ELF>8@@ONHHX8HH0H=8yB@p@x@pIP HfATUSLXHI$0Hx8HHHI$0[H]A\Hx8ff.AUAATLU1SHt5LHcLHIĠH8;rHCtE7KCʾ8u1HSCHHHHHKDHHKEHkFHKG,HKI,SJ@EtEHHHSLSMHH(SNCO@t CP5 (#HHHEf;s Hǃ[]CCSKE-cfDAUATUSHLX@EtBHAt A8t2H[D]A\A]HACC>CB@kCu== PFEHHH6AHz @tA}yNj D밋5(#Df.USHHX=Hǃ8ubHHH9t3HHHH9txBtHfSB7SL6SMH0H(SN4SOH0HSDH0HHSEH0sFH0HCG EHǃ-ff.5ATUSHHH0Hx8KIąuEtH0[L]A\Hx8H1HHH(#HHHHHH8G>GGBÅGD EH0LHx8[]A\HVHv1AVHAUATUHSIHHXH=H-AeH(#HH@H@>fhB EH0LHx8HCHXH=t?H0Hx8I8tqEhC^LH[]A\A]A^ff.@AU ATUSHXHL@HǃM;CK@C>fSBAD$ɀCHAD$ cIAD$ CJAT$EI|$K@Hf(AL$ ɉKȉC(fE1EhGAIHȉEHGHHEH(A9|A $`=HHHǃH[]A\A]ȉC(ft=E1GAIH hȉEHGȉEH(A9|mLcxdLcp[AVL0AUATAHUHHSHLXH8GDHHHI0Hx8LI0[]A\Hx8A]A^fDU5SHXHHHǃu[]C>HfSBHHCCD@Hǃ* []AVAUATUSHHXEuRHHHBH9t;s"ff.f.HPxHBH9t9pDupH0H8H8tdHLJ8HPLLLe8Lu0LLtLm8LL M,$[]A\A]A^Hff.AULATUSLHI$0Hx8HM9$tI$0[H]A\Hx8A]H{tHSHCHBHHLHCH"HCHCP5AWAVAUIATUSHX8uKH5HP@1Ҁcf"t>L1LHcLHIĠH8;rIPMLLe8L}0LLtLu8MM M4$H11Ҿ[]A\A]A^A_AWAVAUATMUSH8HHx8H IH H9tWH8 tNHL tHUHEHBHL LHLtH L}LmImH8LHx8L[]A\A]A^A_DAVAUATUSHHLXD$I$(AAt9HFŃHFEAHi,HHǃhHPHǃLHH`HPLLeHLu@LLtLmHLL M,$H[]A\A]A^I$T$T$XHǃHI$HI$D$H[]A\A]A^I$I$D$A$THǃff.fSH K@0f(HXfCRH C>CBCF`BtEHI`HC(HHC`H߹pH[HC0ǃI`C `fAVAUATUSHHX?tHHttHcHHHǃuMH9tHPLLLe8Lu0LLtLm8LL M,$[]A\A]A^f.AVIAUAATUSHOt>L1LHcLHIĠH8;r8t-H:HHLD@[]A\A]A^CH0f%fCATLUSHH H8HHH0Hx8HL9t+H0Hx8H[]A\LH$H4$5USHHXHHCBCCD(HCFC>f(BHIHC(HHC(#HHHǃHHǃ Ev[]C0ǃIC f.5USHHXHHCBCCD$HCFC>f(BHIHC(HHC(#HHHǃHHǃ EV[]C0ǃIC f.AVAUATUSL(HI$HHI$HHHHHHHHHHHHH HHH(HHH0HHH8HHH@HHHHH HHPHHPXHt}txMeH(LHHHtHPLLLe8Lu0LLtLm8LL M,$[]A\A]A^}uHLHA$ LATUHSHPHXPHHIRLH[]A\ATUSHPHHhPHHIuL[H]A\L[H]A\fDUSHHDESDHXADCFEDC>CCB@kCfD(BthHɉǃIHC(C5 (#HHHE=H[]AIC0AȉDC DUSHHXAd11HHǃH[]ff.@USHHXeH%(H\$HD$D$HH|$1D$@D$A1Hf HǃHHdHD$eH+%(uH[]DUSHHXAHHǃHH|O[]DAUATUHSLXILHDžHǃID$ID$Cg8FЄtV1ff.fH9~=|huIAHHk[]A\A]fDAUATUHSLXILHDžHǃID$ID$AD$Cg8FЄtM1 @H9~=|huIAHH{[]A\A]fDAULATMUHSH8U1t0LL[]A\A] HH!u HHH8LmEHx8IŋuXHǃ@ t  t_H8LHx8O|H7H8LHx8HHH5@HX {Hff.AUATUSLXH=I$L$LHtHƅI$f(HXfKBCFHK@CC>FtyHʉǃiHC(HHK(#HHǃ Ei[]A\A] iʉȉff.@AWIAVAUATUSH5IGIHx8IAIHPHH9sIAEt MupMIExLhHH9uuHBxHPH94tZDr LIGDjHx8IAAIGHx8IAQIGLHx8H[]A\A]A^A_LAEt(#CBt HHHc`HHff9GA}kHu d ff.@USHXHH@HHLJHH@xH9QHHPBt <t<!Bz HyH@1HdžHHA$H),HHJHRHHQHHQdž,H,HXK@CC>fKBfsIHf(HBHi,HHHC,HHC(HEtAHBxHPH9Hǃǃi,ȉkff.HHAWAVAUATUSHHL I|$8D EHH(Pu pt!H}8H []A\A]A^A_LHHHAMDEH8aHHX@t f}TAED5E>HEBú(#E HELPHDH<$IN8IV0HT$HHL$t#H<$HL$HT$I~8HH H9 AEσ AEEuEHHHx8H3I$8H[]A\A]A^A_ uHHHx8AWAVAUATIUHSH8~ALPHHHH $M~HIV@HT$LtH $HT$INHHL ILM$8 HLH$LtH$LM$@ I$8 M> 0C>L@CCBDkCfCII$0 f(HXBC0ǃI 0C 0AHHHHDº1HȘHXH0HBHHHf(HFHH[]A\A]A^A_HLL8 LLHtLM$8 I$@ L+H[]A\A]A^A_HI 0HC(HHC 0H[]A\A]A^A_DAWAVAUIATUSHHX=cL1t5LHcLHIĠH8;rHH(@HǃHBH9u#4ff.fHPxHBH9t t H5LP@E1LJL8 LtH8 H@ HBHL8 L@ JIwHIU롾HFItAH0MH8HH1Lf"IPLe8HU0H$LtH$Lu8M IM4$H11ҾKLH5@H[]A\A]A^A_ff.AUATUSH8eH%(H\$0H@H0Hx8DHEt CLd$Cu"H0Hx8HCH0HHx8CtI$1LHID$ID$ID$ID$ LHCuLH[D 1Et =DEu ǃC1f"C8u#Hf"H= H0HHx8Ct =$HD$0eH+%(H8[]A\A]ocǃT80ǃAIcAHHH@D;rLd$1HD$HHD$LHD$HD$ HD$(LHCuLHCҁ3C8L8t41HcʼnLHHLL;8rLHD$0eH+%(u%H8H8[]A\A]ǃAWAVAUATIUSHLX=IHM1MMZA 1@@M9M$ff.ff.IPxLBI9tnAP uHA9xu1#ff.f.HH| XuD< E8|'tH(HuIPxLBI9uA;sAHH&(H賓IHLx1A~tAGAVI9|H(E1pxHIHhuyȀEAGAHA9}bE<IcEITEȉEE?Eu@EHB$1ҍƃIfAL$BAL$@AD$FHfA$(I$XAD$AD$>FHA$ADŽ$iI$AL$(#LHAD$(HIDŽ$IHxI$@ E!H[]A\A]A^A_ iA$A$cAWAVAUATUSHH DEHL I|$8=IHL0APiAp[LMKIAkAIHHHH9]LD$I1L|$L$$IM|$PLAD$hED$lA9rxM`ff.A9rUHcI4H;(uHPHO0H0HH9t%ff.fH9tHHH9uLIĠAHHLI9BL$$LD$L|$sI8L$HHHIAGDAE>AEAEBHI@5 L(#HESEL$A)A?AIPIL$H|$Lq8HQ0HL$HT$LL$t$H|$HL$HT$Hy8IM I>AAHLHHx8uZI~8L H []A\A]A^A_HLHHx8HLHHx8H3I$8룋 1AHGDUSH0HeH%(H\$(HD$ HD$HD$D$'HD$D$HD$ff.f| 9HuDHFHD$HFHD$ff.| HuDHFHD$| HuDHH @S8Jv{:ƃP H00HP HH0H{8)HHt HHHLL$LD$HL$HD$(eH+%(H0[]HHSvAUAE1H|$ A U 蘅I@IHB_HHHfAHFHHH4$HHXH01[]A\A]A^A_HωT$H $H $T$fAD$$u AD$$HAfHIh1ɋD$$ GHT$ȉHGHT$ȉB $HT$ $HAH9|HD$A$\A( AE TAEEH$E11=HH$HHLT$LD$ LT$LD$H$HωT$H $H $T$AfAAaHEHIhfΉt$$1ɋD$$HT$HT$G $ȉBHGHHBHT$ $HAH9|HD$AE AeIOA)AE< AƇ&A$1A( $HHHXHHHHXHI$HxHHH@XH)H`1HLADŽ$ HXHIXH0U[]A\A]A^A_AI@XA AI8Ht$fSHHHHXH8HT$(LHL$HHL$tHD$(L8I_IL;HXH4$L7AA(D$$hAMA(hL8Lt$(LHL$LLtHL$L8M7MoM}HH4$HHXLIXHD$(HHiàHXIHi۠HT$(LHH8HuHXL#HD$(L8I_IL;fAWAVAUATIUSHH8L7eH%(HD$01HHIhHx8LIMAEH<tƃ AE< HD$0eH+%(H81[]A\A]A^A_IhLHx8IhHH0$0I}`)HHtI1HHHf@UHSHH8eH%(HD$01HHH{hHG@ffCH@ffKH KLIp8M@8LCLFLCLFLC'LFLC/LF LC7v(Cs?H@CDHH@HCHHH@HCXHH@0H;C`HD$0eH+%(H8[]HfKyMKH:fHwHH{H~H{H~H{'H~H{/H~ H{7v(Cs?H@CDHIH{pHC`fH00H$H0H{`)HH4 Hsp1HIH @AWAVAUATUSHH H|$ H\$0eH,%(Hl$@HXH\$0H\$8HHE}@LLI$Mt$LxM9ugILtIVxIHBHHL$8HLHH $tH $Ld$8I^xIL!IGxMgxMHxM9uUHHfɅHAHH $HpHL$N4 tNt`H|$0HLHxH9u4%IvI9wHu IwXI9vtFHHxHxxIHQH9HIWhBuAVA9WuAVA9WuAVA9W uH|$H|$tIWxIHBHHLH|$Ht$tH|$Ht$HMoxIH>IGpHt1AWr@vtHt$(uAGuAx XHt$(LLt$(I@L9$$UHHHpHL$H9LpLLL$MyLL$tIIAHBHHLLLL$Ht$LL$tHt$LM)IqLHt$(LLL$Ht$Lt$(萁LL$Ht$AI&Lt$0IMfLxI9uII|$ptfA $LAD$DtIT$xI$HBHHLLHH $tH $LMl$xI$L1IGxMwxMHxI9wLd$0I$Ml$LxI9t}HpH$IL|LtIUxIHBHLxH$LLtH$LxMIExM&IGxMgxMHxI9u}HyHHHDH\$ HHD$@eH+%(u)HH[]A\A]A^A_6@~fDAWAVAUATUSH H@LXeH%(H\$HDL8 LtH8 H@ HBHL8 HL@ LPHH $M}8IU0HT$LtH $HT$IM8HL IEtIAu2HD$eH+%(H HL[]A\A]A^A_QA ZtHEM$HD$I$U HXI9u(ff.HCxHXI9t9SDuL|$I$pI$pH9XM$pLI^tIIFHBHHL|$HIH"LIF}I$LLHH $tH $M$M.INL1LH!}HCpt/Ht  H5I$P@Ht( H5@I$PCDhHLkxM$pWyLtHSxHHBHM$xLLLM$xL{xLM.ff.AWIAVAUATUSHĀ~eL4%(Lt$xIA^ABuȀ=)0H1%ff.H=9 uHcHR,t.nuA~!uxAucA"wYHD$xeH+%(5H[]A\A]A^A_I0AvL$L$L$L$=1yHIH H@L$BAF8HPHH8HLL$HL$A"A$92AVAFʁ 0AF < H< <AFgIn(HL$IH Ef$L$@AAV8JF>H8DHHL$HL$IvhLL$AFȃp\HD$xeH+%(L$HIL[]A\A]A^A_!A~:IP 0AƆP H0HHL$0I~8)HH4wLHHL$mAF<6AN(H0EFMHL$L$A~:IP H0AƆP H0HL$0I~8)HH4,wDHHHL$wI^(ABtI^XC?HL$IH Ef$L$@A AV8J!  H8DHHL$HL$Hs@LL$IH SdDc`L$@AA AV8Jm e H8EDHHL$HL$AFȃxHD$xeH+%( HHshL[]A\A]A^A_鷋<0IH AƆ@AV8J  H8IVXHL$HL$AFAMD|E1LT$(L|$HD\$L$$MMEH$Lh1HHH@:HHuI$H D$H0LHH00)HI4H$Hxt@LHH$CHsH fH@HH9D|$0Ht$8SL1sHс@?HH:P HHuCk I$H AC̓HHD$GVAD$8PyqLH藍SEHHI$H H8ULD$HXH$Ht$8HSH@fH@HH9z HIH AFg@AV8JH8IV(HL$HL$< twu<w2< <<<t<< M^HD$xeH+%(HLL[]A\A]A^A_j<0<&w<$<%tff.USH@H0Hx8HC@tOt8u#H9HHÈH0HHx8[]H11Ҿff.fAUATUSHH0H0eL,%(Ll$(IHx8HCIH0Hx8HCH0HHx8CtI$1LHID$ID$ID$ID$ LHCuLH[H@^AUIuE1H8HAEL@8u 1HH0HHx8CuSH0Hx8Hǃ@HH0Hx81HT$(eH+%(H0[]A\A]1HH$IHD$HHD$HD$HD$ LHCuLH@H0HHx8H8HH9H0HHx8H8HHfDAWAVAUIATUHSHHeH%(H$1Ld$,H|$0HD$ HD$,LHDŽ$H)dHu4HH$eH+%(HĘ[]A\A]A^A_dLLH LHtH@H|$ LHADžHT$ H=HJL2ȉHι?Ht$D)Ɖt$ HHH HDbIHD Hc|$L@1ҹ DIEIH>AMD$A1AAD$D9d$HL$IcI>HHT$AH $HH+=HH H=Ef LH $HT$IƋD$HA9r1D9d$Ht$HBHHHHD$D$AA!uYD$HAE HLAuI}ELH|$ HcI>Ht$DHH+=HH H=Ef tLH@HHH|$ H|=tff.AUATUSHH0eH,%(Hl$(HH8Hx8I tGH8LHx8 u?HcHT$(eH+%(H0[]A\A]@ uH1M1HH$IHD$LHD$HD$HD$ LL uLLQHHf.AVAUATUHSHH0eL,%(Ll$(IoH8Hx8I@ uMH8LHx8 IcHT$(eH+%(#H0[]A\A]A^HHŅuL t5LHcLHIĠH@ ;r1 f*@ 3Hx1HH$HHD$LHD$HD$HD$ HL uHLHfAUATUSH@H0Hx8IC@ Kf"t>L1LHcLHIĠH8;r8u HH0LHx8[]A\A]H@H0Hx8HC@u2H0HHx8[]A\A]ǃHH/~H11Ҿ[AWAVAUATUSHH(H~XH4$Ll$eL<%(L|$ L>Ll$Ll$HD$Cp\E11E11H<$LuD uKIE1AG tEE1IIt AAuAAAAH$Ht$HH"HxXH|$HLLL9ufItII HBHIIPI ILMIIH-L9uHD$ eH+%(2H(D[]A\A]A^A_H$Ht$E1HxXI!AGIIЅIIIHtHH HBHHHH"H IHPIz?u5AG $IIAOAu ALJL~6A8L3IIIHtHH HBHHHH"H IHPIy$Hff.fAWAVAUATUSHH H@LXDEL8 LD$tH8 H@ HBHL8 HL@ HPH<$Ly8HQ0HL$HT$Lt#H<$HL$HT$Hy8HL I?E}|$I$M$LLHtM$L8 H@ L3H5I$P@I$I$H9H8 H8 HtH8 H@ HBHH8 HLH@ H []A\A]A^A_A%A ZHLh|$A$8LnfAWAVAUATUSHHHD%EHCHx8Itz tFH5HS @HCLHx8HH[]A\A]A^A_HCLHx8HH[]A\A]A^A_HH$HFH $P sHCLHx8-HCLHx8IuH(D0HCHCL怣Hx8H{HCHx8IH{HCLHx8H $HCHx8HHCHHx8HH[]A\A]A^A_HCLHx8HH[]A\A]A^A_HCLHx8HCHx8IH<$zH<$RbULCH<$?H<$SHHHHHHHÅt H[USH8HHHH0Hx8K1ɺHHH0HHx8[]$H8HHff.USHH(eH%(HD$ 1HHHHH$HCHD$HCHD$HCHHD$H$HD$ eH+%(tH([]@SHRS$s H[HHHHHH[HH]H@HHHD$eH+%(usHH[]A\A]H@HHHD$eH+%(u.HH[]A\A]H@HHff.ATIUHSÅu LH[]A\DAUATUSH0eL,%(Ll$(L8AHAtbH1 1HHAHHHAMtu LIHHHD$(eH+%(u"H0L[]A\A]HD$(eH+%(tH0[]A\A]HHHHATE1UHSDM DEHB4MUHAAAA9|[]A\HHHHH8HHHHHHH8HHH8HHff.@H HHI8HH=u] HT$(eH+%(uH0[]A\A]A^A_HHHHHHHHH$HHL$HiHH9HHH[]A\A]A^A_[HH]HHHHHHHHH8HHHHHHHHHHHHHH8HHHHHHHH8HHHHHH@AT=USHXHLtHHA$yMH8HA$A$E$E$HC>HXCCBZCHXcIXCJXHPfǃ(Ft&HȉǃIHC(K IC0ʉK =(#Hǃt HHH=tHH[]A\HHHHHHHH[H]HA\HHHHHHHHHHHHHH[H]HA\A]A^HH8=#HHHHHDHHXH[H]A\HHHHHXHHHHHXHHHHDD$ H $T$T$H $DD$ HHH[]HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH[]A\A]A^A_HHHHHHL8HHHH=HD$(eH+%(u7H0HH[]A\A]A^HHHH[HH]HHkH0AUHAMEE LEffHT$T$LE1Dd$ IDfH\$L‰D$D$9}GK4HDKDCHAAńuf9GuLH\$Dd$ HH[]HHHHHHHHHHHHVHHHHHHHHHHHT$T$HHHHUHH $ E I8HH $$I8HAWHL$H$HL$HHH$L$HHHHHHL$L$HL$HHL$HpHHHiàHXIH8HHHHH8HHHHI$8DHHH0AFIHAVAUATAWEFHH8EELHHHH0AFIHAVATAWEFA_XH8ELHHHL|$H1 1LEAIưHADA9HI~,0LHHL3HI~4HI~` HIIưpIvXHAƆL$AFL$IȃPHD$xeH+%(HL[]A\A]A^A_HL$I^t1L%L$AqI|EsErHI0HL,$L9cuuA9HH6C%<K&I0HDC'C!<wfK"I0HDC#H u>I0 AHgHHH(EflAvhL$I|H1ADH$A9HAF!<EN#EF"H0HLHI~$HI~DHI~dIƘENEFHANAVAvAA4Ef|AvxL$IH1ADH$A9 HAF-<EN/EF.H0HLHI~0HI~\HIIƬb]HHI~(HI~HHHI~haHIIAAAHD$xeH+%(HH[]A\A]A^A_H0AFHAVATSAUt$LL$(EFEH H8ATAMHL$HT$HHEA[L|$H1 L$LL-IHL$ILLLT$IHHHE A9DG1D$$AH\$D9$$$L;mYAHMcIHT$(AMiILHxIH $JL0hHI0E1 HI(HE1E1`L\$HIpHHI8H:AX x I`AXxI`IhHE1IdIAID9t`At6uMh;AX1VЃWЃWAXE1DWBWHǠ뛅v I8HT$H HHuHLH<$$I`IcHwaitdrivers/scsi/ipr.c6ipr: %s: %s: Line: %d 3ipr: %d:%d:%d:%d: %s 3ipr: IOASA Dump: Resetting device IOA initialized. Aborting command: %02X Remote IOA%s VPID/SN: %s %s %s scsi_dma_map failed! Resource path: %s Microcode download required Too many devices attached Error notifications lost 3ipr: %s: %s 3ipr: Device %d: unknown 3ipr: Array Member %d: 3ipr: %s: %s [PRC: %08X] %s [PRC: %08X] 3ipr: %s: %s WWN: %08X%08X %s WWN: %08X%08X %s %s: IOA Port=%d %s %s: IOA Port=%d, Phy=%d 3ipr: SCSI Sense Data: 3ipr: Additional IOA Data: 3ipr: Device %d : %s3ipr: Current Location: %s 3ipr: Expected Location: %s %s %s: Resource Path=%s 00000000%s %d -XFound IOA with IRQ: %d iprcfgtracecfgres_tblhcamsipr_cmd&ioa_cfg->reset_wait_q&ioa_cfg->msi_wait_q&ioa_cfg->eeh_wait_qCannot enable adapter Failed to set DMA mask The max number of MSIX is %d Can not assign irq %d IRQ assigned: %d MSI test succeeded. host%d-%dipr_reset_%dioa_cfg adx: 0x%p %sFirmware file %s not found onlineError clearing HRRQ: No Host RRQ. 0x%08X Dump of IOA initiated Dump of IOA completed. %s %s: IPRraw_moderesource_typedevice_idresource_pathadapter_handledumpasync_err_logfw_typeupdate_fwiopoll_weightreset_hostonline_staterun_diagnosticslog_levelfw_versionunknownphy reset problemspinup holdport selector1.5Gbps3.0GbpsFunctionalDegradedFailedSuspectMissingIncorrectly connectedIOA portExpander portDevice portDevice LUNis healthyis degradedis failedPathActive pathInactive pathSoft underlength errorQualified successInitializing command required9070: IOA requested resetSynchronization requiredNo ready, IOA shutdownFFF3: Disk media format bad3100: Device bus error3400: Logical unit failure8150: PCI bus errorFFF4: Disk device problem8150: Permanent IOA failure8151: IOA microcode errorDevice bus status errorATA device status error4085: Service requiredFFFB: SCSI bus was reset9083: Device raw mode enabledFailure due to other deviceCommand terminated by host6ipr: IBM Power RAID SCSI Device Driver version: %s %s SATA devices are no longer supported by this driver. Skipping device. irq_poll not supported on this adapter Invalid irq_poll weight. It must be less than 256 Current irq_poll weight has the same weight 3ipr: %08X: %08X %08X %08X %08X Failed to setup PCI-X command register IOA dump long data transfer timeout IOA dump short data transfer timeout Timed out waiting for aborted commands Timed out waiting for Mailbox register. Timed out waiting to lock config access. Resetting anyway. Starting IOA initialization sequence. Adapter firmware version: %02X%02X%02X%02X Abort timed out. Resetting bus. 6ipr: IPL stage = 0x%lx, IPL stage time = %ld Request Sense failed with IOASC: 0x%08X 3ipr: Dump memory allocation failed Term power is absent on scsi bus %d Invalid resource address reported: 0x%08X 3ipr: %s: %s VPID/SN: %s %s %s 3ipr: %d:%d:%d:%d: %s VPID/SN: %s %s %s field "ioarcb->cmd_pkt.cdb" at drivers/scsi/ipr.c:6295memcpy: detected field-spanning write (size %zu) of single %s (size %zu) Host RCB failed with IOASC: 0x%08X 3ipr: -----Current Configuration----- 3ipr: Cache Directory Card Information: 3ipr: Adapter Card Information: 3ipr: -----Expected Configuration----- 3ipr: Additional IOA Data: %08X %08X %08X 3ipr: Device Errors Detected/Logged: %d/%d 3ipr: ---------------------------------------------------------- 3ipr: Device %d: %d:%d:%d:%d 3ipr: -----New Device Information----- 3ipr: Additional IOA Data: %08X %08X %08X %08X %08X 3ipr: RAID %s Array Configuration: %d:%d:%d:%d 3ipr: Exposed Array Member %d: 3ipr: Current Location: unknown 3ipr: Current Location: %d:%d:%d:%d 3ipr: Expected Location: unknown 3ipr: Expected Location: %d:%d:%d:%d 3ipr: %d:%d:%d:%d: %s [PRC: %08X] 3ipr: %d:%d:%d:%d: %s WWN: %08X%08X 3ipr: %s: %s %s: IOA Port=%d 3ipr: %d:%d:%d:%d: %s %s: IOA Port=%d 3ipr: %s: %s %s: IOA Port=%d, Phy=%d 3ipr: %d:%d:%d:%d: %s %s: IOA Port=%d, Phy=%d 3ipr: %s: %s %s: IOA Port=%d, Cascade=%d 3ipr: %d:%d:%d:%d: %s %s: IOA Port=%d, Cascade=%d %s %s: IOA Port=%d, Cascade=%d 3ipr: %s: %s %s: IOA Port=%d, Cascade=%d, Phy=%d 3ipr: %d:%d:%d:%d: %s %s: IOA Port=%d, Cascade=%d, Phy=%d %s %s: IOA Port=%d, Cascade=%d, Phy=%d 3ipr: Path state=%02X IOA Port=%d Cascade=%d Phy=%d 3ipr: %s: %s %s: Phy=%d, Link rate=%s, WWN=%08X%08X 3ipr: %d:%d:%d:%d: %s %s: Phy=%d, Link rate=%s, WWN=%08X%08X %s %s: Phy=%d, Link rate=%s, WWN=%08X%08X 3ipr: %s: %s %s: Link rate=%s, WWN=%08X%08X 3ipr: %d:%d:%d:%d: %s %s: Link rate=%s, WWN=%08X%08X %s %s: Link rate=%s, WWN=%08X%08X 3ipr: %s: %s %s: Cascade=%d, Link rate=%s, WWN=%08X%08X 3ipr: %d:%d:%d:%d: %s %s: Cascade=%d, Link rate=%s, WWN=%08X%08X %s %s: Cascade=%d, Link rate=%s, WWN=%08X%08X 3ipr: %s: %s %s: Cascade=%d, Phy=%d, Link rate=%s WWN=%08X%08X 3ipr: %d:%d:%d:%d: %s %s: Cascade=%d, Phy=%d, Link rate=%s WWN=%08X%08X %s %s: Cascade=%d, Phy=%d, Link rate=%s WWN=%08X%08X 3ipr: %s: Path element=%02X: Cascade=%d Phy=%d Link rate=%s WWN=%08X%08X 3ipr: %d:%d:%d:%d: Path element=%02X: Cascade=%d Phy=%d Link rate=%s WWN=%08X%08X Path element=%02X: Cascade=%d Phy=%d Link rate=%s WWN=%08X%08X 3ipr: -----Failing Device Information----- 3ipr: World Wide Unique ID: %08X%08X%08X%08X 3ipr: Device Resource Path: %s 3ipr: Primary Problem Description: %s 3ipr: Secondary Problem Description: %s 3ipr: SCSI Command Descriptor Block: 3ipr: RAID %s Array Configuration: %s 3ipr: %s: %s %s: Resource Path=%s 3ipr: %d:%d:%d:%d: %s %s: Resource Path=%s 3ipr: Path state=%02X Resource Path=%s 3ipr: %s: %s %s: Resource Path=%s, Link rate=%s, WWN=%08X%08X 3ipr: %d:%d:%d:%d: %s %s: Resource Path=%s, Link rate=%s, WWN=%08X%08X %s %s: Resource Path=%s, Link rate=%s, WWN=%08X%08X 3ipr: %s: Path element=%02X: Resource Path=%s, Link rate=%s WWN=%08X%08X 3ipr: %d:%d:%d:%d: Path element=%02X: Resource Path=%s, Link rate=%s WWN=%08X%08X Path element=%02X: Resource Path=%s, Link rate=%s WWN=%08X%08X 3ipr: Primary Failure Reason: %s IOA taken offline - error recovery failed 0x%02X failed with IOASC: 0x%08X Invalid response handle from IOA: Adapter being reset as a result of error recovery. call to scsi_host_alloc failed! Unknown adapter chipset 0x%04X 0x%04X Couldn't register memory range of registers Couldn't map memory range of registers Failed to set 64 bit DMA mask Write of cache line size failed MSI test failed. Falling back to LSI. Request for %d MSI%ss succeeded.Failed to save PCI-X command register Couldn't allocate enough memory for device driver! Failed to save PCI config space Couldn't register IRQ %d! rc=%d Couldn't register reset workqueue Adapter timed out transitioning to operational. Adapter being reset due to command timeout. Microcode download already in progress Failed to map microcode download buffer! Microcode buffer allocation failed 6ipr: Updating microcode, please be patient. This may take up to 30 minutes. Spurious interrupt detected. 0x%08X Permanent IOA failure. 0x%08X Reclaiming async error buffers.Invalid dump table format: %lx Dump of IOA failed. Dump table not valid: %d, %X. Microcode buffer copy to DMA buffer failed has no path state information available8155: An unknown error was receivedCommand to be cancelled not foundFFFE: Soft device bus error recovered by the IOA4101: Soft device bus fabric errorFFFC: Logical block guard error recovered by the deviceFFFC: Logical block reference tag error recovered by the device4171: Recovered scatter list tag / sequence number errorFF3D: Recovered logical block CRC error on IOA to Host transfer4171: Recovered logical block sequence number error on IOA to Host transferFFFD: Recovered logical block reference tag error detected by the IOAFFFD: Logical block guard error recovered by the IOAFFF9: Device sector reassign successfulFFF7: Media error recovered by device rewrite procedures7001: IOA sector reassignment successfulFFF9: Soft media error. Sector reassignment recommendedFFF7: Media error recovered by IOA rewrite proceduresFF3D: Soft PCI bus error recovered by the IOAFFF6: Device hardware error recovered by the IOAFFF6: Device hardware error recovered by the deviceFF3D: Soft IOA error recovered by the IOAFFFA: Undefined device response recovered by the IOAFFF6: Device bus error, message or command phaseFFFE: Task Management Function failedFFF6: Failure prediction threshold exceeded8009: Impending cache battery pack failureLogical Unit in process of becoming ready34FF: Disk device format in progressLogical unit not accessible, target port in unavailable stateIOA microcode download requiredDevice bus connection is prohibited by hostNot ready, IOA has been shutdown3020: Storage subsystem configuration errorFFF5: Medium error, data unreadable, recommend reassign7000: Medium error, data unreadable, do not reassign3002: Addressed device failed to respond to selection3109: IOA timed out a device command3120: SCSI bus is not operational4100: Hard device bus fabric error310C: Logical block guard error detected by the device310C: Logical block reference tag error detected by the device4170: Scatter list tag / sequence number error8150: Logical block CRC error on IOA to Host transfer4170: Logical block sequence number error on IOA to Host transfer310D: Logical block reference tag error detected by the IOA310D: Logical block guard error detected by the IOA9000: IOA reserved area data check9001: IOA reserved area invalid data pattern9002: IOA reserved area LRC errorHardware Error, IOA metadata access error102E: Out of alternate sectors for disk storageFFF4: Data transfer underlength errorFFF4: Data transfer overlength errorFFF4: Device microcode is corruptUnsupported device bus message received3010: Disk device returned wrong response to IOA8157: IOA error requiring IOA reset to recoverMessage reject received from the device8008: A permanent cache battery pack failure occurred9090: Disk unit has been modified after the last known status9081: IOA detected device error9082: IOA detected device error3110: Device bus error, message or command phase3110: SAS Command / Task Management Function failed9091: Incorrect hardware configuration change has been detected9073: Invalid multi-adapter configuration4010: Incorrect connection between cascaded expanders4020: Connections exceed IOA design limits4030: Incorrect multipath connection4110: Unsupported enclosure function4120: SAS cable VPD cannot be readFFF4: Command to logical unit failedIllegal request, invalid request type or request packetIllegal request, invalid resource handleIllegal request, commands not allowed to this deviceIllegal request, command not allowed to a secondary adapterIllegal request, command not allowed to a non-optimized resourceIllegal request, invalid field in parameter listIllegal request, parameter not supportedIllegal request, parameter value invalidIllegal request, command sequence errorIllegal request, dual adapter support not enabledIllegal request, another cable connector was physically disabledIllegal request, inconsistent group id/group count9031: Array protection temporarily suspended, protection resuming9040: Array protection temporarily suspended, protection resuming4080: IOA exceeded maximum operating temperature4086: SAS Adapter Hardware Configuration Error3140: Device bus not ready to ready transitionFFFE: SCSI bus transition to single endedFFFE: SCSI bus transition to LVDFFFB: SCSI bus was reset by another initiator3029: A device replacement has occurred4102: Device bus fabric performance degradation9051: IOA cache data exists for a missing or failed device9055: Auxiliary cache IOA contains cache data needed by the primary IOA9025: Disk unit is not supported at its physical location3020: IOA detected a SCSI bus configuration error3150: SCSI bus configuration error9074: Asymmetric advanced function disk configuration4040: Incomplete multipath connection between IOA and enclosure4041: Incomplete multipath connection between enclosure and device9075: Incomplete multipath connection between IOA and remote IOA9076: Configuration error, missing remote IOA4050: Enclosure does not support a required multipath function4121: Configuration error, required cable is missing4122: Cable is not plugged into the correct location on remote IOA4123: Configuration error, invalid cable vital product data4124: Configuration error, both cable ends are plugged into the same IOA4070: Logically bad block written on device9041: Array protection temporarily suspended9042: Corrupt array parity detected on specified device9030: Array no longer protected due to missing or failed disk unit9071: Link operational transition9072: Link not operational transition9032: Array exposed but still protected70DD: Device forced failed by disrupt device command4061: Multipath redundancy level got better4060: Multipath redundancy level got worse9084: Device raw mode disabled9008: IOA does not support functions expected by devices9010: Cache data associated with attached devices cannot be found9011: Cache data belongs to devices other than those attached9020: Array missing 2 or more devices with only 1 device present9021: Array missing 2 or more devices with 2 or more devices present9022: Exposed array is missing a required device9023: Array member(s) not at required physical locations9024: Array not functional due to present hardware configuration9026: Array not functional due to present hardware configuration9027: Array is missing a device and parity is out of sync9028: Maximum number of arrays already exist9050: Required cache data cannot be located for a disk unit9052: Cache data exists for a device that has been modified9054: IOA resources not available due to previous problems9092: Disk unit requires initialization before use9029: Incorrect hardware configuration change has been detected9060: One or more disk pairs are missing from an array9061: One or more disks are missing from an array9062: One or more disks are missing from an array9063: Maximum number of functional arrays has been exceededData protect, other volume set problemAborted command, invalid descriptorTarget operating conditions have changed, dual adapter takeoverAborted command, medium removal preventedAborted command, command terminated by host!!ipr_probe_ioa_part2"5#ipr_alloc_memipr_save_pcix_cmd_regipr_test_intr5$Q$]$`$j$m$s$ipr_test_msiS p ipr_sdt_copy  = { ipr_get_ioa_dump  ipr_worker_thread ipr_add_remove_threadipr_build_ioadl6ipr_build_ioadl64ipr_dump_ioasa>FIipr_bus_reset_done(;ipr_abort_timeoutQipr_cancel_opipr_eh_abort3Z[aipr_wait_for_opsipr_device_reset__ipr_eh_dev_resetkqipr_eh_host_resetipr_update_ioa_ucodeozipr_copy_ucode_bufferipr_alloc_ucode_bufferipr_store_update_fwipr_store_iopoll_weightipr_handle_other_interrupt<Eipr_reset_reset_work'*ipr_reset_slot_reset_doneUYipr_reset_slot_resetipr_reset_bist_doneipr_reset_start_bist$$$$$$$$$$%4%=%a%o%z%ipr_probe_ioaipr_isr_eh e"n"ipr_free_all_resources%%__ipr_remove ipr_release_dumpipr_free_dumpipr_alloc_dump%%ipr_remove%%ipr_initiate_ioa_bringdownipr_reset_quiesce_done  ipr_reset_cancel_hcam_done. Q ipr_reset_cancel_hcamy ipr_reset_ucode_download ipr_reset_shutdown_ioaipr_initiate_ioa_reset1!Wipr_reset_start_timeripr_unit_check_no_data&ipr_get_ldump_data_section  [qipr_fail_all_opsipr_set_pcix_cmd_regx~ipr_reset_get_unit_check_jobipr_reset_block_config_access_waitvipr_reset_alert!#3ipr_ioa_bringdown_doneipr_dump_mailbox_wait ,ipr_ioafp_inquiryipr_ioafp_mode_select_page24>Iipr_ioafp_mode_sense_page24ipr_modify_ioafp_mode_page_28=ipr_check_term_powerzipr_ioafp_mode_select_page28ipr_process_ccnipr_get_free_hostrcb ipr_log_sis64_service_required_error ipr_log64_path_elemsss}}}ipr_log64_fabric_pathipr_log_sis64_fabric_erroripr_log_sis64_array_erroripr_log_sis64_config_error{ipr_log_sis64_device_error= > A F G H J M ipr_log_path_elem///555:::@@@FFFQQQipr_log_fabric_pathipr_log_fabric_erroripr_log_ext_vpd_compactipr_log_enhanced_dual_ioa_error]]]ipr_log_enhanced_array_erroripr_log_enhanced_config_errorRXZZ]`cipr_log_ext_vpdipr_log_enhanced_cache_erroripr_log_hex_data@ipr_log_vpd_compactipr_log_dual_ioa_errorwwwipr_log_array_error   #ipr_log_config_erroripr_log_vpdipr_log_cache_error./1457:ipr_handle_log_data| ipr_process_error IViqipr_ioa_reset_doneipr_set_supported_devsipr_ioafp_mode_sense_page28ahipr_init_res_tableipr_ioafp_query_ioa_cfg ipr_ioafp_set_caching_parametersTaipr_ioafp_pageC4_inquiryuipr_ioafp_cap_inquiryipr_ioafp_page3_inquiryipr_ioafp_page0_inquiryipr_ioafp_std_inquiry$ ( 2 ipr_timeout $ipr_ioafp_identify_hrrqipr_reset_next_stageE I V ipr_oper_timeoutipr_reset_cmd_failedipr_reset_enable_ioaipr_reset_restore_cfg_spaceipr_init<'d@ 0@@2104-DL1 XXXXXXXXXXXXXXXXP2104-TL1 XXXXXXXXXXXXXXXXPHSBP07M P U2SCSIXXXXXXXXXXXXXXXXPHSBP05M P U2SCSIXXXXXXXXXXXXXXXXPHSBP05M S U2SCSIXXXXXXXXXXXXXXXXPHSBP06E ASU2SCSIXXXXXXXXXXXXXXXXP2104-DU3 XXXXXXXXXXXXXXXX2104-TU3 XXXXXXXXXXXXXXXXHSBP04C RSU2SCSIXXXXXXX*XXXXXXXXHSBP06E RSU2SCSIXXXXXXX*XXXXXXXXSt V1S2 XXXXXXXXXXXXXXXXHSBPD4M PU3SCSIXXXXXXX*XXXXXXXXVSBPD1H U3SCSIXXXXXXX*XXXXXXXX3Z ADDDDJJ]] ?@@NZg  1233>@ACDDDDDDDIDDDDJJgggggggn$%%%%&&&,,,N   ())))??LLgggggggggggggiiikkkkkkk''''''''''''''''''''''& ? S Z [ fast_rebootnumber_of_msixmax_devsdual_ioa_raiddebugtransop_timeoutfastfaillog_levelmax_speed @if9=J,d ,00,,(($$,d D @ p $ $(,\dhversion=2.6.4license=GPLparm=fast_reboot:Skip adapter shutdown during reboot. Set to 1 to enable. (default: 0)parmtype=fast_reboot:intparm=number_of_msix:Specify the number of MSIX interrupts to use on capable adapters (1 - 16). (default:16)parmtype=number_of_msix:intparm=max_devs:Specify the maximum number of physical devices. [Default=1024]parmtype=max_devs:intparm=dual_ioa_raid:Enable dual adapter RAID support. Set to 1 to enable. (default: 1)parmtype=dual_ioa_raid:intparm=debug:Enable device driver debugging logging. Set to 1 to enable. (default: 0)parmtype=debug:intparm=transop_timeout:Time in seconds to wait for adapter to come operational (default: 300)parmtype=transop_timeout:intparm=fastfail:Reduce timeouts and retriesparmtype=fastfail:intparm=log_level:Set to 0 - 4 for increasing verbosity of device driverparmtype=log_level:uintparm=max_speed:Maximum bus speed (0-2). Default: 1=U160. Speeds: 0=80 MB/s, 1=U160, 2=U320parmtype=max_speed:uintdescription=IBM Power RAID SCSI Adapter Driverauthor=Brian King srcversion=9E534974B4A3D7ABE00E3DFalias=pci:v00001014d000004DAsv00001014sd000004FBbc*sc*i*alias=pci:v00001014d000004DAsv00001014sd000004FCbc*sc*i*alias=pci:v00001014d0000034Asv00001014sd000004C9bc*sc*i*alias=pci:v00001014d0000034Asv00001014sd000004C8bc*sc*i*alias=pci:v00001014d0000034Asv00001014sd000004C7bc*sc*i*alias=pci:v00001014d0000034Asv00001014sd0000049Cbc*sc*i*alias=pci:v00001014d0000034Asv00001014sd0000049Bbc*sc*i*alias=pci:v00001014d0000034Asv00001014sd0000049Abc*sc*i*alias=pci:v00001014d0000034Asv00001014sd00000499bc*sc*i*alias=pci:v00001014d0000034Asv00001014sd00000475bc*sc*i*alias=pci:v00001014d0000034Asv00001014sd00000474bc*sc*i*alias=pci:v00001014d0000034Asv00001014sd000004CAbc*sc*i*alias=pci:v00001014d0000034Asv00001014sd0000046Dbc*sc*i*alias=pci:v00001014d0000034Asv00001014sd000003FEbc*sc*i*alias=pci:v00001014d0000034Asv00001014sd000003FFbc*sc*i*alias=pci:v00001014d0000034Asv00001014sd000003FCbc*sc*i*alias=pci:v00001014d0000034Asv00001014sd000003FBbc*sc*i*alias=pci:v00001014d0000034Asv00001014sd0000035Ebc*sc*i*alias=pci:v00001014d0000034Asv00001014sd0000035Dbc*sc*i*alias=pci:v00001014d0000034Asv00001014sd00000357bc*sc*i*alias=pci:v00001014d0000034Asv00001014sd00000355bc*sc*i*alias=pci:v00001014d0000034Asv00001014sd0000033Bbc*sc*i*alias=pci:v00001014d0000033Dsv00001014sd00000354bc*sc*i*alias=pci:v00001014d0000033Dsv00001014sd00000353bc*sc*i*alias=pci:v00001014d0000033Dsv00001014sd00000352bc*sc*i*alias=pci:v00001014d0000033Dsv00001014sd0000035Fbc*sc*i*alias=pci:v00001014d0000033Dsv00001014sd00000356bc*sc*i*alias=pci:v00001014d0000033Dsv00001014sd0000033Cbc*sc*i*alias=pci:v00009005d00000503sv00001014sd000002C3bc*sc*i*alias=pci:v00009005d00000503sv00001014sd000002D5bc*sc*i*alias=pci:v00009005d00000503sv00001014sd000002BFbc*sc*i*alias=pci:v00001014d00000180sv00001014sd00000264bc*sc*i*alias=pci:v00001014d00000339sv00001014sd00000360bc*sc*i*alias=pci:v00001014d00000339sv00001014sd0000035Cbc*sc*i*alias=pci:v00001014d00000339sv00001014sd0000033Abc*sc*i*alias=pci:v00001014d00000339sv00001014sd0000030Abc*sc*i*alias=pci:v00001014d000002BDsv00001014sd00000338bc*sc*i*alias=pci:v00001014d000002BDsv00001014sd000002C2bc*sc*i*alias=pci:v00001014d000002BDsv00001014sd000002C1bc*sc*i*alias=pci:v00009005d00000500sv00001014sd00000338bc*sc*i*alias=pci:v00009005d00000500sv00001014sd000002C2bc*sc*i*alias=pci:v00009005d00000500sv00001014sd000002C1bc*sc*i*alias=pci:v00001014d0000028Csv00001014sd0000030Dbc*sc*i*alias=pci:v00001014d0000028Csv00001014sd000002C0bc*sc*i*alias=pci:v00001014d0000028Csv00001014sd0000028Dbc*sc*i*alias=pci:v00001014d0000028Csv00001014sd000002BEbc*sc*i*alias=pci:v00001069d0000B166sv00001014sd000002D3bc*sc*i*alias=pci:v00001069d0000B166sv00001014sd000002D4bc*sc*i*alias=pci:v00001069d0000B166sv00001014sd00000278bc*sc*i*alias=pci:v00001069d0000B166sv00001014sd00000266bc*sc*i*depends=intree=Yname=iprretpoline=Yvermagic=6.13.0-rc1-MANJARO+ SMP preempt mod_unload @   ( ( (0(           (0@0( @   (0( 0(  (0(   (0( 0  ( ( ( ( ( ( (0hph0( h ( (    (0(  (8( 8 (0( 0(  (080( 8    (08hhh (08H80(   (0(  (080( (( (0(  (0(   (08@80( @ (08H80( H80(  ( (   (0(  ( ( (0(  (00( 0 ( ( (080(  (080(  (080( 80( 8 (0(  (0( 0 ( ( (0( 0   (((( (( ( (( ( ( ( ( ( (08H80( H80(  (0`0( ` (08P80( PPP (08P80( P80( P (08H80( H80( H80(  (08@@80(  (`( `( ` (08HHH80( H (08XX80( XHHPX`H (08h80( h80( h (08p80( pPP (0880(  (08X80( XX (0880( 80( 80( 80( 80( 80(    (08H80( H (08P80( P (08P80( P X X (080( 8     (X( X (X( X (0880(  (X( X (0`0( ` ( ( ( (08`80( ` (08X80( X (0880( 80( 80( 80( @@8( 8( 8  (X( X(  8h80( hH80( 8( (  (0( 88( ((((H80( H`0( `PP@`HXhX80( 80( 80(   HX (0880( 8   `X80( 0GNUGNUK4 :rOM@%LinuxLinux]2X;,[%$ "iffifxifif 889 9:9\9`d=<=V=_=R=S=TJ;JUJWJ]J^JJJJJmJJtJuJJJJJJJ$$$$$$$!iprp+++M+^MpWpc!'{p!'p!'p!'p!'int!'c!',p!'*p~s8o~u8~s16~u16,~s32;~u32J~s64~u64dcE 4!)p!)+!)!)1c!)2c!)H!)I!)X!)]!)^!)_!)`W/pp!*%!*'S!*)!*<c!+ J!+}!+!+!+ #!+#p!+%!+&!+*+!+4!+=!+B!+]c!+^+!+h;!+nJ!+qd!+} Z!+ d!+ d!+ d!+ c!+ c!+ d!+E+ +!+E+ +Z!++-+2+2+R+z+z+z+RzW+M+++ 4/+W;?-@, ,3,c,c,  ,G(, c,,!c0,( 4,)P48,*cH,++P,,X,5 `,6 d,8 h,: l,; p,< t,=cxFse,?R@\rt,@Sdl,AT ,BT ,FWZ,I1E ,J+ ,Kc ,OW ,XW ,]WZ,`"P@ ,d7 ,hc ,kc  ,l+ ,m  ,n'W  ,o,W( ,p'0 ,q X ,s` ,ub ,x d ,yVh ,zp ,{6W ,+ , , ,  , ,  , ,  ,  ,V , , ,  ,O , ,D(Z,1EP\mm,yh ,yp ,*Xx ,  ,  ,  ,  ,+ ,c, c,, c,, c,, c-, c-, c-, c-, c-, c-, c-, c-, c-, c -, c -, c -, c -,"c - ,+ ,*\pid,  ,  ,+ , ,  , , ,( ,0 ,@ ,XP ,XX ,  ,"X ,%Y ,(Y ,+  ,- d ,. d ,3 d ,4O ,6zO ,: ( ,=+0 ,>+8 ,A d@ ,D dH ,G+P ,H+X ,KM`Z,NN ,T`Z ,W`Z ,Z`Z ,^P[ ,k &3 ,mZ[ ,pD  ,qD( ,t+8 ,u+@\fs,xd[H ,{n[P ,~x[X ,[` , _h , h_p , Hx , H , H ,K ,+ ,  ,c , ,r_ , N ,c ,rG ,L , d , d ,4 ,! ,V ,E( ,8 ,|_@ , H ,_P ,0`X ,:`` ,`h ,`p ,+x ,` ,GM ,c , d , d , d ,G ,8 , ,` , , J , J ,"` ,)a ,  ,  a0 , 478 , cX ,%a\ ,:a` ,47h , ,Da , , , ,  ,!c ,"c ,# ,$+ ,& d ,' d ,( d Z,) ,3Na ,Cc$ ,D+ ,LSa ,N+ ,Rca ,SJ( ,TJ, ,Y+0 ,] 8 ,^ < ,_ @ ,` D Z,aH ,dMX ,gma ,iL ,lwa ,w ,x ,z+ ,} ,~|a , d , d ,  ,  ,c$ , , ,  ,  ,+ ,c ,a ,a ,c ,Xd  ,c( ,c, ,V0rcu,0 ,G@ , D ,H ,GP ,dx ,G ,  , "d , d ,d , ,  , d, ,,>Z, ,  ,!"3 ,$"3Z,. ,<eZ,F@@+?- -!;key-";B-?((-A+(-B-(-C2(-=X->78.8.8.0c%H1 1 M1 1 1 "ij1  1 (1  $01 Ԧ81 7@1 !H1 !H1 !H1 H1 !H1 !H1 !H1 !H?@22222QP2h22M2M222 2c 247\kp2  2c( 2c, 20 2 8 2@ 2A 2B 2cD 2 H 2Pmem2@ 2h 2+ 2 c 2 2 2 2 2  2*  2/( 20 2c8 2@ 2cH 2cL 2/P 2cX 24` 2ch 29p 2 -x 2c 2c 2$ 2C 2c 2R 2c 2c 2c$ 2 2 c 2!c$ 2"c 2% 2&2 29c 2:\ 2? 2A 2D  2F  2P f  2Qc( 2T$00B3e(3f+(3g-(3h73u-3v;3w;key3x23U]3V 7%3jz.key3k<%3n.key3o<4;4<"4="[4? c [4@ c$[4A c([4B c++5B5C,5D,[5E, [5E,(js5E,,jdpl5E,-jp5E',/[5F,0javl5F,4jl5F,5jd5F,6jg5F%,7[5F+,8!6+!6+!6+!6+!6+E6 pte6!6"E6 5pmd6!6"%7%^7%%a7%/Ax7' .pgd7'a7'"kx7p .pud7pa7p"a7M@8H 8I+gkw7w08 48+8?@@9T9}3.sp9+.es9 .ds9"9$9&9+(9+09389+X9+`.cr29+h9+p9+x939+9c9J9+9+9 2Ffpu9 2@c(: y: '~?@@8gY~@ 8@558 gQ|8y8 ^7p| 8(8,8|0A8|88X8|h8%}p8+x8`{8 8}8'8Da8}8e{_; ;;_;!;,;,B;0!kval; U U ;D!7!!;,0!_<t!<<t!!+B<!(< UP!< !7!<D!!<!== >!>D!!>! ?s"?!??? ??c?+%,@".fmt@M@M@M@c@M@M$s"A6"(A7](A8zM8Az#AMAMAMAM1Ac1Ac1A4ckeyA9"(IcA=#8AU $AVmodAW $AXMAY$ AZ (A[ ,A\z#0MAuY$AvY$Aw^$AxcAyc"#+Wx$+ B/$B1csetB3getB56B7 4x$1&1 $11 ˪1 1  1 (1 01m81!@1" H1# ǫP1$ ǫX1%`1&h1'p1(x1)51*S1+{1,1-1.{1/ Ь10 11 t12*13 M15 19 =1; j1>51? 1@$ C!&C% C+ C-C/ Ic ''&Ic 3'     +'+!: ;^'!:?'^'+!D cF(     0Gc(GdMGeGg=Gi [Gl` 7&((8H 8H IcIE)E(I)I)valI JI!J I"JI#dI$) JBI*)(I+&)(I,#*J)JJ )K*KcfK ;)EI'U*I(I)!)7)I.dE I1*I2*I3I4 I5+I6+*B(I*(I%E)(I/*(I7U*8I+I+fnI +7*++*+L+L+M`+MdendMdN;+jcsN=djslN?djwfeNAdNE.,jssNGdjstiNId[NKdjnmiNMd[NPd [NSd0[NVd8jlmNXd9[N]d:[Ndd<BN[,kcsN,kcsxNd(N`+BN,kssN,kssxNd(N+Ng-r15Nm+r14Nn+r13No+r12Np+bpNq+ bxNr+(r11Nu+0r10Nv+8r9Nw+@r8Nx+HaxNy+PcxNz+XdxN{+`siN|+hdiN}+pN+xipN+7.,N+spN+7[,O -O O -,pP>.cwdPJswdPJtwdPJfipPJ fcsPJfooPJfosPJP>.PJlJN.+_P*r.ripP+drdpP,d_P..fipP/JfcsP0JfooP1JfosP2J BP).UN.Ur.B0P@.(PA.(PB.J.+ P$/cwdP%,swdP&,twdP',fopP(,7.P5JP6JP9/ P</$P>..J/+J/+?PQ0cwdPRJswdPSJtwdPTJfipPUJ fcsPVJfooPWJfosPXJPZ>.P[lP\mP]nP^ormP_pP`qPa0xPbJ-0+d0+%@P:0P; dP< dP= 0d0+?@@PO11APP. PQ0 PR11@@1d+@P^1<P_-:P`.<Pa/:Pb0@<Pc11|+?@@PfK2PhcPkcPndPqd.xfdPtdPwcPzcPcPcAP@1@@%P2P dPcPc fpu@P2PcP+P2P2PK2 PK20AP1@@1Q &3Q dQdW63+ Rx3R R! ͻR" R#633+33+33S>3S?+S@+SAJcpuSCJT84T9)4T<)4T=)44BU<P4(U=c(U> U:4U;47.4srcUA, dstUA ,444BV4(V!V474!V4EW 4W!!W"48!888!8%8'8,8/48385898<8A8D8H8L8Q8U8Y!X !6(XV6XcX XV6X !Xb6g666c6X#6X$4X%!X' 68YZ"6Z#7Z&7Z'7Z' 767[ 47[  \)v7\*'\+!osq\-7 \/h]h]h]^!7^" c!^&7^D7^D7!^D7^E8^E7!^E7E^T 68^Y8^Z 4!^[8__f8_4_ _8_UB8M_8gf8_`38`4Jlen`4JB`28U8(`6d`1878`88B`i9(`j(`k96`rT9(`sR(`t6`uM`R,:`Tc`U8`V6`W1:`X8 `Y]=0`[b=8`_".>```Ah`a+p`bxq`d878`mR`n7rd_u`v#9T9T9?x1{]=1| 1}1~ N1 O1c 1k1k1! 1A(1*X01 81+@7H1 L1 P1 CX1 C`1 Ch1Jp1Jt1Jx1J|141111 r1J1i1+1+1R1111,1, 1 1 1 0 1@ 1H 1 P 1 T 1 X 1 \` 1hZ1;Wp 18H 1 P 1(X 1 ` 1h 1 p6:r=+'M@`)>`1B`1B`TB`|B`B `B(` B0` B8` B@` BH`tCP`CX`C`r=)>?@1A11 11+1  1Ԧ(1!Y01!^81c@1"rH1+P1+X1+`11:h1ip11 11&1#11$11161 1 1 `{ 1  1   1R 1c  1(Z1z` 1  1J 1C 1C 1!J 1" 1/  10  11 14 + 16c 1<47  1BM@ 1D".>H 1FRiP 1I'X 1L` 1O d 1Rkh 1S7p 1Zpx 1a 1brcu1c 1dj 1f47 1k0Z1n4@@ 1oH 1q4X 1r`3>Ic`B1B1:cBJBJBOB,:86BwBJBcMwB8YBBJBBB1:B4B1:B4B1:]=B/B1:/B aE.CaF1:aGAaHaI=C=CBCBGCboCmntb =Cb 1:GC.CCCoCyC1:C1:AC!cc Cc CcM d3DdcdcdMdMdMe[DededM(eDrcteCe&D 3DIcfDgDg DDh Dh(i 1Ei i iMjfEj+jfEjfE1Ej Ej fEjEjkEjfEM kEqk 1Ek Zk EkEIcl FM@l'Fql(El) Z l*F(l+G0l,8l-9l.:l/;EFFFFM@@m/Gm0m1cm2  seqm37m4Fm5E m60m7 Z8F(n]Gn Rn+n mGnJ 4hGhGG]GoGoo oGGEp GpG+G+!p8GqGq !qGr+3Hr,r-xsuHsuHsc`s+hmaxs+p+H+ Et HsigtG!tH!uR!uSHH!uU!uVHHv I(v (v !v HEv'9Iv(v)Ev-wIv.v/v0 Iv1Ev5Iv6v7v8 IE v<Iv=v>v?v@ vA EvS$JvT h$vUvVE vYHJvZ h$v[ Ev^yJv_+v` va BvJJ(vL(vQ (vWI(v\$J(vbHJE vEJvF7yJEvgKvh_fdviEvm1Kvnvovpc  v%K(v*I(v29Ik_rtv9wI(vBI(vdJ(vjJ(vqK_0w Kw w w w 1K0w K7K!wKKw $Lw!w" H w%fLw'Hw(+w.Hw0 H w3Lsaw4$L x Lx /x +lenx +x (yLy ^z$Mz%z'z( 0zDGMzM#LzP(zW)8{ M{d{d{d{d{d {#d({,d0|)M|*d|+EP|8 N|9 N|:cH|;cLMN+M8|DSNq|E|F47|Gc0M }>N}K}Z}p}}}end}NWNd+E~ Nval~!~ NE~ Oval~ !~ N%,SJO,U d,V d,W!]c,[zO%0,hO,i7,j,kJO.cpu,lc,md,nd ,od(% ,2P,+,,,%,]P,+, J5@@,P, d, d, d, J, J,+ ,+(,+0,c8?@,R, d, d, d, d, d , d(, d0, d8, Z@, dH, dP, ZX, Z`, dh, dp, dx,  d,  d,  d,  d, d, d, d, d, d, d, d, d, d?@,S,2PA, 1E,! d(," d0,# d8,%@,&P,'Q,(R,)S,, dX,- d`,. dh,/ dp,0 Zx,1 d,3 d,6 ,7S,9S,;S,=+Favg,G]P@RS%0,KdT,L,M+,N+,Oc ,P$,Q&,SdT(Sa,]vT{TTTT5,`UA,a1E,h d,i d ,j d(,k d0,l d8,s Z@,t dH,ucP,c,c,c,c,c,c,c,cA,FXA,F.rq,V,iT,U,Ta,^UVVTrqV%,hVC,c C,c C,cC,cx,V,,,,,Vb,hVs,J%,V,VV,VW WV'W+''1W51*X1]=1Q1i1 @1 D1 H1EP1+`1 +h1)p1+x1 1411i1 ;Wpidp7X9 G:c; 4<1:ino=d?j @7@B6HrrcuC`Dzp/XRX+ XcgXMo[Zp'uidq Ngidr O s Nt Ou Nv Ow N x O$y c(z0{8|@}H~PXP[`P[hP[pP[x pKgY[ZkeyP[G]g semi(P X7` Chuid Npgid Otix|~ +7}7eZU[_[i[s[}[X^ __G` ab ce6 h8kK@n7Xq`sdthwpxctz^x1c1cc77qF Zitc$$M$sh$ $X$tty$$ 68$d$ d$d$d$d$d$O$+$+$+$'+$+ $+($"+0$,+8$+@$+H$"+P$,+X$+`$+h$GMp$$$$$ c$$$$$y$47$i0[ h_4G6 %_m_w_%__%@0`N N d  (*,-0_5`Xc`d'e g k 4mQn(o70qj8?``K``% a`a5a+5a?aIa+ca+SNhara3Ha+aa0c ,.Q0@(ZH PX`$$+$47$ cbdi $($h$p$d$ evn$c$c$c$c$$c$4$s$Y$$j$kcdi}$bb$!$d$ > $((aMhyXdzq|c}@sgrWr(G0+X#Es`c@4d5d6 7+8+9 ;c(=c,>0?8]dddde2!eVe e!" [$cH'f(Mkey)z*f+ ,(-0. f8ext/ f@7!eVe!3M 8^ftp9^f: ;J<Je!K;gJ c B ddino)d dev* (+ ,uid, N0gid- O4. 8/C@0CP1C`2Cp3d4d5J6J7d8d9J:J;JIclg+h,!- "nh#nid&-+4+7aMR>iS\iU\iXYZ cc G dX(rrcueHgXj`idmpptqMxr1:uai+RiRiWinhh>i'i G !"iBi(4(ii7ic(06j1'7'osq97;!<hhhhhVL7@! jj4jjj j'jIcSk+IcWk`@ XqkrjsG wqvkHcpuwPk]cq\nenfcsdagph!ipnxD pE~nF pH I47(J4HK47PL+pM+xN+O+P+Q+R+S+TU+V47WX$Y $\+$]+$^k$_np~np+(mn8!3=pBp[p[p+`p6p71p8[p9Bp(0(0E"p#;$%E' q()E+0q,-B!^q(&p(*p(. q q7popsq70qqq2q4+6c7c Ic@qIcHrpRrqqrsWrRr_rq+rq+rU\rrM@@sr+++  (,@s0rrcu8qsHr^qqsidJssd+sss(s!Z E td& )ildt*t8.+@947H:h;up= xC,|D"~t u+alt+++ +(08@HPX`hpx !tu!Fs_8\u8^ 8`cB8Xuklru8YUu(8d(8eB8iv(8j +(8k+_(8RNv7u8h*X7u8s+ _(8uv8z+pp8{v8|+8}+8~' v_8v8+_8v8fw8 fwӃref8XH+hcl+pops /x7v(8QwUvUNvUvUv8B8w(8c(8 x8 w.val8+a8w8Mx8N 8Pct8J$xlru8KUwt8WIx<8X <8Yw@8Gx8I+7x8U*X8V + 7$x(8[ 08\ 48^+8@8FxUIx:8j(8mBy8n+8o+8q 8r 8s 8t 8vc @8layUx:8z08}y8~+8+8 8 8  8 ( 8y8+8+8@8|zUayUy:858D?zgxgBy@gya8+?z51 [{1 1 41  1 1*X1  1]=(1c01c41`Z81GC@7P1 p1  x1#T1$ 1% 1'YgQzQz%85{.ctx86{{%8={8>fi8@N%(8X{8Yi%(8\)|8b+8h+8t=8w 8}$8Q|8+8+8p|U)|:8t8|<8Lz<8?z 8|Frb81E8+{|%$b}$c $h $j$k$q $s($t$0$uB8$wV@${H$~P$~X$`$h$p$x|}{{%8 ~8d.cid88 @@8 $~8 x 8Y~88+8 a@@87g ~@8i@8+P8+X8+`8+h8+p.pgd8  x8) 85 8?78E+8Lc8S 8Z!8]'8_8a48pi8r88+ 8+ 8+ 8+ 8 8+  8+( 8+0 8+8 87@ 84D 8+H 8+P 8'+X 83+` 8+h\brk8+p 8!+x 8+ 8+ 8%+ 80+ 8< 8L@ 8a 8u 8+h 84p 8kx 8 8p 8`{ 8&z 8+ 8+ 8 8  8  8s 8' 8j 8 8+ 8+ 8' 8 $~}+L+3s\+\fofu+d+a8 c%p$/:7$7:(.pmd$9 0.pud$; 87@$EH$FP.pte$L X.ptl$Pi5`$T h]c8 @`````h6h9h<hG8<+22++ +(0<F%,- 4/ 0Q03݄4:678 xa9Q   " $4M@@-:lru/݄0' 2enr3ns4eD7z+?d+E vald!Ic ЅЅ  hNOSX+S!6!BMlrrcumnGo _vΆx,y BuUkx+(r/t+7Ά9>M //u j(( oC+!P[P[4jkeyP[9(1EB2( C( C_(}++9> / B((U2  +t ݈<CU݈y Gs+0'8R@uid NP'X `$ "h Ggid Od+(rcuy@@mgmh!cpumicmjcmkc [mlc[mmc[mnc[moc[mpcmrcmsmtmucm{ Z m|F(m} Z0m~F8qm@@ZVF@ +fL+?8 ! "+#d#d $+($+0'(d)d01 2 3 CDL$MN$8Q^R STX)s+X+ H+֌M06q M` hrrss ֌T086@ X fn 4arg +E b!! JBS(T(UՅW(XRYM8IQqJ iocK`7̍g \c0?  + c(c,G0c4Q8H!X!X!X!XX4`dchpx\dev( r0  4 8 @ 47H\id h +p x  G j   7  G ! " #47 &0 (44 )8 *kH -A\fq2K 3 547 647 747 =  >40 @4\tdDU8ZF@ K6P P47h RI S U1: V1: W1: [47 ] QE 5val!E Xval!A!<p4{{in+vM8_`'ab[c [d rrcue reff{0dE 2v +!%]cTzՅ++ ynzI ӓE. 0 !4ӓ 4+5c6+7T;;+E@JO^%01pǔ1q`{1r 1s Ş1t 1u 1v,$7r(B1(1 N(1 5B1 (1 O(1 XP11c1 7ǔ7 1 1C1C(1C81 `{H%Э(@)R*+ ,0-47@. 4`/ d0Ah1͖p2 x3+4!E cval @!LIc6!BBE͖kuidF NkgidG O(H cD7JoHq      ( 0 C8 C@H;+ c(c, 0 8@% ;! $;%@89ؘ:ؘ;ؘ<ؘ= >(?0@ 8@ؘAĘݘA͖%XDEFљG HI J(Kؘ0N 8O@Q1HS PљA4֙]=]=c1]=%xY%Z[d\d]d^d _d(`d0aZ8cZ@dHeLfdPgdXhd`iZhjp%8cccc ccc.ino  r( r0%c%+% zccc cccc%X#Fؘ__ؘ (0Ý8@H_PzFAC(_AcK}A}dA͖6ÝAܝAܝȝ8 B c i B0 RH\ops!b ]=R+qb+r+t1w<1}<1 4ŞY%11121K1 d1 ~ 1(101 81 @1 .H1 >P1 X1͡`1h1 p1 x171d1 t1ʞ  -`{-zK*X 7d*X-P4ttyi`{*Xci-`{*Xcc-f*Xf4-.-4>-3WYW\(+,-./ 77 C͡*X---ҡ-4-7*X-#UU`{_Zf<4t`{iYWyt1<1j<1c1<17:1t1<1!<1 &4]= t1\<1ma<1a<1 /<1 c\f?@1Zޤ1[ɮ1\1] 1^(1`F 1bn(1d01e81fȯ@1hH1jP1kX1m@`1och1pp1r x1s۰1u1v1y?1{]1}111pޤ%(11`{1 4.pid1X1D.uid1 N1N 1$% 11 +1c1c 1c1c1 t 1<147<1 d 1)T:1*<1+4<1,<1-27md+a1P?01æ11 1 A1æVԦ+%1T1<1 1 1 Q1j 1~(1 01 81ؘ@1H1P1X1`1޲h1p1 x11111 =1 e1~1 1 1 ٦T#hmw|)* f+ f,c- . /+(0 09 4:*X8< @=4D> H? P@dXA47`BCE F47HIK qQW++W;+$a1HMuuMdcz%11 ;.pos1 a1 c˪`{`{/Ъ`{M/Y/c4% mN `{urq`{ǫ`{c+`{̫]=`{`{m5`{S`{:q`{qvX+`{++++eЬma`{c`{macլ`{i %M`{/4bb`{gxRbufR/R R R R  R (R 0R478opRXR`RhRpR=`{`{cj`{`{cBco/c1:ɮ]=1:cM1:]=hή ]=k(]=F1:/-n]=1:K1:]=1:s]=1:ȯ]=1:M]=1:ͯ]=1:@]=1:]=1:c^1:^ ECJctfh1:/Ѱ]=Ѱddְ]=]=1:`{c?]=`{!k]1:D1:kb1:1:%1 .mt1 i1 +]=Ʊ]c1-]=<A-4Q]=Aj]= V~]=o4AA AԲ1:ԲٲAY/b1:=A/eAMByy]=jAWi1:ԦMɳ!+@&@&AM&B&C&D &Ep(sd&F(0&Gfi81&Ic1&Jc1&Kc1&Lc1&Mcbio  q 748 @HPdX ` hpr  t x@mendM++ m(m0&m8h%jj!+(,--.. //01  Gidcls\+%Ȳ @\W+^ȷ+Wݷ+^+$ݷ^+ I+kENrev+In(M(  (Mrrb1Ens0c8< >7H@idd` h{prrcuxn oops9!C (%h4X h"$ % & ͻ(( 02 89@: H= P@"XA @`o4>B vkdir(S(-vDkn(`{b 47 47@`h /x    @  A %}SSD4hS]bmbb4ͻbS/һq S"S@S'Ici0'ż(E) L* м+, - 4(iʼռG&GMG BGmH(Gn(Go&%XG0G1G2 G3 G4k G5 (G7 ž0G9 8G; ž@G= HG?PHH=$[B*Xe`{/pž`{/`{ʾ`{%G@G ^G ^/EMcIc&5ȿ`& && 4&& Xȿ0&tk&u &v&w!&x*&y &z (k4u@(ż4!& &}4&~4&D$&buf&T$& /D+/T+?We|+&&&&eMW +/(X+++++ M0rrcu12fi3 d+ HIJK LM+N X?@.p7HMPLX.bus`h p x47A@ < A K \msi$( Z8 _@ dH dP nX  s` h ~x        \idJ 4    !! # m $ %  '# )+ `, a- b. c/ d9 e< f:;!<%I]  m!]"]#] $](%]0&]8']@(]H)]P*]X+]`,]h-]p.]x/]0]1]2]3]4]5]]N4mb]U]cl%Hx6y 4zc|c}47~0;@6?8zC  C !C "C #C $C %C &C 'C (C )J4 X @ @ A B C D EAFPdj6  c                crr d d d d    (\qos0+,Mid-./4 0(1G02+X3 Z`4 Zh5 Zp6 Zx7 Z8+9+:+;+<+dev=1> 1? z4;%3.ops] C] m m\4C3\cHMrNMOMP!Q!R! T(U0V]8W m@X mHY mP[]X\]`^h_]pa]xc]d mpmfha`aMbusbd $eMg hk$j(k0m]8n m@o]Hp mPqXr]`s!ht!ppmvxw mpywIr`23M5!6!89 ; (< m0>]8@(@AHC PpmEX/44!&0XGYMZ![\ ^ m pm`(Ga+/f BB(D(E(FV(Ge(H(IQ !c"c Q[`_A7K B:(@fUjBN(O+(P(Q !* ;!. J%!!!!)!5M(BEBFMmodBG $opsBH!BI 6BJ BK7; 6/"BBLikargBM kstrBNkarrBOBVBWcBX/i B\maxB^cB_cnumB`TopsBa!Bb$yB&$yB&$M0(/q)/V1E@+ h+ c Y W+7`2-2.mod2/ $@20Hmp21P22XX825f2627 29 2; 2<(2= 0/ fM4 $M $4 $]c2>582E@.mod2F $A2G5P2p2q2r2s2tcFmtn2w% 22 2c2/2/EڅV@+&%fnfH>WMas"@Ic-G/!& i jk (m K##/ K#M-%cc+]c]c%8$ 0%O!A"TO]c1]cB]cO%c2d&Ye2f4g .lidh 2FPUddiPcmax@/0ops1"dev456(788Ic H!$!h`eHyyh4fiIcÅgetÆ|putÇ È ÉË Í(Î 0Ð8Õ1@ØEHÙEPÚYXÜr`ßhápærxéYë|ìîï ð!Q3RcidScT3Pfmghci0|m43333M3Mc13M$ME36Y3Jr3^3Mw3MMcc83 3c!hLubusMNOP Q(? (8@Pp.ops ~   e dev  c c u!! cc5IcY!"!"%(5647.len7c .cap8$t<<?` JK.busLMO  P~(Q0Sc8T<U>V@WBXcDYHZI\,J])P`3Xa`cJhdlemfngxhp.piniqj,rkc$xm)ndtPvyzc(|c-}c.~c/c0c1c2c3c4c5c6c7c8c9c:c;c<cc,3ccc Fdev \irqc 8  @cBc Bc Bc Bc Bc BcBcBcBcBcBcBcBcBcBcBcBcBcBcBcBcBcBc Bc!Bc"Bc#Bc$Bc%Bc&Bc'Bc(Bc)Bc*Bc+Bc,Bc-Bc.Bc/B YF  H  4L HP 7 X X c@M , c`McaM   ! \vpdq , cPO  m  ,  , J c`P  ,  , w Q ,0 2 \rom8  @ MH  +P #|X &$.)M    ( 0 8 @ !H#&P!X!`h 8.H+JX+h+hr+%(  ! "8#`$ m+ 48c`c)=cJe%;<4=aH c]cJ%8_laehk l o (r 0 q4 J!lIcE[NT Ze[4fw++_8+d+B/(8+U($0.vma$1$2 $3 +$4+$5+ 4t$><$? <$@ 54+ +++$cB++)+VG~+[MDaDa+c$+ ! C! +! c!c ! ~!c!c!'xsgl!(x!)c!*c 8GIcMMN fPcRc Tc!4% C_D OI _NsSs_eAB+C%i!`d!!cB( (cnoՅpcu#w x `z { ~c8 4< _@ jP kp Rxd+a2!,!84HH 4 i (60 ,!H@jmklenlwpmnopqrms t}(}++M@!+q&+@@+!H 48c=cBcG mapLTTM@@]?a6@msbqwc | $wsȁ(Ȇ 0Ȍc4Ȓ 8ȗ <$Imt>uvwxyz!} c%U   ( 0 8@H P X` hp $x! :JU_iHx%H @cD&Ha  ca] c%h?ijk+l+ncocpc qc$rc(sc,tc0uc4vc8wc<xc@ycDzcH{cL|cP}cT~cXc\c`cdchclcpctcxc|cccccccaLQjjc%P f@ fHod+%,0: : J B _ Js O  T (X 0] 8b @g Hn Pr ! X{D `ɀ ^ hɇ pɌ r xɒ ə fqg hik l^tagn o$qc(tc,u f0biow8x@7HXɂd`ɅdhɇdpɊxɑzɗ|ɘ~ɛ ɜɟjrefɠ ɢ+7gelv)dM$%7ccc??P.rqs   4<FP%I.ops.mapc8 c< c@ cD cH LcPcT X`7h47pnZ%y]c/cc>4c>c+c cc 99>%DEFGH+%4+cfc?/cc!y:c_&4O?4_Tsd4/x   Ic "(0@%=LM+Ic,     Ic`` ` ` ` ` ` ` ` ` x3[{Ic>!J ^!IcZBz({(|Bɫ(ɬR(ɭ4ɶɷ1E(ɸEɿicq )+EMseqcM>?@6g>@Lk@N'SX[+a e .fqgKm s y c ɂ Ʉ Ɇu  ɉ4( Ɏ60 ɔ X ɚ7` ɠ7h ɣcp ɥct ɫ x ɮR ɰR ɲ ɹ1: ɻ1: R]c&>@@7u94AF+%Tcc ]cz+7%! .rq"#5 5  ! 4J ? 4Z Z NO s  d 4  x 4        / 4   c 4! c D Icc& 4^ IcI r  c 4 Iw 4 b Ic$ h* 3cW a c $dM m(t4048@H HP HX H` Hh Hp \x z \      " 2* 4 K; _E N WXa g  q yM     " c$ c( c, +0 +8 @ D c@  cA  cC  cD  cE  cF  cG cL !P !X d` 6?86&') +40,i58.47@0`1p23X566#;7"E9fi:X<Z >  @c Bc Dc G H+ Qc Rc Sd \c e g h i j k lc mc nc oc p+ q+ z c { c| c c c c c c c c c c c c k k c c  +  +( 0 1\irqc4 8Z@Z0   ( 0Z8;(JKLMkrrcuOpQSZ+\]_`abdegsdbjpkm cp cu cv cw$}$~+$c$$ ;4,Mc (g/hi lm o0p Pr Ts 4Xt`upvrwtxvy+xz+}+idcclunπdρcσ cυφχWψWω47ϊϋόMύMrevώM$ϑ'$ϒ'$ϓ'$ϔ'$ϕ' $ϖ'($ϗ'0$Ϙ'8$Ϛ@$ϜJH$ϠcP1ϧ c 1ϭ c 1ϳ c 1Ϲ c 1ϻ c 1ϼ c 1Ͻ c 1Ͼ c 1Ͽ c 1 c 1 c 1 c 1 c 1 c ppr c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c 1 c $c\$`$ d$Gh$Gp$x$j c        Z Z  j 1       c c ;  47 V   ( H69\Muua4?HOPQRFdevS( Tfi Uc\idVc Xc Yc!\c"^c#`c$ d ( e , kc0 lc4 o W8 p@< q @ rH4 +42Kc7_PfYdb/ 66]c; @!Ic& IcB Ma'rrcublencd^,6]cBpC cID+p!(8   +  8  5 F  G.bus H I.lun J% O  P| Q0% T  U .sn V|%( Y!.vpd Z  [ ! S!+%0 ^?!.vpd _  ` ?! SO!+%, c! d h r s t u v w y  {%a  }|$5@ x"    A =   S  !  O!5 u#      G  G  S   t!   e.lun  e  u#   e0 O!8 %ad  u#h |xe#+5 #    G5 $  G  G  $$+ 5 B$Fhdr #Fdev  B$V!R$d+5 $A  #Fdev "$Vx"$d+$< "$< $$!x"% $.u $$: !!: #x"?( *%Fu $ *%;%|+5, %  G     0% & +  +  ~ + +  +( 0 @  4P i5X T` Jd Jh Jl     x }+ ~h$ C C C C C C C C C C C C C C C C C   L L  L  ,  " h$# -L0  8 h$<\u KH  ~P JX J\ h$` 2Lh p  h$ 7L  LL    \L J   , lL cT dJX |L` h +p x mH ,  ," J$ J( 0 8 L@ H jP jp k 6 6 6 L K L  ~ L =N QN h$ J  VN( [N0 c8 `N< J&S_5 &,      .cdb 0  G5 !Q, " S - S5 0, 1 S 2 S 3 e(7,: 8,< 9 ,V&,,+S,+ 5( 6,Fu :,5( =4- > e ? e @ e A ?!FX-< G S< H e(`-: a,: b(,5 E..a I4- J S K S  L S M S N S P S Q S  R S$ S S( T S, U S0 W S4 X G8 Y G:A [+< ] GT ^ GVFu cX-X5  g. h S i S j S5  m. n S o !5  rA/ s t u G v !%d yz/ z G { G | z/S/+5  0  S  G  G  S  S   S  S  S  S L0: .: .: .5 0Fhdr /Fu 0  A/, 0: .: .: .5 1Fhdr / | Fu 0( A/4% H1    % s1.hdr 1 s11+% 1  5 <2A =       S      G5 2.hdr 1  Fbus 2V12d+% 2.hdr 1 %d 3 O! 3, 38 %a`3+ &3+'% 3      t! %a     = %a %a% j4       =.cap  j4 z4+% 4   .len  44+% B5   .len  !%a #45 &5.vpd ' A (=   ) $ * D + d , 5S5+5 /(6.vpd 0  1%a(A 2= , 3 0 4%aX 5 \ 6 5 96.vpd :  ;%a( <|, = 4 >%a\ ? ` @ 5( C6.vpd D A E=  A F= $5< I7.vpd J  K%a( L|, M|454 Pd7.vpd Q  R%a(A S= ,A T= 0?  W7 X 7S7|+? [7 \ S ] S ^ _ 7(S7+?@ by8.wwn c ?! d| e f8 g y8X.cdb h ?!x i S j S k 7S8+5 n8 o  p   q @ r ` s 8S8+5 vC9 w  x ( y P z x { 8? ~9       S@  SD 3HFdev '9TVB59+?\ :    (  SP  STFdev 0:XV5!:+?h x:    (  SP  STFdev 2x:XV(6:+?\ L;      3@A &L;L  S  S    SZ &];Z = H |L |TV6];+ V6n;+? ;    (  SP  STA = X |\ |d  SlA /;pV7<+?( <    ( =P R S |T |\ !d 0 t! A (<V6<+? = .vpd  @  =`S#=+? ]= .vpd  @  ]=hSn=|+5  =  .phy    !5 B>  G    =  |  !5 >  G  .phy    GA $>Vn=>d+5 R?  G  =  = | R?  GA &b?b?+V=r?d+5L #? $ %t!@ &CA '!?DVB>?+5\ *@ + ,t!@ -CA .#@DV>$@+?` 1P@ 2 3 P@@S`@+ ;A: <$d7: =$7: >$8: ?$C9: @$:: A$<: B$8: C$9: D$n;: E$#=: F$r??  6\A 7 SA 8=  9 S.prc : S Fu G`@ TA: U$d7: V$8: W$#=: X$7: Y$!:: Z$<: [$?: \$$@?  JsB K S L S M S.prc N S  O e P e Q|  R e( S00Fu ]\A@?  `B a BSB|+ B: A: Accn!$rawsB?0  dC e i p t x t!  S  S   S  SFu B?  CA B  ~0 8 +H P 5 KD  S  S %a      G5 D  S  S  S  S DFhdr KDA DVCD|+5  EFhdr KDA EVCE+% gE.bus     J% FC C C C C C C .bus J J.lun J    , ,  O!  SD  eH dP  X |` +h p x? AG 2 z4d &3|.cap 3 4 H1Z ;%% hH + + + + +  +( +0 +8 +@ +H +P +X +` +h +p +x + + + +AG% I ! " # $ %  &( '0 )8 *@ +H ,P -X .` /h 0p 1x 3 5 6 8% ;I <J =, > ? @J AAGI% D_J E, F, G H, K,.cfg NdJII]c QJ@``dJ< eJ< fJ< gJ% Y;K ZJ \ ] ^ a c S.u hJ % kK lJ mJ nJ oJ  px]c sKK< K< K$R$x  L  LWL++-L+?JgEGLGL+C~\L+%lL+E|L+_J;K|L }fi ~+A ]QZ QLFL?` =NA -Fi pNs N  6( X0 GP jx  EO  EO QN QN , JO  ~  (  ~0 =N8\u $N@ &XH 'ZOP (+XLQN=NBN=N~KpN+N: N: NV&,N+?VQ,N+? N: L0: 0:O< iJ< GL< +< !+res "2L< #4EO=N:OZO+_%%( +O ,O -O .J$_OWO+5 1P 2J.len 4J 5J 6J  7J.os ;J =J5 AP BJ.len DJ EJ FJ  GJ.id JJ RJ50 UPFhdr VP W4? ZPFhdr [P \PJP|+5$ _#QFhdr `P aR?5$ d]QFhdr eP fJ gJ ? jQFhdr kOA l PA m!P@A n!#QpA oP4r=RFhdr sPFsdt tDu =RvJ$wJ(xJ,yJ0+% R J   /BR5 R  S  85D GS  S  S    =  4  &3   S0Flid #GS4VRXS+SM SNc SOc SPc SQc SRc SSc STc SUc SVc SW4 IZT+JTSZ$ZT _JT+ uTS T T+S T ^T+%TOT ^U+.TOU ^*U+ US*U O ^jU+ZUOjU ^U+ZUOU S*U O OjU ^U+EUOU ^(V+VS(V O ^hV+XVOhV ^V+)VOĒV Sȷ O ^V+VOV ^W+[WOW ^;W++WS;W O ^{W+kWO{W ^W+SWOȥW ^W+ WSW O ^X+WOX ^9X+U)XO9X S(V O OhV ^X+LXỌX ^X+XSX O ^ Y+XO Y ^7Y+l'YO7Y ^aY+ QYSaY O ^Y+YOСY ^Y+VYOY OaY OW RZ+ZSZ OJZ+ :Z")JZ xZ/eZZZ+ZZ xZ/ZZZ+ZZ x:[/[:[O[+?[O[ x[/j[[[+[[ M[+[ : H _   " L    )H \+3\ ?( ]+?\ $H X     ]+] #( #\ (  !^+2w&^ &^&(l &8 .'`p W' X' T1^)J^K_cTT+MG (_KtR_[N+Kr_L[NKL_MJ,9 _K_dK_d)_ J^+`cT* !`K&<`Jσ b`dTώ u`Tφ `Jύ`GX> ``M`6!K `6K `/MuKk+aX+GE .a.aM`gGf EaXT5caMcaMuT a cJaJϿ aKӣ aMM+T!axKicbx+J!x@bcTGyRbRbKcwbwbMRbKӬ/bMK bMcbK b/+Mu bMK@ cMG%=%ccJԵcJXg`6TX g6G gJgT+ gJ!xgxGk!hx+G 3h+G Eh+ )]K mhhGGv hXGh6G h6Jh,JhJAhJii,K 5#=i222) W) UG ;fiT.iMiMMu/K "+i e+K4 dii JJ ikjGF jhGmGcM`KӺ/!j/ : 9KTj/MuK `#jj2G jK+jMacGC]jMu 8j  G =j <G2 kMuG khGG83kMuTFkKXkk`cK- k[pJ*k) $MK, k[pK@kMuPQ'(l kk lU b^U =8'd:m/rc:'i(V l<'" <':m  klU T Q  klU  kmU Q  kkU "* ' n3nb ',[p '6*3buf 'C'=N'+'+'+ m'+'+ m' m'+'+'P& _˲w в&P$an{9$w *7,$}:GT a>x `U~T Q >lx+>#JVd>#/yJVd>ly `U7T Q >#yJVd>#*zJVd>#}zJVd>#zJVd>9{+> #JVdNʽ{ `U8T Q 1#{? LW>|>#(|JVd&>#JVd)#|7D+Υcܥ y}U~T  y9}UT  y_}UT  y}UT  y}UT  yU8T $ }$N~   N³Nѳ~ ҳ& $)5mA cU T~Q R$ab n %%% *7# D P ]S$e>϶ `U~T Q -W$9ERX$b n٩Y$g Ts#[$ ^U|T Q0R@A$X Y~-b$T9ERc$b nNOu Td$-gNa fYtfmu^} > N  ogU~T}Q2 _U g؃U}T0 MgU~T}e$)٩o$s T} gUvT0 kU T  MU~T  jU~T Q| MIU~T  kpU~T  fU|T~ kU~T Q| kU~T  kU T >   ȴ@(%+T "+2  "BմӖ,% >#"   h T7 hQ6 jT Y2%k#a x  mmmǾϾ׾#  ^ ˿ ֿ N   9T8Q >ֈ   9T8Q r" A R_T QX ""dp }Q ~~"# r_ˉU Q `R X0 BU~#Z (_UsQR X0# (_UsT Q~R X0X)#'"dp }Q~N1| 6 C 9U T@Q >  # 9TQ X" dp }Q~" (_UsT Q8R X0# (_UsQ~~R X0 #iǣԣ dUsX0:#ٍǣԣ dUsT X0>#Bǣԣ dUsX0B#ǣԣ dUsX0J#'ǣԣ dUsT X0 kSU T Nf kU T Z% "#"0 = H$T ^T Q0R@A$X~Ys grUvT} gUvT} fT|v%ܐXw%4dp }UQ ٩x% U TsRF% ّb nRG%b nRH% ]b nP%٩R%ܒ TsUU%%"c p }"F $ 3 > K(   & 2xNγݳ bԔU~TF jU2TFXgvNڕIJԲ jU4TFQG bU~TEQ X}V% ^T Q0R@A$XsY )\%\ ^T Q0R X Y %   gU}T| fٗTs fU} SdU T  j<U~T  jcU~T  7dUvT  dUv U~ dҘUv U~ d UvT0 j0U~T  PU~T sU~T cUvT< jU~T  љU~ U~ cUvT1 "U~ c:Uv TU~ clUv U~ fUv jŚU~T  ߚU~ fUv FeU~ :g)Uv 3eAUv eYU xU  YU~ gUv jћU~T  MU~T  gUvT0 kcKU T Q1 U~ kU T  kU~T  jܜU~T  jU~T  j*U~T  jVU~T Q@ k}U~T  kU T  j֝U~T Rs jU~T R& Hd+^  &~#) !NJ)fNu[ v& !)5mA cU Q R|٩!ԟ Ts U|T  <U|T Q  kUU T  kU T _&ޠq~ ^T~Q~:&<&+ ˧ק iU @Q|&٩=&ԡ Tv dT  dT  d1T f f]T f ɤUvd dТUv $ &|"#Q oe%%(%+'Ĥ  ]%" %:m  %" %:m R% ݣd+^   fT  fT  f:T f ɤ_Us kU T bkU T ^Ĥ+ e%w%*%+%+/i%%+'  %" %:m  %+%+#[l%%6%##%eg ogUvT|Q2 g@U|T0 MgUvT| {%+%+Lm?l%%6%#%eg ogUvT|Q2 g$U|T0 MgUvT|Lw/_wq%kre %+%+ %+%+ %" %:m R% ("d"  %] %٩%ܨ Tv%-gr%Z U}:%"H תU}~%#٪%r +!!   <UsT Q0&%  kU T  kU T ٩%L Tv%-g>%JVd % %J%r- Q ȷ Է TjUs- "-) 5AM٩%ɭ U T|٩% Tv2%@#P Mf"   gU}Tv fήT| fU}_eFe 3eU~ .Us e :gU~ k|U T  kU T  eدUs& U o k=U T ckiU T o^+ w0% (%<+%#iJ'X  %" %:m %" %:m *$ $*$!$+$$+$,rc$$T$T$T$+$+$c'W out{%s%s%s%s%s%s%s~% g$" $:m  $" $:m  ˲$" $:m  ޲$ $" $:m  B$" $:m  t$" $:m  $" $:m  $"  ѳ)$$ $" $:m  E$" $:m  w$" $:m  %" %:m  (%c(%c(%c)(% 4%" 4%:m  E=%" =%:m  eP%+P%+ a%" a%:m  ɵo%" o%:m  v%+v%+z%" z%:m *K$ jK$-+K$F,rcM$N$+,irqO$'  Q$" Q$:m  ϶S$+S$+ T$!  ]$" ]$:m  O`$" `$:m  d$ td$sd$d$6d$d$d$ ׷e$+e$+ j$" j$:m  ;m$" m$:m s$" s$:m =0$Hx2irq0$&0$12$+3$+iW 5$" 5$:m  :6$+6$+ 6$o٩;$ Tv k߹T QU FkUs'T3Q1R0*$ U$;+$,i$,rc$ 0$ $2+$,n$P# #?+#Lq#LT#&#Lb~l##6##F#L#&# og1UsTvQ2 _U| gcUvT0 MgUsTv&#-g#X3ko*#|L,#/,i#90# #2+##1,i# #! #! #!  ʽ#!  #! 90n# 'n#/+,pp#&',tq#,r#hHmH0X# YX#9+,iZ#9*" ".+",i",rc" 'W out4#sL#sI#sG#s@#s8# "" ":m  1"" Q,#,#5#" 5#:m [D*x" -x"3+z"=N{"-|" ~,i}"}" }" """"-0a" a"8+c"'  e"" e":m n"" n":m ^+0M" M"/+O",iP"P&" B&".+/i("+"ǣԣ dT X00"*ǣԣ dX05"ǣԣ dX09"ǣԣ dT X0Nf BUv 4UvXNfP" "3+/i "edNfNf0! !5+!+'  *!" !:m  J!+!+ !"  u)!!!" !:m ^+=!m!@!! !c   R! d&^  !r!N U|:!"H תU|~!  oUsT ٩!0 T} FkUs'T3Q0R0+-!; H UR! d&^  !A٩! Tv <UsT Q 0!  !2!+!+,i!!+!+=!-!<!+!+ !+!+R! d+^   !#!  oUsT ٩! Tv <UsT Q  FkUs'T3Q0R00! !,!+!+!+!+=q!_q!>s!+t!+ v!+v!+Rt! Md+^   v!٩y! Tv gUs=Y! Y!.=N[!+/i\!r`! Uv:b!"H תUv~+Xe!dp@} D  $ 0 iU|TvQ~0!! <!!8+"!iJ,i$!' 1!" 1!:m P r 9+ QN iJ =N/i r!  U|:!?"H תU|~ fWUsXrgP  0=N/rc J J +X dp@} D  $ 0 iU}T|Q~Us >UsUsH  4=N + iJ +/rc '   "  :m   "  :m  4UsT Q  k`U T  kU T Ht t 6=Nv +w L'Y  !y " y :m  S "  :m @ N"[ h u   g A" ^V  ( 4g |UsT Q R `= kU T  kU T =^ WJ^ ;=N` +a L gR1X0H& i& 3=N( +/rc) * i+ =N, ZO'hV  . " . :m #<3 Lf3  Q " Q :m U2 gt UsT Q  k@U T  kU T +H 8=N + =N ZO/rc  'X  ; "  :m L^  q   "  :m r  " U~ F  oU|T X Ddp@} D - $ 0 iU}T|Q: "H ת|U~ תU~ תU~ kU T  kU T * 4=N+'  o" :m " :m H s-=N+,^/rc'ȷ  E" :m  w" :m -9E hT4Q^ UsTN MUvT o kJU T  kU T = |i:=N+/rciN{^t&R b n UUTN* 2+T= 4};=NUHf f@=Nh+/rcii Vv" v:m h UsTN jT ^+"*Q dQ2=NS+'t  "U" U:m  5V!Y" Y:m ^t+de556j7=N8+9:+'t # 7 R<" <:m  rA+A+ E" E:m A٩D  JVdvC`,CC C C C U~T}Xh<dp-}$ Q % $ 0 iUsT|Q} J._U~QwR8 J.U~Q}R| 0 | $$$,(2&o U~ U~ U~P# %t#8+i X&" &:m bjT =  Q} 5=NU +H 2=N+TDnH/i't  o" :m  " :m  " :m FT arlJ U~Nn sPm"an{ T0:t"H תU~ǫ |ӫݫ-c Dq|& 'N> P*an{ T0&ǫzӫݫ-c Dq|& 'rB Uv:x"H תUv~-9ER b nR >b n-9ER b n-9EF R b n- 9EXdp }U| k4T  kMU| kyU T  kU T H F2=N++JTL+dit {" :m R b nXdp@} D  $ 0 iU}T|Q~R b n3 Rub n-9ER b n kUs kU T} Qv 0g g2+iZO meSTS4=NT+'hV  W" W:m XXdp@} D  $ 0 iU~T}Qc k+UU# kU T P5 2t55hG7=N8+9+#7 ;+;+ ;4٩BwX>@ D ȷ Է TjUsH- "-) 5AMU}H 5=N+-ZO'jU  X" :m  " :m   "  :m  $" $:m   UsT Q  kLU T  kkT  kU T  kU T * `3=N+'hV  1" :m " :m H 5=N+['jU  " :m #<       & ˯د  n" :m  jU[T0Q@ UsT1Q0XHo kU T  kU T W)+* 5=N+'jU  " :m " :m Ho  o3=Nq+r /caps 'hV  v u" u:m # w&Pwan{  " :m ; y~ M Z  g vr  s    UvT1QXH k U T  kU T z43HN 6 N6=NP+Q R6 'Y  T" T:m # V&PVan{ L a" a:m ; X M Z  g vr  s    UvT1QXL k U T  kU T 4*9  9A 9K,i;==e0=N<F~"-'  b "  :m  ," ,:m )`  % 2+   % 2 UsT Q  kU T bkU T ^+* >=N-+6 '  " :m  " :m  "  :m ^+ 0 @;=NS-H ;=NJ.= }05=N+-0/cap 'jU  T" :m  " :m  " :m   % 2&    % 2 kU T  kT  UsT Q  kU T &3HY %Y0=N[+/res\2L\#2L]($^^^/i^_'{W  Ua" a:m  h" h:m #j#j#j#y#y#;y m" :m # #####!#? q" :m PkͶ 6Q ;ȷ Է TjU|- "-) 5AM&X2 7dp-}- Q  $ 0 iU|TQswz5oFQ\ i v&5FQ\ i va{1"Ͷ% 6Q ȷ Է TjU- "-) 5AM&X< 7dp-}5 Q  $ 0 iUTQ}Wfi7)Ugt "Ͷ 6D ȷ Է TjU- "-) 5AM+X 7dp@} Q  $ 0 iUTQ}E""Ͷ 6*!D  ȷ Է TjU~- "-) 5AM&X8 7dp-}1 Q -" $ 0 iU~TQ}Q$"Ͷ 6#Q #ȷ Է TjU|- "-) 5AM&X3 7dp-}, Q $ $ 0 iU|T~Q 8|$U $UT z$U}o j%T  kE%U T  jd%T  kU T H: (:9=N<+' Y  &>" >:m  C&I" I:m 8/?{'F/S/`/m/z/ /+  % 2+   % 2 'UsT Q  k'U T  kU T H$ H($@=N&J.H +:=N+++'V  )" :m  :)" :m 4j*555(5"55 B5+g  % 2+   % 2 6*U}T$Q3 *UsT Q  k*U T  kU T H12H -9=N+' Y  +" :m  +" :m 8/ -F/S/`/m/z/ /+  % 2+   % 2 >-UsT Q  kj-U T  kU T H .9=N+JL ..= o8/2=N+Jit ." :m X.dp }Us j/T  UvT 0 /3=N S ~'-Ht 4t:=Nv+w+x'V  A0z" z:m L k0 0" :m 6{1"+6 86 E6+ 44,494 F4 S4 `4>m4W1 r4>4r1 44 "4 4 4 4 4 44Q6|2_6l6#e2 y6 6 6 6 6UvT(Q4 jT P5}<3^5k5 x5 5 5 5 5 63UvT(Q4 jT 4l4555(5"55 B5+g  % 2+   % 2 4U|T Q  k4U T  kU T 0Z P5Z4=N[S[\~\^-0+ 5+?+,+,i.. ,bus/50516'6 =" =:m 1E<2^6+60 Q6:+J,i0 66++,i,bus56't " :m ={7}7+UJ2lenJ7JJ1H ;4=N+;-/res2L' #78 i8" :m L8 8" :m 9)&w ,;:< <><9 <&Pan{v-< .< ;< H< U< b<Yo< p<&˯د _;  % 2+   % 2 ;UsT Q R k;U T  kU T ;%0} <}?;~ < -<      < HC CC0=NE+/resF2L/jG'{W  |=I" I:m #=T =V" V:m L=T (>i" i:m  Z>q" q:m rL> U|:N>"H תU|~ZO?+ ˧ק iU @Q۶/]@! @Q  @ȷ Է TjU~- "-) 5AM&> JVdXlAdp@} D A $ 0 iU~T|Q@phB& "˧ק iU @Q BUsT2 BUsT1 jjBT kBT  FkCUs'T3Q0R0 kACU T Q R V kmCU T  kU T H :G4=N+/i'  -D!" !:m  _D#" #:m  D3" 3:m %E+ "˧ק iU @Qs&r+IE U|:-E"H תU|~X1}Fdp@} D fF $ 0 iU~T|Q FkFUs'T3Q0R0 kFU T  kGU T Q R # kU T =MNH3H ++ G++ H٩ [H Tv `U T WH|+He Ye/f6h+/resi2Lj-k=Nl+/rcmnZOol Iy+y+#pK     #bK#~J #JLJ jU TQ R@+˯د  K++ K++L-%L&Pan{1v MC P+  @:| LW+ެ 4 Y  yFM"ٛ N UMgt>M +@ D oNȷ Է TjU- "-) 5AM٩=O" THO#0 >OU iU8T0Q0R0X07OI7PI7TPIwPsQss s s s s s s t t%  TQ5BuQ"R `QUg bU rRrr#R r r r s s s +s 8ssBPR"R `RUg jT  R"XSdp@} D S $ 0 iUT~QT   &xT &-9E٩T" T٩7U" dU"٩U" Ts٩ U"٩4V"XMWdp@} D AW $ 0 iWUTsQ@ iUTsQ@٩W" WT T|X:Xdp@} D X $ 0 iUT}Q@٩X" T ,1YUT0 hVYU| hnYU| hYU|e>g>,=N@+A6BJC+ 0ZJ+J+ PZQ+Q+EZ JZXN[dp@} D [ $ 0 iU~T}Q٩O[٩U>\X Qs\rR\gS*ggg g g h h7X]IOj^]jjjwj#^ j j j^jT j j jD.$^"D DD77Y^ID0^"D DD k^U  kU Tv|2$ kU X1_dp@} D _ $ 0 iU~T}Qi2ai i j j %j 2jN?j(` @j&P`an{Wg`i&W iןa&7 HIןa&7 HIן Xb&7 HIן($bן b&7 HIW(ci!h ue3h @h Mh>Zhgd _h lh yh h h>hc h hYh h& ˯د Yi* i )i 6i Ci Pi>]id bi oiY}i ~i& ˯د ן e&7 HIkfk k k k-mf;m Hm Um zfUs7o cmfUs UsT Q h hfU~mh gUsjj:TlgHת hgU| hgU|mh0 !h/+=N6,res2LJJ* i/=Nii i      h,, h      }i,, iL000X OjX,=NZJ[!,res\2L]i^J`0 k0+=N3res<2L,i,J J i! +"'X  "k>" >:m  TkF" F:m I" I:m 0 k1=N6,res2LiP Z-m4=NZO+ Al++ jl-ml;m Hm Um lUs7o٩m"XX Uv0 cm6=NiJP {+n}:=NU-i ~8&Pan{P =7o+=NZO+ n++ n٩ o"X "oUs 7oUvPd ord-=Nf6/resg2LhJRLpo o o o o zo epooo poo&o˯د ןtUq&7 HIX|Srdp@} D T QTRQ bUUT *HFC+J,rcHJ'X  " :m  " :m " :m H ɒ+6+/rc+'  " :m  ++ D" :m yՑ   $ 1 > K X c pRdHb n7f}Ir jƎ UN@m F` m>z" Y :sH תUXdp@} D n $ 0 iUT~Qןϐ"&7 H"I fU~ EaU TsQ  ^?U}T  kkU T  kU T  kU T Q R ٩? tU|f  kU T  kU T = o0E+++/rc r++ ٩*G #G,6I=NJ+,resK2LLiMJ,iNN OZO'W  ”Q" Q:m  " :m " :m e 2t 2hG"=N#=N$+%i&+' #ܕ" (" (:m  .)+)+ `;" ;:m  )٩+ؖX٩:" T| fi`U Q0R  fxUv T Q ckЗU T  kU T h1=N+/res2L'{W  " :m #L֘ " :m Xdp@} D  $ 0 iU}T|Q~jj k?U T bkU T H }2cmd/6/rc+/res2LV d}#   6_H"U#  b o | XϜdp@} D  $ 0 iUTQ@ fUv ^UvT  k6U T  kU T  EaU TsQ  kU T  kU T  kU T _,ŪŪŪbf * 616+,res2L,rc'{W  " :m " :m *  1+3res#2L=N-iJ'  ۟" :m " :m ^+ He 2cmde06g+h+/rci'  ˠk" k:m  m+m+ q" q:m Lslyy6y#yeg ogU|TvQ2 gơUvT0 MgU|Tv z+z+ 3" :m  e" :m m٩xݢy-g zG٩ Tv ʣUsT jT o k"U T  kNU T  kU T Q R *) 5)1+)@*I,=N-,i- .+/ZO01X'  b3" 3:m  8+8+ L+L+ ԥZ" Z:m  [" [:m a" a:m I=N5* /=N=N * ʦ+=N:= #j0+/res2L+/rc s++;  N ĭYҭ ӭן&7 HI٩ߨ Tv٩) Tv fiU TsQ0R = p52limu+/res2L+ $++YwwWԪi٩ T٩h T@ yR_l  3jUvT0Q  U}ha fibU TsQ0R XvoP U3/res2L++ ++5٩xX*|#2L|E~+,res2L ҭPd d4fg+fN  aUsj" " / <QIN4  aUv>Id NY\ ] p -ѵ *ݵn -ѵ*ݵ&l -ѵ*ݵ*O#2LlOHQR+,resS2L \UU=3 $)}3.U}4T5f}5YR8787 8 f>B>B=2dev2 #2bufM+/res2L+/len   9++ nw" 3 > K U|٩ B T} jqU|T0Q: fiU Q0R =O2dev1#2buf+/+/res2L+/len  z ++ ϵ٩ Tv bU|T Q =2dev6T#2buf`/+/res2L+/len  * J++ ٩ɷ Tv bU|T Q =2dev2P#2buf\/+/res2L+/len  ڸ ++ /٩y Tv bU}T Q =j ˻2devj6jT#2bufj`/lm+/resn2Lo+/lenp q l s+s+s٩}9 T| brU}T Q  TQ0 bU}T Q o=H{2devH7HU#2bufHa/JK+/resL2LM+/lenN  J ƼP+P+ P٩TE Tv bU|T Q =9 979A aUsTTH  ,`{ B  2buf /2off  (+/rc ۾ ls~#8   N/  & &    Y$ % fU T N7 x < I afU  mfy@ĩΩ@ǫ}ӫݫ@cDq|+ '٩ T}N 0  ) afU ٩z T}+ ˧ק iU @Qs,  + +   v$ %4  FS eT QH# 3@ .   bVU ~ $ &T|Q0R X} NfnU} kU T Q R  C    >$" )j+֡ɡ Ϣ" ߢ@ä # դ>     ( 5 BNO P&"˯د  T~Q~Ne3- f q+ ֡ɡ Ϣ" ߢ@ä # դ>    ( 5 BNO P&"˯د  T~Q|  gU~ua NfU} wfUE bU|TdQ R} |bU|T: WbU~T| k0U  OUvT}@bo jT @b jT Q|RW+c=a a5+bLd+it Vf+f+#lii6i#ieg ogUvT|Q2 gU|T0 MgUvT| .j+j+ `o" o:m  z" z:m LmVl6#eg ogUvT|Q2 g;U|T0 MgUvT| v++ f j٩h* Tvi_-g  oUsT0٩  Tv>-g s٩٩y Tv٩nJ Tv aR1X0 jT  jT o0< @<4=N=L?-@sAx,sgBx,iC0 6=NL- dt!x,sg"x,i#* u5L !3lenJ,i,sgx'hV  e" :m  0 6L*L96L'    " :m Hwo2devw7x#2bufyMy{|+}+H~+/iijU { O" :m  " :m  " :m  ++Aдڴ bUvT:QHv٩ T}" 33 > Kc$UQo" 3 > KcUQo gU| $ &55$s"# dU| $ &55$s"#Q  k#T  kBT  kaT o=^Y 2dev^6_!#2buf_-/ab+c+/lend 5a Uf+f+f٩h T| bUsT Q =76 2dev778%#2buf9M9$;<+=+> ; C+C+LplGG6G#Geg ogU}T|Q2 gU|T0 MgU}T|C٩FG T|G|-gE  oUsT0 wfUEo=2dev7%#2bufM$+ + /i   ++Lpl6#eg ogU|TvQ2 gUvT0 MgU|Tv٩Y T~-gr U|: "H תU|~j  oUsT  wfUE aUvT Q6o= s22dev 6 $#2buf 0/  + +/len     + + ٩ $= e2dev 5 ##2buf M "  + +/rc    , + +#l  6 # eg ogUvT|Q2 gU|T0 MgUvT|  + +Lpl  6 # eg ogUvT|Q2 gU|T0 MgUvT|  + +   R٩  Tv -g ,  oUsT0٩ n" Tv -g ٩ ٩ b" wfyUE cU o= Z2dev 3 !#2buf M   + +    + + ٩ , T|" {3> KbUQ jUvT0Q:=p bB2devp 2q !#2bufq -/s t +u +/lenv  ms  x +x +x ٩z   T| bUsT Q =M 2devM 3N !#2bufN -/P Q +R 0S +lenT P  4V +V + V i٩[  T| bU}T Q =( v( ,`{( B) 2buf* /2off* * (/dev, - . +/ +/ret0  ,  -  62 +2 +2 k٩5  T| fUvT}QPX e / 3j + L +' #}    "  :m   + +  + +   + + A  "  :m   v   + "˧ק iU @Qs ٩ .  T|٩ q XT Z `@A-O+[gq@~ Q}   -  #.&  ŬYϬ Ь e: UT1 eUT2٩   T|(  ((#W ( ) ) ) +) 8) E) R) _) l) y) ) ) ) ) ) R !b n٩ k T}٩  T}T  ` cU  4k p} >, L,Y,,  ,+M ^i t  &"  3 > K&   & 2O+ o]+j+, :, )&7v G+M ^i t  "  F3 > K Uȭ׭N2' jNUOTD U#lTg, u,, ,+, ,x+ ++, ;,v+ + + + + +Y+ +& ˯د ," =,٩B  T}٩  T}٩R  T}kb W} ,n ,,,# , - - - *-^7-Z D- Q- ^-N~-_ - - _U T0>- - --a ٩j ) T@ kiU T Q R S  J.UT}"Rv2&eg kU T Q R p  J./U|T~R2$ jT Q~  kU T  jT  jT  jT  kU T ٩ S T| + |G;D@eǨ+Ө E + 3 & 3O  Fal&  &  ŬYϬ Ь eUT3 &U  ٩ X٩ 7X   oU|T `g kU T bkU T e & 7j +/res 2L  +/bus  /lun  'hV l  .   `  "  :m   + +L    + +L   !  '! + +LQ!  ! "  :m   !٩ " T| 7"٩ z"X٩ " T| " <%Ͷ 6 $D #ȷ Է TjUs- "-) 5AM&X? 7dp-}8 Q $% $ 0 iUsT@Q٩  % T| <`%TsQ}R~ `%U~ u` &U~ b`!&U~ !`E&T2ckq&U T  kU T e ( + L + +/i '  5'  g' "  :m  ' + + ' "  :m   '٩ 1( eU(T0, 5+ @+            ,     0 g, 7+ @+0 , 8+ @+ 00 ,3hdr C,P*> J.> -+? +? #JA B ,rcB B B B *C +D +E E+'  -P P + -S " S :m  -_ _ )_ .a +a +p " p :m H e3 ;+ J + J TL/i  iX %/ "  :m  W/ "  :m e31 0"w3"33"3 3- /9E&R b n- `09E- 09E- 09E- &19ER h1b n- 19E- 19E- "29E- X29Em + 2y 3hU ƧR& 2b n 3Usf3 @  *3Usf3 @  jI3T  jT * 3 @+ J + J,i *  4 3+ @ T  +* J4 7+3bus C K,res 2L,ste $4 J 4  O*a 443resa /2L,ic ,jc c d <,stee $49e? 72t? 1hGA =NB +C +' #5A  5E " E :m  5F +F + 6I " I :m  :6V " V :m  F o6٩U 6 T|R 7  oUsT  jA7T ckm7U T  kU T e 9:2t ,hG =N! +" +'aY #'8  Y8$ " $ :m  y8% +% + 8( " ( :m  82 " 2 :m  % 9٩1 \9 T|/ 9  oUsT  j9T ck:U T  kU T e B 0=N + GL JQ Ji : "  :m ۶ G< ;D |;ȷ Է TjU~- "-) 5AM+> JVdX I=dp@} D 2= $ 0 iUTQvC =CC C C C U|TvX >dp-}+ Q > $ 0 iU~TsQ} -?+ "˧ק iU @Q|&B AB#A BNB? B BBYB B۶ SA! AQ @ȷ Է TjUv- "-) 5AM+> JVdY;C " > :m  EA " A :m  EF " F :m  FG " G :m  OFH " H :m  FJ " J :m M " M :m 0& F& 7+' GL0 PG F+ GL $PG'  "  :m $@0 bH<+ GL$bH$gH,cfg'lH,i 'X  H" :m  3H" :m " :m ?>=0 J;+GL,i $J)J J'  *I" :m  \I" :m  I" :m  IJJ I" :m  J" :m  DJ" :m  vJ" :m  J" :m " :m <6J+0 K6+GL$K"L,cfg%L,i 't  K" :m  K" :m " :m r?B>n=0_ M_5GL3cfg`*lH,ib,jb cdef'  ,M Ls" s:m  Ls" s:m s" s:m  ^M}" }:m  M}" }:m }" }:m 0 Q3GL3cfg-L,i,j  !'  Q bN/" /:m  N/" /:m  N/" /:m  N5" 5:m  *O5" 5:m  \O5" 5:m  O:" ::m  O:" ::m  O:" ::m  $P@" @:m  VP@" @:m  P@" @:m  PF" F:m  PF" F:m F" F:m  NQQ" Q:m  QQ" Q:m Q" Q:m 0 R7GL)gH,i,j 'hV  R lR" :m  R" :m " :m " :m 0 V5GL%L,i,j '  U S" :m  S" :m  T" :m  CT" :m  uT" :m  T" :m  T" :m  U" :m  =U" :m  oU" :m  U" :m " :m " :m 0n Vn8+oGLq$V'  zVw" w:m  Vw" w:m w" w:m <0P WPA+QGLS$W'  ZW]" ]:m  W]" ]:m ]" ]:m #=05 bX52+5C+3len5M,i7'  3X= = @" @:m 0 Z5+GL,i$Z'Z J'  Y" :m  3Y "  :m  eY" :m  Y" :m  Y" :m  Y" :m  -Z" :m  _Z "  :m  Z "  :m #" #:m :60 U]>+GL,i $U]0Z] J'V  v[" :m  [" :m  [" :m  [JJ ,\" :m  ^\" :m  \" :m  \" :m  \" :m  &]" :m " :m n;70 Y_6+GL,i(Y_$^_'t  ]" :m  0^" :m  b^" :m  ^" :m  ^" :m  ^" :m  *_" :m " :m B5C90p ap<+q GLs,ist3au$ av'X  `{" {:m  A`" :m  s`" :m  `" :m  `" :m " :m (6!:0H bH?+IGLK,iKL1bM$b'6  aR" R:m  aX" X:m  bZ" Z:m  EbZ" Z:m  wb]" ]:m  b`" `:m c" c:m 590( d(5+)GL+$d'  \c." .:m  c/" /:m  c1" 1:m  c4" 4:m  $d5" 5:m  Vd7" 7:m :" ::m 80 -f>+GL$-f'V  e" :m  6e" :m  he" :m  e" :m  e" :m  e" :m " :m 8P %f2vpd1fiȷ f" :m  gfUsbkU  0 g+/GGL3vpdf'jU  Sg" :m  g" :m " :m P $l2vpd)$l@iaY#"i8 8   8  8 8 h h&˯د #Ej8 8  8 8 8 i i&˯د  wj" :m #k8 8   8  8 8 k &k&˯د  k" :m  kkU T@ klU T@o 0  o'/CGL3vpd$lͷO,snͷ'  8m      m m      m zn      Zn n" :m  n" :m " :m 0 4o3i"3buf+/ey.=N+GLJQiȷ o" :m ۶Gq! pQ |pȷ Է TjU}- "-) 5AM+> JVdXIrdp@} D 2r $ 0 iUTQyLyyy y^y y y>yr yNyr zUU?sgt>zZs z_pt@ D sȷ Է TjU~- "-) 5AMX4audp-}, Q wu $ 0 iU~TQ}qu+ "˧ק iU @Q|&jtv+ ˧ק iU @Q|&WmxͶ 6wQ >wȷ Է TjU}- "-) 5AM&X9 7dp-}1 Q x $ 0 iU}T~QcxT1 yUsT 8|%yUsT z=yUso jT Q"~H0H%$!0)(8/0<  z<:+=GL,res?2L@($A SCJ yM zM\ P 8|res=2LU 2L!+#z+Lz+1={ -ѵ*ݵ'{ -ѵ*ݵ&) -ѵ*ݵP ;2res=2L-;#}     z \} ~}&˯د L L     z ~ ~&˯د #     z  &&˯د #     z R t&˯د 5QFQ\ i v@yR_l  3jނUT0Q  Us fi-U Q0R Xo$*/6+ !/3len&,p/=/w(!8/2lenD/i/p/ 3jLU}T Q $ &Q  3jUsTvsQ * 3res:2L1;PM 2resM;2LN2;PQ+R2L#vb b b b b zb bbb bb&b˯د #ćf f f f f zf .fff Pff& f˯د #kL k_bq~ iUv(3-  9ǠYѠ ֠_|q~ iUv~(3- _Lq~ iUvˊ(3-  iUs0  1 /+ ;!GL#=N$-* ^3+cP 4=NmG J+1v aUs T Q g,ŪVdX ΌUsT QvR| 3aU~0 @-=NA~3len JsdtP /4=NbmhUU# P )=NEOmG:JXdp@} D  $ 0 iUvTQ@Ə   & &-9E kߏUs ,UsT0Q00 4/=N+ ~VՓV2+X=NX=NYZO'  ܐ[" [:m #^#^#6^ hq" q:m `- Q  ȷ ԷTj- "-) 5AMr ]Ғ U}l WhU~ :oYH תU} ,U~TQ  kU T bkU T PC =C/=NE+FZO PH+H+ Hy٩J"X ̔Us UvP, Y,1=N.6X6&dp@} D  $ 0 iU}T|Q~h hKUvmh* Ӗ5+,rc't " :m * M6+,rc'hV " :m P f?+ J/ir U|:'"H תU|~ i -9E-9ER'b n&- 9E==Nٛ<+=NٛY U*gt>E +@ D ۚȷ Է TjUv- "-) 5AM&I#0 >Us iUs T0Q0R0X0*=N@ZO=N 0 >0=NEOPs }s2=NUu-viw ~x8{&P{an{Pb R,b0=Nd+e+ g+g+gʝ٩i XUsPF ^kF+=NG}GJQI-LJ+Kc+M@:| LW+ެ 4 v * o o'J qJ* Tҟ T5GL Vҟ W!= * F3res F@2L* :3res ::2L* *73res *?2L* W3res ;2L* w3res A2L* 3res D2L* 3res B2LW 8d;p 82 { :  : x : eR%;cmd566GcWcB;cmd76W#x_;cmdA6* @3dev*!3dev= 0""0"="M3len" ,to"/ " " " " " " """"")"R#Ϣ6#/W#6#2R3633=+2dev<Ed/rc _UvT| _UvT|03dev5A ~*)3dev7C[N3gfp!0aRa4a@*\r\5W4646L64B65[NW!ä;sg!8x*$$E *::7Ra-;valad6aXeRCR;valCc6CXeW;c|6;|ret;cWΥ;irqc6-T6D+6M;dev03dev3>*3dev:*pM73devp9W&WMT6&W>R%em6%e(cR8682+* % ; G*(3nDNZ *|.4|D|Pc*%cl<)*z0>zCzX+*6j*3wq8kj0  4j >W+60hGW>T6>)6>6R+m6+*R6+RT;xT7XSW! *C!Ө3rCCe*1!3r1Ee1MY*A3i"3r1e9Y,old0[3r-eR~;r/e67YR;i;r(e60YoldR{٩;r{-e;n{40@i5T+++0:9i50V5i50vrv7i50]]3i5*D(5DCi5G+Ū5+G)ת5G'5K +5G5G#5W 0@6 H+R%c*x3i3v+xW;i;v+xWxǫ;ix;vx$xRA;vAx;iA*3i"3v/x*:3i"3v/x*1c3i13v1(x03vx3i!*3v!W[ެ;i[6;v[Cx{] WS;iS7;vSDx{U R2;v7x;i>WM;v=/53p 43q 9R       )  )  ȭ)  ׭)  )  ) 9 ) 9 ) 9 ') 9) 93p $3q ? R     )  )  )  )  ή)   ) 9 ) 9 ) 9 ) 9) 9 /)  >)  M)  \)  k)  |) 9 ) 9 ) 9 ) 9) 9#P #: $  %  &  '  ( () U 7) U F) U U) U d) U  y) U9 ) U9 ) U9 ) U9) U9 Ű) W ԰) W ) W ) W ) W ) W9 ") W9 2) W9 B) W9) W9" :     )  )  )  ı)  ӱ)  ) 9 ) 9 ) 9 ) 9) 93p 9R  ,ret  g)  v)  )  )  )  ) 9 IJ) 9 Բ) 9 ) 9) 9 ";p AR6 T{  {  ret  x__p /{ {  {  n  n  n  n  n  γn 9 ݳn 9 n 9 n 9n 9* #B 3 C  W3!_63<* + 8 e L+,val +GW;ndW ;s5M6Ec;resZc$R';nr',6'H7R@;nr*6FR^c;v^O|6^YRP;vPJ|6PT*3x(* &+ѵ A+RH;nrH6H1R4;nr464/W"K;key"JP6"Z(<K* s s6) u -* j j8 jV0 3۶ 352 420  42R 6 /2R )6 72R X6 226 K2n R };new 426 K2R ;new 126 26 2n W j6 jF2ret l{ o2{ p2W A>;new A@26 B26 C2ret ER #o6 #52 dn %n &R;ptr<|6H6W,Ǹ;p,;|6,Kcw$UTw}/ƹQ  $ 0 iUsTvQ|wB9U  ğ+ T  ğo  ĺ  kU T  MUvT  kU T oWWWW WNX  X %X kU T||2$o >";&>VJVdW˧ק iU @Qs Q   kU T  kU T oYýk x Y$ k x  jT  hT7hoHZ gH NZ g kU T Xc kU T w33^3T 33@ m y!hR Cb nv3 3&m  y 3hU XAw@P9R_l y0 3j$UsT0Q  UvwŦЦݦ ݦ+  beUUTT o Ĥ Ѥ ޤ   ^ 8NH; ` m>z Y ٩Bc< "LNCO R` m>z. Y ٩VP " `U|T k5U T  jTT o kU T  kU T  kU T o1   M٩ +G;D@wǨ+ӨE + 3 & 3O  Zal&  &  ŬYϬ Ь eUvT3 &Uv٩XckU T  kU T o%  kU T  UsT X kU T w?m!Qm]mjm wm mm m+?m ' Qmjm]m wm m m m 'Nm  m٩''g T~Nm m'٩)' U T} 9U  fQUs }T Q o  ( 5 #  ( 5f % 2 UsT Q R kU T  kU T  kU T w-mm;m Hm Um  % 2&"   % 2 cm6UsbUUT Q R poI    kU T   UsT0Q0Xd kU T o)$; H) ; H kU T  UsT1Q3XH kU T w;   #     #X(dp@} D  $ 0 iUTQ@X)dp-}1 Q  $ 0 iUT~Q5  % 2&    % 2?   &? &-9E fUv ,UsT0Q +XAdp-}, Q  $ 0 iU}TsQ~w)lKDlQl^^l^klO^xlF7l >lll ll lvll&˯د  oo&o>8m =m Jm Wm dm qmv~m m& ˯د  oo&o>m m m m n nvn n& ˯د  o,o&o  ğ& T  ğ@Jy"R_l  3j4UvT0Q  Us8 kU TvQ RXOYF jT Q RXOYF kU Y oovCCC C C CD D DD    ğ+ T  ğ@  y"R_l  3jUsT0Q  U~8V IVV (Vwk  ğ+ T  ğ@wy"R_l  3jUsT0Q  U~8WzWWW WcuU~TT#o jUv jT QvR| U~T~f7l  k&U TsQvR| kU YvV VV W]  ğ+ T  ğ@]y"R_l  3jUvT0Q  U~8f_ffgm  ğ+ T  ğ@y"R_l  3jUvT0Q  U~8 5U~Tsf7l  jmT Q R|X} kU TvQ R|X} kU Y W`=WWW WXo jUUs jT QsR| kU TvQsR| kU YsUG (cGpG }G G G G G  ğ+ T  ğQQQ#d Q Q Q Q R^R>4R>9RS  ğ+ T  ğ@yR_l  3jyU~T0Q  U~#@5yR_l  3jUsT0Q  U|8@yR_l  3jU~T0Q  U~# T~#Q~fy0 jT Qs $ &4$"Rv $ &4$" kU TsQvR~X~ kU Ys $ &4$"+@yR_l  3jIU~T0Q  U~# kU TvQ~ LL(L# 5L @L KL XL eL^rL>L>Ls  ğ+ T  ğ@;sWyR_l  3jBU~T0Q  Us@syR_l  3jUvT0Q  U|8@;syR_l  3jU~T0Q  Us kU TvQ~R~X~Y~ TsQ~fy0 jcT Qv $ &4$"R~ $ &4$"Y~ kU Yv $ &4$"}  ğ+ T  ğ@}yR_l  3jU~T0Q  Us@}ZyR_l  3jDU}T0Q  U|8@;}yR_l  3jU~T0Q  Us (TsQ~fy0 jUT X~Y kU T}Q~R~X~Y kU @Jy"R_l  3j4UsT0Q  U~8W WWW WXo jT Q~ kU TsQ~ kU Y~J J K K &K 3K @K KK!  ğ+ T  ğ@y"R_l  3jUsT0Q  U~8RS SS %S 0S ;S HS US>uS6>zSu  ğ+ T  ğL  ğ+ T  ğ@y"R_l  3jU}T0Q  U~8@y"R_l  3jjU}T0Q  U~8 kU T}QsRX|Y~ U~ kU T}QsRX|Y~ GU~T~8Q~fy0 kU QsRX| jT QsRX| kU Ys jT QsRX| +U~T~8Q~fy0 kbU QsRX|Y} kU Ys kU Ys jT QsRX|Y} kU Ys jT QsRX| kU MMM# M M M NQC  ğ+ T  ğ@Qy"R_l  3jU~T0Q  U~8>*N=>/Nf@w  ğ+ T  ğF  ğ+ T  ğ@Fy"R_l  3j{U~T0Q  U~8@@-y"R_l  3jU~T0Q  U~8 kvU T~Q~R~XY~ U~ T~8Q~fy0 kU Q~R~X~Y}  U~ #U~ kU T~Q~R~XY} jT Q~R~ kU Y~ jT Q~R~Y}  U~T~8Q~fy0 k[U Q~R~X}Ys kU Y~ kU Y~ jT Q~R~X}Ys k U Y~ jT Q~R~Y} kU T~QsR~X~Y~ jT Qs kU YsW0WWW WXo jUT Q~( kU TsQ~( kU Y~(F =FF+W) WWW WXoc_ q_~_ _ _ _ _^_ kU Q| kU  U~,TQ0 kAU Tv 2fYU~ kxU  2fU~4 kU  2fU~ kU  2fU~XF FF GW WWW WcU~TT#o kU T~bX pX}X# X X X X5FQ\ i v kU  gUs kU  k;U T~ kZU  kU Tv kU  kU  kU  kU  kU _] m]z]#P ] ] ] ] kU Q| kU  gU~ gU~$ gU~ g.U~L kU Tv kuU Tv kU  kU  kU  kU a  a+a#'  8a Ea Pa ]a k U Q| k U  2f U~ 2f U~0 2f U~ 2f U~X kU Tv kL U Tv kk U  k U  kU b 8 bb c k U  k+ U  gC U~( kb U  g{ U~ k U  k U  g U~ k U  g U~ck) U oqH  HH#  H H H H^H HNI  I I5] FQ\ i v 2fu Uv kU  k U   U~T~Qfy0 kU T~ k$U  kIU T| knU T| UsTv4Qfy0 kU  UsTv,Qfy0 kU  kU D DD# D^EWI WWW W U~T~Q WK UWWW W U~T~Q@WN WWW W U~T~ kU T~ kU  k!U  FU~TsQ0 keU  kU T~ kU  kU  kU d vdd d kKU  kjU  2fU~ kU  2fU~( kU  kU  2fU~ k/U  2fHU~ckgU oZ ZZ# Z Z [ [ $[>[ [ [5FQ\ i v kU  2fUs kU  kU T~ kU  kCU Tv kbU  kU  kU  kU  kU jj j T Q| k8U TsQ|o kjU Y| jT ohoz ht z  kU T  )Uv FUsT0 kU T o r6! U|:8!$"H תU|~D!+ "˧קbiU @QU#&c<UUT  jT  4Us FkUs'T3Q0R0wo boUUTTYH! 5A!:!F ^! q!q ! ! Iint F ,! *!,s8R,u8e,s16},u16 ,s32,u32,s64,u64P \!   1F 2F Hc IP X ] ^P _ `:!! <F  '   o   #SB! %{ & 4 = B h n' } 1  ;  ;  F  F   $1  XXX0xx : JKL Wx K  s \x2MH  5  G "V y  ( ;$0 t8 ]@ "H "H "H ~H "H "H "H "H%@    0  RP h  5 5 F @  E F 10kp J  F( F, @0  E8 B@ BA BB FD  OH sP9mem T@ t   F 0 e j  t ~  ( 0 F8 @ FH FL P FX ` Fh p  x F F @$  F  F F $  F !$ "F % &r' 9F : ?0 A0 D } F  P  QF( TE$0N  ; cs =;sl ?;wfe A; Ex ss G;sti I; K;nmi M; P;  S;0 V;8lm X;9 ];: d;<  cs   csx ;    ss   ssx ;   g r15 mr14 nr13 or12 pbp q bx r(r11 u0r10 v8r9 w@r8 xHax yPcx zXdx {`si |hdi }p xip x  sp   B  C  D  E   E (s E ,dpl E -p E' / F 0avl F 4l F 5d F 6g F% 7 F+ 8  % %% *%/ :' pgd' *'"  @H? I"_0_0 48em f g h u vwkeyx\m  U V ? j keyk n keyo ;l<=? F @ F$A F(B F+%-@ (y0FF  4( F,!F0( 4)Y.8*FH+P,(X5 `6 d8 h: l; p< t=Fx6se?@@0rt@A9dlABBBFD&I2JKFODXD]D&`"w>@d]hFkF lm nD oD(p'0q Xs`ubx dy/Dhz0p{D 0 0  /D00 x=01(&2P0mmhpEx    F F, F, F, F- F- F- F- F- F- F- F- F- F - F - F - F -"F -300pid * *( (00((000@>FPCFX 0"{F%v(v+ - ;. ;3 ;4<6=: (=0>8A ;@D ;HGPHXK:`&N;TGWGZG^Hk -mHp0 q1(t8u@0fsxHH{HP~HXI`Lh Lp 5x 5 58 ~FL o<F\4h9 ;  ; u1 2" TD p2( (8 L@  H MP  MX M` Mh Mp x M /: F  ;  ;  ; 4 <  M 0  '  ' "M )M  0  M0  18  FX N\ N` 1h 0  N      !F "F # $ & ; ' ; ( ; &) 3*N C$ D L/N N R?N S'( T', Y0 ] 8 ^ < _ @ ` D &aH d9X gIN i9 lSN w x z } ~XN  ; ;  $  FmNwNNN F(F,vD09rcu04@ D(H4POx4  " O OO  ; >& !"-$"-&.<(O&F-@@l%@@q-spes ds"$&(0-8X`cr2hpx-F' i-6fpu ,@F(  '%@@"d@&i@ - "c c B(,Gd0'd80XQdh%`dpxb ed' Njdb !  >! val   R!! ,>!!! !!  ^! !!R! ! " \ " ?? 2"R! " "2" F, #fmt555F55$O6,# 7 8 8#5555(F(F(4Fkey9 #(#F=#   8U;$V0modW;$X5Y@$ Z ([ ,\#05u$v$w$xFyF,## :$ /$1Fset3Cget5\7 .$D&;$ 5 X {  -( -08!@" ߙH# P$ X%`&/h'Hp(/x)k*+,ٚ-ޚ./ 0 .1 2`3 5 9 ϛ; >k?@=$ !'% + -/  :' !key " ?h' A Bm' Cr' h'' =' >:' '  ;{' ! $0"c("d5"e."gL"i j"lo 5('# N# Np$(cwd$'swd$'twd$'fip$' fcs$'foo$'fos$'$($'l '($*(rip$+;rdp$,;$..)fip$/'fcs$0'foo$1'fos$2' $)B)((0$@d) $Ad) $Bd) 't) ;$$*cwd$% swd$& twd$' fop$( .)$5'$6'$9* $<*$>d)@B) '* '&*?$Q+cwd$R'swd$S'twd$T'fip$U' fcs$V'foo$W'fos$X'$Z($[l$\m$]n$^orm$_p$`q$a+x$b'! +@$:Q+$; ;$< ;$= Q+ ;a+%@@$O+'$Pt)$Q+$R+@ +3P@$^,$_9(.$`t)$a&*.$ba+@$c, ,E%@@$f,$hF$kF$n;$q;xfd$t;$wF$zF$F$F'$+@@$,$ ;$F$F Qfpu@$d-$F$$d-$d-$, $,0'$,@@,% -% ;%; :- - --- -&N&N&N'8.'92.'<2.'=2..(<Y. (=F (> (:.(;.7.src(A  dst(A ..#F).  () /) /val) ')!' )"')#;)$ / ')*G/ )+&G/ ),#t/#*t/*uQ* L/)'/)(6)).%/).; )1/)20)3)4 )5)6 /()30 )%. )/y/ )7/8)`0)fn) t00\o0o030`0+>0+?+@+A'cpu+C'#F,0     - 1- 1  1. 01.0/ K1/ 0a1 0"0u1K1 0a11 11! 1"1 2)12*'2+2"osq2-01 2/0(3 23 3 0304P244P24P224 p24 P2424U24P2 52)5 25 5 25p2#F6 2 @6'q3)6(26)  6*3(6+406,86-96.:6/;2332q3@@7/470~71F72 6 seq73;743752 76077 83(8G48 x88 W48' R4R44G49499 94 4: 4:4 4 :84;4;  ;4<+5<,c<-cx=_5=_5=F`=hmax=p o5 > 5sig>4 >o5 ?RE ?S55 ?U ?V55A@5 @  @  @ 5@'"6@(o@){@-`6@.@/@0 5@1@56@6o@7{@8 5 @<6@=o@>{@?@@@A@S 7@T $@U@V @Y17@Z $@[ @^b7@_@` @a @J7 @L @Q @W6 @\ 7 @b17 @E7@Fb7@g7@h\_fd@i@m8@n@o@pF A @%|8 @*5 @2"6 _rt@9`6 @B6 @d7 @j7 @q70A 8A A A A 80A 8|8 A8 8A  9A!0A" 5 A%N9A'5A(A.5A0 5 A3h9saA4 9 B 9B B lenB B B(C9C {D$9D% D'D( 0DD/:DM#9DPB(DWB)8E :E;E;E;E;E; E#;(E,;0F):F*;F+2PF8:F9:F:FHF;FL :;8FD;;)FEFF1FGF0 G>;GKGZGpGGGendG; :;3H!;H" F H&;HD;HD; HD;HE<HE; HE<HT L<HY<HZ u1 H[(<I o<valIZ I X<I <valI f I {<S<U ;V ;W2"7F[=    0hx=i;jk<cpulFm;n; o;( == '-@@w> ; ; ; ' ' (0F8%@@ ; ; ; ; ;  ;( ;0 ;8 1@ ;H ;P 1X 1` ;h ;p ;x  ;  ;  ;  ; ; ; ; ; ; ; ; ; ;%@qA=' 2! ;(" ;0# ;8%0@&qP'qQ(qR)qS, ;X- ;`. ;h/ ;p0 1x1 ;3 ;6 7qA9{A;{A=6avgG=@@ vA0KAL0MNOF P$Q&SA(A*]BBBBBB-`C'a2h ;i ; j ;(k ;0l ;8s 1@t ;HuFPFFFFFFFF'2X'2rqCACB*^CC(CBRrqCC<F <F <F<F:/DSTDBbCBs'qDqDTD? ~DD D CD'' D-EqRjS @ D Hp2P` h)px u10S DFpidpJ7>FJ9 4J:FJ; u1J<minoJ=;J?y J@]@JBSH/rcuJC`JDypE xSF K{FKFKZTSFLoGLp'uidLq o<gidLr < Ls o<Lt <Lu o<Lv <Lw o< Lx <$Ly F(Lzy0L{y8L|y@L}yHL~yPLqXLH`LHhLHpLHxL L}L iL8L}"}FGFkeyMHM4Moz"{M| semMS(M|PM X|`M huidM o<pgidM <tM{zxM|M~M M||M|G H H H H H;XN^LN_4N` NaNb Nc0NeS Nh(8Nk8@Nn]XNq`NsdNt(hNwpNxFtNzx(NF(NFNFN]N])N2N itNN4N:NƀhN N>FN=ttyNۀNN L<N;N ;N;N;N;N;N<NNNN'N N(N"0N,8N@NHN"PN,XN`NhN/:pNNNnNN FN NBNNNN1NS0IC NLNu1N4NSN^ L L L L M MXOcMOd'Oe Og Ok u1OmRjOn(Oo]0OqT8M M8 M M PMPcPKPWM M N N N %N ?N;; DN NN 5hN hN rN |NhQyNQzYQ|FQ}`["ZQzZ(Q40QXQ#e[`N N O O O #ORNRNRNR!NR%NR'NR,NR/NR3NR5NR9NR<NRANRDNRHNRLNRQNRUNRYN3PShPSSSS PS!sS" }S$FHS'QS(5keyS) S*QS+ S,(S-0S. Q8extS/Q@w'3PhP S3 S8pQtpS9pQS: S;'S<'P * TRT'T TFT  T;T;inoT); devT* (T+ ,uidT, o<0gidT- <4T. r8T/K@T0KPT1K`T2KpT3;T4;T5'T6'T7;T8;T9'T:'T;' qRU#SU$u1U%0 U' R$VN$VN$VNW\SW 4XNTY Y"iSYS Yu1 YnSYSzSYFY(Z0TZ1'Z7'osqZ901Z;2"Z<0$ZN$ZN$ZN$ZN$ZN[+T[,2"[-0 \ TTTTT \T\'\0\TX]qU]rT]s4 wq]vUHcpu]wP Ux^U^^U^U(len^'H^UP^p #UU U \U;@_V_V_V_ )_u1@@_ (UH_!_"_#B_$4_%TU_& _'W0_(8=cpu_*@=ssp_+NWH 'V`_6W_7u1_8U_:U(_;H_<WP_=X_>\V_eNW_fFsda_gX_h"_iX WCx_DX_EW_FX_H _I1(_Ju1H_K1P_Lp_Mx_N_O_P_Q_R_S_TB_U_V1_WSF_Y _\_]_^T__NWp WXUSW`NaX a+ a+a" Ya#a$a%a'/Ya(a)a+SYa,a-a!Y a&X a* Y a./Y aYXopsaYSY YYa2Ya4a6Fa7F #FQ@Z   #FQH@Z   QpuZQqZQrQszZ uZQZQYQVQZ)QQ4QZZWZ@Q`[Q@ZQQQ Q B(Q,Q`[0/rcuQ8Q[HZYQ[QidQ j[[3Q[Q[ [(b\b2"b1b0b  c \c;c& $c)Sldtc*\8c.@c91Hc:hc;]pc= xcC |cD~ \d ]ddaltddd d(d0d\8d\@d\Hd\Pd\Xd\`d\hd\pd\xd\d \d!\\] cF\\]^ `FX^ lruY0] d0 e0i>^ j  k(Rn^]hE^s (u^zpp{^|}~' ^^^_  ^4(Q0_>^n^^^8R_ F  : k_val*R_1M_N PF+J_BlruK0x_+W_X Yk_1@GL`I_UEV  _([ 0\ 4^85@Fj`_.j 1(m`noq r s t vF 5@l`j`.z 10}Ta~     (1 a05@|a`Ta. -Da"L`"`@"a*a- b  u1   E  q(F0F4G8w@pP rp  x#Օ$ % 'ڕ"a5cctx6c c=Cc>AS@;(X`cYS(\cbht%w }$1c5cc.+daaX Gd6rb2Cc Ld Vd[dc`cd;cid Y@@ d : d0 mNZ@@h"d@S@PX`hppgd  x) 5 ?hELFS Z2"]'_au1pSr0$ (08;@u1DHP'X3`h0brkp!x%0hh@h]hu1pix( ib&i  ['T!i' dod h3 [h h iQ i i 5i3$e6N$e9N$ej gGMj gHj gIii 4j9j CjHjh,jh- u1h/ h0RjgAjigK ~g:j g@~ijgNj gO gP gQ r(g+Dkg,g-Bg.Bg/ ~jj 0pkqbr rs t u v $H(Dkji"ki#ki&ki'ki' kkkj(lju1j 4jBl8jljWl"(lk3{lk4'lenk4'k2lWl k6;k1l{lk8lkil kj0 kklS[krm ksx ktk8kukRmkTFkU<kVkkWmkXl kYq0k[q8k_"q`k`uhkapkbx)kdBllkmxkn]/d_ukvlmm%x{q| }~ o< <F !e u(E0 8@H L rP X ` h'p't'x'|u1^ 'Sx0o  000 \?0$@$H P T X \@e`yh&Dp08@H P(X`h pm q-q'@kqkukukvk6vkJv k^v(k nv0k nv8k v@k vHk.wPkLwXkew`-qq%@u0 q r t(!0!8@"HPX`mhSp &!#:D$SXk 0 b b l vxF (&` '!'"/ 0 14 6F<1 B5@D"qHFxPI'XL`O dRUhS]pZ ixaxbx9rcucdTf1k0&nu1@@o0Hqu1Xr0`q#Fku umFuvv vmlu1vvF51vlvJvv;v^vmOvnvmcvvmqsvvmv lEvlFmlGulHlIvvvvwm)wmntm vm mwvGwGwB)w3wmewmuQw n"wn#nidn&n-n4n7mNnRxnSxnUxnX\nYnZ Fnc 4 ndSF(/rcuneHngXnj0`idnmpnptnq5xnrmnuxxxxwjwx'0o3xo4\yo60o7o8 Bxao9Rj  o4yo 0o" \o$u1@@o-\ylruo/xo0' 4yJ2ynrJ3nsJ4y0 ]y ayy3p yvalp; py#Fq y   y r1zrr r$sNteztjzt ez M MMlz/rcuMmMn4Mo BMvzMx My Muzz xM(MrA{MtzMK{MP{M5 A{A{zA M{{ M M {U{ { M{{{H{{HF{{{M{M{keyMHMK{4M| M08M2MA| M  M (M|MMMK{MP{M  (M| MzA|1 M|M0M =z+ M|MU{| | |{u}u 4u[u0u'8ux@uidu o<Pu'Xu `u$>"hL}L 4LgidL } <}34L} L]rcuL}};@@7g~7h2"cpu7iF7jF7kF 7lF7mF7nF7oF7pF7rF7s7t7uF7{  7|3(7} 07~38)7M@@}2~#F7:M        >3@^ N9n?8NN N! \N"N#;N#; N$(N$0N'N(;N);N04N1 $N2 $N3 $NCONDNLwNM(NNwO8NQNR NSONTSF| ƀ >Fր ր  4  v)v(0wlwwwS)w `x /rssx )xq0x8xS@x Xy fny .argy  ez bz z { 'OSA OT0 OUy4OWb OXx8OY8OIqOJiocOKM"A O\F0 b | ҂val|Z || val|f |ނ} v}  }%7F}T^    #q~      . 0 $ 4#F.ۃ   45F679 * % /4`  o<  ҂  <  PF >`  rKK(K8 bHЁ()x*0+0 ,00-1@. u1`/ d0uh1bp2 rx34 { څval ÅGF  #F6(   BEb uidF o< gidG < H څD4JH ( ( ( ( (  (( (0 8 @HЇ0 F(F, (0 (8@ Ї!;$ЇGF        @89:;<=È >È(?È0@8uÈ܈u܈bȈXDEÈFG HÈIÈ JÈ(K0N щ8O@QHSPủ̉q(qڅ։q̉xYZ[;\;];^; _;(`;0a18c1@dHeLf;Pg;Xh;`i1hjp8FFFF FFFino  ( 0‹F‹ ҋ QFFF FFFFX66 Y(|08|@H6PQuGw6uF"TuTҋ;wubw ^u܈wuD8  F S 0 (H0ops!8  q( 8 H+wm}r mwk\Ǐ! : T (0 ѐ8 @ H P -XP`dh p x   ̏ba!E B:E&JJO ?bErFSYbErFFѐE~~֐B -kkPEy2dUB~~iBEؑؑbݑ bkkǏ+?MF5e].+! &q+ޒIN  F ޒ %@Z`[[\~]^`؜ b(d0e78fZ@h}Hj7PkXmҝ`ohp"pr @xsmuvyў{}:S` j t ~  ( b 1pid>F0uid o<o< $ p FF FF r+ 1 ;5 )Օ.*+., -]*P^F    %0c  'c>ltΟ    ( 0 8@9HMP9XM`php x Ϡ  ) ) y  +& 05 ? INۃ ] g q { : :$*Bߘߘ5r;F pos r* Fr5brXb~oi:{b5~oi]kF bߘՙbՙڙ \bFb/qbHbߕ4kbrrMbpb ٚb$PINboi~F.boiIN~F QbQSV[ 3\brreb ϛbrbr~FrbrbrrFԛF =F$m[qmFB5ymqy`qqB؜mqmBݜmqm7qm#Zqm5<}qm_qmҝqmqmFmםGw'FQ@m~'cqc;;h EqrqmbFўqbm֞m0m05 Sm0? mt S qX7F   qΟuqӟqq u9u%Mu>fmfk RuvumϠu~ru5~rԠ q\)ux==B . LQmyt5[ "@@AA5B0CFD֪ E<(sdF90GAS8(IF(JF(KF(LF(MF *  . 'PPW     qq  ZU2_rev Z99  95/rb2ns0F8< >Y@id;` hp/rcux opsJ!T r9hEi y"$ % ɦ & ަ(( 02 ~89B@: H= P@3XA Q`E O  dir d > Ukn9b 1 1@`0h x  ~  B@  BA %`dddUydn~oiɦoiަΦd~rdՙ3drQdr8#Fz  0'֧(V) ji* +, - .(z2ۧ 2"5"5" "mW "n "o&X"0"1 "2 ~"3 "4y "5 ("7 ө0"9 8"; ө@"= H"?PWW )F) LF3~jFQ)2EtbFr~~өbFr~rbFrةbF"N" l" #lF)SF)5~q`֪0 u1 X0t7u LvQw!Vx*yy z (۪7LFAN[(oot֧A`t~ttiyiC }~=buf  ? :/Ed}/xtix5ttd׬5׬>(E>F5modG;$opsH!I JKa ܬì\׬HL argM  strN arrOVWFX \max^F_Fnum`qopsa!b$0(;));>2L t F v   :7` -  .mod /;$@ 0FHmp 1P 2{FX  8 5r 6  7  9  ; ͯ  <( = 0r5~ͯ;$5;$ү;$7F >   -8 ELmod F;$' G7 J       _-P p q r sB tF6mtn w  1  1 F   6;"ܬy>e& o y#QNW/Q  "L Aϱϱ `  ϱ ϱ  A28"2 2 2 2 2 2 2 2 2 2  2 !2 "2 #2 $2 %2 &2 '2 (2 )2 *2 +2 ,2 -2 .2 /2 02 12 22 32 42 52 62 72 82 92 :2 ;2 <2 =2 >2 ?2 @2 A2 B2 C2 D2 E2 F2 G2  A/"I/ a M b L % Kint 1u8? #W   1 <!%',/359<ADHLQUYɲʲ˲  6 9 < GK 1 :@ 1T| 1.111-  g l - - - `J 9   % V9  `/V ,4p ,  I~1B : ;9 I8  : ; 9 I8 I !I4:!;9 I4: ;9 I : ;9 I8 41B  H} H}4:!;9 IB1RBUX YW ( 1RBX YW : ;9 I'IH} U : ; 9 I!I/  : ; 9 I8 : ;9 IB  : ;9 I k&I< 1 41!: ; 9 I"1# U$ : ; 9 I8% : ;9 &1RBX YW '4I4( : ; 9 I).?: ;9 '<*.: ;9 'I +1RBUX YW ,4: ;9 I-1RBX Y W . : ;9 I8 /4: ;9 IB0.: ;9 ' 1 : ; 9 I k2: ;9 IB3: ;9 I4'5  : ;9!6: ; 9 I7 I8 84: ;9 I 9 : : ;9 I ;: ; 9 I< : ;9 I=.: ;9 'I@z> 1U?  : ;9!@1RBUX Y W A : ;9 I 8 B : ; 9 C : ;9 I k D1RBUX Y W E : ; 9 F : ;9 I 8 G.?: ; 9 '<H.:!;9 'IU@zI>! I: ; 9 J.?: ;9 'I<K.?: ; 9 'I<L M  : ; 9!N 1O4:!; 9!I P.:!;9 '@zQ1RBX Y W R.: ; 9 ' !S4: ; 9 IT.?: ;9 '<U IVI W.: ; 9 'I !XH}Y 1Z : ;9 I 8[ : ; 9 I k \ : ;9 I8]> !I: ;9!^41_ : ; 9 `(a: ;9 IbH}cH}d!Ie.:!;9! 'U@zfI~g I 8 h4: ; 9 I i4I4j : ; 9 I k k : ; 9 Il :!;9 m 1n.?: ; 9 '<o.1U@zp$ > q : ; 9 I 8 r : ; 9 I!8 s :!;9 t : ;9 uv 1Uw.1@zx : ;9 y4: ;9 I?<z {4: ; 9 I|!I/}:!;9 I~:!(; 9!I  : ; 9! : ; 9 I8 : ;9  !: ; 9!1X!YW  1U : ;9 I 8'I4: ; 9 I?< : ; 9 I!  : ;9!  :! ;9!4: ; 9 I41 5I : ;9! : ; 9! :! ;9! :! ;9 I81UX!YW .?:! ;9 'I !1 I8 : ;9 I  :! ;9!.?: ; 9 '<.?<n:!;!>! !I: ; 9! !: ;9! : ; 9  !: ; 9!(  :! ;9! 1H}4:!;9!I!< !: ; 9   : ;9  :! ;9 I!.?: ;9 '<1X!Y!W!  :!;9!4:!;9 I!.:!;9 'I@|.:!;9! 'U@|4:!;9!I 41!1!% U$ >  &4: ; 9 I?' : ; 9   : ;9   : ;9   : ; 9  I 8 : ;9 4: ; 9 I? < : ; 9 I 8  : ; 9  I   : ;9   : ;9  : ; 9 I (  : ; 9  : ; 9 I k4: ;9 I?.?: ; 9 n'I<5.?: ; 9 'I<.?: ; 9 '<H}4: ;9 I1UX YW .: ;9 'IU@|4: ;9 I : ;9 : ;9 I : ; 9 .: ;9 'I .?: ; 9 'I .: ; 9 '  : ; 9 11 .?<n : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 'I : ; 9 I8 < ( : ; 9 I : ; 9 I I&I!I/ 4:!; 9!I! : ; 9 I8 : ;9  I8  : ;9 I k : ; 9  : ; 9 4: ;9!I '  : ; 9! : ;9 I I : ;9 I8  : ; 9 I k  : ; 9  : ; 9 I k : ; 9 I!$ > " I 8 #>! I: ; 9 $4: ; 9!I %  : ;9!& : ;9 I 8' : ;9 I 8 ( : ; 9 I k) : ; 9 I 8 *: ;9 I+ : ;9 ,:!; 9!I-  : ;9!. : ;9 I / : ; 9 I!8 0 : ;9 I81 : ;9 2'I3!I4 !: ; 9!5  : ;9!6 : ;9 I 8 7> !I: ;9!8 : ; 9 I!9 : ;9 I 8: : ;9 ;  : ; 9!< :!;9!I k = : ; 9 I8>I ? !: ;9!@ I8A : ; 9 B : ;9 IC : ; 9!D : ;9!E!I/F !: ; 9!G>! !I: ; 9!H% I$ > J K&L4: ; 9 I?M'N4: ; 9 I?<O : ; 9 P  : ;9 Q  : ;9 R<S : ;9 T : ; 9 U : ; 9 I 8V  : ; 9 W I X  : ;9 Y  : ;9 Z  : ;9 [  : ; 9 \ I 8] : ; 9 I ^> I: ;9 _( `4G: ; 9 a.?: ; 9 '<b.?: ; 9 'I<( 4: ;9!I $ > 4: ; 9!I &II!I/ 4:!; 9!I  : ; 9 I :!; 9!I!8 >! !I: ; 9  :!;9!I8 > !I: ;9!>! !I: ; 9! !!:!; 9! :!; 9!I8!% $ > : ; 9 I4: ; 9 I?> I: ;9  : ;9 ( PSP%U%SSSX}uX_U>]%^%]%\%^ ] \ ^ 1 2P3U3U8USSS8S0)P)9VLVPVVVVPVVVV8V000 1 \(|(6\2020 s&#8 s&#8s&#8VpSSSS8S,SSS#SSSSs&#8VMS@\0V%T%0v08VXUXVU\VU#V##\##V#%\%/V//UQTQ~/T\P0VBZV S0PSPSPSPSPSV2v24V&U&{VVU\VV#V##\##V#%\%.VT{~~TT.TP~-P_ 'P'__-_\P ~ %P%~ {0{{  0 P S P S P S P S   S P P S P PPSPSSS0 ]S00P#]#%]&'](( ((0((P((\(( ((P(+\++P,,\,,P--0-. ..SP,SSP0S1#R-     9~ 0 $P,9P#U#~_V0%Q%909=Q?JQQPPPPP  PA~08P8;p;AP RRVPvPV~p~#%R~1   0P5PVVZ~VVPS&BPBS SM0MQPQSP]P\\6#8@D$QP56#8S#\# #0# #~@D$QP5u ,$ 6$7&  ,CHP 1%1&0 1%1 6#86#8]38Pf@p@@ @D~N\~P P(6P~=s~=`v~`s~ S s~ v~ s~ v~s~1\c\|\ \ | \\|]}]\|\|\|   ~ P P UuuUuuT@R@]^ T ^ ^~@2PCIP@0@VS 0 S S0 0P80 0<P8   Q X ~~"#S  TQ S ^ Q~$0P00 0P u~"#x  ~"#xUQ~S 8Q8 "S~ 2$q 2$!T^!Q!"~~" 'S"|" 2$"&T&|!&|!#S# "| $ &#3$"#"| $ &#3$"# S  T'S| 2$"| 2$"&T|&Q|&RS 88]]PPS P 0 X ^S U  SP5PP5PP6P6#86#8S}]}},^,F~jFFP!P!8Q(^(F(F` PP 0XS Y &v) ))    &Y&) M~F] \ ,T,9|9F\Vv\)0)5P5S|&#8%1   0|&#8S|&~ u8Q|&TQ|&|&#8V#U#SUSS-UzVV(VUu6U6UUUUP"3P3^VPVPVVVV7VVSSSS0(\(D|DM\P\\2020U s&#8 s&#8s&#8PV| $ &s"#tSSSSSgSt00000g0.SSS.000%SSS%000S0s&#8VP s&#8  U8sUsUs 1PPQ T\s&#8VSS7JS^^7J^FS s& 0 V+T+6v6>V%U%)Q)xUTrSrxTTrSrxTT0TXPXsV s&#8s&#8V9U9jSjsXUUUU]U]u&q (}1)] DIPP P]]UV|qU0"\"C|CL\0 sv 3% sv 3%$v&#$(U) (v'(v'*v&#*.Us 2$#s 2$#.Ts.Qs.R3v&#37U% v  %7T7v 7v !v&#!%U& s%Qs%s%U%SU 0 bV8U8UUU<T<TTTUUUU0<P<]PP]SSS 0 V:v:BVUus&#8v $ &s"#S s&#8]U3URhU0 P 3VRePehV2SKaSUus&#8s&#8VUU%0%)P)wV|VdSjSUu s&#8S s&#8V#U#MSMUUU_S+0+3P3NVU\P\_V<\AK\Uu |&#8|&#8V1U1]U_\0'S'DsDNSs $ &|"#0\%^%\%V%^ \ V ^ 1 5P-U-SUS-T-^p T^-Q-]p Q]P 0 V:v:BVv $ &s"#USUP',PWV0]%^%]%\%^ ] \ ^ 1 %P/U/lSlyUyS0ST]Y]0]JVSV0V017L\LSPS12110\.U.SUS0SwVV\\\\\MSSMSS.V.sVsVss)U-4P49U 0 ]1}1E]0SSSS%U)0P0:U0])})B]BK0*U*RSRWU/PQp&USUSUSS0UCVChvoVvoVVm1m~S~P12110Ss<U#<PGPCvChv@vv@vvQ,vUav Qv+U+VUVUU0V\\\\]12SP12110ST0T10100\ 3](_(](\(_ ] \ _ 1 ,PP<U<SUS0SVV0VPQ_kQ@D$QmUm|UPYu 727E1Eh2Pu Pu #%PU=S=CUCqSqwUwwS-S,V1`VeeV-VA1Ae2ee1-14U4| UU&U&0| \U x\\U x0\SS S0SsVzVV0VF0FOPzPX04U4| UU&U&0|  s&#8s&#8T#U#dSdfUfSUUSUU0SVV0V,0,6PDK1KY0vSPSS00 Q#U#ZVZ_U_VV&U&0V>SDS0S QPs&#U#SUSOSVVOVv&Qv&v&Qv&Pv%P|U|^U^^U'^N t  t ]sg]] ]PPPP\\\ \      SSS S 0  0  0   0   0   P\\\ \{ 0  0  0   0 PTTT tL% PP+SSS1PPQS^]$S$]$S$\$]S\]1$PU%UP)AP>U>\U\UU0\]]0]0%S%BsBKS]]VSjs~jSs^  }# 1 }# 1 }# 1 }  Q  }     }# 0 }# 0 }# 0s $ &}"# QP}&PP}%P QP}%PPQPQP}%PQ| U| pQLULS}uUSUSSp }  }  }  } ( v (EPPPP v  v  V ]\\\\0@K$ O$00PV@].^.].\.^ ] \ ^ 1 .PQ|%Q O$QP|%P@K$QP|%P#U#S~uuuUSS#T#VTTTV3^&_&^&]&_ ^ ] _ 1 -P,U,GSGS} SXUXSA]AFU PF]0\;{\0!P!.V.:T;CPC{V,U,GSGS} SXUXS |&#8|&#8p8 V TsHU5sHsHUsHsHU sH 1 PPQUZSZ`U`SUSnSFVKVVnVUESEKUKSUSnSp $ &v"#p $ &v"#BUBSUS0SVV0V4455  55@@00 4 5  @ 85U5VUVV&U&0V]]0]s|Ps0s\\0\HH H  -s- П0P"p"-P)stDD5U5VUVV&U&0V]]0]s|s0s\\0\LL L  $s$ ğ0Pp$P skDD U SUSESEKU T VTTTFVFKT Q QQQKQ R RRR2X2KR X XXXKXUSUSESEKU2SvSRvR2Xv}X} s2G$vG$pspvU#vssU#pspvU#vssU##S RX# s#G$#UUU5U5SUVUSU||YSP9AP?QYG$sU#sU# SPQ G$NUN U  U7U7VVdUdn V VnV^^^r_r^_P__\_\_]_^___ P i_inPPQP_P_P~x_P_P^^^ R010100pp&0&||6%|6%||6%||6%||6%\ P|S[[bPbg|UxssssPuqsssspRY::^P~qyyP~\P||\ddkPkp|P\PS\\1PPQ2\2S-\R--S\RS11P_/Z_/Z  ~ 8     ~ 8     U 4 U % U  1 PPQU<<]U5T55]UT]19P__v Y..dYY1PPQYHH]YATAA]YT]1OPUU^U^U^1PPQ8^8]1^R11]^R]11PQ\\\1PPQ3\3,\,^,\^1P&U&SUS7SVV7VBSSB  B$$&PPSUSS:SSPP::G$G$sU#sssU#ss SP  G$.UUUUSUS0S\\0\]]0]P#p##4p#;  ;AA;SSQQSUSS(SS QQP( sP s(G$G$pspU#sspspU#ssSQP sG$&U&SUS7SVV7VBSSB  B((&PPSUSS:SSPP::G$G$sU#sssU#ss SP  G$GUUUP-u --PPp  P u # pu #x6U6iSioUQV Rs Us p0Q'U'\U\\]]]VsVsVV0isiV!p#!/p#} p'u #xP0UuUU]]UU u3$}"## u3$}"##zXXQP} }  QnwQ0xGQ@]4]@V4V 0 P#P P 4 p ~#_4_ P +^4^]9]$V$s9s0g^9^pcV9V~ $ &#3$}"##&~ $ &#3$}"#&6 p3$}"#6_~ $ &#3$}"#Pg_9_k  kAAk\\1Q1ksQs\U\\G\\ Q GsQsPG |P |GG$G$|U#|||U#||\QsP |G$T{X$Q$]Y]qyq{YEQRtr$T$)tr)RT5U5SSU7SVV7V&t&yRytRtttUSSU7SPs *p*QraQPGs #xs #xs #xs #x P(QQQR^t s # )q)MR,,, ,  HHH9 9 9H9HH 8CSSPPC,,CG$G$msssmsssS P,G$'U']~uU]T]SYSTS;PPP 0 V:v:BV0\|\|| Q 7r7?s s s  Qv $ &s"#_T_/^!^^1PPQ^U9^ Q *@ U *^*\ Q *@ U ^ \ Q @ 1 >P__4U4]~uUUUi]SSiS 0 V:v:BVs&Qs&s&Qs&v $ &s"#0^%_%^%\%_ ^ \ _ 1 9PUHSHNUuHsHNU#/0/3P3IV u8 s8 VUVU V U V U V U VUV6VT\R\T\ R T T \ R \ T \T\1\16T uvU# v u v U# v U# vU#v6v] ] ] ]]6]uuuu   u  u 6uuu  u   u  u6PeTeP T P S T P\P00 0 0    u"#n v"# v"# v"#PP        6         6 @@ @ @ @6@        6 R1R1808R11  PP    @@    88U` `  <uu p Pq)Q 1 u4 1 u4  1  u4  1P1 v"#@0@DPDp R?_0___1PPQTHH ]]]]]vv v vu  0R/r/>R>b0nPPPP>UJRPRgUU ##00T 0 JJ$ T 0u   vv v v vvv0 R r*R*F0nPPP*U6>P>FUr #L0LlBJ$l0JJ$ vQvQv:_Q:#_#^Q#_^Q1+P:uuQ3QPp1!q1!)1!),PPP#%Pq%TS TT;___;@@@'___'SSS'@@@__SS@@1P1PP\:_:@&_&]&@ _ ] @ 1 *PIUISUSUSU S U S U S U S USS@S@0VVV\V\VM\\PeVP\P s #X3^&_&^&]&_ ^ ] _ 1 -Ps #XVv&#8 v&#8 s #P UV VV\V\VSUUSUSU S U S U S U SS@S@^ ^^] ]]#Q##H0H%$!0)(8/#H0H%$!0)(8/Q#H0H%$!0)(8/#H0H%$!0)(8/Q#H0H%$!0)(8/#H0H%$!0)(8/Q#H0H%$!0)(8/ Q #H0H%$!0)(8/ Q #H0H%$!0)(8/ Q #H0H%$!0)(8/#H0H%$!0)(8/\\\ \ \ \ \\\]VVVV VV\V\VSSSS SS@S@]]]] ]],0,VVVev|egV{~VQ&s 8$  #%!&WQs 8$  #%!s s s s 0P PP%P]#P3^&_&^&]&_ ^ ] _ 1 &PSSSSP}PQPQPTTTT]]]]s s s s s QQ#H0H%$!0)(8/QQ#H0H%$!0)(8/Q````` `  ]]]]]]]]] ] ]]]SSSXs es Xs es p ` -(  1s 8$  #%! ` -(        `P s 8$  #%!` p ` -(   ` 8p ` -( 1s 8$  #%! ` -(    `Ps 8$  #%!` p ` -(   ` 8 ]]]`SSY\\P6s< S s< s #P UU;S;FUFOSOZU u P\TP%\%)T  u #PSS s< U#<s<*U#< \ T\"T{U{u <PT>VTVTVSVZU[SSV P hVhmPP-]-1T]P_P_UPuM[s [aPafus`]TUUU1PPQUs ;U;^U^^;T;@@;Q;SQSSQEPPP]]u;0;VvVVVM_!__1PPQ,_,S(_(\(S_\S1,P*U*KSKOUOPU#T#.Q.PTQ.R.PQ*U*SUSUS8S8PUPSPPP     -S-;P;O  Ou  S|#||| | |8SS SPSP]]L]~3p3x_x,}<}<L}<0,0P 00 0*Q*\\P~5_| _ET/QR:u R | _UKQ> U 99^ Q 9 U  ^ Q  1 VPPPs#8~8;Ls#8O`s#8X4EXHYXUjVjoUT/S P CTujvjoU#I0IaRaiSioP u8UT%U%MSM\U\SUSSU/S%uu%MsuM\U P\suU PsusuU P/suP>U4V?VV V/Vu<0/P/6\6>T?ZPZ\\\/0%U%MSM\U\SUSSU/S v&#8 v&#8 p8P\Tv&#8\)U)S}uUSS,}u,3UVVV?PQJr Q0]%^%]%\%^ ] \ ^ 1 +P3U3sSsUSUUSxS       p#p#u#ppu# |8(SISSSxSv3tvvp3Pp(0I0  0`0`x vvPVVPV  V0VH`Vp<v<  v<0v<H`v<UEQ9@U9R9Q9@URQ@1GPPv8s#8s#80U06S6UU0S0TUsss0Ts04PnPVPVV000NPNTV  \P  \\T  50 s6#8s6#8P s6#8s6#8V*U*SUSUSU||&PLnP!P!VV 0S 0 |6#8dSrls#lrss#rsq]PQ]r Q P9?PP|6#8V|6#8V8U8SUSJTJ\T\~~]] 0 .P._P_ ~6#8]]]~6#8_~6#8P_<0<~.}.;U;<}<V%V%;p $ &"pUKSKUUP>v$0$+P+TT v6#8 v6#8 p8TUB\BGUG\ SS ssV S"SSV\vbvvsBPV VVQUv Q P s P sPsPsPsPsQ$Q Qq<%$Q q $Q )U)dSdUS-T-T-Q-\Q\Q\Q-R-R)u|)ds|dU s|~~VV0*P*]]PPI\IRP ~6#8V \  ~6#8]'U'KSK~U~SU+T+T+Q+w\w~Q~\'u|'Ks|K~U ~s|U `}en}&PHQP0P\VenVS!P }6#8}6#8V'U'VSVwUw~S~U+T+T+Q+p\pwQw\'u|'Vs|VwU w~s|~U Y}^g}PAJP0PUV^gV= =TST^P^g }6#8}6#8V(U(bSbUSU,T,T,Q,]Q](u|(bs|bU s|U d|k}|'PM_P0PbVk}VI IaSakPk} |6#8|6#8V:U:SUSUSULTLTLQL]Q]u|bs|bU s|U s|U vv9U9:s}z~U~s}U 0 9P9\P\P\b bSP S S v6#8v6#8\'U'KSKxUxSU+T+T+Q+q\qxQx\'u|'Ks|KxU xs|U Z}_h} PBKP0PVV_hV> >USU_P_h }6#8}6#8VUSUTTUU.U(T(OSOYTYS.S(Q(Q.Q(R(KVKYRYkVkRVRVR.R(X(X.X(Y(R\RYYY\.\(T(OSOYTYS.S(tu(OsuOYT 0Ysu.su4]48s8BT#B]s]s].]000\]\s]ss].]PVPVVV V +P+.VP*vܡPP P\0\bPb]0]]0.0000.0PVPVVV V +P+.V      0PVV1V1V1 V 1 p8s,#8]0Ps,#8]Qs,TQs,UU,T,STSTSTS,Q,Q,R,VUVVVUVV,X,]]]]]]],Y,^\^~s^^^\^~s^^TSTSTSTStusuT 0suT 0suT 0sutsT#sT#sT#s__ !0![PPP@P@0 T }"#? X"#_iTiq }"#!q3$p"t q3$p""} q3$p""} }<%3$p""9S  p4$#,*!H0H%$!0)(8/4$#, Y^\^^Y\^\^Q<@< < <  }< X Q    } 8S   *}# 4#+(} S  *}# 4#+(} 8%S% % % % S  8 s,#8_________000111000___QQQ  1  _  1  _ 1 _ 1Qs,#8P$  $__ $__ $__ $00 $11 $00 $__PP  1  _ 1 _   _  Ps,#8P) er )_er_ $_ee_ $_ee_ $0ee0 $1ee1 $0ee0 $_ee_P[bP  1  _ 1 _   _  P$U$U(T(ST(Q(Q(R(R(X(X(Y(\P(T(ST(tu(suT 0 (t(sT#Wvg 303:P:^s#P#zszT# {VWVt,#8DVD_VV1PPQ,V,_%V%]%_V]_1%Ps,#8^+U+U/T/STST/Q/Q/R/iViRVR/X/Y/\Y\Y/T/STST/tu/suT 0suT 0 /t/sT#sT#rgR :0:APA]]V"Ps(P(GsGQT#QXPXkskuT# R(rRrt,#8s,#8]s,#8]U`S`hU"T"hT"Q"c\chQuu`su`hU 0u`s`hU#<0CV" >C URVRYUTYTQHSHYQuuRvuRYU 0uRvRYU#707;P;T\P S PuvU\USUS0T0T0Q0Q0R0VRVfsufpU 0psufsfpU#ps P *\PfPfy\gVgpRpV50 s,#8s,#8\s0USUS5T5T5Q5ZVZQVQVQ5R5]R]jsujvU 0vsujsjvU#vs P 1^ViPi^o]ovRv]0"V">v>FV50 s,#8s,#8^v $ &s"##s# UXSX^U^sS T sT Q DVD^Q^qVqsQuuXsuX^U 0^ssuuXsX^U#^ss$0$7P7ST^hPhsT 8 V#P187u,#8s,#8TUSUS0T0T0Q0Q0R0]R]suU 0susU#s 0 'P'4VGNPNVVTVPTPTV0TV]]5050 s,#8 s,#8s,#8Vs0s,#8 s,#8s,#8Ts,#8URSRZU"T"ZT"Q"SVSYUYZQ"R"ZRuuRsuRZU 0uRsRZU#0004P4U\u,#8s,#8\V U QU[V[bU"T"bT"Q"FSFbQuu[vu[bU 0u[v[bU#<0<@P@]\PSPu,#8v,#8\'U'|S|U+T+T+Q+]Q'uu'|su|U 0'u'|s|U#Zv0#P#\\ p8s,#8\+U+vU/T/lSlvT/Q/vQ/R/TVTvR/X/Y/q]qvY/T/lSlvT/tu/lsulvT 0 /t/lslvT# I0IMPMo\PV"Pt,#8s,#8\*U*SUSUSUSUSSUSPS\^q\q{T|P\P\P\PVT\T\PV\\\P)R)PRRuY{sY{U PsYU PsYU PsYU PsYsYU PsYU{S{USUSUSUSSUS s`#8 s  Qs  s  Qs s`#8\s`#8U\T P RRR P RRR P RRR 000 111 000 P RRRPPP  1  P R  1  P R 1 P R 1Ps`#8\[sYsYsYsYsYsY[ ~  ~  ~  ~  p   (  ,0,;P;[]P]P]00]]][#######[#!#!#!#!#!#!#!PEYETYYzZzVVTVX_____].C]P&Q|QQ1Q [111111Y1 Y Y  Y #0#2v4%v4%v4%#vp4%#v4%4%v4%4%p8P^s`#8P]s`#8P] 4s`#8^^ ~L% QQ sY# #,T#HT T6T6.T6. .6,55 5, ,6!,6*55 5JsYsYJ## #P p5>ppV`kVkoUop#lU_`p_D`pD `p QWfQU_ ]sY]#Ep#xsYQ# #   A A A A   8x!p8T ]s`#8] s`#8 T ]u4%sYsYsY      ___.0.]0]]PmVV  Pp}w}}}RP,QQPQ.00P[P[@~!N00P,QPQp}w}}}Rs`#8 s`#8q8 [T@p8T \ s`#8   RR RR RR 000 111 000 RRPPP 1  1      P s`#8s`#8UVTs`#8U\TsY (U(_U_U__!U!/U/9_L\P\T\P\Q3]3qQ]^uYYU pYU pYY!U p!/uY/9Yqq;^L001PefffP1S1B}Pq @#8p8T \ @#8@#8U\T@#8\ @#8ZSPZSS1PPQ?S?8ST8@8ST@1P p8 \UVUUU(V(-UUVUUU(V(-ULSSS0007P7?T00 0 S$s$,S s&#8s&#8PT4U4cScoUoS@S9T9\\\oToT\T\\@T9Q9\VovQvV |2$v"# |2$v"#VV9R9\]\oRoR]R@R0B\BF|FK\\70J00@0Q)P),p|,1P0QRQs&QDD$Q@D$Q\Q@D$QPs$P@D$Q@D$Q@B$R@D$Q :Ps%P%U%yVyv UU%U%/V%uu%yvuyVU PU P%uu%/vuF0FMPM\\\/0SSS/S%U%yVyv UU%U%/V s&#8s&#8\S %U%yVyv UU%U%/V%uu%yvuyVU PU P%uu%/vuF0FMPM\\\/0SSS/S%U%yVyv UU%U%/V s&#8s&#8\S <U<S  S%S%`  \}pU\`\V~gQV`VU3^U^U^1PPQ^$U$LQ9 U 44_ Q 4 U  _ Q  1 UPPPP \\ VV+^+]+^+S+]^S]1CP|&Q|&|&Q|&g\;\sgNS|&P&g|P;|SsS s:V!VV1PPQV ] S sSS s!\! U S%U&U&SU 8     @ H   8 8    GUGSUS  US%S\U\%\VQV%V6]!]]1PPQ]"R"E Q / R //_ Q / R  _ Q  1 =PoPPP\V 0 S;Q;_v O1 P _} P| w^7^^^1PPQ4^4],^R,,]^R]1,P|&Q|&|&Q|&Q|&TQ|&W]W_]]1PPQ9]9_1]1^1_]^_11P&04h0hQPRPt RQp Qp QpQpQpQp)U)SUSpTpQTQT0001h,,h  h  h,,h,,, 888    88888 k8k k k8k88 J,J J J,J,, 8 s p0 8    ;0U$s;s$U$;$U$%%6p $ &"P6:T)U)\U&T&]PQ,V,0T0Q 1 *~*;^;?~&T&=]=}S1U1SUSUSUSTVTTTTVTVTVT0010\\\\000P0r88r  r  r88r888 `88`  `  `88`88 8  QHr QVTP V | P V |  t# t# V |  TPVPVV |  TPVPV9U9zSz~uU'T'{V{TQ}\}QQ]^}&#8}&#8U*U*.uu./U-U-SUSUATA]T]T9Q9\Q\QEREIV Q +@+V+_ Q +@ V _ Q @ 1 2P:S:HUHJSQ3s 3AU# ACQ P p1!q1!$s 1!$<PPs #%Pq%OUOUUb^U^ _ P _P3R3s@sS}RUPu~ PuUUU1PPQ s~  U ~ sU6V6=UP\T u  u #P \ T,U,S}uU9V0]%^%]%\%^ ] \ ^ 1 2P$U$SUS$T$]T]$0$5V5QvQYVv $ &s"#   P Q]PPs% s%(U(3pp3UUMSMSP(u(3pP3]U#u/0/]S0 u P8V.VVV1PPQISI Uu +P+fu fiPisu sr H  #U#CSCRUPV#T5\ |&#8|&#8p8 V TUPRP^UITI^p1P U "r pp1u 1u 1 u 1PU$V$+UT&\&+TPSPU'S'/UT(V(/TQ*\*/QUSTVQ\1"PuUu8#U#OSOUUUUS0S5V::V0VS&UUQU&TTQTQ&QQ004\4C||CL\ Q  #U#SUS0SqVvvV0VP v' s SU$S$)U)IS$SP !P PPS#U#LSLRUR`S0S2V7EV0VS'U']U]U1V U mVv~V v $ & UP}%PS s s~s  UPUTKVKPT&Q&JSJPP&Q&1S1A p $ &s"AETUU T T Q Qut U UTut U UTpUp^\^\cUch^hvUv^=T=VVVVcTcVQTTRR 0 SS0SS(SSiUUUUPwYYPYY ] _~__]\|~\(\h\P(h HT2PQ=r QUYT |CR-PQ8t Q|UYRUtStzUzSUSSU-SCVHgVgkU#'llVV2029P9QTT0 s&#8p8T (A V(AV V((V2AV V((V2AV 0((02A0 1((12A1 0((02A0 V((V2AV P%P(4P  1  V 1 V   V  P p8 TUGSGLULLS0SS#U#U0T0VVVT Q QUQ+V+TPUSPe^xPP]  !Ps&#8^ P s&#8 ]*U*RSRXUXSUSHS*U*RSRXUXSUSHS u 1v6vvHvQSXXSS*S* *DRSRXUXXSS U SUUS/SKmSP/s KMPMms /`Km`/G$KmG$?s?JuJKU#Kms?s?JuJKU#Kms SP s  ` G$#U#[S[aUaaS0SAVFFV0VS#U#eSekUkkS0SKVPPV0VS-U-VUUV~pUV  -T-]TTT-Q-\QQ\}gQ\gQUVV  ]]TQ\\gQPSSSSR> Q /@ R //_ Q /@ R  _ Q @ 1 SP8_Q11_1^Q1_^Q16P8SSPP8 0  0 8G$G$ssss SP  0  G$9SSQ2s QPp1!q1!(s 1!(+PPPs #%Pq%,],^,],S,^]S^1?PUSUSTTTTTT 8 9  87P!p!(PPp-@@AA  AA@@00 @ A  8@?P"p")PPp.OO8899  998800 8 9  87 Pp"PPp'FF/USS sEsUu8,0 u8 s8+U+,s8,VV' p $ &v"'+T1U1>UUUZ~U1T1^T^t~T^T ^ T ^ \^T^T(^(*\**T*1\11T13\37^7;\;<^<<\<=^==\=>^^~~T^t~T^~T^~ T ^ T ^T^T^T^~X^T^T~R 0 DPPM^^^K~^^~8~8 !0 !~8 !S  S  p $ &s" TUUU^t~T^^~(tT#(~(~(M^^^M~^^~8~8!0!~8!S  S  p $ &s" TFUU?~?ETEFT#~pP?QQUU^T^StSM^^^M~^^~8~8"0"~8 U "V  U V  p $ &v"!Tq  q^^Tqss\^^^T~^^~8~8"0"~8 U "V  U V  p $ &v"!T?UU-s->TspP8QQUU)U-1U11U33U^\^ \ T '\''T')\-1\11\33\~|~ | T#X '|''T#X')|-1|11|33|\~~&~&(~,0~01~22~&T&sxsSqxsxS$sx$%sx%0%~~T&~&(~,0~01~22~%Y%_~~_Y&~&&Y&&~&(_,0_01_22_9^^^K~^^~8~8\&'\,/\00\22\~&'~,/~00~22~0PpP&&P&'S,,P,,p,,s,,P,-S--P..P./S00P22P012(32 1 0V&&V&'~#,,V,,~#..~#00V00~#22V22~#3T&'T,,T..T00T22T:Q&&Q,,Q..Q00Q22Q,\\\|\\|8|8D0!U!+|D~#D^ ,^,;p $ &"p'0P|'|8'SS" p $ &s""&T@0U%|@~#@^ &^&7p $ &"p@0P%|@~#@^&^&7p $ &"p\\$\$%\sxsx$sx$%sxPpPPT~P P T !~""T"#~##P#$p$$t$$P012#3#,4,>510 4 3 2t sz sz sz sz  sz ""sz $$sz q s| s| s| s|  s| ""s| $$s| q?s|?s|?s|?s|? s|?""s|?$$s|?N\\\|\\|8|8;0U%|;S;^ &^&:p $ &"p90P|9|8U9VUV4 p $ &v"48T;0U%|;S;^ &^&:p $ &"pM\\\|\\|8|8C0U-|CSC^ .^.Bp $ &"p/0P|/|8U/]U]* p $ &}"*.T;0U%|;S;^ &^&:p $ &"p!0!~8!S  S  p $ &s" T9UU.\.8T\8YYZUUUUU$(U((U,-U-.U./U//UU UUUZ^^T^^^^$(^((^,-^-.^./^//^^ ^^^Z~(~(T#(~(~(~(~($(~(((~(,-~(-.~(./~(//~(~( ~(~(~(VVV!$V%%V))V*+V+,V,,VV VVV_Q _!#_|_ _ _0~S~~!$~%%~))~*+~+,~,,~~ ~~~R~~RR~~!$~%%~))~*+~+,~,,~~ ~~~9^^^K~^^~8~8!0!~8!S  S  p $ &s" T{^^^!"^$$^$%^))^)+^+,^,,^^{VVV!"V$$V$%V))V)+V+,V,,VV0PpIPIMpMWq\kPPQPQPQ!"Q$$P$$Q$$Q()Q**Q 0 12'3310$$2wRRvR !v""v$$R$%v))v)*v*+v,,R,,vnUUU !U!"U$$U$%U((U)*U*+U,,UkTTT !T!"T$$T$%T()T))T**T+,T!^^^U~^^~8~8%^^^W~^^~8~8"0"~8 U "]  U ]  p $ &}"!T"0"~8 U "]  U ]  p $ &}"!T^ ^!#^|^ ^ ^_ _!#_|_ _ _PpPPPPRPpP PPP 0 12'3'141@510432s s s  s      s          s !!s !" ## s?s?s??s? ? ? s? ? ? ? ? s?!!s?!"?##??^^^T~?^^?~8~80~8U~ U~p $ &~"!^^^`~^^~8~8!^^^b~^^~8~8%0%~8 U %~  U ~ $p $ &~"+0+~8U+~ U~"p $ &~""*T3UU&V&2TV2RR9UUU2^29T^^9UUU ~ 8[[[8QQ UU&^&<~~<TT\\VvVV^~~^~T#XT#XKUUD^DJt~JKT^D~DJt@JKT#X~7UU6T67T#T~pP4QQqUvUq^v^0V/V/:T:V:TVd~(i~(SSsX\\\\ s  8   8UU U^~TT T\\ \0VvvV v^~~^ ^~(~T#(T#( T#(U U^~T T\ \0Vvv V v^~~ ^~(~T#( T#(U U^T ^~(T#( ~(UUU^^^0,\\\T\T\ \ ,~~~~~~>V>@vDVV]]]]]" ~@    v  8   8U^~U~ U~@UT~QUUU^T^~XT^^UUU^^^VVVTVTVQ\\\~(~(~(2S24sLSS]]]]] P"BBB s  8   8#U#XSX^U^^S0S>VCCV0VS?U?JSJQUQRURjSSqYUSU?T?QQRjQ"Q"T TV4v4VVv $ &s"#s&QU#&s&QU#&UUUTTTGm@dx%%;   "   j 9? EO0  %#     -     '">C6!U0&Q0 =,8I$`0 (@  "*2x  bLjr   -(A((2A $) */38 !& X   8 "  0 0  3 3 O  L00w-0# 0 0  0 0  $$$  %)er)ee ::5HJn;00/ 0(-1TZI +> +29> HL #*3 0 0   &)5 i" 0 0   N "  0 0  3b~ 0 0 "0 7\"\"7\"\"~ 0 0     #( #K #%-_%a00k00""O"+@@0++O+4@@. .  # 0  #4;v #*;=HJNv9  a" @#t7O.%",8 7JF -  3 3   +A 3 3   XI     ` 7 ( 49SXi 0 #29:A_flx(Ix0H E E   >>G+c9AT"#'CC%8Kp8,#..nvG@1< !/66IRTZ#  P    KK !IILOR[]]`cfo>>>CCU-%.   '/48F6J p   8# 0   18$+E       F : : ; 4  3  *.<258 9>#-2@  (07:>  %  >6 8""26C 5""26C#.1;@ 5""26D  |=""26D'*49   )-111332 &(,00022&',/0022   ,7?D47F[`m3;@3;@$$% ##$BJRh   *N/2AHMchz)M#C$<AS""26C!*49Z$(((,--../  /""26C{!"$$$%)))++,k "$$$%())+++' "$$$%())+++ %%&&%''7;I""26D !#|   ?? ??44CGS |  HP\glt{|  !**?CO''IMR$.3 $*49 $*49LPS]b ,03=B  |          "  ' .  !*-15 !    920^0j! #G.  8]dk  8]dk  T#.##!! 5  N 1EA # 9 (    "fp~ `    !&""")%'"'  (  !CHM  0 !3 !3 >AHMpx/ip/ipH  @M,)HHM,1IV    > 2- -2 *%%* " #"3Rhu  &=bip   '@uA% A% `,3:%  EE ;U`g;(3:!         [#,3EfXf,3NTbb~ 5>%gmrw $JQ_c+++2H%v}&Xsgzgztt zt<zt. XyXzt#f J > +> '3>(]"CtJuY ]"u ] "  v,X(Y&]EAX<H/4fY.4&JJYX&<  XY k%X<[=,J= [ .J^>  w<./=I<Y xJ l.v fZ [KUzX+ tKUKYLi <Z Z J lu<f uXv< u< ttJ YfJJY)f^ztYRyt u ~=uvgJ-;R*uuvX<->(Y xt v V)uugJ-;<->>\Y<o$=f>:Ye<=""<"<WY.>;"tfJN f.;K=zB(\#J;X<<#tt.sJJY#X !;Y :Ku hV J(X=W .]"]"J.fXX h.f=/]"] "<]X" bYvKvAB   {  wqM {  X> J       - yX >w.t .tXWy'*' w L <yX.<\J/JfJJg<= . u- z  z>w.  .jX u- z  z>w. )< Y=M Y = KJ .:Xau tt=GJ8Gt8 H6<J[/;Ht7</r;uKIKH7X f</iE|: H7t  /G8%G<&8<%>H%vG&8Xv,Dtt; Dt. ;MDt. ;LJKDtt; Dt. ;K X.~tE|)X;)tDt.;u Y WY = sYDX<;Dt. ;Lu xX1Dtt.;#w?#Y) E: E:J EJX: ɞKWtX9!u@vt [V Mv; DJt;(ο@J@?@?f .U].(b6xtRJ Ys< tXt2c<<>cct =X ..yXcct 4X ..zX(h5ytQJYW<hX<>hht ..~YzfZK(it<iit /3=3.X*fY Mq?Y KtYj&zt&f<< J _:u(^!CtJYs< j J  ^J!< ^  !X  ^J<!Y<_ _t X...St0tv(gyoAJY<hX<ghht f <   f.X!X:u(^!CtJX<uY- < X-t <_ _t J ..UtP:u(_ CtJX<vY t>_ _t J .. vXtW :u(_ CJX<u X t>_ _ J ..zX. tS4zX:r<>(_ ts<  t X<#``tt ..wt$ I<X< z.t.J:u(_ CtJX<uY  X``tJ .. xXtz(ezztBYI<fX/fX = .(bzztBJ0Yt<0<cctf .{(f^ztBJX< Jggt = U JX(gzztBJYW<hX</hht = .S#yt0?u(gJY<thht !f .. c X<F 9ef XGY =t=  J/ wXZ7c.=vhKef S WZ v d# UZ .k >k.Xtg!kt. LJxJ<kJ2 t.f IY.JX uJ ..J(Yuff=.)tj<. jt. / I=$X .XjttXjttjt<jt.tJ jt.  .YZjtt$JXjttjXjt.jt.jtjxjt.MJs[ PzX A=t.KYJ Jg!aJa Y J W  O t <`X J W  O tttjJtJJY&X Z  Z [$S[$[ %"X5 yX yXQ yfd tvX:1(\#I<!g %t <K YJtX..ttYX7 !< f\J#<\tX# J` J tXY4u 77!< t :0=([$W<#u't<K EJtX.ttYX94#< t\X#<\tX#Lu.  tXY   97#<X`<YbNfX {<|<t> {p YJg K<" zut/"z ztXqXttf|<X. XZ a.A(`ts<!s]a^!!lSy   ]J `X~ ..aJ a X YwtY tX tX =% <&tK t<uJ tX& ttf X K tJ tX"_u.-AJYh } m t  } t t  {< t |p Yg K<" SUX&JffKs)Ks  ز<<J J[ =M K u uJ XltZd>)t  Ft<9X FX[ =M Y u uJ9#vp# f-Xc.=vjH@ 8 GtX8f gXCt./<z XtKu d At. >KJ/t"t\[xKWuT X~e =fX<",]bsYvt!JwyZ tX/@tt? X</u@tXKsKpX sXtKuV X Xb.=utxZOhKXr.Btt=WY < xXt.u </%@<&?<%>H%v@&?X<)t  t<J оJ[ =M K u uJXfCv?tY tYY)t  zt<J zJ[ =M K u uJ X "({. |X < f_!!lSy   K .bbt <IX% <=XvX<6;C < ?"[9< ?9t><9;K c* ;h:K<:X v<`t~ X _!!lSy   ]XX`X~ X f*Ys)  yt< zJJ zJ[ Y=M  WK su<#tHvr#sZ Ru v&xth>s> fI>gJ&ts>s>>e@YX.t<[t< ] MXztf=ugo k.v J..Xbtu(K"K"LKRZgv XZ te ~.=uf B t=tYtttYgttvX(X<bh TuX*rfK u<L9t=2t=2=2f=1=1.p=1t=vr>[ZXgyfJ?u(Z%t;<JgZ%tZ %< Z.% Xw=uptt0hH=cK,LYZ%Zt% .X%0JbX6tx  ((X<tJ"Rxtk X s=(K"MfYtJJ(t0fXr,2bKu>v W!Vu]'"JK!LC]f!"<=C!X=!]"X]J]z<uu!"<g ] W>=u: K;L.=tGX<tX( "X Y x ] W?X=:K;Ls>e9X<tJX ^JXiYx.txttxJt =vxt uXL{{tzu z.J.z.X4X%a.#q.?v Y  eX  bZJaJ`uL[lX Xob=ugttJ*YXIJJYY t)t  Xt<&J YJ[ =M K u uJ&f Xp/tLu(H7AJH7H 7< H.7JH.X7 Gp9  FJYg K<"8 G<K8w#bu KS@ -t Rt-e-Ku /P/ P<&/< >H vP&/X<)t  Nt<0J OJ[ =M K u uJ1K .tm.(bytCJ Ys< tX  `< bt Yg K<~[t =M u K KJbbtJ .Js E.:rIWL i   0#tus#oZ)  Etpvv(t% Y#1ph.t9<>t.K \YjX hs  t<J ۿJ[ =M K u uJ &Ya@K /@?A<&><>HvA&>X<  s=uv X-vXLr|/thucuY(D;tD;Dt;X .UtXfwtc.=vQt-XIvJ fKL Rv>pvv(t.fXrZf  QX#1ph.t..c.=vQt-XIvJ ~fKL Rv>pvv(t.fXrZf  QX#1ph.t.$Yu?e W (Y aV(fKL tYY)t  St< ~tR-.HuR-.K Rg;iTv<.fXsZ . QXY.e.gt ]w (i JvttJ=tJJJ<IJJ<K 9=iJ</GKi=(hJZiiJtifX   XMuiiJ(hJ uX  gt< hJ Yg K<~[t =M W Iu K uIiKX1X tJ(t X(t ׷ٷtXf$tX   fX <Y!÷<&<!LH!v&X< VIg v Xct#ʷ̷tX tYX Դttt(tr<(YI< p Yg K<" ~KXt ydv g f.K% <&W%= X <.&W tYYvf  XtX   fXv XX .Dvc. û ^!<? ~ t a d . .DJ0d<J _ w#.JCXKu4 tYY)t  PtZJqKVL.XtJ T* *f _ u;.YX/u@2rutJK [Y J%!$bJu ^ P/ Q .JT+XJ$X^XuTX+tIu LLMTt+t Tf<vTv+t h  Z$JJ z T.h&=x..B[XX$ T+3<=[$U tYZ B % [ttg NcM:LX*=Xt<Y)t su  YJ%J ZJ[ !=M  LW WK u u<&&+ZX&[$<[<$ u<X [XeX[$<[<$XX`Y@ z *Yt s=  xtJ yJ[ =M  K WK u u< yt yt[ =M  Iu <X XFuuKKM vt x#1ph.t$8NZ ~u v&xtpvv(y.X ..J*ufeK t.KP/P<&/<>HvP&/X<trJt<JJYYf R-tRt@ -" Ot g K<~tt2gM"U5"y .pY  M.2<u) NtJ1 NJ[ =M  IK suJ1LKR@ <-X..X ԺJ(tJYs<X   V(ܵt tXf$tX   fXpt.X ~Ig v Xc<tt׳Xuf / s fg';K'IX.<tX   fX8 pt8 wcu J/% <&W%= X <.&WhXVuX Xhu.ctu`tJ `t1XfJJY$T,tWf%J[Ju0t5J&JJ X'&}J ~M  wJL .uy+XC+y<J  z< _KxJ? KJ rfYJ ;ZJ<KXt==`-<-.XtuR-XvbXbtfa<iZ< YtR-.R-.g R;T-XXqfZ. RY..!t 3h(Y&f< *2<=z tWt.( ett e<X e<YX& X' XY6 <Yt }JtXWttX]Z%<ZtX% J \' _ y="LVKY<v<X.t<Y z)"t   WX'J XJ[X X=   WK u u<' eV(L)-Y<&<-StJ-YX&,YtX&]tzY)&Y<&<Y<&,Y)&Y<&<Y<& y<tG.w et |JXm y<Yg x/ Y e X k Jv X x/ ! b X h Jv X x/  _ Xt e Jv X  tJ3<|~u~tX~J-.YY%bf<.X<.X JX|$"b.<.X +IZ|%%t <;W(tv Wix|   %  xf <%.<.<Z((Q.tX< T+TJ } .  QJ    {t .=tGX< XYzJ \#  \#X RR-R-(P/ Q-%;YQ. XR- JXfz suXvt#T+zT/R-R- 1. O t[X =  Wu I=<0Q.z" .vc*N O t[X =M  = KJ0Q.QJ.JQJ. zXtXiX(Q.t O t<[t =P0Q. OX  Wu I=X$ 2T;!;<>(]"ts<  hX< h+K  ht+X h"su  hX hKufVuJZ]"]t"<...V]"]t" z.dWKXdJ-.YYdX!W<= K;Kz<Pz<K  f> z t+9?&f="tL z ' {<tfWy z ?q/9?$f>x..<r z SLgPKt!X_J-.KY(,yf]TKs'NttJt= K Jg K<~[X !=M  HY K u<5JJ<J[ Ks  t@q?G/[XtJR | |)-JJ<J= RJn,X/g1W,h7Wf- K :g K<~[t =M  Z Vu K u<5   J WX X( W!Ytt(aJaX K t4 t  I 6J K Yg K<~[t =  Vu = K<5 J5\XtJ=Y  I6< K Yg K<~[t !=M  Hu Y <5JJ<JXJXJf= K Jg K<~[t =M  Iu sK<6JJ<J]Mq1dvH u#XSXssv wt <Yg K<~t  utt )  utt J vJ[ =M  K WK u u< Yi <`J ..`fX QyYzBJtJJYX x   v  {XX+W {X {ztzXzJ-.KY { Gu ;NKsZ w x F 8aX3<t}/ }Y  }t< J}X <aX3<}= Tf<Xf!{JJ< ttL) ~  |;t |X3<X6 &N p..x& f}< }Xt<< }MKV/-==t1JfyYXts.JJyJY.JJJ& ~LK>qCt/Jf }<  }<XJ. }f3<<"9X }  };tY }X3<XJ1B ~ |/J< tL {5xtxXxJ-.KYJ6. &NX F..@& f }K-/-=>1.Jt1111 JXJ z yYWXyJ-.=Y=,tJw=EXOJ> : K=z<&-&X  }ft {X+W<XX1|\I3XY.ts  t  J}X3<t.JJ< ~Kzt/Jf+ ~XJ  ~Jt< ~<X3<(t<Z22222"JJ^"<.<^<"X^  ~ttI XhX  ~t ~}X3<- ~X+W8 ~X+W)z ~}X3<,2jX X. ~XzW yWXyJ-.=Yt7Xf.X<X.<<z<XX /wJfJ2XX1& ~/ |J {%X+W&X eztzXzJ-.YY X+W& }}t}X}J-.YY %X+W}-X wtwXwJ-.KYJ |tX+W<1|9X X.X-}.22222# }J J  }J<<< }Xf3<fX<AX=EXOt> ; ;=-z =zJ& . |<2} }xYXx.KYxJtxtfxX;/;YY }%+xY!.KYJ r }xY<!.KYxXtx<xtxXfxX;/;YY }-+xY<!.KYeX/xJXJ2.~1111\ ~ f3<X<9 ~ztzXzJ-.YY *X+W<2XXX ~XzytyWY-.JyJY ~1X+W'1~XX| }X3<tX1!JXJ1#X XyYeXW.JJyJYy<WyJtfyJ<yt<yX-.KY +yYtX- G8=#[ XA.8W 1e t  D ; p0Z W g K<~[J =M K u uJ)JgP I<J3wJ $IK J wJ (W( VM;<t>X ~tX'Jtt= Vp YJg K<"u) Vtt)V X)Uttf_tvX XzJ:(V)X<gJ;/l<&<fW ~tX(Jtt= Vp YJg K<"u) Vtt)U X*Uttf^i*//s<& <f LdYW( w.W (tW<X( X<X z#a.g([$t  \#\t#Y&X([$otfi\#\t# .sXX.<tX   X sxYXyfu<=B= t}+t  @t AJ[ =M K  ~<u uJ>BX=  X< xB=<BtX=uwB=.Tawv(mtuq<trft nnt <yX -tQawv(ntuq<trft nnt <T -tYzXJX(gt tX(gt tggteX$tX   X &YJgt<IgXeX(ftggtXSf NrXXtX   X rgX t X'Mv; D.t;(tJJKK t@tf U[4Xq(cJX< X(ct ddtaXf$tX   fXfNu #\ddtaXf(ct<ddt /XzXXtX   fXwddt uddt ./u K+tWh Y >tf7 gX tL;J. ~ ~ N Fj *>t!c"e#~$"q *" ~!)~"<'"eJ!)~JJ$ t"qXL;x0 0< K; JJ<6J~tKZS -t~ t> ~Y ~X!c"e#~$"q *" ~!)~"<X!)cH!vf'X</su &YXX6tX   X p'fgk VMv t<(tJX<dYIu / ȿ<'< >H vſ'X< ~Xοпt ]w Mv t;(tJX<h@?@t ` YR<.9Jgt uJ JyX(W(XX:-;. J </!Ut.* <pt xUdZXwXt . NX  . v< XYK<<sKf..W_J0Xt . GX 7t  .XX  (q.J % [JXXty_XftPX( .X ._.XfXtIXXrtttntt .Xttusut.Xm|ttI t>},4zt/u?0u.XK>KP/tvK4t=4f= PHg;evv( qXg#1p/eg.</tV.XZ. f. Xt.~Xt#.gXuu-XmttiwttqtottuuJ- XX$.X =0<uu -Xww Q..t Q..tt<X  I Xt  .hXtsett  .fXtultsh  .tctIXR2yj.  .Xy.I sXEt;Xt at0 u IK< /\Z <t<."s=..") JX<XtZ zXtttk.X*.XFt:. XXst( t .Xz itt B<tt* Xt .XN Xy(Q.tXX#tBttyTxDxt6<+9( y  v.?v wxt0r>v<Z"/qtt$qXX; ~Y|J!Ju |.<XftXz z L o.vZ< K we<Xu-.K%%Ynt^JX~L y G yy.>Jv<ZI(/sJ tZtJJJf...$qXXL y G yy.>Jv<ZI(/st t$sXXX ytJ.<xJtx.XE7 } = trt/1< X s " /JJ. ~ZtJJ.<..[GHEsY/ {! {!-{t!J-t {.XX tXz. ;[r. x NtJ.<xJtx.X z v utZ<t. [+<Y w" /<J.~ JXG|X.X`X6}K-.MK%%w]~0XcX RX-<YXtXCt  .X N*@?!@<'?<!>Y@'?X3<JK/=:u=YLKC@ =t Bt=X  B.X==W=^ r$p!u@Hhr0tX) Kt4 Kt4J KJX4f X X} X XsY"r>;g<ttXX|X.Xgt%}f<K |pX.ttX >YWX}X u -K .0~# s/<,JY,IZ .J). .vYj.\@X'K;u!'fL Iz}<tmtxJ<v }euuY////0yt t t X ttt ttt tt Xt ttt tt  t  tt tXXfv X$X"Y;&<fh  W[ [Z  Wrtt )uktttJutIvtu иJ и.<J ϸJ<J.K).yJ.vuK[0fJ gK K\ YVX[4ZWsu *t4. }#tu#tu%tu%tu' tutu tu tu"tutu&tu(!tu$tu&tu$u&vt}<uuuttYKƶO   t K[sKVX\"ȶt. IKZfYZ uW e[/KZv x֑ ~  r>..(t<X5ttt.tθ #K< ~ <5ttطt.X.XXX J J   < .(߹t<ZWY / t.Zttw0%z| tfлXx ʻX=ZKt/ X?'3'.3<gK-g3 `f<<#<t< <½ Žt ŽtXy = tO ="uJ<$ Jv t Xu  tt tX"f<x.ZZm&|<5(η t tt< X.Dv< Ctt w..(ҾO    WgK=Yv>.  J.2~1P2p1 !\~1KZY Z( ۸f<@ X׶ٶ,Q wX/ X'/'}.  {qu.. y<Xx& »0X&= t&t< »JX#03޽t tJy ~ ? Ywutv t!vJYgK! < ;hX us=5h&i...  <Y<< [t<K!u'%<Z%#.0" =V.L2i>= ?(e#N>(ouu ݻ %V<Xҽ$ ԽJo սJXy<x~X$ jXo<ot.W/ XtX.Xt v>r> 0  S) n{"N ,J< ntL% ng%zVJ,$W  ,JJ@oJ tX$  jJ$< nJ{ XLg  &y t .t'I <eX kf mXYJU:= ~0v kh,tjvt-,Qtv-t,SJui)w  >))tvtt l ffgM ~~~tyt~ttWjLdZr>VLT2J.0fjJ<uIjjX    q?kkJkXH f Xxtg,<<jfjjJffuXi<sftO tYv0:gt JYY jJ X vX u vf# K Z< . }*vc*X..}X.v}8 =  >t(kJ<6lX<llJ$g2/su2tK X$u 9[ I :lJ XOluA K         device_attribute___GFP_THISNODE_BITlineget_budgetlinkstart_timekernfs_nodeout_free_hostrcb_dmaRPM_REQ_IDLEtoggle_bitsuppliersdev_tFREEZE_HOLDER_USERSPACEmsi_caphost_blockedscsi_dma_unmapdup_xol_addrshared_tagscapture_controlres_handlenr_wakeupsstartput_budgetwait_for_completion_timeoutstart_brkbudget_mapstatic_key_modreq_flags_td_ino_softlimitipr_wait_iodbg_ackxregs_stateWRITE_LIFE_LONGdma_flagsipr_driver_dumpuclamp_seFORTIFY_FUNC_kmemduptag_listpkruElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersrq_end_io_retzone_wplugs_lockbridgeipr_hostrcb_type_12_errord_releasestates_d_opmce_whole_pagestatsreadipr_slave_allocblk_mq_queue_dataipr_update_ioa_ucodenetlink_nsipr_is_gscsineed_qsswap_deactivateclr_interrupt_reg32blkcnt_ttype_21_erroricq_treework_bitssi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITremoveable_medium_rsvdmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributesWQ_HIGHPRIsbitmap_wordpci_set_mastercached_rqscache_line_sizevfreeset_child_tidblk_unique_id_overrunsystem_statemax_devs_supportedrestrict_linksystem_wqtmpfilercu_read_lock_nestingem_perf_statemin_nrtick_dep_masksbitmap_queuefifo_timelistthrottle_disksi_errnoqmodelromlenipr_dumps_inode_lrusector_sizeatomic_setlink_ratesrcu_size_stateblk_plugscsi_host_stateendian_swap_regneed_tsof_nodefd_dev_idrefsmmap_compat_basetrace_eventsenv_startDMA_FROM_DEVICE__UNIQUE_ID_ddebug637dma_addrcnivcswd_flagsipr_get_ldump_data_sectionxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPipr_config_tablereal_parentipr_gen_senselockedVTIME_GUESTeh_should_retry_cmddevfnregsslice_maxlast_switch_countpci_set_drvdataqsize_tWORK_OFFQ_DISABLE_SHIFTseek_counterfilesdevicesdqb_bhardlimitlivemode_pagesatomic_write_unit_maxrun_listixolallow_restartbd_mappingsym_vvar_pagemodule_sect_attrsprobe_donereturn_instancesoftirq_activatedSHOST_RECOVERYpdevzone_wplugs_worksystem_long_wqDID_BAD_INTRSYSTEM_RESTARTpci_power_tclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idbin_attrautosuspend_delayunsigned intSUBMITTED_BY_SCSI_ERROR_HANDLER__compiletime_assert_112notifier_callgendisk__compiletime_assert_116__compiletime_assert_118spc_timelimits_instancesdescseqcountremove_busoom_score_adjeh_entryipr_scsi_doned_seqbi_crypt_contextinit_requestia_vfsgidioa_unit_checkedprot_capabilitieswq_flagssize_tacpi_device_idptm_enabledprepare_to_wait_eventcap_permittedTT_NATIVEipr_error_tabletransfersizeclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesipr_mode_page_hdrremoving_ioadata_lenmanage_shutdownrcu_tasks_idx__compiletime_assert_39error_statercu_tasks_holdouttarget_listno_64bit_msi__kunmap_localpasid_activatedipr_ioafp_page3_inquiryipr_read_dumppi_sedump_timeoutget_offset_ctxcore_forceidle_sum__compiletime_assert_127exit_requestioa_data2freeze_ucountalloc_workqueuecpuhp_deadneeds_fresetipr_match_luns_remove_countsyscall_worksysfs_remove_bin_filedevice_physical_location_vertical_positionflags_loscsi_add_hostatomic_long_tmax_cmd_id__ipr_scsi_eh_doneprealloc__init_swait_queue_headpfn_mkwritecallback_heads_vopblk_queue_rq_timeoutperf_eventf_securityi_sb_listvm_rcupgtables_bytes__compiletime_assert_45target_destroyget_link__compiletime_assert_47__compiletime_assert_48fmode_tIPR_SHUTDOWN_NORMALSTARGET_RUNNINGcputime_atomicno_difpci_channel_state_tprotection_levelhost_lock__ipr_erp_donerestoredelayed_callbi_iter__compiletime_assert_134max_nr_cid__compiletime_assert_137_statusmark_deadd_sibipr_show_adapter_handlekernel_ulong_tscsi_dispositiondma_opsversion_entrybin_attributemin_align_maskpercpu_counteruser_iopoll_weightdev_groupsscsi_blockednuma_pages_migratedipr_hostrcb_type_24_errorhdr_typelimits_lockdl_dev_stateirq_poll_initgsindexexpires_nextnvectorsi_io_listemulatedeeh_wait_qf_ep__compiletime_assert_51pci_restore_statesrcu_barrier_seq__compiletime_assert_54__compiletime_assert_55msi_lock__compiletime_assert_56__compiletime_assert_57links_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_t__param_transop_timeoutdpc_rp_extensionsclass_srcu_is_conditionalenable_cntDEVICE_VERT_POS_CENTERnotes_attrsipr_sdt_copy__s16dq_idgroup_exec_taskno_highmematomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodews_activetmf_in_progressfile_leasescsi_device_statemodelscan_objectspid_typewb_errcputimertrace_recursionsis64_addr_databv_lenhotplug_user_indicatorsstart_dataposix_cputimerskrefipr_hostrcb_type_13_errorjit_keyringsrcu_unlock_countfile_dispdoorbell__param_fastfaildma_drain_bufrcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depth__compiletime_assert_158change_queue_depthdata_vm__s32entry_eiptaskstatsipr_cmnd_list_dmahugetlb_usage__dummyratelimit_states_pinsscsi_cmnd_submitterattr_entry_ptrstarget_dataget_next_child_nodeFAULT_FLAG_WRITEgpddmasked_ioascstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDipr_target_destroyblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountinq_periph_qualforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointsupported_eventsipr_hostrcb_type_02_errorresvipr_free_cmd_blksnr_wakeups_idlehrrqFORTIFY_FUNC_memsetSDEV_DEL__compiletime_assert_164__compiletime_assert_166io_cq__compiletime_assert_168ipr_biosparamres_attr_wcelf64_symdevice_blockedend_tokenlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listclr_interrupt_regPROBE_FORCE_SYNCHRONOUSuse_192_bytes_for_3fBLK_UID_NAAipr_halt_donelength_of_errorWORK_OFFQ_FLAG_SHIFTp2pdmablk_mq_req_flags_tsyscoreprot_guard_typeipr_store_adapter_state__s64type_status__UNIQUE_ID_y_614dqi_bgrace__UNIQUE_ID_y_618out_free_res_entries__kernel_pid_tstatic_call_modipr_isr_mhrrqSYSTEM_SUSPEND_timerdma_map_opsma_external_lockdevice_physical_location_panelhost_resetuid_tflush_requiredpcie_flags_regDUMP_OBTAINEDsum_block_runtimehctx_listpgmapmin_perf_state__UNIQUE_ID_y_622sccs_rsvdstrnlen__UNIQUE_ID_y_629dq_opsdev_datarcu_tasks_nvcswpoolexpected_res_pathrefcount_warn_saturatecrypt_keyslotwriteipr_notifiertypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionalfd_res_pathFORTIFY_FUNC_strlcatdma_poolsend_off__UNIQUE_ID_y_631__UNIQUE_ID_y_633_addr_lsbdevpi_generation_sigpollprocentmxcsrdevtend_stated_rt_spc_hardlimitps_page_codebi_end_iowrite_ioadl_addrblk_holder_opsipr_reset_ucode_download_doneqas_enabledipr_cmdnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parent__UNIQUE_ID_y_640nr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infobuffer_lenclr_interrupt_mask_reg32indexdeststarget_sdev_userdriver_datathread_headlast_queue_full_timeipr_log_sis64_array_errorend_iodev_pm_qosipr_free_dumpbi_sectormap_typeipr_fail_all_opsDID_REQUEUEf_oppids_active_resetrandomsense_uproc_interrupt_reg32confirm_switchseqcount_tnuma_scan_seqcfg_lockedinode_operationsatomic_add_returnclass_raw_spinlock_irq_is_conditionalportpercpu_sizecfg_tableshost_groups__compiletime_assert_199id_tabledq_sbipr_reset_freezearch_static_branchptm_roothost_noscan_doneipr_number_of_msixname_msi_vectorsrun_worksighand_structipr_log_array_errorflagsi_lock_key__refcount_dec_and_testkmem_cacheinodedrivers_dirback_padipr_initiate_ioa_bringdownbug_entrysdev__UNIQUE_ID_fastfail598___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimefw_versionint_regnestedalloc_time_nsnr_forced_migrationsseq_operationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirinit_hctxpcie_link_statesockipr_scsi_eh_doneSCSI_EH_NOT_HANDLEDipr_cancel_opbi_write_hinthash_lenget_policy__list_add_validtmf_work_qHRTIMER_RESTARTexternal_facingipr_ioarcb_add_dataSDEV_QUIESCE__bi_nr_segments__ipr_erp_request_sensesym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadvec_idxclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_baseDID_SOFT_ERRORdevice_is_availabledquotdl_runtime__ret_do_oncenumbersbi_vcnttry_rc_10_first_softexpiresrq_flagskey_user_hugetlb_cgroup_rsvdscsi_doneskip_ms_page_3fvset_idsfaultableio_comp_batchstate_mutexshutdowndq_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueptrace_messagenum_trace_eventsptm_cap_sys_privatealignment_offsetopen_mutexscan_finishedpath_status_descinit_fs_contexts_subtypeheaderipr_ioafp_mode_select_page28funcperf_event_contextmax_cmdsipr_err_handlertlbflush_unmap_batchsoftcrypto_kobject__sifieldsvpd_cbsrcu_read_unlock_specialfortify_memset_chkread_bytes__compiletime_assert_200__compiletime_assert_201__compiletime_assert_202__compiletime_assert_203__compiletime_assert_204__compiletime_assert_205__compiletime_assert_206fsverity_operations__compiletime_assert_208identify_hrrq_indexipr_hostrcb64_device_data_entry_enhancedfree_pageswake_q_noderequest_key_authdispatch_busySAM_STAT_INTERMEDIATE_CONDITION_METallowedhdw_dma_regs_pcivirtual_dr6dnld_sizekprobes_text_sizeioa_portstatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksmailboxstart_stackwatcherskmalloc_cachesipr_process_errortype_41_errorcompletionhrrq_startsw_reserveddevice_removablebd_meta_infobio_integrity_pool__param_str_transop_timeoutbuf_lenUTASK_SSTEP_ACKactive_uprobeipr_ext_vpd64show_optionsmax_cmd_lendisktype_17_errorbpf_raw_event_mapsize_is_constantipr_get_chip_infoFREEZE_HOLDER_KERNELcore_nodepri_capcurr_nrsector_ttrc_blkd_cpuin_memstallhostrcb_free_qpermission_utimepm_subsys_datahost_failedfree_res_qbsg_devpasid_featuresscsi_target_statefd_lunget_dquots_raw_spin_unlock_irqrestorenum_orcsclass_task_lock_is_conditionalsystem_unbound_wqshow_rqipr_hcam_labelFAULT_FLAG_MKWRITESTARGET_CREATED_REMOVEoom_reaper_timermemcmps_uuiddestroy_dquottype_30_errorhost_eh_scheduledd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onipr_log_ext_vpd_compact__warn_printkvm_operations_structget_orderbin_attrs_newrpm_autosuspendbio_alloc_cachebi_bdev__builtin_memcpyconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classipr_update_res_entrymultiprocesspi_waitersexp_hintd_childrenjob_step_faileddirty_folioblk_status_tis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksprimary_problem_descnum_symtabascii_part_numwrite_inoded_fsdataRPM_SUSPENDINGvpidsnrpages_refcounti_crypt_inforaw_atomic_fetch_add_relaxedsaved_cap_spacelist_emptystats_sectorserror_remove_foliohrrq_currold_time32_tcore_kallsymslast_queue_ramp_upsrcu_parentdetachedclock_op_might_sleepdma_use_sgenvp_idxWORK_STRUCT_INACTIVE_BIT_head_1_head_2sg_reserved_sizebd_size_lockbackvmemmap_basestate_add_uevent_sentblock_cfg_accessret_stat_leni_hashresulthlist_node__basesprintfio_uringipr_ioafp_cap_inquirymax_idWQ_MEM_RECLAIMcore_occupationsimple_tagswritelrevidftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qcmd_per_lunfileattr_setkzalloc_noprofrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalmatchesioctx_lockkveccurrent_stack_pointeradd_cmd_parmsNR_KMALLOC_TYPESsect_attrsdata_lengthexposed_mode_adnres_typeproc_namequeue_work_ononlineruntime_resumedup_xol_workqueueccinstart_time_ns___GFP_WRITE_BITused_res_qMEMORY_DEVICE_PCI_P2PDMAsdtrtotal_vmjobctls_time_maxnode_list__UNIQUE_ID_description592dio_offset_align__UNIQUE_ID_ddebug635delay_workstrip_whitespaceoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockout_disablegfp_tipr_reset_mode_sense_failedswap_slot_free_notifyseccomp_filterstimelist_add_taili_mmapipr_exittype_01_errorphys_addrd_lrusignal_structWORK_STRUCT_COLOR_BITSperf_event_mutexioa_type_entrypri_enabledreset_donearray_vpddriver_lock_flagscan_queuehprobecrcspgdval_tipr_mode_pagespage_linksetattrfind_first_zero_bitipr_sdt_statef_mappingnoinstr_text_startprepareBLK_EH_RESET_TIMERbin_attrssas_ss_flags__ipr_get_free_ipr_cmndf_modeki_completescsi_add_devicevtime_statewakee_flipsipr_ioafp_page0_inquiryset_aclScsi_Hostrom_attr_enabledsystem_power_efficient_wqdriveripr_build_ioadl64scsi_unblocki_opskip_bus_pmldt_usr_semkobj_ns_type_operationsbd_security__UNIQUE_ID_transop_timeout600seqcount_raw_spinlock_tpercpu_rw_semaphorecfgtescan_mutexcredjump_entryno_write_samemax_host_blockedlist_lru_nodetagset_refcntsrcu_gp_seq_needed_expinterval_expaddress_space_operationsRQ_END_IO_FREEspinlock_tscsi_add_host_with_dma__UNIQUE_ID_max_devs606show_info__task_fpstateDID_RESETmask__ret_oncewait_queue_headioarcb_host_pci_addr64class_rwsem_read_try_is_conditionalipr_eh_host_resetfreeze_kcountwork_func_tfwnodemajor_releaseis_dirty_writebackipr_is_af_dasd_devicetrace_bprintk_fmt_startdump_sizehuge_faulthas_msithis_idata_op_codekstatfssitesipr_ioasa_af_dasdDEVICE_VERT_POS_UPPERptracePCI_ERS_RESULT_NO_AER_DRIVERquota_disablekprobe_blacklistcpus_ptr__UNIQUE_ID_max_speedtype593paccti_dentrydisk_events__UNIQUE_ID_license611grab_current_nsWAIT_FOR_DUMPaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjsgl_free_ordersrcu_cb_mutexstatic_call_sitekobject_ueventfortify_funcMODULE_STATE_UNFORMEDpage_listexpires___GFP_HARDWALL_BITnivcswfirst_entry_offsetMODULE_STATE_GOINGDL_DEV_UNBINDINGvendor_idthreadparam_ops_uintsym_timens_pagesriov_configures_time_minbusn_ress_devcpus_allowed_lockget_next_idrwlock_tpci_ers_resultmax_integrity_segmentsipr_dev_groupsipr_driver_lockpgprotfalsecmd_lenremovedshow_pathPIDTYPE_TGID__bad_udelaypriv_flagsMQ_RQ_IDLEipr_free_ucode_buffercurr_ret_depthipr_reset_shutdown_ioaac_utimebus_list_dummy_pkeysense_bufferTIMEOUT_ERRORiommu_mm_datamce_countswap_info_structipr_ioasa_vsethost_waitsequenceipr_free_memwas_resetipr_abort_timeoutpage3_dataipr_get_free_hostrcbrt_spc_warnlimitnr_reserved_tagsac_flagcoredump_datatasks_pidscsi_cmndaddress_spacemm_context_t__num_online_cpus__q_sizeis_probed__call_single_nodestartupipr_inquiry_pageC4ipr_is_gataof_device_idseqcount_spinlock_treset_devicesbio_issuei_wbipr_eh_abortioa_last_attached_to_cfc_vpdhas_elevatordma_alloc_coherentcompleted_opspanelclass_id__read_overflow2_fieldqueuecommand_may_blockinactive_timer_pkeyfilename__compiletime_assert_110s_export_opros_rsvd_ram_rsvdfront_padno_start_on_add__mptrstashedipr_init_ipr_cmndvm_page_prot__udelaytimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqdma_map_sg_attrspagetrc_holdout_listsense_buffer_dmaget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolocationlast_busyi_pipebasehostipr_store_reset_adapteruaddripr_format_res_pathipr_is_same_devices_wb_errshm_clistWORK_STRUCT_PWQ_SHIFTis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descsskip_settle_delayskip_vpd_pageseyecatcherexec_vmrw_copyfscrypt_inode_infost_name__SCT__might_reschedmmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoirq_managedqueuecommandalloc_inodeexit_cmd_privuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidscsi_set_residipr_ioafp_mode_sense_page24__compiletime_assert_619rseq_sighandleflush_workdev_pm_domainstart_tokenlimit0limit1nr_zonesevent_workmigrate_modebio_poolwakeup_prepared__compiletime_assert_623__compiletime_assert_624__compiletime_assert_625poweroff_lateftrace_callsitesd_hashis_confidentialdl_bw__real_strnlenkobjfsyncmtd_infoINACTIVEi_flagsblk_crypto_keyslotblk_eh_timer_returnlimitsipr_reset_quiesce_donekernel_siginfouprobes_stateuintFAULT_FLAG_REMOTEkernel_siginfo_trb_nodenew_vpdblk_queue_statspushable_tasksplatform_datad_comparesighanditerate_shared__compiletime_assert_636is_visiblesignal___GFP_ZEROTAGS_BITipr_handle_log_datareleasedascii_lendep_mapalloc_dquotipr_dump_entry_headerpm_messagecard_typemay_split__q_size_fieldmem_cgrouplast_update_timescsi_lundata_typerobust_list_headmultiple_queuescurrent_state__ubuf_iovecinit_timer_keyignored_posix_timers__mod_device_table__pci__ipr_pci_tabletime_stampcount__compiletime_assert_642SCSI_RETURN_NOT_HANDLEDGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__compiletime_assert_46vpd_pg0ioa_last_with_dev_vpds_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventulongipr_ioasa_hdrhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmipr_mode_page28out_release_regionsusage_count_folio_nr_pagesioctlshowpci_sriovignore_hotplugrequest_typed3hot_delayunsigned charumount_beginipr_mode_page24vdsommap_legacy_baseipr_request_other_msi_irqsKOBJ_ONLINEpipe_inode_infocur_bus_speedsecurebitsscsi_remove_hostpartition_meta_infostate_initializedipr_ioa_bringdown_doneslave_bdevsuring_cmd_iopollscsi_host_statusbi_poolcompat_uptr_tuevent_opsrequest_irqsg_tablesizepref_windowsdt_statepoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPdev_get_drvdatanum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITs_vfs_rename_mutexwce_default_onsuspend_latewakeupeh_abort_listcg_listlink_bwctrlDID_BAD_TARGETsrcu_barrier_completionsdev_gendevsaved_config_space__compiletime_assert_58driver_flagssg_timeoutelementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapSYSTEM_HALTfiemapuse_16_for_rwwaiterscmd_indexsubdevicepcix_cmd_regsessionidjob_steparch_atomic_readdefault_lockIPR_SHUTDOWN_QUIESCEbi_flagsSYSTEM_RUNNING_sifields_hugetlb_subpoolhrrq_pending_qd_manageicq_hintipr_worker_threadhandler_datafiemap_extent_infoDMA_TO_DEVICEpadding1force_runtime_start_on_system_startllistunmap_limit_for_wsdebugfs_entrySDEV_EVT_LASTmax_num_entriesacs_capelemnr_retriesbiotailsigval_tsectorsalimitundo_listKMALLOC_RANDOM_STARTipr_read_traceipr_is_ioa_resourcemissedreport_zonesbi_idxquota_readst_shndxparmcmd_flagsio_start_time_nsfreeparthostrcbi_wb_frn_avg_timeswap_lockipr_pci_tablebd_fsfreeze_countfile_ref_ttypemembarrier_stateIRQ_HANDLEDlun_wwnpage_poolsuspendinitfiles_structwrite_iterneeds_sync_completedelays_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultzone_wplugs_err_listrequest_threaded_irqoom_score_adj_minDID_OKkobj_uevent_envtype_04_errorfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tsiblingsoverlay_idhotplug_slotpathudelayst_sizeDID_TRANSPORT_MARGINALrmtpmemcpywait_sumnum_tracepointsclr_uproc_interrupt_reg32upidraw_atomic_add_returnexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalsense_interrupt_regconsumersshost_datakernfs_elem_symlink__compiletime_assert_160clock_was_set_seqpageC4_data__compiletime_assert_163DD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerbreserved_tagsunlink__kmalloc_noprofSAM_STAT_BUSYkstrtoulperiod_contribpci_alloc_irq_vectorsIPR_SHUTDOWN_ABBREVrcu_node_entrystart_scan_seqnr_ctxfsgidswap_rwneed_parent_lockrcu_syncnum_recordsipr_reset_slot_reset_doneproc_dir_entryvm_opsiopollactive_queuespagesizeHCTX_TYPE_READdisk_name__ipr_format_res_paths_blocksizevm_pgoffRQ_END_IO_NONE__remSDEV_EVT_MODE_PARAMETER_CHANGE_REPORTEDSDEV_EVT_FIRSTauprobeno_uld_attach__retipr_hostrcb_type_07_errornuma_workupdate_timeptrace_dr7no_d1d2priority_call_addrrescue_lockmax_segmentsWORK_BUSY_RUNNINGloginuidcheckin_erpexpiryoptimistic_spin_queuespin_unlockdl_defer_runningbi_bvec_doneroot_blkgipr_log_enhanced_cache_error__lstatebroken_cmd_complueventlock_countrefcount_t__UNIQUE_ID_z_641plugchild_countsaved_auxvipr_hostrcb_type_20_errormce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagspage0nr_mapsmod_namesdev_groupsproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlsched_tagsrseq_lenjiffies_at_allocmodule_attributepollfdsis_versionnr_wakeups_remoteSDEV_EVT_POWER_ON_RESET_OCCURREDSAM_STAT_INTERMEDIATEpci_busllist_nodeipr_log_levelswappagesclass_spinlock_irq_is_conditionalmemcg_awareadd_timerclass_spinlock_irqsave_is_conditionalrseq_cs__param_str_max_speedprimaryvsetnum_ftrace_callsitessoftirq_expires_nextpageC4atomic_fetch_add_relaxedREFCOUNT_DEC_LEAKDEV_DMA_NOT_SUPPORTEDreadlinkscsi_report_bus_resetmigration_flagsipr_ioafp_inquirynon_compliant_barsioa_cfg_pincountlength_in_wordsioadl_lenrq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmapsysfs_create_bin_filelist_headtgidwrite_protect_seqsilence_suspendltr_pathipr_get_errorcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holderend_codeipr_process_hrrqqspinlockKOBJ_MOVE__kmalloc_large_noproflru_geninsnfilldir_t__param_dual_ioa_raidscsi_add_work_q__must_check_overflowdl_non_contending__UNIQUE_ID_fastfailtype597dir_contexttracepoint_ptr_tutasksdev_statesched_entityipr_show_iopoll_weightd_spc_hardlimitmq_freeze_wqipr_show_resource_pathlong unsigned intsleep_maxmmap_baserescue_workio_context__condrevisionDID_IMM_RETRYquiesce_depthpcii_reghctx_tableipr_vpdgpl_symsseq_showipr_hostrcb64_fabric_descswait_queue_head__param_log_levelcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitsioarrin_regstrchrsched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_f_raw_spin_lock_irqipr_fw_version_attrin_eventfddevicebi_integrityerror64s_shrinkscsi_block_requestsi_private_listhrtimer_restarts_fsnotify_maskfw_entryregister_reboot_notifiersym_hvclock_pagexstate_headerpci_channel_io_normalinaccessiblequick_threadstime_sliceobjcgipr_inquiry_cappci_device_idarch_clear_bitnoderesetsdev_targetvm_lockno_cgroup_migrationcmd_pktnextevts_writers_key__countdma_free_attrsxcomp_bvcma_areadma_set_maskstatic_prioipr_init_regsflush_listmay_skip_resume__UNIQUE_ID_log_leveltype595shrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockexpecting_lun_changeatomic_write_hw_maxl1d_flush_killi_versionuse_10_for_msDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimedev_entrystate_remove_uevent_sentlegacy_memfirst_minorincomp_dev_vpdia_sizein_hrtirqs_master_keysdesc_idcfg_table_sizewchar_addr_bndkernel_symbolsubsys_databi_statustv_secmax_xfer_rateipr_pci_slot_resetma_lockcascaded_expanderpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsnr_phys_segmentsma_rootipr_send_hcamuring_cmdnr_failed_migrations_affinefd_res_addrtrace_entryREFCOUNT_SUB_UAFresiduser_cpus_ptrpi_top_taskWORK_NR_COLORSipr_hostrcb_cfg_ch_notreset_occurredtemplist_del_initslotactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writehlist_bl_nodeipr_build_ucode_ioadl64st_otheri_mutex_keyksethrtimer_clock_basevruntime__builtin_strcpyhctx_typedisable_depthasync_scan_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsload_idnr_integrity_segmentsipr_std_inq_data___GFP_HIGHMEM_BIT__param_fast_rebootipr_ioafp_mode_sense_page28modulepcpu_cidIPR_SHUTDOWN_NONEngroupsfree_file_info__kernel_time64_tbudgetipr_log_enhanced_dual_ioa_errorautaskuser_namespaceHCTX_TYPE_POLLvfsuid_traw_spinlockuse_10_for_rwtimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachehostrcb_dmadqi_flagsSYSTEM_FREEING_INITMEMcfc_last_attached_to_ioa_vpdstrcpyipr_trace_attr__UNIQUE_ID_number_of_msixtype607ipr_config_table_entry_wrappersglistl1sssriov_set_msix_vec_countarray_idkfreeread_posstatic_call_trampbtrace_seq_pp_mapping_padsa_maskipr_hostrcb64_config_element__UNIQUE_ID___addressable_init_module643request_queueipr_init_ioa_cfgipr_dev_bus_entrydqi_dirty_listipr_log_level_attrmax_timemod_tree_nodeerror_indexf_sb_errwritepagehost_rrq_dmaFORTIFY_FUNC_strlenipr_reset_restore_cfg_spacechip_cfgstatic_rqscodegtimedisconnectsigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listsched_rt_mutexstage_timelocked_pendingreset_preparetype_24_errornr_deferredfown_structfeatures_lockedtracing_graph_pauseipr_regs_pciqueue_numpermSDEV_BLOCKipr_sdt_headercompat_robust_listbi_blkgnr_hw_queuesis_msi_managedktypelockrefin_dpm_listsrcu_struct_ptrsipr_reinit_ipr_cmnd_for_erpmm_structvlagi_uid__wake_uptablesDMA_BIDIRECTIONALbi_iocost_costserial_numspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnipr_reset_next_stagevm_mmunregister_reboot_notifierfortify_memcpy_chkdebugfs_idSAM_STAT_CHECK_CONDITIONguest_permmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_diskrq_nextsp_offsettype_13_erroripr_ioadl_descsrcu_cblist_invokingi_lockd_nameSDEV_EVT_LUN_CHANGE_REPORTEDcpuhp_onlinetraceget_ownershipufdscrypt_ctxexe_filenr_scannedpcp_listipr_inquiry_page0pid_linksipr_inquiry_page3hrrq_free_qs_sysfs_nameMQ_RQ_IN_FLIGHTq_size_fieldrefcountnr_activevaddrrequestfailing_lba_hirw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipqc_dqblkipr_dump_ioasaretry_hwerrormmappedseqcount_raw_spinlockpci_save_statebd_holder_dirbroken_intx_maskingipr_shutdown_typeheader_lengthipr_show_fw_typekill_sbipr_ioa_cfgsense_uproc_interrupt_regd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parameterseh_timed_outWORK_OFFQ_FLAG_BITSi_write_hintfxsaveprocess_keyringlist_op_pendingiotmo_cntDEVICE_VERT_POS_LOWER__stack_chk_failpci_opsllist_headreserved1reserved2reserved3reserved4byteswait_startipr_reset_wait_to_start_bistf_freeptrno_scsi2_lun_in_cdbclass_raw_spinlock_irqsave_try_is_conditional__ret_condshow_fdinfofixupirq_getdata_transfer_lengthhashposix_acldd_key_falsebug_addr_dispdqi_igracemax_slack_shiftstarved_listclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_endSAM_STAT_COMMAND_TERMINATEDmax_channels_fsnotify_infotype_02_errorset_interrupt_mask_regmempolicyadd_linkspm_message_t__UNIQUE_ID_log_level596iovecsecondaryi_private_lockDID_TRANSPORT_DISRUPTEDWQ_BHsegment_boundary_maskipr_next_async_err_logVTIME_IDLEfactor2static_keyscsi_timeout_actionipr_send_commandremovetrace_indexs_magicadd_datadl_overrunfailing_lba_loallocsubvendord_parentlocation_entry__WQ_DRAININGirq_polltransparentpayloadipr_show_raw_modeac_minflti_sborig_nentsblk_mq_hw_ctxkmalloc_noprofd_sbcommcompcan_matchdma_pool_zalloclast_timePIDTYPE_PIDeventsofflinescsi_host_allocatomic_write_segments_maxatomic_openbio_end_io_tipr_device_id_attrstart_prevent_timedev_to_shostcondreadahead_controlblk_tracesubordinate__kernel_gid32_tkernfs_open_filedumpf_credipr_reset_bist_doneMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesqdepthbd_devipr_cmd_pktauto_sense_lenslave_destroyread_newsignalfd_wqhmmapmodnamenotify_typeasync_put_workmknodirq_poll_schedipr_log_dual_ioa_errorSYSTEM_BOOTINGhrrq_numpri_reqs_allocctxsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemaphrrq_iddma_alias_maskipr_cmd_labelwritepagessched_statisticsheadminors__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controlipr_ioa_vpd__param_str_log_leveluclampinit_feedback_reg__UNIQUE_ID_version612super_operationsipr_is_vset_devicebi_cookiesplice_eofucode_sglistsam_statusutil_avgipr_build_mode_select___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lock__refcount_addD_REAL_DATAerrors_detectednentsbd_holdersstart_offpt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idmap_nruse_16_for_syncd_rt_spc_warnsiopoll_weightpci_write_config_wordq_usage_counteri_verity_infoata_classxsavetimespec_type__rb_parent_colordevres_lockipr_max_bus_speedsbitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infofd_res_handleats_capsupp_devipr_test_intrblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opscompare_product_id_byteipr_adapter_handle_attrtemp_pcii_regFORTIFY_FUNC_memscaninquiry_mutextrace_startipr_trc_hookipr_hostrcb64_array_data_entrylog_ioasa__param_str_number_of_msixdriver_dumpipr_ioa_fw_type_attrnsegdev_flagsREAD_DUMPvm_private_dataio_bitmapkmap_local_page__bi_remainingnum_entriescfg_table_startuprobe_task_statetimerkobj_typebroken_parity_statusdiskseqmsi_receivedmsleepi_pagesatomic_write_hw_boundaryhlist_bl_headino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitdoe_mbspage_fragwrite_bytescharipr_store_diagnosticsdomainunix_inflightnotifications_lostioa_dumpholders_dir__wq_entrydel_timerinit_cmd_privfpu_state_permi_fsnotify_maskbio_vecipr_mode_parm_hdris_added__compiletime_assert_44ari_enabledgraph_get_port_parent__compiletime_assert_49__WQ_LEGACYmax_zone_append_sectorsSDEV_EVT_MAXBITS__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstk__ilog2_u64GET_DUMPbio_slabABORT_DUMPtag_alloc_policyd_aliasno_read_disc_info__iovcpumaskmq_hctxdumperscratchwakeirqres_entriesclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimes_rootsipr_raw_mode_attrdma_data_directiondoneqhost_response_handled_rt_spc_timerallow_cmdsevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nr__this_moduleipr_log_ext_vpdscsi_remove_devicebio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityno_report_opcodeshrr_queuerq_countrunningipr_dump_headerrseq_event_masks_rootra_pagesipr_ioa_attrsTT_COMPATfwnode_handleElf64_Symsense_bufd_automountqueue_limitspage_freebridge_d3ipr_sdtpci_release_regionsadd_to_mlparentspecial_vec__dummy2atimecopy_file_rangeinquirytask_cputime_atomiccommit_rqs__compiletime_assert_149user_definedkey_typeWORK_STRUCT_LINKED_BITget_named_child_nodelaunder_foliocurr_targetnumberis_suspendedipr_config_table_entry__UNIQUE_ID_fast_reboottype609dma_lengthPCI_ERS_RESULT_DISCONNECThotplug__keytimeout_workburstipr_test_msiraw_atomic_setetypeei_funcsmodule_kobjectorderactive_memcgmsi_wait_qdef_flagsipr_timeoutd2_supportbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatetarget_blockedvendoripr_chip_cfgcap_bsetssleepopen_modearchdata_sourcepower_statesingle_lunnr_perf_statesstack_vm_areasaved_statepci_find_capabilitykernfs_elem_attrbasesipr_ioa_groupspcie_mpsss_bdev_fileipr_oper_timeoutnuma_faultswork_qipr_interrupt_offsetsipr_send_blocking_cmdblist_flags_tlinux_binfmtpage_table_lock_sigfaultcountersname_linkcmaxrssscsi_device_getno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typesriovipr_scan_finishedpolicysharedbsize_elemwait_queue_entrydismisstarget_idslist_deld_real_typelookahead_bandio_portseq_start__targetssecond_problem_desc__UNIQUE_ID_max_speed594rq_qos_mutexzone_wplugs_wqipr_dump_ioa_type_dataraw_lockd_dnameget_dqblkWQ_CPU_INTENSIVEipr_dump_mailbox_waitioadl64wait_indexipr_initialize_bus_attripr_get_free_ipr_cmndscsi_levelmax_hang_timecpus_maskipr_hostrcbsubdirstask_groupstarttimerem_page_lensis_typeiounmapmmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_tKOBJ_REMOVEipr_cmndmin_sliceargs__poll_tout_scsi_host_putfwnode_operationstarget_allocshow_devnamelogical_block_sizeipr_config_table_hdrrun_delaytailsblk_flags_tlinenoSDEV_EVT_SOFT_THRESHOLD_REACHED_REPORTEDbi_io_vecbase_pfn__param_str_fast_rebootget_inode_acl_addr_pkeyipr_init_dump_entry_hdrmigrate_foliocustom_sliceaer_capsaved_mode_page_lenthread_keyringhosttkparam_arrayentry_lengthrefcount_setutimeDID_ABORTwait_for_completionsecurity_supportedstart_codelowmem_page_addressset_bitis_managedis_hardiorequest_cntfsbasecompatiblesubsystem_deviceSHOST_CANCEL_RECOVERYclock_listpcie_hot_resetattrsdynidseh_deadlinecpumask_tioa_fw_levelWORK_OFFQ_POOL_BITSbus_attrswregs_statedqb_isoftlimitdma_iommublk_mode_tKOBJ_CHANGEorig_axbd_claimingcompletesched_rt_entitymight_reschedtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEsoft_reset__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainbios_paramparam_ops_int_sigchldIPR_SHUTDOWN_PREPARE_FOR_NORMALpi_offsetsupported_devdiscard_granularityfopsreservedlatency_record_countcgroupsprev_scan_seqwriteqipr_ioafp_set_caching_parametersprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetmax_lunnext_cpustrimtime64_tdma_poolnuma_faults_localityhas_child_subreaperrom_bar_overlappref_64_windowi_aclmemset___GFP_ZERO_BIT__UNIQUE_ID_dual_ioa_raidtype603write_newlist_lockpm_domaininstrument_atomic_read_writecpu_bitmapipi_liststatic_call_keyutil_estucountsraw_atomic_fetch_sub_releaseBLK_UID_EUI64qc_stateset_rq_budget_tokensoftirq_next_timerkobject_namemax_active_zoneszone_wplugs_poolcheck_flagsipr_erp_starthandlerimm_readyswp_entry_tbi_inline_vecsbsg_deviceuint64_t_mapcountdomain_tagipr_config_table_hdr64pasid_requireddescriptor_idhang_detecteduuidchild_ns_typeqf_fmt_idipr_cmnd_is_frees_vfs_rename_keyeventsg_prot_tablesizeDID_PARITYget_unique_idset_performance_statexfer_lenphys_addr_tSHOST_CREATEDclass_preempt_is_conditionalcfg_sizeconsumers_cntmodule_memorypi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoipr_init_res_entryload_sumvfsgid_tcoublockioac__init_worknr_to_scanfs_parameter_specdesc_structdq_offipr_hostrcb_type_14_errorexec_maxkmap_ctrlqueue_ctxnode_stamponstackcompat_rmtpuproci_bytesmax_bus_speedpci_drivereh_compipr_init_ioadld3cold_delaydma_cleanupmaple_treekref_putKMALLOC_DMAdentrylast_merge__UNIQUE_ID_dual_ioa_raid604cpu_itimerpercpusriov_get_vf_total_msixlast_queue_full_countrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupsaved_end_ionr_threads__i_nlinkfailure_reasonipr_dump_location_entrypushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAipr_erp_cancel_alldelayed_workmq_listmanage_system_start_stophiwater_rsskretprobe_instancesPCI_ERS_RESULT_NONEshostloop_cmdrangecpu_addrmax_delayhost_lock_flagsresource_table_labelSYSTEM_POWER_OFFfutex_exit_mutexipr_hostrcb_type_03_errorpm_onlyipr_reset_slot_resetkernfs_iattrsPCI_ERS_RESULT_RECOVEREDtrc_blkd_nodesdt_wordPCI_ERS_RESULT_NEED_RESETipr_iopoll_weight_attr__sectoripr_add_remove_threadd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameblk_mq_ctxsa_codebi_iopriou_flagsipr_ioa_async_err_lognvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingipr_ioadl64_descis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typestate_savedi_rdevirq_reroute_variantin_ioa_bringdownpath_state_descself_exec_idipr_log_sis64_device_errorkernfs_opsWORK_CPU_UNBOUNDnew_ccinstd_inq_databist_methodMODULE_STATE_LIVEclearedipr_removeclass_maskstopnr_migrationsa_opsdual_raidreq_listxa_flagsmemory_read_from_bufferfreeze_raw_spin_lockbin_sizemap_busclosedev_dma_attrcfc_vpdgrphi___GFP_RETRY_MAYFAIL_BIT__compiletime_assert_2__compiletime_assert_4nr_sectorsDID_PASSTHROUGHipr_fast_rebootd_spc_timerjump_entriesnum_dma_sgasync_suspendmsi_device_dataipr_handle_config_changealignsuper_blockFORTIFY_FUNC_UNKNOWNBLK_EH_DONEset_policy_typercu_tasks_holdout_listioasc_specificFORTIFY_FUNC_memcmpinterruptscpuset_mem_spread_rotorio_optbvec_integrity_poolWORK_STRUCT_PWQ_BITassoc_arrayipr_ext_vpdmnt_idmapdq_dqblast_resetuidhash_nodesaved_tfblk_mq_queue_mapElf64_Xwordold_timespec32device_configureipr_pci_error_detectedlock_class_key__UNIQUE_ID_y_616num_symsipr_interruptsmodule_notes_attrsvm_lock_seqipr_free_all_resourcesipr_show_device_idPIDTYPE_MAXnlinkipr_hostrcb_config_elementis_virtfnpath_active_descpercpu_refhorizontal_positionipr_build_ucode_ioadlioerr_cntipr_log_hex_datapref_node_forkjiffieswait_queue__int128dqi_privrss_statpos__ipr_internal_cmd_donemems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profileop_codefutexipr_reset_start_timerwait_maxioa_vpdDEV_DMA_NON_COHERENTresult_maskstate_synceddump_takenpp_magicdquot_operationsmappingRPM_INVALIDgrploioa_data_lenipr_handle_other_interruptREFCOUNT_ADD_UAFclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_file___GFP_COMP_BITmax_device_blockedi_blockss_state__UNIQUE_ID_y_627user_sizetable__printk_ratelimitdev_pm_opscdrom_device_infoscheduledkobject_actionFAULT_FLAG_TRIEDraw_atomic_readclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkdestroy_workqueuekmalloc_typen_io_portdispatch_wait_lockqstrma_flagsnr_ia_rangesvset_nummax_user_discard_sectorsno_msifutex_stateorig_pmdqueue_lockshpc_managedipr_bus_reset_doneread_counterhead__acct_timexpdSHOST_DEL_RECOVERY__rcu_icq_cachesizedev_res_addrem_perf_tablewakeup_sourcef_posin_reset_reloadnext_posix_timer_id__kernel_long_ttask_fragipr_wait_for_opssrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lenarray_idsSAM_STAT_TASK_ABORTEDcinblockextableexitrpm_autosuspend_delaykernel_param_opsbus_dma_regiondpc_capio_uring_cmdirq_poll_disabledirtied_whenpdt_1f_for_no_lun__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexext_control_bufcore_statetimerqueue_headlist_is_headf_wb_errschedule_workWORK_OFFQ_DISABLE_BITSrcharfutex_pi_statekstat__kernel_uid32_tadd_cmd_parms_lendispatchq_lock_cls_keyaccess_stateinit_wait_entryDEVICE_FIXEDpte_tbar_seldevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockwake_batchWORK_STRUCT_FLAG_BITSget_namefwnode_endpoint__intwq_misc_constsopt_sectorsepoll_watchesipr_build_ioa_service_actionprealloc_pteauto_senseprot_typeborkensend_dma_addrSDEV_CANCEL__compiletime_assert_207dqb_curspace_entrygp_statebitsetload_avgsched_dataaccesscstimepcie_capcompletion_cntipr_ioa_reset_attrcfs_rqrq_end_io_fn_uidprot_opst_spacemm_cid_next_scanns_typescan_startmsix_enabledipr_save_pcix_cmd_regipr_store_iopoll_weightac_majfltpasid_enabledfactor1flush_dcache_pageposix_cputimers_work_upperpcie_reset_stateresetting_devicedata_ioadl_addrflags_and_data_lenmodule_param_attrsshort unsigned intstargetbus_flagssame_target_siblingsi_mutex_dir_keymq_pollpci_set_pcie_reset_stateq_node__param_max_devsspc_warnlimitvalidfd_ioascs_encodingqueue_worklast_func_vset_res_addrtype_07_errorgpl_crcsorc_entrykeysdma_handleorig_ptersvd_subtypepasid_capendlinedqb_curinodesload__s8sense_datapci_get_drvdataipr_set_supported_devsinvalidate_lock_keyvectors_infodma_maskprealloc_mutexnanosleepipr_shutdownipr_dual_ioa_raidSTARGET_REMOVEipr_hostrcb_raweh_host_reset_handlersrcu_gp_seq_neededsbq_wait_statedq_dqb_lock__kernel_ulong_tipr_set_sup_dev_dfltvolnameio_minelapsed_timeSAM_STAT_ACA_ACTIVEdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathHCTX_MAX_TYPESipr_hrr_queuedio_mem_alignnum_lidsbtimeprefix__u8is_roxipr_store_update_fwlockimage_hdrrlim_maxslave_dirDEVICE_PANEL_FRONTipr_alloc_dumprestartsipr_log64_path_elemdma_pool_allocnext_page_indexruntime_deferred_listd_waitlocal_fwnodequeue_flagslist_lru_oneipr_set_pcix_cmd_regdevice_physical_location_horizontal_positionsgl_alloc_order__UNIQUE_ID_debug602type_20_errorseq_stoppci_dev_flags_tipr_log_sis64_service_required_errordev_idscsi_unblock_requestsipr_get_hrrq_indexkiocbNEEDS_RETRYnum_entries_usedbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidflagipr_pci_perm_failureipr_is_scsi_diskaer_statsclr_uproc_interrupt_regs_blocksize_bitsnuma_scan_periodutil_summigration_disablediter_typeschedule_timeoutclass_device_is_conditionalqueue_rqsout_free_vpd_cbsshrinker_idbio_setpci_cfg_access_trylockrootoom_reaper_listscsi_device_handlershutdown_premax_dump_sizesym_VDSO32_NOTE_MASKscsi_devicewdtrbpf_storagepci_enable_device__data_lenmq_mapno_callbacksipr_probe_ioa__u16timers_activewait_countipr_get_sis64_dump_data_sectionalloc_hintsig_okipr_pci_frozenipr_build_mode_senseipr_dump_attrdelaysqf_ownerreadaheadkmalloc_cache_typecache_capstart_stop_pwr_conddump_data_regmutexpgd_tnr_cpus_allowedeh_abort_handlerdiscard_alignmentraw_spinlock_t__param_number_of_msixlock_flagskey_tagINIT_LIST_HEADtype_14_errorsysdatafs_flagswordneeds_warm_resetworkpgprotval_tkeytypeipr_hostrcb_type_23_errorsigpendingmq_freeze_depthfsindexshstkslave_configurereserved_tagssrcu_sspSDEV_CREATEDpage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdevpending_eventsirq_poll_fn__u32ptracedtrc_reader_specialdevice_get_match_datapci_disable_deviceipr_misc_cbsHPROBE_GONEioarcb_host_pci_addractive_timei_sequencepool_datapci_vpdpci_read_config_worddisk_statsipr_queuecommanddqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendori_dir_seqpath_stateirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmauclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typedpc_rp_log_sizepci_channel_io_perm_failurenotifier_fn_tBLK_INTEGRITY_CSUM_CRC64WQ_POWER_EFFICIENTf_iocb_flagsiodone_cntpoweroffcmaj_fltfeedbackvtime__UNIQUE_ID_max_devstype605math_emu_infoioadliowait_sumf_path__u64read_ioadl_lenjournal_infooverride_onlycc_res_handlereset_work_qFORTIFY_FUNC_memmoveres_addrsched_contributes_to_loadtimer_deletestatic_key_truedisk_events_disable_depthweighti_privatemaxrssipr_ioa_groupcfg_table64flushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGtty_audit_bufmax_hw_zone_append_sectorsipr_bus_attributes__UNIQUE_ID___addressable_cleanup_module644class_irq_is_conditionalipr_log_fabric_pathreschedule_jiffiessum_sleep_runtimeipr_show_fw_versiondeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacitydma_addressvm_startSAM_STAT_CONDITION_METtag_list_lockunused_hctx_lists_flagsget_rq_budget_tokenipr_log_enhanced_array_errorcpumask_var_tfaultipr_reset_allowedfabricalternative_gpt_sectorerrors_loggedkref_initshow_statsdl_densityresidual_data_lenfreeptr_tipr_build_ioadlset_dbd_for_msread_dqblkintegritydq_flagsread_before_msout_free_host_rrqnext_cpu_batchatomic_fetch_sub_releaseDD_CLASS_TYPE_DISJOINT_NAMESipr_hostrcb_type_01_errorpci_devp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgdma_boundarys_time_gran__refcount_inckernel_cap_tSUBMITTED_BY_SCSI_RESET_IOCTLnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITSDEV_EVT_MEDIA_CHANGEnum_kpin_execvehost_tagsettlb_flush_pendingpage_offset_baseRPM_REQ_SUSPENDs_listread_ioadl_addripr_get_mode_pageFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_lockno_report_lunss_dquotmax_hw_sectorsfolioqPCI_ERS_RESULT_CAN_RECOVERsystem_highpri_wqtagssync_cmdq_flagsprev_posseqcount_spinlockstrncmpexpire_countblock_desc_lenpci_write_config_bytescnprintfs_umountis_bin_visiblepgoffADD_TO_MLQUEUEsyscall_user_dispatchipr_erp_donercu_tasks_exit_list__UNIQUE_ID_transop_timeouttype599archdataia_uid__list_del_entry_valid_or_reportfd_phys_locatorchildrenrb_subtree_lastipr_error_table_tno_pm_callbacksipr_regsbuild_id__p_lenrequeue_lockvfork_done___GFP_ACCOUNT_BITvmalloc_noproferr_nodevBLK_UID_T10zero_sntimestamppud_tioarcbrt_spc_timelimitsym_int80_landing_pad__msdma_set_mask_and_coherentfailing_lbatailia_atimelastpath_type_desctlb_ubcSTARGET_CREATEDbi_issuequota_format_typemsi_enabledseekstask_structbudget_tokenDID_ERRORrelease_dquotsrcu_n_exp_nodelayipr_do_reqsuspend_timerdma_pool_destroyreset_retriesquotalendev_id_typef_pipei_wb_frn_historylast_wakeenextWORK_OFFQ_LEFTKOBJ_BINDio_tlb_memhost_self_blockedarch_spinlock_tsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometry__compiletime_assert_0__compiletime_assert_1manufacturer__compiletime_assert_3devcapsuppress_bind_attrsRPM_RESUMINGd_weak_revalidate_raw_spin_unlockgsbaseSDEV_EVT_ALUA_STATE_CHANGE_REPORTEDdispatch_waits_quota_typesinternal_tagipr_show_log_levelf_llistmq_freeze_lockget_free_pages_noprofi_nlinksdev_devbranchwrite_begingroups__const_udelayerr_handlerno_vf_scanpi_blocked_onipr_find_sdevs_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdriver_namedl_serverscsi_device_putSCSI_EH_RESET_TIMERtrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabled__UNIQUE_ID_x_630syscwil_prevget_name_prefixwlockedfreeze_superipr_init_res_tables_inode_list_lockelevator_queuenum_hrrqipr_wait_for_pci_err_recoveryprotoruntime_idleipr_update_fw_attrsweventirq_nonefreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgscsi_scan_host__param_str_debugntabdevice_typemaj_fltarch_rwlock_tmode_hdripr_log_sis64_fabric_errorold_resctx_mappcie_warm_resetSHOST_DELbitposclock_baseipr_probearch_atomic_setipr_device_resettype_23_errorcdevmy_qgroup_leaderhostrcb_report_qmkdirdma_free_coherentnextentsreal_blockedarg_lockclr_interrupt_mask_regnum_exentriesmode_pagerequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningipr_debugclassesnext_timerclass_write_lock_is_conditionalfinish_waitbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_databytes_to_copymmap_locksysfs_lockipr_sdt_is_fmt2rq_qosipr_ioa_state_attrfsavekeyring_index_key__WQ_ORDEREDSAM_STAT_GOODrefcount_saturation_typeqrwlockoverflowsystem_freezable_wqFAST_IO_FAILSDEV_EVT_CAPACITY_CHANGE_REPORTEDfile_ra_stateuser_structioasaioascKOBJ_OFFLINEon_rq__p_size_fieldfs_contextmempool_alloc_tmem_flagsprealloc_bufDL_DEV_DRIVER_BOUNDpci_cfg_access_unlockprojiddrop_inodenum_trace_evals__param_str_dual_ioa_raidnum_vffree_irqcylindersunsafe_warnllseekfoundDEVICE_HORI_POS_CENTERDL_DEV_PROBINGrem_lennext_offsetcommit_dqblknamespacei_ino_warnlimitipr_ioafp_query_ioa_cfgatomic_write_boundary_sectorswritable_sizercu_nodeWQ_SYSFSipr_hostrcb_device_data_entry_enhancedunfreeze_fsintervalclassipr_device_configurepci_addresslast_mm_cidfile_lockuntrustedmax_open_zonescookieipr_initiate_ioa_resetbd_stampSTARGET_DELset_uproc_interrupt_reg32targetstarved_entrydevice_spec_parmsa_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structsense_lencred_guard_mutexbusymajorWORK_OFFQ_POOL_SHIFTsigcntipr_copy_ucode_bufferhrtimer_cpu_baseresourcescb_headcheck_quota_fileFORTIFY_FUNC_memchrattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cachecfc_last_with_dev_vpdclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsioasa_datalist_lruusing_gplonly_symbolstarget_knsival_ptrtry_vpd_pagesreg_offsetipr_hostrcb_type_ff_errori_opflagsshost_devsense_interrupt_mask_regrobust_listipr_cmnd_listbus_phasesym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descpci_request_regionss_incoredqsd_iputcompat_ioctllockdep_mapnew_pathipr_dump_version_entryfiltercurr_ret_stackirqreturn_tlast_queue_full_depth__compiletime_assert_451dockmaskvalioasa_lensdev_bflagsipr_supported_devicedev_links_infoloff_tthread_pidKOBJ_ADDsrcu_gp_seqascii_plant_codeia_rangesno_command_memory_archst_valueclass_write_lock_irq_is_conditionalipr_log_sis64_config_errorilidKOBJ_NS_TYPESpprevcallseh_actioni_default_acleh_target_reset_handlers_uuid_lenioc_nodeof_node_reusedipr_ioasainsnlenbytes_copiedsis64class_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnospin_lockuintptr_tbatchasync_sizeacct_vm_mem1num_online_cpusentries_each_hrrqmatchblk_integrity_checksummemory_typerb_rootnr_wakeups_localnr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorspci_error_handlersWRITE_LIFE_NONEWRITE_LIFE_NOT_SETextended_reset_delaypadding__init_waitqueue_headipr_inquiry_page_supported__filler__list_addsaved_sigmaskd_timeentriescpu_idipr_reset_mode_sense_page24_failedfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namestarget_busys_mtdkparam_stringpoweri_mtime_seccleanup_rqevent_flagssched_delayedbd_statsbi_sizesupported_modescsi_device_eventmodule_state_dev_info__write_overflow_fieldmq_kobjlast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statesense_interrupt_reg32firstiommu_groupdispatch_fromipr_slave_destroydma_alignmentmigrate_to_ramipr_log_enhanced_config_errorscmd_printkwait_pidfdptrace_bpsipr_hostrcb_type_21_errors_umount_keyscsi_bufflenvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridge__param_str_fastfailia_ctime__fortify_strlenFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendipr_process_ccnipr_alloc_memFORTIFY_FUNC_memcpynsproxycan_wakeupipr_dev_groupscsi_cmdxol_areascsi_idipr_ses_table_entrytransporttrlockfl_owner_t_rescls_mskia_rangeeuidwaitbug_tabledirtied_time_whenstart_addrdma_drain_lensequential_io_avgipr_ucode_image_headernr_pagesDID_BUS_BUSYnum_trace_bprintk_fmtqueue_ramp_up_periodvm_policysize_mulperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVEioa_is_deadio_window__state_sizecallerthread_structcached_requested_keyenvpdev_set_drvdatabvec_iterctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenpme_supportdqb_btime_nr_pages_mappedutf8datascsi_host_putmm_usersbd_holder_locks_idcleanup_nologs_dentry_lrubp_offsetSHOST_RUNNINGblk_crypto_profilefolio_queuelast_task_numa_placementipr_log_cache_erroripr_ioa_infopgtable_tblock_startKOBJ_UNBINDcgtimeipr_show_resource_typesymlinkbq_enc_multioom_flag_originipr_reset_cancel_hcam_doneDMA_NONEcounterorc_unwindWRITE_LIFE_SHORTminor_releaseptf_numbermedium_type__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqint_mask_regtrace_eval_mapres_flagsdonefscrypt_operationsipr_scsi_bus_speed_limitrelease_workipr_ioa_service_action_failedipr_reset_timer_doneksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSptm_granularityratelimitfree_foliodebugfs_dirdriver_managed_dmaqueuedataMIGRATE_SYNCipr_dump_ioa_type_entryexport_operationsPIDTYPE_PGIDrm_xquotarefcount_inc__builtin_strlendl_timerioasa64i_dataDL_DEV_NO_DRIVERipr_isrFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrflags_hilong long unsigned intanon_nameopen_partitionsend_io_datablkcg_gqmap_queuesia_filesival_int__ipr_eh_dev_resetnuma_preferred_niddma_need_draininstrument_atomic_write_hugetlb_cgroupipr_haltdentry_operationsipr_reset_ioa_jobchannelmemcg_nr_pages_over_highd1_supportqueue_offsetarch_uprobeSAM_STAT_TASK_SET_FULLres_pathipr_config_table64_Boolsleep_start__p_sizemin_fltwwidHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatereverse_orderingstrleni_link__outlistxattr_lowertrap_nrcleanup_nomemmax_queue_depthasync_probe_requested__list_add_valid_or_reportcompat_long_trefcount_dec_and_testipr_reset_get_unit_check_jobactive_countipr_erp_request_senses_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemin_cmd_idipr_hcammce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupswakeup_cntpmd_ts_opsysv_shm__param_str_max_devsdma_channelipr_get_unit_check_bufferlast_sector_bugdq_countipr_config_table_entry64utf8data_tableset_latency_tolerancesystem_freezable_power_efficient_wq__func__resource_size_tnr_tagsipr_log_fabric_errorfoliowake_entryxa_headsuidnum_sgscsi_sglisti_readcountipr_max_speedmanage_runtime_start_stopblk_integritylocked_vmipr_probe_ioa_part2rb_leftseq_nextguess_capacitysym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_t__compiletime_assert_620class_rcu_is_conditionalfilepbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idignore_media_changeretrieskernfs_elem_dirsrcu_lock_countWQ_UNBOUNDipr_hostrcb_fabric_descksm_merging_pagesipr_transop_timeoutautosleep_enabledipr_trace_entryptrace_entry__flush_workqueueblkg_listhost_scribblerecent_used_cpunum_jump_entriess_qcopatomic_tbv_pagealloc_tag_counters_flagsrqos_debugfs_dirpci_channel_io_frozennotify_nextmax_perf_statebus_dma_limitbuffershort intmynode__compiletime_assert_634part_tblipr_eh_dev_reset__compiletime_assert_638zone_wplugs_hashrestartblk_mq_opsscatterlistbridge_ctlclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdiripr_log64_fabric_pathVTIME_USERsa_flagstestproduct_idBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invavail_stat_lenpad_untilDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerextra_lenprio_listatomic_write_hw_unit_max_flags_1_flags_2eh_device_reset_handlersbitmaplast_arrivalsupported_speeds__UNIQUE_ID_debugtype601em_pdtrace_event_callout_msi_disableis_guestdevice_physical_locationpm_domain_dataeh_eflagspoll_table_structipr_show_adapter_statedirect_IOpcie_deassert_reseteye_catcherwait_queue_entry_televatoripr_reset_start_bistdasdcurrent_may_mountseqlock_tskip_ms_page_8bd_queuenuma_scan_offset_ipr_initiate_ioa_resetipr_log_config_erroripr_ioafp_std_inquiryioa_mailbox___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskhost_rrqvpd_pg80vpd_pg83vpd_pg89__ret_warn_onregfuncfirmwareindex_keymemalloc_noioGRPQUOTApci_dynidsi_ctime_nsectime_leftia_validvertical_positionSUCCESSWORK_OFFQ_FLAG_ENDreset_wait_qFORTIFY_FUNC_strncatipr_dev_attrsdriver_templatei_rcuscsi_is_host_devicei_atime_secWORKER_DESC_LENcur_lenipr_sglistqc_type_statekey_serial_tmax_bus_speed_limitdev_ueventsetupf_lock___GFP_MOVABLE_BIT__read_overflowpcie_bwctrl_dataactiveselect_no_atndqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMtemp_regsrcu_idxpidsspinup_delaymax_discard_sectorsDID_NO_CONNECTFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listno_read_capacity_16op_foundtagged_supportedreap_refget_unaligned_be64DID_TIME_OUTxarray_start__flagsp_size_fieldfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atipr_alloc_ucode_bufferscsi_host_templatelast_sum_exec_runtimeipr_ses_tableiov_iterarch_atomic_add_returnipr_ioa_headia_gidSDEV_OFFLINEtransop_timeoutipr_driverattribute_groupMQ_RQ_COMPLETEcontextposix_timersdriver_exclusive_resourceselectorucode_vpdblkcg_polsMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasebi_nextdefault_timer_slack_nskcsan_check_accessoffline_alreadysource_listRPM_REQ_NONEdma_unmap_sg_attrsswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BITdid_workgroup_infovdso_image__param_max_speedblk_qc_tfileWORK_BUSY_PENDINGof_match_tablepercpu_count_ptr__user_state_sizefilp__WQ_BH_ALLOWSpcie_cap_locklist_move_tailtype_03_errorsg_pagemce_kill_meipr_hostrcb_type_41_errorpci_free_irq_vectorsipr_resource_type_attrraw_modephysical_block_sizeuuid_teh_noresumeproperty_read_int_arraySCSI_EH_DONE___GFP_UNUSED_BITatomic_write_hw_unit_mincount_objectserrorq_sizedma_set_coherent_maskipr_hostrcb_type_17_errorfls64_stimezone_device_dataipr_alloc_cmd_blksSDEV_EVT_INQUIRY_CHANGE_REPORTEDnr_active_requests_shared_tagsipr_uc_sdti_flctxqueuelistphysfndefparamresid_lenfred_csq_lockdep_mapinquiry_lenfault_flagipr_dump_trace_datakprojid_tptracer_credtlb_genstoreio_lock_cls_keySDEV_TRANSPORT_OFFLINEpage_mkwritescan_enabledipr_isr_ehkobjectaudit_ttymce_ripvstatfsipr_hostrcb_type_30_errortag_set_dev_erripr_ioasa64__WQ_DESTROYINGats_enabledsdt_endnumab_stateremovableipr_reinit_ipr_cmndipr_store_raw_modefeatureson_listkgid_ton_cpuipr_max_devsFAULT_FLAG_VMA_LOCKWORK_OFFQ_BH_BITfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistipr_unit_check_no_dataipr_reset_block_config_accesseetlp_prefix_pathclass_groups__refcount_sub_and_test__warn_flushing_systemwide_wqnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNdump_addr_regwait_chldexiterrseq_tipr_pci_mmio_enabledioctx_tableVTIME_SYSchangedcmndfnamesysfs_registeredallow_interruptsdebugfs_mutexwatch_list__fortify_sizeaudit_contextpp_ref_countipr_get_autosensesysfs_opserror_detectedsequential_iois_busmasterSHOST_CANCEL_large_mapcountipr_dump_trace_entrysda_is_static__compiletime_assert_109formatftopenclaveshost_gendevSDEV_CREATED_BLOCKbi_privateexit_hctxsp_regcreatehdw_dma_regsiattrWORK_STRUCT_PENDING_BITrseqipr_reset_enable_ioanfdssigvalvma_lockmax_discard_segmentsperf_event_listgetgeolid_table_offset__compiletime_assert_111vpd_cbs_dma__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115get_reserved_space__compiletime_assert_117ipr_hostrcb_array_data_entry_enhanced__compiletime_assert_119sg_sizenon_seqstack_refcountinvalidate_lockbmap_raw_spin_unlock_irqipr_change_queue_depthkey_payloadhcamtimer_rand_stated_real_locklink_stateclear_isrexpiry_active__already_doneoldp__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126dqi_max_spc_limit__compiletime_assert_128__compiletime_assert_129IRQ_NONEexception_table_entryipr_log_vpdvirt_boundary_maskevent_countWORK_STRUCT_COLOR_SHIFTfallocatei_spc_warnlimitbuddy_listcdl_enablei_ino_timelimit_find_first_zero_bit__compiletime_assert_50SDEV_RUNNING__compiletime_assert_52__compiletime_assert_53__compiletime_assert_130__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135__compiletime_assert_136mems_allowed__compiletime_assert_138tlb_flush_batchedipr_free_irqsout_free_irq_ddebug_infoslave_allocipr_check_term_poweripr_log_path_elemis_noirq_suspendedvariable_ffztracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tscsilun_to_intneeds_hard_resetblocksnum_elemsinit_completionset_infofileattr_getirq_poll_completevectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcat__devices__bi_cnttimer_listheads__compiletime_assert_150__compiletime_assert_151__compiletime_assert_152__compiletime_assert_153__compiletime_assert_154__compiletime_assert_155__compiletime_assert_156__compiletime_assert_157device_dma_supported__compiletime_assert_159d_ino_warnshiwater_vmtracepointcompound_headia_vfsuidrelease_firmware__kernel_ssize_t__UNIQUE_ID_number_of_msix608orig_ret_vaddripr_sdt_entrypoweroff_noirqsrcuunique_idrenamevm_area_structrpm_statussb_writersino_timelimit__compiletime_assert_161__compiletime_assert_162pci_bus_flags_tsplice_write__compiletime_assert_165msix_cap__compiletime_assert_167ipr_get_max_scsi_speedi_rt_spc_timelimit_raw_spin_lock_irqsaveipr_resource_path_attrioasa_host_pci_addripr_find_starget__list_del_entry_validrom_base_regpage_codeipr_chip_tqf_nextcdl_supportedaen_naca_fmtio_window_1krangesipr_ioafp_mode_select_page24del_from_mliommu_mmats_stublk_features_ttype_ff_errorcutimeem_tableprot_flagsipr_clear_res_targetpersonalityget_stateclr_intspci_unregister_drivertask_sizes_inodes_addr__param_debugbinfmtreset_cmdirq_domainnr_queuessigned charread_data_transfer_lengthprioprivgetattrsched_infopids_actived_fieldmaskquiesced_byipr_reset_wait_for_dumpshutdown_typeuprobe_xol_opsseq_fileipr_initfreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsspin_unlock_irqfile_operationsqueue_rqipr_auto_senseKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tagscsi_change_queue_depth_killktime_tsymsgroup_nodepci_ioremap_bari_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timerSAM_STAT_RESERVATION_CONFLICTipr_init_ioa_memavx512_timestampfuncsend_dataarch_atomic_fetch_addreadlsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncarray_entrysetleasepinsipr_ioa_dumpsaved_pcix_cmd_regpacct_structcfgtewmust_resumeresidual_trans_lengthlong intfile_lock_contextusagel_yesQUEUEDsiglockipr_find_ses_entrystatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ss__dynamic_dev_dbgproperty_present__pptrexpecting_cc_uaipr_read_async_err_log__kmalloc_index__write_overflownr_iosprintk_index_sizesymtabfree_disksg_tablert_mutex_waitertime_since_last_ioa_resetremount_fss_typeruntime_statusin_iowaitlun_in_cdbunregfuncarray_member2egidiomapipr_reset_alertpatch_numberdq_hashvset_serial_numput_superfwnode_reference_argsipr_write_dumphrrq_endpushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donehrrq_indexis_thunderboltmark_dirtyeh_cmd_qnum_srcu_structsbdi_writebackkobj_completionSOFT_ERROR__kernel_clockid_tipr_diagnostics_attrseccomppage_lengthiteratorqc_infodev_nameTT_NONEscsi_dma_mapVTIME_INACTIVEf_inode__kernel_timespecipr_ioafp_identify_hrrqcancelled_write_bytessrcu_usagebitmapacpi_match_tablesc_data_directionmemcg_sigvalhrrq_flagsipr_software_inq_lid_infobvecnameidataipr_mask_and_clear_interruptslatency_recordmod_kallsymsmnt_idirq_flagexpected_dev_res_addrmultifunctiondepthsnprintfwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldipr_release_dumpdma_pool_freedma_addr_tshiftipr_iopollcheck_eventsssize_tiopl_emulpage0_datamax_write_zeroes_sectorswork_structdesc_lenflocktrack_queue_depthtask_io_accountingmremaps_writers__fortify_panicadd_lentracepoint_funclast_res_pathargventryfree_cached_objectsworkqueue_structrequest_firmwaredma_pool_createmax_target_blockedipr_store_log_levellog_hcam__list_del_entrypr_opssecondspi_lockcapable___orig_eipipr_chip_cfg_tprobestubipr_is_deviceipr_hostrcb64_errorget_timemm_cid_activeelemsizedirty_paused_when__UNIQUE_ID_x_613__UNIQUE_ID_x_615maxlen__UNIQUE_ID_x_617suspend_noirqevent_listscheduleclass_spinlock_irq_try_is_conditionalset_uproc_interrupt_regoom_mmehandlerspin_lock_irqFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nsecpci_channel_offlinei_lrud3cold_allowedFORTIFY_FUNC_strcpy__UNIQUE_ID_x_621queue_depth__UNIQUE_ID_x_626__UNIQUE_ID_x_628cmd_regunderflowipr_log_generic_errorgfp_maskpi_state_listrcu_segcblistsubvolsubmitterusecspin_unlock_irqrestorefree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infomq_rq_statesrcu_struct__UNIQUE_ID_x_632rlim_curnofault__UNIQUE_ID_x_639mm_countdrv_groupsstackfast_donescsi_data_bufferfunctionkstrtoullperi_qual_dev_typeki_flagsipr_hostrcb_errorbvec_poolbd_start_sect___GFP_IO_BITsrcu_have_cbsipr_resource_entryd_in_lookup_hasheh_timeoutmax_sectorssgidipr_reset_cancel_hcaminitial_nsFREEZE_MAY_NESTipr_get_ioa_dumptype_12_errorscsi_transport_templateREFCOUNT_ADD_NOT_ZERO_OVFbucket_idrb_leftmostthread_infop_lensuspended_timedatastrtabtty_old_pgrprcecipr_lock_and_donedl_throttledi_rwsem_oldget_projidtimeout_funcsched_reset_on_forkmq_ctxHPROBE_CONSUMEDbpf_net_contextcfgte64opc1ipr_reset_cmd_failed__int128 unsignedpcountwake_indexjiffies_to_msecsrestore_noirqdma_pad_maskipr_modify_ioafp_mode_page_28ki_filpbitmap_tagscap_ambientdma_configureruntime_errorout_ipr_free_cmd_blocksactive_modesg_nextatomic64_tanon_vmaipr_log_vpd_compactHCTX_TYPE_DEFAULTruntime_autoPROBE_DEFAULT_STRATEGYDID_TRANSPORT_FAILFASTrlimread_folionr_eventsclear_bitipr_hostrcb_device_data_entryiommubi_opfstageprivatedev_lunst_infomap_countipr_ioa_reset_donepdeath_signal__UNIQUE_ID_author591exit_signalsa_restorerbpf_run_ctxipr_fastfailscsi_vpdpci_irq_vectortph_enabledsplice_pipehostdata__be16short_inquiryblk_mq_tag_setpasid_no_tlpipr_hostrcb_type_04_errorspinlock_checkblk_independent_access_rangess_lock_keyipr_dump_version_data__pci_register_driveris_ndnipr_reset_ucode_downloadsrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqipr_hostrcb_array_data_entryres_attrDEVICE_PANEL_RIGHT__compiletime_assert_537simple_strtoulbus_widthKMALLOC_RANDOM_ENDmods__UNIQUE_ID_fast_reboot610slotsSUBMITTED_BY_BLOCK_LAYERtqheadeh_bus_reset_handlers_activeipr_chipMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangemin_shallow_depthnr_hangssym_vvar_startgid_twake_cpuchainedio_uring_taskarray_memberabort_workmemcpy_to_pagepage_offsettask_worksmemory_failurerb_root_cached__be32ioadl_flagss_copcfg_table_dmadd_key_truekmalloc_array_noprofhres_activesdev_prefix_printkbpf_raw_eventsdma_alloc_attrsipr_is_naca_modeldq_dirtydl_deferround_robinbug_listdirect_completeblk_mq_tagswbt_flagsxa_lockfxregs_statelog_levelload_weightipr_ioasa_gpddkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countlockableipr_reset_reset_workhcam_cmdkey_restrictionnr_rangeexit_stateSYSTEM_SCHEDULINGioa_datais_late_suspendedsysvsemadd_busshost_statebd_nr_sectorsFAILEDadd_cmd_parms_offsetignore_childrenresourcerestore_earlyipr_cmd_poolclock_mutexfs_superskref_getipr_ioafp_pageC4_inquiryarch_set_bitqueue_stopped__be64hdr64vpd_pgb0vpd_pgb1vpd_pgb2vpd_pgb7dqb_bsoftlimitpendingmax_dev_sectorsno_vpd_sizef_task_workipr_ioarcbipr_res_addr___GFP_NORETRY_BITiowait_countmatch_driverprot_sdbnotifier_blockset_read_onlyipr_std_inq_vpidsgscsi_resthrotl_datadma_io_tlb_memstringread_countfix_capacityfutex_offsetlong long intmmio_always_onadditional_lenatomic_flagssysvshmsense_interrupt_mask_reg32timer_expirestrace_evalsactive_basesinit_namerp_bufferearly_initrcec_eacmd_sizemprotectipr_ioarcb_sis64_add_addr_ecbsecurityxmm_spaceactivatescsi_targetmsix_basef_pos_locksystem_statesi_fieldmaskREFCOUNT_ADD_OVFtls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structipr_dump_location_databroken_fuaWQ_FREEZABLE___GFP_FS_BIThostrcb_pending_q__ipr_removeipr_reset_block_config_access_waitdomain_datarelax_countdma_devtagset_freedlinelinkstart_timekernfs_nodedev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchreschedule_countvfsmountextable_basenoinstr_text_sizeattributesset_child_tid_overruntmpfilercu_read_lock_nestingtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugrefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tUTF8_NMAXfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqia_vfsgidsize_tcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workatomic_long_tpreallocclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicdelayed_callmax_nr_cid_statusd_sibbin_attributepercpu_counternuma_pages_migratedgsindexexpires_nexti_io_listf_epsrcu_barrier_seqreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tHRTIMER_BASE_BOOTTIMEclass_srcu_is_conditionalnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionHRTIMER_BASE_REALTIME_SOFTstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registers_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrstate_in_sysfstty_structUTASK_SSTEP_TRAPPEDbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollnr_wakeups_idleio_cqelf64_symlatch_tree_nodedestroy_work__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerma_external_lockuid_tflush_requiredsum_block_runtimepgmapdq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditional_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitnuma_groupdescriptionclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinei_inodyndbg_infoindexthread_headmap_typef_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_len__UNIQUE_ID_alias473__UNIQUE_ID_alias474__UNIQUE_ID_alias475__UNIQUE_ID_alias476__UNIQUE_ID_alias477HRTIMER_RESTART__UNIQUE_ID_alias479MOD_MEM_NUM_TYPESsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxcpu_basedquotdl_runtime__UNIQUE_ID_alias480__UNIQUE_ID_alias481__UNIQUE_ID_alias482__UNIQUE_ID_alias483__UNIQUE_ID_alias484__UNIQUE_ID_alias485__UNIQUE_ID_alias486__UNIQUE_ID_alias487numbers__UNIQUE_ID_alias489_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroup__UNIQUE_ID_alias490__UNIQUE_ID_alias491ptrace_message__UNIQUE_ID_alias493__UNIQUE_ID_alias494__UNIQUE_ID_alias495__UNIQUE_ID_alias496__UNIQUE_ID_alias497__UNIQUE_ID_alias498num_trace_events_sys_privateUTF8_NFDIinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authHRTIMER_BASE_TAIvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherscompletionsw_reservedUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treequota_onvm_operations_structbin_attrs_newiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdatanrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupwake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlinedup_xol_worktotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramd_spc_softlimitreported_split_lockgfp_tseccomp_filterstimei_mmapthaw_superd_lrusignal_structperf_event_mutexcrcspgdval_tSB_FREEZE_WRITEsetattrf_mappingnoinstr_text_startbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activei_opldt_usr_semkobj_ns_type_operationsDQST_FREE_DQUOTSseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tis_dirty_writebacktrace_bprintk_fmt_startkstatfssitesptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGthreadsym_timens_pages_time_min__UNIQUE_ID_alias503s_devcpus_allowed_lockget_next_idrwlock_tpgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutex_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupseqcount_spinlock_ti_wbclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedpagetrc_holdout_listget_inode_usagenormal_priodestroy_inoderelease_folioi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inameHRTIMER_BASE_MONOTONIC_SOFTi_mappinginblockrmidrseq_siglimit0limit1dqi_max_ino_limitmigrate_modeftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksd_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrDQST_SYNCSstack_vm_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalcg_listsrcu_barrier_completionrw_semaphoremnt_sb_ddebuginfofiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypeinit_modulemembarrier_statepage_poolinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_mempathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwrcu_syncvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstate__UNIQUE_ID_alias478ueventlock_countrefcount_tplugsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttableslist_headtgidwrite_protect_seq__UNIQUE_ID_alias492compat_robust_list_head_tids_inode_wblist_lock__UNIQUE_ID_alias499end_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextgpl_symsseq_showswait_queue_headblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfds_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceobjcgnodeDQST_READSvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvstatic_prioshrinkerdl_yieldeddqi_formatexec_update_lockDQF_PRIVATEDQF_SYS_FILE_Bl1d_flush_killi_versionprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symboltv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskSB_FREEZE_PAGEFAULTactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlock__rcu_headmce_vaddrquota_offdq_inusedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmod_tree_nodef_sb_errwritepagecodegtimesigactionclass_rwsem_read_is_conditionalsum_sched_runtime__UNIQUE_ID_alias500__UNIQUE_ID_alias501__UNIQUE_ID_alias502__kernel_timespec__UNIQUE_ID_alias504__UNIQUE_ID_alias505__UNIQUE_ID_alias506locked_pending__UNIQUE_ID_alias508__UNIQUE_ID_alias509nr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listktypelockref__UNIQUE_ID_alias510srcu_struct_ptrs__UNIQUE_ID_alias512__UNIQUE_ID_alias513__UNIQUE_ID_alias514mm_struct__UNIQUE_ID_alias516__UNIQUE_ID_alias517__UNIQUE_ID_alias518vlagi_uidspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesvm_mmmod_mem_type__UNIQUE_ID_alias520__UNIQUE_ID_alias521__UNIQUE_ID_alias522debugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipMOD_INIT_RODATAqc_dqblkmmappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCi_write_hintfxsaveprocess_keyringlist_op_pendingllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyioveci_private_lockVTIME_IDLEstatic_keys_magicdl_overrunDQST_ALLOC_DQUOTSd_parentpayloadac_minflti_sbd_sbcommPIDTYPE_PIDatomic_write_segments_maxatomic_openreadahead_control__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupblockedi_securitystats_lockD_REAL_DATApt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colorbitsiopriocap_inheritablegp_waitlookupDD_CLASS_TYPE_LEVEL_NAMESvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vec__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATElf64_Symd_automountparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcestack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkDQST_CACHE_HITScmaxrsstimer_slack_nspolicysharedd_real_typelookahead_bandseq_startraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamerun_delaytailslinenoget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_code__UNIQUE_ID_alias488is_hardfsbaseattrscpumask_tswregs_statedqb_isoftlimitorig_axsched_rt_entitytimerqueue_nodeil_weightmem_dqblknr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pause_sigchldreservedlatency_record_countcgroupsprev_scan_seq_DQST_DQSTAT_LASTrcu_usersoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockUTF8_NFDICFcpu_bitmapstatic_call_keyutil_estucountsMOD_RODATAqc_statesoftirq_next_timercheck_flagsswp_entry_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aMOD_INVALIDmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalautogroupnr_threads__i_nlinkpushdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magicfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsMOD_INIT_DATAnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_infoshared_pendingi_gidmin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idHRTIMER_MAX_CLOCK_BASESkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsxa_flagsbin_sizegrphid_spc_timerjump_entriesassoc_array_ptrsuper_block_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_array__UNIQUE_ID_depends472mnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpref_node_fork__int128dqi_privrss_statmems_allowed_seqrefcntD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxresult_maskdquot_operationsmappinggrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizescheduledclass_raw_spinlock_nested_is_conditionalworker_privateis_relqstrma_flagsfutex_stateHRTIMER_BASE_TAI_SOFTacct_timexpd__rcu_icq_cacheDQST_WRITESsizef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attempts__UNIQUE_ID_srcversion523alt_lencinblockextableexitkernel_param_opsio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tdl_server_has_tasks_frunnable_sumreal_credepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgcstimecfs_rq_uidst_spacemm_cid_next_scanac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysMOD_TEXTdqb_curinodesload__s8invalidate_lock_keyprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_marksdio_mem_alignbtime__u8is_roxlockrlim_maxruntime_deferred_listd_waitlist_lru_oneseq_stopkiocbclass_rwsem_read_intr_is_conditionalfsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeshrinker_idrootoom_reaper_listsym_VDSO32_NOTE_MASKbpf_storage__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingfsindexshstksrcu_ssp__page_1__page_2__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEi_sequencedqb_ihardlimitd_lockrefnum_bpf_raw_eventsaddr_perfi_dir_seqkqidKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typef_iocb_flagscmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagshrtimer_base_typestart_boottimevm_starts_flagsiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listhrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendings_listdqb_rsvspaceversionserialalloc_locks_dquotfolioqprev_posseqcount_spinlocks_umountis_bin_visiblesyscall_user_dispatchrcu_tasks_exit_listia_uidchildrenrb_subtree_lastbuild_idvfork_donenanosleeprt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelayquotalenf_pipei_wb_frn_historylast_wakeenextarch_spinlock_ti_mtime_nsecmmlistutf8_normalizationset_dqblkreg_offsetgsbases_quota_typesf_llisti_nlinkwrite_beginpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedHRTIMER_BASE_BOOTTIME_SOFTfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tquota_enablesched_avgntabmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextprealloc_bufprojiddrop_inodenum_trace_evalsllseeknext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeunfreeze_fsintervallast_mm_cidcookietargeta_flagstrace_overrunsession_keyringfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributerestrict_linkMOD_DATAi_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackloff_tthread_pidsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringma_locksched_delayedmodule_statelast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimemigrate_from_cpusrcu_barrier_mutexi_private_dataElf64_Halfnsproxyxol_areacleanup_modulerlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_datasignumfscrypt_keyrings_mountsuse_memdelay__state_sizethread_structcached_requested_keyenvpctimereleasesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_datasysv_semanon_vma_namefileattrDQST_DROPSlong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionali_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_ts_iflagsmce_kflagstotal_numa_faultss_countd_revalidates_opsysv_shmdq_countutf8data_tablefoliowake_entry__UNIQUE_ID_alias507xa_headsuidi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_lockiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_id__UNIQUE_ID_alias511kernfs_elem_dirsrcu_lock_count__UNIQUE_ID_alias515__UNIQUE_ID_alias519ksm_merging_pagesptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_t_flagsnotify_nextshort intmynodeclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_ownerbp_regVTIME_USERsa_flagstesti_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivaltrace_event_callis_guestpoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keyGRPQUOTAi_private_listia_validi_rcuHRTIMER_BASE_REALTIMEi_atime_secqc_type_statekey_serial_tsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsi_wb_listxarray_startfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectordefault_timer_slack_nssource_listswap_readahead_info__fpstateactive_refgroup_infovdso_imagefile__user_state_sizemce_kill_meuuid_tcount_objects_stimezone_device_dataf_wb_errdefparamfred_cskprojid_tptracer_credtlb_genstorekobjectaudit_ttymce_ripvstatfsnumab_statefeatureson_listkgid_ton_cpufregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisti_mmap_rwsemwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadd_realexpiry_activedqi_max_spc_limitexception_table_entryfallocateHRTIMER_BASE_MONOTONICi_spc_warnlimitbuddy_listi_ino_timelimitSB_FREEZE_FSi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infotracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevfs_structclockiduint32_targ_startblocksset_infofileattr_getvectortimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrrenamevm_area_structsb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextiommu_mmcutimepersonalityget_statetask_sizes_inodes_addrbinfmtsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filercu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataki_posexecute_only_pkeysetleasepacct_structlong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typein_iowaitunregfuncegiddq_hashput_superMOD_INIT_TEXTpushable_dl_tasksf_flagsf_inodemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infoTT_NONEVTIME_INACTIVEcancelled_write_bytessrcu_usagebitmapmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_cold__UNIQUE_ID_name470ssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenDQST_LOOKUPSclass_spinlock_irq_try_is_conditionaloom_mmsrcu_reader_flavortv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idsrcu_structrlim_curnofaultmm_countSB_FREEZE_COMPLETEstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infodatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountki_filpcap_ambientatomic64_tanon_vmarlimread_folionr_eventsprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keysrcu_gp_startopenit_real_incrmodert_prioritymm_lock_seq__UNIQUE_ID_intree471KMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksrb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionexit_statesysvsemMOD_RO_AFTER_INITDQF_ROOT_SQUASH_Bfs_supersSB_UNFROZENdqb_bsoftlimitpendingf_task_workiowait_countstringread_countfutex_offsetlong long intatomic_flagssysvshmtrace_evalsactive_basessecurityxmm_spacef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesclass_rwsem_read_intr_is_conditionalclass_mutex_is_conditionalclass_preempt_notrace_is_conditionalMOD_INIT_RODATAMOD_TEXTclass_srcu_is_conditional_nameclass_rcu_is_conditionalclass_migrate_is_conditionallong long unsigned intNR_KMALLOC_TYPESclass_rwsem_read_is_conditionallong long intsigned charPIDTYPE_SIDclass_preempt_is_conditionalElf32_Wordorc_headerPIDTYPE_TGIDlong intclass_raw_spinlock_irq_is_conditional_descclass_local_lock_nested_bh_is_conditionalHRTIMER_BASE_MONOTONIC_SOFT__UNIQUE_ID_retpoline471class_rwsem_read_try_is_conditionalUTF8_NFDIDQST_LOOKUPSclass_spinlock_irqsave_is_conditionalclass_spinlock_try_is_conditionalclass_local_lock_is_conditionalhrtimer_base_typeMOD_RO_AFTER_INITn_descsz__u8DQST_ALLOC_DQUOTSSB_FREEZE_FSKMALLOC_NORMALDQST_WRITESunsigned int__int128class_irqsave_is_conditionalHRTIMER_BASE_REALTIMElong unsigned int__u32HRTIMER_MAX_CLOCK_BASESclass_spinlock_irqsave_try_is_conditionalclass_spinlock_is_conditionalshort unsigned intHRTIMER_BASE_TAIclass_local_lock_irqsave_is_conditionalclass_read_lock_is_conditionalelf32_noteboolDQST_DROPSclass_local_lock_irq_is_conditionalMOD_RODATAKMALLOC_CGROUPclass_rwsem_write_is_conditionalclass_spinlock_irq_try_is_conditionalclass_spinlock_irq_is_conditionalclass_write_lock_is_conditionaln_typeMOD_DATAclass_write_lock_irqsave_is_conditionalHRTIMER_BASE_BOOTTIMEn_nameszSB_FREEZE_COMPLETESB_FREEZE_WRITEclass_raw_spinlock_nested_is_conditionalMOD_MEM_NUM_TYPESDQST_SYNCSDQST_FREE_DQUOTSmod_mem_typeHRTIMER_BASE_MONOTONICclass_mutex_intr_is_conditionalclass_task_lock_is_conditionalUTF8_NMAX_nhdrPIDTYPE_PGID_Boolunsigned charKMALLOC_RECLAIMHRTIMER_BASE_BOOTTIME_SOFTcurrent_stack_pointershort int_note_18_note_19utf8_normalizationKMALLOC_RANDOM_STARTDQST_CACHE_HITSclass_irq_is_conditionalDQF_PRIVATEPIDTYPE_PIDDQST_READSMOD_INIT_DATAclass_raw_spinlock_try_is_conditionalclass_raw_spinlock_irqsave_is_conditionalPIDTYPE_MAXcharGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackSB_FREEZE_PAGEFAULTUTF8_NFDICFclass_mutex_try_is_conditional_DQST_DQSTAT_LASTclass_write_lock_irq_is_conditionalKMALLOC_RANDOM_ENDMOD_INIT_TEXTclass_raw_spinlock_irqsave_try_is_conditionalpid_typeHRTIMER_BASE_REALTIME_SOFTKMALLOC_DMAclass_read_lock_irq_is_conditionalHRTIMER_BASE_TAI_SOFTSB_UNFROZENclass_raw_spinlock_is_conditionalkmalloc_cache_typeclass_read_lock_irqsave_is_conditionalclass_rwsem_write_try_is_conditionalDQF_SYS_FILE_Bclass_raw_spinlock_irq_try_is_conditionalDQF_ROOT_SQUASH_B__UNIQUE_ID_vermagic470__int128 unsignedMOD_INVALID/home/thomas/Documents/kernels/stagingdrivers/scsi/ipr.c/home/thomas/Documents/kernels/stagingdrivers/scsi./arch/x86/include/asm./include/linux/atomic./include/linux./include/asm-generic/bitops./include/asm-generic./include/scsi./include/uapi/asm-generic./include/uapi/linux./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/deviceipr.cipr.catomic.hatomic-instrumented.hatomic-arch-fallback.hspinlock.hio.hinstrumented-atomic.hbitops.hfortify-string.hipr.hfind.hunaligned.hlist.hpci.hdevice.hkstrtox.hdma-mapping.hkernel.hworkqueue.hdelay.hslab.hscsi_host.htimer.hkref.hrefcount.hcompletion.hscsi_cmnd.hjump_label.hinterrupt.hcpumask.hdmapool.hgetorder.hscatterlist.hhighmem.hhighmem-internal.hmm.hdelay.hkobject.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hsched.hstatic_call_types.hpreempt.hasm.hinit.hfs.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hpage_64.hrange.hptrace.hmath_emu.htypes.hshstk.hseq_file.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hwait.hrcupdate.hlist_bl.hosq_lock.hmutex_types.hmutex.hseqlock_types.hlockref.hdcache.hmount.hpath.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hswait.hshrinker.hmaple_tree.hrwsem.hworkqueue_types.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hblk_types.hioport.hmod_devicetable.hkernfs.hkobject_ns.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.hbvec.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hdevice.hfwnode.hirqreturn.hdma-direction.hmempool.hblkzoned.hsbitmap.hblk-mq.hhdreg.hfirmware.hscsi_proto.hscsi_status.hscsi.hscsi_device.hirq_poll.hgfp.hsprintf.hstring.hjiffies.hscsi_common.hscsi_eh.hdev_printk.hreboot.hcacheflush.hspinlock_api_smp.hoverflow.hlog2.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/scsi/ipr.mod.c/home/thomas/Documents/kernels/stagingdrivers/scsi./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/schedipr.mod.cint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hirqflags.htypes.hshstk.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hquota.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hipr.mod.c/home/thomas/Documents/kernels/stagingscripts/module-common.c/home/thomas/Documents/kernels/stagingscripts./include/uapi/asm-generic./include/linux./include/linux/sched./include/uapi/linux./arch/x86/include/asm./include/asm-genericmodule-common.cint-ll64.htypes.hirqflags.hpreempt.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hpid_types.hhrtimer_defs.hslab.hunicode.hquota.hquota.hfs.helf.hmodule.hasm.hmodule-common.cint-ll64.hGCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910x ^4RKAA vDB<GEH C(  ABBE $,UJA@A$,oJD[A{Q4$dJU,xJCeA%{DGBE D(K0`(D BBB4FFG@rAA$%FV4#KAA  ABE TGAD  ABE W ABE  ABE 4/BDD ]ABLKBB D(A0D@ 0A(A BBBE $0@/$WJH4_KAA @ ABE \KBD D(G0d (A ABBE Y(A ABBDvKEA D(G0O(A ABB,LDA$-YO4GAA ABLKBB D(A0 (A BBBE 4ZKAD BAB<KBD A(b  ABBE <KBD A([  ABBE <KEA A(h  ABBE T KGE A(A0GhqpIhg 0D(A BBBE <KBD A(\  ABBE 4YKAD AAB4hKDA PAB,sJDJ AE 4bKAD JABDKEA A(K0Y(F ABBDhKBA A(D8B (D ABBE L8n (H ABBE n (D ABBE $JM,NJA}A4+BDD YAB\GBA A(DX (D ABBE Y(A ABBB,UPA~A0&4QBDD AB,PAzA0$IF^ E $,`PA{ AE 0\GEG F(D0n (F ABBE D(C ABBLRGBE D(D0G8E 0A(A BBBE $@8,PFI{A4KDE k ABE <GGE B(A0A8IhDhT 8A0A(B BBBE TGBB B(A0A8DHx8A0A(B BBBDbHE8O0A(B BBB4LAg AE ^A,-A OE 4GAD AB,FH AE D_KBI A(A0{(A BBBLMBB B(A0D8{0A(B BBB$8,PA AE O$|MG E ^$LPw04JCD( FAE 0(4wJAr AE nA-,PA AE 0DKBE A(A0(A BBBDKBB A(A0x(A BBB4=KAD eAB\KGE E(A0D8G@z 8D0A(B BBBE tGBB E(D0H8GH 8A0A(B BBBE F8A0A(B BBB<JAO AE J AE n4}KHA \FB<RBA A(V  DBBE $0(,UJA AE 0DQAA z DBI AB,/ A HIE D!\IB A(D0(A BBBDKHA A($  ABBE $0(DGIB K(K0R(A BFB4JGA AE RAHLQBB A(A0 (A BBBE 430Y(H IBB<KIA A(q  DBFE LQBB E(A0A80F(B BBB$i8LKBB B(D0A80A(B BBBlKBB A(A0G8 0F(A BBBE L 0F(A BBBE $8$Fz L DKBB A(A0(A BBBLGEE A(A0| (A BBBE <KHA D(  AABE 40(A  HHBE ,PA AE 7,PA AE 7LoGBB A(A0% (A BBBE 4=KAD eABDZKAA n DBE IDB4FCG( AAE ,K(vOA,aPAJA04JAD( FAE 0(,kPATA0<KHA D(  ABBE $0(<KHA D(  ABBE $0(<uKND D(n  ABBE $.(DAKBA A(  FBBE $0(t%KEB B(A0A8DH 8A0A(B BBBE 8A0A(B BBBD9HD 8O0A(B BBBE LGBB A(A0D`R 0A(A BBBE <` 0O(A BBBE ,PAA$-YOTKBB B(A0A8GP 8A0A(B BBBE $P$JA,7Y AE \BB B(A0A8GPB 8F0A(B BBBE 28A0A(B BBBOP$xP;GBB B(D0D8DH| 8A0A(B BBBE E 8A0A(B BBBE t8A0A(B BBBTBKBB E(A0A8D@8F0A(B BBB$T@\KBA A(D` (A ABBE s (A ABBE $8`\8KBB B(D0A8DH 8F0A(B BBBE $H\[KBB B(A0A8GX 8C0A(B BBBE $XDKFADH AAE PFXF`NH|KBB B(D0D8Dhb 8C0A(B BBBE - 8F0A(B BBBE $6hTKGB B(D0A8Gp 8C0A(B BBBE 4FIGP AAE \KBB B(A0A8D 8F0A(B BBBE $nTKBB B(A0A8DX 8L0A(B BBBE $%XNGEB B(A0A8D 8A0A(B BBBE  8K0A(B BBBE T 8H0A(B BBBE 1R 8G0A(B BBBE BZAw 8I0A(B BBBE ^GXBHB^wBBEBR~ABDBDWoKWEyABfXDZBKWKKBKABRAk 8J0A(B BBBE VBDBOBUBBDBOX|L~BEDNA^A~ABDDWJVBEBP cDBNSDLAI 8D0A(B BBBE  8H0A(B BBBE `CBDWNi; 8H0A(B BBBE CBBDWpK[B<FC O BBBA E $' ,.PDE AE 0,^PAGA04jGCA  ABE <  ABE QAB,oJHWA#G.$PFE\;GBB B(A0C8DH 8C0A(B BBBE $HT5KBB B(A0A8GP 8D0A(B BBBE \KBB B(A0A8DP 8D0A(B BBBE <KAA DX  DABE TXTKBB E(A0D8D8C0A(B BBBT5QBB B(A0D8 0A(B BBBE $084QAD  ABE ,/ A HIE 4QAD  ABE ,/ A HIE DeKBA A(LX (D ABBE ,JAk AE DGBA A(GX (A ABBE \KBB E(A0D8J} 8A0A(B BBBE $MD6KBA A(LXv (A ABBE LKBB A(D0L`z 0A(A BBBE TmKBA A(  ABBE y  ABBE \KBB B(A0A8G` 8D0A(B BBBE $u`\KBB B(A0A8GX 8A0A(B BBBE $`XKBB B(A0A8Gv 8A0A(B BBBE O 8A0A(B BBBE K 8A0A(B BBBE O 8A0A(B BBBE D< 8O0A(B BBBE     !"#$&(*+-/13568:;=>@BDFGHIJ5^5R56$36UK6`$_6ow6 {6Q <,6 46<-wDd++ DxD%6p607{(7pDD%D7#Z7Ps7p /7 :<P44>B{Ct>D)0C]7 /7 W7`_78v,8 P-fPC8[8t8Z8088`8 809Y49@hK9sh9Pb99phC5s99 N: E+-EE9B9U=@00:P&Q8:>0F<+Lm0S:@I$n:`B."0;::RH@:@ PQEP:  ;!h:u^p 0;$<@/ b#G;@&m-b;&u;(;(_;P)=`? p!;*O1&; +|>0]Pj100%a-_<-00z<`.</=<@0<@3e?LaCnP[xE@}PUA=@6!=p7Ud=0;+ $ 0@ ZC5M 0hp==8=@>u / U=9!:+ :L 0 =<:==Bp#| H!@V!. 3FpS io%>@A|` O>C ?J=E o>`Ey 0>G@0n8BG 7PS> H @QAB. 7 ( ?@Io1?KZM?K K0p'?M=b 0XpY?Mke 0X?`N 00X?PO 0W" 0V?@Pu R .  0B(0@0S%O 9jpL@pUw  0N@Y+ X+@ X+ Xy- p@PZd`@b@@hB7/R@c<xR _ @e;AuDPlyTR@j8b*Aq[ p .AtKTAPw 5,>6kAABtnZpTg%AN|b0b@ a@b@a` A'3BP^ 0' p^4 0V $VBjc .>@      E PCP;  !.CBCд 5!T  E!, P9  _hI tR : f + Dpt :~ : : +  t +  38 +  0 :  p 388gD`6 R90V c 9/y \ 9/ PZ CeC@CC 9M 0D6,DJDm  -:u :` ; 0 ,  9 ,D @,O ,Z ,e  r @,} p , , , @, , , , @, , , , @, , ,$ ,/ `,: ,E ,P @,[ h ,s ,~ ( @, , , , @, , , @ ,  ,  ,  ,@ , , ,% ,0@ ,; ,F ,Q@ ,\ ,g ,r ,}` , ,  ,`,,,P,,,@,p,*,5 ,@`,K,V,a@,l,w, ,,, ,`,,,`,,, ,`,,, ,'`,2,=,H ,S`,^,i,t ,` ,,,`,,, ,,, ,`,,,( ,3`,>,I,T`,_,j,u@,,,@ , , !,@!,!!,! ",`", ",", 0#-`#,8#,C#,N@$#[$,f$,q%,|@%,%,%, &,`&,&,',@',',',@(,(,( ),0)%`),0),;),F0*S@*,^p*k*,v*% +,P++,+,,,@,,,,,,, -,`-,-, -,.#@.,..,9.,D.Q /,\`/,g/,r/,} 0,`0,0,0, 1,P11,1,2,@2,2,2,2 3,`3,&3,13,< 4,G`4,R4,]4,h5u@5,5,5,6,@6,6,6,7,@7,7,7,8,@8,8,8,9,%@9,09,;9H9,S :,^`:,i:,t:, ;,`;,;,;, <,`<,<,<,=@=,=,=,= >,`>,(>,3> @?,K@?,V?,a?n?,y @,`@,@,@, A,`A,A,A, B,PBB,B,C, @C,C, C,+D,60DC@D,NpD[D,fD,q E,|`E,E,E, F,PFF,FF, G,`G,GG,H,@H,pH)H,4H,? I,J`I,UI,`I,k J,v`J,J,J,K@K,K,K,L,@L,L,L,M,0M @M,M,M,M,7 N,B`N,MN,XN,c O,n`O,yOO,P,@P,P,PP, Q,`Q,Q,Q,@R,R, R, S,"S,-S,8T,C@T,NT,YT,d U,oU,zU,V,V,V, W,`W,W,X,`X,X,Y,@Y,Y, Y, Z,`Z,*Z,5Z,@ [,Kp[X[,c[,n \,y`\,\\, ],`],],^,@^,^ ^,-/@1oP+@M^8]1j1w11 1(10181@1H1P1X1`1h 1p1x&141B1P1^1l1z111111111111"101>1 L1(Z10h18v1@1H1P1X1`1h1p1x11 1 1 1, 1: 1H 1V 1d 1r 1 1 1 1 1 1 1 1 1 1 1  !1(!10(!186!1@D!1HR!1P`!1Xn!1`|!1h!1p!1x!1!1!1!1!1!1!1"1"1$"12"1@"1N"1\"1j"1x"1"1"1"1"1"1 "1("10"18"1@ #1H#1P*#1X9#1`H#1hW#1pf#1xu#1#1#1#1#1#1#1#+ #+@ #1 $1$1)$18$1G$1V$1e$1t$1$1$1$1$1$1 $1($10$18$1@ %1H%1P(%1X7%1`F%1hU%1pd%1xs%1%1%1%1%1%`0%+` 0%+ %+ &+ &+ 3&+ E&1T&1c&1r&1&`0&+ H&+` &+@ &+ &+ &+ &+ '+ ''+ >'1M'1\'1k'1z'1'1'1'1'1'1'1'1 '1((10(18(1@.(1H=(1PL(1X[(1`j(1hy(1p(1x(1(1(1(1(1(1(1)1)1)1-)1<)1K)1Z)1i)1x)1)1)1)1)1)1 )1()10)18)1@*1H*1P,*1X;*1`J*1hY*1ph*1xw*1*1*1*1*1*1*1*1*1*1 +1+1++1:+1I+1X+1g+1v+1+1+1+1 +1(+10+18+1@+1H+1P ,1X,1`*,1h9,1pH,1xW,1f,1u,1,1,1,1,1,1,1,1,1,1 -1-1)-18-1G-1V-1e-1t-1-1 -1(-10-18-1@-1H-1P-1X-1` .1h.1p(.1x7.1F.1U.1d.1s.1.1.1.1.1.1.1.1.1.1 /1/1'/1 6/1 E/1 T/1 c/1 r/1( /10 /18 /1@ /1H /1P /1X /1` /1h /1p 01x 01 &01 501 D01 S01 b01 q01 01 01 01 01 01 01 01 01 01 11 11 %11 411 C11 R11( a110 p118 11@ 11H 11P 11X 11` 11 1W2q22(F2@t ^2m|22((2Pt2M2`3P(3`t *3vVG3h3x(~3pt3T3;3(3~t3N\4(4(@4t\4*t44(4t 4F4M4(4t 5e[-5J5@(\5t r5/5&5u555 5 j55p56-6E6PY6q6666`6 7"7`>7T7@m7` ~7 7 7 7P78&8=8U8n88 88P88 9.90E9b9@{99`999p9:@2:M:0h::::0 : ;!*;$A;0&\;&o;(;(;@);*;+;+<,0<,Y<-t<P.<0/</<00<03<@4<06=`77=8O=9^= ;}=<=p==0>=P?=@>0A.>BI>Cn>D>PE> F>F>H?0I?J+?KG?pK_?pL{?L?M?PN?@O?0P@Q*@ SF@`UY@Yj@@Z~@a@c@e@0h@j@ nApq(AtNA@weAAAAAA B-B@PBtB0B`BBC@C(CF9SF49hFm9}F9F9F9FQ9F9F9F9G59%Gn9:G9OG9dG9yGR9G9G9G9G6 9Go 9G 9 H 9!H 96HS 9KH 9`H 9uH 9H7 9Hp 9H 9H 9H 9HT 9I 9I 92I 9GI8 9\Iq 9qI 9I 9I9IU9I9I9I9J99Jr 0J{ FJ ZJjJ J5J"J"J#JJJJJJJ K'K7KMK\KlKKKKKKK8KKMLLL7LCLTLjLtLLLLL*LPLLM MMM,MBMLMWMfM}MMMMMMHOdMM*NQN/N8NINZNqNNONNNNNNNOO2OBOTO]OkOOOOOOOOOPP P5PVP+@}PPPPPPPPQQ$Q8QJQ]QsQ{QQQQQQQQQQRR*R@RHR_RmR|RRRt@RRRRRSS/S6SFSTSdSkSSSSSSSSTT+T v~ Y   #  P4* ? n    s    B > J DZ } #    g -= ,CeT/EWj{!'#8Hp~z#5bnzzz6L S Z e  l 5X~  f f5Ce fY !f f5X~ .f  f%E_p  fUo  f! 4.fARuz>!6| %3A FH #P\c #j#  @#%1Qmr#i 0Fh#  +AVe{## [=V;VA b ]m n     !!#  "#<"q""###Z'#]#^#$7$#D$x$r$$#$%,%~% @/%{%% &#&H&&A&G&#T&~d&&&#&i&&&&'z-'x''''z(@(( ((()Y;)Q)W)#o))Y)) D) `?)**#/** **h*#***+%+g+  u++++#++ +#++,#,#H,-^,g,  ,#,E,,  +,--?-O-]s---#-- . #.#+.4.G.[e....Y/ D#/E/m/yu//g/Y//0)0E0i000-1x1x1112x222A33Y33#484U4g4#o4z4 L44#445# 5 5 D5 P45#55E6L6#k6 z6 ,6#6 66 p76# 6 6 D7 0;/7 F7# u77#7 7 7#7 88 ,)8# 8 D8 8 p788#90 989H9 O9 T9h9 o9 @>9# 99#9 99:: #:': 1:  B:w\: c: ({:# ::  ::#: #: ;5;=;#Z;` e; ,<:< E<  L< DW<#_<H o<<<< #= a!=j1=  F=N=f===#= = @=#= == D=  > p># >x ,>E>K>#e> >m>Y?#%? 2?>?e?????@@#7@ K@\@h@@@YA} A#AD )AEAeAAAYAABCB#XB\ BB B DBBYCAC P4zCC P4CKD SD JDDD  DEYBEaEEEF5FQF#`F mFwF~FFFFF#Fu FG G#G G# G G 0nG DG G#G G%H+H#?H H# H H QH DH H#H IAIJyJ/JgSJYzJJ J JJJJK/KRKfKKK#K L# L !L D/L#7LE BLLL#L^ L ML#Lv LMM#>M bMM MM#M MMMM#M N `N3N#;N GNeNmN#N N PO!O'O#/O UO]O#O6 O =PP#P EPePPPPn PPN P3QBQfQrQzQzQQhQQ#R| R# R R DR GR#R R5SLS#TS hSS TTFTNTavT~TTTTTYU0U6U#>U QUqUU#U UUUU$\dpyR ˜ ] n1 6p  ]˝n  5 < P`y ]nÞ Ȟ *X8XHUnvR a; U ac bx* ]Env ]nơ С ]n= `j ]nڢ ] b a'nN Hi ]n a b  .K b Hb b 'E ]pn   H I ]^n  ٦ ` !Y e bǧ ]էn ] Hb. bHnr w ]n b Hb! &Q?[ 0 ]שn  > [s}j \\ɪ  ժ]bYլ#/Ik  # , @ P* *U[#o ,#* @6ATu ̯ ׯ b% 0 G:Q!!Yv۱;n{DzѲ)س{-iuմ#I!;@_q#ya!#1!ĵ|2kZ f#ǶN9Ҷ OYq|#f9Ϸ#9!/ E#~9# #9 (5qw#9Ź,QV|Ǻk.>Zϻֻ|k!E^ ͼ}Aaf|ѽk@E[y޾|k, 8Uc Xov;M PRf_l9$ gv{x zX'=LQxbzp |X#:$)X|kBZy~ o |k^ % `.D}ea{#3P:{#G):{ t*i:/UYJYnh:::u#<h#6< )ms#{:-;;*U> $ + 07 <C J dQ  Vpc hp* 6Fe}x . V,7 tH]h  ]   ]   P 8 P   >L Xz 6_v|k 0  0 %H [ip w |   @_     h* +Zba p h mr# # p  <" p  # p   # C&H$S #Z iq x ~  T& p! o) & /* & * L* P  + P# (-+4 0%; @EH,L 0%S X],k 3- 0 +. 0 - P[ 5 P4 P[  o4 P[ #(4EM#j PUq v xa # r   D <3 # PU      k6   6 p   7 p   7!  ) 0 7  > C H 9O  V [ ` _<g  n s x Z; @V    > @V   = @V   = p   e> p   %   \@ # @@, %3 j: }? D @@K %R W \ Ah p u XB}       `F PS   "G PS   G (   BH (   H p'! 3 E KP p'W ^ e pYl q v L} pY   L X   M X   >M 0X   M 0X   ;N W   /O W   N% V, 1 6 P= VD I N OU 0Z b zn Pu 0z  (   R (   R p   p   TS    U 0  "X# * /4-W; 0B GM#TXo v   V  Y    d0 9 "\ R c R tc  4d  # (-_e4 ; @EeL  S X]dd k pue R j }i R kh R fj  -l  k * in  *' ,1)q? ajo{ Xo  q p  q p  ct  ,t % j, }1:tH Thp~ eІ pT H H pT  i X6?6Y Kej6 6 76  0l9 AP 0Ue jz  RLR yE W^ czR    p  - 2> CL HQs    0   0 `Mi x   0  $R+ 07 <L Qa 8fm r  h  !A  MXry <      %4  J[lb  j}  @ gL pL RLRR+ 7@I Nj oy ~<  <       , 818 =M R h y   Z  R R `  #  3P p`g lx }  H p^ _ p^ / $  o $  %*8  Mf$}h % - PW d < l       !<'! x1!a8! ?! D!I!P! W! \!a!m! t! j{! }!!y!!#! P! ! " "&" _+"?" I"h" t" t" "&##P# 3r# #S# :#S# @#S# D#S# L#S# R#S$ p$ Z$ #$ 0S$$ #$ q$$ #$ % % @% tW% L& [&wm& (r&&_&_& &&& X&x( ( (( ((( ( ) !) &)1) Y)e))))#) 0) ))* # * q*+*U*g* n* v** **#* ***+|7+G+kW+h+~+ ++#+ +++U+#+ 0+ ++ + , ,&,F,`m,,, ,R---l .# . . ... @8.I.S.r[.c.k.. -. #.. .  .l . #..#. P. / /#/ p!/ &/7/P/ =W/ 8c//</  /\E//#/ p/ ///  0q#0  (0q/0 @ I0qe0  j0y0  00i0lU000h0131 Q1\1<m1#~1 1 11l 2P2 \2]f3}3u4l 4 5G5i5555z5T5 x6U6W6666 &6f6767Z7t7 `y777 788U/8 =8 `B8`8 e88 8 08Z8 889U99&99N9U9 \9 a9f9Ƕm9 t9 y9~99 \9 99 \9 999 PZ9 99 PZ9 999 S9:: 0: j: }$:):bF: K:P:L\: vi:5|: (::: P::L: ::,: p:::; 0 ; ;;{;; @;;<%< ,< 1<6<A< H< W<g<x== =#>(>*9> >>N>S>*>>  ??#0?*7? 0>? C?H?*A@X@#p@ w@ j~@ }@AEAKA#^A eA jlA }qAAAA #  ( (d08 @H$PX`hpp0xpP   d 4d4 (D08T@HtPX$`hpPx@@  !$@&&((P)*$++,--d. D/(/0D08@3@T4HDPD6Xt7`8h9p4;x<=D>d?@DABCD`E4FG$H@IJKKLMMdN TO(DP0Q84S@pUHYPTZXb`chepDhxj4nqtTwT@$ t P (0Դ8!@HPXĹ`DhpxdTt$   G ! !$!(&,001428w<J@7 pj@H pPj j j@H Pj\d pj  0j 0j$@H 0Pj\ d 0j  0j  0j@}H Pj} j 0j 0j$@H 0Pj\d 0j 0j 0j`h pj j pj@H pPj j j@H (Pj (j (j pj@H pPj  j  j@ H  P j }  j   j   p  j@ H  p P j   p j   p j     p  j@ H  p P j    j    j@ H  P j   j   j (  0 j< D ` }h  p j   j X( 0j<D`h pj|} j} 0jS Pj Pj Pj$@H PPj pj  pj  ( p0j< D`(h pj| jP j@H Pj j Pj ( P0j j j ( 0j`h pj 0j 0j`h Ppj Pj  Pj ( P0j<D`(h Ppj| PjX Pj ( P0j<D`h Ppj| Pj Pj  @( P0j<D`xh Ppj| Pj Pj ( P0j `j 0j 0j`h pj j Pj ( P0j j j 0( 0j`0h pj j j ( 0j`h pj 0j 0j`h pj j pj@H pPj  j  j@ H  P j   j! ! !j!$!@!H! p!P!j!.! !!j!! "h(" !0"j<"D"`"h" !p"j|"""" #"j"" #"j`#@h# 0#p#j|#### $#j## $#j$$ @$$j$$$$ 0%$j%% 0%%j@%H% %P%j%}% %%j%% %%j &(& &0&j`&h& &p&j|&&&& &&j'' p''j@'H' p'P'j'' ('j'' ('j@(H( (P(j(( ((j)) ()j)$)`)Xh) 0)p)j|)))) *)j)) *)j@*H* 0*P*j\*d**p* p**j* * +(+ *0+j+H+ P++j++ P++j,, P+,j,$,@,H, P+P,j,`, P+,j,, P+,j,, -(- ,0-j`-h- ,p-j-- ,-j---- ,-j@.H. .P.j.. ..j.. ..j.. /(/ .0/j`/h/ .p/j// ./j// ./j 0(0 .00j`0h0 .p0j00 .0j00 .0j 1(1 .01j11 P11j11 P11j22 P12j@20H2 P1P2j22 P12j22 P12j 3 (3 203j`3 h3 2p3j3 3 23j33 23j 4@(4 204j`4gh4 2p4j4p4 24j44 24j@5 H5 5P5j5 5 55j5` 5 55j556 6 56j@6 H6 5P6j6 6 56j666 6 56j7 7 57j@7` H7 5P7j\7d77 7 57j7` 7 57j8 8 58j8$8@8 H8 5P8j8 8 58j8p 8 58j889 9 59j@9 H9 5P9j9P 9 59j9999 99j :(: 90:j`:7h: 9p:j|:::0: 9:j:X: 9:j ;K(; 90;j<;D;`;h; 9p;j;; 9;j;; 9;j;< < (< 90<j`<H h< 9p<j< < 9<j<<< < 9<j@=H= =P=j== ==j== ==j== >(> =0>j`>h> =p>j>%> =>j>>?? >?j@?H? >P?j?? >?j???? ??j @(@ ?0@j`@h@ ?p@j@@ ?@j@@ ?@j A(A ?0Aj`A hA ?pAjAHA ?AjApA ?Aj B(B ?0BjBB PBBjBB PBBjCC PBCj@CHC PBPCjC0C PBCjCC PBCjDD PBDj@DHD 0DPDjDD pDDjDD pDDj E(E pD0Ej`E8hE pDpEjEE pDEjEE pDEj Fh(F pD0FjFF PFFjFF FFj G(G F0Gj`G hG FpGj|GGGG GGjHH GHj@HHH GPHj\HdHHH pHHjHH pHHj I(I pH0Ij`IhI pHpIjII pHIjII pHIj J (J pH0Jj`JHhJ pHpJjJpJ pHJjJJ pHJj@KHK KPKjKK KKjKK KKjLL KLj@L0HL KPLjLL KLjLL KLjM`M KMj@MVHM 0MPMjMtM 0MMjMM MMj N(N M0Nj`NhN MpNjN8N MNjNN MNj O(O M0Oj`OhhO MpOjOO OOjOOPP OPj@PHP OPPjPP OPjPPPP PPjPQ Q(Q R0Qj`Q}hQ RpQjQQ RQjQ QQQ RQj@RHR RPRjRR RRjRR PSRj S(S PS0SjSS pTSjSHS pTSjSSTeT pTTjT$T@THT pTPTjTT PUTjTxT PUTjT U U(U PU0UjUU @VUjUU @VUjVV @VVjVV VVjVV VVj W(W W0Wj`WhW WpWjWW 0XWjXX 0XXj`XhX XpXjXX XXjYY pYYj@YHY pYPYjYY PZYjY(Y PZYjYZ Z(Z PZ0Zj`ZhZ P[pZjZPZ P[ZjZ ZZZ P[Zj [([ P[0[j[[ p[[j[[ \[j \(\ \0\j<\D\`\h\ \p\j\P\ \\j\] ](] ]0]j`]h] ]p]j|] ]]] ]]j^^ p^^j@^H^ p^P^j^^ ^^j^^`^@(_Pw8_d@_H_ p_qx_c_д____ ___0`p` x`@ `` a a(a0a8a@aHaPaXa`ahapaxaaaaaaaaaaabb(b&8b2HbXb=hbHxbTb^bcbod@e} eh8ePeheee(eheee8f(f@fXf pfPffff(f`gg0gHg(`gXxggggggh  h@8hPhphhhhhh8h*hpi(i@iXi pi`iiiiPijj0j Hj8 `jh xj jAj j\j jpk k!8kPkhk@!kkp!k!k!k"k0"lP"(l"@l"Xl#pl0#lh#l#l#l#l$m8$mp$0m$Hm$`m%xm`%m%m%m%m &mX&n& n&8n 'Pnh'hnn'n'n n(n0(nX(o((o(@o(Xo )poh)o)o)o*o@*o*p*p+0p@+Hp+`p+xp,p@,p,p,p,p(-qp- q-8q-Pq-hq .qP.q q.q> q.q.r(/(rh/@r/Xr/pr00rp0r0r1r@1rp1s1s10s02Hsh2`s2xs2s3sP3s3s3s3t 4 tZ 8tP4t uu u u u8u uPu uhu vu vu @wu @wu @w @td #( Pt0d8H P `tXd`p x ptd  ~td# td#  td# t d(\8 @ tHdP\` %=? ?DD i   O$(,048F<V@DH L| P T Xr \ `BdhVlzptx|B$Qi0qd:  %&&(:)*t+++,>-r- 3."//1"4 74$4(5,608498:< ;@n<D=H+>L1?P(ATAXC\yC`AEdFhGlHpyJtALxL|MFN OPPRPUX5Zldegg&h}jl@qwtvz~1oxԬjS9u,õ  $:(W,04 8 < @oDHgL=PTXh\` dh l p t x |M9 <  $d(,04 8<$@pD0HLpPTX\:`dh,lPpt x |= }  ) > m     Y v   ,d.Di Go4 amy $5(k,~048< @4DWHLPTX\4`ddhlptXx|4WD^Tn-@t 5 $2O[ $P(,0@4U8z<@DH<LPTMX\`@ dl h l p t x!|p""\##$$%+%%%%@&c&&&&&','4'w''''(?(p((()P))*v*** *$++++ ,$],(,,,0,4-8-<f-@-D-H.LF.Pd.T.X.\.`D/dl/ht/l/p/t/x0|0D0h000,111122222 3@3333T45D67t7889S9[9999:O::: ::4;<P< <$<( =,5=0E=4M=8=<>@D>D>H>Ld?P?T?X@\[@`@d@h@lApDAtdAxA|AABBBCCDDE`EEEEF4FlFvF}FFFFFGG$HH@IJJ.JRJJJJJ K.KBKVKK (L$L(L,M0aM4M8M<M@,NDdNHOLTOPPTDPXdP\P`PdPhPl2QpAQteQxqQ|yQQQRR4SgSS TTMTuT}TTTTTU/UpUUUU;VBVRVcVVVW?WZWkWWWW W XMXWXgX xX$X(X,X0X4X8BY<IY@YYDjYHYLYPYTYX Z\Z` ZdTZhZlZpZtZxZ|7[K[\\\\\^G`?a}aaab_cc#dTdddd)eeeefFffCggDhhh9iPii iii j?j Wj$j(j, k0,k4tk8{k<k@kDlH?lLlPFmTMmX]m\nm`mdmhmlnp4nthoxo|qqqQrr(sdsssAtOttttt4vKvpvv(w6wTwwAxxxxyy8zszzz{5|Z| |}}}} ~$s~(~,~0~4+8_<g@DHLPTVX\`DdkhlptxK|a}3`_M ;Շ8$[uΊHp  w Ѝ  i    $ )( ?, T0 |4 Տ8 < Q@ D H L ͑P T ֒X ]\ U` kd ~h hl p t zx |  3  3   A     5 Y s   ՛  ʜ   5  ʝ   O _   Ǟ  + w D Y   ϡ  ( i$ ( Ģ, &0 C4 h8 < ã@ D -H L &P oT X \ ` ]d xh l p dt ԧx | G \ v  Ө % : m  ֩   Z   Ԫ    Y u    H P r ҭ   T z   @ t   P   $ ( ڱ, 0 4 :8 m< Ʋ@ вD H (L P T ׳X h\ t` d h l Դp t :x ^|     1 K e    * N p  η   D     4 p  Ĺ   + P    ƺ   - = Y λ ջ $ ( ,  0 D4 ]8 < @ D ̼H L P @T `X \ ` d нh l ,p ?t Zx x| ݾ     7 T n u   Q ^    z       & P a {     # n       A Y x$ ( ,  0 C4 8 < @ D H L P ]T X \ ` d h ,l Cp dt x | `   "    m      . T   I   # M t    l      )T * =$(/,;0U4g8<5@EDdHwLPT+XG\\`dhlptxW|^uZ{*l'? W $ (",D0u48 < @ D H L PB TZ Xr \ ` d h l p> tV xo |     2 p        0 H Y a y     .F8' ?Wo $(,0+4`8<@DHL0PSTgX\`dhl5pdtx|/@HT]ir~Vb~1BP Lw  $(,0/4;8D<P@YDeHqLzPTX\L`dhlp$tIxZ|i6Mn}$0<EQZ  2_ k$|(,048<@DH L$PLTeX\`d$ hV lc p~ t x |   +!C![!!!!"*"H""######$$%Z&q&~&&&&&&&c((((( (()%)X) g)$)(),)0)4)8)<*@**DT*Hu*L*P*T*X+\6+`F+dV+hg+l+p+t+x+|+,,%,l,,,Q----.7.@.H.R.Z.b.j..../%/6/b//////0'0H0i00 00000 1$P1([1,1014182<[2@2D2He3L|3Pt4T4X5\F5`h5d5h5l5p5t5x6|6666757Y7x77788A8d888899989`9x9999#:J:c:::::;?;; <0<f<== ">$=>(M>,>0?4B?8@@<@@ADDAHpALAPATAX`np  $(,048<@DHLPTX\`dh;l<pEtPx|  J`T` [`wy~ h $(,30@4W8X<\@ D H L" Py Tz X| \ ` d h l p t# xV |` r v z            j k l n p r w      BGPklm  $(,P0Q4R8T<V@[DtHuLvPxTzX\`dhlptx|,0  ; =$A(B,048<@DHLPTX=\>`@dBhGlPpktpxq|r"'()0 ;=AB !" $$)(0,K0O4P8<@DHLPTX\`3d@h[l\p`tx|-FLMOQV`{}~ *+hi np $/(0,50@4v8<@DHL!P0TFXd\i`dhlptx|#)-23468:?" 0 F O       $ ( , 0$!4@!8!<!@!D!H!L!P!T!X!\"`"d#h#l|$p$t$x$|$$$$$&&&&!&#&%&*&0&L&M&&&&&&&&&&&'''((((((( ((((( 3)$4)(6),8)0:)4?)8@)<])@_)Da)Hc)Ld)Ph)T)X)\)`)d)h)l)p*t *x!*|***++-+t+y+++++++,,,!,,,,,,, - -=->-C-q-r-w----2. 3.8.M.P.k. m.$r.(s.,t.0/4/8/< /@"/D'/H0/LK/PM/TO/XP/\Q/`/d/h/l/p/t/x/|//0%0&0(0-000K0R0W0\0]0a0h011111111"303G3I3K3P3T3\3c34 4 4 4 4  4 "4 '4 -4 .4$ /4( 14, 340 544 748 <4< @4@ Z4D [4H 4L 4P 4T 5X 5\ 6` '6d 06h R6l T6p U6t V6x 6| 6 6 6 6 V7 `7 z7 {7 8 8  8 8 8 8 8 8 -9 19 39 <9 9 9 9 9 9  : : : : : ; ; ;  ;  ; ;  ; ;; C; D; E; i<$ j<( l<, n<0 s<4 <8 << <@ <D <H <L =P Z=T [=X ]=\ c=` e=d j=h p=l =p =t =x =| = *> +> Q> S> U> V> W> > > *? +? -? /? 1? 6? D? P? k? t? u? v? ? ? ? ? ? ? @ !@ #@ %@ *@ +@ ,@ A  A "A $A &A (A -A$ 0A( KA, MA0 OA4 QA8 UA< VA@ AD AH AL AP AT AX A\ B` Bd Bh Bl  Bp !Bt (Bx C| C C C C C  C lC rC sC uC wC yC ~C C C C PD \D ~D D D D D D D :E ;E =E ?E AE FE PE gE lE qE rE sE E E E E E$ E( F,  F0 ;F4 CF8 DF< HF@ FD FH FL FP FT FX F\ G` Gd Gh Gl Gp Ht Hx 0H| 1H H H I &I 0I GI II KI LI MI rJ sJ uJ wJ yJ ~J J J J J J J J J J K K K K KK OK QK VK _K cK eK jK pK K K K$ ?L( @L, AL0 FL4 kL8 pL< L@ LD LH LL LP LT  MX  M\ M` Md Mh Ml Mp Mt Mx M| M EN FN KN PN kN sN tN xN N N O O O  O %O :O @O [O cO dO hO O O  P  P P P P *P 0P KP YP]PaPP PPPPQ Q$Q(Q,Q0Q4R8R<R@RDRHSL SP;ST@SXBS\DS`ESdFShJSl;Tpq$@q(Eq,hq0pq4q8q<q@qDqHqLqPnrTrXkt\nt`otdqthstlutpwtt|txt|ttttvvvvww#w1w;w@w[w]w_wawewiwmwzzzzzzzz ~~~~~~~ !~" $$&(*,+024%8(<)@+D-H/L1P6TX\Ɓ`ρdցhlptx|`fgikmotԉu  $(,04n8o<p@rDtHvLxP}TX!\"`$d&h(l*p/tx|ʒܒѓؓٓۓݓߓ&/02468=: " "@wy{ $(,ҙ0ә4ՙ8ٙ<ۙ@ߙDH%L0PGTLXŚ\ƚ`ȚdhFlJpdtfx|ț|HJUVik}~ա[]acrWYnp ( $(,048<@DHLPT X \`,d.hLlQpStcxު|Ԭ٬ $ijo>@`aǮʮˮ   *0X`> @WY[] ^$a(e,i0l4m8o<q@sDuHzLPTX\`dhlptx|òղ#$&(*,1۴ܴݴõȵ  $(,048<շ@DHLPTX\`Ƹdиhlptx|˹͹ιϹ۹vz{}%0JKӼz  $(,0014284<6@8D:H?LPTX\`dhQlRpStUxW|\ $0 MPkm oqrsz $(,0 4 8 <@3D@H[L]P_TaXb\c`jdhlptx|W`{}  "$&(-xyz|~  $(G,04o8t<@DHLPTX\`dhlepftgxl|p089;=Bptuwy~     $(,048<@"D&HeLfPhTmX\`d1h@l^ptx| P_`bdfhmn}1a,0KST       & / 4 L |    $ ( , 0 4` 8y <z @ D H L P T XM \\ `] db h l p t x |        l{|~y>t*.0>  $(,048<@DHLPTX\`dh l p.tWx|knprv.     * 2      ! !5!!! !$!(!,!0!4!8!<A9@D9DE9HG9LI9PK9TM9XR9\9`9d9h9l9p9t9x9|99-::;><M<N<P<R<T<V<[<B,:|z R3zl(p(*>/B/bp (P08@HPX`h`p x`p@`    P P  (008@@HP`X`hpxp@00 @ !$0&&((@)*+ +(,0,8-@P.H0/P/X00`03h@4p0x06`789 ;<p=0>P?@0ABCDPE FFH0IJK pK(pL0L8M@PNH@OP0PXQ` Sh`UpYx@Zace0hj npqt@w@0 `(08 @@HPX`!hpxи0P@`9 (@0!8YPjp ^@  ``  h  p  x    0     `    0 0@ h @0x @P  ` ` @       H X @A - @ 5  ?  p M  X   e8 @ uP PX ` p  :    u ^     `( `0 8 @ H P `X ` h p `x    `    `    @        @  !( 0 @ 8 @ H @P X ` `h p x % $ $    @     `  @^ ^ & `& & # # !  ]( `]0 ]8 [@ @!H [P ZX Z` `Zh @Yp Yx X `X X W `W W V V @' ' V U U U T T @T T S S (  @(( '0 '8 S@ RH \P )X )` )h `)p Rx @R Q Q `Q Q % % @%   @      ` @     @ ( 0 8 @@ H P @ X ` h p ` x   @       `  @    `        ( `0 @8 @ H P X ` h @p x   @ `" " `\ \ [ Z Y Y P * P @P P O 4 4 `4 4  3( 30 `38 3@ +H .P .X @.` 1h 0p 0x `0 0 / / `/ / = = @= , , @, , + + 9 @9 9 8 8 @8  8( 70 78 @7@ 7H 6P 6X @6` 6h 5p 5x @5 - - `- - < < `< < ; ; `; ; : : `: : 9 @H H G  ?( @?0 ?8 F@ JH JP `JX J` Ih Ip `Ix I H H B A A `A A @ @ `@ @ ? M L L @L  L  K  K  @K  2(  20  @28  2@  1H  1P  DX  C`  Ch  @Cp  Cx  B  B  `O  O  N  N  `N  N  M  F  E  E  `E  E  D  D  @D  >  `>  >  M  @M(  `G0  G8  F@  @*H  "P  "X  `#`  @ Pj8@ pHjP=UDW 1kDl ?$(U,048e<@DDH(LP}TX5\`*dPu % *B +' + (;' ). *EXZ *uf *p *)~ *c * *F * * *ۣ * * *o * *6  * *j *7 *Qf *˗ * *% *( * *Rn * *? *o *`  * *$ *< *C *H *_T *Wf * r *R~ *^ * * *] *Q *  * * * * *] */  * *?+ *E7 *߹C * O *.[ *g *U's *y * */ * * * * * * * *eV *  *8 *EE *S *w,` *m * *F  * */# *- * * *+ *|9 *G *U *%c *4q * * *1 * * *f * * * *[ *;  *hE *T *)c *;'s * *, *iq *g *p * * k *Kb *~ *k  *ä *85( *c^7 *F *U *d *Us * *# *pP *  *[ *`  *.  * *; *E  *  *̶' *߃6 *}E *;T *c *^'r * *"9 *@ * * * *  *N * * *.& *5 *E *U *+e *'-u *c *1 *F * *M *3[ *: * *k' *Y * % */5 * E *b T *r *oV *U * *z * *j *D *u */ *d *Lg *& *5 *D *ZS *6b *܁q */ *c *\ *_ *- *э *6 *: * * * *% *{5 *D *TS *2b *q *fm * *+  *o  */ *g *~ *, * *@ *F@$ *q3 *B *qQ *8 ` *%Ho *M~ *E1 *. * *ER *J * * *y * * *L# *B-2 * *A *q^P *ʵ_ *n *y-} *S *n* *wX * *" *p= * *˫ *  * *C" *1 *ؓ@ *O *ń^ *Hm *w| *= * *d * * *x * *C *Ȯ *N0 *(! *k0 *B? *N *] *l *|{ *% * * * *+ * *Q * *)} * *\! *0 *? *SN *=>] *jyl *S{ * *{ * *O * *J *ۗ *^ */H * *! *0 *? *}N *] *l *7{ * *, *] *U *dd * *_ *{ *Z *X *W  */ *> *u^ *m *| *+ *( *| *; *  * *A; * *8a * *HS! *1 *A *7Q *sa *c8p * ** *\\ *= *6 *6 *y *}L * *4) *78 *1E */#Y *7g *u *! *9 *BM * *T *" * * *h *  *  * . *< *J *X *W[f *+t *B_ *` *) *V` * *S * *ɱ * * *ǯ *E *u, *: *0H *V *^s ** *I *X *˝ *j *% * * *X *L *w|) *w8 *QSG * V *e *t *}+ *- * *M *Y *K * 1 *2 *{N *  *h *d( *f7 *F *U *vd *s *v4 * *" *  *3 *,U *? *  *t% *'5  *`H *e' *%6 *E *T *9c *r r *` * *{ *  * *x *}L * * *2 *c *&3 *K= *WlJ *r^ *7{ * *ԝ *f * * * *}L *@ *? *r>" *{/ *{= *}Lq *y> *{ * * *$a *0 *x *6 *B *7P *7_ *  * *< *e *; *% ** * *  *x U *c *q *[ * * *^% *Q * * *rt * *  * *) *Td7 *ɥ_ *lwl *r *,e * * *e *; *+ * *+[ *~) *:7 *E *PS *RQa *Eo *bt} * *e *B *g *9! * *8  *d! *1! *WE! *Z! *Zg! *R! *[*! *)! *V=! *! *e! *! *`! *~! * " *8" *%" *z2" *o{?" *Q;L" *KY" *%f" *,t" *y" */#" *" *%" *]E" *@" *~" *j" *I # *0o# *&# *:3# *b@# *݀O# *M:^# *%{# *# * # *O# *# *Bs# *2# *5# *S# *# *x# *<$ *j$ *I%$ *52$ *#?$ *<L$ *gy$ *{$ *%$ *$L$ *$ * $ *x$ *$ *% *% *#% *L1% *P?% *N@M% *[% *Si% *w% *+o% *<% *% *5% *U?% *Gu% *% *o% *܆% *9& *%& *o& *q-& *T;& *I& *ojW& *9ze& *s& *W& *^& *G& *& *j& *& *%& *%& *M & *o& * ' *qa ' *^J' *I' *g' *v!' *U)' *5' *<6F' *L' *SR' *JcX' *^' *d' *j' *+p' *v' *|' *' *s' *a' *p' *' *' * ' * ' *ǂ' *' * ( *Sq( *`( *uH( *( *N ( *ZS&( *(,( * 2( *8( *>( *HD( * J( *.P( *V( **\( *b( * h( *}n( *Mt( *z( *q6( *( *( *@( *( *( *V( *( *v@( *ư( *( *( *R9) *?) * ") *r3) *9) *u ?) *yO) *6<i) *%v) *l) *) *) *fN) *) *$) *c]) *) *.) *c] * *(* *5* *}LH* *i6_* *gl* *y* ** *c]* ** *T* *4* ** ** ** *}  + *Y-+ *(,9+ *)F+ * a+ *8+ *N+ *+ *+ *}L+ *n, *  , *{O, *8|, *N, *qP- *8o- *%- *- *\- * - *$. *1. *. *J. *8&. *D ?/ *~L/ *Y/ *f/ * s/ *$/ *0 *0 *i,0 *K90 *h~F0 *0|_0 *Kl0 *Iy0 *0 *Z0 *R0 *|[0 *0 *1 *1 * #"1 * B1 *)R1 *ݺ_1 *Wim1 *u#z1 *r1 *1 * 1 *s1 *1 *R1 * M1 *x 2 *2 *+?,2 *߶<2 * L2 *vZ2 *Mph2 *v2 *2 *¾2 *2 * 2 *32 *d2 *;f2 *y2 *w 3 *<3 *s73 *4D3 * Q3 *^3 *k3 *F3 *o 3 *rt3 *3 *%3 * 3 *3 *i4 *4 *T4 *84 *D4 *MQ4 *w9^4 *K4 *r4 *~e4 *T34 *~4 *;74 *5 *Y5 * $5 * 25 *v@5 *N5 *6j\5 *3o5 *}5 *T5 *45 *T5 *5 *N5 *-5 *5 *65 *5 * 6 *K6 */~"6 *%/6 *<6 */#I6 *W6 *X6 *36 *6 *Ap6 *|6 *6 *+u6 *6 *_6 *7 *7 *bR'7 *57 *B7 * O7 *V=i7 *w7 *7 *F7 *w7 * 7 *87 *7 *Gh7 * 7 *27 *g7 * 8 *98 * )8 *78 *L8 *Y8 *Aq8 *R8 *d8 *j8 * 8 *8 *9 *#09 */9 *Lw;9 *WH9 *eU9 *b9 *jo9 * |9 *$?9 *l9 *f9 *9 *=9 *h9 *am9 *9 **9 *P: *: **7: *YF: *T: *b: *;ep: *n~: *m?: *: *(: * 2: *4m: *=: *q: *: *Î; *_; *x; *,; *;:; *EH; *V; *d; *`r; *f; *; *; *Ji; *p; *); *z; *; *; *i,; * < *9< *(< *6L6< *D< *S< * b< *z< *k\< *< *Vf< *خ< *< *< * < *< *= *v!= *0= *+?= *mrN= *hs= *3= *= *´= *$?= *<@= *= * = *= *I;= *= *~> *y> *J> *4> *C> *zQ> *7_> *km> *FQ{> *> *0> *> *K> *> *:> *`> *;> *l> *zy? *? *#? *Y1? *L?? *M? *j[? * ]i? *T w? *? *E? *x? *? *M? * }? *? *? * ? *@ *@ *k&@ *5@ *:D@ *7S@ *.b@ *TZq@ *kk@ *@ *(@ *N@ *tg@ *@ *H@ *#@ *@ *ZA *y A *^%A *c<4A *LCA *HRA *EaA *pA *A *A *A *A *A * A *VA *kB *\~B *qB *B *B *rC *IC *о!C *ߑHC *;NbC *C *JC **;C *c]C *C *C *%C *݀ D *0oD *&D *:4D *AD *iND *\D *uD *}D *lD *mD *7D *D *5;D *D *eD *AD *KD *D *D *l<D *w E *E * $E *.2E *??E *rLE *<YE *nlE *UyE *?E *HE *UE *E *sE *[E *i6E *JE *UE *DZF *^f F *K F *F *[,F *!9F *FF *<SF *`F *EmF *S*zF *EF *S_F *T!F *F *F *RyF *"F * G *,G *)G *6G *i6CG *PG *%sG *G *cG *AG *G */G *rG * G * G *H *R H *bqH *w&H *(4H *AH *2NH *A[H *H *yH *H *>H *vH *oH *H *H * I *{KI *(9,I *ԛCI *VPI *]I *jI *"I *(9I *ԛI *I *(9I *ԛI *I *'I *I * M J *yJ *.J *.8;J *:RJ *9_J *5lJ *J *J *QJ *5]J *FJ *J *)J *r~ K *RK *e$K *3K *#@K * LK *ddK *MpK *}|K *mK *5K *iK *fK *K *mJK *?K *?K *JK * L *SL *@%L *c2L *O?L *FLL *YL *fbgL *L *L *L *,L *L *L *lwL *suL *;L *,M *sM *`# M *w|-M *:M *HM *QUM *bM */]oM *F|M *<M *#M *}uM *NM *M *O[M *=M *M *|M *N *N *{+N *s9N *FN *ӕTN *aN *QnN *{N *UN *%N *N *SN *v O *O *\ O *܁.O */b *չKb *%Yb *gb *"ub *b *5b *1b *Gb *b *Fb *>b *c *c *=Vc *PY,c *:c *ˆHc *mVc *sMdc *Irc *~c *c *c *tc *m|c *c *Zpc *d *Id *?Y$d *&1d *L>d *eKd *Q^d *ھkd *xd *yd *sd *%d *Td *d *d *0d *d *8d * d *e *="e */e */# l *l *Cl *l#l *-l *v6l *1=l *Jl *7Wl *Zdl *=(ql *:~l *1l *l *l *Apl *ˀl *l *l *%)m *7m *Dm * Qm *^m *lm *&ym *m *3m *fm *$/m *sm *Mm *m *Zn *#n *0n *6=n *XJn *3Wn *+dn *Ȕqn *$n *Yn *nn *@n *n *dn *[n *]En *o *6 o *o *'o *x4o *Ao *3No *.[o *2kho *)uo *Oo *3o *;o *eo *o *Io *o *lo * o *so *$p *X2p *ap * np *5 {p *p *Rp *FWp *p *k=p *˾p *p *zp *˾q *#q *˾:q *Fq *%Rq *0_q *q *q *Oq *q *xq *q *tq *ɪq *q *&q *q *r * r *zr *Ʀr *r *0+r *8r *nEr *^Sr *^fr *`sr *gr *].r *r *r *0r */#r *r *nr * s *]s *3s *)OKs *Xs *ٽs *?s *Bs *Bs *bs *s *As *Ss *}s * rs * t *12%t *%2t *?t *FLt *Yt *Uft *Lst *t *R"t *t *=t *st *'t *%t *pt *Xt *u * u *2u *Z'u *64u *jAu *Nu *[u *hu *Zuu * u *u *E9u *]u *Au *u *1gv *v *.v *Av *Xv *qv *Vb~v *Yv *v *Lv *v *v *v *ov *5w *w *}Lw *%,w *&Fw * Sw * w *F w *|w *7w *w *]w *A/x *} *L} *QZ} *h} *: v} *} *} **} *$ } * } *S} *} *H/~ */~ *S=~ *oK~ *n~ *R|~ *aX~ *F~ * ~ *j~ *~ *L~ *~ *]`~ * *ä *$ *72 * @ *N *}\ *j *5x *t * * *. *P * * *< *3F *{ *tV ** *9 *VH *W *f *6 *% *) *} *) *]"π *#Sހ * *= *u *% *-) *58 * G *V *ge *^t *q * * *G * *?΁ *"݁ *Do * * *_ * ( *>W] *v}g */v *;= *U8 * *jMĂ *% *Y *;, *; *ZL *R *f(X *^ * d *j *p *4v *?| *d * * *' * *- *" *ǃ *ԃ *q * *e *Ј *$L *" *l/ *Z= *NR *w` *< n *| * *a *[ *S *Ą *Tބ *Р *S * * *2- *@ *N *U *> *ią *ʅ *х *Nۅ *M *FW *{j *= *(, *Ǒ9 *&F *(T *L^ *j *ǿv *' * *7 *0 * * *j *}L *A" *0 *zE *R *&|^ *= * * Ƈ *NR * *V *P *[R& *< *jI *\V *}Lc *Ap * * *} *ޝˈ *mވ * *! * *e[ *Ț *u+ *q8 *R *P_ * l *Lz * * *x`lj * *< * * ! *kO. *< *]J *X *#f *G.t *W *hK * * * *+Š *AUϊ *܊ * *) * 96 *C * NP *8] *=j **mw *I *N *i6 *F *Qz *܁Nj */ԋ *w *% *1 *! * ** *?7 *D *|wQ *9 * *݊ * *ת *q-Ɍ *׌ *P *c *  *r *W *24 * A *-N *I[ *)Yi * * *֍ *Z *c *Y *-a *TD *%R *ba *o *^} *; * *Ġ *V */Î *ю *dߎ *X *]r * * *ܙ% *@3 *&A *O *X] *&k *y *? * * *Ï *úҏ *~ *n * *z# *g+ *b{: *I *yYX *g *v *R *N */ *[ *ڱ *А *ȹߐ * *dW *d *oGs * *5, *\ *̴ *ٴ *) * *UJ * *  *Y]' *t4 *H *U *b *do *ղ| *de * *Z *! * *͵ * ۵ *G * *  *  *, *%9 * F *zS *j` *rs *j * *Z *I| *Y *l *IͶ *ڶ * * *ɩ *6 *: *] *9k *y *}L *b *= * *" */ *&J *T *>Oa *o *E| *A *" *z *ȸ *jո *% *c * *. *|H *<U *sb *p *'~ *< *5 *X *~ *vĹ *Rҹ * *m * * * *+o& *? *G^ *j *cw * *cn * * *º *к *޺ *͇ *S * *m *?h& *@6 *PF *W *ӧ] *qc *j *=2w *}L * *5 *5 * * * * * *c0 *;1< *e)I *EW *ce *ss * *1 * *o * *ǽ *ս *+o *$ *F2 * *ݕ *o *. *, *W *G * *ʳ¿ *{ɿ *N_ֿ *S * *P? *G *t *5* *7 *D *Q *׼^ *g *M * * *+& *xf *s * * *R * *)$ * )1 * > *rK *%Y *s * * *% * *| * * *% *s *Y *P? *z: * H *}Ld *1r *.@ * * *T * * * *] */ * *f" *1 *I@ *O *^ *[m * | *D * *84 * * *r *= * * *5 * / *> *IM *s\ *nl *m| *b * *pm *F * *@ *͇ *k * * 1 *L# *L1 *;-? *M *[ *Di *w *H *I * *zq *? *  * *j; * *k * *1 *- *N.; *зs * * * * *`* ** *Z *E *f *j * *w *' * *g *+ *  *( *87 *A *sP *|^ * m *| *d * *z * *  * *  *  *VI * * *"&, *H: *J *Z *j *z * *[ *Q *  *s * *w *`F *S *_ * *- *`/= *tM * ] *q m *} * * *a * * *g *7 *V * * *< */ *.> *)M *M]\ *m{ * * * * *w *t *  * *c *m *n *a# *0 *= *DJ *W *&q *" * * *G *X> *  *o *#  *C *@~% *b *}o *| * * * * *, *R * * *l *:" *G. *m *L% *;-2 *]? *L *e *P *# * *  *S * * * *v * * *l- *:": *LG *;-T *a *z *9 * * *y * * *L!, *֯9 *F *OS *` *׼m *g * * * *R! *L!. *5g *kt *) * *- *) * *fw *- * * *w *_ *#v* *7 *D *\ *z *A *yA *g *M *5 * *G *d * *{ * ** *"6 *C *=P *] *9_j *Kw * *GN *y *S/ * *d *]E *%j *w * *  * * *cK *? *6 *! *[A *N *y[ *{i *ev *( * h * *{ *P? *_ * *ܜ * T *c% *F2 *? *L *OY *$L *t *e *n *6 *I6 *c1 *[A *kO *<] *=k *y *s * * ** *B * *?] *& *? *N *l *} * * * *; * * *c *F *Q *i_ *=m *S{ *l * * * * *6 *D& *\ * * * *N *~ *)O *ȧ *% *3 *uA *=P *ΐZ *k *zq *)Vw *ˊ} * *; * *A * *4 *} *i * * * * * *G: * *: *3 *~G *@Q *ke * *Գ *; *y *k *~ *)O *% *  *c *Ģ% *6 *D< *LB *I *U *3z *P * * *U *a *5 *m *l! * * *fp% *h2 *? *SL *Y *Jf *^s * *z * * *< *jv *F *x *j *k * *F& *9 *F *84S *D` *M' *nA *SN *T{[ *zh *P?v *wT *[ *z * * *zp * *  *M *7 *L *- *z; *UI *W *1Ge *s * * * *Nu *\ *=v *w *.N * *G# *Z) */ *֨6 *G *+M *ոS *Z *[f *r * * *} * *F * *%8 *Fn *L! *v/ *^= *K *I|Y *Yg *u *m * *X * * *I *  *V * * * *K *}- *I *W *pe *1s * * *kA *_ *~ * * *) * *x *{ *Q+ *}; *yK *[ *D k *>{ *%2 *F * *h *F * *b * *V * *g# *T @ *T^ * m *| *  *m * *H * *; * * *~ *K, *t+ *ʎ; *K *[ *^vk *S{ *S *n0 *> *: *d *^ * *d * *# *+ *E; *K *[ [ *zhk *F{ *}= *U *m9 * \ * * * *1 *Nt *r *@( *+I7 **+F *U *d *Rt *" * *E *< *8  * * *F *ƨ *H$ *s3 *B *E'Q *o` *cp * *' * *ku *[K *l *v * *7 *% *I/ * : *ĉH *V *d *r *l *L *;- *:" *6 *b *` * * * *1 * *m/ *i *s *\ *i *3  * * * * * * *S * *D7 * * * *:{ *Ό *4 * * *C& *f4 * dB *z0P *;-^ *, *I= *C *I *kO *,U *.\ *i *yv *C *9 *n *S *)N *\ *հj *իx *0 * * * *0 *, *x *) */{6 *D *^ *qk *9m~ *D *)x *Re *J *3 * *% *` *K *K *R *m *% *' *5 *CC *Q *j *[Gw * *K *F* *9 * *N * *q * * *x *ҿ! */ *'w= *:K *UaY *>g *u *b& * *k *R * *kX *p" *S * *л- *I *V *c *&p *M'} *nI * *l *$L * *N *) *9s *  *}L *%n, *39 *[F *S *$y` * *` *] *w *HL *W *I * *r *  *% * 2 *@ *;Y *mf * *" * * * *2 *z *:H *_ * *B *% * * *v$ *31 *\? *!K *]Y *g *Hu *< *5 *|F * * * *8 *  * */ *K *L! *+ * 9 *=G *Ƭ` *j *m5y * *% * *P? *^ * * * *р *y * *% *A+ *o9 *G *@ U *c *sq * *= * * *" *S * * *x *ϖ *5 *  *' *v5 *C *Q * _ *H\m *{ *u * *, * * * *&R *S7 * *ʽ * *5# *?1 *Q@ *gp *~ *P? *"Y *q * * * *ez * ** * *$ *h2 *g@ *N *L\ *j *x * * * * * *O( * *g * *tw * L! *!; *,H *gU *b */| *sK *)L * *u. *L *2  *E+ *] *_ *g * *+ *R *_ *Il *@y * *@ *ú * *&  * *8 *Q *r *O  *c *_6) *= *l *I{ *S * *d *g *f *S  *P? *a * * *u?! *?2 *8 *(1K *Y *әg *{ * * *Y * *_ * *Q *` * *  *  *bl  *  *  *  *  *   *=  *ez  *V`  *  *I"  *|F/  *<  *uI  *=V  *Ӥc  *?p  *6}  *D  *  *V  *=  *ϥ  *o  *  *  *"  *  *  *  *9,  *:  *4H  *V  *3d  *r  *)i  *  *  */.  *0  *4  *G  *Ӈ  *s  *=  *5  *-%  *o4  *I-C  *;wR  *?b  *Sr  *"  *<  *2  *;  *m:  *2  *a  *S  *6 *1, *: *~H *jV *3Jd *lr *2 *H *_ *y * *8 * *g *2 *X *&  * *'* *(9 *H *W *f *_ku *, *3 * *& *4 *0 *I- *G *Ӈ *s  * *=) *58 *-G *oV *de *St * *߳ *J *, *_ * *2 *; *m: *f *"j$ *4 *5}C *@ R *2a * p * *< *x~ * * *;  *v * *3O *P *e& *V< *-9J *YW * d *~ * * *S * *E% *ٛ *  * * *7 *  *S' * 4 *gA * N *.[ *h *:8u *% * * *X *p,  * *<( *b5 *NB *O *@\ *i *]v * *- */ * * *x * *- *+ *W *v *+ *V8 *}LE *wR *M_ *sl *Ny *Iz *I| *Y *{E *t *k *} *  *  *  *  *[+ *-9 *hG *͋V *(e * t *J *s *K * *  * * *c * *.  *) *8 *,G *8V *e *at *u\ *7 *d *-y *2 *I *r * *! *<  * *4( *:7 *F *U *Qd *)s *  * *1h *, *Tw * *! * *v@ *H  *@ * ' *P6 *KE *s)T *c *Vr *P  *+ * *  *) *G * *T *  *> *] *M *9. *d= *~iL *I\ *l *ȹ{ * *J * *@ *cI *, *' * *." *W *  *Q *,  * *N * *  *W *( *|8 *ΘH *X *3\h *w *:| *0 * *w * *V *s * *) * * # *) *5/ *~5 *PA *K *h}W *Gh *n *t **z * *  *. * *d * *b * * *[ * *pQ *f * *@T *Q *=K *v *& *=- *;7 *#A *'R *ŲX *!^ *žd *y(j *q *~ * *x *O *$ * *b *c *l  *S  *  *a+  *>  *s L  *h  *&  *   *6  *T  *X  **  *ӑ  *! *&1! *P! *`^! *l! *z! *ǯ! *9! *S ! *'! *! *N! **! *:! *se! *z" *ʷ" *!b#" *%1" *?" *N" *\" *Lj" *Ly" *E" *&." *ʷ" *Ɩ" *!b" *%" *" *" *" *# *!# *L/# *=# *LK# *iY# *ig# *i# *# *t# *%# *# *L# *t# *# *%# *i$ *S$ *a$ * $ *2$ *$ *a$ *2$ *% *^% *<% *9J% * .X% *f% *Pt% **% *i% *ǟ% *U% *b% *=c% *-&% *% *f+% *hg& *J& *& *+& *s9& *sG& *tU& * c& *os& *& *fx& * & *P& *h& *?& *j.& *& *ގ& * ' *' *(' *7' *PF' *U' *bd' *ts' *' * ' *' *' *' *2' *' *,' *H~' */( * "( *}L%( *Q 4( *sC( *fR( *la( *t}( *p( * ]( *( *R( *w( *'( *.( *W(( *.L) *[a) *w'") * 1) *Q@) *O) *o^) *:m) *$|) *) *;) *zc) *b) *) *M%) * ) * ) *o* *p* *ݬ!* *&0* *<?* *DN* *q]* *l* *5}{* *kW* ** ** *{* *+* *tn* * H* *#* *i+ * + *D + *[/+ *p>+ *G#M+ *\+ *k+ *z+ *t+ *9r+ *n+ *+ *p+ *F+ *i+ *a+ * , *g', *f5, *ɜC, *իR, *S`, *%n, * |, *ի, *, *-, *k , * , * - *- *&- */>- *ҦK- *3c- *lq- *- *h - *- *Bx- *i- *i- *i- *j- *o- * . *V. *&. *4. *B. *#P. *i^. *G[m. *\ {. *. *~8. *g. *l. *. *4. *. *. *g  / */ *%/ *3/ * B/ *P/ *n^/ *Δl/ *=/ *E/ */ *\,/ */ * / */ */ *u/ * s 0 *R"0 *'U00 *|>0 *M0 *qw0 *0 *'U0 *|0 *0 *70 *0 *1 *+v1 *x1 *+,1 *;:1 *I1 *0e1 *=1 * 1 *1 *1 *b1 *1 *%1 *K1 *1 *2 *j]2 *| 2 *i.2 *i=2 * *i> *&> *4> *C> *Q> *x_> *%m> *]> *> *t> *cK> *X> *x> *r> *> * ? *i? *'? *i5? *tC? *cKs? *.S? * ? *? *t? * ? * ? * ? *? *t@ * %@ *4@ * B@ *=l@ *z@ * 0@ *{k@ *]@ *M@ *@ *@ *f@ *>@ *&@ *DA *A *$A *4^3A * shA *vA *A *&A *A *,A *.dA *(A *&A *A *A *тB * s B *.B *'D *D *!D *%/D *=D *RLD *dZD *hD *tvD *ҡD *4D *yD *D *D *E */E *=E *KE *YE *j]hE *DvE *LE *TRE * zE *wE *E *^E *E *& F *{rF *}L%F *%3F *AF *oOF *L]F *kF *yF *LF *F *F *UF *F *j.F *F *YF *F *8G *}O#G *1G *"sBG *<}PG *k^G *lG *zG *G *w G * G *eG *OG *G *fYG *hG *G *ZH * H *S"H *N0H *p>H *LH *ZH *nH *|H *kH *H *H *H *w H * H *eH *OH *H *fYI *hI *$I *Z2I * @I *SNI *N\I *pjI *xI *I *I *hI *%I *G#I *I *I *9rI * I * J *I|J *Y'J *45J *CJ *YjJ *h{J * J *VJ *\PJ *f`J *@JJ *J *lJ *J *J *J *,J *4K *}LK *I!K *_ *c` *"` *-6=` *}1c` *v` *x` *}` *,` *` *,` *a *" 4a *Fa *pia *Z a *da *a *ya *5a *w;b *Ab *.Xb *}b *rYb *b *Ob *A?b *1b *c *u&c * =c *AYc * lc *C c *mc *FPc *c *Vd *+!d *8d *eTd *mpd *d *Yd *d *OVd *m[d *_e *!e *4e *yGe *`e *ose *<e *e *M>e *e *$e *e *Pf *v!f *'W=f *Of **bbf *xf *Tf *ʏf *JGf * f *f *dg *//g *&=;g *Ng *Vgg *+pg *Q g *g *g *]hg *!Zg *g *R"h *!;4h *Gh *7Oh *!Xh **nh *Lh *!h *h *Grh *|h *h *i *>i *Gi *Pi *V:gi *i *i *Ai *9.i *A j *D#j *w,j *4j *Uj *Tkj *Uj *j *8)j *uj *j *j *. k *Tk *4k *SGk *Aelk *ek *k *mZk *_k *0kk l l,l )l *5lWl &[l & `l *nl *\{l ^l *hll4llll@llZm mml0m@m **^m *͇xm *m *Um *%m *0m *0m **zm *:m *0m **zn *:n *Un(-n *9n &3=n &+Fn )Pn (]n &Yan &Wjn &hnn &fwn )n (n &wn &un &n &n &n &n )n (n &n &n &n &n &n &n (n &n &o))o.)=o *Co (No *DZo &^o &co *Uno &ro &wo *o &ao &Go *o &o &o &o &o *0o **zo (o *ioko *uo *Qp & p &p (p *%pk2pkRpykopkp *0p **zpmp *ipsmp *up *Qp &%p &#p (|p * qRmqbm6qKmSqsmsqjqjqjqjq &5q &3qkqk r &Ir &Grk%r ( 6r &]:r &[Cr &qGr &oLr1ker1kor1kr6krkr (r &r &~r (rkr (>r &r &r (>sl s (Us &s &(s (U2s#lIs@6\sxs &|s &sss sss s1ls (ls &s & t &# t &!tDl'tDl1tDlJtIl\tmftmt &2t &0t &At &?t &Xt &Ntmtmtmtjtk ul3u n@unNu *Zu!qu *D}u &u &~u *u &u &u *Uu & u &u *%u &4u &.u &gu &Mu &u &u *0u **zv!v (|-)v &-v &6v &l:v &`?v (|-Lv &Pv &Yv &]v &fv &#jv &!sv &9wv &1v &v &\v &-v &'v &Lv &Hv &dv &`vo.vg.v_.vW.wM.w<.w9*w87w (-Dw &{Hw &yQwp"[wp"tw &xw &w &w &w &w &wt"wt"w &w &w &w &wt"wp#w (-x &x &x & x &)x & -x & 2x (-;x &% ?x & Hx (-Qx$hxqux#x (-x$x (-x &L x &J x$x$x-$x (-x &[ y &Y y-$y-$4y ( .=y$UyZby#qy4${y4$y &j y &h y4$y;$yI$yI$y &y y &w zI$zP$/zj$9z (#.Jz & Nz & Wzj$lzj$zx$zx$z & z & zx$z$z (3.z$z (F.{ & { & {$'{$>{$S{%k{x{#{%{ (Y.{ & { & { (Y.{ & { & { (i.{ (.{ &{ (.{ & { & | &|&-|&7|&P| & T| & ]|&r|&|%| (.| & | & | & | & |%| (.| &+ | &) | &= | &; |# }3}#0}::}#V}@`}#|}D}#}L}#}R}&} (.} &L } &J })'~ (.~ &[ ~ &Y !~ (.*~ &m .~ &k 7~ & ;~ &} D~ & H~ & S~l(l~l(~l(~ & ~ & ~l(~l(~ & ~ & ~ & ~ & ~p(~($(.(K & O & X & \ & f)p) &  & )) &(  && ) (. &7  &5  &J  &F  (. &m  &a  &  & ( & , & 5)?)\ & ` & j (.s*q#6*6*̀ & р & ڀ & ހ & D*D* &*  && "F*, (.= &G A &E J &[ N &Y SY*lY*vY* &j  &h  &y  &w  &  &  &  & ǁ & ˁ & Ёz**!*> & B & K & O & Y*c* &  & * &  & *Â*܂** &  & **K+@ &6 D &2 M (/_+x &Q | &M +;++كK+K+K+  &y $ &w .+8 (/I & M & V & Z & _+t)) 0*ʄ/** [+'l+J+gq+*+؅+ 0 (&/ &  & ) & - & 6 & : & C=,M (6/^=,h (F/z=, (V/J,l, (f/ʆ &Ά & ӆ (f/ & & &, &(q, ,#,4Ck1M (y/^ &Bb &@g (y/t &dx &R & & &{ &w.55ԇ12އ (/ & & (/ & & & &$ &( &1 &=5 &7> &aB &WKp2d &h &q &u &z2 (/ & & & &2ۈT3T3 & & & & &  &%j3Fm4Pm4r &;v &7{y4`2̉38- (/ &] &[ &n &j &! &* &. &3V-_p-ip- & & & & & & & &-- (/ &   &-,-E &"I & R &2V &0[- (/ &E &? &h &f1ċ1΋ (/ߋ &{ &u & &12 (/+ &/ &8 &< &E &I &R &V &[!24 ( 0 & & &+ &%Ì &dnj &^Ќ &Ԍ &ٌ44 (0  &$ &- &1 &: &> &G &K &P 5n(5x (00 & & & & &  &  &, &*K5ލM5 (@0 &M &K &^  &Z & &}  &$ &)m5G5Q (P0b &f &o &s &| & & & &555׎ &ێ & &* &( &< &: &M &K5(.=J T5b1s  (c0 (c0 &` &\ &| &vɏ7ӏ (u0 & & & & & &  & & & &!72U7s 88..Ӑ &א &. (0 & &  &,  &*.* 9.C.` &Dd &Bm &\q &Zv.#66Ñ &mǑ &iБ &ԑ &ޑ66 &  & & & *6**6G &K &T &X &bu6lu6 & &6 (0 &  & &Ò &Ȓ66 &. &*66< &I@ &EI &aM &_V &uZ &oc6m6 & & & & (0 & & & &Ó &Ǔ &Г 7 7 7 7$ 79 7R 7g 7| 7 7 77Ք7&7&7&72&7G&7\&7u&7&7&7&7ɕ&7ە:76&*j74 (0E &I &R &V &_ &c &l &p &y &2} &,}7`8Ŗ8 &S &Q &d &b &| &z  &  & & &F80`Ka8k (0| & & (0 & & & &9— 9ڗ9/" _M"3="Zd_&&&&Ә&& &'X1h(Q(t(((ҙ )]) l)#);)U)m",*,<.@ƚE.M.W._.*g.Bo.Z.o#y`156țxқ6ߛ6^7840L#9c!x P"v&Ӝ(ݜ&(!+*)HW,t~/ Pi8ǝם8/  (0 & &'/1 (0> &!B &M/W (0h &3l &1q (0~ &G &A*/*/ &d &b>/ٞ>/>/ &x  &v>/>/7 &; &D &H &QB/\g/m8z=/ (0 & & & &/՟;/// **/?L pV/gt p// & & & &/00  & &0" ( 13 &7 &@0J (1W & [ &d &1h &-m00 ()1 &J &H &^ &\0ա 0 ,0  M0(@ 2n0?0T ^0k001U1ǢѢ=9ߢ * (y *D &w &k *U & & *# 1 *\> G *hTc *\p y *hY ( & &Yƣ (ӣ &ף &ޣY Y@ Z1 ;ZH%Z`u  ʤ *Ф (Cۤ *D & & *B &R &: *U & &" && &+ *06 &: &? *I W *\d `m *hz  *0 **z (Z *ihV *uͥ *Qإ &8ܥ &6 (k *GVWV$@VAhVa *0n **z|Y *ioY *u *Q &H &FŦ (iΦ *ۦNY^YGY%oY@kWa &Xe &VjpW} *0 **z *0 **z *\ʧ ӧ *hUU-U7UT &gX &ebUlU &{ &yU ({ & & &è &ȨUUUUV V= &A &FV_Vi ({VV ( & & &( &Ʃ (өVݩ ( &k &e & & (V () &- &6 &: &? (I#W`@6w   & & & &3Ϊ ڪ 1W (" && &/ &,3 &*8DWQDW[DWtIWwWwW &; &9wWϫ~WWW  &J &HW$WA &^E &\OWY ( j &xn &twWW & &WW̬ &Ь &٬ &ݬ &WWW"W,WD &H &Q &U &^WwW ( & & & &W#έWح () &+ &) &? &=XX" (93 &R7 &L< (9I &yM &sV&X` (Tq &u &z (T & & & &RX\XϮlX}XXXX/X<XQfs 0}K 0UU_WٯWW#Y '4 >S` j *t *U * * Ͱ *\ڰ  *h0 *\ ` *h() *ͣ; *DH *U *Ub *<o *xd| * *3 * *u *ɱ *0ֱ * * P *[ *LF */ * *& *. *<; *\H `Q *h^m *\z  *h *\  *h²Ѳ * *\  *h *\# `, *h9H *\U ^ *hkz *\  *h *Cȳ *Tӳ * *\  *h x *\& `/ *h<pK *\X a *hnh} *\  *h` * *iɴ *S״ *A *\  *h X *\& `/ *h<PK *0X **zk *\x  *hH *\  *h@ϵ *0ܵ **z *\  *h8 *u{+ *U8 *DQ *k *u 0 *\  *h *0¶ **zն *\{# *\  *h# *\0 @9 *hFU *Qg *Xv *i~ *u *Q * *X *0ʷ **zݷ *\  *h *\ % *h2= *\J S *h`k *+sw & & *[ &  &  *Uø &4 Ǹ &. ̸ *׸ &V ۸ &P  * *\  *h  *0- **z?:I:f &r j &p ti~ ( &  &  &  & |:ϹJi *F$ *U1 *DV *d *Uq *! * *U &  &  *DȺ & ̺ & Ѻ5 *Q &%! &#!: *X &7! &5!':1:J &M!N &K!UDj *iqz *u *Q &^! &Z! ( *zɻ *XԻ &y!ػ &u!zz &! &!z2Gcd55:$$ܼ &! &! *' *- *b; *UH *<U *Dr *\{ *\{ *\{# *\{#н *\{ݽ# *[ *U *<2 *I@ *UZ *l *Uy *D *  * *Ⱦ *о *sؾ *Q *\  *h *$ *7 *D *S *\` i *hv * *U * *B *Y׿ * *p * * * *3 *A *UN *D[ *e 0s *\  *h *\  *h *. *U *D *8&6 *UB &!F &!U &!Y &!b'l (:} &;" &7" &X" &V" &j" &h" &{" &y"1'M' (M &" &" &" &" &" &" &" &"|'/'9 (cJ &#N &#W &7#[ &3#d &X#h &V#q &i#u &g#z'' (v &|# &x# &# &# &# &# &# &#''9''5(C *Ja *Um &#q &# &$ &$9fr~ *Z *U *B * p *\   *h!0 *0= **zQ */^8l *]@w * *\ @ *h *N *D &$$ &$ * &U$ &M$% (56 &$: &~$? (5H &$L &$U &$Y &$b &%f &%oy &=% &;% &L% &J%   &^% &\% ZZ1 &r%5 &p%:bS] (5o &% &% &% &% (-5 &%  &% &% &%1>Hhr (=5 &% &% (=5 && &% &+& &'& &A& &?& &P& &N&8 &b&< &`&FP (M5a &v&e &t&n &&r &&w1`. *# *D *% *U *0 **z! *x]-@D *DP &&T &&Y *%d &&h &&m *Ux &&| && *0 **zI (2 && &&I (2 &' &'RR &' &'(q2qO &+'S &)'\ &:'` &8'j (2 &L' &J' &`' &^'b Ѽ. *,< *DI *%V *Ud *0q **z * ` *D &u' &m' *% &' &' *U &' &' *0 **zi (' &'# &',i6 ('C &'G &'Rt\ty &'} &' (7 &( &( &'( &%( *`. * &:(" &4(' *U2 &[(6 &Y(E &p(I &h(R.\.y &(} &(.. (.. ( &( &( &( &(.  ( &( &(% &() &(2 &(6 &(?.I (#Y &(] &(f & )j & )s &)w &)| (# &-) &))./ * *U * *  *\ !% *h2 = *D`E[ *Ug &J)k &B)p *J| &z) &p) * &) &) * &) &) &) &)EE &* &*EE ( *E@EXEeFs *EzD * &@* &:* &c* &_* * *U &y* &w*E (  &* &* &*  &*E ( * &*. &*7 &*; &*D &*H &*QE[ ( k &*o &*x &*| &* &* &* (  &+ &*E5EDDD *8# ( . *: &!+> &+C *UN &U+R &O+W *b &|+f &v+k *g &+ &+ *  *\ @  *h0 *\  *h( 7D+5 JW a r  * (  * &+ &+ *U &2, &., *a &U, &K, *   *\   *h@' *\4 = *hJ8X;b ( s &,w &, (  &, &, &, &, &- &- &:- &0-<s< (  &e- &c- (  &t- &r- &-! &-* &-. &-3<BU<]Dj}_   w    *  * &- &-  *U &- &- *a) &.- &.21K *V ( a *m &,.q &.v *U &. &y. &. &. *G[ &/ &/ *  &=/ &9/ * &^/ &R/ * p *\  *hP () ( *:3 &/7 &/=7R *:] &/a &/l *\y @ *hH77 &/ &/78D  *7 pA R_ po *z (91 * &/ &/ *U &;0 &30 *  * &g0 &e0 &0 &t0 *A &0 &0 *  *\ `% *h2`< Q *:d *:w *\  *hX  &#1 &!1 &21! &01+/KHU (O1f &D1j &B1s &S1w &Q1H (b1 &b1 &`1 &q1 &o1 &1 &~1H (u1 &1 &1 &1 &1 &1 &1 (u1 &1 &1 S2lIpS (1eu}ӷe9 }9  *? * *U+ *5 0C *\P Y *hfpq *\~  *hh *~ ( * &1 &1 *U &2 &2 *_ &F2 &@2 *  0% *\& $/ *h<K *\X %a *hnx|,, &a2 &_2 &s2 &q2b,,,,D4A 0%K\\i 0%t *i + * &2 &2 *U &2 &2 &2 &24+4+ &2 &2C+C+7 &2; &2D &3H &3O+j *| *U *e *I  * * ( * &13 &#3 *U &s3 &k3 &3 &3 ** *\7 $@ *hMW!-dk- * * *U *  *\   *h( *\{7 *\D M *hZz *  (  *s &3 &3 * &!4 &4 *U &m4 &e4 *D &4 &4 * &4 &4 *  (  *: & 5 &5& *\3 @< *hIX *0e **zx *\  *hFF &N5 &L5F (  &b5 &`5 &v5  &t5FqF:{FRF_F|FF     *P * * P- *\: C *hP[ *\h q *h~ *g ( * &5 &5 *U &5 &5 &,6 &6 * 0  *\  *h,; *\H Q *h^l-v- &w6 &u6 &6 &6-!.K.  0 1> 0I *n[ *h *Uu *  *\  *h *\ ` *h *^c (+ *  &6 &6 *U &6# &6( *2 p^@ *\M ^V *hcr *\ @^ *h &7 &7 &7 &7  &,7 &(7M(U@wX׭p! p^ p^ *   (g *# &Q7' &G7, *U7 &7; &7@ *J &X *\e &n *h{ *\ `& *h *\ & *h* (} &7  &7* (1 &75 &7:*\*f* &7 &7 &8 &8{***  &!6C &M^i *{ * *U * $ *\ # *h *\ # *h  * (* *U& &28* &$8/ *%: &t8> &p8C *.LN &8R &8s &8w &8| *x &9 & 9 * (* * &F9 &>9aa &z9 &x9 &z9 &x9 &z9 &x9 (* *: &9 &9$ (X+- *8 &9< &9EOh &9l &9u & :y & : &9 &9 (n+ *e &$: &: *? &U: &M:= *!CC &:  &: &: &: K* (*; &:? &:D (*M &:Q &:\f (+w &:{ &: (%+ &; &: (5+ &; & ; (5+ & ; &;",D &7;H &5;Q &F;U &D;^v (E+ &U; &S;ff &d; &b; &s; &q;z1; (+L &;P &;Y &;] &;fp &; &; &; &; &; &; &; &; &; &; &; &; &; &;*=`^ *2  *U &< &< *, *\9 !B *hOYj.u * * *U &0< &,< * ( * &R< &D< *U &< &< *  *" &<& &<+ *5 ]C *\P ]Y *hf0u *\ `] *h( *\ ] *h   ( &< &< ( &=  &<  (- &-=1 &)=6. O. m. w.  &F= &D= &F= &D=C m  (r   $ &W=( &U=1 &i=5 &g=> H ` &y=d &w=m &=q &=z   &= &= &= &=  &= &=   &=  &= &= &=! &=% &=+ Cw Mw f & >j & >s &>w &>w w  &-> &+> &?> &=>w w  &O> &M> &a> &_>  % &q>) &o>. G Q (c }   &> &> &> &>+ +  &> &> &> &>8 8 ( &>, &>5 &?9 &>CM MM j &?n &?w &$?{ &"?[ [  &5? &1? &R? &P?   &a? &_? &p? &n?   0 &?4 &}?= &?A &?K U r &?v &? &? &?   &? &? &? &?f  ( &? &? &@ &@{  +5^ Ncp ]z ] *e ()  * &<@ &,@ * &@ &@ *d &@ &@ *V &@A & (_ N &:BR &8B[ &IB_ &GBh &XBl &VBq (_ z &iB~ &eBBC(C(C &B &~B &B &BWC  (o  &B! &B* &B. &B8bCBbC_ &Bc &Bl &Bp &BzCC &C &C &C &CCC &&C &"C &CC &ACBt $G *U *Ub *t * * *: (! * &^C &PC *g &C &C * p! *\ @! *h@)  (71 &C5 &C> &CB &CK)U (Ga & De &Dn &Dr &D{ &'D &%D) (W &6D &4D &ED &CD &TD &RD (W &eD &aD))),=J p!U *\`?} &D &zD * &D &D *U &D &D * &D &D (  *: &,E &"E *0 **z}?}?+ &XE/ &VE9?C ( T &nEX &jEa &Ee &Ej?|? (0  &E &E? (C  &E &E? (S  &E &E (S  & F & F?? ?=?G?_ &$Fc &"Fl &3Fp &1Fy??? *6 (  * &NF &@F *U &F &F *B &F &F *  &G & G * P[, *\9 `ZB *hO`^ *\k Zt *hX *\ Z *hP *\ [ *hH5 D!6C P[MbPl P[' P[ * * *U * pY *\ Y *h(p3 *\@ @YI *hVha *1l (w * &QG &GG *U &G &G *}L * X *\ `X *h ( * &G  &G * &G  &G% *d90 &G4 &G9 *D &HH &HM * AX &2H\ &.Ha (f *!q &RHu &NH * *dj *3 * *BBMBM &pH &nH &H &~H  &H &H &H &~H$ &H( &H1 &H5 &HB *\O XX *hexofMMM  X  X* * < *I *UV *` 0Xn *\{ W *h *\ X *h *, (8 * &H &H *U  &I  & I  *|S  &  &IB  &IG  (^P  &JT  &I]  (nf  &)Jj  &'Js  & *hKZ *\g Tp *h} *\ U *h  (  &O &O &O &O &O &O &O &O (  &O &O &P" & P+? 5? N &3PR &1P[ &BP_ &@Ph &QPl &OPu &`Py &^Pz PUx D & PU6 *oA (L *X &P\ &qPa *Ul &Pp &P &$Q &Q *^ &Q &Q * & &VGZQZm &Wq &Wz &1W~ &-Wdxxxx &HW &FW &WW &UW|#< &hW@ &dWI &WM &~WV`x &W| &W &W &W &W &W &W &W &W &W &X &X &X &X6ą@ą] &.Xa &,Xk҅u҅ &=X &;X%% &LX &JX%M (i &bX  &\XM! (|2 &X6 &X?MI (Y &X] &Xb (k &Xo &XtRbbbb &X &X &X &Xf i (" &X& &X/ &Y3 &Y<pF (R &YV &Y_ &2Yc &.Yl &JYp &HYypp &[Y &WY &uY &qY &Y &Y &Y &Y    (+  &Y/  &Y=  G  (X  &Y\  &Ye  o  (  &Y  &Y  (  &Y  &Y       &Z! &Z ! &%Z! &#Z!$/!'9!'R! &4ZV! &2Z_! &CZc! &AZl!.v!.! &RZ! &PZ! &cZ! &_Z! &{Z! &yZ!.!.! &Z! &Z! &Z! &Z! &Z! &Z" &Z" &Z "@2"\J"T"q" &Zu" &Z""" &Z" &Z""" &Z" &Z" & [" &[" ##3#=#U# &![Y# &[b# &0[f# &.[o##ć#ć# &?[# &=[# &N[# &L[#ˇ#ˇ# &_[# &][# &n[# &l[$ &}[$ &{[ $ˇ$ˇ3$ &[7$ &[@$ &[D$ &[M$ &[Q$ &[Z$ &[^$ &[c$ڇ$$ $$$$%e%/%<% pTF%[%He%v%% pT% *>% (% *% &[% &[% *U% &\% &\% *% (% *\% @(% *h& & *\$& (-& *h:&H&gHR& (c& &=\g& &9\p& &W\t& &S\}& &u\& &q\& &\& &\& &W\& &S\& (& &\& &\&oH& (& &\& &\& &\& &\& &]& &]& &4]& &0]& (' &Z] ' &R]' &]' &] 'I*' (7' &];' &]D' &]H' &]Q' &]U' &]^' &^b' &^g' (|'H'D'' '' (' '' (( *( (E,( *%( &^)( &^.( *;( I( *ZT( (\_( *k( &I^o( &?^t( *U( &^( &{^( *( &^( &^( *( &^( &^( *x( &^( &^( *( (( *\( '( *h(0) *\) '$) *h1)(?)cRI) (rZ) &_^) &_g) &$_k) & _t) &@_x) &<_) &Z_) &V_) (r) &x_) &p_)vR) () &_) &_) &_) &_) &_) &_) &`) &`) () &9`) &1`* &v`* &n`*R* (&* &`** &`3* &`7* &`@* &`D* &`M* &`Q* &`V* (k*R*R*D** ** (* * + (+ *:`*+ ( 5+ *A+ &aE+ &`J+ *UU+ &>aY+ &8a^+ *h+ PSv+ *\+ R+ *h+@+ *\+ S+ *h+8+GG+ ("+ &ea+ &aa, &a, &{a, &a, &a, &a, &a(, &a,, &{a1, (":, &a>, &aG,OGQ, (F^, & bb, &bk, &$bo, & bx, &>b|, &:b, &\b, &Xb, (F, &b, &zb, &b, &b,G, (j, &b, &b, & c, & c, &c, &c, &-c, &+c, (j -G(-D5-?- T-a- PSk- |-- PS- */- (0,- *- &Dc- &>c- *U- &oc- &gc- *-ۯ- *:. &c. &c . . *$. ;. *G. &cK. &cP. *U[. &c_. &cd. *o. &ds. &dx. *. *\. \. *h.H.o . (,. &d. &d. &=d. &9d. .[ /P/h 9/ *;G/ *T/ *a/ *Ln/ *Y{/ */ *B/ *#/ (/ */ &]d/ &Sd/ *U/ &d/ &d/ */ &d/ &d/ *x/ &e/ &e/ *0 *0 *\"0 )+0 *h80XB0pW0 *:b0 &Def0 &>eq0 *\~0 )0 *h0P0 (0 (0 &je0 &he0 &e0 &we0n0 (0 &e0 &e0 &e0 &e1 &e 1 &e1 (1 &f1 &f'1 &8f+1 &6f41 &Gf81 &EfA1 (N1 &XfR1 &Tf\1 (i1 &wfm1 &sfx1 (1 (1 &f1 &f1 &f1 &f1 &f1 &f1 &f1 &f1 (1[o1 ( 1 &f1 &f2 &f2 &f 2 ( 2 &f2 &f#2 &2g'2 &.g02 &Xg42 &Tg=2 &wgA2 &qgF2mof2w2X2o2 (2 &g2 &g2 &g2 &g2 (2 &g2 &g2 & h2 & h2 &#h2 &h2 &Dh2 & Q> *h>.> *\;> QD> *hQ>_>hi>h> &p> &p>h>h> (c>h>.i> (> &q> &q?.i? (? & q!? &q*? &/q.? &-q3?>iT?Mi^?Mi{? &>q? &H &tBH &tGH`\H7iHTzH#HFH *0H (0H *H &tH &tH *9H &uH &`uH *UH &9vH &vI &vI &v I *BI &7wI &w I *+I &w/I &w4I *?I &xCI &xSI &2yWI &&y\I *gI &zykI &rypI *p}I *I}I *0I **zI (I *I &yI &yI *I &yI &yI *d9I &EzI &9zI *I &zJ &zJ * AJ &zJ &zJ (#J *!.J &%{2J &#{7J (@J *MJ VJ *djaJ &5{eJ &3{jJ *3uJ &G{yJ &C{J (J *J &_{J &]{J:|J *BJ &o{J &m{J:|J@JKx K (K &{K &{$K &{(K &{1K &{5K &{>K &{BK &{KK &{OK &{XK &|\K &{cK yvK *0K **zK *0K **zK}K *K &|K &|K}K}L &/|L &-|L &@|L &>|L &@|L &>|*Lw4L (FEL &S|IL &O|NL (FWL &w|[L &o|dLwnL ([{L &|L &|L &|L &|LwL ([L &|L &|L &|L &|LwL ([L &|L &|L &|L &|Lw M &}M &|Mw(MwKMxUM (kfM &}jM &}oM (kxM &<}|M &6}MxM (~M &Z}M &X}MxM (M &i}M &g}MAxM (M &x}M &v}NAx N (N &}N &}%NAx/N (?N &}CN &}HN (QN &}UN &}ZNFxtNUx~NUxNUxNUxN &}N &}N &}N &}NYxNxNxO &}"O &}'OxBOxLOxiO &}mO &}vO &~zO &~OxOxOyOyO &~O &~O)yP ('P &0~P &,~$Pny.PnyKP &K~OP &I~YPycPyP &Z~P &X~PyP (CP &o~P &g~P &~P &~P (CP &~P &~P &#P &P &OP &GP &sP &oP &Q & Q & Q &Q &Q &#Q &E'Q &=0Qy:Q (gKQ &wOQ &uYQ|cQ (wvQ_|Q|QQ QzQ (Q &Q &Q &Q &Q (Q &R &܀ R & R &R &CR &;#R &g'R &e0R &4R &y=R &AR &JR &ցNR &ЁWR &[R &eR (nRd{xR (RzR{RXRRyR (RzR (S &;S &9S &L S &H)S5z3S ( ?S &dCS &bLS &sPS &qYS &]S &fS5zpS (S &S &S &S &S &S &S (S &ւS &҂S=zSUzSxzS (0T &T &T (0!T &%T & .T &:2T &.;TzETzbT &tfT &roT &sT &}T{T{T &T &T &T &TzT (BT &T &TzUy} U (U!U &Ƀ%U &ǃ*U}[ZH[ (X[ &\[ &e[ &i[ &r[ & v[ &{[ ([ &1[ &-[Z[[[ [[ ([ &H[ &F[ &\[ &Z\\ \ (\ &k\ &i(\ &,\ &}1\,[C\,[M\,[j\ &n\ &x\@[\@[\ &\ &\P[\P[\ ( \ &Έ\ &\ &4\ &\ ( \ &\ &ډ] & ] &] &R] &.] &i] &S(]|[2]|[O] &͌S] &ˌ]][g] (+x] &|] &ڌ] &W] &E] &] &] (+] &] &] &(] &] &] &] &] &] &Ɏ] &Î] (b^ (b^ &^ &^ (b)^ \3^ \P^ &T^ &_^ (rp^ (ry^ & }^ & ^ (r^=^^^^^^\^ ( _ &_ &_ &)_ &'&_\0_ (<_ &8@_ &6I_ &GM_ &EV_ &VZ_ &Tc_\m_ (}_ &e_ &c_ &t_ &r_ &_ &_ (_ &_ &_\_\_{]_ ( ` &` &` (` & ` &֏)` &-` &6` &H:` &@C` &wG` &mP` &T` &]`]v` &Hz` &>`]`]` &` &~` &` &` &` &`]`]` &` &a_a_'a &+a &7aI^AaI^^a &ba &kaI^uaI^a &ϑa &͑ap^a (a &a &ܑap^ap^a &a &a^b^b &"b &+b^5b^Nb &Rb &]bq_gb (xb &%|b &#b_b_b &4b &2b_b_b &Cb &Abd_bd_c &Rc &P!c`+c (k *hKkVk *\ck lk *hykk *k *k *9k *G[k *%kKk *k &k &k *l &) l &'l *l &Dl &8'l *04l **zFlKPl (Sal &nel &lol@Kyl (fl &l &l (fl &l &lGKl[KlGKl (yl &Ֆl &͖lVK mjKm3K.m * n &Pn &N n &@$n &>,n *3nJJn *Vn &eZn &__n *jn &nn &sn *~n &n &n *0n **znJn (3n &n &nJn (Cn &ʗn &ƗnJ oJ#oJ8o *v?o@IVo *bo &fo &ޗko *9vo &zo &o &9o &5o *opIo *o &Ro &Po *o &do &bo *d9o &vo &to *o &p &p * Ap &p &ppI,p *!>p *Kp *djXp *3kp *yp *BppIppIp &p &p &p &p &p &p &p &p &p &p &Θp &̘qJ q (q &q &ܘ(qJ2qJKq &Oq &ZqLJdq (uq &yq &q &q &qLJq (q &$q &"q &3q &1q &Bq &@qLJq (#q &Qq &Oq &`q &^r &or &m r (#r &r &|rWJArmJTrJar"Jyr3JrJrrr *'r *Ur *r *Its *xs *^s *9,s *B9s *Fs *Ps ^s *\ks ts *hss *2s *Us *s *Its *xs *^s *9 t *Bt *6#t *-t 7t *\Dt Mt *hZtkt *Gvtt &t &t *[t &t &t *t &t &t *Ut &'t &#t *t &Kt &=t *t &u &u *^u &u &&u &ʚ*u &Ě/u *y &uBy &kGy *Ry &Vy &[y *^fy &ŝjy &zy &~y &y *| &vG| &K| &T|m|w|| &| &||| (5| &| &| &ş| &ß|'}7 } (5} &ܟ"} &ԟ+} &/} &4} (5A} &E} &{N} &R} &[}>e}>} &ߠ} &ݠ} &} &}b}b} &} &} &} &}k}k~ &- ~ &)~ &J~ &H!~~+~~H~ &YL~ &WU~ &lY~ &jc~m~~ &}~ &y~~ (6~ &~ &~~ (6~ &á~ &~~ (!6 & &  (!6 &  &8B_i &" &  &1 &/ (16 &B &>** &_ &] &o" &m,868S &W &|frpr & & & &ȀҀ & & &Ѣ &Ϣ 1 &5 &ޢDN (A6_ &c &lv (Q6 &( &" (a6 &M &G (a6 &p &lā߁( &, &5 &9 &B[e (q6v &z &rł!ڂ O::($:5P@Ms3h:v *փ &̣ڃ &£߃ *` & & * *  &> &6 *^  &g$ &_) *4 &8 &= *9:H &L &Q * &"B & K &4O &0Tf:p (, &J &H:: &Y &W:Dž: &h &f &y &u? QQ2Q<QT &X &a &e &nUmm & &r͆߱چ˲ղ% *W0 (Z,; *?yG &ѥK &ǥP *`\ & ` &e *> &:MrWrt &[x &YIrIr &l &hVrˎrՎr & & & &  ( & &'r< &@ &KrU (f &ͫj &ɫors ( & & & &sǏ (ӏ &׏ & &4 &2 &E &As (  &_ &[! &w% &u. &2 &7 ( @ &D &Isstt (ttА-siss68@Ub l  5}jÑ ڑAt (6 &֬ &ά &  & FtTt%t2t@qMtk`u p  p ʒ *~֒ * &) &# *Z &I &E *" &a& &]+ *U6 &{: &uJ &N &X *0e **zw &ɭ &ǭ (rǓ &٭˓ &׭ԓ &ؓ &ݓ *  *9 *% *U? *G[L *d *q *~ *  *\ @  *h Ȕ *\Ք ޔ *h *\  *h$ *8* (9 ? &C &H *S &gW &U\ *Dg &׮k &Ӯp *U{ & & *G[ && &$ * &G &5 *   (O ȕ *:ӕ &ו & *\  *h0 *0! **z4 *\A J *hW(e9o9 & &%9 (a  & &– &$Ɩ &˖<9ݖ9 (t  &? &= &S  &Q9#90X9EWa`9y9@>4 Ǘ  їG    * (  * &p &`! *U, &İ0 &A &E &J *T pb *\o x *h@ (  *: & &>˜ *:͘ &ј &ܘ *\ @ *h8 > ( ( & , &5 &/9 &-B>L ( X &>\ &<e &Mi &Kr &\v &Z> (  &k &i &z &x & & ( ř &ə &Ι??> )6 p@ Q^ pi *Ct ( & & &  & *U &9 &3Ț &o̚ &i՚dߚd & &(d(d! (-2 &6 &; (-H &L &޲U &Y & b &7f &)ody (M & &~ (M & & &Գ &ȳ &Û &ћeۛ (r &j &f & &e ( &  &) &- &6 &Ѵ: &ʹCeM (] &a &j &n &w &{ & ( &9 &3.eReМdd , -  7\HU  `duD tϝܝ  Pd (/ &`3 &Z8YdEeRe`es`~ * *9 *UÞ *͞ ۞ *\ @  *hP  *\  *h,H7 *I *Uc *p *B} *G[ * *   *\ ş *hҟ`ݟ *\  *hX  * 4+ (6-B &F &K *UV &׵Z &ϵ_ *j &#n & ~ & &z *  *\  *h Ѡ *0ޠ **z *\  *hxȵ3 *i:6C *uS *Q^ &Ҷb &жg (l-p *}" ǡ6 *0 **z *\ `  *h*p9 *\F O *h\hjt & &, (L- & &Ǣ & ˢ &Т???DM!M> &B &LV (\-g &-k &+t &Ax &?}cPˣjH!  #`!8E O!`}mjz  * *U *Y *,Ť *Ҥ * *% * *g *km *( p 6 *\C L *hYh *0u **z *0 **z *\  *h˥ڥ *\  *h *\ @  *h+O *a *n *  *: *: *k  * *Y˦ *צ * &\ &N *U & &# &·' &, *7 &ܷ; &ַK &O &Y *0f **zx.. &6 &4E ((ȧ &J̧ &Hѧ ((ڧ &aާ &W & &E  & &0 &Ը4 &Ҹ@J (8[ &_ &hr & & (H &  &¨ &ƨ &˨ (X &- &+  &A &?1*?7H`@k *w * &V &N & &| *Ué &ǩ &ة &Ϲܩ &˹ * & & *  *0 **z)K3KP &T &^vh (0y &/} &- (@ &> &< (P˪ &MϪ &K٪ (` &\ &Z &p &n #6- (p> &B &}K &O &TImKw ( & & & & &Һ &̺ & & ( &ū &ʫp] [&; S5cq *#x * &, && &J &H *UĬ &YȬ &Wͬ *ج &oܬ &i *0 **z, &0 &:3D (bU &Y &b &f &kEy *ص * *Uŭ *:ԭ *: *  *  &һ &ʻ *! &% &* *U5 &9 & B L (] &2a &,j  &M &K  ( ( &^Ů &Zή &yҮ &uۮ &߮ &  &  & + &/ &5 N ([ &μ_ &ʼi@!~ & &!! & &¯ &Ư &ϯ!ٯ! & & &$ &" !!4 &68 &4A &EE &CN!X!p &Wt &U} &f &d!! &x &v & &ɰ!Ӱ! & & & & * *# *0 *UO *:^ *:m *sy * * *$y & & *Lϱ *ݱ *K *m &ٽ &ӽ (R *, *jQ &# &* *6Y &#] &b *cn &Kr &G &q &c *A & & * &־ &ξ *U & IJ &ղ &,ٲ &(޲ * &M &C &| &v  *: *0, **z>He &i &s} & &5 (ó &dz &̳ (ճ &ɿٳ &ǿ:p ( &ڿ &ؿ% &) &.CP rp  *m0ϴ &Ӵ &ش *c &5 &1 &U &M *  & &w *U! &% &6 &: &? *J &N &_ &c &m *: *0 **zIIƵ &5ʵ &3Ե޵ ( &I &G &] &[\'E P *\ &t &j *c & & & & * & &ƶ *UѶ &-ն &) &K &G * &g &_ & & *:0 *0= **zOYv &z && (  & & & &9ʷ׷# *Ԓ `/ &3 &8 *cD &#H &Y &C] &;b *m &qq &gv *U & & & & * & & &ø & ͸ *: *0 **zy y& &9* &74> (O &MS &K\ &a` &_ez *.X߹ &| &n *c & &  &  & * &! && *U1 &p5 &lF &J &O *Z &^ &o &s &x *  *: *0 **zMɺM &T &R () &h &f &|  &z%:]Gi!s ̻ *ػ0 & & *c & &% &) &. *9 & = &B *UM &LQ &Hb &jf &fk *v &z &~ & & *: *0 **z˼IռI & &  (9 & &( &, &1F\Sq.| *t * &  & *n &,Ľ &(ɽ * ( *, &I  &C *P? &z  &p% *1 &5 &F &J &[ &J_ &Dd *Ap &{t &qy *: & & * & & *U &; &) &ľ &ξ *: *:P ( & & ($ &( & 1 &p5 &f> &B &KPd &h &q &>u &,~PP & & & &PſP޿ & & & &PP4PM &Q &Z &^ &cP}P (  & &P (  & & & &P (  &" &  &1 &/P (  &A &?( &P, &N5P? ( L &`P &^Y &o] &mkPuP & &}$Q ( & & & &7Q &< * A &Q &M(1 *! * *dj *3 * *B&(10(1I &tM &rV &Z &c &g &p &t &} & & & &11 (  * & & * & & *d9 & & *  & & * A  &$ &)1> *!P *] *djj *3} * *B11 &3 &1 &B &@ &B &@ &B &@ &S &Q & & 1. (] 7 *B &F &K *V &Z &_ *d9j &n &s *~ & & * A & &r2 *! * *dj *3 * *Br2r23 &7 &@ &D &M &Q &Z &^ &g &k &t &x & 2u0u0 & &0 ( &6 &00 (  &Y &S0" (/ &|3 &v< &@ &I0S (_ &c &l &p &y &} &  ( &4 &.00 &S &Q &c &a00 &r &p &  &007 &; &D &H &Q0f &j &s230 ( & & & &01 ()  & & &! &*14 (; D &9H &5Q1[ (; h &Sl &Ou &my &i1 (;  & & & & & & (;  & &11 & & &  &116 &: &C &"G & P1Z1s &1w &/ &B &@1 &S &O121 (M  &p &n  & &1(22 (s C &G &P &T &]2g ( w &{ &2 (  & & & &2 (  &! & &; &7 &U &Q (  &m &i22, &0 &9 &= &F2P2i &m &v &z &22 & & & &2 & &23m0+09 *-lE@A\ *2h &l &q *P?} &  & * &C &? &_ &[ &{ &w *A & & *: & & * & & *U  & &  *.L! &9% &7* *5 &O9 &IC *:V *:i *0v **z (  *< &r &j * & &sA *>A *: & &IA IA& &* &4A> ( O &S &\ &` &iAs (  & &A (  & & (  & & AAAAA) &&- &$6 &5: &3CA[AeA~ &D &B &S &QAA &b &` &q &o & &~AA &  & & &! &% &. &2 &7A\AtA~ (  & & & &AiA * *2 & & *P?  & & *! &P% &L6 &r: &hK &O &T *A` &d &i *:t &x &} * &- &# *U &x &n *.L & & * & & & & *: *:  *0 **z( (G1 *<< &"@ &E *P &hT &dY n *>x *: & & & &9 (W & & & & I"[, (j= &A &J &N &Snhu3 *h@ & & *c & & &7 &1 *  &Y &S *U &" &' *2 &6 &M *:` *0m **zII & & (Y & & & &c% 0 *; (F3R & V &[ *cg &Ck &=| &z &j *A & & * &" & *U &j &` * & & *dZ *a & & *X & & ** &8. &63 *p,> &KB &EG *j%R &mV &e[ *m{ *: *\  *h *\  *h *\  *h$ *\1 @: *hGU_ (\3p &t &y (\3 & & &N &H &| &p (3 & & & & (3 &! & &1 &/ &C &A &S &Q% (32 &e6 &c? &uC &sL (3U &Y &bl & & & & (3 & & (3 & &  (3 &; &7Wfo(:}j 0  (3 &U &Q &v &l & & (3 & & &  & & &  &2# &*, (39 &Y= &SFMP (3a &e &~oMy (4 & & & & & & & & (4M (4 & &M (4 & & (&4 &%" &#+ &</ &:8 &M< &KE &^I &\R &oV &m_M}MM & &~ & & & & & & & & & &'+@ &D &M+W (<4h &l &v+ (O4 & & & & &- &+ &B &< (O4+ (b4 &m &k+ (b4  &  & (r4% &) &2 &6 &? &C &L &P &Y &] &f+++ &  & &! & &! & &! & &! & &2 &0UU.HR (4c &Bg &@l yVPc'1P]+j9S *  *U &W &O *a & &} *% &) &. *< *0I **zW (2` *igսp *u *Q & & (2 *Ľս *0! **z4 *\A J *hWf *\s `| *h *i  *u *Q &$ &" (3 *< \ *0i **z{ &4 &255 &D &BR (2 &X &V  &n &je/e9eRjdn & & & &11 (2 & & & &DDD1ICOMOj &n &xm (3 & & & &} (&3 & & & &"F (63  &)$ &'- &?1 &;6YK#XEe _<sXz *N * *a *B * *A *!_O *\ *ai *Bv *6 * *& *a *  *$~ *p, * * *;8 *\E N *h[g *;v *7 *a * *& *+ *{ *a * 0 * *  *\ " *h/: *1E (\ &e` &Se *cq &u & & & *A & &z * & & *U &K &9 *q * & & &  & * *:# *\0 9 *hFU *\b k *hx *\  *h *0 **z &N &J  &d &b &x &r"F.P.m &q &{ & & & & ( & & ( & & %8\B (S &W &\ (e &-i &)s~%:$\9CXbp *W| &K &E *c &k &g & & * & & *U & & * &  & &! &( *:; *0H **zZd &< &: (I &M &K &\ &Z    *<: &q> &iC *cO &S &d &h &m *Ay &} & * & & *U &0 &* * &^ &V *p, & &| *: *0 **zu *i!* *u: *QE &I &N (4W *dq & &  (4 &! &* &. &3(L(V(o-\ (4 & & & & (4s   *9 &= &B *cN &:R &6c &`g &Rl *Ax &| & * & & *U & & * &. && *p, &S &M &x &p *: *0  **zM, *i3< *uL *QW &[ &` (4i *vNN &  &j (4/ &3 &< &@ &E}^}h} & &  (4* (4- &1 &: &> &C (4MHkF^o *  &, &$ *c  &Q &M  &r$ &h) *4 &8 &= *UH &L &Q *\ &` &q &<u &4 *: *0 **z &^ &\ (i &r &p & &%3 *u?b &f &k *cw &{ & & & *A & & * &- &' *U &^ &X * & & & & *: *0 **z- (426 *i=˺F *uV *Qa &8e &6j (E2s *˺ *0 **z *i!* *u: *QE &HI &FN (2W *dڻqӻ *0 **z &X &V" , I &lM &jWBa (U2r &v &~ & &UUUZں (e2 & & & & (e21; (u2L &P &Zs}22 & &N (2 & & &  &^ *G &K &Ucz 02B% * &( &" *c  &H &D! &g% &_* *A6 &: &? *J &N &S *U^ &b &g *r &v & *: *0 **z & & ( &0 &. &D &B1; (L &WP &QU (e| *9P &y &s *c & & & &  * & & *U) &- &2 *= &/A &)R &OV &I` *:s *0 **zYY &j &h (y &~ &| & & s8 C *Or &v &{ *c & & & & * &  & *U &6 &0 * &^ &\ * &t &n *: *0' **z9C` &d &n2x ( & & & &E24 *K  *, & &" *P?. &2 &7 *C &G &X &\ &m &=q &;v *A &P &J &r &l * & & *U & & * & & &  & *:  *: *0) **z;Eb &&f &$pz (z &: &8 &N &L *J (7 *s  &u  &[  *  &  &%  *tn0  &4  &9  *UD  &_H  &EM  *W  `  (7i  *:t  &x  &  *\  `  *h (  *0  **z  *0  **z  *0  **z  *\"  +  *h8  F P m  &q  &{   (7  &  &   (7  &  &    (7  &  &  &  & 3 =  (7N  &R  &[  &._  &*d -v A  ( 8  &N  &B A  (+8  &  & A  (L8  &  &  &  & A  (m8  &.  &(  &T  &N"  &&  &t+  (84  &8  &A AK Ag  &k  &t  &x  & A A  &  &  &  & A A  &)  &'  &;  &7 A  &S  &O ; B_ ai  (8z  &o~  &m  &  & q q  (8  &  &  &  &  (8  &L  &D  &  & & & &[ &M & &( &N, &F5 &v9 &pB &F &T &X &a &e &n & r &{ &% & &H &F &o &U & & &g  &e   &w  &u  &  & &0 (8A & E & N & R & W.pz (8 &  &  &  &  &  & + & / & 9;C ( 9T & X & ] ( 9f &/ j &) uD; (9 &P  &N  &c  &a D; (89 &y  &w D; (H9 &  &  &  &  (H9  &   &  &  & # & ' & 0D;:D;S & W & ` & d & m & q & zD;D; &:  &8  &R  &P  ([9 &b  &`  &v  &p ; (k9 &  &   &   & ;  (91 & 5 & ?;I (9Z & ^ & g<q< &  & ; (9 &*  &"  &T  &N  (9 &q  &m  &  &  &  & ; (9 &  &  (9# & ' & 1<K <` <u < < < < < < <  <! <3<Ok<t<~ (9 &  &  &  &  (9 &  & < (9 &  & < (: &5  &3   &G  &E <! (::2 &\ 6 &Z @ (X:I &t M &p V & Z & c & g & p & t & } &  & '='='= &  &  &  &  &  &  &  &  &  &  &   & l=# (w:4 & 8 & B>L (:] &a &j &/n &+s'>B> (: &E &C &X &VR>> (: &g &e &| &x> ?* (:; &? &D (:M &Q &\?f (:w &{ & & & &/ &) (: &W &M & & & & & & &  &  && & &o &a  &  &9@/ &3 &< &@ &EE@d (:q & u &~ &D &BA A A &S &QAX;mz 0D;> ?G? 0 (&;) &- &6 &: &?Xb & &. (6; & & &* & . (M; &c &[. (M; & &  & &.$ (M;1 &5 &> & B &K &5O &-T (M;] &ca &]j.t. & & & &.. & & & &..  & & & &%.: &> &Gf/LL & &i (d; & & &6 &2 (w; &N &J! &j% &f*<Fc &g &~p &t &~!Y5< [<% 0 *86 (A *sM &Q &V *a &e & v &\z &T * &~ &| *U & & & & *& &* &( &: &8 * &M &G *  p  *~ S!  *:4  *\A  J  *hW 8f  *0s  **z }S  *:  &u  &m  *0  **z S  *:  &  &  *: ! *0! **z(!S=! *:H! &L! &W! *\d! @m! *hz!0!XS!XS! &! &!S! (! &! &! &! &!S"T"T." &2" &<",TF" (W" &,[" &(d" &Hh" &Dm"JT"jT" (" &^" &\" &q" &o"zT"T"T" &" &~"T# (# &# &&# &*# &3#T=# (#N# &R# &[#Te# (3u# &y# &~# (3# &# &#T#T#T#T#T# &# &$ &$ & $T%$T/$TH$ &L$ &U$ & Y$ &b$Tl$T$ &1$ &/$ &B$ &>$ &Y$ &W$T$T$ &j$ &h$ &{$ &w$ &$ &$ &$ &%T)%TA%UK%Uh% &l% &u% &y% &~%U%lS%T%T%RT%T &T"&T/&4UF& [&h& pr& && p& *& (& *& && && *tn& &6& &(& *U& &}& &w& *& && &' & ' &' *' P(' *:;' *\H' Q' *h^'Hm' *0z' **z' *\' ' *h'@'<'<' &' &'d' (( &( &( &-( &)$(t2(L?(V(c({((( P((( P( *( *U( *tn( *) *) *) *(t,) *u9) *tF) *KKS) *q`) *%m) *\z) *) *) *) *) 0) *\) ) *h*x* *0* **z/* *0<* **zO* *\\* e* *hr*p* *\* @* *h*h* *\* * *h*`* *\* * *h+X+ *\ + )+ *h6+PP+ * ^+ *Uk+ *(ty+ *e+ *U+ *(t+ *+ *+ *d9+ *+ * A+ *!+ *, *dj, *3, *-, *B?, *M, *UZ, *(th, *~v, *U, *(t, *, *Q, *, *U, *, *x, *- *- *+- *8- *\E- *;R- *_- *ul- *v- - *- *- *\- @- *h-- *- *- *>. *0. **z. *\*. 3. *h@.K. *rV. (a. *Um. &Kq. &Av. *. &. &y. *. &. &. *V. &K. &=. *s. &. &. *L. &. &. *. *\/ "/ *h/+/ *\8/ `"A/ *hN/]// &/ &/ &"/ & /// &2/ &0/ &A/ &?//0 &R 0 &N0 &o0 &m#0F-0FJ0 &~N0 &|W0 &[0 &e0ao0a0 &0 &0 &0 &0o0o0 &0 &0 &0 &0y0y1 &1 &1 &!1 &+151R1 &V1 &_1 &c1 &m1w11 &-1 &+1 &?1 &=111 &N1 &L1 &`1 &^11 ( 2 &o2 &m2 &2 &'212 (B2 &F2 &O2 &S2 &]2g22 &2 &22 2 2 &2 &2 &2 &2R3+3 @3hJ3/[3f3 *x3 *U3 *3 *3 *V3 *v3 *U3 *83 *X3 *L3 *p4 *m 4 *U:4 *a4 *j]s4 *:4 *:4 *4 *-4 **4 *}4 (15 &5 &5 *#5 &K'5 &=,5 *75 &;5 &@5 *UK5 &O5 &T5 *^5 \g5 (1p5 *:{5 & 5 &5 *\5 [5 *h55 *05 **z5 *\5 \5 *h56 *\6 `\$6 *h16?6I6f6 &dj6 &bt6r~6 (16 &x6 &v6 &6 &666 (16 &6 &6 &6 &6 (16ĸ7%#7I87B79W7d7 \n7977 \7 *{7 (17 &7 &7 *7 & 7 & 7 *7 &w 7 &k 7 *U7 & 7 & 7 *8 PZ 8 (18 *:8 & "8 & -8 *\:8 YC8 *hP8_8 *0l8 **z8 *\8 Y8 *h88 *\8 Z8 *h888 9 &1! 9 &/!9b!9 (229 &E!69 &C!?9 &Y!C9 &W!H9ua9k9 (2|9 &h!9 &f!9 &w!9 &u!9 (299999(999: PZ:9":/: PZ:: *&@: (6K: *W: &![: &!`: *Uk: &!o: &!t: *.L: &!": &": *: *: *: *\: P: *h::: (6: &Y"; &U" ;; (6%; &q"); &m"2;<; (6L; &"P; &"U; (6^; &"b; &"g;;;;;; &"; &"; &"; &";;< (6< &"< &" <5<L<V< (6g< &"k< &"t< &#x< &"<< (6< &#< &#< &3#< &1#< &D#< &@#<< (6< &^#< &Z#< &v#< &t#< &#< &#< (6= &#= &# =7= N=X= ( 7i= &#m= &#v= &#z= &#= ( 7=(=@= (7= & $= & $= &$= &$=@=@ > &*$> &($> &9$> &7$$> &H$(> &F$1>@;>@W> &W$[> &U$d> &f$h> &d$q> &u$u> &s$~> &$> &$>N>h>k> (,7> &$> &$>k> (<7? &$ ? &$?2?B *:C *\C *%C *h2C=C *<JC *\C *gC *:wC *@C *UC *.LC *C *cC *SC *C OC *\C OC *hDD *\D P&D *h3DBD *\OD @PXD *heDpD *\}D PD *hDD *VD *D * D *UD *.LD *SE * E *E 2)E *\6E 3?E *hLE8[E *\hE `3qE *h~E0E *\E 3E *hE(E *\E 3E *hE E *\E 4F *hF#F *\0F `49F *hFFUF *\bF 4kF *hxFF *\F 4F *hFF *qF *UF *.LF *kF *UF *.LG *SG *G *#G *\0G +9G *hFG@VG *dG *UqG *.L~G *SG *G *G *G .G *\G @.G *hGXH *\H .H *h*HP5H *\BH .KH *hXHHrH *&H *UH *.LH *tH *SH *HH * H **H *H .H *\ I /I *h!I0I *\=I `/FI *hSIbI *\oI /xI *hII *I *I *\I /I *hII *\I 0I *h JJ *\%J `0.J *h;JxJJ *\WJ 0`J *hmJp|J *\J 0J *hJhJ *\J 1J *hJ`J *K *U K *.LK *S'K *LK *YK *cK =qK *\~K @=K *hKK *\K =K *hKK *\K =K *hKL *fL *.LLL *]YL *}LfL *sL * L *L P+L *\L +L *hLL *\L +L *hLL *\ M ,M *h!M2M *\?M @,HM *hUMdM *\qM ,zM *hMM *\M ,M *hMM *wM *.LM *}L N *N *"N 56N *\CN @5LN *hYNxhN *\uN 5~N *hNpN *\N 5N *hNhN *\N 6N *hN`N *\ O @6O *h!OX0O *\=O 6FO *hSOPbO *\oO 6xO *hOHO *\O 7O *hO@O *\O @7O *hO8O *\P 7P *hP0*P *\7P 7@P *hMP(\P *\iP 8rP *hP P *\P @8P *hPP *\P 8P *hPP *\P 8Q *hQ"Q *\/Q 98Q *hEQTQ *\aQ @9jQ *hwQQ *\Q 9Q *hQQ *%Q *.LQ *Q *Q *"R *R * "R *,R ,@R *\MR -VR *hcRrR *\R `-R *hRR *\R -R *hRR *\R -R *hRR *X S *.LS *.W *\;W ?DW *hQW0`W *\mW @?vW *hW(W *\W ?W *hW W *nW *UW *=X * X PFX *&X *t5X *\BX FKX *hXX8cX *qX *U~X *.LX *SX *HX **X *X pHX *\X HX *hXY *\Y HY *h*Y9Y *\FY IOY *h\YxkY *\xY `IY *hYpY *\Y IY *hYhY *\Y IY *hY`Z *\Z JZ *h$ZX3Z *\@Z `JIZ *hVZPeZ *\rZ J{Z *hZHZ *\Z JZ *hZ@Z *|Z *UZ *.LZ *t [ *S[ *H%[ **2[ *<[ ?J[ *\W[ ?`[ *hm[|[ *\[ @[ *h[[ *\[ `@[ *h[[ *[ *\ *\ \ @\ *h#\2\ *\?\ @H\ *hU\d\ *\q\ Az\ *h\\ *\\ `A\ *h\\ *\\ A\ *h\\ *\] A] *h](] *\5] B>] *hK]`] *n] *U{] *.L] *ݬ] *\] *S] *] K] *\] @K] *h] ^ *\^ K^ *h'^ 6^ *\C^ KL^ *hY^ h^ *\u^ L~^ *h^ ^ *\^ @L^ *h^^ *\^ L^ *h^^ *\ _ L_ *h!_,_ *\9_ MB_ *hO_d_ *r_ *U_ *.L_ *ݬ_ *\_ *S_ * _ *_ P1_ *\_ 1_ *h`H ` *\"` 1+` *h8`@ G` *\T` 2]` *hj`8 y` *\` @2` *h`0 ` *\` 2` *h`( ` *\` 2` *h` a *Ra *U,a *.L9a *ݬQa *\^a *Ska *ua PBa *\a Ba *ha a *\a Ba *hax a *\a Ca *h bp b *\&b @C/b *h=g *hJg Yg *\fg `>og *h|g g *\g >g *hg g *cgg &&g &&g * g *h ( h *h *&h *d91h *?h * AMh (Rh *!eh *rh *djh *3h *h *Bh h h &&h &&h &&h &&h &&h &&h &&i && i &&i &&i &&i &&#i (,i *:i *Ii *d9Ti *bi * Api (ui *!i *i *dji *3i *i *Biii &&i &&j && j &&j & 'j & ' j &&$j &&-j &&1j &&:j &'>j &'Kj *\Xj @Maj *hnj xj (j *j *j *d9j *j * Aj (j *!j *j *djj *3 k *k *B+k05k0Nk &-'Rk &+'[k &='_k &;'hk &N'lk &L'uk &='yk &;'k &-'k &+'k &-'k &+'k *\k Mk *hk k0kVkLltla*l *8l *El *.L_l *6ll *Tl *l Fl *l *l *d9l *l * Al *!l *l *dj m *3m *(m *B>m *Km *Xm *d9em *rm * Am *!m *m *djm *3m *m *Bm *m *m *d9n *n * A!n *!3n *@n *djMn *3\n *jn *Bn *\n Fn *hn8 n *\n Gn *hn0 n *\n `Gn *ho( o *//5o *;o (L Fo *Ro &m'Vo &]'[o *Ufo &'jo &'oo *.Lzo &'~o &'o *o *o *\o @*o *ho@ oo (b o &%(o &#(opp &4(#p &2(,p6pRp &C(Vp &A(_p &T(cp &P(hpppppp &k(p &i(p &z(p &x(ppq (r q &(q &( q5q Lq0Vq ( gq &(kq &(tq &(xq &(q0q ( q &(q &(q &(q &(q &(q &(q0q ( q &)q & )q &))q &')q &:)q &6)q ( r &Z)r &P) r=7r\NrXr ( ir &)mr &)vr &)zr &)r ( r &)r &)r &)r &)r &)r &)r ( r &)r &)rr &*r &*rs!s &*%s &*.sDs ( Qs &'*Us &%*_s$is ( zs &6*~s &4*s$s ( !s &E*s &C*s$s (!s &T*s &R*s (!s &e*s &a*s)s4t4 t4*t4Bt &|*Ft &z*Ot &*St &*\t8ut`t`t &*t &*t &*t &*ththt &*t &*t &*t &*t &*t &*th uh%u &*)u &*2u &+6u &*?u &+Cu &+Lu &*+Pu &&+Uuz|uuu ()!u &E+u &?+uu (9!u &j+u &d+uӊv v (I!v &+!v &+*v4v (Y!Av &+Ev &+Nv &+Rv &+Wvyvvv &+v &+v &+v &+vvv &+v &+vvw &+w &+!w &,%w & ,*w!Cw0Mw0jw0tw0w &%,w &#,w &4,w &2,w4w7w7w &C,w &A,w &R,w &P,w?x?x &a,!x &_,*x &p,.x &n,7x &,;x &},Dx?Nx?jx &,nx &,wx &,{x &,x &,x &,x &,x &,xMxhxx`y&y>yuMy^yy *ސy *Uy *.Ly *y *שy *y *:z *:z *:!z *(zpOz * Zz &,^z &,cz *Unz &,rz &,wz (z *:z &-z &-zz *:z &-z &-zzz &.-z &,-z &=-z &;-{{&{ &N-*{ &L-3{ &]-7{ &[-B{L{i{ &n-m{ &l-v{ &}-z{ &{-{{{ &-{ &-{ &-{ &-{{{ &-{ &-{ &-{ &-{| | &-$| &--| &-1| &-9| *)@|c| &-g| &-l| *x| &(.|| &.| * | *| &`.| &X.| (| *| &.| &.| *| &.| &.| *d9| &.| &.| *| &.| &.| * A } &/ } &/})#} *!5} *B} *djO} *3b} *p} *B})})} &!/} &/} &2/} &0/} &2/} &0/} &!/} &/} &!/} &/} &C/} &A/}u~ *~ &U/~ &Q/~ *'~ &q/+~ &m/0~ *d9;~ &/?~ &/D~ *O~ &/S~ &/X~ * Ac~ &/g~ &/l~u}~ *!~ *~ *dj~ *3~ *~ *B~u~u &/ &/  &/ &/ &/ &/' &/+ &/4 &/8 &/A &/E &/M (V *a &0e &0j *u &0y &0~ *d9 &%0 &#0 * &60 &40 * A &F0 &D0 *! * *dj *3  * *B+5N &V0R &T0[ &f0_ &d0h &f0l &d0u &V0y &T0 &V0 &T0 &V0 &T0 ( * &w0 &u0 *À &0ǀ &0̀ *d9׀ &0ۀ &0 * &0 &0 * A &0 &0Ƃ *!+ *8 *djE *3X *f *ByƂƂ &0 &0 &0 &0 &0 &0Á &0ǁ &0Ё &0ԁ &0݁ &0 &0 &0 &0! &1% &1. &!12 &1; &11? &/1H &B1L &@1V+` (q &S1u &Q1~ &f1 &b1 &~1 &|1 &1 &1 ( &1 &1PՂ]߂f  5.A *<<S *U` *m *  *0Qp *ƒ &1ƃ &1˃ * ׃ &2ۃ &2 &C2 &;2 &m2 &e2 &2 &2CKMmPx *P< * *Pτ &2ӄ &2؄ * &3 &3 * &3 &3 *U  &3 &3 *   &3$ &3) ({2 *= &'4A &#4F *Q &C4U &?4Z *d9e &a4i &]4n *y &4} &{4 * A &4 &4 *! *ƅ *djӅ *3 * *B* &4. &47 &4; &4D &4H &4Q &4U &4^ &4b &4k &4o &4w (k * &4 &4 * &4 &4 *d9 &5 &5 *dž &05ˆ &,5І * Aۆ &L5߆ &H5 *! * *dj! *34 *B *BU_x &f5| &d5 &v5 &t5 &v5 &t5 &f5 &d5 &f5 &d5 &f5 &d5Ň (· *:ه &5݇ &5  *: &5 &5  8 &5< &5E &5I &5N g q  &5 &5 &5 &5  ʈ &5Έ &5׈ &6ۈ &6i i  &6 &6i / &363 &16> H (Y &G6] &E6f &X6j &T6o    &y6 &w6 &6 &6ɉ Ӊ  &6 &6 &6 &62  (" &6& &6/ &63 &68B QG [G x &6| &6 &6 &6G G  &7 &7 &7Ŋ &7̊ *^ *U *}L  *.L *$ *B2 *D *UQ *_ *R}f<} * &)7 &!7 * &V7 &P7 *g &y7 &s7 *UNj &7ˋ &7ԋ=ދ ($  &7 &7 (: %=a&#6:=@ (S Q &7U &7ZJ=lR=v (c  &7 &7j=:= όR= *׉ * *Y *%& *3 *6A *“H _ *k &7o &7t  *F@3 * &8 & 8 *̍ &N8Ѝ &D8Ս * &8 &~8 *g &8 &8y3  (  &8" &8+ &8/ &88y3B ( N &8R &8[ & 9_ & 9h &9l &9uy3 (  &49 &29 &C9 &A9 &T9 &P9 (  &m9 &i9Ď333  (  &9! &9& ( / &93 &9< &9@ &9I4S4p &:t & :} &: &:'4'4 &2: &0: &A: &?:Ǐ33 *vl  * *U' *6 *s< (}G *US &Z:W &P:\ *g &:k &:p *^{ &: &: * &: &: * # *\ "Ɛ *hӐP ݐ ( *: &&; &$; ( *: &5; &3; (" *:- &J;1 &B;< *\I "R *h_H m+%w ( &t; &r;+%+% &; &;đ+%Α+% &; &; &; &;0%B%B%9B%CB%[ &;_ &;h &;l &;uF%$$ &; &; %ג% ( &; &;%%%< &<@ & <E%Z% #m˓ #֓ *ݓ/ * &#< &<  * &E< &?< *( &`<, &^<6 *0C **zU/_ (cp &q<t &o<~0 (s &< &<-00͔0 * @/ *  &< &< *9  &<$ &<-/7 (3H &<L &<U &<Y &<b/l (Cx &<| &< & = & = &= &=/ (S &)= &'=ƕ &8=ʕ &6=ӕ &G=ו &E=ܕ (S &X= &T=//'q/4y/L/Z *ݠl *Uy *J * 0# *\ `# *hɖX Ԗ * *U *J  *   *\- @6 *hC` N *Ul *Ux &u=| &m= * &= &= &= &=ԗ &=ؗ &=ݗ< (BA,V6VS &>W &>` &%>d &#>nmxm &4> &2> &E> &C>{{ט &T>ۘ &R> &c> &a> &t> &p>,6O &>S &>\ &>` &>g *as( *U &> &> * &> &>( (ҙ &?֙ &>ۙ ( &4? &.?( (  &U? &Q?(/ (< &n?@ &l?J?(T (a &}?e &{?n?(x ( &? &??( ( &? &? ( &? &?ƚD(P(P(P(P() &?- &?6 &?: &?CT(^m(hm( &? &? &? &?u((ڛ *R1 * * *: *;$ *1 *? *}F0] *k *Bv &@z &@ * &@ &@ *Y &1@ &)@ *p &U@ &S@ ( *ҜWܜW &i@ &g@ &y@ &w@ &i@ &g@ *["9 *E &@I &@N *Y &@] &@b *Um &@q &@{ *0 **z &@ŝ &@ϝٝ (/ &@ &@ &A & A- *s4K *W &(A[ &"A` *}Ll &HAp &DAu *l *@^ &_A &]A *U &pA &lA *l &A &AÞ$͞ ( ڞ &Aޞ &A &A &A$ (  &A &A &A &A$$. ( ; &A? &AH &AL &AU (^ &Bb &Bl *~ * * * *.L *ş *؟ * *9 *88 *@X *px *`4 *K *נ *y *= *]^& *C *` * r *< *n *: *ʡ *;ס *, *V * *) *d96 *C * AQ *!c *p *dj} *3 * *B * * â *yТ *|t *; *i *; *u5 &2B9 &,B> *3J &TBN &NB^ &vBb &pBg *h *sȣ */գ * *&: *s ** *A8 *DE *=S *9e *Ds *zm *k * *F> *kĤ *֤ *; * *D  *ۄ! *y. *,F *yS *c *y *G * *% *ϥ * *= *PH *8 *H *P?U *f|a *Dn *@Nz * *b- *s *% *Ѧ *sަ *% *i *Rm  *s *%& *5 *G *sT *'b *m * *% * *p *s *ا *s * *s * *u *t, * < *H *5U * a *n *z * *r *\{# *Ԩ *6 * *' *B *\ *Fr * *q * *ρک * * *% *0 **z *- *; *xRI *W *e *s * * * * *'ƪ *_ت *Դ * *Y *$ *[)4 *sB * P *~ *]U *ȫ * *R * +; *Nd *{ * *Ѭ *Q߬ * *Q * 3 *"JO *au * *Y *s *n *# *#έ *$ݭ *$ *6$ *O$  *h$ *6) *$7 *(] *sj *w *Y *pz * * *0Ů *Iٮ *b *{ *  * *& *5 *ROD *S *b *Or *" *2 *; *T *Z *f̯ *sٯ * *Y *J *g  */# *. *Q= *jL *[ *o * * * *  * *+˰ *Pڰ *i * * * *( *8 *D *R *#b *so *| *J *I *: *P * ʱ *uڱ * * *K  * *d $ *S? *^ *vm *| *; *  *8 *v *ʲ *ڲ * *>I *1 * *' *(R *Q^ *k *ұ~ *<  * *  *! *9ų *FvԳ *  *cE *  *  *L *a( *Ol5 *iC *{WS *1` *0r *y *s *e *w *.P۴ *< *a  *y *24 *yA *W *sd *z *s * * *ĵ *]ҵ *[ *y *   *y *6 *C *V *:+h *Apv *Z *Z *S *Ap *N *Sζ *Apܶ *^ * *S~ * *, ** *6 *B *O *Y */q *Ap~ *f * * *C *ɷ * * * */  *% *? */K *S\ *Hf *_p * *s *}L *_ *s̸`p  &B &B  &B$ &B- &B1 &B:} D} ` &Bd &Bm &Cq & Cz &)C~ &%C &AC &=C  ˹ &XC &VC  ( &iC &gC  (. &xC2 &vC> (M &CQ &CZ &C^ &Cgq &C &C 0ź 0 (" &C& &C/ &"D3 &D< &KD@ &EDI &uDM &kDV^o &Ds &D| &D &D_ (0 &D &Dʻ &Eλ &E׻ (F &(E  &&E)@J (V[ &7E_ &5Eh &HEl &FEq &ZE &XEǼؼ   (f, &qE0 &gE9 &E= &EF &EJ &ETp &Et &E@ZȽ ({׽ &E۽ &E &F &F &AF &?F&7D O\mz  &XF &NF &F &Fо7ھ ( &F &FANN- &F1 &F: &F> &FH (Q & GU &G^h &2G &0G@ ÿ &FGǿ &BGп &cGԿ &]Gݿ &G &G &G &Gq ]% >PY &G] &Gf &Gj &Gs & Hw &H &&H & HP ( &QH &KH^ (& &H &vH &H &H &I  &H &6I &&I" &I& &~I/ &I3 &I< &I@ &II &dJM &\Jb`pl"zl" &J &J"" &J &J &J &J (= &J &J" &J &J%"/ (M@ &JD &JM &KQ &KV"h+#r+# &K &K## &$K &"K## &5K &3K  &DK &BK (]% &UK) &QK3#H &lKL &jKW$a (mr &}Kv &yK &K &K$H$H$ &K &Ku"a## q, p 6KUbw p  p   p  ( &K &K &L &L &TL &JLX&'X&D &LH &LR&\&y &L} &L &L &L&& ( &L &L &L &L& (  &L &L& (  &M &M! &;M% &5M.&8 ( E &]MI &WMR &MV &yM_ &Mc &Mh ( q &Mu &M~&& &M &M &M &M&& &M &M & N &N&& &N# &N, &*N0 &(N9&N &;NR &7N[&x&& (  &XN &VN &hN &fN&h&  ' 6 (E &NI &uNR\y &N} &N, P+ P9 &N &N &N# &N, &N0 &NO:Y ( f &Oj &Os &+Ow &)O &@O &P: #!:0#:T:R:g(t~: (v  &[P &MP &P &P &P &P &Q &P= (  &:Q &4Q ( = ( 0 &\Q4 &ZQ= &kQA &iQJ &|QN &zQS ( \ &Q` &Qg>~D  @V  @V  @VC: &Q> &QQD[ ( l &Qp &Qy &R} & R &7R &3R &SR &OR (  &wR &oR &R &R\D\D &R &R &R &R &S &S  &S  &SC7\DOJ\r ( &0S &&S &cS &]Sz z  &S &S  pYL!u 2? pYN (#] &Sa &Sj &Sn &Sw   &S &S  0X1N  0X)eD &TH &SQ &qTU &gT^ &Tb &Tuf ( &U &U &JU &DU &uU &kU ( &U &U &U &U>f ( &U &U &V &U >f (! &V% &V. &1V2 &/V; &BV? &>VH>fR (b &[Vf &WVo &sVs &qV| &V &V ( &V &VKfjff ( &V &V &V &V ff. &V2 &V; &V? &VH &VL &VUf_f{ &W &W &$W &"W &5W &1W &OW &KWfff ( &hW &dW &W &~W &W" &W+ &W/ &W4 (= &WA &WJ &WN &WWfafz &X~ &X &-X &+X &u ( &lZ &^Z &Z  &Z (" &Z& &Z/ &Z3 &Z< &[@ &ZI & [M &[V &=[Z &9[c (l &Z[p &V[ykuku &u[ &s[ &[ &[ &[ &[ &[ &[ &u[ &s[ &[ &[}u ( &[  &[ &[ &[# (0 &\4 &\= &8\A &4\J &U\N &Q\W &t\[ &p\d &\h &\q (z &\~ &\uu &\ &\ &\ &\ &\ &\ &\ &\ &\ &\ &\ &\u ( &] &\# &A]' &=]1u; (L &a]P &[]U (^ &]b &~]puzu &] &] &] &]$v ( &] &] &] &] &] &] ( & ^ &^ 9v+]5PvKuv`sv -w;w  (i! &?^  &1^) &^- &^@ &`D &`MW (!h &`l &`q (!z &`~ &` (! (! &a &a (! &4a &2aΌ (! &Ga &Ca (! &aa &]ac (!, &}a0 &{a> &aB &aK &aO &aT (!] &aa &afn]w (! &a &a & b &b (! &Ib &?b| ("  &b &b (" &b# &b1; (%"H &bL &bQ (%"_ &bc &bp#z (7" &b &b &c &c &c &c (7" &&c & c.]D  (J"% &Nc) &Jc2 &rc6 &jc? &cC &cH (J"R/vϜ|ՍY '8NbX (b"i &cm &cv &cz &c (b" &d &d (" &>d &8d (" &]d &[d (" &pd &ld (" &d &d (". &d2 &d@ &dD &dM &dQ &dV ("_ &dc &dh]% (" &e &e &?e &;e &[e &Ue (" (" &e &|e ("! &e% &e3= ("J &eN &eS ("a &ee &erĝ| (# &e &e &e &e &f & f (# &*f &"fϝ],6VK%XnT` (# &Wf &Sf &yf &sf &f &f (#"/d>Vڏk: (0# &f &f &,g &g  (0# &g &g  &)h$ &h- &h1 &vh: &h> &hG &[iK &AiT^ (a#o &is &ix (a# &i &i ({# &i &i ({# &j &j: (# &;j &1j &qj &gj (# &j &j &Nk! &@k* &k. &k7 &l; &lD &NlH &BlZ (#g (#t~ (# &l &l (# &l &l ( $ &l &l ( $ &l &l ($  &l &l &m &l' &m+ &m4 &/m8 &-m= ($F &@mJ &Vԡgn` (j% &Xu &Vu &iu &gu &zu &xu (j% &u &u +]5OȠY (}%j &un &uw &u{ &u &u &u (}%2̞-7 (%H &*vL & vU &vY &v^ (%g &wk &|wt &dxx &Jx &x &x &=y &y &y &y (% &z &z (% &z &z' (& &z &z (& &z &z&O0 (!&A &{E &{S &{W &{` &${d &"{i (!&r &7{v &1{{Z]p (4& &q{ &[{ &{ &{ (4& &c| &=| &|  &| &W} &=}! &}% &}. &C~2 &-~; (t&H (&U%_ (&p &~t &~y (& &~ &~- (' &~ &~ (' &~ &~ ("' &  & ("' &) &' (<') &<- &82 (<'@ &VD &RQi[ (N'l &rp &p~ & & & & (N' & &t]Щ (a' &  & & &% &) &. (a'7 &; &@۩a]k ?HYv8 H ir,A0c_x:XiK 77٪H Xpb (t's &Rw &F & & (t' & &Ҁ &e &O &ہ & &ւ & (' & & (' &ƃ &ă ߗ ('  &ك$ &Ճ) ('7 &; &HhR ('c &g & u & y & &3 &/ (' &O &Im] (' (C( (( &} &w" ((+ &/ &=G ((T &X &] ((k &Ʉo &ń| (( & & (( & & (( & & (( &5 &1 (( &Q &O' &b+ &`4 &u8 &q= ((F &J &Or]|R (( & & &̅ &ʅ &߅ &ۅ (( & &b]}.C w:^ x ڛ$5 g8|p  F !Û6 \q`  Q  ` >O P    () &. &* &P &J &o &k  ()="1bFVk (*) & & & & (G) & &ކ & &  &< &6 (G)!.BL (g)] &`a &\j &n &}s (g)| & & &҇ &ʇ & & &$ & #4E2BMZYo0ybnw  (z) &Q! &M* &u. &m3 (z)< &@ &IS ()d &Ԉh &Јq &u &~ &+ &# ()  () &R  &N &q &m ()* &. &7 &Չ; &щD &H &Q &U &^khk &J &H &[ &Y &o &m & &} & &6 [+<gQ[p pGU Hl& ()7 &; &D &ՊH &ˊM ()Z &^ & g &9k &-t &wx &o & & %/R@Qfv0Q`b ()  &  &  &  &$  ()1  &<5  &8>  &_B  &SK  &O  &X  &Č\  &a |v         ( = M b 0l      (  ()  &  &  &  &  ()  &B  &< 4  @" , ID UY c ^| j 8 v       h* = lG  (*X  &o\  &ie  &i  &n  (*{  &ʍ  &  &  &   &?  &9  &n  &f  &  &   &Վ  &ӎ  &  &    &$  &-  &&1  &$:  &:>  &8G  &JK  &HT  &[X  &Y^ v       %s:J_o%/ (.*@ &kD &iM &~Q &|V (.*c &g &y (D* & & & & &ŏ &Ï (D* (T* &֏  &ԏ & & &# &( (T*2Zd (d*u & y & & & &7 &5 (d*) N "_Gn\ f{@gp (w* &J  &D &{ &q (w*$ &( &-BL ak )58AJV&0_I^hh{ (* &ΐ &Ȑ & & (* &' & &h &` & & & & & & (* &#  &! &6 &0"/,/I &XM &VV &iZ &gc &}g &{p &t &} & & 4D7Y cdxppH#9F[k;| (+ & & & & &  & ) $*GXe $t (+ &, & & & & &ؓbb & &j (+)3 (+D &)H &#Q[ (+m &Qq &Kv@6Q @8 &y< &sE &I &SSq *iu *i{ *a *o_ * * *kN *) *[ * %  *+ +  +~  )_ *6 *} *H{ *d *NK *>8 * *: *mT *T# *m:2 *@ *N *M\ *z[j *Wx *d *Z *. *OD *t *$ *O *ct *Z  *a  *7$  *4T3  *aB  *$VQ  *i`  *^o  *TR~  *1  *F  *$E  *4  *|  *e  *}r  *!! *#! *$! *gH3! *LB! *Q! *>$`! *Oo! *2~! *0r! *v! *<! *HW! *o|! *O! *k! *e! *%" *" *2#" *}2" *_A" *5P" *f*_" *Zn" *)}" *&" *0" *=" *;" *u" *c" *n" *g" *\R# *\P# *yF"# * p1# *SA# *EM# *{o# *u# * ^# *r# *1# *p# *i $ *b;$ *{oh$ *uu$ *B<% *JI[% *{% *4L% *9*% *F% *F% *1% *@*$& *F3& *$?& *VK& *3'Y& *3'h& *& *^V& *(& *& *!& *Z& *1& *c' *F\' *%' *w;*' *N`J' *T' *@a' *wtu' *X' *R' *=T' *w>' *f' *{' *^l' *1( *!+( *[( *z,( *d:( *GH( *yV( *ud( *r( *%( *o( *-j( *$( *Mr( *;\( *k( *|( *_( *s( *]8 ) *() *x{S) *j]b) * !q) *) *W) *I") *B) *W) *B) *) *u@) *;) *G * *u* *dV'* *"&6* *9E* *GT* *uc* *Ur* *5* ** ** *3* *|* *{* *U* *G* *#t* *CO+ * /+ *F[&+ *t]5+ *ID+ *WS+ *(b+ *Mq+ * + *s+ *'+ **+ *lv+ *c+ *fN+ *}+ *2, *{, *P%, *@#4, *sC, *czS, *Xc, *5ms, *", *', *Z, *3v, *p, *Wm, *"8, *Dm, *+f- * - *7#- *s3- *#C- */S- *}b- *]- *5- *- *j- * F- *a[- *- *w^- *V- *k. *^b. *>%. *4. *[C. *lR. *a. *PQp. *H. *#. *|;. *8. *aX. *. * N. *&. *o. *Y/ *Bi/ *L^$/ *a3/ *SC/ *oR/ *ESa/ * %p/ *Sf/ *'A/ *Fw/ *}/ *}/ */ * ?/ */ *@"0 *]e0 *!+#0 **20 *BA0 *^P0 *c_0 *c}n0 *0}0 *10 *[$0 *7|0 *p0 *240 *00 *v0 *Gn0 *)k1 *N1 *Z"1 *Px11 *"@1 *%!O1 *9^1 *\m1 *X|1 *"1 *41 *Q!1 *71 *1 *1 *)1 *L1 *jY2 *~2 *@c!2 *Q02 *r?2 *KPN2 *ZO]2 *Jl2 *Q0{2 *+E2 *+*2 *a2 *<2 * y2 *aa2 *M2 *tQ2 *W3 *gZ3 *# 3 * q/3 *@>3 *]M3 *rI\3 *!Pk3 *z3 *U3 *c3 *h3 *|d3 *ZL3 *g3 *cn3 *43 *4 *0G4 *i 4 *YJ/4 *>4 *pM4 *4\4 *0*k4 *Ez4 *44 *;`4 *e4 *wx4 *Q34 *[4 *<{4 *Q4 *+V5 *05 *I 5 *x/5 *I>5 *PwM5 *G\5 *nk5 *Hbz5 *k'5 *a5 *Y"5 *H95 *]`5 *<5 *+5 * i5 *F6 *86 *6 *6.6 *p=6 *eL6 *PLk6 *6Jz6 *]6 *U6 *g 6 *G6 *.q6 *}6 *U6 *(6 *z7 *:7 *i7 *4.7 *o>7 *N7 *hg^7 *0on7 *'}7 *oM7 *o!7 *87 *)7 *&7 *Ef7 * ~8 *V"8 *08 *I>8 *\L8 *dZ8 *h8 *48 *i8 *c8 *C8 *w8 *8 *e8 *o8 *<8 *V9 *D+9 *gC>9 *N=T9 *Jn9 *@s9 *=9 *(9 *!9 *O9 *89 *G9 *pa9 *z9 *3: *3: *Q$: *C2: *h@: *nN: *e\: *oj: *: *v: *c}: *N<: *[: *u6: *K\ ; *]; *o4>; *L!P; *s_c; *)q; *T^}; *gX; *Xx; *; *O; *5b; *:; *G; *tV; *2; *U; *2`< *mF< *("< *G1/< *<< *WJ< *Kf< *{t< *o< *e< *.< *P< *W|< **@< *0< *A< *y< *g(= *p= *H= *I(.= *K= *b\= *gb= *93h= *Yn= *Cu= *W= *j= *4= *d= *wE= *)= *q= *#r= *J&> *^> *_)> *?I> *aRV> *}> *b1> *t> *~> *{`> *_> *> *> *Cl> *1? *3? *+? **? *48? *(bF? *AT? *a{b? *Xp? *sf~? **? * D? *U? *"B? *J? *w? *hs? *M? *B? *cu @ *q@ * @&@ *F4@ *{B@ *7nP@ *j9^@ */s@ *0@ *7@@ *@ *e@ *@ *~&@ *[W@ *1@ *{@ *% A * A *J'A *{KA *$I\A *hA *nuA *MA *+A *![A *NA *IA *YA *A *oDB *SQB *uB *0B *C *|_C *lC *IyC *SC *}C *cC *.I1D *S>D *pKD *lpXD *GeD *F~D *!1D *0D *D *7D *WD *T8D *IE *E *u"E *t1E *PE *C`E *[_mE *?{E *E *ACE *RE *|E *QE *QE *WE *1 F *vF *l*F *~*:F *]JF *ZF *[DhF *aBvF *8fF *oF *`F **uF *|F *f%F *<F *G>F *n G *DG *)&G *QiG */nG *CxG *eKG *<G *G *?G *dG *05G *F\G *MG *U`G *( H *0GH *GCXH *v^H *dH *EtH *')H *H *{SH *HrH *<H *2H *eLH *OH *19 I *x%I *r2I *1EI *&\I *>iI *pvI *dI *19I *xI *5I *PI *[I *I *]I *|J *z)J *6J *CJ *u^J *oJ *,AuJ *^'{J *QhJ *(J *PJ *=J *xhJ *(1J *RJ *jJ *6)J *H4J *[J *}eK *=K *[%-K *G;K **'GK *XVTK *~aK *){K *UZK *EK *sK *lK *R#K **K *UCK *PK *pjK *YcL **L *B| L *Yc-L *z;L *bIHL * 8VL *&dL *RqL *YcL *7L *e>L *tL *_ZL * 8L *L *yL *)L *L *_QL *D!M *I-M *::M *#GM *_TM *rnM *E{M *mM *nxM *@JM *rM *%xM *&M *yM *M *v N *s{N *Ft&N *Ab4N *#GN *gCeN *dqN *:~~N *N *4N *BN *yN *UN *PwN *|N *+N *Hr)O *E5O *#^AO *VRO *D^O *BoO *p|O *hO *aO *1O *'O *SO *>6O *zO *9wO *C P *'P *S&P *9w=P *'JP *SWP *dP *- qP *QoP *1P *iP *SP *'P *a(P *'P *=OP *kQ *'cQ *&Q *92Q *H>Q *`WTQ *sqQ *GQ *'4Q *=Q *ubQ *Q *tQ *0Q *IQ *YGR *R *h&(R *nt5R *BR *OR *0]R **qR **}R *JR *VR *R *!+R *;R *3R *plR *${R *1;R *K S *0[S *n%S *@J?S *]MS *ZS *DhS *&DuS *(S *@JS *QS *S *FS *NS *MlS *wS *RS *9S *6]T *]T * T *0D-T * w;T *ZHT *68UT *{cT *apT *G}T * VT *eqT *ST *VT *XVT *QT *pT *.T *cU *5U *U *k,U *4VU *cU *'qU *}U *V?U *U *$U *[U *U *0(U *U *UU * mV *|5V *oAV *8OV *H]V *#kV *UzV *{$V *vV *@V *bpV *elV *}V *aXV *V *HV *V *HV *# W *|;W *s)W *z7W *HEW *lSW *pdbW *|pW *X~W *u2W *=^W *P+W *KW *8SW *9W *3W *SW */ZW *B X *JX *KB)X *?7X *PEX *VSX *2aX *w}oX *uX}X *6iX *6X *\ *L\ *Cz\\ *r8l\ *6|\ *@\ *j]\ *|\ *X\ *^4\ *hh\ *R(\ *62] * ] *"] *7L] *Z] *Xg] *zt] *m] *=F] *B] *] *0!] *'~] *] *^ *F\^ *PL!^ * !0^ * HT^ *`^^ *'l^ *")z^ *C^ *=q^ *y^ *q^ *e^ *#^ *!^ *R^ *N^ *_ *_ *@"_ *m0_ *2p>_ *Ce^_ *+k_ *.x_ *U_ *(_ *'_ *d_ *d_ *_ *` *g` *e#` * %0` *uW` *Ujd` *yq` *e~` *Gv` *~U` *3` */` *sC` *` *E` *F` *z` *va *k` a *?a *H'a *4a *}Aa *ByNa *d[a *Jha *oa *ua *Za *a *Bya *}a *\db *<"b *\/b *Rf *nf *lCf *Uf * g *0g *b&g *g9g *Hg *NMRg *a+\g *&6jg *xg *}g *?g *Rg *g *@g *g */g *4N h *E+h *ph *)h *nB6h *Ch *swPh *R7dh *qh *~h *Mh *3h *Lh *jh *0{h *zh *)h *h *c7h *'Qh *i *Di * li *?+i *8i *LEi *@5Ri *x_i *n5li *Xiyi *2i *"i *i *_i *bi *Pi *xi *{i **zi *s j * Zj *lm%j *=v2j *-Aj *rNj *Mhj *Juj *;j *vj *dxj *;uj *6j *j *2_j *k *`k *!$k *:)k * S6k *PCk *s{Pk *P]k *jk *awk *Z]k *ek *Qk *Fk *02k *mfk *Tl *rl *lw l *T-l *\#:l * XGl *'yTl *al *nl *8Al *u%l *Ul *\Bl *Fl *{l *wgl *Dl *ql *>l *jm *5l&m *9d2m *7?m *LRm *kQ_m *b9rm *q0m *+m *~m *)m *UZm *;m *%m *YUm *9%n *%Fn *wSn **z`n *%xmn *{{n *VMn *Vn *Cn *?xn *yn *\Bn *Hn *, o *-No *Wo *G_eo *]kro *o *xo *Uo *&po *To *+%o *>o *m#o *Vo *2o *lp *dmAp *Np *U[p *yhp *tup *+%p *!p *Pp *Op *xyp *np *1+p *Wp *!wq * 8q *.q **q *p&7q *UDq *QQq *ib^q *Tkq *+%xq *S{q *@q * q *k3q *\q *pq *q *0eq *Y0q *q *)Y r *(r *V%r *VNr *jdr *6pr *r *)r *`r *zr *tr *`r *\r *`r *b s *ros *M$s *$iKs * tZs *Z3gs *ts *Es *Os *Cs *7s *Ys *s *hs *Ls *Jis *cs *Ws *wzs * xs *s *n t *9t *9+t *:8t *>Pt **#^t *t *t * xt *{t *yt **st *!|t *Kt *F\t * 3 u *u *G`Cu **Pu *ee^u *eehu *uu *Uu *+u *u *cGu *Cu *ou *$u *u *Uv */v *ov *e(v *<]5v *QuCv *]Mv *oZv **zgv *Qv *CRv *Bv *v *TRv *|v *v *av *7v *&v *Uw *jw *aw *T*w *[7w *Dw *\w *(qw *c~w *Kmw *qw *>w *_w *]w *Px *zx *M3x *!;@x *Mx *p[x *1nx *sx *ox *Xox *4Bx *x *Fx *Ky *K%y *c3y *Kmiy *zvy *;5y *y *Py *_y *Ky *!y *Zy *(z *l%z *"3z *pAz *Oz *f]z *5kz *d/z *Vz *lz * "z *0z *hz *z *G:{ *qL{ *aY{ *'U@{ *VO{ *'js{ */~{ *o{ *{ *m{ *h${ *z{ *4${ *e{ *v{ *~v| *KX| *A| *X3| *QA| *:O| *Vl]| *iok| *d;y| *| *| *E| *h| *q| *M| *q| *U} *_!} *} *-} *$;} *3I} *Jb} *Yp} *id} *O} *d} *4} *j[} *z} * ~ *4 ~ *Hr<~ *#V~ *yo~ *}~ *,w~ *3w~ *b~ *7~ */~ *~ *~ *s *1 *f+ *t:9 *SG *dVU *c * 'q *V *{ *IG *Q_ *h\ *{ *cM *r *7# *fj *WY * *i)- *[/< *FK *5Z *^i *Hx *l6 *V *Au *À *xҀ *r *?n * *h *4 *BP, *s; *nJ *Y *"h *Vpw *~ *d *> *9 *w *mс * *Z *r **  *$ *A+ *s: *kI *^:X *gg *6 * *D *) *t?* *"A7 *cD *!Q *>We *r *9! * *e *a‡ *=Ї *SNއ ** *J *b *$ *A$ **2 *B@ *MT *Nb *4:p *m~ *Mc *t *. *[\ *Ĉ *҈ *> *J~ *X *?  *PJ *!& *Pz4 *RB *eP *."^ *l *D(z *l *g1 **\ *x *E‰ * nى *8 *$W *]> *wZ *~l$ *Zj: *|(I *qhY *Lao *jD~ *T *! *3C *XЊ *h݊ *i *:' *w* ** *W *+ *8 *(E *!bR *G_ *Fl *0y *^q *1O *Z *' *Uʋ *3؋ *` *,v *j *u *k *p(, *Y: *iH *@V *Ed *[r *i *{ *1 *\ *Q| *9ƌ *)Ԍ *)T **/ *CE *"f  *V *$G( *Z7 *%dF *U *\d *Zs *^ *P * *ar( * h7 *jF *U *7d *s *9 *-) *1 *B *. *f͎ * * *j  * *]) *s8 *C6G *;_\ *Gm *Bs *cPI *9V *c *~0p *`} *O *2 *L  *I *y4 *LA *>N *3w\ *i8i *Cov * */c *[ * *> *gё *eޑ * *<> *M *0 *<T *aa * 8n *{ *U *b5 *=U * *ɒ *Uג *% * *2e *HZq *Y* *y? *w *2h * *q *6 *@Ɠ **zԓ *H  *rO *U *  *!O *m *Va* *VD *uQ *L'h *wu * *a_ *@ *1ɔ *K֔ * *JF *Rq *F **z3 *`l *|y *;4 *V *M *b˕ *A4ו *Xn *@ * b *1 *K! *8 *tmT *lGb *GT{ * A *tp * *_ *L8 *OSΖ *ADۖ *C *u *fj *< *h* *o7 *uD *}:v *]S *` *U— *}ϗ *'3ܗ *c| *8 *(K ** *##" *z/ * 1< *{I *GV *c *_p *5} *J *b^ *tY *q *mŘ *T˘ * ј *)ט *;ݘ *] *Q *N *lu *'+ *W8 *2E *z'R *u_ *Al *Sz *L *& *K/ *)F *H *#ə *2Eי *M *v * *`  *F\ *R, *L9 *DF *((y *] *L * *Y *& *`̚ *3ٚ *rS *| *C *a *$) *}6 *j"C *0P *<7^ * * *c *c *Wg$ *n* *0 *Gy@ *\PN *y1Z *o\k *Pq *Jw *~ *S) *Z *G^ *5ȝ *fҝ *j *Z[ *s  *n *% *p2 *m? *cX *8e *[s *I *e *h *, *Lv *:͞ *!k۞ *~| *N *T *j *! */ *@L= *YK *OZ *9y} *o *,} *8 *8 *~N *u *~mğ *W˟ * *_ *pW *1& *|I3 *@ *T}M *eSZ *Zg */Wt *;I *UT *f *m *R> *}8à *myР *G;ݠ *: * *E@ *sq *G* *9P, *[: *DKH *4V *2Vd *s *x *h *8 *Q *vG *@ *$ *P/ *$J *+Hȡ *a֡ *K *6t *: *Y *_ *!* *' *P *" *9+ *  *hϢ *[ݢ *v *&X *q *Xz *(# *' *E? *ṣ *6ڣ *# *  * *M *`  *u. *O< *rJ *)MX *f *$t *M *KE *$C *m * *ɤ *Zsפ *[ *T *C *' *r+ *^: *JH *bV * Qu *v *} ** *B7 *q *usɥ *qץ *_ *D *j *  *: *0^, *&: *kH *rV *Gd *sPr *\ *s *^he *Ks * *J * *0 *g *M *q"C *B%Q *m;_ *zm *@B{ *a *;V *\ * *Mq *dϨ *)ݨ *'h *l *H *SF *R# *%1 *!? *WM *[ *3 *zB *^A *'ǫ *\ԫ *M *1& *m *3 *.yL *)Y *Vf *is *fW *m^ * @ * *C *e *" ά *Hܬ *5 *p *j *3 *,g" *^0 *> *AL *9sZ *,$h *sv *i *0 *4 *RA * *Stʭ *$ح *" *r *  *v *u! *P&+ *y)5 * ? *<M *o[ *Uw * *e * f *{_ *̮ *Qڮ *5c *E *!H *Z *}* *#\B *k}P *\] *j *? *e *H} *$ *9 *q *y *Os̯ *Dmگ *% * *C *B* *)8 *(F *.yT *2b *!p *_~ *ZE *Tv *[t *] *Eİ *#Ұ *&` *o *!v */  * *uH& *T'4 *YB *N1P *^ *4 l *Iz *+x *E *?h *6ӱ *g *f * *1X  * ** *AH *6 *6 *9 *dA *7} *lO *N *@ *t *rR  *0ظ *h *^ *_> *^O *U *[ *y *% *_ *"L1 *o> *MK *%xX * Fe *:r *< *q */ *N *"Ż *8Ի *j *i */ *< *F\# *M/ *Re; *!G *OS *` *)m *zz *9 *Y1 *{b *2 *E *Mkȼ *Hռ *a[ *U *I *3 *a" *z/ *+< *mI * FV *M{ *@ * *s{ *s *p *fE *a{ *Q *k# *N1 *a{? *sfM *"7[ *Gi *xjw *JU * *f * * *˾ *Aپ *_ *t *,g *I* *'m4 *AM *oZ *tg *su *XV *T *_K * *_ *fɿ *N?ٿ *(+ *3 *>X  *uW * C *b *$* *17 *lD *:&Q *^ *yk *p * *+a *M *s{ *Q$ *  * *I *Q$ *z2 *4$@ *N *A\ *j *Jx *_ *A *p *t/ *o7 *:D *Q *J^ **k */~ *C *sf *p * *6K *_ *>O *Y2\ * xi *hfv *! *~E *3 *Ab *M *4 *# *M *< *. *2 *+d? *xL *}d *H~ *x *1 * * 8 *u *[W  *sF *=$ *? 1 *'?> *Lga *Fn ** *$ *v *S *5 *I *t/ *o *m *yl *b1 *Od *N *A *& *& *V; * 8 *= *LT *Ca  *J *} *^v *M$ *5?* *0 *{L7 *KE *)S *q)a * Uo *Q *_w * v *x! */z * *#9 * *O5 *lD *gw *w d *{ { *~O r *  9 *   *5   *J! * *_5 U> *x4I R *] f *=q z *R q  *g 8  *|  *  *  * T  *   *H  *% . *{9 p B *M 7 V *6a j *u ~ *  * S  *   *  *  *W6 o  *; 6  *;  *;) 2 *&= F *<Q RZ *$<e n *9<y  *8j  *]< n *r< 5 *<  *8k  *=  *$= Q *9= " *mk- 6 *X=A J *m=U m^ *=i 4r *k}  *=  *>  *'> P *)R - *ne *1 %  ** +I +" )b  *' *%3 *w: *|? *8M *܄T *+[ *8g *ҁu *n| *& * * * * *ք * * * * *~ *   *8 *# *) *Ʉ/ *5 *< *I *ɅV *c *p *=} * *  * *ɀ *C * * * * *h *  *e *ʼn& *3 *w~? *K *zW *~d *Np *h| *R~ * *  *~ * * *\ *  * *   *c * * *K! *3' *A- *3 *9 *؁@ *ϊQ *\W *Z] *c *i *\o *u *=| *G * * * *g *. * * * * *k *o *= *E *: * * * *t  *O& *܃- *9 *G *ӃS */_ *l *V} *~ * * * * * *~ *( * * *Ä *~ * *5&5 *Ä? *~J *[ *>g *y  *O \4(Z(i )x ) ) ) ) ) ) )jj;bjjltk&Fm6jJk^krkkkl1l$1l3mBmYm!!!/50hM"#1!m!p"2"$Z&:&!.6M.e9)|p"p"p"t"t"p#p# p#& %M $\ -$k 4$z I$ j$ x$ $ % %  & & % %, %> %M &\ )'n )' )' )' p( l( ( l( ( ( ( )) )8 )K )n |* ) ) ) 6* 6*+ D*7 F*H F*\ F*k Y*z Y*  Y* Y*  Y* * * * * * *7 *R +z K+ + + =, J, J,l,t,-,Ck1e,,|,12m33,>2b,,2,2T3T3T3<m4^8-o8-8-8-p-p-p-p- -#-3-F,i1|1122224,4e444444(5(5 (5-(5NM5_M5M5M555555+5=5N5a|.}|.77777.#.-.8 E.P#].n6z66666*6,6,6u6 66/6J6b6v766667j7j7`j7j73j7T8e8p`}888888/"/4/H/e*/yB/>/`>/////00!020K0_0xYYYYpU# SUU mVW*9;VIBYYkWhU|UUUVV  )VP lVVVV   1W-1W<wWKW_Wj#yWWWWWWW#W,W@WSX`zX&X&X&X 5 W s : i i  $&!58!:N!:_!Rz!!z!$!&!9'<"'Y"'k"'|"'"M'"M'"M'#M'#'8#'Y#'j#'}#'#'#'#'#$%$V$$$$ %M>%M%_% s%Z%%%%%&,&B&Q&c&w&&&@&@&R&@'@'R,'q;'qM'a'v'`'`'t'`'`(t(((;(`.\({.q({.(.(.(.(.(.(.(.).)..).K)`E{)`E)`E)E)E*EA*Dd*Dz*D* E*E*E*E*E*E*E*E+E"+@6C+ V+`6j+ }+f6+ +f6+ +0;",L 3,L;?,d V,V;z,d ,;,;,;-L -;;-;f-s<u-s<-<-{<- -.-.p7c. .7. .7/ /18>/7_/7/ /7/7/7/ 0R9<0öY0R9h00ö0R90ö1R9$131E1=T1Hc1Hr1H1H1H1H1H1H1, 212?,421G2d,b2,t2,2 +24+24+24+2C+3E+3E+23-_3at3-3a3-3a30F3y "4BFF4y n4OF4y 4\F4y 4\F4 50F.5y O5Fc5Fw5F5-55-6-6-a6x6-6-666+677-797R7*w77+*77*7*7*8*8*38X8u8E888899ܫ29G9aj9{9a99999:%:=A:V:={::C:E:K::K::;;!;8;G;V;e;ft;f;;;;;;;;;<1<S< << << < = .= G=. X= j= z= = = = = = = >w >w .>w @>w P>w b>w r> > > >+ >- >- >8 >: ?: ?M %?M 6?[ B?] S?] b? q? ? ? ? ? ? ? ? ?f @f =@B}@` @TB@` @TB(A` AAAB]A7BzA` A7BA` A?BAABABABBBBB,BB;BBJBBYBBjBBB(CB*CB*CBWCBWCBbCBdCBdCCCCC'CC3CCDCC_CP)CCP)CC)C) D)D)(D)7D)FD)UD)fD)D`?Dr?D}?D}?-E`?YE}?oE?E?E?E?E?F?%F?4F?OFP4FFe4FFe4FG4RGMwG G-MG GBMG GBMG GBMH HBM!H 3HBMAH SHBMaH qHBMHBMHBMHBMHBMH`NH IN(I =INbI xINI INI ININININJN*JN=JNJJ fJPOJ" JoOJ" JvOJ" K}O'K" 8KOFK" VKOfKOwKOKOKOKOKOK" KK"L GLKlL LKL LKL MK6M YMK~M MKMKMKMKNK>NI eNKNI NFLNFLNFLNFLNp O 'O@HO[\O^}OeOeO O O O O P 4P? CP? RP? aP? PPtP܃Pt%Q"QtQ&=RWRthRRRtRRR-St@SOS"dS-SStSStT*TAKTنZToTT|TTT0T0U0U0&U0=UGLUG[UNjUNyUSUSUSUSUSUSUSVV8VJV[VkV|VV V V V V VZVZWZ2WZIWxXWxiWWWWWWWXX/Xą>X҅MX%cXMXMXMXMXbXbXiYiYp3YpKYp\YpvYpYpYpY Y Y Z Z &Z 5Z'DZ'SZ.dZ.|Z.Z.Z.Z.Z.ZZZ ["[1[@[ćO[ć`[ˇo[ˇ~[ˇ[ˇ[ˇ[ˇ[ˇ[ H\ \;H-\ >\gHX\gHv\gH\gH\gH\ \oH\oH]oH5]oH[]oH] ]oH] ]I]I]I^I^)^ J^Qo^ ^Q^ ^Q^ ^R^(R_cR%_cRA_cR[_cRy_cR_ _vR_vR_vR`vR:`vR_` w`vR` `R`R`R`RaG,a ?aGUa faGGaGGaGGaGGaGGa bOG%bOG?bOG]bOGbOGb bOGb bGcGcG.cGEcQc pcʯc cۯc c9 dO do >do ^d0nddQnddendeCpEepke;oemnenenenfn9f"pHfnYfnxfnfnfofnf[ofnf[ofngxogn3gpoYgxoegnxgpogngog5gog5gog5 ho$ho0h5Ehohoh5hyphypiyp%iypUiypuiipipip jp0jpYjqjpjjEqjEqjEqjEq k 'k IkDXkcmk?kbkkbkl#b>lXl#blll#bl9bmmc'mMb3mcBmMbSmbpmbmbmmbmbmbnnb!nb2nbBnbRnbbnbsnbncncncncnco,ocGoYochocwococo@hoyoah pyph1pyRpyhphpypiphq.i!q.i0q.i?qMiNqMi]qMinqMiqgiqgiqniqiqjqjqj rj%rj;rjLrjerj|rHjrHjr@r r3@s ss@AsH@fsH@s@s@s@s@s@s@s@t@t@!t@uPw v>:vPwv>vw w>8wxw>wqx}x>xwyo3yydyX{ywyxyx+z>Fzx{z>zxz>zx{>&{{6{{H{{`{5|p{:|{x{{{x{{{x{{{x{{|x|{|}0|}A|}T|wx|w|w|w|w|w|w|w}w}w }x=}x[}xj}2xy}Ax}Ax}Ax}Ax}Ux}Ux}x}x~x~PZ ~y1~)y=~7}L~ny[~yp~y~y~|$_|P|tyyyyFyxyzzd{zDd{hzzÁzׁzz<zMze5zt5z5z5z5z5zׂ5zxzz;zuzz{{zʃy}ك}}c~ z~-z~S~v~~~ׄ~~~B~\k{%%%%%Dž%م%K'PZZ,ZNZZZZZLJZևZZZZZ!Z2ZI [] [l\\,[@[ψP[5P[W[ p[!Sp[$js[Ό|[[X[[=)[[ʎ[ߎ[ \ X]\*\9\H\W\f\u\\\{]_]I]x]]I]]]]_I^БI^p^p^^^&q_5_D_Sd_d`~````,`=`N`a```ɓ`ړ``a\ama~aaaєaa aa,a>aVag'a.a@b dd.k:mKmZ~m~~ġ #2C`*p*8:rrҢ)Nqͣ?)h0ۤ)7#5K:Z:i:z:QQmҥP ! P !7P\ !k~ !԰PצP !!0AXgv  Чߧ  4 V qߨqAtKdqqʩqAs'qBqh}NstǪ[r۪q r?rKr\rmIrrrrrΫrsss5sFs`sxsss¬׬At Ht*Jb|ʭڭ8: h8 خv98 '9H8x 8ѯ 9%9%%9@9T9q@> Űa>۰ >v>>!>0>?>N>]>l>{>>>cPd:cpcd(dҲ>dI>d8(dhdIdճddOkeeeeҴeeee:eNaPdд5!ص5!$\5!5!Ӷ, ,M.B] ÷ݷE 7.KEbELLո .BWEйeEK0v?N]q66KKӺKKK-KZp33ӻ   3 N _!z!!  ϼ !D!!!!%!7!F!X!g!y!!!!ڽ$Lr׾ -N}A5ʿ5ۿpp060V00IfI 6IJ^u.Lh&&`$`D`r`yyy:yNb}GqGgGGUMi}0000MIkfIII -J@PaR {@PR @PR @P5R K@PbR |@PR @PR @PR <WPR PPR PNR qPR PR PR ?PoR PPPPPPPPP#P2PBPQPaPpPP$Q$QQs ';Ovp;;8";`;s;/OAAA A/AUAANAAAA*A<ATAaNpaaq;q!;Ma;?q*;\q;q;On>w=?== @&=I=pq;>h x         ; ,>0 ;Q D;d D;z D; D; D;  D; D; D; D;  D; D;; D;F S D;c D;w D; ; ; ; ; <+ ;U ;r ; ; < ; ; < < < <6 <H <] <u '= '= '= '= '= '= '= '= l=>0>FB>YB>h>}>????0?X? AS S+S;SNoSvSSSXSSST-,TI,T_jTrjTTTTTTTTTT!T2TCTZTkT|TTTUU  7 \~44t<d.dLm1L~{#3BS_pFFaaooyy.@Oap   "9Ly99 9!G9eyrr9 F 9x  9  9 !92!F!bZ!bi!x!!P!:!x ":""xI":Z"r"""""""##4#E#_#w####:## $@$@+$@:$@I$@X$@g$@v$@$@$k$k$$:%(%F%:a%|%%%%%%%%&:&:;&:T&6c&6x&&& & & && ''.'0>'0O'0n'''ֈ''ֈ(&(5(D(U(l({((((0(0(0(0)0*)0;)0[)0|)))))ɉ))ɉ**(*7*$F*$U*$f*$}*4*4*`*`*h*h*h*h+h+h++hF+k++++++++,&,05,0D,7S,7b,?q,?,?,?,?,?,?,p,y - -/->-O-^-o-~--------).a..).).).)/)"/)3/)D/)V/ur/u/u/u/u/u/u00&070G0W0g0x0Ƃ0Ƃ0Ƃ0Ƃ0Ƃ0Ƃ0Ƃ0Ƃ01"121C1T1+g1+1+1+1+1p 2pD2pn22p2P 3P3P3`3`(4D4b4444444515M5g5w55 5 5 5 5 5 5 6 6i 46i H6 Y6 z6 6 6 6 62 62 6G 6G 7G 7G *7<W7<z7<7=7=7:=7R=7 8@3O8@38@38@38[38y38y3 9y39y359y3D9y3U9y3n9y3939393:4:43:'4B:'4[:$x: :%:%:$;4'; %6;%K;(%u;+%;+%;+%;+%;B%;B%;$;%<%$</F<0a</r</<0<@/<X/</</</ =/=/*=/9=/H=/Y=/v====>V&>V5>mF>mU>{d>{u>>>>>(>m(?(5?(V?(o?5(~??(??(??(??(?P(?P(?m(?m(? @0@02@WV@Wj@Wz@W@@@@@A)AIA`A=qA$A,A$A$A$A$A$A$B$ B,3BUBwBBp Bp Bp B} C} *C} BC} YCjCyCCCCCCCPD#DP/DLDP_DvDhDD^D^DDmEEm)E8EIE[ErE@EE]EEEE F F3FBFYFF5F7FNFPFP G3GGG@ dG@ G@ G@ GPGP HP'HPRHPH!H^H!H^I"7IL"iIvI|"I|"IL"HJveJe#{JvJl"J"J"J"J"J"K"K+#%K#6K#EK#VK#mK#~K$K$KH$K@&KmLr&>LmUL@&uLLX&L&L&L&L L L&L&M&fV>f2V>fCV>f\V>ftV>fV>fV>fV|fVfVfVfVfWf%Wf6WfPWfiWfWfWfWfWfXfXf.Xf=XfOXfdXHgXOgXVgX~gX~gYhYh'Yg6YgEYgTYgcYgrYgYgYgYgYtYt0Z9u@Z9uPZ9umZ>uZ>uZkuZku[ku![ku>[ku[[kuv[ku[ku[ku[ku[}u[}u\u9\uV\uu\u\u\u\u\u\u]uB]ub]u]v]u]u]$v]$v]$v^$v@^W^^_`7``a5aHaΌbaΌ~acacacacawbwJbwb|b}bbb#c#c#'c#Ocscccbcbd|?d^dCqdddddde!e1e@e\eee eeeĝeĝfĝ+fĝXfZzfZf`f-gg*hhޑh\iii՞ijyyyhzzz=z'z'{O{O%{O8{Or{{{0|d||X}}D~~%~~-~- *=WsiiiiЩЩЩЩS)p)f*܁)ׂ))ǃEڃ))h!h4hPh~ʄ 6RcvRͅRRR/ Q p =aӇ  %RvՈ,S r g։gV2kKk\kg $Lpkkkl֊l|:xlbb=r`||Ōb((C(pllˍ@oV֎'2 $ ;K\lƏ׏ 8K|ϐ(*i*V*$ 7 Y/j/u $~///Pגk -R..Zb*Rz@@ $ 0@P`p $ $  0CSc3si@  00)?9IYl}|  2    M  f (i8HX3k[{ d$p &*:J Zjz2p\cP&1<mGWg@q|7gP  !'!2^>"N"^#n$~$ $ % %%%@&m&&!&0m;'NM'd'w'((.(5(5(5()))"P)-8)H)X)h*s~**+,1-a-...$.4/D/T/d/t0000000 1 k1* 1< 1N 1^ h2t 2 2 j3 j3 j3 3 P4   @6   p7  * 7: 8E  P 8b %9u 9  :  : : : 0; L ; L  *<% <; <T :=d R=w = | = | = @>  o> > > > i? ?1 ?D ?T ?d @o  z H@ H@ @ @ @ @ iA A A A A* B5 ` @ BP B` Bp EC C  E  E  E E 0F y 9F F G #-G7 G-G[ kGu  H MH MH I JAJAJ$AJ4JDJTKg3KzGKK KFL Lb M BMBM$M. 9`ND ON_NoNPO" OOO@PR PR P$Q-WQ=QMQ]Qh s(R (RR 0S S,TjTT$T4TDpUO [UlBV|UVV VV1W WW*W:XEU&X_jIYzYYPZZZZ ['[P[ ,[Wc[s`]\\\{]p^^``%`8aKa]'agaq|b.bMbububbbc c#.(dCNdcseeePdf/f/f/fmff,Hg>gN@hYydhth i iiiijj{kkk4?kVlm1l}Mm0nmnmnmnnnn [oqo*55CpS^CptEq~qqrrss st,73t\tr9u>ukuku}uuuuu v1Pw<>Gzw\wlxx'x9x9x9xxxx{ |()yDyhyx|y>L{V{yXz zz1xzCzVy}fc~vz~>~>~~~K1nAQaq6K)Ƃ+t  *:JZ:jA}AAipԆن _ w- |= M X c s  ! ! ! m     !!*!:!J!Z!j!u!!!!Ό!A!g "|&"8"K"c"b""""ޏ""##`1#b#|###Y## $$-$F$V$f$$4$$ן$ %΢%Q6%H%X%bk%v~%Ƞ%%%&'"&-5&i&u&&&&&ݖ'-#'='O'Bb'u')'')')'4'-(D(*r((ݘ((((m(+) +)H)h){))))`)V)(*\/*E*U*e*x******K**a+ܫ+&+6+F+Y+o+=++++P+++.+m++ ,o ,p&, 1,;, F,P, [,Pf, !q,ڱ,,,,,,e,l,--'-{7-дB-5!M-,]-m- }-!-Y"-M#-T#-#-$- $ .$$.^$4.$G.$Z.%j.%.%. &.%.&.)'.).*.F*/+/+'/=,7/=,G/=,W/=,g/J,z/,/,/2/8-/-/1/1/2 040410(5A0M5Q05d0|.v070.06060^7080/0/0/ 1010*10:1E1R9P1=c1=v1=1[11911r11911922b 2*2952F2V2Bf2ںv22N2ջ2I22022R213m3'373FG3R39]3z393333 3E3M4M4M'4M=4+P4+c4+s4+444\44j44*455e.5>5N5^5`i5-:t55?5H5e5j55575-:66"626B6R6b6r66P6:6666666 770-7k=7kM7\7:g7w7767:7p7;7y7777 8A!8;,8AB8;M8Ac8;n8A8;8A8;8a8q8;88 9;9D;99D;I9D;\9D;l9H;9H;9;9;9;9o<9o<:q<;:q<Y:<x:~<:>:B>:>:?:?:A ;0A';7;.N;.e;ix;;;;;;;;;" +:& +a* +n. +2 +6 +: +> +B +F + J +N +-R +HV +^a +uf +{k +p +u +z + + + + + + + + + + + +& +0 +> +G +S +[ +b +n +v +} + + + + + + + +  + + + +  +$ +) +&. +13 +?8 +G= +OB +WG +kL +uQ +{V +[ +` +e +j +o +t +y +~ + + + + +! +1 +F +X +a +q + + + + + + + + + + + + + + + + +" +0  +8 +D +U +d +k# +v( +- +2 +7 +< +A +F +K +P +U +Z +_ +d +i + n +s +x +-} +@ +P +_ +m +} + + + + + + + + + + +  +5 +J +Q +` +f +m +s +| + + + +  + + + + +" +' +, +1 +6 +; +"@ +)E +4J +>O +OT +UY +\^ +gc +th +}m +r +w +| + + + + + + + + +  +  +  +/  +9  +D  +N  +V  +_  +e  +q  +z  +  +  +  +  +  +  +  +  +  +  +  +  + ! + & + + + 0 +( 5 +1 : += ? +M D +W I +b N +l S +u X +} ] + b + g + l + q + v + { +  +  +  +  +  +  +  +  +!  +4  +?  +F  +U  +d  +s  __ + _ + _ + _ + _ +! _ +6 _ +F _ +] _ +t _ + _ + _ + _ + _ + _ + _ + ` + ` + ` + ` + ` + ` + "` + '` +# ,` +, 1` +8 6` +K ;` +[ @` +f E` +s J` + O` + T` + Y` + ^` + c` + h` + m` + r` + w` +|` +` + ` +.` +4` +H` +V` +^` +i` +q` +y` +` +` +` +` +` +` +` +` +` +` +` +` +` +#` +2` +E` +Ua +da +r a +a +a +a +!a +&a ++a +0a +5a +:a + ?a +Da +%Ia +:Na +OSa +VXa +f]a +uba +{ga +la +qa +va +{a +a +a +a +a +a +a +a +a +a +a +a +a +a +1a +=a +Ma +Xa +_a +ia +za +a +a +a +a +a +a +b +b + b +b +b +b + b +%b +*b +/b +4b +&9b +->b +7Cb +BHb +QMb +`Rb +gWb +p\b +ab +fb +kb +pb +ub +zb +b +b +b +b +b +b +b +b +b +b +ab +b +b +b +b +b +b +b +b +#b +.c +6c +A c +Kc +Vc +^c +i!c +q&c +x+c +0c +5c +:c +?c +Dc +Ic +Nc +Sc +Xc +]c +bc +gc + . 4 .8l .p . . .`  .< .@ T .Xl .p  . . . .p  .0$ .(< .@p . . . . Pt .xp  .  .$ .( < .@ d .h` . .D .H t .x . .$ .(\ .`0 . .` . t .x0 . .@$ .(T .XP . .p . l .p  .   .  . \ .` t .x  .  .  . P . , .0 \ .` m| . @ .  .  .  . t .x  .  . @  . P4 .8  l .p ! . ^ . $L .P  .@& .m .&4 .8(d .h( .P) .$ .(*T .Xt .x + .+ . ., . 1< .@-t .xa .- . .`., .0@/t .x/ .@0  .@3 .P4 . .@ . @6\ .`  .p7 .  .8 .  L .P9 .0; .L  .<L .P= .|  .@> . , .0`?l .p@ .  .@A4 .8B .`  .C .D< .@`E .0F .y  .G4 .8 T .X H .  .@I .J, .0Kt .xK .  .L  .b , .0Md .h  .M .  .`N . < .@PO| ."  .@P .R  .QT .X | .0S . < .@pU .  .Y . $ .( PZ| .  . b .  .!c! .!! .!eD" .H"@h" ."y" ."j$# .(#L# .P#0n# .## .#q4$ .8$\$ .`$t$ .$Pw$% .(%>L% .P%% .%% .%<& .@&td& .h&& .&& .&|) .)l* .p** .** .*+ .+$+ .(+PT+ .X+t+ .x++ .+.+ .+@, ., 4, .8,pL, .P, d, .h,|, ., , .,, ., , ., , .,PL- .P- !t- .x-- .-,. .0.дl. .p.5!. ..!. ..@.L@;@/SLB$ lc@x(LD0 0 0( T)  ) x4@)LJ] MR  QT