ ,? ,ɍ , ,/ , ,uK! ,9 ,FF ,}_ ,=r , , ,r ,w ` ,m ,*z , , , ,c , ,օ ,8X ,8 , ,m , ,ׇ3 ,o|? ,.O , U ,1[ , k ,7w ,{i ,eD ,U , ,lކ ,2 ,y?% ,< ,HJ ,X ,f ,Wt ,9@ ,> , ,{ ,LJ ,$և , , , ,| , ! ,=0 ,? ,1N ,] ,h$l ,{ ,4 ,r ,Z ,? ,ƈ ,!PՈ ,J , ,n ,hH , ,+ ,9 ,M , [ ,G?i ,\w , ,5 ,J ,aX ,a ,7 ,; , ,O ,_ ,kPċ ,RYы ,bދ ,ܺ ," , ,B  , ,D, ,w~9 ,_F ,S ,>` ,Om ,Tz , , ,@N , , ,Ɍ ,׌ , ,l] ,6 ,z ,ϊ ,+ ,W9 ,G ,_U ,nc ,r ,7 , ,C , ,C ,S̍ ,ۍ , ,̅ , , ,& ,@5 ,;E ,U ,%e ,Eu ,* ,5 ,i/ ,^ ,JnÎ ,AҎ ,]  , , ,M, ,U(: ,bH ,NV ,$d ,r ,o ,$H ,* ,'< ,/ ,Ə ,[/ԏ , ,O ,q ,PI ,O ,9, ,Y; , @J ,KY ,h ,o~w ,F ,z , ,C , ,Cѐ ,S , ,V , ,̅ ,+ ,: ,G'I ,7X ,h ,x , ,% ,n ,U ,*ȑ ,5ؑ ,i/ ,i ,^ ,4 ,8' ,6 ,^E ,T ,c ,r , , ,E , ,Ű͒ ,^ݒ ,2 , , , ,. ,H ; ,3H ,zc ,Gp ,} ,P , , ,^X ,څ ,q˓ ,ؓ , , , ,~W ,& ,3 ,k@ ,ezM ,wUZ ,9@h ,v ,G ,y ,ah ,͙ , , ,Wn" ,/ ,-< ,I ,3V ,Nc ,4p ,u} ,~ ,' , , , ,ו , ,2J ,C , ,% , 2 ,/b? ,L ,Y ,f ,0s ,} , ,9 ,9 ,9Ŗ ,QӖ ,Q ,Q ,1 , , ,L' ,6 ,E ,G<T ,kc ,r , ,k ,I  , , ,̗ ,l+ۗ , ,. ,Q ,' ,6 ,zE ,T ,c ,r ,7 ,9s ,* ,  ,= ,"̘ ,;ۘ ,Qz , ,4 , ,a& ,F5 ,nD ,uS ,ʁb ,oq ,> ,7? ,; ,K ,k ,Z˙ ,ڙ ," , ,D , ,B% ,4 ,cC ,R ,a ,jp ,  ,  , ," ,F ,KŚ ,iӚ ,-j ,e ,Y , ,jm ,X, ,5< ,L ,x[ ,j ,}%y ,h ,@ ,!l , ,.ě ,ӛ ,\' ,: , ,ď ,HH , ,Wn ,eȜ ,mOל , , , ,P$ ,4 ,3HD ,ES ,jb ,Cq ,V\ ,  , , ,ܞ , ,q , ,A ,6N ,ȇ , ,Cu ,+ ,7/9 ,G ,IU ,c ,q ,z ,j , ,+ , ,\̟ ,$J؟ , ,s ,n  , , , ,O ,Y ,] ,? ,G ,V_ ,wi ,s , ,l ,7[ ,& , ,  ,(= ,7 , ,A ,N , , , ,<& ,, ,2 ,$8 ,> , LD ,KJ ,aP ,OV ,.\ ,]!b ,h ,{-n ,St ,cz ,z ,o) ,ў ,{ , ,L ,0 ,/ ,uS ,[ ,u ,i¡ ,ȡ ,Ρ ,ԡ ,Uڡ , ,6 ,_ ,ϛ ,W , ,# , ,M ,9% ,M ," ,( ,<. , 4 ,0: ,6@ ,pF ,iL ,:R ,2X ,^ ,d ,lj ,"p ,v ,h| ,n ,T ,: ,& ,I ,D ,  , ,C , ,3 ,WMĢ ,^ʢ ,WiТ ,G֢ ,Vܢ ,H , 1 , , ,_k ,a ,ٙ , , , ,u ,$ ,X* ,(0 , 6 ,< ,|B ,fH ,N ,T , Z ,p` ,df ,.p ,}Qz ,H , ,cţ ,r , ,\ , ,(* ,CB ,P ,P~ , ,4 , ,ʤ ,Ұ ,# , ,0+ ,][8 ,P ,] ,Bu ,c ,[. ,j ,5 ,OVƥ ,ե , ,+> , ,c ,` ,. ,!= ,oCL ,[ ,j ,qy ,  ,k , ,l ,<Ħ ,Ӧ ,Š ,0 ,s ,b ,! ,A- ,c< ,*?K ,Z ,S|i , x ,T: ,B ,) ,g ,AƧ ,Yԧ ,eD , , ,'$ ,8;2 ,@ ,3"N ,$\ , , , ,Ұר ,# , ,0 ,][( ,@ ,M ,Be ,cr ,[. ,j ,5 ,OV ,ũ ,ԩ ,+> , ,c ,` , ,!- ,oC< ,K ,Z ,qi , x ,k , ,l ,< ,ê ,ŠҪ ,0 ,s ,b ,! ,A ,c, ,*?; ,J ,S|Y , h ,T:w ,B ,) ,g ,A ,Yī ,eDޫ , , ,' ,8;" ,0 ,3"> ,$L , , ,l ,Ε ,Ϭ ,(ݬ ,V" ,1M. ,G; ,H ,V ,a ,) ,# ,I& , , ,jx ,ĭ ,ʭ ,Э ,{֭ ,ܭ , ,_E , , , , ,# , , , ,E ,$ ,$* ,0 ,<6 ,< ,TB ,>H ,EN ,T ,gZ ,?` ,#f ,Ul ,*r ,"rx ,K~ , ,  ,C ,  ,G ,; ,( ,T ,M ,}Ʈ ,}̮ ,Ү ,خ ,[ޮ , ,"0 , ,t ,Ts , , , , , , ,nv& ,j,, ,l2 ,r8 ,> ,D ,ZJ ,33P ,V ,\ ,sb ,h ,'n ,t ,Xz , ,L , ,R2 , , , ,: , ,U¯ ,{dȯ ,79ί ,ԯ ,v3گ , ,> ,c1 ,H ,] ,5 , , ,= , , ," ,3q( ,. ,94 ,B: , @ ,FF ,L ,.R ,HX ,Q^ ,d ,bj ,p ,*v ,SR| ,$ , , ,  , ,9m ,m , ,. ,  ,V ,Kİ ,sʰ ,а ,ְ ,ܰ ,D ,h ,1 ,v , , ,f) ,7 ,E ,S ,h$a ,Po ,Y} , ,Y# , ,^ ,ŭñ ,%ѱ ,b ,7 ,z ,Z7 ,9@P ,_ ,Dn ,)} , , ,Z ,]H ,9@ϲ ,];ܲ ,e , , , ,(/ ,= ,K ,YZ ,h ,v ,gd ,? , ,k ,h ,9˳ ,Gٳ ,~N ," ,) ,yG ,?b& ,,5 ,SD ,R ,` ,z , , , ,F ,˴ ,3 , ,ܾ , ,~L* ,8 ,;L ,We ,os , , ,e , ,? ,vɵ ,׵ ,< , ,U  , ,9@- ,F ,S ,#` ,\m ,Gz , ,ͼ , ,Ͷ ,H۶ , , ,3 ,v' ,E ,~LS ,e@a ,o , , ,Q ,  ,'ʷ ,"ط ,o ,U ,\ ,- ,*; ,[I ,hW ,\ e ,[ ,9@ ,^ĸ ,#Ҹ ,~ ,p ,, ,o ,Z, ,9 ,3R ,Epa ,Bz , ,9@ ,VS ,t͹ , ,R , ,d ,, ,|V9 ,!5n ,{ , ,6 , , ,C ,џ ,6 ,i# ,B ,)s , ,' ,5 ,-mC ,Q ,__ ,4 m ,H{ ,I ,c , , , , ,T/ ,< ,&J ,IgW ,)p ,Ε} ,j , ,Mc ,9@ , , ,<  ,x , , , ,0) ,a7 ,5E ,0tS ,a ,Ko ,s} , ,ׁ ,,/ , ,( ,q ,  , , , ,| ,r% ,5 ,>E ,b ,"p ,~ , , ,K ,T , ,8K , ,Y , ,m& ,4 ,'B ,(P ,x^ ,l ,z ,i , Z ,I, , ,U8 , , , , ,E#* ,'V8 ,)qU ,Fd ,"s ,ZK ,9@ , ," ,S ," ,  , ,9@ ,S* ,'8 ,F ,gT ,|b ,p ,~ ,2 ,f ,_ ,h , , , ,y ,5 ,7 ,E ,LR ,` ,m ,/z , ,R ,  , ,P4 ,` ,. ,P , ,$ ,7 ,%pD ,Q ,^^ ,k ,x , ( , ,> , , , ,ݡ , ,y , ,ݡ , ,6' ,- ,c3 ,9 ,3? ,E ,K ,Q ,W ,^ ,x , ,s ,& ,  ,+n , ,p , ," ,/ ,< ,I ,(V ,cc ,Cp ,~ ,Dj , , ,f ,] , , ,Q ,y , ,0p+ ,P: ,1RH ,W ,a ,Q , ,l( , ,; ,\ ,W , ,) ,bW ,͢ ,x ,$ ,) ,29 , ,O% ,-2 ,I? ,L ,i_ ,yTl ,y , ,^  ,! , , ,B/ , ,2} ,` ,  , ,j ," ,ϝ/ ,7< ,I ,#V ,c ,0p ,n} ,g ,P ,, ,7p ,r< , , ,gQ ,} , ,9 , ,( ,T6 ,&D ,'1R ,8` ,8n ,| ,  , ,Þ ,k ,d , , , ,f' ,5 ,ŭC ,^ ,V}l ,h$z ,Y# , ,^ ,, ," , ,Ε , ,h , ,[) ,M77 ,+E ,6oS ,<a , , ,Ε , ,\ ,V ,$ ,8 ,$ ,!2 ,@ ,aN ,yG\ ,j ,UQx ,d ,'} ,u' ,i ,n ,s , , ,/ , ] , ,] ,5. ,. < ,TmJ ,hX ,Pf ,t ,1 ,Ŕ ,r ,- ,B ,u ,fR , , , ,u , ,* ,l9 ,H ,}DW ,v , , , , ,T ,e[ , , , ," ,? ,* ,9 ,3W ,9f ,%u ,o , ,G ,H , , , ,X ,b ,z , ,ӧ ,ث , ,D ,q ,g ,t ,} , , ,A ,^8 , , ,0 , $ , > ,ܺK ,X ,Gk , ,{f ,D ,e , , ,  , ,D" ,$ ,H ,V ,d ,r , ,P ,z ,+ ,. ,y , ,< ,% ,( ,r  , , ,b ,o ,җ , ,F ,i? ,X ,@C , ,d" ,a( ,r. ,4 ,; ,!B ,tI ,P , W ,Ca ,o , ,N , ,} , ,Y ,Q , ,! , / ,o> ,ѱH ,AV ,zd ,Pr , ,j , ,.[ , ," ,i~ ,'. ,? ,M ,] ,nk ,D"y , ,] , ,N ,} ,s# ,D  ,W , , , , ,Ε: ,9@V ,ud ,r , ,~I , ,0 ,I ,Xv , ,P , F ,v}T ,b ,p ,~ , ,F{ , ,W ,.C ,J , , ,G% ,/A ,ܺ[ , ,+ , , , , ,Ε ,/ , ,h' ,V( , 6 ,l ,&z , , , ,& ,m , ,5 ,: ,6OH ,l ,i} ,ժ ,/ , , ,, , , ,d , ,K6 ,}n , ,5 ,1$ ,W* ,S1 ,.A ,ރG ,&iM ,NS ,~Y ,X_ , e ,k ,1<q ,w ,N} ,# , , , , ,= ,z ,  , ,~p ,&+ ,b ,' ,  ,d ,ճ , ,T , , ,( ,d5 ,gB ,dO ,7\ ,!i ,Bv ,1k ,9 , , ,9@ , ,{ ,T ,d ,g , ,d( ,C ,Q ,+_ ,m , , , , ,u , , ,N , ,n ,+! ,U/ ,Qe= ,EL ,,\ ,j ,x , ,Z ,d ,g , ,d , ,v , ,1k , , ,9@. ,M ,y\ , k ,z ,3 , , , , ,Gf , ,I , ,  ,3 ,n& ,4 ,KB ,P ,^ ,l , z , , , , ,p , , ,%B ,j ,$ ,/ ,L" , '0 ,> ,L ,DZ ,9i ,:w ,d ,g ,ĵ , ,7Q ,d , ,) ,J ,e ,r , ,HP- ,2J; ,}I ,X ,LUg , mv ,] ,l ,} ,C , , , ,z , , ,B ,e* ,9 ,ZH ,W ,,f ,u ,e ,S ,c , ,Oh ,8 ,1l , , ,G ,ŧ& ,n3 ,A@ ,M ,BZ ,Sg ,zRu ,/ ,Q , , , ,,, ,! , , ,@l , ,3 ,f ,2& ,i, ,Z2 ,8 ,o> ,SD ,JJ ,EP ,V ,\ ,$b ,h ,^n ,*t ,c*z , ,L: , , , , ,j  ,l ,Z , ,{ , , ,#6 ,bj , , ,߷ ,w , ,h , ,L ,l ,S , ,c ,Ks" , ( ,7C. ,J4 ,}: ,@ ,\F ,L ,$R ,IX ,@*^ ,d ,j ,p ,={v , | , , ,!d , E , , , ,ִ , ,t ,7 ,B , , ,m ,N ,R ,4 ,F/ ,x#5 ,; ,TA ,pG ,3M ,gS ,KY ,/_ ,e ,-k ,|q ,sw ,} , , , , , , , , ,y ,Y" ,0 ,KE> ,KL ,p[ ,>i ,w , ,! ,/ , ,RA , 8 , ,tA , , ,y , ,SD. ,< ,WJ ,i ,w ," ,Y , , , ,m , , ,N ,C ,: ,@ ,4# ,## , ,! ,/ ,S= ,}K ,2Z ,h ,v=v , , , , , ,2n , p ,  , ,>n , ,( ,. ,ץ< ,J ,X ,qLg ,7u ,w! , ,} ,  ,1 ,+w , , ,A , ,f , ,{, ,-: ,}H ,yrV ,0e ,s , ,{w ,Ez ,u , ,{w ,V ,FM , , , , , ,T7 ,R5D ,2Q ,;^ ,Ck ,Zx ,A8 ,  ,r ,+ , ,X ,ƛ ,] ,( ,8 , ,2 ,,6 ,g% , ,- ,4d! ,' ,4- ,3 ,9 ,k? ,;E ,UK ,2Q ,W ,.] ,c ,,i ,Oo ,u ,{ ,X ,H ,O ,?$ ,' , ,, ,x , , , ,  , , ,s , , , , ,Ua ,0 ,6 ,< ,|B ,%;H ,N ,T ,[ ,k ,q ,bw ,sb} ,u ,,e ,e ,"e ,G[ , ,  , , , , , ,C , , ,$ ,@2 ,I@ ,3N ,0u\ ,ej , ,z ,t ,  , ,~ , , ,f , ,I ,p, ,; ,J ,eY ,C:h ,dx ,] ,5 ,n ,= ,5Y ,= ,O ,t ,6 ,}K$ ,k33 ,jB ,?Q ,` ,o ,M~ ,\ , ,_ ,3 ,S , ,j ,}  ,. ,uD< ,`X ,\s , ,6 ,% , ,C ,Y ,9 ,. ,Q ,+ ,  ,} ,) ,,7 ,>E ,ߝS ,KFa ,בo ,} , ,: ,\l ,- , , , * , ,P , , , ,q ,hB ,k , , ,] ,J , , ,$ ,<+ ,f; ,A ,G ,M ,S ,qY ,_ ,e ,k ,dcr , ,* ,ܢ ,w ,) ,P ,<4 ,. ,! , , ,   ,% ,9@2 ,h? ,L ,Y ,f ,s , ,e ,i , ,W , ,-j , ,}6 , ,"! ,5 ,IB ,O ,\ ,9@i ,v ,e ,~4 , ,B ,B ,I ,kt ,0 ,J , ,Mb ,b ,.v* ,+8 ,F ,!T ,6b ,%p ,~ , , , ,X , ,W , , , , ,?R) ,{7 ,'R ,b` ,n ,A8| , , ,S ,5 ,e ,-% ,$ ,2 ,@ ,p\ ,Pj ,ry , ,*$ , ,= ,P , , , , # ,1 ,u? ,xM ,[ ,_i ,4!w ,`v ,4 ,` ,@ , ,f , ,-* ,8 ,^F ,T ,,b ,2p ,~ ,7 ,  , , , , ,f ,ܺR ,_ ,l ,my ,| ,K ,]U ,Զ ,i , ,] ,H , , , &( ,4 `5= ,~R ,)g ,Ш| ,FT , , , ,f    ,# ,@6 ,Y ,r&m ,.v , ,~ ,;y , ,  , ,'1 ,R ,n , ,6 ,< ,  ,; ,P ,s, ,h3 ,c ,y , ,g ,Z , , , ,/g1 ,C ,~U , , ,< ,O ,' ,  , .: .4 , .X  .V , .k .g" < ؙR , X p  ,|       ,ܸ ` ,  , ,QS9 ,3C [ ,i ,t .x .~ ,QS , . . , . . ,!o   . .  Ś ,& ,? ,Y ,Tc P"q ,~ " , "0 , " , "( ,B , , ,2 ,[ ,QS , ,* ,T p  , , , ,   , "8 ,p  ,H ,- ,; ,H ,U ,x , ,QS , ,p ,* ,_ ,T   , , ,) ,6 !? ,L "H[ ,pi ,H} , , ,si , @! , "@ ,J , , ,0u ,5 ,*O ,TY "b ,v ,  # , " , `# , " , # , "x  , #" ,/ "p> ,K  $T ,a "hp ,} `$ , "` , $ , "X , $ , "P ,R& /N1 ,< .P@ .O .S .X ,_l v /N . . /N . .  /N . . .  . /N .2 ..    .P .N ! 9 ._= .]L #V /Ng .k .lt .x .} /N .Y .U . .u . . .m .g  ٹ  , , . ." ,, ,D .H .S ^] ^z .~ . . . . . k k . . k k . . ݹ  /O .! .* .G. .=7 A /1OQ .zU .t^ h /1Ou .y . . .  /1O . . . . . . /1O .5 .1  /FO .M .K .]  .[  /FO+ .l/ .j8 .|< .zE O /FO\ .` .i .m .v /FO . .    /VO . . /fO . .  . .  8 B _ .c .l .p .y ."} .    /yO .3 ./ .R .J /yO .w .u . . . . ! /O! .! .$! .(! .-! /O6! .:! .C!  M!  e! .i! .r!  |!  ! .$! ."! /O! .5! .1! /! /! .R! .P! .c! .a! .c" .a " ]" ]2" .t6" .r?" .C" .L" ]a" .e" .p" lz" /O" ." ." ." ." /O" ." ." " " ." ." ." ." .# . # # +# .!/# .8# B# Z# .0^# ..j# t# # .?# .=# .N# .L# "# "# .^# .\# .z# .t# &# &$ .$ . $ &*$ &C$ .G$ .P$ .T$ .]$ &g$ &$ .$ .$ .$ .$ .$ .$ .$ .$ &$ &$ .$ .$ .$ .$ &$ &% .$% ."!% .4%% .2.% &8% &Q% .CU% .A^% .Tb% .Rk% &% .e% .a% 9% /O% .% .% /O% .% .% 9% .% .% 9% H& )& F& .J& .S& .W& .]& u& & ʹ& ҹ& & & !' ;' "S' k' M' '  !' '  H!' 2' 2' .' .' 2( 2( ."( .+( 25( 2N( .R( .[( ._( .d( A( h( /O( .( .( .a( .W( /O( .( .( .( .( w( / P( . ) . ) w) w/) .3) .=) ~G) /PS) .*W) .&b) غl) /*P}) .J) .F) .z) .r) ܺ) /3 .MB3 .IK3 .lO3 .dT3 /IQ]3 .a3 .j3 .n3 .w3 .{3 .3 M3 /fQ3 .3 .3 .3 .3 /fQ3 .3 . 3 Z3 Z3 ./3 .-3 Z4 Z4 .> 4 .<-4 /xQ:4 .M>4 .KG4 iQ4 ij4 ._n4 .]w4 .p{4 .n4 .p4 .n4 4 /Q4 .4 .4 .4 .4 /Q4 .4 .4 4 /Q4 .4 .5 .5 .5 /Q5 .5 .+5 >55 >R5 .V5 ._5 >i5 >5 .5 .5 >5 >5 .5 . 5 .5 .5 M5 Z 5 Z 6 ..6 ., 6 .=$6 .;*6 OB6 Z6 r6  6 6 .6 66 >6 7 p-7 B7 W7  "a7 v7  "7 >7  "7 S7  !7 7  !7  7  `"8 L 8  !'8 ~ 88  %G8 KQ8 /Qb8 .f8 .]o8 .s8 .x8 /Q8 .8 .8 8 |8 T8 / R8 .[8 .Y8 T8 / R8 .j8 .h9  9 )9 .{-9 .y69 .:9 .C9 M9 e9 .i9 .r9 .v9 .9 .9 .9 9 9 .9 .9 9 9 .9 .9 9 /R : . : .: .$: .: /R,: .L0: .F9: .v=: .nF: .J: .\: zi: s: : .: .: .: .: .: .: : : : .: .: .; . ; .; .; (#; (;; .?; .H; (R; (j; .,n; .*z; z; z; .;; .9; z; z; .J; .H; z; z< .Y< .W < .h< .f< hB< z\< 4}< <  %< z< z< .x< .v< z< z< .< .= z = z#= .'= .0= .4= .9= ^= h= /?Ry= .}= .= .= .= = /QR= .= .= = /QR= .?= .9= .`= .\= = /QR> .|> .x> .> .> . > .%> /QR.> .2> .;> E> b> .f> .o> .s> .|> > > .> . > .> .> > > .-> .+> .>> .<>  ? .O? .K? 9? C? /cRO? .nS? .jX? /sRa? .e? .n? ? .? .? ? ? d? /R? .? .? .? .? h@ /R@ .*@ ." @ h*@ /R7@ .X;@ .PD@ .H@ .~Q@ h[@ /Rh@ .l@ .u@ .y@ .@ .@ .@ /R@ .$@ .@ h@ h@ .C@ .A@ .S@ .Q@ h@ hA .b A .`A .rA .pA h)A hBA .FA .OA .SA .\A hqA .uA .~A A RA /RA .A .A /RA .A .A RA .A .A RB a$B .B /R?B .CB .HB /RQB .UB .^B hB /RtB .xB .B .'B .%B /RB .9B .5B ȾB ȾB .WB .UB ȾB ȾB .fB .dC C /RC .#C .s,C .0C .5C /RBC .3FC .OC .SC .\C .`C .iC .GmC .5vC .zC .C .C .C .rC .bC .C .C .(C .C fC fC C /4SC .aC .]D .~ D .zD /4SD .D .'D 1D ID .MD .VD `D xD .|D .D D /ISD .D .D .D .D /ISD .D .D D D /YSE .$E . E .:E .8E /YS"E .M&E .I/E 9E QE .iUE .g^E hE E .xE .vE /lSE .E .E /~SE .E .E /SE .E .E E F .F .F .F .F ."F .(F @F /SMF .QF .ZF .:^F .2cF ZF F F  $F F F .fF .dG .uG .s G &G N'G eQG {jG  {G  p$G *G /SG .G .G .G .G /SG .G .G . G .G .DG .BG .[G .WG .yH .qH .H .H -,H -9H GCH G`H .dH .mH GwH GH .H .H GH GH .H .H .H .H CH /TH .H .I .I .  I /TI .0I .*#I B-I BEI ._II .]RI B\I BtI .nxI .lI LI LI .}I .{I .I .I .I .I VI bI /TJ .J .J .J .J /T!J .%J ..J l8J lPJ . TJ . ]J lgJ lJ .J .J /.TJ .+J .'J wJ wJ .EJ .CJ .UJ .SJ .UJ .SJ  K  K .f!K .d*K .u.K .s4K GXK rK K K K 8K  `%K \K />TK .L . L .L .L `"L /UT2L . 6L .?L `IL /UTVL .8ZL .0cL .dgL .^pL `zL /UTL .L .L .L .L .L .L /UTL .L .L `L `L .#L .!L .3L .1M ` M `$M .B(M .@1M .R5M .P>M `HM `aM .aeM ._nM .rrM .p{M `M .M .M \M M /lTM .M .M /|TM .M .M N .N .N  N CN MN /T^N .bN .kN .oN .tN /TN .BN .:N .tN .lN .N .N N N /TN .N .N .N .N /TN .N .O O 'O .++O .)4O >O VO .:ZO .8gO qO O .IO .GO .XO .VO .hO .fO O O /TO .yO .uO .O .O /TP .P .P P /T*P ..P .7P .;P .@P /TIP . MP .VP `P xP .,|P .*P P P .;P .9P P .LP .HP P Q .fQ .dQ .vQ .tQ .vQ .t*Q 4Q PQ .TQ .]Q .aQ .jQ Q .Q .Q Q Q .Q .Q .Q .Q Q .Q .Q ?Q 3R .R .!R .%R .1R F;R /THR .+LR .'UR .EYR .A^R /TgR .ckR .]tR R~R RR .R .R RR RR .R .R R  0%R fR /TS .S .S .S .$S /T1S . 5S .>S .:BS .4KS .\OS .V]S .aS .jS .nS .S S S S /US .S .S .S .S /US .S . S lS lT .;T .9T l%T l=T .JAT .HNT XT /.UiT .YmT .WvT .hzT .fT /.UT .xT .vT T T T .T .T .T .T .T .T U U .U .'U 1U IU .MU .YU />UfU .jU .sU /PU|U .U .U U .U .U U U .#U .!U .3U .1U .3U .1U 4V 4%V .D)V .B2V .S6V .Qr .Cr ,Nr ./Rr .-Wr ,Ter ,rr `/{r ,r "r ,o[r .r .r .?r .=r 7r 7s .N s .Ls 7s 74s .]8s .[As 7Ks 7ds .lhs .jqs .{us .yzs Fs Fs /As .s .s .s .s Js /As .s .s Jt /At .t .t .H#t .B,t J6t /ACt .jGt .dPt .Tt .]t .at .ft /Aot .st .|t Jt Jt .t .t .t .t Jt Jt . t . t .t .t Ju Ju .+!u .)*u .<.u .:7u JLu .MPu .IYu tu h~u /Au .pu .hu /Au .u .u /Au .u .u mu u  v v  { .LG{ .^K{ .\T{ ^{ w{ .m{{ .k{ .~{ .|{ { .{ .{ { @{ /NG{ .{ .{ /hG{ .| . | /rG| .| ."| E3| ZZ| d| | .| .| ..| .,| Ŧ| | | } }  `#} ,)} /CH>} .EB} .;Q} .U} .}Z} ,e} .i} .n} ,y} .}} .l} .} .} ,T} } } } ,} @*} ,} "~ ,~ *~ ,%~ "/~ /HC~ .G~ .W~ .[~ .k~ .+o~ .%x~ Y~ /H~ .H~ .D~ .e~ .a~ /H~ .~ .~ ~ ~ .~ .~ ~  . .' 1 I .M .V ` y .} . . .   /YH . . .5 .%  /rH . .w  /rH' .+ .4 .8 .A K /rHX .\ .e .i .r .;v .3{ /rH .d .^   . .}ŀ .ɀ .Ҁ ܀  . . . .  2 .6 .? .C .L a .e .n  n /H . . /H ./ .) /Hǁ .Qˁ .Kԁ s  D D3 .o7 .m@ .~D .|M DW Do .s .| . . . . L L . .ł Lς L . .   .# .- 7 T .X .a . e .k   l ˃     N  9 ,x? /KJ ,U .?Y .^ ,i .m .| , . . .& . ,_ʄ .`΄ .^ӄ ,T , , , "  9 .o= .mF .~J .|T ^  . . . .   /K΅ .҅ .ׅ /K . .  /K . . .  .  /K' .0 + .* 4 > V .O Z .M c m  .^  .\  ϳ .o  .k  ϳ† ϳۆ . ߆ .  .  .  .  .   - . 1 . : . > . G . K . T  ^  v . z .    .  .  Q /KЇ .!ԇ .!݇ .&! ."! .B! .>! .d! .`! .! .|! .! .! .!" .!' /K0 .!4 .!= QG /KX .!\ .!e /Lr ."v . " /L .;" .9" _ _ .M" .K"Ȉ f҈ /%L߈ .\" .Z" .m" .k" .}" .{" ." ." ." ." ."$ ."- ."1 .": sD /5LU ."Y ."h {r /EL ." ."  /UL . # . # lj /jLӉ .'#׉ .##  /|L .A# .=# .[# .W#  /L' .w#+ .s#4 .#8 .#A .#E .#J /LS .#W .#` j  .# .# .# .#  Š . $Ɗ .$ϊ .$ӊ .$܊   .($ .&$ .8$ .6$ . .I$2 .E$; TX fz ! /L .g$ .c$ .$ .$ ! /Lɋ .$͋ .$֋ ! /L .% . % .9% .5% ! /L .S%" .O%+ .m%/ .i%8 .%< .%A /LJ .%N .%W !a !~ .% .% .% .% ! ! .% .%Ȍ .%̌ .%Ռ !ߌ ! .& .& .& .& !' .(&+ .$&4 GX rb /Ln .K&r .C&w / M .x& .r& /M .& .& { ۍ L L .& .& .& .& .7 ״X Pm   !Î yԎ   ,p /K .& .& .%' .' ,& .t'* .f'/ ,: .'> .'M ,t .(x .(} , .L( .D( ,_ .( .}( ,d .(ď .(ɏ ,ԏ .)؏ .) .) .) , .) .) ,T ް" ְ1 ǰ? ,L @+U ,b "8q ,~ + , "0 , + ,Ɛ "(А /Kِ , .D* .B*   .T* .R*! .T*% .R*. .T*2 .R*> ,K ,T ,a " p ,} @, , "  ȑ .d*̑ .b*֑ ǰ ǰ .s* .q* ǰ ǰ, .*0 .*9 ǰC ǰ\ .*` .*i .*m .*r ְ ް //K .* .* .*Ò .*̒ ֒ /FK .6+ ..+  /FK .d+ .\+ .+ .+$ . /FK; .+? .+H .+L .+U .,Y .+^ /FKg .0,k .*,t ~  .O, .M, ._, .],  ؓ .n,ܓ .l, .~, .|,   ., .," .,& .,/ D .,H .,Q ±l v  ., ., /]K ., ., ” .,Ɣ .,ϔ   6 6* .-. .-7 .-; .-D 6N 6f .--j .+-s .<-w .:- .N- .J- > > .l- .j- >ƕ >ޕ .{- .y- V /mK .- .- .- .- /mK) .-- .-8 B /}KS .-W .-` .-d .-i /}Kr .-v .- U U .. ..  ݖ .&. .$. .5. .3.  ް$ A ϱY n  x 8 P _̗ Dz  ## -0 E  O d  n   P G   , /PDĘ ,Ϙ .h.Ә .B.ؘ , ./ . / .g/ .W/ ,T . ,$ .- ,: "PI ,V @._ ,l "H{ , . , "@  /fDǙ ./˙ ./ԙ ./ؙ ./ G G ( (7 ./; ./D ./H ./R _\ /vDm ./q ./z .0~ .0  /D .0 .0 .&0 .$0 /Dš .70ƚ .50˚   /D .H0 .D0  /D# .b0' .^00 : /DG .|0K .x0T .0X .0a k /Dw .0{ .0 .0 .0 .0 .0 /D .1 .1  ֛ .%1ڛ .#1 .51 .31   .D1 .B1 .T1# .R1, 6 O .c1S .a1\ .s1` .q1i ~ .1 .1 [ mʜ (Ԝ /D .1 .1 .1 .1 ( /E ."2 .2& (0 /E= .M2A .E2J .t2N .p2W (a /En .2r .2{ .2 .2 .2 .2 /E .2 .2 ( (Ν .3ҝ .3۝ .3ߝ .3 ( ( ."3 . 3 .23 .03% (/ (H .A3L .?3U .R3Y .P3b (w .c3{ ._3 N r /2E .3ž .~3Ǟ /LEО .3Ԟ .3ݞ /VE .3 .3 { + 5 R .3V .3_ .4c .4i    (؟   x   8 :'  4 .? ,Q ,^ ,l ,jr //M .4 .4 .e4 .Q4 , .4 .4 ,  .Z5Ơ .B5ˠ ,֠ .5ڠ .5 .6 .5 , .k6 .e6 ,  .6 .6% .6) .6. ,T= L [ i ,v - , "p , @- , "hȡ /Mܡ .6 .6 , - , "` ,) -2 ,? "XM jW /Mh .7l .7u .!7y .7~ /M .37 ./7  Ţ  x Ϣ     .Q7 .O7$ . K .`7O .^7X b z .o7~ .m7   .~7 .|7 .7 .7   /EM .7 .7 .7 .7 $ /jM4 .=88 .58A K /jMX .l8\ .d8e .8i .8r | /jM .8 .8 .8 .8 .9 .8 /jM .49 ..9¤ ̤  .R9 .P9 .b9 .`9  & .q9* .o93 .97 .9@ J c .9g .9p .9t .9}  .9 .9 Ҷ ĥ /MХ .9ԥ .9٥ /M .: .9 /M .$: .:  = CG Cd .D:h .@:q .Z:u .X:~ C C .k: .i: .z: .x: .: .:Ǧ KѦ K .: .: K K .: .:) X3 /MD .:H .:Q .:U .:Z /Mc . ;g .;r |  .5; .3;  .H; .D;ʧ ԧ  .e; .c;  .x; .t;" U, /M= .;A .;J .;N .;S /M\ .;` .;k u  .< .< ~ ~Ǩ .&<˨ .$<Ԩ .5<ب .3<ި ٵ  ڶ& ;  E ] {    0 ,é ,Щ , , ,* ,T' %0 ,7 ,K ,X @%a ,n "y , % , "x , /H ,ê .j<Ǫ .B<̪ ,ת .)=۪ .= .~= .p= ,T , `2 ,$ "2 m< mY .=] .=f .=j .=t ~  .= .= .= .= .= .= ׫  /H .> .>  /I .0> .*>" , /I9 .Q>= .K>F .r>J .l>S ] /Ii .>m .>v .>z .> .> .> /I .> .>  Ȭ .?̬ .?լ .,?٬ .*?   .;? .9? .K? .I? ( A .Z?E .X?N .j?R .h?[ p .{?t .w?}  ^ +ƭ /I׭ .?ۭ .? .? .? + / .6AG .IAK .GAT +i .ZAm .VAv Q c /UI .}A .uA /oI¯ .AƯ .Aϯ /yIد .Aܯ .A l  S' SD .AH .AQ .AU .A[ }    +ذ   P , /cJ .B .B" .rB& .`B+ , 6 .B: .B? ,J .CN .gCS ,^ .#Db .Dg ,(r .Dv .D{ ,e .D .D , .D .D .!E . E ,TƱ oձ g X  , 0 ,$ "3 ,@ 1I ,V "` /Jt .Ex .E , @1 , "  ڲ .E޲ .E .E .E .E .E    ,, 15 ,B "Q ,^ 1g ,t " , 2 , " X X۳ .E߳ .E X X .F .F X! X: .F> .FG .$FK ."FP gu o /zJ .6F .2F .nF .^F s /JĴ .Fȴ .FѴ s۴ /J .F .F .$G .G s /J .JG .DG& .pG* .jG3 .G7 .G< /JE .GI .GR s\ sy .G} .G .G .G s s .H .Hõ .Hǵ .Hе sڵ s .$H ."H .5H .3H s" .FH& .BH/ pJ BT /J` .iHd .aHi /Jr .Hv .H /J .H .H K `Ͷ ׶ /J .H .H /J .H .H  ) . I- .I6 .I: .IC .+IG .'IP Z r .IIv .GI   .XI .VI  ڷ .iI޷ .eI .I .I .I .I  # .I' .I0 : R .IV .Ib )l ) .I .I .I .I  ˸ .Jϸ .Iٸ ͯ ͯ .J .J & &5 .J9 .JB ..JF .,JL :d o|   й ȯ  H ׯ ,% :  8D UY  xc x     h , /FA , .OJź .;JԺ .Jغ .Jݺ , .J .J ,( .[K .QK , .K .K ,$ .K( .K- ,T; ,H /Q ,^ "l ?v /\A .7L .5L .FL .DL /\A .YL .UL E Eջ .wLٻ .uL E E .L .L a a< .L@ .LI .LM .LW a /lAr .Lv .L .L .L /lA .M .L    ,Z) /Eɼ ,Լ .@Mؼ .M .M .M , .1N .#N Z ,T" ,/ )8 ,E "S 5] /En .lNr .jNw F  /E .N .{N  /Eǽ .N˽ .NԽ ޽ /E .N .N .N .N  /F .O .O( .,O, .&O5 .PO9 .JO> /=FG .qOK .kOT ^ z .O~ .O .O .O   .O .Oþ .OǾ .Oо ھ  .O .O .O .O " .O& .O/ L n x /\F . P .P .-P .+P  /lF .@Pÿ .:P̿ .aPп ._Pտ  ¥ /|F .rP .nP% .P) .P2 ¥< /FL .PP .PY ¥c /Fp .Qt .Q} .DQ .@Q ¥ /F .^Q .ZQ .xQ .tQ .Q .Q /F .Q .Q ¥ ¥ .Q .Q .Q .Q ¥% ¥> .QB .QK .RO .RX ¥b ¥{ .R .R ."R . R ¥ .3R ./R   /F .VR .NR /F .R .}R /F .R .R& 7  ^ |h | .R .R .R .R h   ( ,G /pE , .S .R .S .vS ," .S& .S+ ,T9 ,F `0O ,\ "j Ft /E .T .S /E .T . T ؤ    w  D ,J / NU ,` .2Td .Ti ,t .Tx .T} ,T / N ,o[ . U . U ,  ) , " ! /0N .U .U .U .U % /VN) .V- .V6 %@ /VNM .IVQ .AVZ .sV^ .mVg %q /VN~ .V .V .V .V .V .V /VN .W .V % % . W .W .0W ..W % % .?W .=W( .OW, .MW5 %? %X .^W\ .\We .oWi .mWr % .W .|W  U /yN .W .W /N .W .W /N .W .W Z m5 ? \ .X` .Xi .(Xm .&Xs   ! S u   /,  L ,fR /B] ,h .AXl .5Xq ,T , ) , " u /4B .xX .vX .X .X  /GB .X .X  /XB$ .X( .X1 ; /XBH .XL .XU .XY .Xb l /XBx .Y| .Y .#Y .Y .>Y .:Y /XB .YY .SY   .tY .rY .Y .Y   .Y .Y .Y$ .Y- 7 P .YT .Y] .Ya .Yj  .Y .Y  ) ϟ /iB .Y .Y . Z .Z  ' /yB8 .-Z< .)ZE .WZI .SZR \ /Bl .sZp .oZy  /B .Z .Z .Z .Z  /B .Z .Z .Z .Z .Z .Z /B . [ .[  ! .[% .[. ./[2 .-[; E ^ .>[b .<[k .N[o .L[x   .][ .[[ .n[ .l[  .[ .{[  + /B .[ .[ /B .[$ .[- /B6 .[: .[C 0T ?s !  H ,d /:D , .[ .[ , .\ .\ , .>\ .8\ ,T  , % ,! "0 ,= &F ,S "] eu     ¢    0  P ,V /Ca ,l .m\p ._\u ,W .\ .\ ,T ,  0 , " v /C . ] .] .(] .$]  /C .K] .C]& 0 /C< .s]@ .m]I S /C` .]d .]m .]q .]z  /C .] .] .] .] .!^ .^ /C .B^ .<^   .^^ .\^ .n^ .l^  + .}^/ .{^8 .^< .^E O h .^l .^u .^y .^  .^ .^  -  /C .^ .^ .^ .^ ͡5 ѡ? / DP ._T ._] .A_a .=_j ѡt /D .]_ .Y_ ѡ /D .u_ .q_ ._ ._ ѡ /D ._ ._ ._ ._ ._ ._ /D ._ ._ ѡ ѡ9 . `= .`F .`J .`S ѡ] ѡv .(`z .&` .8` .6` ѡ ѡ .G` .E` .X` .V` ѡ .i` .e`   2 .`6 .`; /*DD .`H .`Q f .`j .`s   v   , /LJ , .` .` ,T , @& , " ) ,6 &? ,L "[ ,h &q ,~ " , ' , " , @' , "   .va .ta$ .a( .a. *F d^ lv     ح 6   V"  `, vA  K `  j {   ,ւ /U , .a .a , .a .a , .^b .Tb , .b .b ,W .b .b , . c .b ,  .ec .[c5 ,@ .cD .cI ,_T .dX .d] ,h .0dl ..dq ,Tz /U ,o[ .Hd .>d , 2 , "x , 2 , "p ,  3 ,$ "h3 ,@ `3I ,V "`e ,r 3{ , "X , 3 , "P ,  4 , "H , `4 , "@- ,: 4C ,P "8_ ,l 4u , "0 ,  5 , "(  /U .d .{d .d .d  / V .d .d ( / V5 .d9 .dB . eF .eO Y / Vf .'ej .#es .Cew .?e ._e .[e / V .e .{e   .e .e .e .e   .e .e .e .e ' @ .eD .eM .eQ .eZ o .fs .e|  4 4 .f .f /V ./f .-f 4 .>f . .jG gQ gj .jn .jw .j{ .j g g .k .k .!k .k g .2k .0k g /V .Ek .Ak .ok .kk g* /V? gI /V[ .k_ .kh gr /V .k .k .k .k /V .k .k g g .k .k g g .l .k g( gA .lE .lS gh .$ll . lu    .Al .?l /V .Sl .Ql  .bl .`l  . _8 /VI .ulM .olV _` /Vl .lp .ly _ /W .l .l /W .l .l h t t .l .l .m .m x 0 fH h      0 8' @? iW so / Q n   A g+ C 1[ 9s F _     w   @'    h')  >  `&H #!]  &l O!  & z!  & !  & !  8& !  & 0".  &= _"N  'n ,/{ , , , , 0 , , .m .m ,f ,7 ,D , P ,a ,o[o ,a ,  , , , , ,}K ,Q , ,N &+ ,N9 ,NM ,RX pp ,z .:m~ .*m , .m .~m , .m .m ,T .;n ./n  ,o[ .kn .in  ,!  ,o[% .zn) .xn/ @ ,:M yW /@c u  /@ .n .n  /@ .n .n  /@ .n .n .o .o  /@ .0o .*o .Ro .Lo .vo# .no( /@1 .o5 .o> H /AX .o\ .oe o /A{ .o .o  /A .o .o  /A .o .o ǜ / A . p .p .!p .p .Cp .?p ǜ / A+ .[p/ .Wp8 .sp< .opE .pI .pR ǜ\ / Ai .pm .pv .pz .p .p .p / A .p .p .#q .q .Bq . ,U ,Nb ,}~ ,V ,N , ,N ,: ,N ,? ,oVb ,k ,s , , , ~ , ,i ,r ,c , ,+ ," ,r. ,c< ,*Y ,re ,c~ , ,\ , , ,{ ,O ,: ,\ ,:h} , ,ʤ ,  ,ĉ, ,_J ,{~ ,^ ,Q ,_ ,n , , , , ,. ,< ,:]^ ,{ , ,D" , ,( , , ,tm , , ,0 ,H ,`0 ,< ,nI ,Og , ,4  ,Qi , ,D" ,Y ,D" ,߶ ,D" ,j- ,D"9 ,F ,sa ,D"n ,Vo ,D" p .{q .sq .q .q y .q .q y  .r .q 2 M .1rQ .%rZ .ur^ .krg .rk .ry /D@ .r .r   /D@ .s . s .!s .s   /D@ .3s .1s  /T@ ]1  > &M /d@Z d /{@p .Est .Cs}   Q Q .Ts .Rs Q Q .es .cs  .vs .ts Q" Q: .s> .sG .sK .sT Q^ Qv .sz .s .s .s Q Q .s .s .s .s ƛ ԛ /@ .s .s ԛ$ ۛ; (E /@U .sY .sb .tf .to (y /@ .*t .&t .Bt .>t .Xt .Vt ( /@ .it .et .t .}t .t .t /@ .t .t 0! B6 .t: .tC BX Bl ƛ  .t .t . ,L , LQ ,j_ ,d ,} ,k ,I , ,m , ,  ,1 ,8? ,cD ,zCP ,\ ,Sh ,xt ,E , , ,y ,D ,0 ,6 ,5' , , ,# , , ,x ,# ,V/ ,W; ,=?G ,xS , _ ,r ,cw ,% ,N , ,[ ,U ,% , ,cA ,% , ,ѓ , , ,ٿ$ ,0 ,< ,Q ,r_ ,%t ,r ,\ ,Y , ,:! , ,0 , , ,E ,.* ,7 ,Ik ,N# ,JW ,z ,N  ,  ,~s , ,  ,~s ,F& ,M4 ,B ,HP ,"D^ ,+l ,Nz ,  , ,H , ,L , , ,H ,Q , , ,% ,3 ,A ,MO ,'] ,>bk ,y ,w ,t ,_Y , , , ,5 , , ,F ,_& ,D*5 ,(D ,5S ,b ,/q ,! ,5 ,c ,e , ,%* , , ,o ,f ,7& ,25 ,:D ,gS ,b ,0q , ,J ,g ,c , ,? ,  , ,Z ,  ,/ ,m(% ,b"4 ,(C ,#R ,a ,Jp ,. ,V , ,' ,E ,S= ,$ ,8 , , ,E ,$$ ,U4 ,!j ,\+ , ,5 ,߿ , , ,7" ,!O ,\+\ ,h# ,>B ,kb ,Lo ,x| , , ,߿ ,x  ,% ,& ,@2 ,> ,J ,vm , ,X) ,i\ ,i\ , ,W  , ,&G$ ,1 ,kK ,X ,Ut ,߿ ,P , , ,( , ,> , , ,E2 ,8 ,E ,V R ,_ ,km ,X{ ,߿ , , , ,& , ,)< ,% , ,~  , r ,q( ,L6 ,D ,| R , y` ,kn ,<| ,i , ,2 ,A ,% , , ,Ek ," , , ,O ,q^ ,m ,l} ,XC ,=C ,K ,7 ,' ,  , ,O , ,D_ ,# ,2 ,,A ,jP , _ ,n ,} ,+ , , ,y ,L+ ,  , , , , ,qk" , 1 ,-@ ,*LO ,v^ ,'m , | , ,I ,s ,f , ,  ,N< ,5 ,Q ,?! ,60 ,/? ,xdO ,_ ,o ,; ,- ,8 ,W  , ,ߨ ,= ,Yb ,. , ,'i ,|/ ,? ,dO , ^ , | ,' , ,w , , ,` ,OD ,f , ,F ,! ,0 ,{? ,?N ,oq] ,l ,<{ , ,=L ,-3 , , , , , ,7! ,Y! ,D ! ,/! ,\?! ,;N! ,]! ,l! ,E{! ,.! , ! ,4.! ,/! ,z%! ,%! ,o]! ," ,B@" ," ,M." , =" ,gL" ,[" ,Nj" ,^y" ,s" ,n" ,s" ," ,L" ,v " ,c>" ,)k" ,# , # ,ȹ# ,-# ,<# ,$K# ,#Z# ,xi# ,x# ,gJ# ,=-# ,I# ,2# ,# ,# ,# ,D# ,M# ,$ ,\$ ,,$ ,;$ ,rJ$ ,`Y$ ,5Ch$ ,w$ ,($ ,`$ ,5$ ,"$ , $ ,$ ,$ ,$ ,`$ ,2 % ,A8% ,[+% ,7W:% ,I% ,RX% ,U~g% ,0pv% ,% ,G$% ,% ,% ,% ,P% ,% ,"% ,ri% ,] & ,޹& ,H#+& ,<:& ,xI& ,X& ,g& ,'v& ,& ,b& ,& ,`& ,QR& ,& ,t& ,#& ,l& , ' ,~' ,^w+' ,:' ,goI' ,t?X' ,g' ,Gv' ,%' ,;V' ,' ,5' ,7' ,' ,U' ,' ,y' ,o ( ,ئ( ,Ӿ*( ,Wa9( ,*H( ,ig( ,v( ,.( ,î( ,( ,'( ,M( ,-( ,0( ,o( ,&( , ) ,g) ,J*) ,V:) ,J) ,P'Z) ,j) , y) ,) ,) ,) ,A) ,#) ,Y* ,Y* ,ٴ** ,:* ,ߢo* ,p}* ,* , * ,\* ,Y* ,!* ,* ,* ,* ,+ + ,+ ,f'+ ,5+ ,C+ ,Q+ ,D+ ,+ ,1+ ,'+ ,8+ ,+ ,k, ,, ,R), ,*7, ,0lE, ,1T, ,&b, ,p, ,a~, ,, , , , , ,5(, , , ,T, ,Ӯ, ,9, , - ,N!- ,.- ,]\- , p- ,qF- ,pJ- ,- , - ,]#- ,k- ,- ,X . ,. ,+. ,T4. ,V"<. ,I. ,=&W. ,pc. ,p. ,w}. ,=. ,. ,Q. ,Z. ,k. ,[. ,. ,I. ,/ ,/ ,Y  / ,>/ ,VJ/ ,W/ ,hld/ ,q/ ,~/ ,/ ,s%/ ,1/ ,/ ,k/ ,Ӫ/ ,y/ ,@/ ,/ ,_/ ,À 0 ,##0 ,]00 ,5=0 ,J0 ,W0 ,o0 ,|0 ,V0 ,0 ,0 ,>0 ,0 ,k1 ,z1 ,u%1 , 31 ,A1 ,zO1 ,Ȕ]1 ,k1 ,y1 ,1 ,1o1 ,G1 ,1 ,OX1 ,,1 ,k1 ,1 ,$1 ,'2 ,"2 ,'!2 ,w/2 ,,b=2 ,K2 ,OY2 ,5g2 ,u2 ,&2 ,FM2 ,q2 ,2 ,s2 ,2 ,2 ,2 ,2 ,=3 , 3 ,!3 ,.3 ,k<3 ,I3 ,Mm3 ,߿y3 ,3 ,3 ,3 ,3 ,3 ,C3 ,I3 ,64 ,a4 ,4 , 4 ,4 ,+ 4 ,&4 ,6,4 ,24 ,84 ,`>4 ,D4 ,.J4 ,P4 ,U V4 ,!\4 ,:b4 ,4y4 ,O4 ,U4 ,4 ,˞4 ,4 ,D4 ,4 ,4 ,4 ,P4 ,4 ,4 ,4 ,5 ,QI5 , 5 ,a5 ,5 ,5 ,r%5 ,c`+5 ,w15 ,jE75 ,0=5 , C5 ,_I5 ,^O5 ,}U5 ,6\a5 , q5 ,5 ,S5 ,-5 ,5 ,5_5 ,5 ,u5 ,~5 ,A>5 ,6 ,6 ,{*%6 ,6P46 ,C6 ,R6 ,*a6 ,Lp6 ,!6 ,l6 ,F(6 ,?6 ,6 ,6 ,6 ,I6 ,6 ,7 ,t7 ,X%7 ,EV47 ,}C7 ,[R7 ,Q'a7 ,]p7 ,k7 ,L7 ,!7 ,17 ,7 ,c7 ,?A7 ,7 ,7 ,M8 ,8 ,8 ,*+8 , E8 ,MR8 ,^8 ,7k8 ,8 ,RO8 ,8 ,9 ,ʪ9 ,^9 ,9 , 9 ,#: ,0: ,#f=: ,ʪJ: ,/W: ,): ,A : ,ʪ; ,w; ,!; ,uD*; ,VC; ,\iP; ,]; ,]; ,; ,{; ,2; , ; ,; ,A; ,Ą< ,sV'< ,T7< ,xD< ,зR< , _< ,fvm< ,P< ,!< ,L< ,w< ,{< ,V.< ,< ,f&= ,5"= ,#= ,3= ,AA= ,ZO= ,]= ,.}= ,= ,Bc= ,!= ,b= ,]7= ,= ,g= ,Kn= ,> ,L.> ,T;> ,H> ,WU> ,b> ,"> ,> ,+> ,Q> ,k> ,1> ,> , ? ,? ,'? , 4? ,5A? ,AN? ,0\? ,i? ,? ,? ,? ,? ,w? ,\? ,:? ,@ ,<@ ,/@ ,k<@ ,I@ ,o|V@ ,r@ ,P~@ ,1@ ,j@ , @ ,~s@ ,K@ ,߿@ ,(p@ ,2 A ,A ,.$A , 1A ,~s?A ,kWRA ,S^A , jA ,wA , A ,4}A ,qA ,kA ,'"A ,^A , B ,B ,'B ,iVAB , TB ,dB ,2jB ,pB ,;vB ,ʹ|B ,B ,B ,B ,B ,1B ,B ,B ,%{B ,]B ,XB ,0 C ,T"C ,=&0C ,pBC ,;C ,C ,&OC ,qC ,L%C ,;D ,vD ,L%"D , 0D ,Z=D ,/KD ,(pYD ,mfD ,L%tD ,U D ,^D ,D ,D ,/D ,zD ,D ,D ,D ,D ,D ,!E ,d+.E ,;E ,IHE ,KbE ,LoE ,\(|E ,7E ,gE ,݋E ,n E ,(pE ,E ,kE ,c>F ,R F ,>F ,(F ,;F ,1YF ,TpeF ,jCrF ,F ,AF ,F ,L F ,8F ,goF ,F ,F ,o|G , G , G ,<-G ,xRG ,] ^G ,+jG ,{G ,'G ,` G ,+G ,&G ,&G ,j1G ,@G ,eG ,H ,%/H ,7H ,6H ,@CH ,ePH ,7gH ,@tH ,eH ,hH ,XH ,\2H ,H ,"H ,H ,H ,x@I ,I ,!I ,8I , DI ,PI ,"\I ,_hI ,~~I ,I ,\WI ,I ,ŤI ,t|I ,I ,G J , J ,{%J ,.f1J ,=J ,GSJ ,ܖ`J ,=mJ ,zJ ,MdJ ,J ,lvJ ,@J ,/J ,J ,:J ,K ,K ,"K ,0K ,(=K ,JK ,WK ,|dK ,rK ,T9K ,)K ,NK ,gK ,K ,+ZK ,K ,tK ,L ,gL ,LL ,/K+L ,58L ,FEL ,ISL ,1`L ,KmL ,{zL ,bL ,cL ,L ,\L ,L ,; L ,L ,L ,L ,L ,= M , ")M ,\6M ,TDM , QM ,_M ,xlM ,kyM ,^M ,M ,kM ,~M ,M ,~M ,M ,NM ,?! N ,~N ,F%N ,2N ,~@N ,UN ,~bN ,wpN ,N , dN ,N ,-3N ,<N ,N ,wN ,% O ,O ,'O ,O ,q$O ,.+O ,9O ,~GO ,`UO ,qO ,<O ,O ,=LO ,O ,-JO ,O ,O ,O , O , O ,g-P ,(P ,^*P ,S8P ,FP ,TP ,qbP ,լpP ,hD~P ,P ,@P ,SP ,P ,\P ,P ,SP ,DP ,PP ,3 Q ,/Q ,Z)Q ,7Q ,EQ ,"$SQ ,uaQ ,{oQ ,}Q ,fQ ,Q ,3Q ,XQ ,Q ,W Q ,'Q ,Q ,zQ ,A R ,R ,%R ,?3R ,GBR ,VRR ,`R ,oR ,w}R ,bR ,R ,R ,EkR ,qR ,$R ,ʯR ,9,R ,xR ,e S ,S ,2%S ,3S ,AS ,OS ,]S ,BkS ,eyS ,S ,BS ,S ,S ,S ,˄S ,'S ,EkS ,T , T ,BT ,?(PT ,;_T ,6umT ,T{T ,A[T ,T ,:kT ,T ,wT ,kT ,M>T ,tT ,FT ,1U ,qU ,e/U ,?U ,OU ,-^U ,zU ,6 U ,U ,U ,QU ,cU ,#U , U ,\( V ,_ %V , 3V ,AV ,V6OV ,v_V ,F V ,zV ,V ,iV ,V ,V ,OV ,\V ,W ,W ,ư$W ,2W ,}@W ,NW ,Nw\W ,rjW ,bxW ,[W ,kW ,W ,W ,W ,W ,;W ,W ,Y X ,wX ,G..X ,I;X ,?gHX ,eacX ,X ,X ,fX , X ,X , yX , X ,"Y ,fY ,R}Y ,t(Y ,˓5Y , aBY , OY ,_\Y ,6<iY ,vY ,IY ,Y ,Y , Y ,&Y ,Y ,-Y ,I$Y ,>Y ,@Y ,$Z , y1Z ,EZ ,0_Z ,I$lZ ,-Z , Z ,]7Z ,Z ,Z ,Z ,kZ ,"[ , [ ,N[ ,U4%[ ,k/[ ,B@<[ ,I[ ,͸V[ ,Oc[ ,mp[ ,B}[ ,[ ,[ ,[ ,<[ , [ ,E[ ,)[ ,k[ ,EZ[ , \ ,tn\ , \ ,&'-\ ,t:\ ,G\ ,T\ ,a\ ,an\ ,k{\ , \ ,\ ,\ ,/\ ,gn\ , \ ,TV\ ,\ ,i] ,] ,] ,,] ,x:] ,<V] ,d] ,r] ,<] ,] ,?] ,Z] ,=L] ,] ,-3] ,] ,] ,] ,K ^ ,Y^ ,D(^ ,S6^ ,iD^ ,u]R^ , `^ ,n^ ,*|^ ,^ ,^ ,D^ ,^ ,2^ ,^ , ^ ,^ ,^ ,b_ ,_ ,r$_ ,fK2_ ,M@_ ,T_ ,Ca_ ,Fn_ ,{_ ,up_ ,$_ ,_ ,_ ,gJ_ ,_ ,]_ , _ ,_ , ` ,!` ,%` ,%3` ,A` ,O` ,Hc` ,Im` ,2z` ,` ,AQ` ,` ,w` ,4` ,` ,` ,T` ,` ,a ,a ,a ,,a ,9a ,KGa ,IUa ,Jca ,qa ,ja ,a ,W}a ,ua ,#a ,a ,a ,_a ,[`a ,b ,$b , #b ,!2b ,.Hb ,Rb ,`b ,nb ,߮|b ,b ,.b ,Ib ,7Wb ,rib ,b ,c ,*c ,vBc ,Pc ,C^c ,Xrlc ,dzc ,=c ,pc ,c ,cc ,`Tc ,c ,Zc ,9c ,\c ,d ,}d ,E"d ,0d ,o>d ,۟Ld ,LZd ,jid ,xd , d ,d ,td ,d ,d ,d ,d ,"d , e ,e ,$e ,#1e , >e ,%Ke ,Xe ,ee ,Hvre ,e ,e ,e ,{Ne ,e ,ke ,e ,6e ,e ,f ,]@f ,O#f ,%1f ,cLf ,-Zf , hf ,pvf ,6f ,6f ,f ,rf ,f ,Cf ,f ,f ,~g ,V"g ,+g ,b_9g ,Mg ,XZg ,gg ,tg ,`g ,`bg ,g ,cg ,Yg ,k"g ,zKg ,g ,&g ,Ag ,G h ,`h ,$h ,71h , >h ,dKh ,Xh ,+$jh ,wh ,dzh ,Bh ,h ,&h ,omh ,h ,h ,kh ,h ,e i ,/i ,I'i ,4i ,"Bi ,TOi ,\i ,Aii ,78xi ,Yi ,Mi ,Ci ,)i ,qi ,i ,2i , j ,6"j ,/j , qk ,_Lk ,@Zk ,hk , vk ,3gk ,k ,k ,Rk ,k , k ,k ,k ,8h!l ,L.l ,e;l ,~5Hl ,Ul ,bl ,,ol ,i|l ,Ll ,Ll ,[l ,l ,l ,l ,#l ,(l ,0m ,=m ,m ,E5m ,Am ,Nm ,k[m ,~3hm ,Ium ,n m ,Nm ,:m ,wm ,m ,~m ,Tm ,1n ,vn ,"n ,٭(n ,Br.n ,/4n ,G:n ,An ,Nn ,\n ,nn ,-n ,`n , n ,7@n ,Xn ,n ,#n ,n , o ,ko ,)o ,R+o ,8f8o ,Eo ,Ro , _o ,9lo ,wyo ,Jo ,L o ,o ,o ,o ,n o ,Io ,o ,T p , 0p ,H:p ,#Gp ,Ttp ,p ,p ,p ,Dp ,p ,kq ,q ,q ,(q ,,5q ,wCq ,PPq ,q]q ,ljq ,owq ,rq ,Tq ,;q ,V$q ,\q ,Xq ,wr ,r ,r ,l,r ,u9r ,Fr ,Yr ,F&fr ,'r ,/r ,tr ,,8r ,/r ,Y r ,r ,r ,wr ,Ar ,s ,qs ,l"s ,+s/s ,X* ,w9 ,G ,hU ,c ,w q , ,~ ,5e ,d" , , ,-! ,'% ,/ , = ,K ,fY ,Aug ,u ,Ge ,d< ,) ,: ,?v ,7ɀ ,›׀ ,V ,M ,# ,MC ,2 ,@ ,o|\ ,[v ,7 , , ,"΁ ,H܁ ," , ,# , ,=0 ,*> ,לL ,Z ,l h ,v , ,V , , , ,ʂ ,#؂ , ,; ,x ,W ,! ,"#0 ,? ,4N ,'] ,&l ,KS{ ,Ih , ,^ , ,ƃ ,[ , ,. , , ,W/ , > ,5M ,.\ ,^Bk ,kz ,i? ,ϝ ,  ,> ,%ń ,Ԅ ,X ,E ,0p , ,q ,7. ,V= ,L ,@[ ,j ,`my ,!N , ,|Dž ,;mօ , , ,Ƈ ,  ,w$ ,yB6 ,{J ,kz ,l  , ,+h ,b҆ ,؆ ,ކ , ,x ,u; ,- ,x , , , ,  ,l ,& ,|6 ,q< ,f=B ,H ,N , T ,Z ,b` ,\f ,l ,=r ,sx ,B~ ,& ,zt , ,= ,j , ,3 ,B ,d , ,  ,0Ƈ , ̇ ,h҇ ,8o؇ ,އ ,vo ,! , ,m ,@ ,8 , ," , ,u , ,F& ,. ,B: ,2G ,XT ,ha ,En ,{ ,3 , ,pt , ,`sψ ,`݈ ,  ,  ,< ,Y ,% ,o4 ,XC ,R ,&a , ,$ ,[@ ,N ,]\ ,<j ,  ,Kk ,%Ɋ , ׊ ,Y , ,) , ,= ,%, ,@: ,SH ,0V ,jd ,# r ,  ,k , ,j ,[  , , ,O % , 3 ,wh ,ׯx ,w , ,F , , ,?̌ ,kڌ , , , ,@# ,!T1 ,?t? ,{zM , | ,6& ,{z ,F\ ,sȍ ,C΍ ,ԍ ,ڍ , ,, ,Ȝ ,`g , ,I ,7)' ,5 ,QC ,/Q ,v_ ,m ,;d{ ,N ,  ,wH , ,+ ,Jώ ,ݎ ,n ,$ ,M , ,C# ,1 ,A ,P ,_ ,kn ,w} ,1 , ,kI ,ړ ,iɏ ,J؏ ,e ,ǟ , ,: ,# ,Ȧ3 ,cB ,  ," ,`g ,9~̐ ,#ڐ ,z ,/ ,. , # ,2 ,@ , N , \ , j ,nx ,"bΑ , ؑ , ,1 ,' , ,z ,$ & ,S3 ,A ,)Z ,u" ,<  ,[ , ,’ ,Rϒ ,u"ܒ , , , ,^ ,Y( , @ ,M ,/[ ,Ąi ,e} ,nb , , , ,/˓ ,?gؓ ,߿ ,<  ,r ,$ ,( ,a] ,c ,j ,n w ,b , , ,) ,/ ,È , ,Ą ,x , , ,_o , , ,_oە , , ,W ,5 ,? ,. ,u; ,xH ,U ,m ,| ,? , ,Is ,ɖ , ,J , ,{ ,b ,- ,`: ,|G ,T ,n ,I`| , ,3c ,]\ ,~3 ,%7— , ,6 ,O09 ,G ,QU ,vc ,$q ,% , ,M , ,u ,.Ϙ ,@ߘ , , ,] ,- ,; ,I ,SW ,>p ,|} ,0 , , ,Eƙ ,wә , , ,F ,OpC ,3/P ,Ic ,M ,  ,: ,R , ,Κ ,Paۚ , ,? ,< ,< ,~ ,cH) ,g6 ,-C ,Z/P ,i] ,%j ,8~ , ,/ ,Ǻ ,Xϛ ,5ݛ , , ,{ ,m ,# ,p1 ,~? ,KM ,y[ ,0 o ,} ,V ,T , , ,eGÜ ,&ќ ,ߜ ,$ ,0 , , ,% ,#3 ,pA ,O ,] ,k ,e y ,& , , , ,  ,ΌΝ ,ݝ ,L ,ZR , ,(" ,1 ,:@ ,HW ,zf ,(v , ,' ,d , ,Qɞ ,_V ,6 , , ,<" ,/ ,ĸ< ,I ,oV ,c ,9 p ,} ,Ye , ,  ,G ,7͟ ,Z۟ ,?6 ,G& , ,j ,$ ! ,q/ ,7= ,'K ,OY ,Qg ,]u ,3 , ,9 ,q ,5 ,ɠ ,qנ ,k ,, ,F ,e  , ,t+ ,x9 ,:G ,?V ,We ,t ,"l ,K[ ,a , ,c , ϡ ,cޡ ,B , ,  ,hq ,) ,]18 ,b G ,OV ,We ,It ,ȣ , ,& ,f ,W ,<΢ ,Yݢ ,c , ,s7 ,&) , 8 ,sH , W ,97f ,{ , , ,_g ,t ,gM ,>p , ,¤ ,ܤ ,Pa+ ,8 ,d ,{9 ,{P ,R ,C} ,ե ,j; , ," ,p , ,R$ ,?1 ,> ,kK ,X ,fs ,{N , , ,M ,  , , ,/ , , * ,TgD ,Q ,^ ,k ,wy ,c , ,( , ,/*# ,7) ,./ ,n6 ,X@ ,.M , \Z ,yg ,u , ,Qv ,k ,Y  , ,̨ ,ڨ ,( , ,n , ,C. ,9= ,L ,>[ ,uj ,y ,: ,t  , , ,ĩ ,ө ,:c ,$ , , ,'\ ,. , = ,@ L ,%[ ,-3j ,py ,)q ,(P ,'Ī , Ӫ , ,| , , , ,F, ,/6 ,B ,N , i , yv ,b* , ,9 ,Ϋ ,Op ,߿ ,} ,P ,T  ,E+ ,]7 ,Y ,% ,] ,< ,_Ϭ ,H۬ ,? , ,m ,Op! ,(. ,߿; ,}H ,P_ ,s={ ,K ,T ,{ , ,έ ,0ۭ ,I ,% , , ,) ,6 ,C ,@zQ ,^ , yk ,@  , ,)ή ,w ,Y ,. ,. , / ,p, ,B-: ,%H ,U ,db ,o ,| ,z , ,U; , ,/O ,Z ,V ,  ,$ ,M1 ,> ,d#K ,JY ,84f ,(ps ,u , ,< , ,x ,hLð ,hѰ ,(ް ,Wd , ,  ,k , % ,X ,!b ,| , ,w ,  ,V , ,̱ ,_ٱ , , ,8l ,]t ,_ ,' ,p4 ,gB ,gO ,] ,j , w , ,5 ,) ,M , ,d#Ʋ ,JӲ , , ,; ,x ,W ,#4! ,\. ,@; ,H ,\V ,d ,r , , , , ,a% ,rƳ , Գ , , , ,-] , ,QU* ,8 ,xF ,?T ,Bb ,0p , , , ,Wd , ,ô ,ѣд ,ݴ , ,OF ,4^ ,! ,$e. ,< , ,/ ,A ,v ,AIʵ ,Ϧֵ ,M ,% ,k$ ,$4 ,MNB ,'P ,C^ ,Xl ,"%z ,T ,C! , ,Q ,bQ ,5Gζ ,_/ܶ ,SP ,y , , ," ,0 ,Τ> ,/L ,yi ,Yx ,P ,  , ,>y· ,nѷ , ,} , ,- ,0 ,I+ ,: ,jI , X ,g ,v ,/ , ,r ,9 ,z$ϸ ,{޸ , , ,' , ,) ,F ,.V ,7 e ,t ,! , ,A ,>| ,υ ,ι ,D , ,4, ,8 ,T ,֑a ,Jn ,| ,X , ,' , , ,z ,C ,1 , ,u< ,Ӳ ,M ,9& ,3, ,m2 ,$8 ,> ,D ,"J , (P ,V ,}\ ,$=b ,*h ,En , _t ,z ,x , , ,$  ,̻ ,ڻ ,6 ,L ,  ,& , , " ,( ,m. ,4 ,: ,KX ,3re ,Tu ,%{ ,$^ , , ,! , , , ,ʼ ,w׼ , ,o , ,q%) ,5 ,(K ,W ,_?d ,Lq ,~ , ,D, ,  , ,ν ,0 ,}v , , ,q ,Э( ,6 ,D ,R ,s` ,)nn ,| , , , ,jȾ ,Lؾ ,P޾ ,V? , ,g ,% , 8 ,߿F ,]S ,.` ,Rm ,Qz ,AE , X , ,U ,q ,ɿ ,ֿ , , , , , ,?$ , 1 ,h> ,L ,Z ,h ,v ,g ,? ,( ,: ,", ,C ,Ш ,bu ,[ ,& ,@g ,\u , ,y ,T ,  ,'- , ,J  , , ,: ,@ ,| ,  ,> , ,[ ,Ը , ,=h , ,[ ,( ,h6 ,1D ,R ,` ,n ,Q} ,U ,k , , ,l ,@ ,U , ,, ,P ,G& ,d4 ,S ,Da ,(o ,{} , , ,B ,a  , , ,  ,Pe , ,# ,q ,& ,4 ,B ,P , ^ ,l ,C ,Q ,k_ , m ,o]{ , , , ,! ,C/ ,m= ,K ,=#Y ,g ,)u ,  , , , ,>5 , , , ,kO ,u ,m ,  ,+ ,dR9 , f ,_'s , ,( , , ,8 ,u , , , , , ,b, ,A, ,9 ,F ,S ,Ia ,| ,Ǻ ,j ,4 ,2a , ,D ,7D ,9 ,7 ,9& ,N)? ,E"L ,Ie ,Cr ,2 , ,d , , , , ,E , , ,;{" , 0 ,> ,L ,#Z ,Ch , v , , ,> , ,R ,1 ,  , ,p , , , ,, ,:U: ,WH ,Ga , | , ,Yq ,c , ,  , ,z ,b7 ,m , , , ,) ,7 ,-E ,S ,9a ,io ,} , ,A ,n , ,v , ,?1 , ,Ep , , ,S% ,wB ,?L ,2V ,` ,(j ,x , ,w , ,f , ,F9 , ,L , ,! ,p/ ,WH ,U ,un ,e| , ,T ,b , ,] ,Yb ,  ,Ix ,YT+ ,9 ,XG ,U ,2c ,q , ,j , , ,a ,ڞ ,i ,4 ,*; ,ET , ,w ,' ,P5 ,qC ,Q ,"_ ,rm ,{ ,. ,c ,}S ,G , ,i , ,* ,a ,* ,7 ,D ,A Q ,^ ,:k ,<x , " ,eX , , ,}] , , ,k ,0d , , ,ۺ ,ӊ! ,. ,; ,\O ,:i ,;w , , ,F , ,y ,a , , ,5 ,r ,Z* ,'" ,0 ,> ,ƶZ ,0h , v ,W ,b ,," ,_[ ,q , ,6 ,! , ,5 ,; ,5 , ,;T ,E , ,L ,K, ,9 ,[F ,IS ,|_` ,wy , , ,~3 ,Kug ,{4 ,WW ,r ,U , , ,4 ,jj ,SA ,iK ,7 ,3  ,M ,n  , ,/ , , ,- ,X ,! ,l0 ,H\ ,Pi ,3v ,H ,h , , ,-[ ,V ,o ,)  ,_ , , , ,m3& ,3 ,A ,'|O ,] ,[5k ,(y , ,K ,r' ," , , ,y , ,O ,9 , ,E ,c(! , . ,Y; ,I ,c , p ,} ,< ,ӕ ,V , , ,~@ ,  ,x , , ,\( ,& ,ML ,OpY ,kf ,R , # ,L , , ,L ,! , , ,' ,L]- ,:; , lI ,]$W ,Ȕe ,Os ,8 , , ,k ,z ,7 ,  ,M ,B ,yQ ,, ,9 , #G , U ,6c ,Yq , , ,O , ,G ,a , ,L ,Wx ,R ,eS ,߿ ,!r ," ,ܱ/ ,E?< ,m ,  , ,M ,R ,.4 , ,A ,M ,L ,~3 ,m ,Ȕ ,- ,; ,I ,zW ,k , ," ,- ,/ ," ,z/ ,2< ,O ,A\ ,'i ,v , ,; ,C ,e ,- ,7: ,yG ,}c ,! ,< , ,M ,0Q ,4^ ,M ,]7 ,Y  ,k , , ,6 ,P ,C w ,p , ? ,/ , ,M , , ,}! , ,Ij4 ,JA ,2[ ,t ,á ,- , ,M ," ,- , , ,zl ,;} ,8 ,t, , ,kY ,T: ,/ ,l , , ,! ,L ,]& ,4 ,B , wP ,ad ,- , , ,t , , ,9 ,& , ,: ,~# ,* ,׷7 ,wD ,LQ , , ,i ,7 ,) ,B7 ,E ,c ,Sp ,O ,o ,a  , ,9e ,r ,C  , ,' ,rG ,+Y , , ,) ,|b ,#W , ,w ,Tj ,м( , 5 ,KB ,O ,pw\ ,Qt ,J ,2 , ,T ,߿ , ,W , ,  , ,$+ ,: ,'I ,g ,"v ,s ,9 , ,7 ,R , , ,۝ , , ,C ,N* ,G ,I4V ,e ,r~t ,! ,' , , , ,  , , ,F ,  ,e| ,. ,I ,rV ,Ho ,0 ,r ,C , ,7u ,  ,jU ,g , , " ,1 , ,m , ,(c ,7 ,! , ' ,- ,4 ,\KA , N ,[ ,xh ,S ,=n ,  , ,$ ,2 ,k ,_3 , , ,' ,%4 ,NA ,bkN ,x[ ,kh ,j]{ , ,Bj , ,g  , , ,  ,t! ,Y" ,. , < ,;J ,X ,rf ,t , ,K ,  , , ,2i ,t ,5 ,+ , ,g , ,} * ,3|8 ,پF ,T ,tb ,ܫp , ,Y , ,S ,U, ,o  , , , , ,h ,t ,(   ,& ,w% ,3 ,XA ,O ,b] ,sl ,wv , , ,? ,v ,C ,v ,Z ,tr ,4 ,P?  ,ӹ ,Vv* ,.98 ,wF ,n T ,b ,Ap , ,/) , , ,G , , ," ,T ,  ,EG ,W% ,&3 ,/nC ,)S ,tc ,is , ,H~ ,h ,G , ,B ,-z ,M ,h ,A ,q ,{+ ,p9 ,zG ,DV ,e ,t ,P| , , ,u ,M ,n  ,w ,EG ,   ," ,$% ,+2 ,A? ,D L ,]&Y ,Sf ,0s , ,\ ,` ,\( ,& ,d ,d , ,# ,1 , ? , M ,] [ ,) ,v ,M ,0 ,^ , , ,3 ,0 ,ı  ,~ ,DK' ,}S4 ,%A ,N ,r[ ,h ,u ,E ,h , ,p ,M ,  ,] ,# ,/" ,/ ,}< ,ıI ,~V ,DKc ,}Sp ,r} , ,! , ,Q/ ,r~ ,M) ,6 ,C ,P ,] ,j ,Vw ,15 , ,C ,e  ,;+  ,M8  ,!E  ,0R  ,_  ,'  ,/  ,C  ,  ,U  ,  ,  ,P  ,N  ,d  ,M  ,"%  ,-y  ,t  , ;  ,s  ,2  ,   , V  ,  ,  ,  ,  ,ee  ,h  ,{  ,1  ,c  ,u"  ,0  ,cZ>  ,^M  ,[  ,~i  ,x  ,  ,y  ,.A  ,u  ,  ,λ  ,Y  ,g  ,U  ,  ,k>  ,+  ,  ,   ,'  ,  ,  ,  ,^"  ,40  ,K3>  ,`[  ,kTo  ,y  ,ĭ  ,  ,A]  ,@  ,  ,  ,  ,1  ,  ,>  ,#  , 1  ,?  ,KX  ,e  ,Dr  ,}   ,P  ,m  ,#  ,  ,  ,u  ,=  ,  ,  , ,9 ,* ,8 ,EF ,$T ,_b ,|p ,}~ ,e , ,( , ,) , ,  ,) ,)H6 ,wC ,(P ,7] ,%j ,w ,S ,z ,  ,3H , ,m4 , ,߿ ,./  ,N ,rd& ,3 ,w@ , n ,+{ ,O ,]S ,a , , ,* ,5 ,; ,~ ,! ,   ,<9 ,yOF ,_ , l ,by , ,i ,\ ,' ,H ,m ,  ,c ,k , ,> ,L ,[ ,7q ,5* ,8 ,F ,>T ,b ,'p ,'3~ ,, , , ,| ,Q , , , , ,  ,  , X& ,1? ,vI ,Q1X ,=b ,l ,}iz ,2 , ,J ,v , , ,R , ,k ,#(  ,B ,?& ,?i4 ,|B ,P ,]^ , ;l ,z , , ,& ,J ,> ,LA , ,k ,? , ,s ," ,m0 ,> ,L ,Z ,bPh ,v , , ,F , , , , ,A , , ,* ,  ,9sO ,n] ,2k ,hfy , ,f , , , , ,H , ,  , , ,- ,; ,ϒI ,e8W ,Ie ,s ,Z , ,J ,  ,K ,A , , ,: ,{ ,#' ,4 ,#9A ,[ ,n ,{ , , , ,* ,16 ,Y , ,9 ,e ,  ,w1 ,$> , K ,X ,[cl ,v , ,o , , ,~ ,W ,[M ,}= ,- ,Y ,w ,z$& ,?0 ,: ,d ,br ,Q ,C! ,e ,z| ,N , ,k , ,X\ ,y ,=  , , . ,< ,J ,]Y ,Bj ,!p ,v , ,Ý , X& ,6 ,%< ,C ,c ,Ыo ,HY , ,a , , ,! ,Op ,  ,; ,kH , #B , kU ,Nl ,tz , , ,01 ,k ,6= , , , ,  ,0 ,߿$ ,3 , B ,MQ ,/` ,mo ,X\~ ,< ,N ,S& ,[ , , ,2 ,A ,>|  ,  ,$  ,/5  ,3t;  ,M  ,w[  ,Mi  ,}  ,7  ,j  ,  ,  ,`  ,zz" ,/+" ,R" ," ,j" ,W8" ,΁" ,( " ,A" ,F" ," ," ," ,H" ,H # , # , # ,&# ,,# ,z2# ,8# ,v># ,7BD# ,J# ,P# ,V# ,,\# ,b# ,h# ,_n# ,Vt# ,Wz# ,# ,8# ,# ,# ,# ,&# ,# ,!# ,# ,MG# ,$# ,$v# ,D# ,a# ,v4# ,2# ,(B$ ,z1 $ ,{$ ,$ ,/$ ,$$ ,L$ ,Z$ ,h$ ,u$ ,$$ ,`$ ,$ ,X$ ,$ ,$ ,z$ ,4$ ,C!$ ,L$ ,R% , ,% ,% ,++% ,D% ,^% ,2vk% ,ox% ,% ,߿% ,m% ,% ,% ,% ,% ,% ,n% ,& ,,e& ,e$& ,>e2& ,~@& ,~N& ,$~\& ,0j& ,Gx& , & ,?& ,p& ,& ,g& ,ޚ& , & ,!& ,& ,7 ' ,' ,*' ,<.9' ,UH' ,/.W' ,CYv' ,}' ,8' ,D' ,#' ,' ,w' ,"' ,b' ,~' ,tU ( , ( ,*( , 9( ,#gH( ,W( ,%f( ,iu( , ( ,( ,\( ,'( ,( ,( ,A( ,j( ,yj( ,~ ) ,-) ,֙)) ,8) ,G) ,2IV) ,e) ,t) ,) ,n) ,) ,) ,z) ,g%) ,h) ,4) ,4) ,* ,NL* ,r$* ,2* ,@* ,N* ,R]* ,Jl* ,!{* ,7* ,-* ,* ,* ,9* ,j** ,O* ,* ,k+ ,+ ,ݵ"+ ,X1+ ,c@+ ,QO+ ,8!^+ ,\m+ ,}+ ,+ ,0+ ,y+ ,R+ ,tA+ ,fB+ , + ,+ ,+ ,s , ,GU, ,eg', , 5, ,C, ,YQ, ,_, ,!m, ,Ԡ|, ,*u, ,C;, ,, , , ,k, ,w, ,, ,, ,r- ,ɩ- ,!- , 0- ,?- ,(N- ,]- ,l- ,){- , ;- ,- ,- ,B- ,Q- ,b- ,- ,- ,. ,. ,b%. ,5. ,tUE. ,fU. , Ze. ,?u. ,&!. ,/. ,!c. ,r. ,*. ,p. ,z. ,. ,. , / ,\D+/ ,:/ ,J/ ,Z/ ,$i/ ,x/ ,/ ,/ ,t/ ,8/ ,`/ ,/ ,{/ ,0 ,,0 ,˵<0 , L0 ,I\0 ,sl0 ,{0 ,;0 , 0 ,0 ,m0 ,0 ,0 ,0 ,Z 0 ,0 ,n1 ,01 ,1 ,\!1 ,'1 ,C31 ,`y@1 ,M1 ,[1 ,k1 ,q1 ,w1 ,~1 ,H1 ,J1 ,1 ,1 ,s1 ,1 ,1 ,'.1 , 2 ,ņ2 ,2 ,)2 ,62 ,&AC2 ,P2 ,j2 ,w2 ,q 2 ,2 ,]-2 ,2 ,L2 ,k2 ,2 ,12 ,42 ,3 ,1.3 ,43 ,:3 ,{A3 ,-N3 ,z|[3 ,ևh3 ,u3 ,3 ,M3 ,3 ,'33 ,,3 ,4"3 ,3 ,_3 ,#3 ,3 ,"4 ,4 ,:4 ,+4 ,kz84 ,E4 ,R4 , `4 ,-n4 ,j<|4 ,=4 ,J4 ,n4 , 4 ,r!4 ,4 ,#4 ,J 4 ,t4 ,s  5 ,b5 ,0'5 , 65 ,E5 ,(T5 ,c5 ,r5 , ;5 ,5 ,5 ,B5 ,5 ,O5 ,5 ,<5 ,r*5 ,K 6 ,tU6 ,f,6 , Z<6 ,*K6 ,SZ6 ,/mi6 ,t5g8 ,dx8 ,+~8 ,y8 ,, 8 ,Wz8 ,϶8 ,8 ,Ӥ8 ,8 ,Y8 ,&8 ,8 ,-8 ,8 ,* 9 ,9 ,:&9 ,49 ,?C9 ,ɋg9 ,t9 ,/9 ,]9 ,r~9 , 9 ,39 ,k9 ,u{: ,pi: ,Rhy: ,: ,: ,l: ,: ,w: ,: ,: ,: ,: ,: ,w: ,6D: ,%x: ,M: ,: ,F{: ,: ,K: , : ,/X: ,: ,,: ,c2; ,S ; ,; ,{; ,h; ,!!; ,2:'; ,-; ,3; ,l9; ,N?; ,@E; ,VK; ,9Q; , CW; ,=]; ,c; ,'i; ,0o; , u; ,8{; ,(; ,WN; ,&; ,z; ,O; ,!y; ,; ,I; ,; ,; ,O; ,a; ,p; ,; ,v; ,\; , ; ,; ,; ,M; ,; ,h; ,V< , < ,< ,&Q< ,u< ,p#< ,)< ,/< ,n5< ,;< ,xA< ,qyG< ,M< ,S< ,_Y< ,_< ,:e< ,[k< ,q< ,o/w< ,3}< ,ܐ< ,< ,w< ,< ,+< ,< ,< , < ,S< ,< ,a< ,< ,< ,C< ,< ,< ,< ,I< ,NE< ,zT= ,}= ,1= ,p9= ,gH= ,7_= ,C%l= ,O`z= ,4J= ,= ,8= ,}= ,n#= ,= ,k= ,8E= , > ,)U> ,p%> ,3> ,G> ,U> ,c> ,%q> , > ,i> , > ,> ,> ,> ,:!? ,)? ,6? ,N? ,R[? ,os? ,? ,? ,I? ,? ,C? ,_!? ,!@ ,&@ ,?@ ,Z\@ , i@ ,v@ ,@ , @ ,@ ,Y@ ,@ ,@ ,@ ,A ,h'A ,ii$A ,2A ,AA ,TPA ,|_A ,cnA ,Eo}A ,NA ,rA ,"A ,6A ,A ,A ,U2A ,FgA ,B ,B ,Z"B ,1B ,@B ,KKOB ,l^B ,C#mB ,lj|B ,&B ,B ,AB ,eB ,nB ,2TB ,B ,HmB ,N$C ,OpC ,<*9C ,1GC ,QUC ,ofcC ,>qC ,~LC ,RC ,C ,CC ,_!C ,!D ,D ,/D ,ZLD , YD ,vqD ,~D , D ,D ,YD ,D ,D ,D ,D ,h'E ,iiE ,"E ,1E ,T@E ,|OE ,c^E ,EomE ,N|E ,rE ,"E ,6E ,E ,E ,U2E ,FgE ,E ,F ,ZF ,!F ,0F ,KK?F ,lNF ,C#]F ,ljlF ,&{F ,F ,AF ,eF ,nF ,2TF ,F ,HmF ,N$F ,OpG ,<*)G ,17G ,QEG ,ofSG ,>aG ,~LoG ,R}G ,G ,UG ,BG ,G ,gH , SH ,SH ,Ky_H ,uslH ,(yH ,?H ,H ,H ,SH ,PH ,H ,H ,̧H ,H ,TH ,I , I ,W I ,I ,@qI ,nI ,q%I ,p&+I , 1I ,0N7I ,@=I ,&CI , II ,qOI ,HUI ,N[I ,aI ,ggI ,mI ,HsI ,!jyI ,I ,EI ,I ,kI ,pMI ,I ,I ,lI ,=I ,II ,!I ,I ,I ,I ,fI ,I ,.%I ,I ,RI ,oI ,J ,: J ,ȉJ ,$J ,ZJ ,!J ,*'J ,-J ,:3J , 9J ,?J ,EJ ,%KJ ,1%QJ ,إWJ ,W]J ,cJ ,-iJ ,aoJ ,uJ ,{J ,^J ,.J , 'J ,OJ ,J ,%RJ ,J ,J ,f$J ,xJ ,J , ]J ,(J ,J ,9J ,fJ ,!J ,уJ ,J ,\dJ ,K ,J^ K ,K ,iK ,\K ,#K ,s)K ,/K ,5K ,;K ,hAK ,CGK ,#MK ,KSK ,pYK ,_K , eeK ,(kK ,JqK ,&#wK ,^}K ,'K ,K ,%}K ,K ,K ,K ,2UK ,~K ,:OK ,K ,K ,3K ,)K ,K ,aK , K , K ,K ,!K ,K ,ǢK ,L ,L ,4$ L ,pL ,L ,~L ,0L ,>L ,T-LL ,ȕZL ,JhL ,vL ,-L ,NL ,|L ,7 L ,?L ,ML ,L ,HL ,$L ,PM ,M ,#*M ,=DM ,DhM ,kM ,M ,pM ,TM ,EM ,M ,DM ,(tM ,kN ,f N ,&N , 4N ,VBN ,2QN ,CS`N ,nN ,|N , N ,iN ,N ,N ,N ,?N ,ҚN ,2N ,dN ,, O ,zO ,'O ,5O ,RsIO ,+WO ,bWfO ,PuO ,@O ,{O ,vO ,nO ,O ,´O ,lrO ,O ,]P , !P ,?P ,#MP ,x[P ,IiP ,I}P ,P ,R P ,4P ,FP ,P ,P ,/P ,P ,(Q ,Q ,z$Q ,:33Q ,BQ ,k^Q ,wQ ,Q , Q ,<Q ,nsQ ,Q ,Q ,Q ,Q ,t R ,&R ,3R ,]KR ,XR ,vR ,xR ,kR ,IR ,R ,&R ,R ,KR , R ,M S ,R S ,AS ,PS ,-D^S ,UlS ,qzS ,S ,A3S ,=S ,kS ,S , T ,T ,r:T ,68T ,R ET ,D]T ,jT ,]T ,:T ,eT ,dT ,kT ,T ,T ,AxU ,&U ,LU ,@ZU ,HmhU ,kU , U ,U ,U ,U ,U , U ,AxV ,k6V , CV ,aV ,{V ,V ,V ,V ,QV ,D<V ,V ,zW ,xW ,k/W ,K SZ ,EaZ ,zpZ ,Z ,TZ ,B+Z , Z ,rWZ ,Z ,OZ ,!Z ,yZ ,d[ ,[ ,H$[ ,3[ , B[ ,߿P[ ,?l[ ,[ , [ ,\([ ,[ ,g[ ,C[ ,q[ , \ ,F\ ,f #\ ,0\ ,C\ ,bhP\ ,_]\ ,- j\ ,G.\ ,^)\ ,\ ,\ ,\ ,M\ ,>\ ,@\ ,x~] ,b ] ,?] ,.0] ,>>] ,@L] ,;`] ,m] ,0z] ,+] ,] ,] ,Q] ,] ,^ ,*^ ,3gD^ ,bb^ , )i^ ,;v^ ,0^ ,2^ ,k^ ,b^ , ^ ,^ ,T^ ,V _ ,ci9_ ,~T_ ,Ia_ , n_ ,p{_ ,_ ,`_ ,_ ,_ ,_ ,=_ ,_ ,o ` , ` ,a%` ,M2` ,x?` ,nL` , h` ,nv` ,` ,` ,&` ,4` ,xJ` ,M` ,u` ,` ,F` ,a ,8a ,4>ea ,~a ,~a ,a ,a ,a ,a ,`a ,a ,ba ,k b ,'b ,&b ,s73b ,sAb ,Nb ,\b ,C'jb ,7[xb ,Qb ,`b ,b ,Vb ,wb ,Db ,b ,b ,Yb ,8c ,|Rc , c , 7.c ,%h ,h ,Eh , yh ,h ,Fh ,!Zh ,` h ,B"h ,7h ,h ,_ i ,b:i ,%$i ,12i ,3(Yi ,Fsi ,i ,i ,(i ,hi ,i ,Bi ,tRi ,i ,ii ,Ti ," j ,j ,#j ,1j ,>>j ,Kj ,Xj ,wfj ,avj ,|j ,yj ,j ,1j ,#j ,Uj ,Ej ,j ,j ,uj , j ,Tj ,Pk ,'k ,<Ek ,Uk ,E[k ,bk ,qk ,9'~k ,wk ,9k ,k ,ْk ,ok ,5 k ,k ,l ,l ,l ,*l ,"7l ,ODl ,[Ql ,{9^l ,ll ,%zl ,1l ,d~l ,l ,Ol ,[l ,l ,Rl ,m ,fm ,Cm ,%Pm ,V^m ,vxm ,#m ,m ,Fn ,  n ,.n ,Wd=n ,=gn ,tn ,&n ,un ,n ,gn ,n ,n ,Cn ,Jn ,Kn ,n ,  o ,Yo ,F#o ,0o ,j=o , KJo ,Wo ,do ,qo ,~o ,o ,1o ,o ,o ,p[o ,o ,8o ,|o ,Vo ,,p ,g p ,p ,'p ,}4p ,!Ap ,Np ,[p ,`ip ,wp ,Wp ,LQp ,[p ,bp ,_p , p ,?p ,z p , q ,90q ,W&>q ,-Lq ,Zq ,T-hq ,ȕvq ,Jq ,$q ,q ,ެq ,Nq ,Mq ,q ,Hr ,or ,Mr ,`(+r ,9r ,Nr ,[\r , jr ,xr ,Ybr ,$Vr , r ,r ,t ,w#u ,u , u ,.u ,%u ,f}u ,u ,u ,Qu ,u ,m v ,v , )v ,7v ,Ev ,Sv ,av ,\ov ,`}v ,3v ,v ,v ,v ,v ,sv ,{v ,|v ,cv , w ,Ww ,~%w , ,a{ ,& ,̈́ ,ӄ ,xZل , , ,I ,߿. ,@; ,, K ,UQ ,>aW ,] ,Jc ,i ,ao ,u ,| ,Y , ,ԗ ,z , ,k ,3 , ,og ,>… ,MHȅ , N΅ ,8Յ ,F , ,D ,  , ,8 ,}  , ,U ,) ," ,&0 , = ,$J ,W ,d ,>q ,~ ,0 ,cF , , , ,"̆ ,kن ,T , , , ,- ,; ,>J ,}e ,s ,U ,_ ,T , ,o&Ƈ ,ԇ ,D , ,c) ,z  ,:' ,<5 ,C ,Q ,]_ ,n ,AW~ , , ,- ,j ,Ĉ ,҈ , ,> , ,H  , ,& ,4 ,"B ,kP ,Tn ,J} ,  ,H ,] ,+? ,s1ɉ ,׉ ,$ ,$ , ,  ,: ,K+ ,]9 ,J G ,FU ,wc ,#q ,  ,% ,  ,! ,$ ,6Ŋ ,8ӊ ,D , ,> ,m  , ,<' ,Z5 ,o8C ,mQQ ,_ ,m ,{ ,  , ,5 , ,1ȋ ,Ջ ,B ,F ,~ ,5  ,  ,Q$ ,&2 ,g? ,u$L ,(@Y , f ,*t ,LT ,d ,W ,[ ,ʱ ,u$Ì ,Ќ ,pތ ,2 ,_ , , ,^ ,S  ,K ,n ,<& ,O3 ,@ ,<M , 1Z ,g ,t , , ,-~ ,c ,/EǍ ,wԍ ,V ,[ , ,TY ,  ,; , ,O ,T# ,) ,e#/ ,1,5 ,; ,<2A ,'2G ,qM ,5-S ,y(Y ,"_ ,e ,+k ,5#q ,Tw ,} ,e ," ," ,  ,  ,J ,f ,u ,G ,Y  ,R ,Ŏ ,aˎ ,7ю ,׎ ,Cݎ , , ,r  , ,j ,x ,* ,*  ,d , , ,J% ,o+ ,v1 ,A7 ,= ,oC ,eI ,NO ,.U ,T[ ,(a ,*g ,m ,s ,]y , ,i ,- ,/ ,P ,< ,1Ϗ , ߏ , ,y ,3 ,6; ,$ ,U ,ԛ  , { ,~ , ,m, ,M2 ,8 ,A> , D ,KJ ,rP ,J@V ,SZ\ ,;b ,h ,<0n ,t ,z ,ÿ ,t , ,o ,o ,ǐ ,OMՐ ,y ,O ,u ,\  ,i ,b* ,K8 , F ,T ,b ,p\p ,~ , , % , , ,Nő ,Nӑ , ,; ,c ,ӡ  ,$ ,9`' ,u4 ,A ,oN ,؈[ ,Sch ,4u ,A ,^ , , , ,ԌĒ ,(Ԓ ,cڒ ,? ,U] ,a ,O , ,vX ,@ ,  ,l_ ,s ,b ,Ś" ,]( ,. ,]4 ,: ,Y@ ,U"F ,WL ,R ,X ,e^ ,td ,sj , |p ,Nv ,| ,  , ,  , ,@ ,W ,\f , , ,ē ,nZѓ ,n6ޓ , , , , , ,0# ,) ,\/ ,~5 ,; ,B ,PR , X ,r^ ,_d , j ,8p ,$v ,.| , ,e ,4 ,k0 ,v0 ,0 ,0 ,Ӕ , ,Xn ,~ ,a ,K ,( ! ,d. ,*; , H ,U ,c ,oq , ,L, ,# ,J ,e ,^ŕ ,ӕ , ,! ,   ,T ,2+ ,: ,5I ,'X , g ,+v , , ,( ,# , ,͔Ж ,eߖ ,k , ,! , ,h/ ,? ,hO ,{n ,} , ,xw ,?^ , ,kȗ ,Gח ,R8 ,} , , ,R&" ,c^7 ,tR ,sn , ,Y< , ,_p ,Ϙ , , ,{a ,GP ,$" ,s0 ,@> ,;9L ,XZ ,}h ,1v ,RB ,: , , ,  ,ʙ ,rؙ ,  , ,  ,e( ,8. ,X4 ,m : ,@ ,TF ,L ,|R ,X ,=^ ,d ,T%j ,np ,v ,$| , ,  ,v ,B , , , ,š ,:Ț ,aΚ ,vԚ ,(ښ ,M  ,0 ,4 , , ,}   ,\U ,( ,e ,! ,1( ,_5 ,5] ,mk ,x , , , ,k ,`ƛ , ӛ , ,'. ,H  , ,͔ ,u! ,. ,YH ,TU ,b ,p ,pa , ,=M ,9 ,ɜ ,֜ , ,k , ,͔ ,Y_ ,U0* ,n7 ,_nD ,uQ ,ڣ^ ,S[k ,+y , ,9 ,Ñ , , ,͝ ,K۝ ,a ,  ,3  ,vx ,2! ,8/ ,g> ,fZ ,]-h ,^w ,B , , ,r~ ,̞ ,R , , ,Sc ,S ,; ,oI ,GA ,͔ ,O ,K ,fǟ ,'՟ , , ,- , ,NV ,d ,hr ,f ,p , ,1 ,4 , Ơ , Ԡ ,- , , ,mK  ,ʥ ,^( ,x6 ,Xl , ,+ ,N ,h ,͢ ,ۢ ,  , , # ,|. ,b! ,A/ ,nc ,p ,C} ,N ,' ,w ,2 ,£ ,xϣ ,ܣ& ,] , ,  ,a ,IJ& ,e3 ,F ,\ ,Br ,# , , ,jʤ ,r" ,* ,d ,e.& ,PB ,!r , ,d ,xԥ ,d , ,P6& ,8 ,=T ,Yf ,H} ,L ,n^ ,gզ , , ,Y" ,m+ ,4 ,SL ,IS ,p ,s ,  ,4§ ,w , ,%( ,? ,Q ,cm ,1 ,6 , ,Vը , ,Jz , ,u , ,I ,|e ,~#} ,g@ , ,hĩ ,[ ,\ ,h  ,p- ,$8 .w< .wK .xO .x^ .*xb .$xg ,x}mlv ,>} .Ix .Ex , .hx .bxڪ .xު .x .x .x .x .x .x .x1 .x5 .x> .xB .xK` .xd .xmw . y . y .y .yʫ /Wӫ ,>}ޫ ..y .*y , .Hy .Dy  * G .^yK .\yT i{t ,VǬ ,jѬ /Kt .sy .ky ,N , ; , ".8 /atI .yM .yV .yZ .yc .yg .yp .yt .y} .y .y /atP ­ϭ2 C ,A /W ,$$ .y( .y7 .&z; . z@ ,NN ,[@;d ,q" /W .Hz .Fz<ƮDޮ" ( ,1 ,< .cz@ .WzE ,P .zT .zYn ,!y .z} .z .z .z˯ .zϯ .zۯ .z .z$ .z( .z3= /YN . {R .{W /Y` .'{d .%{kx ,t /W ,O. .?{ .5{ ,Ȱ .{{̰ .u{Ѱ ,$ܰ .{ .{ ,a .{ .{ ,N ,; ,*"9 ,!F ,k!Ti ,!v ,k! ,; ," ,ʱ <ӱ ," . | . |#-J .|N .|X"b /Ws ..|w .*|}}"ò 'Ͳ" I '" I% 'F ,@P /yd[ ,O.f .X|j .H|o ,$z .|~ .| .| .| , .8} .0} .j} .b} ,Dɳ .}ͳ .}ҳ ,N ,! .} .} /d' .}+ .}4 /d= .}A .}N ,[=d ,q" ,@= ," /d̴ .}д .}ٴ /d .~ .~ /d  .~ .~V$ /d5 .-~9 .#~B .u~F .m~O .~S .~\ .~` .~e /dr .v .{ /d .F .D /dĵ ѵ& /e .U .S(E .dI .bNgq .s .q׶ .۶ .  .$ .)>jc{1+ַ 9D, h9O O' .+ .1>V"v=, 9%, @9߸ ,6 ,O.  ,$0 ,k= ,DJ ,$R ,!_ ,k!o ,u /Z . . . . ,O. .; .1 ,$ƹ .wʹ .oϹ ,kڹ .޹ . ,N /H[ . . ,!! ,. G7 ,D"pN%_ @)o ,|`G ,"h /\ .ڀ .ր ,!Ѻ ,޺G ,"`$ ) ,,G5 ,B"XL /\` .d .n ,! , H ,"P& *ϻ ,ܻ`H ,"H //\ . . ,!1 ,>HG ,T"@^%o `+ ,H ,"8 /[ ..ļ .*μ ,! , I ,"0# ,/ ,<`IE ,R"(\ / \p .Jt .F~ ,! ,I ," I$Ͻ ,߽ ,I ,"  /U\  .f$ .b. ,!A ,N JW ,d"n% p- ,`J ," /{\о .Ծ .~޾ ,! ,J ,"]&/ .? ,LJU ,b"l /[ . . ,! , K ,Ŀ"οi#߿ . ,`K ," /[0 .4 .> ,!Q ,^Kg ,t"~# / ,K ," /B\ .ց .ҁ ,! , L ,$".K%? 80O ,\`Le ,r"| /h\ . . ,! ,L ,"& 0 , L ,""1 ,!> ,k!PUZ /Zk .o . t /Z} .$ ." /Z .3 .1 .B .@ .R .P /Z .e .a)A .E .{NXt .x . . . .ʂ .Ȃ .ق .ׂ /Z . . .# .(GQ /[b .f . k /[x .;| .5 .e .] . .M . .-/M9 /([J .N .W .Ӄ[ .у`]u& L )bb . .jj /8[ . .v7vAv^ .b .g~|# /$ p,$ -"$7 8/A$V H*`%u +% 0#& )& .' H1!' -2'+ +Q ,9[ /Wf ,q .7u .#z ,O. . . ,$ ., . , . . . .څ ,D . . .D .: ,N ,!" .~& .|/9 /3XF .J .S /3X\ .` .h /]Xq ,a ,O ,"x , ,! ,  ,u ,ߔ ,!+ , : ,uH ,ߔ] ,!o , ~ ,u ,ߔ /Y ,! . . ,  ,u ,ߔ , ,! , $ ,u2 ,ߔG ,!Y , h ,uv ,ߔ ,! ,  ,u ,ߔ /Y ,! ,  /Y ,u .ˆ .dž  ,ߔ" ,5 ,!G , V ,ud ,ߔy ,! ,  ,u ,ߔ ,! ,  ,u ,ߔ /Y ,! . . , - ,u; ,ߔP ,c ,!u ,  ,u ,ߔ ,! ,  ,u ,ߔ ,! ,   ,u ,ߔ* /Y3 ,!E , S /YX ,uc .g .m ,ߔ , ,! ,  ,u ,ߔ ,! ,  ,u ,ߔ ,!/ , > ,uL ,ߔ\ /Xe ,!p .t .~ ,  ,u ,ߔ /X .- .+ /#X .< .: /#X  .L  .J-" /CX3 .f7 .^< /CXE .I .T^ /oXo .s .} . .V /X .̇ .Ƈ . . /X . .  .. .& .Q  .O /X  .b$ .^- .|1 .x: .> .G .K .T .׈X .ӈa /Xn .r .{ /X . . .# . .# . .D .@ .c ._ . . /X . . . .  /Y .ˉ .ɉ#v< .ۉ@ .ىFvW (j ({ /Y . . /"Y . . . . /5Y .1 .- .G .E( .X, .T5? /EYO .qS .m\ .` .i .m .r /EY{ . .   .Ȋ .Ɗ .ي .׊"X, /UY= .A .JXT /hY` .d .mXw /xY . . /xY .4 .0]ii .K .I .Z .Xm /Y+ .i/ .g8 .|< .xA^w2pC[-E+#V Lc X( ,= ,$ , ,N5 ,!  ,5! ,."> ,K 6T ,a" ,! ,`6 ," ,6 ," ,r /"e  . . .<! .$1 .5 .E .@I .(X .\ .h!u .ڍ .؍ /9e . . . .$ /Ue4 .88 .2AK /leW ._[ .Udn /le{ . . .͎ .ǎ /le . . . . .C .9 /le .x .r  . . . .$.F .J .S .ƏW .ď`j .Տ .ӏ . . . .d  . .7A /eR .#V ._ /el .=p .7y /e . . /e . . . . . . .А .ΐ& .ߐ* .ݐ3 .7 .BLi .m . v . .!) /e .1 .+) /e .S .M)( /e5 .u9 .oB .F .K>qD{ /f . .DD .ő .ÑLZi /!f .ޑ .ґ .$# .( /!f5BiL /If] .ha .^jiti . .q{ /of . . /f .֒ .̒ /f . .  .D$ .>-7 /fC .jG .dP .T .] .a .f /fo .s .| . .  . . .- .+ .= .; .L .J( .\, .Z5J .mN .iWn . . . . ) .- .2G`j /f{ . . .Ŕ .Ô /f .ה .Ӕ, 9i, .  .~,  0:+CPj, x:, :! /f . . /f ." . .@ .<:: .Y .W?0?: /fK .hO .fX .w\ .ue`o /f{ . .h) ,X , ,g  ,$ ,& ,1Be ,)q ,! ,} , / ^ . . ,( . . ,N / ^ .6 .2 ,! , B& ,3"='N 2g ,t`B} ," ( 2 ,  , ,N68 ,!G ,T7] ,j"z ,@7 ," ,! ,7 ," , 7 ,#"D ,!S ,`8i ,v" ,@8 ," ,] / r .T .N . .| . . .j  .V ,p .˗ .×/ .3 .8 , C .PG .>L ,W .7[ .%` ,gk .o .t , .  . , .8 .. ,1B .h .f, ,N ,.7 /s .{ .u ,!  ,8# ,0":1K A[ ,h8q ,~" /t . . ,! ,9 ,"1 B  ,@9! ,."8 /2tL .P .Z ,!m ,z9 ,"2 C ,9 ," .  .% ,!0 .4 .>H /sU .Y .b .f .kxII .' .% /!r .J .4 . . /!r .)  ..) /cr: .> .GQ /ra .e .j| /r .Ҝ .̜ /r . . /r .2 .( .g .a /r  . . . .' .ݝ+ .ӝ0 /r9 .= . FPl .1p ./y .A} .? .P .N .` .^ .o .m . .} . .!8T^v .z .  . . .ʞ .Ȟ ( .ٞ, .מ1&F._i /rz .~ . . . /r .  .0 0@ /r .% .!.1 PA.02G .AK .=PJ2a @r:cI1 x@b1 A2 A3c= /sN .cR .Y[cec . .hr /-s . .v /Ds .џ .ǟv /Ds .  . .? .9v( /Ds4 .e8 ._A .E .N .R .W /Ds` .d .mvwv .  . . .vv .( .& .8 .6vv  .G .E .W .U&v; .h? .dHQ_D{ . . . . . . # .' .0 .ˡ4 .ɡ= .ݡA .١JTl .p .y .  . . . .( .& .: .6" .V& .T/9U .eY .c^$s,4 /[s .x .r4 /qs . .4 /s . . .ڢ .آG*V4 /sE .I .R .V .[ /sd . h .s} /s .' .% /s .8 .4 .V .R .o .m /s .~ .|" .& ./49 /sE .I .S<j4{2 @B2 B 2 HC4 ,:\ .̣` .e ,$p .8t .6 .N .F , . .r ,1B .¤ . ,)U /_ . . /_ . .UU2 .-6 .+? .=C .;H_`j .L .J /_ .\ .Z L 2 w /_% .n) .j2 .6 .? .C .L .ĥP .Y .] .f .j .s .&w ."| /_ .@ .>w /` .Q .M /` .k .g /.` /@` . .  /P`# .' .0 .4 .= .ƦA .ĦJ .צN .զW .[ .d .h .q .u . ~ /f` . . /|` ./ .-# /` .@ .> /` .Q  .M .o .k E*EC .G .LJ`Jj /`{ . . . . /` .٧ .קn /` . .r /` . . r) /`6 .+: .'C .FG .DPrZ /`f .Vj .Ts .fw .d .x .t /` . .rr . . . .rr . . .Ѩ .Ϩr%r> .B .ިK .O .Xrm .q .zQ @n ,  /` .1  . . .$ ,/ .3 .8 ,1BC .G .L , R[ ,Nd /`m ,!x .a| .K /a .Ѫ .ͪ ,! ,: ,"() H5 ,@: ,(" 2 /aF .J .T ,!g ,t:} ,"* 5 ,: ,"B /a . .B /Aa( .X, .V1GJQT /Qad .kh .eqU{ /ha . .U /ha .̫ .« . .U /ha .' .! .L .F .u .k /ha .  .UU: .Ȭ> .ƬG .جK .֬TU^Uv .z . . .UU . . . .U .' .#"6, /~a8 .G< .AAB_i /az .l~ .f . . /a . . . .' /a3 .խ7 .ӭ@ .D .I_w11* 5D* (6 ,_6 ,$ . . 1D ,J`l .3p .' .u .g . . . . .4 .0 ,,ii  .L .J% /b6 .c: .YCM /c] .a .f /,c . . /Ac .ί .į /Ac . . .4 .. /Ac .X .R .|! .v* .. .3 /Ac< .հ@ .ϰISo .s .| . . . . .! . .0 .. .@ .> .Q .M$;-W6a6y .m} .k> /Vc .~ .z /fc . . /vc .ѱ .ϱ   .  .' 1 N  .R  .[ e   .  .     /c  .  .   /c  .6  .0   /c  .X  .R'  .v+  .t0 R j   , ]  ,$  ,N P<  , `<  , "8  ,) <2  ,? "0K  ,Q 0q  .u  .  .  .   ,$  .j  .h  /Y  ,!  .  .w y  /Y  .  . y y  .A  .? 4 >  /ZN  .TR  .N[ e  /3Zq  .yu  .o~   /3Z  .  .  .  .ݴ   /3Z  .  .  .+  .%  .S  .I  /3Z  .  .  $  .(  .1  .5  .> H `  .µd  .m  .ҵq  .еz    .  .ߵ  .  .   .  .  $ ) /HZ" ."& .+5IS /[Zd .Ch .Am /[Zv .Tz .P .q .m . . /qZ . . . .  /Z .۶ .ٶ)CM /Z^ .b .ku . . ^` , , ,N)p=I ,!X ,e=n ,{" ,= ," ,! , > ,"x ,`>' ,4"pU ,!d ,q>z ,"h ,> ,"` ,! , ? , "X ,*`?3 ,@"Pa ,!p ,}? ,"H ,? ,"@ , , ,   ,", ,$7 ..; .K .O .T ,_ .c .r .v .ܷ . . , .> .8 ,1B .a .[ . . , z /g ,} . . ,F .ո .ϸ ,f$ .( .- ,Ƭ8 .)< .#A ,SL .SP .MU /g^ ,i .}m .ww ,I , ,b4 , ,)}} . . . . . . . . .  .) .¹- .8}B /gO .ҹS .й\ .` .߹e /gn .r .{ . . . .& /g .4 .,& /!g  .Z$ .V)2B<L /1g\ .r` .ni@s /Cg . .@ /Cg . . . .@ /Cg .ܺ .غ . . . . /Cg .0 .* @@2 .O6 .M? ._C .]L@V@n .nr .l{ .~ .|@@ . . . .@ . . &~0 /Ug< .ʻ@ .ȻE_]i /egz .ۻ~ .׻ . . /eg . .]] .4 .2 .C .A .T .Rg , .c0 .a9 .t= .rB /wgTm .q .w%I L 2 /g . . . . .ͼ .Ǽ . .  . . .4 .0$ .V( .R- /g6 .p: .nCM /g^ .b .}k /gx .| . /g .ǽ .Ž .ٽ .׽ /h . . . . .  .  .' .# .B .@& .R* .P3 .e7 .c@!J /*h[ .u_ .sn!x /@h . .I /Vh . .I /Vh . .I /Vh . .۾  . .I! /Vh- .*1 .$: .P> .JG .vK .pP /VhY .] .fIpI . . .ȿ .ƿII .׿ .տ . .II .  . . .I4 .8 .A`^yzz .3 .1zz .B .@ /mh, .Q0 .O5 /mh> .bB .^K .O .|Xb{ . . /h . . . . /h . .<%; ,>M ,$s ,k ,} ,F ,f ,Ƭ ,S , ,I# ,  ,b4  ,%  ,);  ,!H  ,k!W  ,!d  ,k!t  ,pz P  ,$  .  . q  ,>  ,$! ,)! ,O.6! ,kC! ,`'O! ,!\! ,k!o! ,!! ,!! ,k!! ,!! ,El! ,! ,! /\! . ! .! ,$" .X " .T" .v" .p-" .1" .6" ,OA" .E" .J" ,NS" /]g" .k" .u" ,!" ,"M" ,"""l'" 1" ,"M" ,""# /\ # ,# .# .+# .&/# ."9# ,!K#U# /\f# .?j# .;s# .Xw# .T|# /\# .u# .o## /\# .# .# .# .# /\# .# .##d#d$ .$ .$ ."$ .'$ /\9$dR$ .V$ .\$xq$$ L$ 2$$ /]$ .$ .$ .$ . $ .-$ .)$ .I$ .E$ .e$ .a$ .% .} % . % .% /]% .% .(%2% /+]C% .G% .P% /J]]% .a% .j% /T]s% .#w% .!%%% .5% .3%% /p]% .D% .B% .S% .Q% .c% .a% .s% .q% .& . & .& .& .& .%&D/& /]@& .D& .S&D]& /]j& .n& .|&&_&m&&'& 1' ,' / b.' .2' .A' .E' .tT' .(X' .]' ,7h' .ol' .aq' ,pX|' .' .' ,' .' .' ,#' .K' .;' ,' .' .' ,j' .' .' ,H' .=' .'' ,k' .' .i' ,2((( ,N%( /#b.( ,}9( .=( .B( ,FM( .Q( .V( ,fa( .e( .j( ,Ƭu( .By( .<~( ,S( .i( .c(( ,( ,I( ,( ,b4( ,( ,)))') .+) .4) .8) .A) .E) .N) .R) .[) ._) .h) .l) .t) /b) .) .) ,!) ,) @) ,)")+) h6) ,*`@ * ,*"$* /b8* .<* .F* ,!Y* ,f*@o* ,|*"*** 6* ,*@* ,*"* /b* .%* .* ,! + ,+ A+ ,,+"6+*G+ 7W+ ,d+`Am+ ,z+"+ /b+ .O+ .I+ ,!+ ,+A+ ,+"+:++ `8, ,,A&, ,3,"A,K,h, .wl, .su, .y, .,,, ., .,, /Lb, ., ., /Lb, ., ., ., ., -"- .&- .+-?-I- /_bZ- .^- .g- .k- .t-~- /rb- .)- .'-!---*- H7 .+. 8(.+=. 8M.+^. 6x. ,F~. /Kj. .b. .6. .o. .1. .. .z. . . .. ,$. .&. .. .. .j / . / ./ ,/ .R!/ .00/ .4/ .9/ ,NI/R/ , X/&a/ /qu/ .,y/ .(/ ,!/ ,/ N/ ,/"/}./ :/ ,/`N/ ,0"0 /l%0 .H)0 .D30 ,!F0 ,S0N\0 ,i0"s0?.0 8;0 ,0N0 ,0"0 /m0 ,0 .r0 .`0 /m0 ,)0 .0 .1 /m 1 ,1 ./1 .-1 /m$1 ,)/1 .H31 .F:1 /tlC1 ,N1 .lR1 .XW1 /l\1 ,)g1 .Dk1 .Br1 /q{1 ,1 .X1 .T1 /q1 ,)1 .1 .1 /q1 .1 .1 ,!1 ,1 O1 ,2" 2.2 ?62 ,C2`OL2 ,Y2"g2q22 .2 .22 /bj2 .2 .2 /wj2 .2 .2 /j2 .X2 .V233 .j3 .h'313 /jB3 .{F3 .wO3Y3 /je3 .i3 .r3|3 /j3 .3 .3 .3 .33&33 /j3 .3 .34 /k4 .4 .434*=4 /kM4 . Q4 .Z4.d4 /,kp4 .Gt4 .=}4.4 /,k4 .4 .v4 .4 .4.4 /,k4 .4 .4 .4 .4 .+4 .!4 /,k4 .`4 .Z4.5.#5 .'5 .}05 .45 .=5.G5._5 .c5 .l5 .p5 .y5.5.5 .5 .5 .5 .5.5 .5 .5I5 66-6 .16 .66P6Z6 /Ckk6 .o6 .x6 .y|6 .i6 /Ck6 .6 .666 /tk6 .6 . 666 .Y6 .U677 /k.7 .s27 .m;7E7 /kQ7 .U7 .^7h7 /ku7 .y7 .7 .7 .77 /k7 ..7 .(7 .T7 .N7 .~7 .t7 /k7 .7 .778 .8 .8 .8 .8(8@8 .D8 .M8 .Q8 .Z8d8}8 .8 .8 . 8 .88 .18 .-8888 /k9 .Q9 .K 9!&909 /kA9 .sE9 .mN9X9t9 .x9 .}999'9'9 .9 .9 .9 .959T :%:&/:&L: .P: .Y:&c:&: .: .:.:6:R: /k: .: .: . : .: /k: .+: .': .E; .C ; .X; .T;R!; /l2; .t6; .p?; / lL; .P; .Y; /8lb; .f; .q;h{; /Jl; .; .;p;p; .; .; .; .; .&; .";; /bl; .F< .B<<s9<C< /lT< .nX< .\a< .e< .j< /lw< ."{< .< .>< .:< .Z< .V< .< .r< .< .< . < .< .l< .f< .< .<k =4=#= /*m4= .8= .A= /*mJ= .N= .W= /*m`= .Ed= .Cp=z= / /Qm> .> . >(> /am9> .I=> .GG>Q>n> .Xr> .V|>x>x> .g> .e> .v> .t>>=> /qm> .> .> .> .? /qm ? . ? .?E ?E8? .@(4@wL@}@b@@5@q A/A >%A/:A x?DA0YA >cA0tA >AAA .BA .@A .QA .OA .cA ._AAA .A .BB(B .,B .8BBB / nSB .WB .`B .dB .cmB .\qB .>zB .~B .B / nB .IB .AB .~B .zB .B .B .B .B .B .B .zB .jB .B .B .CB .-B .B .C ., C .C .C .C ./#C .,C .0C .9C .=C .FC .JC .XC .'\C .eC . iC .rC /pnC .{C .gC /nC .C .C /nC .6C .*C .C .qC /nC /nC . C .C /nC .C .DmDm/D .3D .=D#GD /nXD .\D .eD*oD /nD*D /oD*D /oD#D#D .D .D#D .D .E9E /,oE . E .+E /I .xBI .rKIeUI /obI .fI .oI .sI .|I .I .I .I .IeI /oI .BI .<I .gI ._I .I .I .I .I /oI .I .Je J / pJ .  J .)J .2-J ..6J .R:J .PHJ .aLJ ._QJ / pZJ .t^J .ngJeqJ / p~J .J .J .J .J .!J .JsJsJ .0J ..JvJ /pJ .CK .=K /pK .fK .`Kv2KP .P .|P9Q9Q9+Q ./Q .8Q .7V ,DV ,OQV ,N[VEiV ,wV ,)V ,!V ,V@EV ,V"8V ,VEV ,W"0#W ,!2W ,?WEHW ,UW"(eW ,rWF{W ,W" W ,AW ,W ,\$W ,!W ,W@FW ,X"X ,#XF,X ,9X"HX ,VX ,)jX ,SwX ,#X ,plX ,X ,X ,%X ,X ,X ,mX ,}X ,FY ,fY ,ƬY ,S-Y ,?Y ,ILY ,YY ,b4hY ,vY ,)Y ,N%Y ,!Y ,Y ,)Y ,^Y ,$Z , !!Z ,g;Z ,nZ ,{Z ,TZ ,NZBZ ,:+Z ,!Z ,ZBZ ,Z"p[ ,[C[ ,&["hG[ ,!V[ ,c[@Cl[ ,y["`[ ,[C[ ,["X[ ,[ ,![ , [ ,u[ ,ߔ\ ,!$\ , 3\ ,uA\ ,ߔV\ ,!h\ , w\ ,u\ ,ߔ\ ,!\ , \ ,u\ ,ߔ\ , \ ,] ,] ,)] ,8] ,L] ,Y]Cb] ,o]"P] ,!] ,]D] ,]"H] ,]@D] ,]"@] ,M7^ ,1B(^ ,6^ ,"H^ ,$n^ ,Nx^M^ ,^ ,!^ , ^ ,u^ ,ߔ^ ,!^ , ^ ,u _ ,ߔ!_ ,!3_ , B_ ,uP_ ,ߔe_ ,!w_ , _ ,u_ ,ߔ_ ,_@M_ ,_"x_ , _ _ ,$` .f` .`` .` .` ,k(` .,` .1` , <` .@` .E` ,!P` .T` .Y` , _`m` ,!z` ,k!` ,!` ,k!`L` ,!` ,k!`7`7a . a .aa /3W.a .2a .;a .?a .DaRa@`a ,na ,$a ,ka , a , a ,NaFa ,!a ,k!a ,!a ,k!b ,! b ,k! b ,!-b ,k!@b ,!Mb ,k!\b ,ibFrb ,b"b ,b ,$b ,!b b ..b .&c .W c .Oc ,$c .|c .x'cS1cSNc .Rc .\cSfcSc .c .chc ,c ,GPc ,Tc /]c .c .d .d . d ,Nd /](d .*,d .&6d ,!Id ,VdD_d ,ld"vd'd X2d ,dDd ,d"d ,d ,!d , d ,u e ,ߔ e ,!2e , Ae ,uOe ,ߔde ,!ve , e ,ue ,ߔe /]e ,!e .De .Be , e ,ue ,ߔef /]f .Xf .Rf)3f9Hfqf ,w+f ,df ,f ,xf ,f ,fg .xg .t'g .+g .4g>g /%jJg .Ng .Wg ag /8jqg .ug .~g g /8jg .?g .9g .ag .]g g /8jg .{g .wg .g .g .g .g /8jg .g .g h &h .*h .3h .7h .@h Jh ch .gh .ph .th .}h h h .'h .%h .8h .6h h .Ih .EhUi8 i8"i .j&i .d/i8Di .Hi .MiH^i ,,xi ,;wi ,ii ,$i .i .i .i .i .i . j . j .j /CWj ,>})j ,3j .+7j .#'ǁ ,Lԁ ,, ,L .  .)3 /WC .MG .GPZ /Wg .qk .kt .x . /W . . . . . . /WĂ .Ȃ .тۂ . . .+  .)5 .:9 .8B .JF .HOYr .Yv .W .j .h .{ .w҃܃ . . . .< /9^K .O .t .x . /P^ . . /n^ .Q .K .w .uȄ .̄ .Մ .ل . . . ( ._, .]6-@ /^Q .xU .r^1h /^t .x .1 /^ . . . .1 /^ȅ .̅ .Յ .-م .' .S .M /^ .v .p1 1' .+ .4 .8 .A1K1c .g .p .t .}11 . . . .1φ .ӆ .܆nN%NB . F . O . S . XYwY /^ .4  ., YYŇ .Z ɇ .X ·ak /^ .m  .g k /^$ . ( . 1k; /^H . L . U . Y . bkl /^x . | .  ."  .  .H  .B  /^ .k  .e kk׈ . ۈ .  .  . kk .  .   . $ . -k7kP . T . ] . a . jk .  . ˉՉ /^ .  .  /_ . # . ( /_5 .c 9 .U B . F . OYv . z .  /5_  &NJ /E_؊ . ܊ . 2 /U_ ..  ., 77 /e_D .? H .; MG(^ h4m /_z .[ ~ .W ( x3l( .w  .s ŋ(֋ 3 /_ .  . )  3A)4 . 8 . =V)N 4Yq,( 04Č(ٌ 3j) H3{) 4!)2 5AKh . l . u .  . ҍ܍ /_ .  .  .  . 0F`P{ .  .  .K  .C  .u  .q  .  .  .  .  .  . Ɏ . ͎ . ֎U .6 .4U /c  .K .I /c& .^* .Z4 /cA .|E .tOY /dj .n .x /d . . /$d . .Ï͏ /$dڏ .ޏ . .M .I /$d  .i .e . .$ .( .- /$d6 .: .CMi .m .v . z .  . . .* .(ɐ .9 .7 .I .G .Z .V5Q![!x .v| .t . .,,,Α .ґ .ב4>> . . F9jC /6dT .X .a .e .j| /Id . .Ò /YdԒ .ؒ . /id . .-EN]Vu .. . . .ē .ȓ .ѓ .MՓ .Kޓ .c .[ . . . . .   . .B .@ .[# .O,9 /hF .J .T^ /ho .s .| . .  /hה .۔ . /h .  . /h .? .= /h( .O, .M1#JTm .^q .\{ /h .n .lŕ֕ L 2// . .|( ., .5 .9 .B<L<d .h .q<{< . .K . .ɖKӖK . . .  . .   . /i0 .4 .= .7A .3J .WN .QW .z[ .td .h .q .u .~ . . /i . . /i . .ŗ /)iҗ .֗ .ߗ /;i .H .F#- /Mi: .W> .UG .fK .dT .yX .ua .e .n .r .{ . . . . /]i . .Ø͘ /miژ .ޘ . /i  . . /i .! . * .-. .)7AZ .F^ .Dcwe /i .] .Se /i . .™e̙ /iٙ .ݙ . . .e /i  .  . . .# ./' .), /i5 .T9 .PBeL /j\ .k` .ii .{m .yve /j . . . .e /j . .ʚ .Κ .ך /j . .A,B] .a .j .n . u ,Jy ,J ,` , )&] , --Z -Z *>& ,cT ,Z ,4 ,$i ,n  ,j ," ,.C0 ,n5 ,tC ,'H ,*D` ,bl ,Ez , , , ,  , ,] ,! ,g- ,{9 ,tE ,YQ ,:i] ,i ,u ,f ,h , , ,  ,, ,ĝ ,Н ,ܝ ,N ,cB , ,(x  ,hd ,/$ ,Z;0 ,)C ,H ,} T ,` ,l ,x ,v ,N , ,f ,N ,  ,s̞ ,? ؞ , , ,#  , , ( ,6 ,B ,yO , \ , t , ,W ,4 ,  ,џ ,Vޟ ,  , ,M > ,L ,oZ ,%h ,v ,h ,  ,( ,9 ,  ,Hlʠ ,5ؠ ,o , ,a ,l ,K ,GJ, ,M*; ,K ,A)Y ,0g ,ou ,e  ,i , ,c , ,yyɡ ,ס , , ,[ , ,. ,i= ,~L ,S[ ,0j ,[y ,Y ,0 ,K ,[Ţ ,Ԣ ,( , ,R ,E ,f ,E. ,.= ,v]L ,*[ , j ,y , ,W ,U ,I ,ģ ,4ӣ , ,F  ,#G ,$ , , - ,hW< ,JQK ,LZ ,i , x ,l  ,Q ,5  ,5w ,ä ,RҤ ,,= ,b ,M ,^ ,H ,j, ,D; ,NJ ,c ,~p ,  ,  ,|¥ ,? ֥ ,i ,[m , ,81 ,@MD ,e R ,.^ ,f ,Ln ,{ ,  ,k , , ,b ,Dɦ ,*s֦ ,tz ,< ,  , ,( , 6 ,-D , R ,j ,v , ,  ,5 ,Q ,.ɧ ,cӧ , ,> ,X ,7 ,/C ,$3P ,͉] ,7j ,?w ,-? ,N ,6 , ,<̨ ,˺ܨ , ,|e , ,` ,` ,- ,.) ,~6 ,AC ,6?P ,h ,nu ,j  , ,  ,cΩ ,۩ ,< ,H ,# ,91 ,? , M ,O[ ,n+i ,w ,  , ,* , ,x ,˪ ,٪ ,Ǫ ,?N ,P ,  ,. ,- ,W; ,eI ,qW ,[e ,s ,z  ,o ,< ,@6 ,[ ,K ǫ ,j6ի ,p, ,  ,b ,: ,_5 ,-, ,<: ,wb ,n , { ,@  , ,A ,@  , ,K ,S ,J 8 ,[F ,T ,@o ,} ,1 ,K٭ ,S , ,̮ ,< ,ko , , ,! ,U , , ,\  , ,. ȯ ,;ԯ , , ,R& ,|4 ,|C ,3i ,|8 ,  ,j , ,<հ ,n  ,u ,J ,   ,  ,% , 3 ,A ,[7P ,i` ,n ,| ,3 ,*  ,` ,< ,± ,O б ,ޱ ,iY ,Wf ,N , ,$ ,ƈ2 ,  @ ,k=N ,\ ,| ,% , ,ò ,{gҲ ,`g , ,] ,P ,W) ,- ,< ,v K ,6~Z , i ,x ,#U ,.5 ,: , ,!ó ,Sҳ , , , ,S ,$ ,., ,B; ,2 J ,5+Y ,h , w ,ݥ ,n , ,?  ,ε´ , Ѵ ,l ,w ,  , ,{ + ,a: ,a I ,X ,dg ,v , = ,r , ,8 ,ŵ ,I յ ,U^ ,8: ,] , ,_b% ,5 ,kVE ,U ,ֆe ,^u , ,܂ ,G , ¶ ,PѶ ,j ,  ,( ,0D  ,ά ,#h+ ,: ,nII ,8jX ,g ,v , ,  ,؍ ,W- , ,e=з ,n߷ ,Y ,4 ,԰  ,= ,G* ,S09 ,H ,1W ,hf ,u ,f| ,{a ,.  , ,h ,Vи , ߸ ,6V ,~W ,N  ,4/) ,|8 ,MG ,DeV ,[7e ,ot ,N  ,C ,4 ,  ,} ,ι ,ݹ ,? , ,bo  ,J ,c( ,7 , 3F ,u7U ,Ld ,@s , ,  ,5 ,! ,>. ,Rmͺ ,`Uܺ ,8B ,RY ,]  ,A ,e' ,h6 ,oE , FT ,B c , r , ,U ,i ,Xg ,0 ,Q̻ ,ۻ ,[ ,  ,2  ,7  , & ,5 ,c D ,"YS ,]b ,{q ,w , , t , ,͌ ,˼ ,Mڼ ,  ,? , ,4 ,/% , 5 ,!D ,}S ,bb ,+Mq ,a , , ,+ ,  ,J˽ , ڽ ,P+ ,- ,s ,d ,0& ,M5 ,D ,,S ,b ,*q ,/ ,* ,d ,I  ,j ,˾ ,vھ ,> , ,h] , ,v% ,t4 ,C ,R ,6a ,p , ,q ,J ,. ,sF˿ ,ڿ ,  , ,14 ,U ,% ,ǻ4 , C ,GR ,Ga ,lp ,v ,  ,  , ,{  , , ,`J , , " ,  2 ,"g ,Yu ,9 ,  ,{| ,y ,+L , ,  ,t+ ,T , ,n ,1- ,,+; ,kI ,yh| ,A ,X ,'  , , ,\ ,B , ,* ,8 ,XG , U ,#c ,+q ,]  ,. ,  ,  ,3 ,su , ,_ ,  ,.F , ,& ,pJ ,V ,)b ,o ,| ,  , ,g , ,M ,  ,}  ,? - ,] < ,tK ,Z ,i ,'~x ,Y1 ,# ,- ,lc ,m  ,Ѹ ,:S ,q ,F ,  , ,n, , ; ,#J ,#QY , h ,  w , , ,  ,9 ,  ,D ,2 ,v , ,2 ,>P ,|, ,<; ,vJ ,KY , i ,<x , ,e , ,= ,o , , ,S ,i  ,7  ,{(( ,3q5 ,IB ,  ,º ,A}T ,` ,} ,[  ,FI , ,º ,SW ,o / ,  ,º , ,K ,Ih ,= ,  ,[J ,01 ,0? ,M ,IY[ ,^ z ,`  ,  ,ϛ ,!w ,u , , ,9 ,M  ,q, , < ,>oJ ,6X ,f ,QV ,f ,*  ,  , , ,> ,C , ,V ,,) ,h7 , E ,S ,%]a ,Io ,U ,I ,6? ,>o ,< ,{( , ,  ,GY ,^ ,Th ,?,u , ,: , ,W ,  ,  ,J , ,z ,7 ,5|G ,_M , S ,ac ,} ,< , , , ,E ,X ,w ,@  , ," ! ,4 ,ŌK ,zYX , e ,Vr ,@  , ,w ,% ,  , ,  ,  , ,<% ,\L2 ,A}M , ] ,]Yc , i ,>Go ,u ,| ,l1 ,n ,< ,X , ,v , ,| ,? ,  , , ) ,f5 ,] B ,9O ,e i ,Rw ,o ,   ,kf , d ,/a , ,q ,f ,  ,/a ,  ,  ,:) , 6 ,yWD ,ŌR ,>_ , m ,J} ,} , ,P ,yW ,r ,? ,6? ,A) ,O  ,] ,  ,S' ,} 4 ,FA ," [ ,h , u ,\ ,~ , ,7 ,Ō ,? ,< ,c ,- ,c ,@! ,#4 ,XR ,^ ,gk ,;y ,e ,  ,  ,_^ ,* ,[C , , ,%  ,e= ,& ,K ,8W ,Tc ,t ,1  ,*  ,13 , , ,`X ,T , ,G ,V  , ,. ,T; ,H ,_ ,Tl ,y , , ,Y ,2 ,h  ,3 , ,Ve ,H  ,  ,0 ,9< ,H ,LT ,` ,v , ,w ,< , , ,c ,79 ,  ,7 ,( ,(4 ,kJ ,W ,d ,+q ,G ,( ,S ,he ,yW , , ,  ,  ,0 ,[7' ,P4 ,/A ,N ,{ [ ,Fi ,_ , ,= ,~ ,B ,/z ,A ,А , ,~ ,>o , n" ,[/ ,e < ,J ,:W ,d ,;q ,~ ,& ,3 ,Z , ,  , ,Z. , , , c ,t  ,f|- ,; ,] H ,RV ,c ,{p ,b} ,5 ,< ,- ,J , , ,1 ,  , ,j ,3) ,7 ,L ,Y ,g ,% , ,  ,Y , ,e= , ,O , ,  ,P , ,/ ,V" ,40 ,> ,L ,A)h ,v ,e= ,n ,  ,Km , ,+ , ,9 ,  ,U ,Q ,}! ,5/ ,= ,3K ,CY , g , ,  ,P , - ,r  , , ,b7 ,e* ,k9 , I ,W ,f ,l3t , ,. , ,ƈ ,H ,  ,c ,T , ,I , ,uY ,0* ,28 ,F ,(T ,/gb ,p ,/ ,/g ,r , ,h, ,֛ ,M ,ƈ ,C ,7 ,9 , G ,/aV ,`d ,}ur ,+{ , , , ,l3 ,< ,xc ,85 ,sj , ,% ,& ,6 ,IF ,UU ,q ,&9 ,- , , , ,  ,8 ,  ,  ,N ) ,K7 ,a\E ,VT ,7y ,į ,  ,J , ,[ ,p , 5 ,D ,>I  ,I ,~& ,4 ,B ,P ,^ , l ,t{z ,< ,  , , ,< ,Xa , ,  , ,IV! ,l. ,; ,V ,y , , ,-  , ,` ,\  ,  , ,˗ , ,m( ,5 ,^B ,O ,a\ , i ,lv , , ,}  ,- ,v ,U ,!  ,X ,he ,  ,`# ,D7 ,Q ,! ^ ,Uq ,a. ,%] ,G ,  ,A) ,< , ,  ,p  ,Z ,! ,De. ,; ,H ,EU ,7b , o , | , ,  ,C , ,Y ,z1 ,Q ,Iz ,@; ,k ,6 ,  ,, ,9 ,.F ,wS ,` ,<m , z ,A  ,  , ,^ ,i , w , , , , ,԰ ,, ,aH ,V ,d ,r ,e= ,M ,U  ,n ,]F ,Y ,= ,G ,  ,n ,1  ,h ,It( ,6 ,|D , R ,` ,Rn ,| , ,h ,O ,Z ,! ,W) , , , ,9 , ,An$ ,+2 ,F ,I S ,I ` ,m ,z ,\  , ,  ,Rm ,T ,| ,  ,@ , ,K  , ,% ,>3 ,27A ,ZU ,8B_ ,RYl , y ,r , , ,Z , ,= , ,] , , ,  , ,e+ ,9 ,lG ,mU ,=1c ,q , ,З ,B ,M , ,o  ,~ , ,, ,lN , ,A $ ,V: ,D ,R ,0` ,n , ,.* , ,w ,! ,v , ,  ,2 ,@@ ,_ N ,\ ,1Hj ,cx , , , ,Yu , ,y , ,M| ,ˡ ,  , ,M  ,. ,< ,J ,,Y ,١h ,8w ,uE ,D ,A ,7 , ,j ,  , ,J ,  ,tM! , . ,; ,:H , U ,/b , o ,| ,? ,p , ,< ,A) ,\ ,F , ,Le , , ! ,,< ,J ,};X ,;f ,t , ,# ,4 ,l0 ,  ,> , ,- ,L  ,  ,T~) ,E = ,$J ,A)W ,d ,x , , ,́ ,+ ,  ,Un ,  ,  , ,j ,~ , ,՝ ,K( ,m5 , B , T ,a ,n ,f{ ,_ ,wO , ,r6 , ,p ,3 , ,n ,  , ,  ' ,u4 ,:A ,N ,]] ,m@j ,o ,g ,R ,  , , ,< ,\ , ,! ,t4 ,@ ,5M , [ ,LIl ,U ,- , ,9e ,  ,* ,YM , ,9 ,e  ,R ,s( ,4 ,@ ,4L ,9X ,d ,lq ,<~ ,Z , ,7 ,Q  ,I , ,T , ,_ ,( ,66 ,uG ,XS ,ɒ_ ,> , , ,7 , ,F , ,8  ,k ,  ,: ,G ,TT , a ,h{ ,̪ ,< ,:F , , ,]  ,  , ,V# ,0 ,= ,.J ,X ,ag ,. u ,@4 , , ,@ ,G , , ,  ,  , + ,~EE ,SR ,e ,]r ,yW ,  ,E , , ,=f , ,V , ,k ,x ,О ,  ,( ,75 , B , O ,\ ,;Rj ,$x , , , ,j\ ,{ ,) ,L ,  ,& , 3 , J ,SZW , n ,z , , ,  , ,Yt ,> ,R , ,>= , , ,Ro  ,+' ,77 ,Y<= ,JC ,YI , P ,] ,A)j ,~Ew ,x ,x ,- ,N , ,m , , , ,*  ,- ,V: ,ߓG , b , z ,7a ,0 ,Q] ,f ,f ,< , , ,0  ,r  ,- ,6: , T ,<a ,n ,K{ , ,H , ,  ,+ , , ,>o ,~< , , ,0" ,/ ,QS< ,I ,: V ,Cc ,op ,T} , ,\ ,  ,* , ,1  , ,w ,+ , 5 ,FA ,] ,p ,Z ,> ,^ ,1 ,  ,  , ,r ,L  ,Q` ,܈4 ,A ,N ,<[ ,Bu ,9 ,k ,V ,  , , Z ,% ,w[ ,Zh ,N ,< , ,F , ,n  ,u ,  , , & ,I14 , B ,=P ,.B^ ,Ɗ} ,9 , ,  ,P ,z  , ,'_ ,  ,\  , 5  ,BD  ,h  ,rz  ,  , ,M ,\ ,k ,)z ,}  ,X  ,[ ,5 , ,  ,Kx , ,D , ,f. ,<= ,dL ,[ ,9j ,Xy ,t  , ,x , ,͌ , ,v ,Q] ,E , , ,l- ,< ,MpK ,v4 , ,q ,4 ,I ,p ,/ ,( ,  ,9 ,  ,< ,(O# ,1 ,w? , M ,Ś[ ,v ,v ,he ,F ,J , ,# ,  ,g ,  , ,f" ,6 ,<f , t , , , ,N ,L6 ,6 ,6 ,a , ,j , ,2 , ,n ,Չ  , , ,, ,"? ,ݿL ,Y ,"u ,s  ,ݿ ,=  , ,d ,j ,  , ,) , , ,d$ , 2 ,@ ,%c ,z ,P3 ,NH ,y , , ,= ,0  , ,  ,~ ,>$ ,Y2 ,|@ ,ZN ,\\ ,}{ ,\ ,W , , ,4 ,  ,N ,B) ,g9 ,I ,Y ,Vi ,=y , ,  ,| ,T , ,Z ,) ,c ," ,W0 ,5= , J ,b ,Xn ,yz , ,zi ,  ,  , , , , ,t ,x ,J ,+ , : ,6I ,X ,$g ,jv ,O ,> ,0H ,d ,Tr ,| ,3b ,W) ,̈ , , ,  , ,PR% ,3 ,bB ,P ,e^ ,tl , z , ,  ,C ,< ,  , ,K9 ,  , ; , I , W , ,p , , ,3j , , ,Z ,< ,~-  ,} ,0( ,eG ,'uU ,}c ,cq ,V  ,=O ,c ,{ ,E ,g ,G , ,˱ , U  ,F ,! ,C/ ,]@= ,QK ,Y ,sg ,yWu , ,2 ,5 ,p , ,k , ,UT ,=m ,  , ,$* ,o+ , 9 ,!G ,(U , e ,t , ,< , ,  , ,l ,| ,t ,Y/ ,  ,  ,))  ,-8  , G  ,&W  ,f  ,V  ,  ,  ,z  ,T  ,! ,I+! ,h9! ,G! ,V! ,d! , r! ,8! , ! ,,! ,)! ,*! , " ,X" ,P"" ,V/" ,H<" , I" ,tV" , d" ,Rx" ," ,yW" ,0" ,z," ," ,)8" ,Ϝ" ,b" ,"# ,lw# ,0D"# ,B =# ,` G# ,ܧT# , b# ,Ao# ,|# , # ,(# ,o# ,# ,<# ,-# , $ ,#$ ,}=$ ,ǪJ$ ,>oW$ ,Le$ ,s$ ,Ǫ$ ,P$ ,|$ , $ ,/$ ,5 $ ,O$ , $ ,G$ ,n+$ , % ,% , 4% ,S% ,9_% ,,l% ,{% ,;% ,>o% ,N% ,% ,{% ,F% ,^~% ,% ,f- & , & ,Z$& ,s=& , J& ,;W& , e& ,] s& ,\& ,:& ,0& ,}& , & ,F& ,9k& ,+' , ' ,( ,( ,Γ( ,4t( ,t(( ,5( ,B( ,nO( ,&\( ,pdi( ,p( ,$8( ,W ( ,( ,-( ,U7( ,( , ( ,2#) ,J) ,>oW) ,d) ,[q) ,)~) ,o) ,) ,) ,G ) ,S ) , {) ,B) ,) ,X) ,* ,* ,o* ,-2* ,Z>* ,DK* , Y* ,,g* ,>ou* ,Z* ,0* ,O* ,i5* ,n+* ,~4* , * ,"+ , /+ ,o<+ ,7I+ ,(V+ ,1 , M1 ,k1 ,7Lz1 ,r 1 ,^1 ,\1 ,1 ,#t1 ,=1 ,#+1 ,%1 ,eI2 , 2 ,g2 ,p.2 ,,K2 ,ZZ2 ,?i2 ,x2 ,L2 ,P2 , 2 ,2 ,e2 ,82 , 2 ,2 ,3 ,73 ,"3 ,շ23 , H3 ,#)U3 ,b3 ,3 , 3 , 3 ,~C3 ,c 3 ,R3 ,3 ,) 4 ,14 ,.$4 ,V24 ,@4 ,eUN4 ,xN\4 ,8 i4 ,v4 ,R4 ,4 ,4 , 4 ,`4 ,% 4 ,q4 ,K5 ,:5 ,5 ,=(5 ,65 ,QD5 ,R5 ,`5 ,6n5 ,m|5 , 5 ,G<5 ,5 ,5 ,5 ,[5 ,=5 , 5 ,5 ,m6 , 6 ,Җ$6 ,26 ,Z?@6 ,CN6 ,Y\6 ,>6 ,C6 ,T6 ,6 ,T6 ,9 6 , 6 , 6 ,6 , ?6 ,6 ,6 ,66 , 7 ,7 , 7 ,8,7 , :7 ,`H7 ,OW7 ,ϻa7 ,q7 ,%7 ,d7 ,7 ,7 ,y7 ,97 ,7 ,:7 ,{d7 ,W8 ,=8 ,^#8 ,18 ,7?8 ,M8 ,S[8 , k8 ,Q{8 ,8 ,@8 ,8 ,g8 , 8 , 8 ,8 ,38 ,j9 ,fx9 ,O9 ,-.9 ,( >9 ,N9 ,^9 ,Cn9 ,~9 ,v9 ,E9 ,% 9 ,f9 ,,9 ,9 ,9 ,f9 ,: ,f: ,PB$: ,2: ,hA: , GP: ,$_: ,n: ,}: ,: ,0: ,o: ,7: ,: ,j: ,8 : , ; ,M; ,uT; ,uf*; ,i87; ,dOD; ,tQ; ,W^; , k; ,gx; ,o/; , ; ,4; ,; ,; ,r< ,{(< ,-< ,R *< ,Ǚ8< ,~ F< ,< ,< ,o< ,\ < ,+< ,ة< ,=< ,4Z< ,X< , < ,ͩ= ,n= ,t= ,xN,= ,9= ,F= ,S= ,`= ,Jim= , = ,= ,-= ,o= ,9= ,.= ,> ,]W > ,{H> , '> , 4> ,ͩA> ,nN> ,t[> ,h> ,u> ,L> ,ة> ,W> , ? ,o? ,V&? ,ة3? ,?@? ,,M? ,/Z? ,g? ,`[t? ,٭? ,h? ,@ ,`@ ,o(@ ,L5@ ,XB@ ,,O@ ,P@ , @ ,7@ ,{@ ,@ ,@ ,-@ , A ,A ,$A ,7A ,*DA ,:QA ,- iA ,UvA ,yWA ,ϛA ,A ,A ,A ,B A ,(A ,yWA ,B ,B ,7*B ,7B , DB ,QB ,B ,oB ,[B ,;B ,B ,(B ,B ,DB ,VB ,C ,C ,ϛ"C ,B C ,0C ,WC , C , C ,C ,C ,D ,I!D ,T?D ,hD ,WuD ,lD ,oD ,K D ,D ,1D ,D ,D ,D ,51 E ,~E ,&E ,3E ,^@E ,kME ,ZE ,;UgE ,'WtE ,+E , E ,`E ,E ,E ,*E ,E ,\F ,F ,F ,I+F ,! 9F , GF ,@UF ,^BcF ,TqF ,F , 9F ,FF ,0F ,F ,F , F ,jF , F ,G ,NG ,G ,-G ,L ;G ,IG ,MWG ,eG ,3sG ,G ,WG , G ,OG ,}DG ,/ G ,BG ,g G ,{G ,DH ,woH ,s'H ,q6H ,6EH ,"TH ,`cH ,HyH ,H ,~QH , H , H ,˂H ,dH ,H ,wI ,0\I ,+@)I ,6I ,CI , PI ,]I ,jI ,wI ,R?I , I ,)I ,BI ,;I ,:I ,I ,HI ,ȬI ,P\ J ,NOJ ,&J ,Y4J , BJ ,PJ ,]^J ,y lJ ,pzJ ,!sJ ,|J ,4J ,uCJ , J ,J ,[J ,J ,zJ ,.K ,*K ,"K ,J0K ,>K ,]LK ,ZK ,7`hK ,dwK ,FK ,4K ,K ,5{K ,K ,K ,K ,JK ,FK ,L ,/L , ,L ,э;L , JL ,SXYL ,:hL ,mqwL ,\xL ,lL ,ѴL ,Y4L ,OL ,EL ,ԶL ,X L ,yL , M ,,M ,;];M , JM ,[KYM ,iM ,xM ,]M ,M ,M , M ,~N ,BN ,oN ,یN ,4N ,`N ,N ,LO ,YO ,O ,B_O ,rO ,tO ,O ,~O ,aP ,P , P ,+P ,8P ,EP ,ZRP ,j_P ,<lP , yP ,P ,pP ,0P , P ,oP , P ,Q ,1I$Q ,01Q , >Q ,LQ ,ށfQ , yQ ,PQ ,Q ,RQ ,Q ,R ,; R ,xR ,V R ,{-R ,,:R ,HR ,6XR ,8gR ,<uR , R ,R ,AR ,R ,CR ,R ,sR ,R ,#S ,_S ,S ,c.S ,@=S ,7JLS ,.[S ,7jS ,yS ,=S ,B S ,} S ,`S , S ,FS ,S ,{S , T ,8T , T , .T ,Y=T ,QLT ,[T ,qjT ,OT ,0T ,T ,nT ,$T ,kT ,B T ,T ,JU ,tU ,z U , ;U ,`HU ,!S_U ,(lU ,*U ,U ,U ,U ,U ,4rU ,u U ,l2U ,CV ,*V , cV ,WpV ,aV ,@V ,lV ,V ,V ,V ,V , V , W ,W ,4r0W ,bLW ,gnZW ,usW ,) W ,ZW , W ,>W ,lW , W , W ,W ,*-W ,00X ,sX ,?"X , /X ,`X ,c X ,* Y ,ZY ,Ō#Y ,H1Y ,>Y ,KY ,e=XY ,fY ,osY ,]3Y ,QY ,QY , Y , Y ,QY ,Y ,Z ,LZ ,,Z ,:Z ,cGZ ,G TZ ,aZ ,pnZ ,G|Z ,Z ,Z ,Z ,Z ,Z ,~Z , Z ,Z ,DZ ,~Z ,B [ ,![ ,9'[ ,J?4[ ,[A[ ,RO[ ,/p\[ ,>i[ ,c v[ ,*[ ,5[ ,f [ ,`[ ,[ ,-[ ,Z[ ,'|[ ,e[ ,3[ ,Z\ ,\ ,="\ ,G0\ ,>\ ,hL\ , Z\ ,$ h\ ,v\ ,\ , \ ,\ ,  \ ,|\ ,A\ , v\ ,*\ ,5\ ,=] ,f] ,] ,1)3] ,=] ,J] ,QX] ,e] ,y r] ,ڴ] ,۵] ,] ,i] ,u}] ,V ] , ] ,,] ,@7^ ,C^ ,$X^ ,d^ ,ly^ ,-^ ,$p^ ,% ^ ,<^ ,C`^ ,yp^ , ^ , _ ,_ , )_ , u7_ ,KE_ ,;S_ ,2sa_ ,ro_ ,j}_ ,,W_ ,q_ ,_ ,_ ,i_ ,@_ ,_ ,_ ,KW_ ,` ,C'` ,r6` ,W)E` ,T` ,xq` ,(` ,` ,` ,h,` ,` ,W` ,` ,=` ,H` ,!@a ,a ,%a ,yW4a ,mCa ,Ra ,aa ,R ~a ,Na ,a ,Fa ,Pa ,a ,a ,a ,Vb ,\8b ,̙#b , 2b ,JAb ,KfPb ,ݖ_b ,nb ,}b ,b ,`b ,[b , b ,xc ,c ,mc ,+c ,8c ,Ec ,PRc ,_c ,  mc ,c ,c ,c ,Mc ,e}c ,c ,c ,X c ,*d ,jd ,zd ,'d ,c4d , Ad ,[dd ,nd ,4 d ,d ,VQd ,ud ,dd ,d ,d ,* d ,Te , e ,e ,?+e ,?e ,dMe ,k [e ,ie ,, we ,e ,Ͻe ,% e ,D7e ,6e ,'e ,xe ,1e ,e ,2f ,j%f ,o5f ,ar;f ,dAf , Hf ,Muf ,}f , f ,f , }f ,f ,f ,&f ,hf ,xf ,f ,u g ,g ,@&g ,!3g ,=@g , Mg ,@Zg ,5gg ,rDtg ,eg ,g ,| g ,  g ,Xg ,g , g ,g ,eg ,mQh ,`h ,Th ,5-h ,;h ,Ih ,Wh ,zeh ,peh ,U|h , h ,h ,h ,L; i ,RUi ,&i ,J4i ,Bi , Pi ,^i ,pei ,>i ,f j ,Nj ,r5#j ,z1j ,?j , Mj , [j ,ij ,zwj ,ej ,j ,ij ,j ,H j ,Bj ,rj ,vj ,<j ,k ,Hk , k ,1.k ,^o ,lo ,Bzo ,o ,so ,No , o , o ,o ,o ,_p ,<^p , p ,,/p ,>p ,MMp ,I\p ,kp ,Tzp ,$p ,Sp ,0p ,p ,Fp ,޸p ,*p ,p ,q ,q ,"q ,q-q ,]q ,o_/s ,]vs ,Ks , Rs , s ,ls ,'s ,5 s , t ,t ,#t ,1t ,;t ,Et ,)iUt ,(ct ,qt ,t ,d:t , t ,8t ,-t ,nt ,9t , t ,t ,dt , u ,,u ,,'u ,?K5u ,'Cu ,Qu ,+_u ,w=mu ,*{u ,*u ,uu ,5u ,*ku ,r:u ,A)u ,u ,ցv ,n v ,v ,'v ,ߕ4v ,*]Av ,gNv ,\v ,Ajv ,(xv ,Av ,Pv ,Uv ,Ov ,P_v ,v , v ,v ,v ,w ,޻w , w ,j.w ,5Xoax , ox , }x ,x ,Bxx ,fx ,o x ,x ,  x ,]x ,uy ,&y , 6y ,Dy ,hRy ,`y ,Ruy ,4y , y ,*y ,5 y ,By ,Ey ,y ,y ,z ,z ,ǰ z ,̆.z ,s< { ,{ ,UL{ ,x{ ,{ ,a+| ,|| ,!| ,QE.| ,B;| ,*H| ,3U| ,b| ,>o| ,|| , | ,+| ,C|| ,C| ,/a| ,| , | ,| ,j} ,} ,f } ,7--} ,_:} ,\G} ,%a} ,So} ,eP}} ,} ,z} ,G} ,\ } ,9} ,x} ,Ȁ} , } ,I{'~ ,f~ ,t~ ,w~ ,K  , . , \< ,J ,QX ,Au ,Xi ,u  , ׄ ,Sx ,/ ,J= ,qN ,mT ,Z ,*  ,6 ,z ,BA ,LrN ,Q [ ,*lh ,u ,O , ,{ ,( , , ʇ ,ׇ ,/ ,HE , ,Y  ,; ,2& ,Ɩ4 ,B ,[P ,-^ ,K.m ,~ny ,WP ,  ,  , , ,Fƈ ,q҈ ,d߈ , ,Y  ,  ,U  ,y  ,. ,ǸS ,[` ,o ,%] ,  ,< ,ں ,  , 8 ,ԦR , y ,sG ,4d ,yWÊ ,.Њ ,p݊ , , ,  ,  ,5 ,~mB ,\ ,u , ,U , ,, ,G ,K  ,΋ , ۋ ,Hm ,: ~ ,6 ,T , ,y ,_ ,yWÌ ,uь ,6?ߌ , ,  ,>o ,L' ,B5 ,C ,Q ,e ,U ,; ,  ,Ѝ ,s ,]W , ,  ,~v ,  ,/ ,r> ,ph ,H4u ,, ,G ,K  , ,` ,  ,Y ,G- ,v3 ,9 ,? , F ,W ,N] ,Sc ,Yi ,w p , ~ ,ؑ ,  ,Wz ,A} , ŏ ,xӏ , ,E ,Ô ,e ,>  ,{  ,1 ,b ,P! ,Rv( ,r*9 ,c? ,%TE , L , ] ,oPc ,i ,p ,DF~ ,} ,=[ ,Y ,dŐ ,duِ , ,ܼ , ,| ,j) ,6 ,f] ,ؑj , w ,< ,  , , ,2‘ ,yWϑ ,|ݑ , ,i  ,4Z ,<G ,3a ,No ,_ , ,? ,` ,1 ,W , , ,CoŒ ,, ,> 9 ,g_ ,7  ,~ ,k ,C0 ,&֓ ,u ,p( ,08 ,K> ,O D ,J ,Q ,7n^ , k ,x , , ,A , ,c• ,Е ,Ǚޕ ,6 ,m , ,h ,G 2 ,Tr> , K , Y ,e ,9 z ,Α ,b , ,j ,u3 ,ɖ , ז , ,` , ,  , ,+ ,;: ,= I ,QX ,]*g ,v ,ğ ,  , ֗ ,~k , , ,  ,  , $ ,t1 ,H> ,- V ,kb ,Al ,Zy ,{( , ,V ,j Ƙ ,lӘ , ,N ,^  ,HT( ,5 ,tC ,!Q ,A^ ,k , x ,< ,Ga , ,M  ,- ͙ ,Qb ,Zq ,8  ,7 ,& ,t 3 ,F ,V ,M \ ,hkb ,Nh ,8o , | ,< ,  ,)d , ,{ ,˚ ,ך ,. ,) ,* ,Ǫ ,P ,Y+ ,9 ,`DG ,؜U ,v c ,rq ,  ,) , ,, ,Y ,9ś ,rxӛ ,H ,  ,GX ,T ,A ,,' ,5 ,h?C ,mQ ,e ,4r , ,s ,,+ ,< ,  ,EgŜ ,.Ӝ , ," , ,  ,` ,W' ,$J5 ,ݲC ,I Q ,6m_ ,dm ,e{ ,f ,t , ,R ,ҏ ,ϝ ,fݝ ,ʠ ,Q ,x ,r ,# , 1 ,? ,M ,X[ ,i ,w ,ϟ ,6 ,  , ,S ,׽̞ ,y ,3  , ,-& ,D ,xN ,\ ,:0j ,Bx , ,]k ,_6 , ,A ,h,̟ ,ڟ ,Q , ,!^ ,m ,3  ,z. ,e< ,uJ ,C c ,=m ,f ,5 ,K0 ,-` ,Ǡ , Ԡ ,h, ,^ ,  ,  ,( ,5 ,B ,O ,\ ,B\i ,v ,D , , ,A) ,l3ޡ ,?N ,d; ,G ,y , # ,- ,m7 ,o E ,S ,-a ,o ,o} ,b ,  ,8y ,ɢ ,R Ӣ , ݢ ,%I ,' , ,2s- ,K; ,d I ,W ,pe ,h,s ,< ,  ,| , ,# ,Aǣ ,ۣ , ,T ,| ,f , ,I# ,ˤ , b ,rxݥ , ,B: , W ,) ,_' ,U4 ,:A ,1N , [ ,jh ,Pyu ,I ,, , , ,w ,(æ ,~Ц ,ݦ , ,8 , ,# ,< ,x26 ,ǎC ,q\ ,o ,>| ,g ,B ,v]] ,%;j ,"vw ,~ ,A ,?L ,X2 , , ө , ,N ,n. ,N  ,; ,_0 ,M< ,myL ,,R ,3X , h , t , , , ,/a ,k۪ ,  ," ,^9 ,G ,AU ,ec ,&Xq ,< ,sb ,? ,  ,Sī ,<8ӫ ,  , , ,x  , ,- ,|/< ,|K ,bZ ,pi ,ZOx ,I ,M ,ğ , ,Kfì ,ݖҬ ,  ,. ,C ,q , ,( ,a 6 ,A)J ,]X ,(f ,t , ,5 , G ,U , ,0 , ,x , ,U , ,wί ,Bۯ , ,o ,[J ,Y , ,iL) ,6 ,C ,VP ,',] , j ,Jw ,Y  ,z ,S ,E , ,n;ư ,1A԰ ,a , ,u ,;H  , , ( ,؜6 ,B D ,JR , ` ,+ o ,Ҁ~ , ,K  , ,T  ,ۙɱ ,ر ,` , ,  ,Eg ,+# ,2 ,HB ,$bR ,1Sb , r ,,v ,¿ ,z , , ,eϲ ,[ ,1  ,  , ) ,t7 ,!fE ,fS ,:a ,{o ,>} ,- ,u , ,: ,7>ó ,zѳ ,߳ ,  ,Z ,T  ,` ,D) , 8 ,#G ,WV , e ,t , ,ݹ , ,K  ,+ ,T δ ,ۙݴ , ,bR ,`  , , ( ,Eg7 ,2sF ,U ,e ,u , , ,6 , ,,vŵ ,¿յ ,z , ,  ,W ,G$ ,3 ,B ,k Q ,` ,6?o ,~ ,& ,0h ,  ,ʶ ,ڶ , ,1 ,  , ,1l+ ,wm8 ,fE ,ҹ` ,m , z , ,)V ,s  , , ,wȷ ,շ ,e , 7 ,  ,Ɯ ,a9# ,0 ,K= ,J ,W ,<e ,A)s ,4G ,U ,4 ,t ,D ,C` , ,VH, ,x9 ,F ,i*S ,ߕ` ,m ,Kz ,J ,zs ,~T ,E ,U ,$6Թ ,A , ,U , ," ,/ ,W< ,I ,1V ,)c ,%2p , ,M7 , , ,'º ,Sк ,\޺ ,e ,X , k ,08 ,$ ,V 3 , B ,4Q ,` ,8o ,K~ ,e ,H] ,~ ,F ,>Vɻ ,vػ ,1V ,hy ,9 ,~^$ ,h3 ,4B ,5Q ,2` ,Lo ,H~ ,ʳ ,,v ,  ,  , ɼ ,҄ؼ , ,O , , , # ,=2 ,A ,P ,t_ ,.fn ,} , , ,U ,D ,)Ƚ ,׽ ,vl ,8  , ,3 ," ,+ 1 , @ ,EO ,N^ ,֬m ,B| ,uZ ,eC ,n , ,~¾ ,о ,z޾ ,; ,ž ,  , ,˝) ,9 ,I ,X ,)Sg ,qv ,T , , , ,x ,zп ,?s߿ ,B  ,p  ,| ,Q , , ,p ,P ,A ,8 ,t ,A! ,l1 ,<A ,/P , _ ,K n ,} , ,A) , ,C5 ,D , ,4  ,J ,I ,P ,  , ,0( ,y6 ,_ D ,;R ,1U` ,8 n ,>| , ,]` , ,Dd , ,  ,h , ,Z ,( ,f ,}X ,  ,c ,8 ,  ,TD ,\ ,7f ,xp ,D ,E , ,l , , , , ,) , 7 , \ ,j ,0w ,A ,Bt ,a ,Y ,$ ,cl ,.  ,g# ,K< ,Y ,g ,  ,z ,7 ,CH ,mD ,9 , ,By  , ,) ,ś8 ,<G ,MPV ,e ,ODs , ,6 , , , ,C ,  ,ر ,\ ,r  ,PC ,Y' ,6 ,(>E ,T ,zc ,,r ,˦ ,&n , ,B  ,  ,P  ,8 ,e ,v , ,8u ,A-* ,~8 ,& F ,` ,Rz , ,es ,4 ,'c ,-o ,W ,A  ,g ,K, ,I ,W , p ,z ,7 ,CH ,mD ,9 , ,By ,  , ,ś( ,<7 ,MPF ,U ,ODc ,r ,6 , , , ,C ,  ,ر ,\ ,r ,PC ,Y ,& ,(>5 ,D ,zS ,,b ,˦q ,&n , ,B  ,  ,P  ,8 ,e ,v , ,8u ,A- ,~( ,& 6 ,P ,Rj ,x ,es ,4 ,'c ,-o ,W ,A  ,^ ,f% ,j3 ,~A ,RtO , , , ,Q ,d ,; ,n ,  ,jr ,} , , $ ,8 5 ,; ,\ A ,G ,M ,1S ,Y , _ ,e ,k ,7q ,\pw ,#e} ,O ,q9 , ,k ,p , ,n , < ,H , ,= ,  ,Ӫ , ,o , ,g ,Ȳ , ,l , ,= , ,  , ,>% , + , 1 , 7 ,?= ,?C ,_I ,O ,ENU ,z[ ,?a ,pSg ,ܳm ,s ,9y , ,H ,C  ,N ,^ ,w ,  ,y ,  , ,> ,H} , , P ,m  ,  ,s ,  ,&. ,>  ,P ,C  ,| ,P ,7 ,,! ,Ƀ' ,F - ,r3 ,99 ,V? ,E ,}K ,Q ,W ,{] ,c ,i ,~o ,bu ,{ , ,g ,  ,f , ,  , ,g< ,m ,%  ,r ,  , , ,  , ,h4 ,u ,ǘ ,q ,S> ,E ,^Z ,Q  ,Ȯ ,M , ,~ # ,2) ,/ ,@25 , ; ,4CA ,GG ,MM ,S ,3Y ,_ ,bp ,~ ,wU , ,0 ,  ,L  ,p , ,: ,p  ,p  ,N ,KG& ,^4 ,qB ,\ , j ,@  ,| ,< , ,a ,u , ,  ,| ,f' ,<@ ,YM ,=f ,k t ,پ ,Y ,jt ,e  ,/ , ,  ,F ,% ,4 ,d , ,X- ,< ,UJ ,X ,O<g , u , ,g ,w ,r ,e ,< ,h ,6 , , ,/ ,x < ,}T ,a , ,fM , ,$  ,MA , ,7 , , ,/ ,= ,W, , : ,H , V ,d ,Ys ,oJ ,< , ,~ ,9 ,J , ,  , ,o0 ,> ,ڐL ,[Jf ,x s ,} ,I , , ,h ,$  ,S  ,+ ,lE ,m" ,8 ; ,oI ,7W ,0 , ,h ,:v , , ,Y ,_  ,< , 5 ,9C , Q ,`_ ,x ,7 ,| ,x  ,} , ,i ,E ,<  ,/ ,{> ,X ,f ,0 ,e ,~ ,< , , , , ,r# ,+2 ,O ,<v , , , , , ,}0 ,}  ,a ,+  ,A ,O ,<o , | ,\ ,m ,} ,H+ ,< ,H+ , ,H+, ,<E ,7S ,|a ,<z ,< , , ,Z ,  ,[J ,> , ,^N ,\,, ,9 ,| F ,S ,q` ,m , ,k ,9_ , ,d ,9_ ,  ,|. , , ,Q9 ,>oE ,R ,j_ ,Dl ,[J ,c , ,i , , ,S ,: ,x ,{  ,eq ,uK( ,z7 ,F ,l(U ,Rld ,s ,9 , ,d , ,W) ,  , ,"  ,C/ ,`< ,TI ,V ,8c , p ,L ,. ,g~ ,: ,IV ,R , ,Z , , ,eG  ,d ,V/ ,X= ,heK ,ga_ ,tl ,Wy ,+  , ,  ,2 , , ,) ,C ,_ ,Qf ,s ,- ,2Y ,< , ,  ,j , ,r  ,6 ,Q ,l^ , k , x , ,~ , ,( ,> ,b ,  , , ," ,p/ ,< ,I , e ,s ,1 , ,l  ,  ,cm ,G  , , ,\j ,= ,^  ,_cb ,3{ ,  ,( ,] ,6 ,j ,ά ,0D ,W ,<  ,P ,<# ,;]0 ,Ƿ> ,(K ,AY ,0Pg ,!{u , ,G , , ,D ,M ,$ , ,y , ,s ,K- ,\+ ,'9 ,G ,HU ,Pc ,Hq ,W ,k ,1 ,o ,z ,B  ,Tj ,  ,q , ,9 ,LG ,U , c ,r ,Q ,. ,  ,  ,0 ,  ,C ,  ,tw ,6 ,  ,;b , J ,DZ ,h ,Hv , , ,X@ ,o ,! ,< ,  ,o ,(# ,o1 ,Z? , M ,<[ , v ,yW ,g ,Ǫ ,P ,  , ,| ,  ,/ ,5  ,  , ,n+, ,: , ; ,^ ,ci ,` ,  ,nj ,%z ,  ,wL ,\ ,w ,~ ,` , ! , / ,QV ,3jp ,( , , ,K , ,6g ,s ,: ,n , ,= ,: ,  ,. ,c; ,:H ,U ,c ,2s ,P=y ,Z , ,E@ ,M ,t  ,h ,)  , ,xG ,Q  , ,@r , # ,A ,<Q , W , ^ ,>m ,&Pz , ,P_ ,q ,ħ ,B ,  , ,G ,  , , & , 3 ,f@ ,>M ,B_Z , h ,u ,  , ,  ,f ,> , ,-t , , ,0= ,NJ ,*X , r ,> , ,j ,IK ,6( ,Q7 ,a ,n , { , , ,F ,) ,(E , ,m ,n ,B> ,0  ,y ,Cj ,* ,i7 ,mD ,eQ ,^ , k ,x ,/ ,X ,  , ,Z{ , ,F^ ,x ,Qw , ,_ , ,X! ,. ,; ,p H ,U , c ,z q , ,r ,{ ,g , ,  , ,8 ,: ,e * ,  8 ,UF ,T ,wUb ,p ,0~ ,^ ,  , ,p ,p ,N ,KG ,  ,o ,=Q% ,j3 ,))H ,V ,9d ,dFr , ,v ,G ,) , ,m  ,j  ,  ,' ,;5 ,W C ,Q ,ql ,Mz ,  , , ,M ,ߗ ,O , ,Xs , ,qA , ,d " ,Z0 ,> ,L ,Z ,!h ,Sv ,Y ,׮ , / , ,2 , , ,k , , ,  ,ژ ,i, , : ,=H ,V ,d ,r ,c ,1  , ,Sa , ,? ,qa ,  ,!  ,? ,1;' ,06 ,gE ,oT ,c ,Ur ,9 ,} , ,  , ,$ ,U ,S8 ,G ,Y& ,0  ,9D ,  , , , ,  ,S ,_E , ,S # , B) ,}/ ,H5 ,2< ,οC ,I ,A P ,#AW ,z_ ,O[k , , ,?7 , ,1  , ,iK ,\ ,8  ,D ,*[# ,~0 ,>o= ,k , ,  , , ,i , , ,x ,% ,6 ,  , ,  ,- ,m  ,& ,, ,HM2 ,8 ,> ,,D ,׎J ,zP ,W V ,ً\ , b ,* h ,n ,t ,z ,m ,n , ,  ,Z ,o ,  ,~ ,J ,  ,v! ,G/ ,= ,JK ,Y ,7g ,Fu , , ,| , ,  ,1 ,  ,pi , ,{( ,o- ,< ,yL ,  , ,K ,n ,>o ,Sa ,g ,\ ,  , ,p( ,{[7 ,|LE ,MS ,a ,] o ,j} ,< , ,P5 ,a , ,FB ,z{ ,~b ,H+ ,-9 ,WH ,> ,6 ,lB ,kH ,K ,Y , , ,  ,Ћ ,* ,~8 ,ST ,h ,`Q , , ,v ,.  ,^  ,  ,$  ,j2  ,z@  ,N  ,Ks\  ,7j  ,ix  ,U  ,  ,Y  ,2  ,'  ,1  ,)E  ,gR  ,Eu  ,0cz  ,  ,  ,«  ,<  ,bz  ,  ,{(  ,|  ,  ,D+  , ;  ,(A  ,G  ,ЯM  ,$mS  ,Y  ,V_  ,e  ,l  ,y|  ,  ,ի  ,  ,  ,  ,Z  ,  ,  ,  ,k  ,8p  ,h^  ,  ,[  ,wJ  ,  ,,  ,]  ,.  ,[  ,gv  ,nR  ,/  ,J  ,9-  ,:  ,G  ,2T  ,ca  ,,2n  ,{  ,i  ,`  ,  ,A  ,L  ,<  ,  ,  ,5  ,  ,2  ,A+  ,c:  ,+U  ,R c  ,Gvq  ,  ,4  ,  ,3  ,  ,`h  ,e  ,"R  ,ʕ  ,4 ,c2% ,C3 ,TA ,O ,^ ,wn ,| ,d  ,r) , , ,2 ,A ,c , ,Ŷ ,D ,` ,A$ ,L2 ,<@ , ^ , m , | ,;l ,0} ,Vd ,iX ,  ,c  , ,U ,D ,  , ,&}) ,+:7 ,w E ,kS ,La , o ,X } ,  ,  ,,N ,E/ ,+ ,  ,< , ,֊ ,  , ,{z% ,+^3 ,rA ,O ,G)] ,-k ,%  ,2 , ,4 ,X ,H , ,` , , ,n ,~% ,h2 ,1? ,cwL ,j ,݀x ,qn , * ,H ,;  ,| , ,M ,N ,  , ,5 ,.! ,/ ,?A= ,<K ,Y ,6h ,u ,V  ,A ,U , , , ,M , N ,^ ,q- ,] ,S ,:  ,  ,   ,-& , / ,pX8 ,˥B ,9R ,X ,\e^ ,d ,!j ,p ,Rv ,q} ,. ,  , , ,a  ,ڨ ,ƨ ,Ш ,! ,  ,9 ,D ,T , ,-  ,. ,}< ,J ,-X ,Ku ,  ,= ,Y ,A) ,3 ,n  ,W) , ,% ,A ,0\ ,A)j ,x ,q ,  ,h , ,_ ,y ,* ,  ,f ,$` ,J  ,K  ,8 . ,< ,uJ ,X ,f ,Az , ,? ,x ,8 ,G  ,u ,  ,G ,D  ,b ,   ,  , ,˭ ,8@ ,.  ,W ,j ,!g ,W  ,  ,o ," $ ,s`* ,\ 0 ,b6 ,Q< ,=9B ,WH ,N ,;?T ,n[ ,;k ,vq ,w ,} ,^0 ,  , ~ ,b , , ,J  ,5 , ,< ,t( , 5 ,B ,)VO , \ ,3i ,Tv ,T ,~ ,: ,  ,z ,d  , ,  ,o  ,\_" ,K~/ ,W< ,yI ,VV ,c ,p ,={} ,y? ,: ,u , , , ,@ ,n , ,  ,  ,% ,8Y3 ,^A ,Ho ,} , ,  ,_ , , ,4[ ,o  , ,S ,g  ,f ,Hn% ,P3 ,}A ,4O , ,5 ,# /t# .# .$ .$ . $&$$9>$QU$ , f$ ,r$ ,A~$ , $ ,$ ,I$ ,I$ ,$$ ,K$ .$ .$ ,$ .+$ .%% , % .F% .B% ,% .X!% .T&% ,0% .p4% .l=%F% /tU% .Y% .d% /tm% .q% .z% .~% .% % % .% .%% /t% .% .%%" &3&32& .6& .?&3T&:f&&& /t& .& .& .& .&&& .& .& .& .& . & .&'$' .(' .1' .&5' .$>' .2B' ..K' .FO' .BT'z''p'' ,?' ,' , ' ,( ,)( ,K( ,+( ,<( ,J( ,*[( ,0h( ,T{( ,( ,T( ,? ( , ( , ( ,[( ,2 ( , ( , ) , ) ,01) ,-9) ,DF)]) .ba) .Vj) .n) .) ) /t) .) .) .) .) /t) .) .) . ) .) /t) .!) .)`  * .D * .B*$ +*H J* )fO* ,B< T* -yeX* -Re\* *j.c* ,kG * ,ES * ,% * ,Bc * ,\ * ,c * ,!@ * ,0( * ,z * ,d * ,b * ,) * ,e + ,* + ,) + ,ag ++ ,}w + ,` + , + ,c + ,* + ,a + ,yP + ,q + , + ,Q + ,K , ,y , ,' , ,N 1, ,$_ 8, ," =, ,uW I, ,eu U, ,&! a, ,vl m, ,I y, ,y , ,% , , x , ,* , , , ,1q , ,n% , ,O , ,m , ,# , ,B , ,0 - ," - ,y4 !- ,' 6- ,v D- ,dz Y- ,v g- ,O s- ,F - , k - , - ,? - ,ys - ,2 - , k - ,q - ,& . , k . ,8/ B. ,3 Z. ,;Y f. ,AL s. ,I . ,z . ,A9 . ,I . ,z . ,B . ,\ . ,ee . ,/ . , " / ,v / ,uN (/ , 6/ , k D/ ,ċ R/ ,Ή `/ ,s n/ ,BZ |/ ,H / ,, / ,J / ,Gc / ,b / ,J / ,5" / ,O# / ,\ / ,Tj 0 ,{f 0 ,s &0 ,i 40 ,? B0 ,XS P0 ,J ^0 ,4 l0 ,^ z0 , 0 ,wi 0 ,Yp 0 ,G 0 ,c 0 ,op 0 ,d 0 ,|x 1 ,m 1 ,.a 1 ,XB =1 ,U L1 ,-T [1 ,VE j1 , y1 ,rt 1 , 1 ,2 1 ,3 1 ,$( 1 ,pW 1 ,[ 1 ,, 1 ,4 2 ," 2 ,hC 2 , -2 , <2 ,L K2 ,"f Z2 , i2 ,^ x2 ,Lz 2 ,t 2 ,6 2 ,# 2 ,. 2 ,L 2 ,n 2 ,/F 2 ,; 2 ,h 3 ,/ 3 ,6 ,3 ,@ ;3 ,M J3 ,/ Y3 ,~ h3 ,jr w3 ,T} 3 ,& 3 ,6a 3 ,P_ 3 ,U 3 ,~ 3 ,+ 3 ,T 3 ,~ #4 ,m K4 ,l g4 ,S u4 ,,B 4 ,b 4 , - 4 ,q 4 ,~ 5 ,m 5 ,R 5 ,>X 5 ,, 6 ,([ (6 ,: 56 ,U B6 ,U P6 ,,B 6 ,: 6 ,U 6 ,4 6 ,se 6 ,7 6 ,7 7 ,% .7 ,8e @7 ,p9 M7 ,, g7 ,]2 t7 ,h 7 ,,B 7 ,r 7 , k 7 ,5 7 ,K 7 ,(o 7 ,|! 7 ,O 8 , 8 ,g 28 ,~a O8 ,c \8 ,M i8 ,u v8 , 8 ,z 8 ,,B 8 ,; 8 ,j 8 , 8 ,qs 8 ,V 8 ,7 8 , 9 ,, 9 ,6 9 ,t~ .9 ,y <9 ,D5 J9 ,Ӏ X9 ,k f9 ,e : ,6 : ,J : ,W : ,E ; ,d ; ,bF !; ,+# 0; ,u/ ?; ,ND N; ,c ]; ,+ l; ,% {; ,% ; , ; ,7^ ; ,? ; , j ; ,Nl ; ,X ; ,e ; ,u9 < ,\ < ,0 < ,z /< ,8 >< ,; M< , k< ,q z< ,Z] < , < ,}C < , < ,^ < ,3 < ,& < , < ,tg = ,{ = ,>3 #= ,8 3= ,~i C= , S= ,~ c= ,{ s= ,H = ,{ = ,u = ,0 = ,H = ,& = ,e4 = ,' = ,7 > ,hl > ,F /> ,7- >> , $ M> ,U \> ,;j k> ,L- z> ,Qm > ,e > ,/z > ,8q > ,M > ," > ,]j > , # > ,J) ? ,D` ? ,W ? ,4 .? ,K =? ,PI L? ,;g [? ,A# j? ,\ y? ,r7 ? ,! ? ,`h ? ,x ? ,&m ? ,) ? ,b ? ,~ ? ,b @ ,5 @ ,-u @ ,0P .@ ,̅ =@ , L@ ,D [@ ,8$ j@ ,N @ ,\$ @ ,2 @ ,7t @ ,; @ ,; @ ,Q @ ,mm @ ,r @ , A ,@ A ,B ,A ,5 ;A , JA , YA ,D hA ,IA wA ,a A ,| A ,y A ,] A ,i A ,ֆ A ,R3 A ,1 A ,!J A ,k B ,gg B ,f3 +B ,=E :B ,2 IB ,G XB ,Q! gB ,. vB ,f: B ,[ B ,Dh B , B ,r B ,` B , B ,?_ B ,N^ B ,Y C ,@ C ,4T *C ,: 9C ,p HC ,L WC , fC ,;p uC ,\ C ,h` C ,f C ,Ai C ,4 C , C ,O C ,l C ,fX C ,_ D ,<, D ,od )D , 0 8D ,w GD ,Vs VD ,N[ eD ,u tD ,| D ,D D ,+ D ,9V D ,x D ,MY D ,h' D ,w D ,E D ,: E ,T E ,zE )E ,o 8E ,s GE , VE ,C fE ,j uE ,‰ E ,` E ,e E ,@ E ,X E , E ,X E ,օ E ,V E ,=} F ,"q F ,8 )F ,% 8F ,3 GF ,I VF ,7o eF ,L tF ,( F ,w F ,U F ,H F ,T# F ,.G F ,* F ,t F ,D[ G ,*Y G ,l )G ,d 8G ,$1 GG , V VG , eG ,e tG ,d G ,X9 G , G ,`K G ,x G ,ME G ,@~ G ,B" G ,Bv G ,} H ,E8 H ,c\ ,H ,,2 ;H ,7I KH ,: ZH ,7 pH ,u H , H ,e H ,|' H , X H ,qk H ,s H ,/ I ,D $I ,tx 2I ,}r @I ,R NI ,W \I ,- lI ,$ zI ,\~ I ,zL I ,e I ,S I ,pR I ,L I ,Y J ,Ɓ #J ,2M 1J ,49 EJ ,2 SJ ,^ aJ ,H oJ ,V ~J ,Jp J ,Z J ,D J ,D J ,_ J ,R J ,w J ,`} J ,t J ,P~ K ,2. "K ,$ /K , FK ,SL SK ,j K ,F K ,%k K ,l K ,E K , 2 K ,Mn L ,W: L ,.m L ,Ag *L ,ކ 7L ,)$ JL ,^ RL ,q ZL ,HK gL ,V uL ,Ne L ,) L ,c L , o L ,vU L ,h9 L ,A L ,, L ,f L ,Z M ,8/ M ,} "M ,! 0M ,? >M ,! VM ,݊ bM ,3O oM ,-A |M ,P M ,= M ,9 M ,V M ,W M ,8 M ,, M ,q M ,v N ,C N ,h N ,R N ,f "N , ! O , LO ,Uo ZO ,n hO ,W" vO ,++ O ,z O ,jB O ,D O ,; O ,^* O ,E O ,q O ,P O , P ,g P ,Mu P ,A; ,P ,S :P ,c HP ,+Q VP ,Y dP ,v rP , P ,\ P ,Q P , P ,! P ,O P ,"U P ,o P ,| P ,I P ,@ Q ,, Q ,@O -Q ,4) :Q ,! GQ ,, UQ ,;7 bQ ,5f Q ,,B Q ,? Q ,6 Q ,* Q ,Y Q ,8/ Q ,X Q ,& R ,} R ,\ "R ,; /R ,i Z ,E QZ ,_ ]Z ,hj iZ ,^* vZ ,hl Z ,G Z , Z ,, Z ,u& Z ,( Z ,( [ ,5P [ ,8 [ ,+w ![ ,L9 '[ ,_ .[ ,L 3[ ,Rw @[ ,A N[ ,pa X[ ,x e[ ,9 s[ ,D [ ,j [ ,Wt [ ,L [ ,6 [ ,V [ ,7 [ ,2e [ , \ ,W: \ ,/i )\ , T 6\ ,h C\ ,!{ P\ ,4 ^\ ,; k\ ,^R x\ ,_ \ ,5y \ ,3r \ ,; \ ,Ȋ \ ,3r \ , \ ,VX \ ,H \ ,b7 ] ,a ] ,3r ] ,1H 0] ,nM 6] ,- =] ,9i J] ,H X] ,g. e] ,= r] ,9 ] ,5" ] ,S` ] ,2 ] ,X ] ,J ] ,E. ] ,+ ] , ^ ,T ^ ,u| (^ , 5^ ,4Y H^ ,Z U^ , b^ ,b7 o^ ,= |^ ,, ^ ,a ^ , ^ ,̂ ^ ,q ^ ,4 ^ ,pR _ ,s _ , _ ,# ,_ ,2E 8_ ,Q E_ , R_ ,c `_ ,օ m_ ,* z_ ,<< _ ,΀ _ ,T _ ,l _ ,e _ ,S _ , Q ` , ` ,w (` ,p 5` ,A J` ,8 W` ,sb n` ,F {` ,# ` , ` ,/ ` ,8 ` ,sb ` , ` ,8 ` ,sb ` ,=' a ,0 a ,} (a ,B 5a ,mx Ba ,b Ya ,+8 fa , 9 }a ,8 a ,1^ a ,mz a ,r a ,`+ a ,I a ,W a ,:f a ,O b ,V 5b ,D Bb ,M Ob ,Oq ]b ,j/ jb ,< vb ,* b ,X b ,bV b ,w+ b ,%7 b , b ,b# b ," b ,SA b ,X; c ,u; c ,Y 'c ,e 4c ,O# Ac ,; Oc ,L \c ,-D ic ,z vc , c ,K c ,Z c , j c ,4} c ,4Y c ,k c ," c ,S d ,/S d ,p9 "d ,4Y /d ,` =d ,P/ Jd ,U Wd ,* dd ,z rd ,| d ,a d ,I d ,l d ,l d ,/ d ,9S d , d ,ci d ,H d ,D e ,) e ,'V e ,d *e , He ,b Ue ,ne ce ,2e pe ,` ~e ,w e ,+ e ,r e ,'F e ,, e , % e ,zE e ,G% f ,`8 f ,1, f ,_N *f ,G% 8f ,5 Df ,i Qf ,G% _f ,8 tf ,G% f ,c f ,{ f ,@ f ,m~ f ,PI f ,W f ,4 g ,c g ,85 +g , 1g ,O 7g ,~ =g ,z Cg ,$ Jg ,;g Xg ,G% fg , W tg ,5" g ,W g ,4 g ,K g ,z g ,4 g ,W g ,={ g ,Js h ,4 h ,g h ,C -h ,m ;h ,; Ih ,Z Wh ,b eh ,xJ sh ,?D h ,\b h , i h ,Q h ,Y h ,TQ h ,N h ,_ h ,d h ,_C i , i ,Og i ,x +i ,}G 9i ,h Gi ,u Ui ,Y ci ,* qi ,;[ i ,.$ i ,( i ,I i ,m i ,)\ i ,- i ,a! i , i , i ,;r j ,E j ,+ 'j ,a 5j ,B Cj ,c* Qj ,8& `j ,NG oj ,=c }j ,I j ,(h j ,M] j ,fW j ,O j ,on j ,s j ,[ j ,W j ,C k ,;T k ,, &k ,J 4k ,L Bk ,@ Pk ,] ^k , lk ,U zk ,lb k ,Lm k ,? k ,lb k ,FX k ,$ k , N k ,] k ,|H l ,on l ,e~ %l ,2 9l ,a _l ,Uu ml ,; |l ,T. l ,J l ,c l ,6; l ,h l ,c l ,(h l ,, l ,Ɉ l ,H m ,F m ,O ,m ,Dl ) n ,/ n , k n ,D[ n ,1 n ,W n ,n n ,8 o ,9 o ,R (o , 6o , Do ,z Ro ,s `o ,4 no ,U2 |o ,a o ,] o ,, o ,( o ,O o , | o ,~ o ,t o ,<< p ,? p ,c %p ,,9 ?p ,8 Lp ,r Yp ,s sp ,_. p ,J0 p ,v p ,mt p ,5 p , p ,y q ,n q ,ht q ,̈́ +q ,Xd 8q ,lD Eq ,b@ Rq ,|R _q ,u% lq ,T yq ,U q ,C q ,) q ,Eo q ,N q ,W q ,/ q ,e q ,ȇ q ,is q ,Y r ,} 3r , @r ,i Tr ,A0 nr ,ȇ {r ,e r ,6s r ,L r ,j r ,` r ,5" r ,, s ,p s ,̅ s , *s ,]B 4s , >s ,7t Hs ,4 Vs ,o cs ,q$ ps ,[ }s ,nH s ,, s ,~ s ,jU s ,8] s ,1 s ,g s ,P s ,<( s ,+ s ,, t ,a t ,9 (t ,bY 7t ,` Dt ,'} Qt ,'< ^t ,o lt , t ,( t ,) t ,| t ,A# t , t ,ǀ t ,[ t ,Q u ,W u ,4 u , -u ,eb ;u ,K Iu ,u Wu ,PI eu ,\ su ,r7 u , u ,# u ,x u ,&m u ,, u ,2g u ,: u ,54 u ,%a u ,Z v ,g v ,V )v ,[ 7v ,/L Ev ,c Sv ,6 av ,Q" ov ,6~ }v ,g v ,v v ,P% v ,B v ,` v ,o v , I v ,, v , v ,<< w ,P w ,y ,w , 6w , @w ,f3 Jw ,# Tw ,2 ^w ,G kw ,M xw ,~} w ,uR w ,c w ," w ,wA w ,q w ,v w ,Q! w ,B\ w , < w ,F x ,O# x , &x ,N :x ,a Tx ,=/ ^x ,O hx ,+ x ,R@ x ,(] x ,; x ,. x , % x ,wQ x ,5" x , x ,G y ,q0 y ,.- y ,\ +y ,D >y ,[ Hy ,y Ry , \y , fy ,: py ,& }y ,G y ,` y ,[, y ,S y ,z y ,N y ,+ y ,[ y ,E y ,: y ,F z ,2x z ,C &z ,{3 3z ,9+ @z ,m Mz ,^q Zz ,_ vz , z ,8/ z , z ,h z ,h z ,{ z ,Ä z ,. z ,| z ,\ { ,Y { ,K "{ ,i /{ , <{ , f{ ,G r{ ,0 { , n { ,%- { ,n { ,2 { ,0K { ,a { ,_ { , { ,_ { ,D- | ,# | ,4l >| ,t e| ,` r| ,U | ,B | ,Gu | ,c | ,6 | , | ,c | ,4 | ,f | , | ,L( } ,v$ } ,AP ,} ,26 9} ,c F} ,eQ T} ,U `} ,T l} ,Qv x} ,S } ,) } ,M } ,y } ,z } ,s } ,* } ,{[ } ,_` } ,I ~ ,A ~ ,<< ,~ , F~ ,W: S~ ,/i a~ ,L m~ ,B6 y~ ,3d ~ ,EW ~ ,YO ~ ,G ~ ,c ~ ,I ~ ,t6 ~ ,a ~ ,  ,  ,8/  ,J\ ( ,ne 5 ,R \ ,ņ k , x ,eQ  ,W  ,!  ,!]  ,,  ,!n  , z  ,")  ,g , ,c : ,~ G ,jc T ,5 a ,M n ,*4 { ,ne  ,4C  ,z  ,{  ,(  ,c  ,O  ,w  ,5 " ,2 / ,_ < ,] O , \ ,| v ,;  ,f  ,  ,H  ,?  ,w# ʁ ,-7 ׁ ,c  ,`  ,Cq  ,jc  ,5  ,ى % ,O 2 ,1 ? ,D L ,j Y ,H f ,' s , t  ,A  ,x-  ,h  ,"  ,ne ł ,e  , (  ,F  ,$ & ,a: 3 ,o @ , W , d ,o { ,fk  ,o  ,q  ,}  ,\ ă ,w  ,  ,D  ,})  ,T ! ,^ / ,R @ ,AH F ,# L ,a0 R ,* Y ,# j ,$x p ,\r v ,e | ,  ,  ,5"  ,|  ,GJ  ,GJ ˄ ,)K ؄ ,M  ,3  ,D!  ,$ - , : ,8/ G ,7 T , a , n ,vZ { , k  ,C  ,'  ,!o  ,g;  ,?t  ,?t  ,Y'  ,c " ,<< / ,O# < ,lV S ,&R ` , ~ m ,i5  ,,  ,c  ,<@  ,}  ,t Ȇ ,l Ն ,׃  ,.  ,}  ,  ,` ! ,a . ," ; ,`) H ,.a U , b ,$ o ,p | ,OH  ,7  ,d  ,Fy  ,p  ,c ʇ ,j ׇ ,-  ,b(  ,8  ,r  ,{ F ,R R ,M h ,+ t ,~l  ,_  ,}  ,w\ ӈ ,K  ,#  ,  ,NB  , % ,+ 2 ,} @ ,=Q f ,& | ,U  ,Z  ,Y ʼn ,r Ӊ ,{  ,}  ,E . ,, B ,_ P ,+ d ,Z r ,]2  ,h  ,p9  ,+{ Ŋ ,2 ӊ ,8  ,&*  ,u  ,rF  , @ ) ,e B ,4{ P ,2 ^ ,]A l ,w z ,}.  ,J  ,e[  ,;h  ,d  ,e  ,y  , % ,} 3 ,Z) A ,n| O ,%5 ] ,, k ,4 y ,t  ,  ,  ,%g  ,P  ,Zg ӌ ,`  ,&  ,z  ,}  ,K  ,' 4 ,2. Q ,T [ ,[w i ,) w ,\  ,  ,c  ,2  ,]-  ,, ͍ ,X5 ۍ ,]D  , Y  ,oh  ,Cs . ,& G ,s T ,fE { ,Dj  ,Z  ,1  ,zE  ,΀ ܎ ,=4  ,  ,O#  , + , M ," [ ,G i ,A@ w ,#  ,7*  ,<  ,=B  ,u ˏ ,J ُ ,b  ,>e  ,2'  ,7  ,&  , - ,RV ; ,+n I ,Bk W , e ,W\ s ,q  ,3  ,+y  ,1h  ,)  ,: ͐ ,@ ܐ ,U  ,F  ,zm  ,W  ,F ' ,( 6 ,ǃ E ,r! c ,50 r ,,  ,|  ,#  ,.  ,BE  ,6_ ̑ ,U ۑ ,}  ,,  ,3  ,~  , & ,is 5 ,M D ,NJ S , b ,{ q ,<,  ,i  ,  ,g;  ,)  ,P ˒ , ڒ ,z  ,J  ,v  ,F < ,EV F ,_ U ,<: _ ,78 x ,@  ,k  ,k  ,Z  ,O Γ ,1 ۓ ,y  ,3  ,1  ,y $ ,S 0 ,3 < ,Dž H ,i T ,T ` ,J w ,S  ,u  ,T  ,  ,]  ,y  ,<<  ,<  ,\  ,C , ,| 9 ,| F ,d S , ` ,V m ,h  ,-d  ,;  ,Ѓ  ,,5  ,} ͕ ,F ە ,*l  ,R  ,ys  ,m " , k / ,q P ,c ] ,<< s ,'E  ,L  ,$O ̖ ,- ٖ ,Z`  ,\  ,4  ,d 0 ,S < ,] H ,pv U ,[ b ,# o ,^% | ,;  , P  ,M  ,#  ,:  ,}N ʗ ,+P ח ,r  ,L2  ,f  ,E'  ,1 7 ,, F ,s T ,p b ,L p ,G] ~ ,P;  ,vY  ,q  ,d5  ,&P Ę ,: Ҙ ,Q  ,+  ,}]  ,J  ,A|  ,'r , ,Z : ,? H ,5k V ,Y& d ,j+ r ,M  ,Ќ  ,g  ,N  ,DY  ,1 ƙ ,ֈ ԙ ,Ya  ,|t  ,2  ,'  ,8  ,{ ( ,B 6 ,k D , S ,& b ,| y ,FI  ,e  ,fM  ,Qi  ,{ Ě ,y ښ ,$9  ,Kw  ,&p  ,sS  ,c - ,g2 < , ,΋ D ,4 J ,-J P ,m V ,$ ] ,Ձ l ,{ z ,f6  ,K&  ,,  ,Q  ,s:  ,9  ,  ,(C  ,@2  ,n  ,cT , ,ڄ : , H ,l V ,T d ,4 r ,o  ,I~  ,  ,/@  ,0  ,~W  ,7  ,h  ,A  ,l-  ,0  ,zX  , ( ,. K ,w Z ,# s ,v  ,t  ,/  , g  ,l)  ,G;  ,P  ,F ' ,G 5 ,AJ R ,r  ,.  ,d{  ,]  ,(  , ] ,La  ,A x ,iw  ,m  ,n  ,l  ,0  ,,!  ,~  ,6  ,un  ,[  ,.~  ,\  ,  ,U  ,J  ,L + ,) 8 ,m@ G ,) V ,2 e ,]I t ,]y  ,x  ,@  ,L  , k  ,\  ,,t  ,!  ,^  ,y*  ,4:  ,  ,J ' ,B 4 ,Uq A ,RC O ,T [ ,y h , W u ,;j  ,d  ,X  ,C  ,p  ,!  ,<<  ,u|  ,U  ,\  ,$O ( ,, 5 , T ,m a ,q  ,oT  ,  ,`  ,tz  ,]  ,  ,Mu  ,G  ,V  ,=y  ,$d % ,W" 3 ,tu A ,& O ,++ ] ,^* k ,P y ,n  ,f  ,v  ,)  ,{  ,P  ,}  ,  ,m  ,2e # ,[c 1 ,SZ ? ,O# M ,n [ ,tu i ,WN y ,;  ,D  ,g  ,Of  ,R  ,q  ,u5  ,,B  ,{  ,6  ,\"  ,s  ,~ < ,- P ,p ] ,\ j ,  ,5  ,1  ,K'  ,)  ,`  ,}  ,4  ,W"  ,P  ,++  ,|Y  ,n & ,P f ,  t ,@  ,(~  ,J  ,O#  ,Y  ,<;  ,@  ,R + ,Mu 8 ,  E ,O* R ,*Z _ ,n l ,M  ,C  ,  ,Bu  ,2 2 ,T r ,!  ,q  ,\  , E  ,H4 , ,\ S ,L ` ,? m ,,  ,s  ,&  ,  ,W  , E ,A b ,* o ,H  ,/  ,5f  ,|U  , M  ,0  ,0N  ,&v  ,U  ,<; ( ,, A ,> O ,b Y ,E f ,) s ,@  ,(~  ,h|  ,z  , B 9 ,)s J ,] P ,P V ,y7 \ ,L7 c ,K  ,H  ,8M  ,&c  ,p  ,Y  ,  ,  ,\  ,>N  ,-  ,o[  ,Z  ,9  ,:  ,c  ,` - , ; , I ,52 W , e ,1+ y ,I  ,$  ,^  ,J{  ,v  ,; " 4R , ] { ,r^   ,4G   ,Ht  ,1B  )l ,  -/m -m *1 ,F  ,  ,  ,  ,  ,b ! , ( , 4 ,X B , I , ` ,Z g , n , s ,4  ,\  ,  ,  ,  ,  ,  ,  ,  ,*  ,M  ,O  ,  ,  ,3  ,O # , 0 ,c = ,Ù J ,u W , d , q ,O ~ ,ɑ  ,  ,)  ,v  ,  ,  ,h  ,  ,K  ,  ,  ,  , $ ,v 1 ,ԍ = , I ,، U , a , m ,V z ,q  ,D  ,  ,  ,  ,  ,  ,0  ,C  ,ѐ  ,  ,ǘ  ,  ,  ,^  ,U  , $ , * ,o 0 ,p 6 , < ,s B ,Í I ,͓ Y , _ , e ,? w , } ,  ,  ,  ,9  ,6  ,  ,  ,Ï  ,˒  ,  ,9  ,'  ,u  ,  ,Տ  ,b  ,7  ,)  ,Y  , , , 9 ,ܒ J ,M P , V ,h \ , b , h ,A n ,= t , z ,)  ,B  ,I  ,p  ,  ,  ,I  ,p  , ( ,ē 4R , ^ | ,Վ  " -E& -l* -. -2 -6 -: -> -B -F -J -!N -<R -RV -iZ -{e -j -o -t -y -~ - - - - - -  - - -# -. -< -D -L -Q -Z -` -g -y - - - - - - - - - -  - -$ -, -6 -B# -N( -a- -q2 -|7 -< -A -F -K -P -U -Z -_ -d -i -n -s -x -} - -) -7 -? -K -\ -k -v - - - - - - - - - - - - - -& -. -6 -C -L -X -d  -j -x - - -" -' -, -1 -6 -; -@ -E - J -O -)T -GY -\^ -qc -xh -m -r -w -| - - - - - - - - - - - -  -, -< -G -N -Y -c -t -z - - - - - - - - -  - - - -! -& - + -0 -(5 -2: -9? -BD -KI -YN -`S -lX -v] -b -g -l -q -v -{ - - - - - - -  -  -  -*  -0  -9  -F  -O  -X  -^  -e  -n  -t  -  -  -  -  -  -  -  -  -  -  -  -  -  -  -( % -3 * -= / -F 4 -S 9 -_ > -k C -y H - M - R - W - \ - a - f - k - p - u - z -  -  -  -%  -2  -E  -O  -b  -m  -  -  -  -  -  -  -  -  - 1Ly - } -?  -R  -b  -q  -  -  -  -  -  -  -  -%  -<  -S  -a  -s  -}  -  -  -  -  -  -  -  -  -  -  -  - -  - -! -2 -= -H$ -V) -^. -f3 -k8 -t= -B -G -L -Q -V -[ -` -e -j -o -t -y -%~ -. -: -M -] -h -t -| - - - - - - - - - - - -  - - -' -1 -; -C -O -_ -h  -v - - - -# -( -- -2 -7 -< -A - F -K -(P -6U -FZ -W_ -hd -si -n -s -x -} - - - - - - - -, -3 -C -R -X -e -l -r -| - - - - - - - - - - - -  - -  - -% --" -5' -G, -M1 -]6 -h; -o@ -yE -J -O -T -Y -^ -c -h -m -r -w -| - - - - -  - -  -* -9 -B -J -O -[ -a -j -r -{ - - - - - - - - - - - -  - -  - -$! -3& -:+ -C0 -S5 -]: -h? -rD -zI -N -S -X -] -b -g -l -q -v -{ - - -! -1 -; -F -P -Y -g -t - - - - - - - - - - - - - -! -3 -? -N -[ -n  -x - - -  -% -* -/ -4 -9 -> -C -H - M -W].4 -g4 -4 -4 -4 -4 -4 -4 -4 -4 -84 -N4 -c4 -~4 -4 -4 -4 -4 -4 -4 -4 - 4 - 5 -) 5 -45 -@5 -I5 -T5 -^"5 -h'5 -,5 -15 -65 -;5 -@5 -E5 -J5 -O5 -T5 -Y5 -^5 -c5 -h5 -m5 -r5 -w5 -|5 -#5 -(5 -15 -C5 -S5 -c5 -x5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 - 5 -5 -%5 -15 -75 -@5 -H5 -T5 -d6 -o6 - 6 -6 -6 -6 -!6 -&6 -+6 -06 -56 -:6 -?6 -D6 -I6 -N6 -S6 -X6 -+]6 -4b6 -Bg6 -Nl6 -Zq6 -fv6 -l{6 -w6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -#6 -46 -?6 -L6 -T6 -]6 -k6 -u6 -6 -6 -6 -6 -6 -6 -6 -7 -7 - 7 -$7 -17 -87 -> 7 -H%7 -Q*7 -W/7 -`47 -l97 -z>7 -C7 -H7 -M7 -R7 -W7 -\7 -a7 -f7 -k7 -p7 -u7 -z7 - 7 - 7 -# 7 -* 7 -4 7 -E 7 -K 7 -R 7 -] 7 -b 7 -o 7 -w 7 - 7 - 7 - 7 - 7 - 7 - 7 - 7 - 7 - 7 - 7 - 7 - 7 - 7 - 7 -!8 -!8 -! 8 -!8 -%!8 -.!8 -8!8 -B!$8 -K!)8 -S!.8 -Z!38 -e!88 -r!=8 -!B8 -!G8 -!L8 -!Q8 -!V8 -![8 -!`8 -!e8 -!j8 -!o8 -!t8 -!y8 -"~8 -"8 -"8 -%"8 --"8 -6"8 -B"8 -U"8 -a"8 -j"8 -p"8 -"8 -"8 -"8 -"8 -"8 -"8 -"8 -"8 -"8 -"8 -#8 - #8 -#8 -'#8 -3#8 -?#9 -M#9 -^# 9 -p#9 -v#9 -#9 -#9 -##9 -#(9 -#-9 -#29 -#79 -#<9 -#A9 -#F9 -$K9 -$P9 -!$U9 -+$Z9 ->$_9 -I$d9 -]$i9 -f$n9 -n$s9 -w$x9 -$}9 -$9 -$9 -$9 -$9 -$9 -$9 -$9N , -(%0 -O%4 -b%8 -q%< -%@ -%D -%H -%L -%P -%T - &X -'&\ -6&` -L&d -c&h -q&s -&x -&} -& -& -& -& -& -& -& -& -& -& -' -' -' -#'Ý -+'ȝ -3'͝ -<'ҝ -A'ם -J'ܝ -\' -l' -|' -' -' -' -' -' -' -' -' -' -' -(" -(' -#(, -3(1 ->(6 -J(; -R(@ -^(E -n(J -y(O -(T -(Y -(^ -(c -(h -(m -(r -(w -(| -( -( -( -) -) -) --) -9) -E) -K) -V) -g) -v) -)ž -)Ǟ -)̞ -)ў -)֞ -)۞ -) -) -* -* -* -+* -3* -<* -J* -T* -c* -t* -* -*! -*& -*+ -*0 -*5 -*: -*? -+D -+I -+N -+S -'+X -0+] -6+b -?+g -K+l -Y+q -b+v -o+{ -y+ -+ -+ -+ -+ -+ -+ -+ -+ -+ -+ -+ -+ -, -,Ɵ -,˟ -$,П -5,՟ -;,ڟ -B,ߟ -M, -R, -X, -^, -e, -n, -{, -, -, -, -, -, -, -,% -,* -,/ -,4 -,9 -,> -,C -,H --M --R --W -#-\ -,-a -4-f -;-k -F-p -S-u -b-z -l- -s- -- -- -- -- -- -- -- -- -- -- -- -. - .Š -.ʠ -.Ϡ -'.Ԡ -0.٠ -<.ޠ -O. -[. -d. -j. -y. -. -. -. -. -. -. -. -. -.$ -.) -/. -/3 -!/8 --/= -9/B -G/G -X/L -j/Q -p/V -y/[ -/` -/e -/j -/o -/t -/y -/~ -/ -/ -/ -0 -0 -%0 -/0 -B0 -M0 -a0 -j0 -r0 -z0 -0ġ -0ɡ -0Ρ -0ӡ -0ݡJF & -0* -1. -212 -A16 -Q1: -l1> -1B -1F -1J -1N -1X -1] -1b -1g -2l -2q -2v -*2{ -52 -C2 -K2 -S2 -\2 -h2 -s2 -}2 -2 -2 -2 -2 -2 -2 -2 -2 -2 -2 -2 -2 - 3 -3 -3 --3 -93 -A3ji -3m -3q -3u -3y -3} -3 -4 -.4 -D4 -Y4 -t4 -4 -4 -4 -4 -4 -4 -4 -5 -5 -5 -.5 -55 ->5 -F5 -Z5 -e5 -n5 -y5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5" -5' -6, - 61 -66 -#6; -+6@ -06E -96J -K6O -[6T -k6Y -6^ -6c -6h -6m -6r -6w -6| -6 -6 -6 -6 -6 -7 -"7 --7 -97 -?7 -H7 -P7 -\7 -l7 -w7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -8 -8 -8 -!8 --8 -=8! -F8& -T8+ -`80 -l85 -x8: -~8? -8D -8I -8N -8S -8X -8] -8b -8g -9l -9q -$9v -59{ -F9 -Q9 -^9 -f9 -o9 -}9 -9 -9 -9 -9 -9 -9 -9 - : -: -!: -0: -6: -C: -J: -P: -Z: -c: -i: -r: -~: -: -: -: -: -: -: -: -:% -:* -:/ -:4 -:9 -;> -;C -;H -);M -9;R -D;W -K;\ -U;a -f;f -l;k -s;p -~;u -;z -; -; -; -; -; -; -; -; -; -; -; -; -; -; - < -< -%< -,< -:< -A< -M< -W< -b< -q< -< -< -< -< -< -< -< -< -< -<$ -<) -=. - =3 -=8 - == -&=B -,=G -5=L -B=Q -Q=V -c=[ -l=` -t=e -=j -=o -=t -=y -=~ -= -= -= -= -= -= -= -> -> -> -%> -.> -<> -I> -U> -c> -t> -~> -> -> -> -> -> -> -> -> -> -> -> -? -? -+? -8?# -K?( -U?- -h?2 -s?7 -?< -?A -?F -?K -?P -?U -?Z -?_ -?d -?i -?n -?s -?x -@} -@ - @k6' 4 -p@4 -@4 -@4 -@4 -@4 -@4 -@4 -A4 -(A4 -=A5 -LA5 -gA 5 -}A5 -A5 -A5 -A"5 -A'5 -A,5 -A15 -A65 -A;5 -A@5 -BE5 -'BJ5 -0BO5 -7BT5 -ABY5 -LB^5 -WBc5 -]Bh5 -fBm5 -rBr5 -|Bw5 -B|5 -B5 -B5 -B5 -B5 -B5 -B5 -B5 -B5 -B5 -B5 - C5 -C5 -.C5 -@C5 -IC5 -VC5 -fC5 -tC5 -C5 -C5 -C5 -C5 -C5 -C5 -C5 -C5 -C6 -C6 -D 6 -D6 -D6 -&D6 -/D!6 -;D&6 -DD+6 -LD06 -WD56 -gD:6 -tD?6 -}DD6 -DI6 -DN6 -DS6 -DX6 -D]6 -Db6 -Dg6 -Dl6 -Dq6 -Dv6 -D{6 -E6 - E6 -E6 -#E6 -/E6 -5E6 -@E6 -NE6 -\E6 -kE6 -~E6 -E6 -E6 -E6 -E6 -E6 -E6 -E6 -E6 -E6 -F6 -F6 -F6 --F6 ->F6 -\F6 -gF7 -wF7 -F 7 -F7 -F7 -F7 -F 7 -F%7 -F*7 -F/7 -F47 -F97 -F>7 -GC7 - GH7 -GM7 -#GR7 -,GW7 -9G\7 -CGa7 -IGf7 -RGk7 -dGp7 -lGu7 -~Gz7 -G7 -G7 -G7 -G7 -G7 -G7 -G7 -G7 -G7 -G7 -G7 -G7 -H7 -H7 -H7 - H7 -%H7 -2H7 -:H7 -LH7 -RH7 -XH7 -_H7 -hH7 -sH7 -yH7 -H8 -H8 -H 8 -H8 -H8 -H8 -H8 -H$8 -H)8 -H.8 -H38 -H88 -H=8 -HB8 -IG8 -IL8 -IQ8 -IV8 -(I[8 -5I`8 -DIe8 -KIj8 -YIo8 -`It8 -lIy8 -vI~8 -I8 -I8 -I8 -I8 -I8 -I8 -I8 -I8 -I8 -I8 -I8 -I8 -J8 -J8 -#J8 -)J8 -8J8 -JJ8 -SJ8 -\J8 -eJ8 -{J8 -J8 -J8 -J8 -J9 -J9 -J 9 -J9 -J9 -J9 -J9 -K#9 -K(9 -)K-9 -/K29 -8K79 ->K<9 -OKA9 -[KF9 -gKK9 -qKP9 -zKU9 -KZ9 -K_9 -Kd9 -Ki9 -Kn9 -Ks9 -Kx9 -K}9 -L9 -L9 -L9 -%L9 -.L9 -6L9 -BL9 -JL9 -TL9 -_L9 -iL9 -qL9 -L9 -L9 -L90+ -L -M -&M -6M -MM -dM -sM -Mĭ -Mȭ -M̭ -MЭ -Mԭ -Nح -Nܭ --N -;N -MN -dN -mN -vN -N -N -N  -N -N -N -N! -N& -N+ -N0 -O5 -O: -%O? --OD -8OI -EON -KOS -TOX -^O] -lOb -qOg -~Ol -Oq -Ov -O{ -O -O -O -O -O -O -P - P -P -P -%P -2P -7P -@P -IPƮ -UPˮ -hPЮ -xPծ -Pڮ -P߮ -P -P -P -P -P -P -P -P -Q  -$Q --Q -=Q -KQ  -QQ% -eQ* -sQ/ -Q4 -Q9 -Q> -QC -QH -QM -QR -QW -Q\ -Qa -Qf -Qk -Qp -Qu -Rz - R -R -&R -4R -@R -LR -XR -^R -iR -zR -R -R -R -R -Rů -Rʯ -Rϯ -Rԯ -Sٯ -Sޯ -&S -1S ->S -FS -OS -]S -gS -vS -S  -S -S -S -S -S$ -S) -T. -T3 -T8 -T= -#TB --TG -6TL -\& -N\& -c\& -u\' -~\' -\ ' -\' -\' -\' -\ ' -\%' -\*' -\/' -\4' -\9' -]>' -]C' -]H' -$]M' -0]R' -@]W' -K]\' -_]a' -m]f' -{]k' -]p' -]u' -]z' -]' -]' -]' -]' -]' -]' -]' -]' -]' -]' - ^' -^' -^' -(^' -9^' -H^' -V^' -d^' -s^' -^' -^' -^' -^' -^' -^' -^' -^( -^( -_ ( -_( -_( -&_( -5_( -F_$( -d_)( -o_.( -_3( -_8( -_=( -_B( -_G( -_L( -_Q( -_V( -_[( -_`( -_e( -`j( -`o( -`t( -`y( -+`~( -4`( -A`( -K`( -Q`( -\`( -n`( -u`( -`( -`( -`( -`( -`( -`( -`( -`( -`( -`( -`( -`( -a( - a( -a( -a( -$a( -*a( -0a) -7a) -@a ) -Ia) -Va) -ca) -ka) -va#) -|a() -a-) -a2) -a7) -a<) -aA) -aF) -aK) -aP) -aU) -aZ) -a_) -ad) -ai) -an) -bs) -bx) -b}) -"b) -)b) -4b) -Ab) -Pb) -Zb) -ab) -ob) -vb) -b) -b) -b) -b) -b) -b) -b) -b) -b) -b) -b) -c) - c) -c) -c) -*c) -=c) -Ic* -Rc * -Xc* -gc* -yc* -c* -c"* -c'* -c,* -c1* -c6* -c;* -c@* -cE* -cJ* -dO* -dT* -dY* -)d^* -:dc* -@dh* -Idm* -Odr* -`dw* -ld|* -xd* -d* -d* -d* -d* -d* -d* -d* -d* -d* -e* -e* -e* -$e* --e* -5e* -Ae* -Le*. -e. -e. -e. -e. -f. -f. -(f. -?f. -Vf. -qf. -f. -f. -f. -f. -f. -f. -f. -f. -f. -f. -f. -f. -g. -g/ -g/ -g / -/g/ -?g/ -Jg/ -Wg/ -cg#/ -kg(/ -wg-/ -g2/ -g7/ -g +2X> > +2>> +2>> +2>2> +2>$? +?(?|? +??? +??p? +??$@ +?(@ p5Z* 5B Q ` o ~  9c}66X,U~ .q `{@ (Gf ,Idt.HaPPP P= P P P PQ  @ (p    nD nw n n n n n* n: I X n    >M^1z0@@Ntn0Rq x-SrETcr (.@ (.@ (.@ (.@'?L (.@V (.@a{ (.@ (.@ (.@0]0400(zLGGq%k,Ubbbqjj.=S )Ogw `!<@`v<`<`r<DW`<H.`<F +<p        & W !&!W-!&;!WN!&[!Wk!?z!?!?!D! ! " K"""7#o#$C$>$%>%>b&>#'>_'%'''!'5(!(K(())5)?`)u)y*y4*yc*y*P*P*P***yL+y+y+y+ ,=,p,,,,,, -%1-%-- -W .* ;.* T.* c. . .O .O .W .0N/l/0//;/0~80mG0V00y0000 1*1K1o1111122$232D2U2c2x22223*3N3s33333334 (p]4 (p]484R4_4 (p]k4 (p]v4444 (p]4 (p]444 (p]5 (p] 5 (p]5;5Z5v5` 5` 5` 6 6f6 7fO7 7 8f[8 q8 8 8 8 8 8 8 8 8 8 9 29X 9f9X :f7:{ :f: :: :; Q;l ;f; ;*<- u<<c< << < = = (=5=H= V=i= w== = = = =- = > > .> @> Q> c> s> > >m >m >m >m >m >m ?m *?m ;?m R?J c? t? ? ? ?P?_??@6@U@s@?@C@CACAC8ACXACAKACACACACACACACBKB%B:B_BnB}BBBBBBBBC)Cp CCp C+Dp DDp DD E %E 8E [E jE+yE+E EKE0 FIF $FI6FIFFIXFIpFIFIFIFIFIFIGJ=G8G8%H8H8H8IQI9mIIF9J8BJ8pJ8JbK:tK8K:L81L:aL:L8L:L9M9SAOSA^SAmSA|SASASASSSS ST,T1>WT8{T1>T8TK>U8&U>7U>YU?U8U>>U>>UK>UT>Uy>Uy>Uy>Vy>V}>!V4V}>IVXV>gV>xV>V>V>V>V>V>V>VW> WW>:W>{WkCW>WmCW>W>W> X>)X89X>IX>`X8?}X8X8?X8XS?XS?XS?X`? Y`?)Y`?DY`?cY`?Y`?Y|?Y|?Y|?Z|?$Z|?EZ|?cZ|?Z?Z|?Z|?ZtCZ?Z?[?[?*[?D[?\[?n[?[?[?[?[?[?[?[?[?\B\)B!\)B0\)B?\)BS\8Bk\X\8B\X\8B\X\MB]X]xB-]kBF]BY]EBo]X]AB]X]B.^EB=^EBM^MB^^VB|^VB^C^`B^kB_kB1_{CC_qBR_xBc_xBs_xB_B_B_B_B_B_B_B_B`B`B%`B6`BF`BW`Bg`Bx`B`B`B`B`B`B`B`BaCaC a,C/a( >a( Ma( Xa ea( za( a,9aF9aF9aF9b]9"bX9$ٱ>$>$ FJ$ j"F$ ʲ"F$ +EF\"F$ F$ 4F \F+F:FIFXFjFyFFJ FδJ ݴFF(9GjFyFFFĵFFFF!F<FLF]GnGRGRGRGٶRGRG7RGSRGsgGRGRGʷHܷ`GgGgG gGgGUgGkgG{gGGGGG͸l ޸G G GG0GBHQH`Hq&H}l ;HpH@ @ &@ Z s @ X غ   P75DQP7rD7D»"8߻77 )7?Z7i}777μD7D77%767G7V7g777h7hɽ8ٽ8"8N8N8,N8JN8kN8N8N8W8ѾN8N88%P84W8DW8SW8fW8W8W8W8t8˿p8 +W I440D4d4w44444 ) S u?W?W&f3''>hX33?2Jcu K$%5$s(%u%}%(%u%}%-%-%-%3-%JB%YB%rp&p&&&&&.`:hG[}!0D[#6V`$`$`$`$w${$$Q/u///"/GfXGfxGfGfGf`fGfGfGf1GfPQf_Qfn`f~`f`ffffff/f@f\fvffffffff!g/!gO!gm!g!g:g!g!g!g!g.+g=+gL:g^:go:ggggg g 6gK agpgggghggggh$g3gDh\hkh~dhdhdhdhdhdhdhdh dhVh,Vh=VhR````a`A`m(```&` (`%(`G(`c(`{?a(`?aCaEaMamamac$c3cBcfK K KE nK K3 SK NK K^ K KBKXkKqkKkKkKK  kK kK, K; KJ KY Kj K K  K K6 Kt  K K K  A KR Ku K  K1  q K  K-  m K  K) WKhKyK$L$L$L 3$LC$Lg$L $L$L$L\ =L=L=L 8=LH=Ll=L =L=L'=Lk PLPLPL GPLWPL{PL PLPL,PLp bLbLbL LbL^bLbL lL xLL-L< PL^ sL LLLLLLLL!L0LALRLgL|LLLL 7LILmL L L :MO `LL L L F MR c'M'M 'M EM pM8 4pMX8 ppM8 MpM8 pM8 &pM98 JpMX8 kpMz8 MpM8 pM8 pM8 pM=8 PzM\8 qMMMMMM? QMaM{M NNN% ?`Nn `N `N  N `N+  > `NS  f `N  `N  `N  wN!`N#! 6!`NQ! g!`N! !`N! !kN! "N9"NM"N^"4Nn"4N"4N" "4N"4N"4N$# 8#4NP#4Nj#4N# #ON#ON#ON$ $ON*$OND$ONt$ $N$N$N$N$N$N$N%N%N-%N=%NO%Nb%Nr%N%N%N%N%N%O%O%O&O&O*&O=&OU&Og&Oz&?O&?O&?O&?O&?O&?O&?O&?O '?O'?O-'?O?'?OP'?Oa'?Oq'O'O'O'O'O'O'O'O(O(O)(O;(OM(O](Oo(O(O(O(O(O(O(O(O)O)O&)O>)OP)Oj)O)O)O)O)O *P*O=*Oc*O*O*O*O*P*P*P*4P+4P+4P(+\PN+\Pn+\P+\P+\P+uP+\P+\P,\P7,\PV,fPe,fPt,uP,uP,uP,P,P,P,P,P-P-P:-Qo- -P-P-Q-Q-Q-Q-Q.Q]. .Q.q .Q.q .Q/q +/Q>/QS/q h/Q{/q /Q/q /Q/q /Q/q /Q0Q0q $0Q20q E0QS0q r0Q0 0Q0q 0Q1Q*1Q=1dQU1dQz1dQ1 1yQ1yQ$2yQc2 2yQ2yQ2yQ3 M3Q]3Q3Q3 3Q4Q,4Qk4 4Q4Q4Q5 U5Qe5Q5Q5 5Q6Q56Qt6 66R66R66R07 j76R{76R76R7 18XRV8 l8XR8 8XR8 8R8XR8 9XR9 (9XR69 I9XRW9 j9XRx9 9mR9XR9 9XR9 9XR9 :XRN: s:cR: :R:R:R:R:R;Rr; ;R;R;R3< i<R< <R< <R< <*S=R'= <=RO= `=Rn= =R= =R= =S=R= =R> >R*> N>R> >S> >cXKc [cXlcXxc cXc cXc cXc cXc dXdX)d :dXGd YdXfd xdXd dXd dXdXdXdwXewXe0YAe^ Ue}z5}5}5}5}5}ɔ5}ڔ5}>}}}/gpv Еpv *pLv epv qqpӖp|qp KqKq+Kq:KqV̗ܗ7J7 77*J;CJC_|˘! )F>Փ[t̙ޓ6BS_p~њޚ !1*W*w*77FěFӛFF$F5FFsWshs{Ӝiє%6GXg$v$$$ĝНGG$ $$)$9GHUW]f]{ԕ ԕ ɞޞB+<dq  ԟ(( (B(777FBUBfBwBBBBBɠ ؠ <Mݖdw ӡߡ+<KZҖiҖxݖ ̢ۢ   i+i<iMi^ioiiiܗܗܗΣܗޣ )8Ggpopon%< 4nCnSobor< J եO'poͦ)8O }  00 \\.pl[lvlll٨lllm#m2lDplUmsmmmmĩmөmm (^G -n -n-n5-nD-nX-nc (G lkllv; nv v۫ v# @vcvvvϬvvv>vZvjvyvvvvvȭvݭww"w?wYwsww#wɮwٮwwwww(w5#wd@u@Zu@°uڰppp+pFp_p}pn αpn &pnX v++X+y³+ճ+ ,+Gy+!`݄δݴ +:LYjyi`vĵvѵ+3/Nх\pʷ1aVmxiRzUW  . = L ^NQɺ8LZXiauaxԻxxx)5FTivWǼWؼxxqq'>f77׽ 7A7ƈ7Ҿƈ7ƈA7R-jyſ'ֿ' $ 37B?Y''t''(N'h' '&yԏ׏ +;J Y h w '/\ ,\RǑbǑzyИ ;Yl &QS44!3@Q`##@Zk#RnBz,,^^^kkkݹ#3Hݹ{6N^m}# 4Sx/ % 6/S/d/u]]]lll"1@O_"j{"&&&&&&0&&%&5&D&U&f&t09992222 hBbh ww+~KغXh{غܺܺܺܺܺ-ܺG_ܺoܺ~ܺܺܺܺܺ***#V YBDt0c[);6S6S 6S#c4\C\VOyO]OG .Jf  + <Tcrݻݻ77 D1MNMmMi߿MMM0Z?ZNi`iqi>>>>/Z >Z S`5Ks4KF4u 4\TkT|%:Mbw44(-(<zKzZzizyzzzz@a}.?P^odd+hYhhhhh%sDhThchshhhhsRRRϾ(:GϾXȾgȾUU4 eUU'#HU!U;Us]U5U)=QUbn#%;N[jy5%U;5Xgv* * -  !YEB\wzGGGGC8C81C>8KB`BoB~LLYbbb ll,wFwVwg v\\ `9`e````k$`4`C`S`b`s``k.C`u^ ,;JYiz-<Mgw??,FFFdFRRf4f4 i(4;]vsbbbb+s<lKlZiy$4E4T<crJ`5JW&J5JGJTWePtP '\p*E{!=Yu§§-6:Hc6666636Q6x@6666666@>`~>mVq_Z/    1 Y        *Wy8P888PI I Z# Z5 ZB _S ed w   ʬ ʬ     `t & q &  ~ ~  5 N g         - = N [ l y     > X r        -;P%}%%&1t0@.O7^7m7|7FFJ JIJkJJJTJJ JJ,J=JNJ\Tqhhh0oAN,N<bKb[ontxxxxxx3RxbxqxxxxxOz0@O_n@@@ /Fn`èYЩ,թIYUfYsY 6<e%%n0nRnpDSDDDSLL '@PLP'apϳ 1 P _ p ϳ ϳ ϳ       !Q'!QC!Qe!Q!9!9!Q!f!Q"Q<"kN"_]"fn"f~"f"f"f"f"f"s"{#(#B#\#x###### $$)$9$J$W$h$!u$$$!$!%!:%!T%!n%!%!%+%!%!%!%!&!&!)&!7&+L&ry&r&r&L&W&P'&'PY'u'P''y'(6($M(fo(((()))K)$)1*$E*U*e*t*ǰ*ǰ*ǰ*ǰ*ް****ް7+e++++,1,P,`,o,,,,,,,,,-6-E.-6=-6O-6\-Em->|->-V-V-V-f----.+.U'.6.i.//K/h/////(/(/_0_0'080I0c0}000001&161E1U1d1t1111(111(#2(N2(u2(2(2(2(223(3(#3(33(B3(S3(d3(r323r3r3r344B4~f44~465~[55~55~6X6~l6;6?6X6z77j"7j47jA7zR7a7p77777777>8m8888959S9c9r9999999:%:E:C[:Rl:C{:C:C:R:K:K:X::X: ;X;%;6;I;f;y;;U;U;a<'<~6<k<@ =S*=Nd=S==m=m=== >1>R>s>>>>??-?>@ѐ2)T)v))DƑDߑi I,%iQI,iii{גEk.>M]n{Ɣؔ,i,!#(A(Z:i?x?`pߕ'p'7'U@l0@ܖ0@I0k@0̗e!h1Q8mh1 9i|11š2 (@K00*d0Ӝ3hޝ2BQap˞ڞ 0&1B02dccrҟv v@vfvvv vv)v9vHvXvivv̡ޡ );HWfy444ۢ4VV Ve(9Wp4ͣ9Okä.Ub.U>bM]owwwťwww'wARwlwǦئ0A#R3p3EJJڧnr,rGrWrgryr|rr¨rҨrrrr|2 )0)0B>)b )Ҫ))BYBlQUͫUU(UMUvU_ɬU٬UUUUU(U5_H6m֭4`v```5M`dϯ5Y}ְ"1AR_n6ұ27Yw0GkO0 yByUz,Tõӵ#)DUrܶ /s<?b&sָs}*}T}~}}}ù}ӹ}}} 5&[&s<@@@ݺ@@@1JP@`@o@@@@@J˻~ܻ]]j5]D]Ujduμ5WqȽeڽ (CSfv!!IIII+IQIwISIɿIؿIIIII%S4zCzRcP  H7'Y wRT''@Yvddd.Jf$6ETdtDD`JI*`I*)KI*pI* !LvI*`>`R*`*Cj_+h*&*P+x*cp,pp],p, ,'HD.,S.,-d.I*.s,0IYm8/EY .D.Yk|!*H.....,.a8.......8zZt /U!2?Rt''&&R R,RFuYhuR\hpp'p4uGo8/8/#?[/!R/m8/FZt4z/Rz/@9z/JYhxw}===PEE\//g0CRdqF,,],,J Su, ,{"SDN-S-S0S,(, g|,7LN-N-gm###9,qQl..2; F;(F8UHUWUgUvUUeCCCGeeVeyeeee eCeheeev e3eSebeueee"e1sDvgz&&&& &&.6FUf*******;8J8Y8k88888oog c*6*bt0*Dp99 9I99999ll--s-I.g 7C77/ X } SS '+'EYy @ b |   *    ( 9 J X*k88,M_q''''''''7Nr,;KZk|(;(R$h(xL($P(`y-1111.1T1w;1111111 ; N N5 Y[ Yn k k k k k# kI kl u k k k k k k k u  H (d  ( 2 (  / 2@ 2(\ (x l( ) A)     PL Pv P P  7PLP_}Nj +:J[hw!!,>jj/Nd ACK\/!&@P&_o///<<KK K8X{IXgz.G^eeeeee0eUjle|eeeeeej -@P`{n 5K^0it5iqqq#p .9 I \ o% * 7 B  K0 K f   . EfP gfr fX f   ; D &D <J OKiUnnnnn$40?JlKju y)y@PP]`zbfff$4D`O<[m&W00B0Rbr *?KK+ R . > BN Y  d t  "   (    V   V  V ' V2 D V h x            5! !8 !H !X !j "| 1" k" s" " " # # m$ m$ $" $2 $B $T $f %} -% -% -% S% % % % %  & &2 p&< G &V a &k v & ' `'  ' ' ' ' ((,8(>Y(Pd(b(t(((()/*J****+I+>[+N[+^b+n+yS+#,;,;,[,Sg,k,,#,5S@,JSU,_Sj<-z-.^.... /@///*C0Zt^00023P331.?41Ot1dt1tN4~b44444 56N6'i67~6G6Wb6r77P7D777 D7'777AhLF8bF8uF8P8W8W8Z888888$849s8999::: ::/=J8a=s==)@Z@@@@@@@ +1>G8Y}>hs>>>>>>>>>8?%80=?C`?V|?n|?|???????8BX8B-VBBVBT`Bf`Bv`B`BqBxBxBBBBF99,9C9U:g:y):D;I;R;R;= #<(3#<E,<W<g<z<TAC  D DDD#D WEwE& 1EAEQE[ fFq$ }F\FFFFFF$ FF,RGJRG\RGn`GgGgGvGGl HH&Hl HH)H9HLH\HlI|3ImIIIIII 3K> JkKZKjK}KKKL$L1L=LDL PL bL bL0 L:  E LT  _ Lo L L  L  L  'M  'M! !TM:!8 E!TMT!8 _!TMn!8 y!TM!8 !M!M!M!N! N! " N" %" N4" ?" NQ" \"Nw" " N"4N";N"N"N"N"N"N#O#O+#+O;#?OK#xO[#On#O~#O#O#O#O#O#O#P#4P$\P$\P)$uP9$PL$Qb$!Qu$5Q$q $5Q$q $5Q$q $5Q$q $Q%dQ%kQ/%yQ?%QO%Q_%Qo%6R%6R%@R% %@R% %@R% %@R% &R&R/&R?&R\& g&Rv& &R& &R& &:S&rS&rS&S ' 'S&' 1'S@' K'S]' h'S'T'T'$T'% '$T'% '$T'% '$T (% (T/(T?(TO(Tl( w(T( (T( (T( (!U([U([U(eU)lU&)U=)UM)U])Uz)K )U)K )U)K )U)K )2V)lV)lV *V*V-*V=*VM*V]*Vw* *V* *V* *V* *.W*aW*aW +aW+lW9+ D+lWT+ _+lWo+ z+lW+ +X+W+W+W+W+HX ,HX,RX-,UX=, H,UXW, b,UXq, |,UX, ,kX,0Y,^ ,0Y,^ ,0Y,^ -0Y -^ +-YB-@^M- X-^z-^-^-^-_-N`-N`-`-`.b.b*.c?.cQ.wcf.wcv.wc.c.c.d.&d.&d.Xd.Xd/d(/d:/dM/e]/^_~/ /j_/ /_/_/_/a0 0a&0 10bA0bQ0"ba0ebt0ub0e0e0e04f0Gf0Gf0f0f1f 1f01!gB1!gT1:gd1gv1 1g1 1g1g1h10h1`2`<2`^2&`u2`2(`2(`2Ea2Ya2h 3h%3 i73hL3i\3cil3ci|3J3 3j3$j3yj3j3j3j 4j#4yl34lI4l]4lm4m4m4m4pn4 4n4< 4n4p4v 4p 5v 5p/5v :5pK5v V5ql5q5r5 r5`u5`u5zu5cu5zu6u6v"6 -6v?6vV6we6 p6w6 6w6x6x6 x6x6x64x7;y 7_y27nyD7nyV7wyh7yz7y7y7y7y7y7z7{8 {8{#81|685}H85}_8}o8~z8 8P~8 8~8 80808 8p8K 9@99p'9=29=9wI95Z9e9u9P99999+99+9i9`9v9:::2:>:NP:Nb:Zt:Z:a:x:x::W:W:W ;f";b5;@;7K;ƈb;7m;x;l;;;;;;;;<ߋ+<<><<T<f<q<<<@<u<0<<9<<<'<='=ԏ4=ԏF=X=m==\==\=y=====>>>)>A>Q>[>k>}>>Փ>>*>F>F>s>>?!?є3?єC?єV?f?v?$?G?ԕ? ?? ????@@"@k-@ E@U@e@8|@@ԛ@ @@@y@@A!Aǜ1AӜGA0RA]A5mAAAFAJAhAhAhAAB2Bp*B5BuHBYBjBϟzBBBB+BB+B+BB`B&BBC+C&6COC%^C&iC%sC%C&CPC[CuCvCC[CC[C DѡDѡ+D;D@FDQD\DgDwD_DxDDDDDD(EE(3ErBEMErWErfEqE{E?E?E0E|E5EE|EE|FF|F3F|>FRF|]FmF}F¥F¥FFFF0FFtFxG+G6GOG@^GiG@sG@GGpGGGG6GG6HH H*H9HDHOHZHsHHnHnHnHYHYH@HSHII+2IS=I+VIceISpIczIcISIIII IIJJ8*J8=JeMJXJdJoJ{JoJsJBJBJBJJ KKP$K0KްGK^KnKV~KKKPKLKKKQKQLQL_&Lf6LfFLiVLlkL}LLLL!LLL!LrML MrMr%ML0M;M~FMkMMMMMXMjMMjMI NзN!Nٷ1N!LNWN%oNzNUNUNUNN4NǸNǸN# OOݹ2OGOWOgOzOOO/OlO9O9OhO PwP~+Pغ=PܺOP*_P*rPPP6PSPOPQQ%Q5QJQMgQMyQiQQQKQ4RTR5R@RRRdRtRRdRhRRRRRRRS45S?SJSZSmSSS4SS5SUS#S TCT8Tb/Tw?T\VT`mT}TTTTTTTTFTfU4U$Ub/U?UQUcUsUCUJUUUUU UU VV4,VCVZVjVVVVgVgVV_V_W_W W4WDWTWgW7wWOWpWd"W"WW"WWWWX#X$X4XDX-^XpXXGXVX#XeX#XXXGYTY#Y6YFYVYCiYCyYCYzYYY#Y/YY9YyZ4ZIZ)\ZrZZZZPZ0#ZUZZI$ZZ[[0#)[M9[jI[0#[T#[#[# \4$\v$0\$C\6%V\t%i\%|\H&\&\ \7'\\7'\\\d]!]7',]@]7'K]U]f]7'q]]]']7']]']]]' ^p^'!^':^E^(Q^c^(o^^(^-^1^Y^(^k__*_(6_F_ V_,f_(_L(_(__U__o`o `o/`A`Q`g`}``#`J``n`r` `)`)a87a)Ba8RaQiaUa6a)aaaa)a) b`bI*$bBbI*Mb`bsbbI*bT*b*b*b{c{-cBcWcgcwcccccUccdd%d7djJdZdjdzdd+dddd6d+dAdAe#e.eI,:eVemeeeeee)e)e)fD"fi>fI,JfiefI,pf{fffI,ff?fOg&"g&2g<Dg@Vg~fg]xggsgsg}ggggh+hAhWhInhhhhhhhhii*i