ELF>hH @@GFHHv?HjZVHHH)HH¸?H A1Hi>)ֺq @A1qff.fHcAWIAVAAUL,bATUSMIl$HHbAt$f tuf(tnILADEts;5H13ff.ff.HcHH;Hyuuy[]A\A]A^A_;5H?ff.ff.ff.@AIcHH;tgHzuI I$HHIT$HPAT$fPI A$ []A\A]A^A_f.AWAVAUATUSHH0X6eL<%(L|$(I8.HX.H@.HD$HD$ Ht!HH|$} H}H1EwHHEMgH)HEhpHAGE fDubLH‹E )ȍE\6E\6HbAG{LhbLIDH$IHbE C|/tOH<$bHD$L)Ht$Ht$H9LD$H9MDIbv =HEDAIWHxLHHDILHLH)A H)H} 8.X6f-fHH.HU@1 u[]P.[]fDAWAAVLcAUATULSH HN@>f-fw IHDh HD`A A.B*UEtMBDŽ*.9 .s .*H@)*H[]A\A]A^A_DHl.pAtUEtB*tfH H@>f-fvOIDj HI Dh$BDŽ*..9.s.1[]A\A]A^A_I Dj$f.AWHcE1AVLH>E!Dž iHH)HD(BDŽ* .)H3HAH@.Hx8DH[]A\A]A^A_H<;p61"Eu Dž AuA9s)ЉAA9)ЉH|$1ɺǃp6H-DD$DH )HD(BDŽ* )HD$ tKEDž AuA9s)ʉ1lIVHD\$D\$Eu Dž A1ySHHHt"H HE1HHSHt"H HE1HHX.[SHtCL%;s1[[[AVAE1 AUAATMcIULSHH eL,%(Ll$AHH$HHHèL1HH<$ID$1I$HIAu@ff.ff.ff.ff.DHcLHLHHH9u1HT$eH+%(uMH[]A\A]A^ff.ff.@HcLHLHHPH9ufATUHSHH1HHx81HHIċ@1HP41P<1P81P,1P01P(1PD$1D 1LHH1H8Hx8Hc[]A\f.HPF1fAVHcAUIATUHSHLHXL% tYuQI(#@u-Ou/H$HI9xc2@t$HEX uɉHuʼnHiHEH A9u11At11DHGH[]A\A]A^ff.UHA1SHH{HHHǃHH)HC|ƃffD1HfDfDƃ 1HaHD$fHD$ fHD$(fHD$0fHD$81.Dž*[]ƃ1H1Htff.fS@HHH HދH@.HE1E11j1ҾHjjjjNH(ff.fH@H8T@ATUSH@HHx6L8=xH1LH6u@H8HL0Hx6H-[]A\HfAWAVAUATUSHHPeL$%(Ld$HAD$A HhL- tvt HDIPF6utLL-I(#Hh0HD$HI9u̿A H@@u31 HH H@@t݁L\$111E1fL$ E1ɹ#ft$f|$HfDD$AD$ASLT$ARL|$ AWLt$&AVLl$,AUCH(D$ L$LT$L\$T$f6f6f6D$f6EHH2.26.02.H6AH#H6HxHf6ǃ6014ǃ6f6HHǀH)1HD$8HD$9HD$ALAzIAuLL$LL$I,`6H9h6AAHh6H)H4ׂCHH?HH)IE11I AAH6IH6IH6IH6IH6I H6I(H6I0\AAY6Ao6GAAX6ƅ6HHX.*THX.;VAyuƅ6AAY66AAƅ6DX6IcHHTH2IHrIHrIHrIHr I Hr(I(Hr0I0Hr8I8Hr@I@HrHIHHrPIPHrXIXHr`I`HRhIhHD@ AAY6A6AAX6ƅ6AHX.*HX.9H0IHpIHpIHpIHp I Hp(I(Hp0I0Hp8I8Hp@I@HpHIHHpPIPHpXIXHp`I`H@hIhHX.@ H@.LL$Hx8)LL$ID(HЃAȈ)HDHL$(DŽ*HL$@Hǀ HD$IDp6HD$ADD$ƒT$At/H If~>nHHDrHHD$ILL$0HHHL$HxHHHT$ HHH)H)HΉHDHH@.LHx8p6LL$0Lt$`1APFLL$8LLx6HD$`HD$hHD$pHD$xHDŽ$H\$0LLl$8Ht$HHúLLp6uLLLl$8H\$0p6LL$8HD$HHIHL$ LL$HHAHD$HxHH)H)HH@.Hx8L$.H)(HHD$(DŽ* H@.)Hx8LL$%`6AA Dž`6Ii@BHHh6IAAIX6HX.*HX.;H0IHpIHpIHpIHp I Hp(I(Hp0I0Hp8I8Hp@I@HpHIHHpPIPHpXIXHp`I`H@hIhHX.@ X6AA!X6AAX6HX.*ȃHX.9AT$f% AfAfEtHEIfA)Dž`6AA'AAhX6AHX.*HX.9]X6HHX.*THX.;AHTfDAT1A,AUHSHHd6H>L8H7HPHLZ H[]A\ff.AWAVAUATUHSHLHHLt%LHHLHL6HHHHx6L81ҾH@(L>L$ pH6HƃH0HPpǃL2ff.ff.ff.ff.HÐ6HpH0DŽL2HH=uH>ǃ>Hǃ>HfJ2fH1H>HHHHAƅ#f}>HHL@HFL)HHELH8H@1LuiE>f-ff ?fwHLLHǃAƅAH8HLOHH[D]A\A]A^A_HLHFL)HHEHHHHHcbHPbHHJIHHHII@.IIHcbHAH$AGPvt1ATLL$HHt$ XEHPHPbHPbcHƿL)HH@.HudHHDžP.H@.HIHIHH@.Hu|H HHUH H@.HuwH HHU IHyHH IHH@.Ht\.IHH@.HtJ/IHH.HH/HH@.Ht-IHHHH@.HIHH@.Hu]HHHH@.HtlIHIHHHHHWI$@.HuzHHH $E1HLI$ HI$@.HtMIHċIH{HHzH@.Ht(IHHHH@.Hu'HHIHDATL8USH_xHHx6H8H8@H@(HH6tLjE1E11j1ҾHjjjH(tPHx6Ht%8IH+H8H HH81[]A\HH[H@.Ht%1IHH1HAULcAAJ4AT1UHfASHHDfǂRfǂH^HfD HfDSfDCHDǂHDHHCtRH@.Ht'IH1HH.BDŽ*[]A\A]H@.HH6H|$D$H@.Hu{HHH@.Htz!IH뉋6IHaIHzH!HH@.HIHH HH@.HHH.H@.Ht\IHKH@.HtJIHHHHHH@.f"w-HtwI2HHt(I3HH3HH2HnHHIHSH@.HtP IH IHH HH"H>"IHA7H@.HLL$IHLL$Hx6Ht-+IH H+H׺#HHA$HHAHx6HHHHx6HH%HAHx6HIH듋IHk%IHpHx6HH5HAHx6Ht(IHHHH@LHAL.ALD01ALIELHH=tf}>tHu6MṀ 1IHAƅtuHx6HH0HH6tHH4HHAHL$H8@H=I11H)IHHH5IHkHx6Ht\'IHHx6Htr&IHH'H0IH-H&HDAVAUATL8USHoxHHHx6L8LHHuHH$AHLLH1LM鹀 1IHÅtPHx6Ht%BIHvHBHWH6tLH8@HVHt2@IHHH@H҉[]A\A]A^H2.26.02.0143w_9xxx scsi%d:drivers/scsi/3w-9xxx.cPCI Parity Error: clearingPCI Abort: clearingMemory allocation failed43w-9xxx: Suspend complete. Connection shutdown failedtwaError posting request sense./include/linux/thread_info.h4Failed to enable pci deviceFailed to set dma mask&tw_dev->ioctl_lock&tw_dev->ioctl_wqueue3w-9xxxFailed to get mem regionFailed to ioremapscsi add host failedError requesting IRQ43w-9xxx: Resuming host %d. 43w-9xxx: Resume complete. 3ware 9000 Storage ControllerstatsSGL entry contains zero dataInvalid command opcodeSGL entry has illegal lengthCommand packet is not alignedInvalid request IDDuplicate request IDID not lockedLBA out of rangeLogical unit not supportedInvalid field in CDBParameter item size mismatchFailed memory allocationMemory request too largeOut of memory segmentsInvalid address to deallocateOut of memoryOut of heapDouble degradeDrive not degradedReconstruct errorReplace not acceptedSector count not allowedNo spares leftUnit is offlineCannot update status to DCBInvalid stripe handleHandle that was not lockedHandle that was not emptyHandle has different ownerIPR has parentIllegal Pbuf transfer lengthIllegal Sbuf transfer lengthCommand packet too largeSGL exceeds maximum lengthSGL has too many entriesVerify error (data != parity)Could not clear SbufFlash identify failedFlash out of boundsFlash verify errorFlash file object not foundFlash file already presentFlash file system fullFlash file not presentFlash file size errorBad flash file checksumParameter list length errorUDMA CRC errorInternal CRC errorData ECC errorADP level 1 errorPort timeoutDrive power on resetADP level 2 errorSoft reset failedDrive not readyUnclassified port errorDrive aborted commandPCI abort errorPCI parity errorPort handler errorToken interrupt count errorCorrected buffer ECCUncorrected buffer ECCNext image buffer expectedBinary image has no signatureBinary image has bad checksumI2C device not foundI2C transaction abortedSO-DIMM unsupportedSPI transfer status errorSPI transfer timeout errorNoneERRORWARNINGINFODEBUGAEN queue emptyController reset occurredDegraded unit detectedController error occurredBackground rebuild failedBackground rebuild doneIncomplete unit detectedBackground initialize doneUnclean shutdown detectedDrive timeout detectedDrive error detectedRebuild startedBackground initialize startedBackground initialize failedFan speed is below thresholdPower supply was removedPower supply was insertedDrive was removed from a bayDrive was inserted into a bayProduct case was openedSector repair completedSbuf memory test failedDrive reported data ECC errorDCB has checksum errorDCB version is unsupportedBackground verify startedBackground verify failedBackground verify doneUnsupported ATA driveBackground migration startedBackground migration failedBackground migration doneSO-DIMM incompatibleSO-DIMM not detectedCorrected Sbuf ECC errorDrive power on reset detectedBackground rebuild pausedBackground initialize pausedBackground verify pausedBackground migration pausedFlash file system repairedHandler lockupRetrying PCI transferAEN queue is full43ware 9000 Storage Controller device driver for Linux v%s. 43w-9xxx: scsi%d: ERROR: (0x%02X:0x%04X): %s:%s. 43w-9xxx: ERROR: (0x%02X:0x%04X): %s:%s. field "event->parameter_data" at drivers/scsi/3w-9xxx.c:411memcpy: detected field-spanning write (size %zu) of single %s (size %zu) 43w-9xxx:%s AEN: %s (0x%02X:0x%04X): %s:%s. 43w-9xxx: scsi%d: ERROR: (0x%02X:0x%04X): %s. 43w-9xxx: ERROR: (0x%02X:0x%04X): %s. Controller Queue Error: clearingMicrocontroller Error: clearingFound unaligned sgl address during execute scsiFound unaligned sgl address during internal postPost failed while reading AEN queueFound request id that wasn't pendingReceived a request id that wasn't postedError completing AEN during attention interruptFailed to allocate correctly aligned memory3w-9xxx Driver version: %s Current commands posted: %4d Max commands posted: %4d Current pending commands: %4d Max pending commands: %4d Last sgl length: %4d Max sgl length: %4d Last sector count: %4d Max sector count: %4d SCSI Host Resets: %4d AEN's: %4d Found unexpected request id while polling for responseNo valid response during init connection43w-9xxx: Suspending host %d. Connection shutdown failed during suspend43w-9xxx: Shutting down host %d. 43w-9xxx: Shutdown complete. No valid response during get paramResponse queue (large) empty failed during reset sequenceMicrocontroller not ready during reset sequenceResponse queue empty failed during reset sequenceInitconnection failed while checking SRLInitconnection (base mode) failed while checking SRLFirmware and driver incompatibility: please upgrade firmwareFirmware and driver incompatibility: please upgrade driverCompatibility check failed during reset sequenceFound unaligned address during AEN drainNo valid response while draining AEN queueAEN drain failed during reset sequence43w-9xxx: scsi%d: WARNING: (0x%02X:0x%04X): Character ioctl (0x%x) timed out, resetting card. WARNING: (0x%02X:0x%04X): Command (0x%x) timed out, resetting card. Controller reset failed during scsi host resetFailed to allocate memory for device extensionCommand packet memory allocation failedGeneric memory allocation failedEvent info memory allocation failedFailed to initialize device extension43w-9xxx: scsi%d: Found a 3ware 9000 Storage Controller at 0x%lx, IRQ: %d. 43w-9xxx: scsi%d: Firmware %s, BIOS %s, Ports: %d. Failed to register character deviceFailed to set dma mask during resumeError requesting IRQ during resumeSGL entry has unaligned addressSGL size does not match commandParameter table does not existParameter index does not existSpecified port has invalid driveReplace drive capacity too smallIllegal Pbuf address alignmentIllegal Sbuf address alignmentInsufficient resources for rebuilderRequested segment not in directory of this DCBDCB segment has unsupported versionDCB segment has checksum errorDCB support (settings) segment invalidDCB UDB (unit descriptor block) segment invalidDCB GUID (globally unique identifier) segment invalidCorrupt flash file system detectedInvalid field in parameter listParameter item is not changeableParameter item is not saveableTimeout waiting for PCI transferUnsupported command during flash recoveryBinary image architecture incompatibleImage downloaded overflowed bufferSO-DIMM parameter(s) incompatible using defaultsInvalid unit descriptor size in CreateUnitUnit descriptor size exceeds data buffer in CreateUnitInvalid value in CreateUnit descriptorInadequate disk space to support descriptor in CreateUnitUnable to create data channel for this unit descriptorCreateUnit descriptor specifies a drive already in useUnable to write configuration to all disks during CreateUnitCreateUnit does not support this descriptor versionInvalid subunit for RAID 0 or 5 in CreateUnitToo many descriptors in CreateUnitInvalid configuration specified in CreateUnit descriptorInvalid LBA offset specified in CreateUnit descriptorInvalid stripelet size specified in CreateUnit descriptorSMART attribute exceeded thresholdEntire logical unit was deletedPower supply reported AC under rangePower supply reported DC out of rangePower supply reported a malfunctionPower supply predicted malfunctionBattery charge is below thresholdTemperature sensor is above thresholdDrive bay cover door was openedDrive bay cover door was closedPrepare for shutdown (power-off)Downgrade UDMA mode to lower speedUpgrade UDMA mode to higher speedError flushing cached write data to arrayBad sector overwritten during rebuildBackground rebuild error on source driveReplace failed because replacement drive too smallVerify failed because array was never initializedSynchronize host/controller timeSpare capacity is inadequate for some unitsVerify detected and fixed data/parity mismatchUnit number assignments were lostError during read of primary DCBLatent error found in backup DCBRecovered/finished array membership updatetwa_get_param@@twa_allocate_memorytwa_initialize_device_extensiontwa_scsi_eh_resettwa_chrdev_ioctltwa_probe  ))/1BBQQ__twa_shutdowntwa_suspendtwa_aen_drain_queue88BBHHtwa_poll_responsetwa_initconnectiontwa_check_srlJJ[[``bbtwa_reset_sequencekktt||twa_decode_bitstwa_aen_queue_eventtwa_fill_sensetwa_scsiop_execute_scsiFFSStwa_aen_read_queuetwa_interrupt"",,twa_resumetwa_initH(use_msiparm=use_msi:Use Message Signaled Interrupts. Default: 0parmtype=use_msi:intversion=2.26.02.014license=GPLdescription=3ware 9000 Storage Controller Linux Driverauthor=LSIsrcversion=3C42D19767DE5A04B31C83Ealias=pci:v000013C1d00001005sv*sd*bc*sc*i*alias=pci:v000013C1d00001004sv*sd*bc*sc*i*alias=pci:v000013C1d00001003sv*sd*bc*sc*i*alias=pci:v000013C1d00001002sv*sd*bc*sc*i*depends=intree=Yname=3w_9xxxretpoline=Yvermagic=6.13.0-rc1-MANJARO+ SMP preempt mod_unload $ (0880( 880( 8 (08h80( hh (080( 80( 8 (08@80( @80( @88 (080( 8 (08P80( P (0@@0( @ (08@HPX  (080( 8 (08   (0880(  (  (0880(  (  (080( 88hph@8P@8 (08@H  (  8 (0( 0GNUGNU2ࣄGX٦ފLinuxLinux]2X;,[%$  $      !"#$%&'()0123@PQRS`abpq  012345@ABCHIPQRSTUVWXYZ[\`  !"#$%&'()*+,-./0123456789:;<=>?@ABC3w_9xxx N++2+S+dSN]NiNNNNinti,N* Nes8ueu8es16eu162es32Aeu32es64eu64di8 !N+1i2iHIX]^_`].NN$&(<i Pv "#N%&*+4=BhAnPqd} Z; d d d i i d* * Z  .V VV[.V]p+- p!+WA    !2"#  Z   luvH u S   " #   ʰ(  %0  8  @  #H  #H #H (H #H #H  #H  #H;@      ZP h  S S     i 5)I>6)J+)Ki)OH)XH)]H>)`"B@)d)hi)ki )l+)m )nH )oH()p)0)q X)s`)ub)x d)y\Hh)zp){H)+))) )) )) ) )\H))) )A)) 6(>)>6P+8)A d@)D dH)G+P)H+X)K>`>)N)?)TL)WL)ZL)^L)k 0)mM)p5 )q85()t+8)u+@ )i ) d ) d ) d )8 )@@ ) )zR ) ) P ) P )"R ))R )  ) R0 ) 58 ) iX )R\ )R` )5h ) )R ) ) ) )  )!i )"i )# )$+ )& d )' d )( d >))p )3R )CO& )D+ )LR )N+ )RS )SP( )TP, )Y+0 )] 8 )^ < )_ @ )` D >)apH )d>X )gS )i= )l#S )w )x )z+ )} )~(S ) d) d) ) )O&) ) ) ) )+)i)=S)GS)U)U )i()i,)H0yrcu)p0) 9@) D)H)'8P) Vx) 9) ) "V) V)'V)) ) d) ))>>)p) )!"1)$"1>).p)<1V>)F@@+?;@@*!* 1%sp*+%es* %ds*"*$*&*+(*+0*018*+X*+`%cr2*+h*+p*+x*O1*+*i*P*+*+* 0pfpu* '0@i (+ 9!+ )>!;@@&d!E7n@&gr@K  x!g&"E0l&9!& %$Nl &(&,&l0S&sl8&X&lh&%mp&+x&@k& &m& *&R&m&Ekq?,",,?,",2,2),"Ival, 6"6" ,#$",,"?-4#--4#D#+)-_#- 6# - #$D#-#-_# . #. . # //  0#0#0# 1`$1#111 11i1+,2$%fmt2S2S2S2i2S2S$`$36$37e38-83g%3S3S3S3S3i3i34i key39$(2i3=% 83U%3V mod3W%3XS3Y% 3Z (3[ ,3\g%0uS 3uE&3vE&3wJ&3xi3yi$%+]d&+ 4/&41i set43; get45T47 e2d&c ( %     *  M   (  0 8 !©@ " H # P $ X %` &5h 'Np (5x )q * + ,ߪ - . /  0 4 1  2f 3  5 L 9 y ;  >q ?ɬ @& 5!(5% 5+ 5-5/ 6 (6!A key6"A)6?')6A+6B,)6C1)')( 6=W)6>$(2i3)     +)++ ;!)+?)! *+7 i9*      0:c+:dS:e%:gC:i a:lf $,(* ;B+;d end;d,< ,<  p=+ cwd=P swd=P twd=P fip=P fcs=P foo=P fos=P=+=PlP++?=*, rip=+d rdp=,d?=.S, fip=/P fcs=0P foo=1P fos=2P )=)g,6+6,)0=@,=A,=B,P,+ h=$+- cwd=%2 swd=&2 twd='2 fop=(2$S,=5P=6P=9+- =<;-=>,}g,P;-+PK-+? =Q(. cwd=RP swd=SP twd=TP fip=UP fcs=VP foo=WP fos=XP=Z+=[l=\m=]n=^o rm=_p=`q=a(.x=bP#=.+dM.+@=:.=; d=< d== .d.+;@@=O.S=P,=QM.=R.@.Y+@=^7/+=_^+i=`,+=aK-i=b.@+=c7/I/+;@@=f/=hi=ki=nd=qd%xfd=td=wi=zi=i=iS=.@@='0= d=i=i fpu@=0=i=+=0=0=/ =/0S=I/@@I/ > 0> d>d]0+ ?1? ?! ָ?" ?#0 01+@1@1+E1J1- @1@i@i@S@S@S,A,A,A B81B92 B<2B=21)C<*2C=iC>  C:e2C;1$2 srcCA2 dstCA 2j2!u22iD2*(D2D2 valD PD!P D"PD#dD$2 P)D*3D+&3D,#D3 ED3EXE A3*D'3D(D)u2$2D.d* D13D23D3D4 D5+D6+3)(D4D%2D/I3D73 8D04D+ fnD D4$3 ?4?4404 F>4F?+F@+FAP cpuFCP G4GdGd-(G4OctGT1G&4 42iH5 I.5I 35.5 J S5J K n5K )L5L# L5$n5L5*M 5M#M"5 N) 6N* *N+# osqN-S5 N/ (O >6O O O-Ps6P+Ps6Ps6>6 P 6P s6 P6Px6Ps6- Q6PQ >6Q ; Q 6Q62iR 7-@R'7PR(6R) ; R*7(R+"80R,8R-9R.:R/; 67777-@@S/"8S0S1iS2  seqS3@S47S56 S60S7 ;87 (Ti8T .T+T y8TP !t8t8'8i8 U8UU U88*V 8V8+8+V88 W 9W W8 X+?9X,X- xY9Y9Yi`Y+h maxY+p+9+ *Z 9 sigZ8Z9[R[S99[Uv[V99\:\ \ \ 9*\'E:\(\)*\-:\.\/\0 :\1*\5:\6\7\8 :* \<:\=\>\?\@ \A *\S0;\T T&\U\V* \YT;\Z T&\[ *\^;\_+\` \a )\J;\L\Q \W:\\0;\bT;* \E;\F$;*\g <\h _fd\i*\m=<\n\o\pi  \%<\*!:\2E:I_rt\9:\B:\d;\j;\q <?0] <] ] ] ] =< 0] <$<]<< ] 0=]!]" 9 ]%r=]'9](+].9]0 9 ]3= sa]40= ^ =^ .^ + len^ +^  (_=_ ! `$>`%`'`( 0`DS>`M#=`P(`W) 8a >adadadadad a#d(a,d0 b)>b*db+6 Pb8?b9?b:iHb;iL>)?+-8bD_?PbEpbF5bGi0- c>?cKcZcpccc endc?]?Y+ d!?d" id&? dD@dD?dD? dE@@dE?dE%@*dT p@dY@@dZ 5d[L@*e @ valee |@*e @ vale e @)S@)U d)V d)W#@i)[+A0)hA)i?)j )k@%cpu)li)md)nd )od( )A)+) ) ) )B)+) Pg@@)B) d) d) d) P) P)+ )+()+0)i8;@)AD) d) d) d) d) d ) d() d0) d8) Z@) dH) dP) ZX) Z`) dh) dp) dx)  d)  d)  d)  d) d) d) d) d) d) d) d) d) d;@)E)AS) >6)! d()" d0)# d8)%@)&P)'Q)(R))S), dX)- d`). dh)/ dp)0 Zx)1 d)3 d)6 )7E)9E);E)=+pavg)GB@ADE0)KF)L)M+)N+)Oi )P$)Q&)SF(E.)]'F,F ;F;F@Fg)`GS)a>6)h d)i d )j d()k d0)l d8)s Z@)t dH)uiP)i)i)i)i)i)i)i)iS)7XS)7%rq)G)F)G);F.)^GG G;FrqG)HJ)i J)i J)iJ)if)\H)))))H~b)H~s)P)H)HH)HHHGH+))Hg I | Au [  p@  D  H 6P +`  +h )Рp +x  Œ 5  [  Hpidpf7mJf9 9f:if; 5f<x inof=df? f@@fBZHOrcufCp`fDpI.J+ gJgig\J-ho Lhp * uidhq @ gidhr @ hs @ht @hu @hv @hw @ hx @$hy i(hz0h{8h|@h}Hh~PhXhL`hLhhLphLxh hhNrh=hEJ LkeyiLi 9idEi semi[(iPi X$`i h uidi @p gidi @tipxi|i~i i+$$ćiLM MM!M+MhXj^Pj_ 9j` jajb jcjeZ jh8jk=@jnXjq`jsdjthjwpjxitjz`xjijijijjPj7j ; itjejj>juhj jmJjjttyjjj p@jdj djdjdjdjdj@j+j+j+j'+j+ j+(j"+0j,+8j+@j+Hj"+Pj,+Xj+`j+hjS>pj jjjj ijjjjj9!j5j[05Mz jQj5j 9jZj PQ#QkXQkk-Q@lQl:l :l d l (l*l,l-l0]QQ XmcaRmd *me mg mk 5mmAumn(mo0mql\8QfR<uRR nRnKn3n?RRR+RRR+S+_?SS?98S+8SBSz0lUllllW l,l.lAu0l4@l(FHl PlXl `ll+l5l ijbdil> l8(lhlplPl jevlZlilililO&lil5l_llll\l\jcdililjbblsl#ldl * l((LS-hoyUozao|io}+cEboCb(o'80o+Xo#0c`UVVV"V,V,#,,,!,%,',,,/5,3,5,9,<,A,D,H,L,Q,U,Y2 ^W pWppp p Wp!gp" q8p$i Hp'?Xp(S keyp)p*?Xp+ p,(p-0p. DX8 extp/IX@6)^WWp3- p8X tpp9Xp: p;Pp<PWEA qZqPq qiq # qdqd inoq)d devq* (q+ , uidq, @0 gidq- @4q. 8q/2@q02Pq12`q22pq3dq4dq5Pq6Pq7dq8dq9Pq:Pq;PZ+r ! Z (rbZrir rbZr rnZsZ ZZi Z r#Zr$5r%r' ZFs5FsFs t[t 9,uv v"[)vR[v5v$[ v[$0[viv (w0[w1 *w7 * osqw9S5w;#w<FwFwFwFwFw x+=\x,#x-VL7@y W\\\!g\g\l\ y\y *yyK\ Xzq\zrl\zs'8 wqzv\H cpuzwP\ x{M]{{M]{]]( len{ *H{m]P{p\]]++m]+}]+h@|X^|X^|X^| P|5@@| \H|!+|"+|#|$'8|%l\|&p |'^0|(+8jcpu|*@jssp|+_H *h^+ `|6^|75|8]]|:]](|;+H|<^P|=X|>\h^ |e_|fi sda|gk`|h#|ip`^zx|D[`|E^|F[`|H |I5(|J5H|K5P|L+p|M+x|N+|O+|P+|Q+|R+|S+|T|U+|V5|WJ|Y |\+|]+|^\|__p^k`+}]_,})~`~-.~-.*~"`~#A~$~%*~'`~(~)*~+a~,~-)~!La~&`~*`~.` ~sa$` ops~}a$asaxa ~2a~4+~6i~7i 2io@a2ioH b op>boqaorosCb>b?olboao+obPopo+qob6Hblb-@o+co bo+o+o+ o (o,o+c0Orcuop8o\cHbLa o\co ido5ckcY+ ococc (c#Z * kdd& )[ ldt*pd8.+@95H:h;ep= xC2|D(~kd ze+ alt+++ +(08@HPX`hpx !udzeFc?&\e&^ &`i)&XeIlru&Y6e&d&e)&i f&j +&k+?(&R9f$e&hI$e&s+ ?(&uf&z+ pp&{f&|+&}+&~ * f?&f&+?&f&Qg&  Qgs ref8JHhil+p ops x$fq(&Qg6 f69f6f6fv&p)&g&i& f& g%val&+.&gk&Mg&N &PiZ&J h~lru&K6gZ&W0h+&X +&Ygk@&Gh&I+$g&UI&V + $ h(&[ 0&\ 4&^+8w@&Fh60hi&jk(&m&i&n+&o+&q &r &s &t &vi w@&lDi6hi&zk0&}i&~+&+& & &  & (k &i&+&+&w@&|i6Di6ii&g&DjEhE&i@Ei.&+jg ;k  5  |   E I    |( i0 i4 L8 @$+P  p  x # $ Œ % Œ 'EP1j1j&5bk%ctx&6gkbk&=k&>Z&@?(&Xk&Y[(&\ l&b+&h+&tC&w &}$k&0l&+&+w&Nl6 li&pZ&sl+&,j+&j &lprb&>6&+klbmc uh ujkq so(t0u8w@{oH~oP8XL`ehpxlmlkk&m&d%cid&& @@& n& f &7n&&+& =S@@&rEm@&R[@&+P&+X&+`&+h&+p%pgd&  d!x&) &5 &?r&E+&Li&S &Z#&] *&_&a5&p[&r&&+&+&+&+&&+ &+(&+0&+8&?@&5D&+H&+P&'+X&3+`&+h Hp 8}ZH  P (>X H` Rh  pxx#|+'-@|+? S( c0 c8 x@ H#PAXZ`#||;@      +    ( !0 !8 @ "H +P +X +` xh [p     & #֦  $   v  4 @k > H . i  |(> `   P   !P "R / W 0  1 4 g 6i <5  BS@ D"|H FP I *X L` O Œd R\h Sp ZNrx a byrcu cp dl\ f5 k0> n5@@ oH q5X r`|2ì xì xw &iS&w ?0 SxD!cxX!xx|h .x.} E݁FxGHI   mnt  x݁ <<( xZxF "#p nid&-+4+7=S-R~SUXYZ ic 9 dJ(OrcuepHgXj` idmpptqSxrxu +_~ * 034Q678  xa9Au ) " $5-@@-Q lru/0 * ) f2| nrf3 nsf4|5+VY+* vald2i  % F Z_+Zii#-ilOrcuimpin 9io ?ivՅix2iy `)iu6Ixi+ (ir6it+$Յi@iEiS 66| iqii vJ+i LL;q ii keyiLi@qiivi>6)i7i i ?(ii+i+i@iEi . )(ii67k ićii 2Z i+iJ6 } 9c+0 *8.@ uid @P *X `$#h hh 9h gidh @Y+qhhrcuhp}h@@SgSh# cpuSiiSjiSki 8Sli8Smi8Sni8Soi8SpiSriSsStSuiS{ ; S|7(S} ;0S~78PS@@u;7@ +r=+? 8jj j! j"+j#dj#d j$+(j$+0 j'j(dj)d j0j1 j2 j3  jCjD jL&jMjN& 8jQ`jR jSjTJ+u+mJ+9+ ؋-0ZPp -` jOrss ؋!08Z@ X   fn e2 arg +* b P)mSmTmUqmWmX.vmYp-8mIQ qmJ iocmKaR$ΌE m\i0;l l llll+ li(li,l 90li4lAu8lHl#Xl#Xl#Xl#XlsXl5`ldlUhlplx50l@4lFp@lKZPlP5hlR5lSlUxlVxlWxl[5l] Q* 5 val* X valA<p!{{ in+v-8_` *ab8c 8d Orcuep reff{0d* 2 v +%@iTz++ nz2 Ӓ*. 0 4Ӓ 4+5i6+7T;;+E@JO) { @ 5)  @ X P  i $Y${   2 2( 28 @kHС(Ҕ).*+ ,0-5@. 5`/ d0h1^p2 x3+4* val Ҕޔ2i6$B)E^IuidF @IgidG @H D$0J H $ $ $ $ $  $( $0 8 @ H̖+ i(i, $0 $8@ ̖!w%̖@8P9i:i;i<i=} >}(?}0@8і iU }n ^XDIE}FbG rH}I} J}(Ki0N 8O@Q˜HSP bN!rg |$w | ˜|xYZ[d\d]d^d _d(`d0aZ8cZ@dHeLfdPgdXhd`iZhjp8Qiiii iii%ino   X( X0|i|+  iii iiiiXכii (60T86@rHP כ< iܛ  1^1ǘ T1; mmQYPc8 Ӝ i [ Ӝ0 H H? P@QXA5`BCE F5H~IK PQ}9CM]g+]w+$.  Sdi   w%pos  .  i @k *@k.)t M@kS)t/ kvkip ll:ll -R ©@k j۩@k۩ǩ @ki+ @ks! 5|@k! N@k: q@kS @kv @k +ߪ@k++++OW  S@k)ti 4@k)tSi W@kW[\a9 @kk!@k x?L buf?.? ? ? ?  ? (? 0?58 op?X?`?h?p y@k@kiQ @k@ki~ iĬ kiά x|xi S#x|#j F|- d|K x.i |x ȭx|x |xͭ |xS '|x O|x, ||x|xiT x Ǯ<ǮPiX x.Ѯ | dd 0| X|x@ki5 {|@k] x x گxگ߯ xگ ,%mt R[ + ;;|,@i i |xi!|} | |!ʰ Eϰ  x 8!. Qx= y.V S~ | ӱ ر x#S#8+ @@ASBCDͼ E3( sdF10GZ8IiJiKiLiMi88bio34  P $48 @HPdX` hpr  t x* A. Pnhn? th+ R+x6W rev+R w1-1  1SOrb>6 ns0i8< >$Q@ idd` hpOrcupxw x opsB!L 1h=a q"$ % & ָ(( 02 89@: H= P@+XA I`x=G) Idir\6 M kn1@k 5 5@`h .x    @  A %m \\M!q\f v )t )t!ָƸ \.۸ j\۩ +\s! I\02iq 0'͹(N) $t* ׹+, - e2(quҹ ܹu :,:S: ):mN:n:o&X:0:1:2 :3 :4p :5 (:7 ʻ0:9 8:; ʻ@:= H:?PNN    C* aH uIk @k.u ʻ@k. @kϻ @ks!:E: c:  c .J  Sh `ͼ 58 X 0t.u CvHw!Mx*py z (Ҽ.!C8ER+ ffk͹W ku!k.t3tz }~jbuf .+.+?]'+ \u' pkap Skz k\ ϾSϾ6 (4E64FS mod4G% ops4H!4I <4J4K$Y Ծ T.Ͼ@)4LIarg4M Istr4NIarr4O 4V4Wi4X. 4\ max4^i4_i num4`! ops4a!4b&4&&-0(AP)A>6R+  z+  i ! ]+7 ` - .8 mod /%@ 0H mp 1P 2JX 8 5x 6 7  9  ;  <( = 0 .x S!%S %!%@i >&g8 ER%mod F%S G%gP p q r s tipmtn w&    i . .KԾR#+(-7NX_ZXZPi_s`$R; G 8 L@%p H SP  X%bus ` \h  p  x 5 S      ? Nh!LAw%ops1 1 A A0!L 0Li MFNSOSP!MQ!MR!M Tk(U0V18W A@X AHY AP[1X\1`^h_1pa1xc1d A pmfh5 _L_f `faS busbd%eSg h%$jH(kM0m18n A@o1Hp APqXr1`s!Mht!Mp pmvxw A pyWdK Gp LF `2Z3S5!M6!M89 x ; (< A0>18@(f@AHC P pmEX .ss_!Z} !.t3t 0 X YS Z!M [ \  ^ A pm `(2i-HRd .s.t3tk i j k  m  L. LS B i i +@i l@i 8      B0  !t " @i 1N@i Br@i O c d& e2N f4r g %lid h D d" cma1<F @/0 ops1"1 dev4L56(78PP, 2i , get put   ( 0E8h@|H|PX`hpx+DX, QjRi idSiTj Pfghii=. ! j j j jS EjSi" hjS%J S|jm j j jS jSSiio j 6 + Dji0 XI h L bus M% N O/ P  Q8(;  %  %  (  8 @ P p %ops            X Lydev }   i  i *  i " "( 5 65%len 7i %cap 8$Z + +  ;`  J K%bus L% M% O   P( Q0 Si8 T< U> V@ WB XiD YH ZI \2J ]P `%X a ` cPh dl em fn gx hp%pin iq j2r kO&x m nd t  v4 y zi( |i- }i. ~i/ i0 i1 i2 i3 i4 i5 i6 i7 i8 i9 i: i; i< i i 2 % i i i @pdev } j+? +@ !us!j s!+z s! s!+++ vrri vrr++ +s! 8s!+ SLs!= es!RQ Rs!+O&j s!+  + ii  dii '2 sgl(2)i*i , G2in2i"(0@+2i,H     2i`K K K K K K K K K 1;k-MN LPiRi Ti! lCLlD lI lNlSL elA~lBglC%V` di) itcknkokpiku#kw kx `kz k{ k~i8k5<k-Q@kl\Pk\pk.x tY+.2 p%!5 H 5 [ (Z05 @jZk lenl wpmnopqrZs tj(j+z+-@!+P&+@@+#H 4 8i=iBiG mapL T!z-@@],aZ @m sbqwi | $ ws( 0i4 8 <2lm lt*lulvlwlxlylzl} ilAl lll l l(l 0l 8l/@lHHl Pl ]Xl`l hlpl%xll 6AKU5dnHll8l @liDl&Hx.l  i.l] ilh+liljlk+ll+lniloilpi lqi$lri(lsi,lti0lui4lvi8lwi<lxi@lyiDlziHl{iLl|iPl}iTl~iXli\li`lidlihlilliplitlixli|lililillllilililil.l8= VViPll8l L@l LH[Y+,0H: XB mJO  T (X0]8b@g HnPr /X{R` lh p x  hfs qg hik lo tagn o$qi(ti,u L0 biow8x@$H4Xd`dhdpxz|~){ ref +$E elv7d[x#iii,,P%rqs 5(2<5%ops%mapi8 i< i@ iD iH LiPiT X`#h5p_Flelsls@il ki U*!U 4*i+ i Ui %4%* H44!]4+M ULi+b .Us U#e U!4! 4 4!-k"2iO[ 2os2iZ)z{|s).1qv>6t*' icq '7+*[ seqi[O;@6EL@L\@N)SX[+a e %fqg7m syi 5(Z0 X#`#hipit x..8xx`$@i&L@@795AF+!ii @i+#!*%rq"s# CC*/!XM!hh:]  r! !s s .s k!s i!/i R5sii4!l5siW  q!5!ss2i$zh* 3iW a c%dS m(t;0;8@H OP OX O` Oh Op cx  c      " 9* 4 R; fE N WXag qyS "i$i(i,+0+8@D i@  iA  iC  iD  iE  iF  iG iL!MP!MXd` # # B ( ;8B &') +50,V8.5@0`1p23J5Z6#B7"L9Z:J<F> @iBiDiGH+QiRiSd\ieghijkliminioip+q+z i{ i| i i i i i i i i i i i i\\ii+ +(01}@>}0 L(0>gr8G h(JKLM\OrcuOppQSZ+\]_`abdeEg sdbjzkm ip iu iv iw,}~+i,  !# 2 S#  ih(g6h# i lm o0p Pr Ts 5Xt`upvrwtxvy+xz+}+ idii lundi i]]5,SS revS11111 1(1018@QHiP i  i  i  i  i  i  i  i  i  i  i  i  i  i ppr i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i  i i\` d8h8pxl\i    > }> } l\;   iiE5] gr( OB @ cT ||h! ;HOPQRpdevS}(TZUi fsW 4L!k #  # . B  B  # @iB G2i& 2iB -a,Orcubp lencd6@@iBz  i2D+z 34i5.6+FL9 .D+L4 j+pLZ .^   R. + F+ F%lba R%sgl/+(d%sgl   R ~io+ /c d.c F F%cdb-.nx+G.f !R" F#$f'9()*%&+|++a.,91+2+3c/04.589:;<=>? F@ RA F B FC FD FE R.F pI\ KiLiMN O P Q R.SU ViWiXiYi Zi[i.\i c^#!_ `#!ab?]5!+.c f{!g+h+i+.jB!fm !n Fo Fp Fq Fr..s!v"+wP+xP.y!8|"~W "$&(*,.0246."c66%26%F%V%F%  ))S)Z#AsY )ZS)M.)S)SS{6Ml ) i=: *.S{= '*G+G*+EA p*+A*+G+*+G t*L*p+dAs *ZI;Mr+)Z=)9 6+=rW+)ZMr o+ZGs+ZAs +ZG += +@kM  +# G++= , S=# 4,BM ?G, = #^, A v,Ld+M,M " ,iiiSM <, M ,# M , A -- -M u- G9-iGh-i+S -.SA=-iG -LdG -Ld= -2=.2iG 9..S{<f.S=.2i"W"UA;.:=2.2G .B A5].S{8/#A=0/<AK/B A ]/B Gr/)iM  /# = z/ = F/ = */%SG2/S{70(U ]60B0 0 $  0 /0U T /U Q d0+0$]Y7sdev5L # %B:&^71 1 $  0  %2 $  0  W2 $  0  2 $  0  2 $  0  2 $  0  j;3|t ^  ~ 33-3UsT -UsT ~ =43-!4UsT~-UsT~G% 4Xdp|9-T Q0R X Y}55 5$ 5/5U /6U|Ld16U}T0/h6U Q6RBX /6U T6QBR /6U|/6U / 7U Q6R@X /%7Uv/U T6Q@R ] V;sdev6L # %B&77 $8 $  0  V8 $  0  8 $  0  8 $  0  j9|t ^ I9:5 5$ E:/d:U -|:Tv -:U|:UvT1Q0R0X0Y0l0/;U Q6R8X /:;U T6Q8R /U g ='g( i# j% ji;|t ^ pg<,T0Q R x"=5 5$ 9/RG=U|9,,l=Usē=U|9,,=Us -Us_ P'& 'Hj# %++BP^`^]^[^Y^U > $  0  ? $  0  O? $  0  ? $  0  ? $  0  ? $  0  @ $  0  I@ $  0  {@ $  0  @ $  0  @ $  0  A $  0  CA )$  )0  uA )$  )0  A /$  /0  A 1$  10  B B$  B0  =B B$  B0  oB Q$  Q0  B Q$  Q0  ~ "C3-CU}T -U}T ~ C3-CU}Ts-U}Ts l2G~7E`C$E/;MXeMXer/ QP)U pT x bE)UsT Q C%El)UsT Q eEU|T Q0eU|T Q1/'FU T6QFR /]FU Q6RGX /FU Q6RFX /FU Q6RHX /FU T6QHR /U T6QGR 'TG:9G Q' Gcp(UsT}Q}' H:9A-HO\/ c= I5r~G&@ IXdp|9-T Q0R X Y|ViJ5 5$ JJP1K(U0T0Q R X G,IKUv4,aKUv/yKUv,KU T 6+KUvT +KULdKU|T09,,LUvē6LU|,NLUs,fLUv/LU T6Q#R /LU T6Q$R / MU T6Q%R /BMU Q6R%X /yMU T6Q5R /MU QڐMU|T2Q R3X1ڐMU|T1Q R4X@ڐ(NU|T0Q R3X@/SNU R}X~/kNUv/NU T6Q0R  -NUv/NUs/ OU T6Q4R +!OUs/XOU Q6R)X /OU Q6R5X /OU Q6R'X /OU Q6R&X /4PU T6Q'R /kPU Q6R0X /U T6Q&R dP+ P] Q'4)T PF4.:Q2:QFi R'* # %jQ|/ ^ RuT'1%BT oR $  0  R $  0  R $  0  S $  0  ;S|S-STs/SU SUsT1Q0R0X0Y0l0/ TU /ATU Q6R1X /U T6Q1R dT+uTTz TzC%zOUcmd|B &Ubuf _ A\'9%'Escdb,' 'A\ f% F\ Pmi   msrbB msg2[outuB[\VXW!!!!!\! V!!! V!&!/0!AN[huVX#####\# X### >X#&#/0#AN[hu X F$  F0  Y F$  F0  HY S$  S0  zY S$  S0 3 iYD 34YD 5 Z:5:BLZ:& 3K(uZDf8[:wn Z:&f.T1R  x [UUQ0.8[U}9. xh[UvT|Q1/[U Q6R.X /[U Q6R/X / \U T6Q.R /U T6Q/R d[\+K\]a'# scmdB +mrc \++  %] a`a3Q&a3a@aMa`ZaF^5 5$  |^̐  _n3 ^D5'J_ _n3 _D5'`TF`UsT~Q0R0X0K/^`UvK/v`Uv9/`Uv9/Uv `,T}9U4 ba1B  ma%Wout!maB ba_ /c'0B %B?c[out b $  0  @b $  0 )|bU Q0R X6Y,+bUv\tbU|*bUv/bU Q6R+X /U T6Q+R d?c+/c] sLd3U'N4']Lk!R 7d##\##_b Gt'b4%'b@d,ddd*BWt[out e k$  k0  Pe k$  k0  e t$  t0  e t$  t0  e |$  |0  f |$  |0  Jf $  0  |f $  0  f $  0  f $  0  8{shd{J{W{3q{~{{d{g1gCPd] 1hC3Pd]C{ ChQ{a{hhUsTv-hU2hUsTvUsTvh5i j-j#30=J`WiC^ iQcap-jU1-U  {Hk3Ǜԛ`jkQ/ `n/"7l<aIaVacapa}` zl=l3xlUsT Q2R#X5Y0l0UsT Q2RHX5Y1l0/lU T6Q7R /mU Q6R7X /RmU Q6R2X /mU Q6R3X /mU T6Q3R /mU T6Q2R /-nU Q6R:X /U T6Q:R  r7p+a8aER_ly`xo/+xo/.Cpp/3TpUsT0Q}R1XpUsT0l|NUs/qU Q6R1X /DqU T6Q3R /zqU Q6R2X /qU T6Q2R /qU T6Q1R /U Q6R3X 9/]rU T6Q6R /rU Q6R!X /rU Q6R6X /sU T6Q!R /9sU T6Q R /osU Q6ROX /sU T6QOR /sU Q6R X /tU T6Q"R /U Q6R"X dWt+Gt]+ ] x'+<%mi-./+[out] t4+4+7umcmd<B  ? un3 tuD5K/uU}9/U} 1:vr~ 2pv 3v  4v S$w,T|XewYw5N*Ze9ULdUvT1] z'9%'E'V]P d,[out&x/y1uyCPd]yy8zyzUsT|4 8{6%BPLP+Wout {+7&++4 {1%=PGP+Wout {+7&++4 |3%?O"f%|?c Wout | $  0 & $  0 Td U}d/%dHf%dadxddfU}gF\UsglhA\Upaeii_tWsirq&'1P"f%%^^Bg o~ $  0  ~ $  0  ~ "$  "0   "$  "0  7 ,$  ,0  i ,$  ,0 7Ucmd2B 7D P F:tG: T6+:TT3QT ~:n3 k:D5:TTt:n :&-T1R  3C L:D O K ˁ:5:K/Uv9/Uv .9ko*5 5$ 1pCPd]  5 H *5A QB „̐$5N*Ze… 6+ GS3_kw``>LYQfsQx./ C-/ ۇ: C;Ĉξ۾Q/0 AN[hu99. xUsTQ1'5 5N *ZeˉUsUsT"1UhCPd] _ 9C #VtUsT~ xUsQ1ڔUsTЋUsTvUsTv]/U@T3Q1R0/LU Q6RKX /U T6QJR /U Q6RIX /U Q6RJX /$U T6QKR /U T6QIR dg+ W4 >A%Ui | Wout  $  0  ! $  0  S $  0   $  0  > ׎ $  0   $  0  % # & # 44S S4%S@TPT+UVWX8tY8tZ8t[8t\2^f%_``|Wt  Kd } $  0 & $  0 TK ڐK5%KB!] ' 1%' =' M' [' m"f%#U}$%Bg7)/)73/3  @$  @0   @$  @0  xUvT}Q1-UvT}l|N/cU Q6RCX /U T6QCR !T ē6%B oڔ'<%  a^,T@>$X0 ˔^,T@=$X0,_ '0%'<'L'\f%.BT[out ڕ $  0   $  0 7Z\ Ė &/0 AN[hu >.3 g !y3 C"#/;GSF.UvTb.U2TbC -<KZ.U4TbQc QwQQ3,Q QQQ3,Q/U T3Xv/U Q3Yv4 @%P+Wout ~+7&++4 :%PWout_ &'1%'=P,B[out  $  0   $  0   $  0   $  0  G $  0  y $  0   $  0  ݝ $  0  5 5$ ٞ [/U T6Q@R /ǟU Q6R>X /U Q6R@X /3U T6Q=R -QT6Q /U T6Q<R /U Q6R=X /U T6Q>R /U Q6R<X ]y Iߡ'y*|'y>@k{i|m[out ˡ(+UE_~ '~+@kscmd~>isarg~Q+|O&+<+  d~i   f% % ;%[outr^p^kB  ++7_\ ɤ &/0 AN[hu7Ŧ V 7^  Z 7[ V# +;Us6+UT~Q2W+xU~T0+UT~/{ 9G*  $  0 VKQ\  ݧ&/0AN[hu q++Vb˩\ 5 W&/0 AN[huV%\  &/0AN[hu7s\ ݫ &/0 AN[huVͭ,,,,,\, 7,,, Y,&,/0,AN[huV'IIIII\I III I&I/0IAN[hu H:  :i:( S̯do{*UTsQH  E &3*T~Q~R X0S5ñdo{n}#C /Q/ #T*U~T~Q0*U~TsQ~ i1<H}3x/ #T*U~T~Q1'*UsT~Q~ m^,T~X0; QLX5e o v.X#   Ҵ ̐ ||||}}3 }-}:}G} ,T  K: 9,S϶+U o+U|*%U *=U|*UU|9*9U xUvQ19U9/׷U Q6R7X \tUv5!{!"d +4= 1=/%=<!?@@%AA(BP|g Wouty ָ J$  J0   J$  J0  : [$  [0  l [$  [0   `$  `0  й `$  `0   b$  b0 & b$  b0 4. e.P0Wout8_ >'5%'A'Kmi  d@ O& B&[out) J $  0  | $  0   $  0   $  0 V wWUsT0Q~    &3*T~Q@R X0 \^,T~QsX09/U T6Q6R /սU Q6R5X / U Q6R6X /U T6Q5R T k4%@Pf%U}   ;&& J&&4.4.Wout_ w'4%'@cdbX wLf%,BWt[out7/7,/Vm, /  $  0   $  0 TUsTTQXR1XL9/DU Q6R4X /U T6Q4R +u'u6%'uXwPx %maeny z0{.B&7/7!7O7^  7V.U TQ Rb/0AN[hut3 g y3 C"#/;GSF.UT.U2C-<KZ.U4Qc} S $  0  *-3 g  y3 C"#/;GSF.U|Tb.U2TbC -<KZ.U4TbQc 3tg y3 C"#/;GSF.U|Tb.U2Tb QAQQ3,Q k}3`.UT 99.9/U TR4Y4 65%AUcdbw f%!Uaen"###"|& Wouto + . 3 ? 8$  80  q 8$  80   B$  B0   B$  B0   H$  H0 & H$  H0 1 #2%#>Df%DU}DoaenDWout1 (cmd2B  fdev.L#buf/.# %+len  D D+D+n *,T|9U)UvT Q 1(cmdB (buf#X(cmd5B #Gi1i(cmd7B 1#23(cmdAB 1iQ(cmd8B 4 ~@# RdevL4 Rdev 4 'Rdev :4GRresD1(irqi#-#D+#S(devT -  - 3i - FS4 '  ' 0i ' CS ( %E4 c|Rf c;4 i6 36 |4(RnDNZp 4|.|D|Pp&i4%i<&"4z0> zCpzX+1+S(to#+(n?+1+(to#-(nA+1;(kt2G#@n1Z#0G#EG1Z(kt-G1Z;(kt-G(div5Z&D&D1me#m.G#mBG1]#]/G#]CGT@VT+&++T5VT] ]3V4D(DV,DCVA+CDV+A'UDVG +kDVA}DV1##*#6osz&&X#&#:+X0(ptr;(nN+###:$%&'(# "U "U "U "U "U " "U0 "U0 "U0 "U0&"U0 0"W >"W L"W Z"W h"W& x"W0 "W0 "W0 "W0&"W0z: " " " "" 0"& @"0 O"0 ^"0 m"0&"0 Rp93RqSX]Ulen  U__p) .) ) &)  "B -"B ;"B I"B W"B& g"B0 v"B0 "B0 "B0&"B0gRp9XUret " " " " "& -"0 <"0 K"0 Z"0&"0"](pAX#TDDoret  o__p.DD&D b b b b "b& /b0 ;b0 Gb0 Sb0&b013!{#3<G1(nr+#;=1D(nrD3#DO7X'(nr',#'HX)(nr*#FX^L(v^O#^YXPo(vPJ#PTXB(vBI#BS1(nr+#?1(nr4#VD1(nr4#V1N(nr#8&oc XHr(nrH#H1X4(nr4#4/1Ǧ(nrǦ+#Ǧ@opǨJWDǩ+ovalǪ+1 d# #d# 1P# ?2XH(ptr<#H#1,p(p,;#,Ki1((p(:#(Ji{{{|"|/|Q<|I|`i||zwzzzzzzdz1 CPd] 1DC3Pd]CzkQ{a {H-U2UvTsUvTs>ڔfUvT}Q0R0/U Q6RNX /U T6QNR CUbo|ʏ׏ x8=/d x&UvT0Q1JUvT0l|N xlUvT0Q1UvT0l|N/U T6QER /U Q6REX ֲH  5A : F ^  q q     Iint F ,  * +s8R+u8e+s16}+u16 +s32+u32+s64+u64P \    1F 2F Hc IP X ] ^P _ `:   <F  '   o   #SB  %{ & 4 = B h n' } 1  ;  ;  F  F   $1  XXX0xx : JKL Wx K  s \x2MH  5  G "V y  ( ;$0 t8 ]@ "H "H "H ~H "H "H "H "H$@    0  RP h  5 5 F @  E F 10kp J  F( F, @0  E8 B@ BA BB FD  OH sP9mem T@ t   F 0 e j  t ~  ( 0 F8 @ FH FL P FX ` Fh p  x F F @$  F  F F $  F !$ "F % &r' 9F : ?0 A0 D } F  P  QF( TE$0N  ; cs =;sl ?;wfe A; Ex ss G;sti I; K;nmi M; P;  S;0 V;8lm X;9 ];: d;<  cs  csx ;    ss  ssx ;   g r15 mr14 nr13 or12 pbp q bx r(r11 u0r10 v8r9 w@r8 xHax yPcx zXdx {`si |hdi }p xip x  sp   B  C  D  E   E (s E ,dpl E -p E' / F 0avl F 4l F 5d F 6g F% 7 F+ 8  % %% )%/ :' pgd' )'"  @H? I!_0_0 48em f g h u vwkeyx\m  U V ? j keyk n keyo ;l<=? F @ F$A F(B F+$-@ (y0FF  4( F,!F0( 4)Y.8*FH+P,(X5 `6 d8 h: l; p< t=Fx6se?@@0rt@A9dlABBBFD%I2JKFODXD]D%`"w>@d]hFkF lm nD oD(p'0q Xs`ubx dy/Dhz0p{D 0 0  /D00 x=01(%2P0mmhpEx    F F, F, F, F- F- F- F- F- F- F- F- F- F - F - F - F -"F -300pid * *( (00((000@>FPCFX 0"{F%v(v+ - ;. ;3 ;4<6=: (=0>8A ;@D ;HGPHXK:`%N;TGWGZG^Hk -mHp0 q1(t8u@0fsxHH{HP~HXI`Lh Lp 5x 5 58 ~FL o<F\4h9 ;  ; u1 2" TD p2( (8 L@  H MP  MX M` Mh Mp x M /: F  ;  ;  ; 4 <  M 0  '  ' "M )M  0  M0  18  FX N\ N` 1h 0  N      !F "F # $ & ; ' ; ( ; %) 3*N C$ D L/N N R?N S'( T', Y0 ] 8 ^ < _ @ ` D %aH d9X gIN i9 lSN w x z } ~XN  ; ;  $  FmNwNNN F(F,vD09rcu04@ D(H4POx4  " O OO  ; >% !"-$"-%.<(O%F-@@l$@@q-spes ds"$&(0-8X`cr2hpx-F' i-6fpu ,@F(  '$@@!d@&i@ , !c c B(,Gd0&d80XQdh%`dpxb ed' Njdb !  >!val   R!! ,>!!! !!  ^! !!R! ! " \ " ?? 2"R! " "2" F, #fmt555F55$O6,# 7 8 8#5555'F'F'4Fkey9 #("F=#   8U;$V0modW;$X5Y@$ Z ([ ,\#05u$v$w$xFyF,## :$ /$1Fset3Cget5\7 .$D&;$ 5 X {  -( -08!@" ߙH# P$ X%`&/h'Hp(/x)k*+,ٚ-ޚ./ 0 .1 2`3 5 9 ϛ; >k?@=$ !'% + -/  :' !key " ?h' A Bm' Cr' h'' =' >:' '  ;{' ! $0"c("d5"e."gL"i j"lo 5('# N# Np$(cwd$'swd$'twd$'fip$' fcs$'foo$'fos$'$($'l '($*(rip$+;rdp$,;$..)fip$/'fcs$0'foo$1'fos$2' $)B)((0$@d) $Ad) $Bd) 't) ;$$*cwd$% swd$& twd$' fop$( .)$5'$6'$9* $<*$>d)@B) '* '&*?$Q+cwd$R'swd$S'twd$T'fip$U' fcs$V'foo$W'fos$X'$Z($[l$\m$]n$^orm$_p$`q$a+x$b'! +@$:Q+$; ;$< ;$= Q+ ;a+$@@$O+&$Pt)$Q+$R+@ +3P@$^,$_9(-$`t)$a&*-$ba+@$c, ,E$@@$f,$hF$kF$n;$q;xfd$t;$wF$zF$F$F&$+@@$,$ ;$F$F Qfpu@$d-$F$$d-$d-$, $,0&$,@@,% -% ;%; :- - --- -&N&N&N'8.'92.'<2.'=2..(<Y. (=F (> (:.(;.7.src(A  dst(A .."F).  () /) /val) ')!' )"')#;)$ / ')*G/ )+&G/ ),#t/#*t/*uQ* L/)'/)(6)).%/).; )1/)20)3)4 )5)6 /()30 )%. )/y/ )7/8)`0)fn) t00\o0o030`0+>0+?+@+A'cpu+C'"F,0     - 1- 1  1. 01.0/ K1/ 0a1 0"0u1K1 0a11 11! 1"1 2)12*'2+2"osq2-01 2/0(3 23 3 0304P244P24P224 p24 P2424U24P2 52(5 25 5 25p2"F6 2 @6'q3(6(26)  6*3(6+406,86-96.:6/;2332q3@@7/470~71F72 6 seq73;743752 76077 83(8G48 x88 W48' R4R44G49499 94 4: 4:4 4 :84;4;  ;4<+5<,c<-cx=_5=_5=F`=hmax=p o5 > 5sig>4 >o5 ?RE ?S55 ?U ?V55A@5 @  @  @ 5@'"6@(o@){@-`6@.@/@0 5@1@56@6o@7{@8 5 @<6@=o@>{@?@@@A@S 7@T $@U@V @Y17@Z $@[ @^b7@_@` @a @J7 @L @Q @W6 @\ 7 @b17 @E7@Fb7@g7@h\_fd@i@m8@n@o@pF A @%|8 @*5 @2"6_rt@9`6 @B6 @d7 @j7 @q70A 8A A A A 80A 8|8 A8 8A  9A!0A" 5 A%N9A'5A(A.5A0 5 A3h9saA4 9 B 9B B lenB B B(C9C {D$9D% D'D( 0DD/:DM#9DPB(DWB)8E :E;E;E;E;E; E#;(E,;0F):F*;F+2PF8:F9:F:FHF;FL :;8FD;;(FEFF1FGF0 G>;GKGZGpGGGendG; :;3H!;H" F H&;HD;HD; HD;HE<HE; HE<HT L<HY<HZ u1 H[(<I o<valIZ I X<I <valI f I {<S<U ;V ;W2"7F[=    0hx=i;jk<cpulFm;n; o;( == ',@@w> ; ; ; ' ' (0F8$@@ ; ; ; ; ;  ;( ;0 ;8 1@ ;H ;P 1X 1` ;h ;p ;x  ;  ;  ;  ; ; ; ; ; ; ; ; ; ;$@qA=& 2! ;(" ;0# ;8%0@&qP'qQ(qR)qS, ;X- ;`. ;h/ ;p0 1x1 ;3 ;6 7qA9{A;{A=6avgG=@@ vA0KAL0MNOF P$Q&SA(A)]BBBBBB,`C&a2h ;i ; j ;(k ;0l ;8s 1@t ;HuFPFFFFFFFF&2X&2rqCACB)^CC(CBRrqCC<F <F <F<F:/DSTDBbCBs'qDqDTD? ~DD D CD'' D,EqRjS @ D Hp2P` h)px u10S DFpidpJ7>FJ9 4J:FJ; u1J<minoJ=;J?y J@]@JBSH.rcuJC`JDypE xSF K{FKFKZTSFLoGLp'uidLq o<gidLr < Ls o<Lt <Lu o<Lv <Lw o< Lx <$Ly F(Lzy0L{y8L|y@L}yHL~yPLqXLH`LHhLHpLHxL L}L iL8L}!}FGFkeyMHM4Moz!{M| semMS(M|PM X|`M huidM o<pgidM <tM{zxM|M~M M||M|G H H H H H;XN^LN_4N` NaNb Nc0NeS Nh(8Nk8@Nn]XNq`NsdNt(hNwpNxFtNzx'NF'NFNFN]N](N2N itNN4N:NƀhN N>FN=ttyNۀNN L<N;N ;N;N;N;N;N<NNNN'N N(N"0N,8N@NHN"PN,XN`NhN/:pNNNnNN FN NBNNNN1NS0IC NLNu1N4NSN^ L L L L M MXOcMOd'Oe Og Ok u1OmRjOn(Oo]0OqT8M M8 M M PMPcPKPWM M N N N %N ?N;; DN NN 5hN hN rN |NhQyNQzYQ|FQ}`[!ZQzZ(Q40QXQ#e[`N N O O O #ORNRNRNR!NR%NR'NR,NR/NR3NR5NR9NR<NRANRDNRHNRLNRQNRUNRYN3PShPSSSS PS!sS" }S$FHS'QS(5keyS) S*QS+ S,(S-0S. Q8extS/Q@w'3PhP S3 S8pQtpS9pQS: S;'S<'P * TRT'T TFT  T;T;inoT); devT* (T+ ,uidT, o<0gidT- <4T. r8T/K@T0KPT1K`T2KpT3;T4;T5'T6'T7;T8;T9'T:'T;' qRU#SU$u1U%0 U' R#VN#VN#VNW\SW 4XNTY Y"iSYS Yu1 YnSYSzSYFY(Z0TZ1'Z7'osqZ901Z;2"Z<0#ZN#ZN#ZN#ZN#ZN[+T[,2"[-0 \ TTTTT \T\'\0\TX]qU]rT]s4 wq]vUHcpu]wP Ux^U^^U^U(len^'H^UP^p #UU U \U;@_V_V_V_ (_u1@@_ (UH_!_"_#B_$4_%TU_& _'W0_(8=cpu_*@=ssp_+NWH 'V`_6W_7u1_8U_:U(_;H_<WP_=X_>\V_eNW_fFsda_gX_h"_iX WCx_DX_EW_FX_H _I1(_Ju1H_K1P_Lp_Mx_N_O_P_Q_R_S_TB_U_V1_WSF_Y _\_]_^T__NWp WXUSW`NaX a+ a+a" Ya#a$a%a'/Ya(a)a+SYa,a-a!Y a&X a* Y a./Y aYXopsaYSY YYa2Ya4a6Fa7F "FQ@Z   "FQH@Z   QpuZQqZQrQszZ uZQZQYQVQZ(QQ4QZZWZ@Q`[Q@ZQQQ Q B(Q,Q`[0.rcuQ8Q[HZYQ[QidQ j[[3Q[Q[ [(b\b2"b1b0b  c \c;c& $c)Sldtc*\8c.@c91Hc:hc;]pc= xcC |cD~ \d ]ddaltddd d(d0d\8d\@d\Hd\Pd\Xd\`d\hd\pd\xd\d \d!\\] cF\\]^ `FX^lruY0] d0 e0i>^ j  k(Rn^]hE^s (u^zpp{^|}~' ^^^_  ^4(Q0_>^n^^^8R_ F  : k_val)R_1M_N PF*J_BlruK0x_*W_X Yk_1@GL`I_UEV  _([ 0\ 4^85@Fj`_-j 1(m`noq r s t vF 5@l`j`-z 10}Ta~     (1 a05@|a`Ta- ,Da!L`!`@!a)a, b  u1   E  q(F0F4G8w@pP rp  x#Օ$ % 'ڕ!a5cctx6c c=Cc>AS@;(X`cYS(\cbht%w }$1c5cc-*daaX Gd6rb2Cc Ld Vd[dc`cd;cid Y@@ d : d0 mNZ@@h!d@S@PX`hppgd  x) 5 ?hELFS Z2"]'_au1pSr0$ (08;@u1DHP'X3`h0brkp!x%0hh@h]hu1pix( ib&i  ['T!i' dod h3 [h h iQ i i 5i3#e6N#e9N#ej gGMj gHj gIii 4j9j CjHjh,jh- u1h/ h0RjgAjigK ~g:j g@~ijgNj gO gP gQ r(g+Dkg,g-Bg.Bg/ ~jj 0pkqbr rs t u v $H(Dkji"ki#ki&ki'ki' kkkj(lju1j 4jBl8jljWl!(lk3{lk4'lenk4'k2lWl k6;k1l{lk8lkil kj0 kklS[krm ksx ktk8kukRmkTFkU<kVkkWmkXl kYq0k[q8k_"q`k`uhkapkbx(kdBllkmxkn].d_ukvlmm$x{q| }~ o< <F !e u(E0 8@H L rP X ` h'p't'x'|u1^ 'Sx0o  000 \?0$@$H P T X \@e`yh%Dp08@H P(X`h pm q-q'@kqkukukvk6vkJv k^v(k nv0k nv8k v@k vHk.wPkLwXkew`-qq$@u0 q r t(!0!8@"HPX`mhSp &!#:D$SXk 0 b b l vxF (%` '!'"/ 0 14 6F<1 B5@D"qHFxPI'XL`O dRUhS]pZ ixaxbx9rcucdTf1k0%nu1@@o0Hqu1Xr0`q"Fku umFuvv vmlu1vvF51vlvJvv;v^vmOvnvmcvvmqsvvmv lEvlFmlGulHlIvvvvwm)wmntm vm mwvGwGwB)w3wmewmuQw n"wn#nidn&n-n4n7mNnRxnSxnUxnX\nYnZ Fnc 4 ndSF(.rcuneHngXnj0`idnmpnptnq5xnrmnuxxxxwjwx'0o3xo4\yo60o7o8 Bxao9Rj  o4yo 0o" \o$u1@@o-\ylruo/xo0' 4yJ2ynrJ3nsJ4y0 ]y ayy3p yvalp; py"Fq y   y r1zrr r#sNteztjzt ez M MMlz.rcuMmMn4Mo BMvzMx My MuzzxM(MrA{MtzMK{MP{M5 A{A{zA M{{ M M {U{ { M{{{H{{HF{{{M{M{keyMHMK{4M| M08M2MA| M  M (M|MMMK{MP{M  (M| MzA|1 M|M0M =z* M|MU{| | |{u}u 4u[u0u'8ux@uidu o<Pu'Xu `u$>"hL}L 4LgidL } <}34L} L]rcuL}};@@7g~7h2"cpu7iF7jF7kF 7lF7mF7nF7oF7pF7rF7s7t7uF7{  7|3(7} 07~38(7M@@}2~"F7:M        >3@^ N9n?8NN N! \N"N#;N#; N$(N$0N'N(;N);N04N1 $N2 $N3 $NCONDNLwNM(NNwO8NQNR NSONTSF| ƀ >Fր ր  4  v)v(0wlwwwS(w `x .rssx )xq0x8xS@x Xy fny .argy  ez bz z { 'OSA OT0 OUy4OWb OXx8OY8OIqOJiocOKM!A O\F0 b | ҂val|Z || val|f |ނ} v}  }%7F}T^    "q~      . 0 $ 4"F.ۃ   45F679 * % /4`  o<  ҂  <  PF >`  rKK(K8 bHЁ()x*0+0 ,00-1@. u1`/ d0uh1bp2 rx34 { څval ÅGF  "F6(   BEbuidF o<gidG < H څD4JH ( ( ( ( (  (( (0 8 @HЇ0 F(F, (0 (8@ Ї!;$ЇGF        @89:;<=È >È(?È0@8uÈ܈u܈bȈXDEÈFG HÈIÈ JÈ(K0N щ8O@QHSPủ̉q(qڅ։q̉xYZ[;\;];^; _;(`;0a18c1@dHeLf;Pg;Xh;`i1hjp8FFFF FFFino  ( 0‹F‹ ҋ QFFF FFFFX66 Y(|08|@H6PQuGw6uF"TuTҋ;wubw ^u܈wuD8  F S 0 (H0ops!8  q( 8 H*wm}r mwk\Ǐ! : T (0 ѐ8 @ H P -XP`dh p x   ̏ba!E B:E&JJO ?bErFSYbErFFѐE~~֐B -kkPEy2dUB~~iBEؑؑbݑ bkkǏ*?MF5e]-*! &q*ޒIN  F ޒ $@Z`[[\~]^`؜ b(d0e78fZ@h}Hj7PkXmҝ`ohp"pr @xsmuvyў{}:S` j t ~  ( b 1pid>F0uid o<o< $ p FF FF r* 1 ;5 )Օ-*+., -])P^F    $0c  &c>ltΟ    ( 0 8@9HMP9XM`php x Ϡ  ) ) y  +& 05 ? INۃ ] g q { : :$)Bߘߘ5r;F pos r) Fr5brXb~oi:{b5~oi]kF bߘՙbՙڙ \bFb/qbHbߕ4kbrrMbpb ٚb$PINboi~F.boiIN~F QbQSV[ 3\brreb ϛbrbr~FrbrbrrFԛF =F$m[qmFB5ymqy`qqB؜mqmBݜmqm7qm#Zqm5<}qm_qmҝqmqmFmםGw'FQ@m~'cqc;;h EqrqmbFўqbm֞m0m05 Sm0? mt S qX7F   qΟuqӟqq u9u%Mu>fmfk RuvumϠu~ru5~rԠ q\)ux==B . LQmyt5[ "@@AA5B0CFD֪ E<(sdF90GAS8'IF'JF'KF'LF'MF *  . 'PPW     qq  ZU2_rev Z99  95.rb2ns0F8< >Y@id;` hp.rcux opsJ!T r9hEi y"$ % ɦ & ަ(( 02 ~89B@: H= P@3XA Q`E O dir d > Ukn9b 1 1@`0h x  ~  B@  BA %`dddUydn~oiɦoiަΦd~rdՙ3drQdr8"Fz  0'֧(V) ji* +, - .(z2ۧ 2"5"5" "mW "n "o&X"0"1 "2 ~"3 "4y "5 ("7 ө0"9 8"; ө@"= H"?PWW )F) LF3~jFQ)2EtbFr~~өbFr~rbFrةbF"N" l" #lF)SF)5~q`֪0 u1 X0t7u LvQw!Vx*yy z (۪7LFAN[(oot֧A`t~ttiyiC }~=buf  ? :/Ed}/xtix5ttd׬5׬>(E>F5modG;$opsH!I JKa ܬì\׬HLargM strNarrOVWFX \max^F_Fnum`qopsa!b$0(;();>2L t F v   :7` -  .mod /;$@ 0FHmp 1P 2{FX  8 5r 6  7  9  ; ͯ  <( = 0r5~ͯ;$5;$ү;$7F >   ,8 ELmod F;$& G7 J       _,P p q r sB tF6mtn w  1  1 F   6;"ܬy>e& o y#QNW/Q  "L Aϱ /ϱ `   A / /  AG*7/G /G /G /G  A"/ a M b L % Kint 1u8? #W   1 <!%',/359<ADHLQUYɲʲ˲  6 9 < GK 1 :@ 1T| 1.111-  g l - - - `J 9   % V9  `/V ,4p ,   : ; 9 I8  : ;9 I8 I !II~ : ;9 I81B( 'I 4:!;9 I   : ; 9  : ; 9 I8 H}4: ;9 I : ;9 I k<4:!;9 IB: ; 9 II41B&I!I/  : ; 9 I8 : ; 9 I: ;9 I : ;9 H}1RBX!YW  1 : ; 9 I k 1RBUX YW !'".?: ;9!'<#: ; 9 I$ I8 % : ;9 I8 & ':!;9 IB(: ; 9 I) : ; 9 * : ; 9 + : ;9 I,4: ;9 I -  : ; 9!.: ;9 I/1RBX YW 0 1.: ; 9 'I 2>! I: ; 9!3 U4.: ;9 'I 51RBX Y W 6 I7 U8 : ; 9 I k 9H}:1;  : ;9!< : ;9 I8=.?: ;9 'I<> : ;9 I 8? : ; 9 @> !I: ;9!A.?: ; 9 '<B4I4C 1D4: ; 9 IE I 8 F4: ; 9 I G.?: ; 9 'I<H : ; 9 I k I : ; 9 IJ : ;9 I k K(L4: ; 9 IM.?: ;9 '<N$ > O : ; 9 I!8 P : ; 9 I 8 Q41R: ;9 IS : ;9 I 8 T.: ;9 ' U4: ;9 IV W :!;9!X.: ; 9 ' !Y!IZ : ;9 [ :!;9!\ ].:!;9 'I@z^ :!;9 _.:!;9 'IU@z` 1a41b.?:!;!9!'<c : ;9 d 1e:!; 9!If : ;9 g  : ;9!h  : ; 9!i : ;9 I j : ; 9 I8k : ;9 lI~m4:!;9 IBn1RBX Y W o4: ; 9 Ip : ;9 I 8 q !: ; 9!r4:!; 9!I s:!;9 IBt1RBUX YW u'Iv : ; 9 I!w  : ;9!x 1Uy : ;9 I 8z : ; 9!{|4I4} I8~ : ;9 II .?: ; 9 '<.:!;9 '@z 14:!;9 I.?:!;9 'I !5I !: ;9!!I/ : ; 9  !: ; 9!.?: ; 9 'I<1RBUX Y W 4:!; 9 IB41 >! !I: ; 9!4: ; 9 I?<< !: ;9  !: ; 9   : ;9 4: ;9 I?< !:!;9! :!;9!H}1X!YW! H}.:!;9! 'U@z:!;! 9 I 1U1RBUX Y W :!; 9 IB.1U@z1 % U$ >  &4: ; 9 I?' : ; 9   : ;9   : ;9 4: ; 9 I? < : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ; 9  I 8 : ; 9 I (  : ; 9  : ; 9 I k : ;9 4: ;9 I?5.?: ;9 n'I<.?: ; 9 n'I<.?: ; 9 '<H}41 4: ;9 I 4: ;9 I : ;9 .: ; 9 'I@z: ; 9 IB4: ; 9 IB.?: ; 9 'I .: ; 9 ' 41.?<n.?<n: ;  : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 'I : ; 9 I8 < ( : ; 9 I : ; 9 I I&I!I/  : ; 9 I8 : ;9  I8  : ;9 I k : ; 9  : ; 9 4: ;9!I '  : ; 9! : ;9 I I : ;9 I8  : ; 9 I k  : ; 9  : ; 9 I k  : ; 9 I $ > ! I 8 ">! I: ; 9 #4: ; 9!I $  : ;9!% : ;9 I 8& : ;9 I 8 ' : ; 9 I k( : ; 9 I 8 ): ;9 I* : ;9 +:!; 9!I,  : ;9!- : ;9 I . : ; 9 I!8 /4:!; 9!I!0 : ;9 I81 : ;9 2'I3!I4 !: ; 9!5  : ;9!6 : ;9 I 8 7> !I: ;9!8 : ; 9 I!9 : ;9 I 8: : ;9 ;  : ; 9!< :!;9!I k = : ; 9 I8>I ? !: ;9!@ I8A : ; 9 B : ;9 IC : ; 9!D : ;9!E!I/F !: ; 9!G>! !I: ; 9!H% I$ > J K&L4: ; 9 I?M'N4: ; 9 I?<O : ; 9 P  : ;9 Q  : ;9 R<S : ;9 T : ; 9 U : ; 9 I 8V  : ; 9 W I X  : ;9 Y  : ;9 Z  : ;9 [  : ; 9 \ I 8] : ; 9 I ^> I: ;9 _( `4G: ; 9 a.?: ; 9 '<b.?: ; 9 'I<( 4: ;9!I $ > 4: ; 9!I &II!I/ 4:!; 9!I  : ; 9 I :!; 9!I!8 >! !I: ; 9  :!;9!I8 > !I: ;9!>! !I: ; 9! !!:!; 9! :!; 9!I8!% $ > : ; 9 I4: ; 9 I?> I: ;9  : ;9 ( c&U&S|S|S|Ue0euP0PSPSP P\UV}o]&U&S|S|S|U\USS  PP$SS$  PP"s% %% %]3v3v3v @QU|U\USvoVU|U\U@Q3s3s3s@$QUSUSV|oVz\\UuU 3v3v3vUVUV VTT T0PSS0(0(DPDS0 S\\\ \__8_____TP2APUW0ff0P^P^P^PP( EP ^P^P^PP^^P^P ^]8G] 8G P)7P#]]]#   PPP\-\e\\\01MkPkopo~P10-1e11100000 P *sP.s4Ps p  p  p p p p p p @PUSQ]VSvS3s3s"v& && &\3s3s3s @Q0   U UUUuUuou#uUUu#U#sSSUlS@Q@$QUVUUUVUVUUVUVUV4V4^U^VUVT\TT\T\TT\T\T\4\4FTF\T\QQQQQQQQQQQQQQQRRRRRRRRRRRR4R4KRKRRRXXXXXXXXXXXX4X4RXRXXXSSSSssss0P000 00000040Vx0P101U9=P=BUU*UhU1011!@! ! !@! @  8@  @ @ 8 0 U\U\!T!VTVP]]SP u8VVtel$PSqPS0Psss2s2s2s<s< VVVV's'VVVV's' |8 ]NUNUXU(0(DsD\\X\r  r}S}P  X   T sTQ" q+ >+"E t+ >+ETQ+ >+TTQTdq;%dsQ;%55?Q?O@O^Q5??O OTPT^rQqTq .T? > q > 0t >0?Q >q Q 1U1SUSS1T1\T\\000000TPP111111<<SS^^#V#,v 5]V]bv qVV,],~}~~]}~11pVV1VSSP$8PP0>QQ>101ps#PPs# ps#P)SS)SSSSS101)11111PsP P P P<;;;8;Z;;;;;SSSS8SZSSSS\\\\8\Z\\\\00080Z00000 00080Z0000 k0kVvVVV080ZVVV0VP0TW^TT)QPWQQ0^^^8^Z^^^^k00008001011181Z1111   8 Z       @@@8@Z@@@@@ @<<<8<Z<<<<< <7U7VUA0AQs2%QUs2%#U^s|2%#^s2%s|2%#PpP1P?0?APA\]>b]]]]2u2u@Q@=$Q u#8p8T \ @R2v2vrUrSUSUSrTrV^TTV^TrQr_QQ_QA\\]]]]p p\\1 Q]q ]p$]q$%U% UU)T)ST SStE|P|| |a|pwPwT|T0P0P[0[0 0 [ [ [ [ [  [([i[VVVV1VxV\]] ]a]])T)ST SS@0@1 11QE`QRpqPIKpqKQPqrQ||||QQ .S.| t#8pV2s2s2sV1@?$Q@>$Q 4 s 4 s5S5$S$|4s4s@=$QSSS|||QQQqqqUTTTEtPP101R1S|QyqV            : N4N N N N 4  8'S'| 4 s 4 spVV1p \@$Qs#8@$Q2U2VUT]T/Q/QRZRXX]QXqS0P        2U2jSjoU u#!U"@>$!Qu0!R s#!U"@=$!Q!s2U2_U_U__TTT6Q6SPSQSS6R6^R^R^R^.^.MRM^\\\\|TTTT Q&TTTXR1SP13SP11|p"#VBV V V VB B  8VV'Vbb'b%PPPVVbbbb PPV   VTT T0VQQ0`   `TT T0`^^0UkVkpUpVUVVUVUVTgSgT8T8pSpTS2v2v2v@B$Q@@$Q@C$QU.S.3U39S9>U>DSDIUTIT s P s U#L #(P() s ).U#L S/U/UGU{T{_T_T_T_T_T_T_TGT{Q{SQSQSQSQS~QSQ~G~P8U#( PF P 5Y5~~P ~ ~ ~~~~~L000 ~  ~  ~  ~   ~  ~  ~  ~ L0000 0 P _PT0_0_C00000x0x0xC00000 R 0 Q 0R0Q0QR00G0 R r6qq# 3$v"#r"#pp# 3$v"#r"##vv# 3$v"#r"#vr# 3$v"# q"r"pp# 3$v"#q""v# 3$v"# q"v" rv# v q"r# 3$v"# q"r"pp# 3$v"#q""v# 3$v"# q"v"qq# 3$v"#r"#pp# 3$v"#r"##vv# 3$v"#r"#Q P !vRpv 0 0RpvQPvP,Y,~~ ~ ~ ~~~~~i~#  ~# i~iy~ ~gy cy y  y  y y JP PGVGI|TVGV T    5 5G QSTQTSQSQSQS~QSQ~G~  G   G   G   G   G     8 PFbv $@L$) PF$S$$P$MS v $@L$) =v $@L$)       8g8g g g g8 8  8p    p 8p    p  8p    p 8p    p 8USHUT~Q~ "Y"5~5S"P"5~"Y"#~"P"#~#0# "p#+"~#+~#+~#+ ~#+ ~#+~#+~#+~#+Y~P~02Q!Y!2~2^!Y!"~"^"1" @~#+~#+  Y~^1 v#!U"~!Y!~ P v P vvP vp vp @B p8cVcNVV VN~~ ~Nxx xNRR RN^^ ^y2Q2@y Q yR~#QQ 00 0 0G0v#8_ v#81Vp8TPy UUU\U\\&T&VTVVFQF]Q]]0$ p|83%U_ p|83% p|83% P SSPPKSU]PS10111^^^  u# |# T ^ Q @   |#!^!S @4U4SUSXSTTXT"R   @ <mUmSUSShTh_T__VVV^^^^P}"#}"#}"#}"#C}"#Cdw}"#ppp p  XX    bbbb 11 11 0011  X b8 U &4I T &4I!PPP U  T  T >   4I P PU\\bbP}}}d}w}U\\bbbb    PP\\bb+P+`4I\\bb bb  d w  PPS X]  SXX]XX0SQX]0 P|Pq 0 Q|0QUSU"T"T"Q"VQuusuU 0usU#606<P<\ p $ & v $ & Pu#8s#8\<U<VUVUVVV<T<]T]TVTp4%^^V^w @wNUkVkpUpwVS"KSTqS\^|ع^j\w1pS S 1S27S1271pSPv# PUVUVXVqTqTTTXTYQYPQ1!PQ1!XQ1!RZRXRXXXXXXYYYYXY$$$$$ SSXSssXs1P1X1    \I1H6 "'./'))V `'2 - 24Ix4C444C)##4I74I74I.. "3S |  XE"+=F <  ! 536;>n!(.EbEKIIIN ""9<DDKP ! V27X 6 sl   )"FP"FP 08Z8Z-5Wz#   >b$6?G&.2"    )" .=mr [ EJ]3:@  X 8G#-e")7<  $b(6TQ          ? Y R@t. t , X / >vX  e W] @ )/ >z"Yz<zXPww> .zX"N <Y$fg ]fY/! tJ1Y/;!/xR< .fqX/!1%/I!/x| t LVMtU< .fXXXzX vtw vt!YXYY* tJ>>Z~X=GiGG.thf=~"N Y$fCKV~J XL~"N X=$f=~"N .$X*g~Jv tKu ....rX flf  t        X. J/ /.!t/tJ1K/;!/sXXYX2fkCty]tDO(yJt y.f ..wXi X.XXY 6xtAAhKt<J t<J  xf+ W_!'h 0t<t ];X Lu#wv  J%JytX%.wgr gj yJ . yfDXst K s! <Y#rt J+)J=*(<K XJ<J Xr( rJ( ttfJX<giBX$wv%.w  2X .v  /5'<u4&Jg&yvX5'<u4&Jg&yZXst s! *'u(uTX(s#_ JXXtX. XXXtXytRpXJE X t< Xzs<^sX [KXJX J(t JX< R<DJ?s]t   z) tjX"zt) <z.=I"e= Y sV!(  z( hX.!s t sV!(f  z(+u < ..`s.!J`!)y. ytJXv<< w]t zv<t v<t v? / ~) t"~<)==I"e= YK ~(v v<t (-(x|g(w/&&=k J>f"ffQytB<  w KuuJy htJrX$uu6v3s4u/K]-NzzY |( B tBwt=< |t  |X<X~u<<  y>fhv<J Jus  r<<    rVf!(v   }(!<}tfXv<t #fxxtu C w!Yv#  vvf  Kv .f w`!Jv # vvf  v .f wX wlXu X (y~ {v#  vvf  Kv .f w!t W r#f XvXf Yv #J}.Y!!s=Y {  {t  {tX!JY {  {t  {tXu~X @XXO ;D  <D 1  vX X Wt X |X 5 M<, 5yJ 4z<  Tf<, ^zt  R< . K 2  NtX4(/12/<%K;#u#ju    X0X..tr2/<%K?#ux#nK wtX|(~zztBJY<fE~<.~t~i< < J {Z N <t<<  v xZ##o<xJ#x</tJ<  xX. w  ~t  ~ X ~  X<QJ|f+ Xfp  A7% t*tg~ <t/XKOXzt XJ  ~t |   |X~Z".zn$ztn  k<V6E#~f  J  J  J$  X<X <.Oy(q%A&yJtytHX)yJtX ("rt fXtst ttXtX#g(vZv<t vX tXf'.# ."OUzXXY I 4  LX6sX%( "(}"a:/t O v   v.J trvottLo]tK%ott< .}Xq<t yX%y7Yy6txJmf'u{</y$yX+K{YKy<Y Z6x394uX[Ke#Jg JXjxw0e%3(wX(`uX( auXY u X u(( _uX"xgX(X("}"((w("VUx(#oq# v = U y$ yz%(( fyXtX#XX 4 vt8XJ<X< <Lop #<KtCp]tK~B 8qot  zf(x"(tX(StX(-"(7ht  v   v.J Btrv r K  r.  r  o #.KtX%o]tKntt  r. X# >VZ `..!J.. K         device_attribute___GFP_THISNODE_BITlineget_budgetlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEmsi_caphost_blockedscsi_dma_unmapdup_xol_addrshared_tagscapture_controlnr_wakeupsstartput_budgetstart_brkbudget_mapstatic_key_modreq_flags_td_ino_softlimitxregs_stateWRITE_LIFE_LONGparameter_countdma_flagsuclamp_setag_listElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statebd_devicefree_queuesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersrq_end_io_retzone_wplugs_lockbridgetwa_free_request_idcommanddriver_branch_lowd_releasestates_d_opmce_whole_pagestatsreadblk_mq_queue_dataTW_Ioctl_Driver_Commandnetlink_nsneed_qstwa_host_stats_attrswap_deactivateblkcnt_ticq_treesi_code__UNIQUE_ID_version594thread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributessbitmap_wordpci_set_mastercached_rqscopy_from_userset_child_tidblk_unique_id_overruntmpfilercu_read_lock_nestingem_perf_statemin_nrtick_dep_masksbitmap_queuefifo_timelist_copy_from_userthrottle_disksi_errnoromlens_inode_lrusector_sizesrcu_size_stateblk_plugscsi_host_stateneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startDMA_FROM_DEVICEdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTeh_should_retry_cmddevfnregsslice_maxlast_switch_countpci_set_drvdataqsize_tfilesparameter_iddevicesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolallow_restartbd_mappingsym_vvar_pagemodule_sect_attrsreturn_instanceschedulertimesoftirq_activatedSHOST_RECOVERYpdevioctl_wqueuezone_wplugs_workDID_BAD_INTRpci_power_tclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idgeneric_buffer_virtautosuspend_delayunsigned intSUBMITTED_BY_SCSI_ERROR_HANDLERgendisk__compiletime_assert_116spc_timelimits_instancesdescseqcountremove_busoom_score_adjeh_entryoldbitd_seqbi_crypt_contextinit_requestia_vfsgidprot_capabilitiessize_tacpi_device_idptm_enabledprepare_to_wait_eventcap_permittedTT_NATIVEout_remove_hostminor_numbertransfersizeclass_irqsave_is_conditionalserver_pick_taskregister_chrdevpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idx__compiletime_assert_39error_statercu_tasks_holdouttarget_listno_64bit_msipasid_activatedpi_seget_offset_ctxcore_forceidle_sum__compiletime_assert_127exit_requestfreeze_ucounti_ctime_nseccpuhp_deadneeds_fresets_remove_countsyscall_workdevice_physical_location_vertical_positionscsi_add_hostatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_headtwa_aen_drain_queues_vopblk_queue_rq_timeoutperf_eventf_securityi_sb_listvm_rcupgtables_bytes__compiletime_assert_45target_destroyget_link__compiletime_assert_47__compiletime_assert_48fmode_t__compiletime_assert_49STARGET_RUNNINGcputime_atomicno_difpci_channel_state_thost_lockrestoredelayed_callTW_Lockbi_itermutex_lock_interruptiblemax_nr_cid__compiletime_assert_137_statustwa_scsi_queue_lckmark_deadd_sibkernel_ulong_tscsi_dispositiondma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedtwa_error_tablehdr_typelimits_lockdl_dev_stategsindexexpires_nexti_io_listemulatedf_ep__compiletime_assert_51srcu_barrier_seq__compiletime_assert_54__compiletime_assert_55msi_lock__compiletime_assert_56__param_use_msilinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2num_resets__kernel_timer_tdpc_rp_extensionsclass_srcu_is_conditionalmsecenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskno_highmematomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodews_activetmf_in_progressfile_leasescsi_device_statemodelscan_objectspid_typewb_errcputimercopy_to_usertrace_recursiontwa_fopsbv_lenhotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispdma_drain_bufrcu_specialaen_countclear_child_tidcurrent_timef_refextable_lenbacking_dev_infosaved_scratch_registerbyte8_offsetdev_pagemap_opss_stack_depthchange_queue_depthdata_vm__s32entry_eiptaskstatshugetlb_usage__dummyratelimit_states_pinsscsi_cmnd_submitterattr_entry_ptrstarget_dataget_next_child_nodeFAULT_FLAG_WRITEres2state_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDtwa_empty_response_queue_largeblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountinq_periph_qualforce_atomicmmap_compat_legacy_basedefault_groupstwa_interruptpollgraph_get_next_endpointsupported_eventsresvnr_wakeups_idleFORTIFY_FUNC_memsetSDEV_DELio_cqres_attr_wcelf64_symdevice_blockedlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSuse_192_bytes_for_3fBLK_UID_NAAtwa_free_device_extensionp2pdmablk_mq_req_flags_tsyscoreprot_guard_type__s64dqi_bgrace__kernel_pid_tstatic_call_modmax_cmd_lencommand_packet_phys_timerdma_map_opsma_external_lockdevice_physical_location_panelhost_resetuid_tflush_requiredpcie_flags_regsum_block_runtimehctx_listpgmapmin_perf_statektime_comparestrnlendq_opsdev_datarcu_tasks_nvcswcrypt_keyslotwriteinit_connect_resulttypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcattwa_shutdowndma_pools_addr_lsbi_generation_sigpollprocentmxcsrdevtsglistargd_rt_spc_hardlimitbi_end_ioblk_holder_opsfirmware_commandnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexstarget_sdev_userdriver_datathread_headlast_queue_full_time__bad_copy_fromend_iodev_pm_qosbi_sectormap_typeDID_REQUEUEf_opTAG_TW_Ioctl_Driver_Commandpids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizeptm_granularityshost_groupsid_tabledq_sbptm_rootgeomhost_norun_worksighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entrysdev___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestedalloc_time_nsnr_forced_migrationsscsi_dma_mapseq_operationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirinit_hctxpcie_link_statesockSCSI_EH_NOT_HANDLEDbi_write_hinthash_lenget_policytmf_work_qHRTIMER_RESTARTexternal_facingSDEV_QUIESCE__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_baseDID_SOFT_ERRORdevice_is_availabledquotdl_runtime__ret_do_oncenumbersbi_vcnttry_rc_10_first_softexpiresrq_flagskey_user_hugetlb_cgroup_rsvdscsi_doneskip_ms_page_3ffaultableio_comp_batchstate_mutexshutdowndq_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueptrace_messagenum_trace_eventsptm_cap_sys_privatealignment_offsetopen_mutexscan_finishedinit_fs_contexts_subtypeheaderfuncperf_event_contextTW_Eventtlbflush_unmap_batchsoftcrypto_kobject__sifields__UNIQUE_ID___addressable_init_module597twa_aen_completercu_read_unlock_specialread_bytesktime_to_msfsverity_operationswake_q_noderequest_key_authdispatch_busySAM_STAT_INTERMEDIATE_CONDITION_METallowedvirtual_dr6kprobes_text_sizestatic_call_sitescontrol_codethread_group_cputimernuma_scan_period_maxbadblocksheader_descstart_stackwatcherskmalloc_cachescompletionsg_copy_from_buffersw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobeshow_optionsdiskbpf_raw_event_mapsize_is_constant__baseFREEZE_HOLDER_KERNELcore_nodepri_capcurr_nrsector_ttrc_blkd_cpuin_memstallpermissionpending_tail_utimepm_subsys_datahost_failedbsg_devmax_sector_countpasid_featuresscsi_target_stateget_dquotsfree_tailnum_orcsclass_task_lock_is_conditionalshow_rqFAULT_FLAG_MKWRITESTARGET_CREATED_REMOVEoom_reaper_timers_uuiddestroy_dquothost_eh_scheduledd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printktwa_exitvm_operations_structTW_Initconnectbin_attrs_newrpm_autosuspendbio_alloc_cachebi_bdevconfig_rrs_sviov_basetwa_show_statssrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrendirty_folioblk_status_tis_softcntsRPM_SUSPENDEDreclaim_statetwa_aen_read_queuevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infosaved_cap_spacedriver_branch_highstats_sectorserror_remove_folioold_time32_tcore_kallsymslast_queue_ramp_upsrcu_parentdetachedclock_op_might_sleepTW_Response_Queuetwa_removeenvp_idx_head_1_head_2sg_reserved_sizebd_size_lockbackresponse_request_idstate_add_uevent_sentblock_cfg_accessi_hashresulthlist_nodesprintfio_uringtw_lockmax_idcore_occupationsimple_tagswritelftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qcmd_per_lunfileattr_setrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsproc_nameonlineruntime_resumedup_xol_workqueuestart_time_ns___GFP_WRITE_BITMEMORY_DEVICE_PCI_P2PDMAsdtrtotal_vmjobctls_time_maxnode_list__UNIQUE_ID_description592dio_offset_aligndelay_workworking_buildTAG_TW_Eventoublockrecent_cidkernel_paramdeferred_resumektime_getd_spc_softlimitreported_split_lockworking_branchgfp_tswap_slot_free_notifytwa_check_bitsseccomp_filterstimesg_copy_to_bufferi_mmapthaw_superd_lrusignal_structperf_event_mutexpri_enabledreset_donecan_queuecrcspgdval_tfree_headpage_linksetattr__bad_copy_tof_mappingnoinstr_text_startprepareBLK_EH_RESET_TIMERbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclScsi_Hostrom_attr_enabledpids_activedriveri_opskip_bus_pmldt_usr_semtw_ioctlkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorescan_mutexpci_disable_msicredjump_entryno_write_samemax_host_blockedlist_lru_nodetagset_refcntsrcu_gp_seq_needed_expinterval_expaddress_space_operationsRQ_END_IO_FREEspinlock_tscsi_add_host_with_dmashow_info__task_fpstateDID_RESETmask__ret_oncewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultthis_idlocal_timekstatfssitesTAG_TW_Ioctl_ApacheDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsiminoraltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjtwa_resumesrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDpage_listexpires___GFP_HARDWALL_BITnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGvendor_idthreadsym_timens_pagesriov_configures_time_minbusn_resdivisors_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalsed_weak_revalidatecmd_lenremovedshow_pathPIDTYPE_TGIDpriv_flagsMQ_RQ_IDLEcurr_ret_depthac_utimebus_list_dummy_pkeysense_bufferTIMEOUT_ERRORiommu_mm_datamce_countswap_info_structhost_waitsequencewas_resetrt_spc_warnlimitnr_reserved_tagsac_flagsched_rt_mutexcoredump_datataskstwa_empty_response_queue_pidscsi_cmndaddress_spacemm_context_t__q_sizeis_probed__call_single_nodestartupof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatordma_alloc_coherenttwa_decode_bitspanelclass_idtwa_slave_configure__read_overflow2_fieldqueuecommand_may_blockinactive_timer_pkeyfilenames_export_opfront_padno_start_on_add__mptri_flctxioctl_timestashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqtwa_device_extension_countpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddrarch_test_bittime_stamp_secs_wb_errshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descsskip_settle_delayskip_vpd_pagesexec_vmrw_copyfscrypt_inode_infost_name__SCT__might_reschedmmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoirq_managedqueuecommandalloc_inodeexit_cmd_privuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidscsi_set_residrseq_sigfw_builddev_pm_domainlimit0limit1nr_zonesis_sourceevent_workmigrate_modebyte6_offsetbio_poolwakeup_preparedpoweroff_lateftrace_callsitestimezoned_hashis_confidentialdl_bw__real_strnlenkobjfsyncmtd_infotwa_initialize_device_extensioni_flagsblk_crypto_keyslotblk_eh_timer_returnlimitskernel_siginfouprobes_statemanage_shutdownFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statsprint_hostpushable_tasksplatform_datad_comparesighanditerate_sharedtw_devis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapcommand_que_valuealloc_dquotpm_messagemay_split__q_size_fieldmem_cgrouplast_update_timerobust_list_headmultiple_queuescurrent_state__ubuf_iovecignored_posix_timerscount__compiletime_assert_44SCSI_RETURN_NOT_HANDLEDGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__compiletime_assert_46vpd_pg0__kmalloc_noprof__compiletime_assert_134s_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventtw_pci_devhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesioctlshowpci_sriovignore_hotplugd3hot_delayunsigned charumount_beginvdso_test_bitmmap_legacy_basepipe_inode_infocur_bus_speedsecurebitsscsi_remove_hostpartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollscsi_host_statusbi_poolcompat_uptr_tuevent_opsrequest_irqsg_tablesizepref_windowpoll_biotwa_check_srlslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalwce_default_onsuspend_latewakeuplater__check_object_sizeeh_abort_listcg_listlink_bwctrlDID_BAD_TARGETsrcu_barrier_completionsdev_gendevsaved_config_space__compiletime_assert_57__compiletime_assert_58__compiletime_assert_59driver_flagssg_timeoutelementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapuse_16_for_rwwaitersdriver_srl_lowsubdevicesessionidtwa_reset_sequencedefault_lock_sifields_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_infoDMA_TO_DEVICEpadding1padding2force_runtime_start_on_system_startllistunmap_limit_for_wsdebugfs_entrySDEV_EVT_LASTacs_capelemnr_retriesbiotailsigval_tsectorsalimitundo_listKMALLOC_RANDOM_STARTmissedreport_zonesbi_idxquota_readst_shndx__compiletime_assert_63cmd_flagsio_start_time_nsfreeparti_wb_frn_avg_timeswap_lockbd_fsfreeze_countfile_ref_ttypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wqtwa_poll_status_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typetime_remaining_msecmtimeserver_has_tasksvm_faultzone_wplugs_err_listrequest_threaded_irqoom_score_adj_minDID_OKkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tsiblingshotplug_slotpathst_sizeDID_TRANSPORT_MARGINALrmtpwait_sumnum_tracepointsupidout_free_device_extensionexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalrepeat_countconsumersshost_datakernfs_elem_symlinktwa_fill_senseclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerbreserved_tagsunlinkSAM_STAT_BUSYperiod_contribrcu_node_entrystart_scan_seqnr_ctxfsgidswap_rwneed_parent_lockrcu_syncproc_dir_entryvm_opsiopollactive_queuespagesizeHCTX_TYPE_READdisk_names_blocksizevm_pgoffRQ_END_IO_NONE__remSDEV_EVT_MODE_PARAMETER_CHANGE_REPORTEDSDEV_EVT_FIRSTauprobeno_uld_attach__retnuma_workupdate_timeptrace_dr7no_d1d2shost_dev_call_addrrescue_lockmax_segmentsloginuidcheckktime_get_real_secondsexpiryoptimistic_spin_queuespin_unlockdl_defer_runningbi_bvec_doneroot_blkgstart_index__lstatebroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsnr_mapsmod_namesdev_groupsproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlsched_tagsrseq_lenjiffies_at_allocmodule_attributepollfdnr_wakeups_remoteSDEV_EVT_POWER_ON_RESET_OCCURREDSAM_STAT_INTERMEDIATEpci_busllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareresponse_que_valueclass_spinlock_irqsave_is_conditionalrseq_csprimarynum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinktwa_initmigration_flagsnon_compliant_bars_pincountrq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtwa_command_mappedtgidwrite_protect_seqsilence_suspendltr_pathcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holdertwa_aen_sync_timeend_codeqspinlocksg_list__kmalloc_large_noproflru_geninsnfilldir_t__must_check_overflowdl_non_contendingdir_contextTW_Command_Apachetracepoint_ptr_tutasksdev_statesched_entityd_spc_hardlimitmq_freeze_wqlong unsigned intsleep_maxmmap_baserescue_workio_context__condrevisionDID_IMM_RETRYquiesce_depthhctx_tablegpl_symsseq_showswait_queue_headcow_pagetwa_device_extension_listsectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblesequence_idquick_threadstime_sliceobjcgpci_device_idarch_clear_bitnoderesetseverity_codetwa_chrdev_opensdev_targetvm_lockno_cgroup_migrationnextevts_writers_key__countdma_free_attrsxcomp_bvcma_areadma_set_maskstatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingexec_update_lockexpecting_lun_changeatomic_write_hw_maxl1d_flush_killi_versiontwa_addr_tuse_10_for_msDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentlegacy_memfirst_minoria_sizein_hrtirqs_master_keysconst_test_bitwchar_addr_bndkernel_symbolfw_on_ctlr_arch_idsubsys_databi_statustv_secblk_integrity_checksumpid_ttask_listftrace_sleeptimerun_nodeblock_device_operationsevent_indexnr_phys_segmentsma_rooturing_cmdnr_failed_migrations_affineresiduser_cpus_ptrpi_top_taskno_read_disc_infoslotactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writeutil_sumst_otherTAG_TW_Locki_mutex_keyksethrtimer_clock_basevruntimehctx_typedisable_depthasync_scan_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsnr_integrity_segments___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespaceHCTX_TYPE_POLLvfsuid_traw_spinlockuse_10_for_rwtimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flagssglistl1sssriov_set_msix_vec_countkfreeread_posstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuestatus_reg_valuedqi_dirty_listmax_timemod_tree_nodeerror_indexf_sb_errwritepageFORTIFY_FUNC_strlenstatic_rqscodegtimedisconnectsigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimedriver_build_lowtag_set_list__kernel_timespeclocked_pendingreset_preparenr_deferredfown_structfeatures_lockedtracing_graph_pausequeue_numpermSDEV_BLOCKcompat_robust_listbi_blkgnr_hw_queuesis_msi_managedktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uid__wake_uptablesDMA_BIDIRECTIONALbi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmfortify_memcpy_chkdebugfs_idSAM_STAT_CHECK_CONDITIONguest_permmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_diskrq_nextsp_offsetsrcu_cblist_invokingi_lockd_nameSDEV_EVT_LUN_CHANGE_REPORTEDcpuhp_onlineget_ownershipufdscrypt_ctxexe_fileTW_Ioctl_Buf_Apachenr_scannedpcp_listpid_linksaen_codes_sysfs_nameMQ_RQ_IN_FLIGHTq_size_fieldrefcountnr_activevaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipqc_dqblkretry_hwerrormmappedseqcount_raw_spinlockbd_holder_dirbroken_intx_maskingkill_sbd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parameterseh_timed_outi_write_hintfxsaveprocess_keyringlist_op_pendingiotmo_cntDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrno_scsi2_lun_in_cdbclass_raw_spinlock_irqsave_try_is_conditional__UNIQUE_ID___addressable_cleanup_module598__ret_condshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igracemax_slack_shiftstarved_listclass_rwsem_write_try_is_conditionaltwa_string_lookupthaw_noirqopcode__sgloffsetpreempt_notifierssrcu_last_gp_endSAM_STAT_COMMAND_TERMINATEDmax_channels_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_lockDID_TRANSPORT_DISRUPTEDsegment_boundary_maskout3VTIME_IDLEstatic_keyscsi_timeout_actionremoves_magicdl_overrunallocsubvendord_parentsys_tztransparentpayloadac_minflti_sborig_nentsfw_arch_idblk_mq_hw_ctxkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsofflinescsi_host_allocatomic_write_segments_maxseverity__reservedatomic_openbio_end_io_tstart_prevent_timeTW_Param_Apacheretrievedos_specificcondreadahead_controlblk_tracesubordinate__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesbd_devslave_destroyread_newsignalfd_wqhmmapmodnametw_initconnectasync_put_workpending_request_countmknodpri_reqs_allocctxsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapscsi_sg_countdma_alias_maskwritepagessched_statisticsheadminors__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampsuper_operationsno_check_resetbi_cookiesplice_eofnoop_llseekcheck_copy_sizesam_statusutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAnentsbd_holderspt_regsTAG_TW_Response_Queuewhichpipe_bufsto_userKOBJ_NS_TYPE_NETctx_idmap_nruse_16_for_syncd_rt_spc_warnspci_write_config_wordq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lockbitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoats_capblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsFORTIFY_FUNC_memscanparamdev_flagsvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typebroken_parity_statusdiskseqmsleepi_pagesatomic_write_hw_boundaryhlist_bl_headino_warnlimitcommand_packetfasynclegacy_ioi_rt_spc_warnlimitdoe_mbspage_fragwrite_bytes__param_str_use_msichardomainunix_inflightholders_dir__wq_entryinit_cmd_privfpu_state_permi_fsnotify_maskbio_vecis_addedari_enabledparameter_size_bytesgraph_get_port_parentTW_Command_Fullmax_zone_append_sectorsSDEV_EVT_MAXBITSaen_clobber__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_alias__iovcpumaskmq_hctxdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimepending_eventss_rootsdma_data_directiond_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nr__this_modulebio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tcapacityno_report_opcodesrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitsdata_buffer_length_adjustedpage_freebridge_d3pci_release_regionsparentspecial_vec__dummy2atimecopy_sensecopy_file_rangeinquirytask_cputime_atomiccommit_rqsuser_definedkey_typefw_on_ctlr_branchcopy_overflowget_named_child_nodelaunder_foliocurr_targetnumberis_suspendedarch_test_and_set_bitdma_lengthhotplug__keytimeout_workburstpci_enable_msietypeei_funcsmodule_kobjectactive_memcgdef_flagsd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updatetarget_blockedvendorcap_bsetmutex_locktwa_host_groupopen_modearchdata_sourcepower_statesingle_lunnr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasesmax_discard_sectorspcie_mpsss_bdev_filemax_posted_request_countnuma_faultswork_qunregister_chrdevblist_flags_tlinux_binfmtpage_table_lock_sigfaultcounterskasan_check_readname_linkcmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typesriov__compiletime_assert_62policysharedwait_queue_entrydismissd_real_typelookahead_bandio_portseq_start__targetsdriver_versionrq_qos_mutexdo_soft_resetzone_wplugs_wqerr_specific_descraw_lockd_dnameget_dqblksysfs_emitwait_indexscsi_levelremaindermax_hang_timecpus_masksubdirstask_groupstarttimeiounmapmmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcecargpmin_sliceargs__poll_tfwnode_operationstarget_allocshow_devnameTAG_TW_Device_Extensionlogical_block_sizetwa_poll_status_gonerun_delaytailsblk_flags_tlinenoSDEV_EVT_SOFT_THRESHOLD_REACHED_REPORTEDbi_io_vecbase_pfnget_inode_acl_addr_pkeymigrate_foliocustom_sliceaer_capthread_keyringhosttkparam_arrayutimeDID_ABORTsecurity_supportedstart_codeset_bitis_managedis_hardiorequest_cntfsbasecompatiblesubsystem_deviceSHOST_CANCEL_RECOVERYktime_ms_deltaclock_listattrstz_minuteswestdynidseh_deadlinecpumask_tswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitymight_reschedtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEsoft_reset__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpustatus_blockshrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainbios_paramparam_ops_int_sigchldtest_and_set_bitpi_offsetdiscard_granularityfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetmax_lunnext_cpu__twa_shutdowntime64_ti_blocksnuma_faults_localityhas_child_subreaperrom_bar_overlappref_64_windowcommand_packet_virtdiv_u64_remi_aclmemset___GFP_ZERO_BITwrite_newlist_lockpm_domaininstrument_atomic_read_writecpu_bitmapipi_liststatic_call_keyutil_estucountsmem_lenBLK_UID_EUI64qc_stateset_rq_budget_tokenhandledsoftirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagshandlerswp_entry_tbi_inline_vecsbsg_deviceuint64_tTW_Command_mapcountdomain_tagpasid_requiredhang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventsg_prot_tablesizeDID_PARITYget_unique_idset_performance_statefile_inodephys_addr_tSHOST_CREATEDclass_preempt_is_conditionalcfg_sizeconsumers_cntmodule_memoryinternalpi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtp_flags_2amax_bus_speedpci_driverd3cold_delaydma_cleanupmaple_treeKMALLOC_DMAdentrylast_mergecpu_itimerpercpusriov_get_vf_total_msixlast_queue_full_countrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupsaved_end_ionr_threads__i_nlinkpushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listmanage_system_start_stophiwater_rsskretprobe_instancesshostrangecpu_addrfutex_exit_mutexpm_onlykernfs_iattrstag_alloc_policytrc_blkd_nodedata_buffer__sectorbuffer_lengthd_spacegraveyard_linkout_release_mem_regionxol_vaddrsplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagsbase_addrTAG_TW_Compatibility_InfonvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingis_physfni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typestate_savedi_rdevirq_reroute_variantself_exec_idkernfs_opsfile_lock__register_chrdevMODULE_STATE_LIVEclearedclass_maskstopnr_migrationsa_opsreq_listxa_flagstwa_probefreeze_raw_spin_lockbin_sizemap_busclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITcurrent_fw_arch_idnr_sectorsDID_PASSTHROUGHd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNBLK_EH_DONEset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqblast_resetuidhash_nodesaved_tfblk_mq_queue_mapElf64_Xwordold_timespec32device_configurelock_class_keyrequest_idnum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXktime_add_msnlinkis_virtfnpercpu_refhorizontal_positionioerr_cntTW_SG_Entrypref_node_forkjiffieswait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxDEV_DMA_NON_COHERENTresult_maskscsi_sg_copy_to_bufferstate_syncedpp_magicset_featuresdquot_operationsmappingresource_sizeRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_file___GFP_COMP_BITmax_device_blockeds_stateuser_sizetablefw_branchdev_pm_opscdrom_device_infoscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkkmalloc_typen_io_portdispatch_wait_lockqstrma_flagsnr_ia_rangesmax_user_discard_sectorsno_msifutex_stateorig_pmdcurrent_fw_buildqueue_lockshpc_managedacct_timexpdSHOST_DEL_RECOVERY__rcu_icq_cachesizeem_perf_tablewakeup_sourcesize_sensef_posnext_posix_timer_id__kernel_long_terror_strtask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsparameter_len__le16alt_lenSAM_STAT_TASK_ABORTEDcinblockextableexitrpm_autosuspend_delay__UNIQUE_ID_use_msi596kernel_param_opsbus_dma_regiondpc_capio_uring_cmddirtied_whenpdt_1f_for_no_lun__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headTAG_TW_Command_Apachefw_on_ctlr_buildrcharfutex_pi_statekstat__kernel_uid32_t__le32dispatchtriesq_lock_cls_keyaccess_stateinit_wait_entryDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockwake_batchgeneric_buffer_physget_namefwnode_endpoint__intSCpntopt_sectorsepoll_watchesprealloc_pteprot_typeborkenSDEV_CANCELdqb_curspace_entrygp_statebitsetload_avgsched_dataaccesscstimepcie_capcompletion_cntcfs_rqrq_end_io_fn_uidprot_opst_spacemm_cid_next_scanns_typescan_startmsix_enabledac_majfltpasid_enabledposix_cputimers_work_uppermodule_param_attrsshort unsigned intbus_flagsunit__le64same_target_siblingsi_mutex_dir_keymq_pollq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysdma_handleorig_ptepasid_capopcode__reserveddqb_curinodesload__s8sense_datapci_get_drvdataspin_lockinvalidate_lock_keydma_maskprealloc_mutexnanosleep__already_doneSTARGET_REMOVEeh_host_reset_handlerFORTIFY_FUNC_kmemdupsbq_wait_statedq_dqb_lock__kernel_ulong_tvolnameio_minSAM_STAT_ACA_ACTIVEdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathHCTX_MAX_TYPESdio_mem_alignbtime__u8is_roxlockrlim_maxslave_dirDEVICE_PANEL_FRONTrestartsruntime_deferred_listd_waitlocal_fwnodequeue_flagslist_lru_onedevice_physical_location_horizontal_positionseq_stoppci_dev_flags_tdev_id__unregister_chrdev_copy_to_userkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidflagaer_statss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeschedule_timeoutclass_device_is_conditionalqueue_rqsactual_parameter_size_bytesshrinker_idbio_setrootoom_reaper_listscsi_device_handlershutdown_presym_VDSO32_NOTE_MASKscsi_devicewdtrbpf_storagepci_enable_device__data_lenmq_mapno_callbacks__u16timers_activewait_countalloc_hintsig_okdelaysqf_ownerreadaheadkmalloc_cache_typestart_stop_pwr_condmutexpgd_tnr_cpus_allowedeh_abort_handlerdiscard_alignmentraw_spinlock_tkey_tagsysdatafs_flagswordworkpgprotval_tkeytypefortify_memset_chksigpendingmq_freeze_depthfsindexshstkslave_configurereserved_tagssrcu_sspSDEV_CREATEDwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdevtz_dsttime__u32ptracedtrc_reader_specialdevice_get_match_datapci_disable_deviceHPROBE_GONEactive_timei_sequencepool_datatwa_host_attrspci_vpddisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfsubsystem_vendori_dir_seq__UNIQUE_ID_use_msitype595irqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmauclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typedpc_rp_log_sizeimm_readyBLK_INTEGRITY_CSUM_CRC64f_iocb_flagsiodone_cntpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infooverride_onlytwa_majorFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_truedisk_events_disable_depthweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacitydma_addressvm_startSAM_STAT_CONDITION_METsrcu_gp_seq_neededtag_list_lockunused_hctx_lists_flagsget_rq_budget_tokencpumask_var_tfaultalternative_gpt_sectorscsi_sg_copy_from_buffershow_statsdl_densityfreeptr_tset_dbd_for_msread_dqblkintegritydq_flagsread_before_msnext_cpu_batchDD_CLASS_TYPE_DISJOINT_NAMESpci_devp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgdma_boundaryworking_srls_time_grankernel_cap_tSUBMITTED_BY_SCSI_RESET_IOCTLnon_rcuwait_listrequest_pendingpinnedhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpresponse_quei_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BIT__mod_device_table__pci__twa_pci_tblTAG_twa_message_typeSDEV_EVT_MEDIA_CHANGEnum_kpin_execvehost_tagsettlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_lockno_report_lunss_dquotmax_hw_sectorsfolioqtagsprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffADD_TO_MLQUEUEsyscall_user_dispatchrcu_tasks_exit_listmem_addrarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_id__p_lenrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10twa_aen_severity_lookuppud_trt_spc_timelimitsym_int80_landing_paddma_set_mask_and_coherenttailia_atimelasttlb_ubcbi_issuequota_format_typemsi_enabledseekstask_structbudget_tokenDID_ERRORrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memhost_self_blockedarch_spinlock_tsubmit_bioblk_flush_queuei_mtime_nsecperformancemmlisthd_geometrymanufacturerdevcapfw_on_ctlr_srltwa_scsiop_execute_scsi_completesuppress_bind_attrsRPM_RESUMINGreg_offset_raw_spin_unlockgsbaseSDEV_EVT_ALUA_STATE_CHANGE_REPORTEDdispatch_waits_quota_typesinternal_tagf_llistmq_freeze_locki_nlinksdev_devbranchwrite_begingroupserr_handlerno_vf_scanpi_blocked_onpci_try_set_mwis_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_serverSCSI_EH_RESET_TIMERtrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_supers_inode_list_lockelevator_queueruntime_idlesweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgmax_sgl_entriesntabdevice_typemaj_fltarch_rwlock_tctx_mapSHOST_DELclock_basecdevmy_qgroup_leadermkdirdma_free_coherentnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalfinish_waitbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosfsavekeyring_index_keySAM_STAT_GOODqrwlockoverflowFAST_IO_FAILSDEV_EVT_CAPACITY_CHANGE_REPORTEDfile_ra_stateuser_structon_rq__p_size_fieldfs_contextmempool_alloc_tTAG_TW_Command_Fullprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vffree_irqcylindersunsafe_warnllseekfoundDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizecmp1rcu_nodeinit_nameunfreeze_fstwa_chrdev_ioctlintervalclasslast_mm_ciduntrustedmax_open_zonescookiebd_stampparameter_dataSTARGET_DELtargetstarved_entryseveritya_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_trequest_id__lunls_maxbytesreal_timerd_ino_countlast_cpumax_pending_request_countilenmnt_flagsvm_structsense_lencred_guard_mutexbusymajorpci_opssigcntcheck_object_sizehrtimer_cpu_baseresourcescb_headcheck_quota_fileFORTIFY_FUNC_memchrattributerestrict_linkdev_archdatatwa_poll_responsei_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cachetwa_interrupt_bailchrdev_request_idclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrtry_vpd_pagesi_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descpci_request_regionss_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackirqreturn_tlast_queue_full_depth__compiletime_assert_451dockdev_links_infoloff_tthread_pidinquiry_mutexsrcu_gp_seqia_rangesno_command_memory_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallseh_actioni_default_acleh_target_reset_handlers_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_masknr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorspci_error_handlersWRITE_LIFE_NONEWRITE_LIFE_NOT_SETktime_afterpadding__init_waitqueue_head__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namestarget_busys_mtdkparam_stringpowerma_lockcleanup_rqevent_flagssched_delayedbd_statsbi_sizesupported_modescsi_device_eventsize_headermodule_state__write_overflow_fieldmq_kobjlast_used_at__mutex_initvm_endlast_queuednuma_migrate_retryuser_ns__statefirstiommu_groupdispatch_fromdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keyscsi_bufflenvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsis_hotplug_bridgeia_ctime__fortify_strlenFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progressnewcommandsrcu_barrier_mutextwa_aen_queue_eventi_private_dataElf64_Halfuse_autosuspenduse_msiFORTIFY_FUNC_memcpynsproxycan_wakeupxol_areatransporttrlockfl_owner_t_rescls_mskia_rangeeuidwaitscsi_scan_hostbug_tabledirtied_time_whendma_drain_lensequential_io_avgDID_BUS_BUSYnum_trace_bprintk_fmtqueue_ramp_up_periodvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpdev_set_drvdatabvec_iterctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenpme_supportdqb_btime_nr_pages_mappedutf8datascsi_host_putmm_usersbd_holder_locktable_ids_ids_dentry_lrubp_offsetSHOST_RUNNINGblk_crypto_profilefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkoom_flag_originDMA_NONEcounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_worknum_sectorsksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliodebugfs_dirdriver_managed_dmaqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaTAG_TW_Initconnectdl_timerdriver_build_highi_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDretvalsysv_semanon_vma_namefileattrlong long unsigned intanon_nameopen_partitionsend_io_datablkcg_gqmap_queuesia_filesival_intnuma_preferred_niddma_need_draininstrument_atomic_write_hugetlb_cgroupdentry_operationschannelmemcg_nr_pages_over_highd1_supportqueue_offsetarch_uprobeSAM_STAT_TASK_SET_FULL_Boolsleep_start__p_sizeioremapmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatereverse_orderingi_link__outlistxattr_lowertrap_nrmax_queue_depthasync_probe_requestedcompat_long_tactive_counts_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagstwa_reset_device_extensiontotal_numa_faultss_countdev_msi_infod_revalidatebus_groupswakeup_cntpmd_tsgl_offsets_opsysv_shminstrument_atomic_readdma_channellast_sector_bugdq_countutf8data_tableTW_Compatibility_Infoset_latency_tolerancedev_get_drvdata__func__resource_size_tnr_tagsfoliowake_entryxa_headsuidscsi_sglisti_readcountTW_Command_Apache_Headermanage_runtime_start_stopblk_integritylocked_vmrb_leftseq_nextguess_capacitysym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idignore_media_changeretrieskernfs_elem_dirsrcu_lock_countksm_merging_pagesevent_queueautosleep_enabledptrace_entrymessage_creditsblkg_listresponse_queuehost_scribblerecent_used_cpunum_jump_entriess_qcopatomic_tbv_pagealloc_tag_counters_flagsrqos_debugfs_dirnotify_nextout2max_perf_statetwa_suspendbus_dma_limitshort intmynodepart_tblzone_wplugs_hashblk_mq_opsscatterlistbridge_ctluse_sgclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodstwa_allocate_memorybp_regprocdirVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invdev_instancepad_untilDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerextra_lenprio_listatomic_write_hw_unit_max_flags_1_flags_2eh_device_reset_handlersbitmaplast_arrivalsupported_speedsem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datatwa_pci_tbleh_eflagspoll_table_structdirect_IOSTARGET_CREATEDwait_queue_entry_televatorcurrent_may_mountseqlock_tskip_ms_page_8bd_queuenuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faulttwa_scsiop_execute_scsigrpmaskvpd_pg80vpd_pg83vpd_pg89__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTApci_dynidsi_private_listia_validvertical_positionSUCCESSFORTIFY_FUNC_strncatdriver_templatei_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITpcie_bwctrl_dataactiveselect_no_atndqb_itimeseg_boundary_masktwa_aen_severity_tableWRITE_LIFE_MEDIUMsrcu_idxpidsNEEDS_RETRYDID_NO_CONNECTFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listno_read_capacity_16tagged_supportedreap_refDID_TIME_OUTxarray_start__flagsp_size_fieldfadvisepm_capslot_resetvmem_altmaparg_endsyscall_dispatchtextrevoked_atscsi_host_templatelast_sum_exec_runtimeiov_iteria_gidSDEV_OFFLINEattribute_groupMQ_RQ_COMPLETEforce_flagcontextposix_timersdriver_exclusive_resourceselectorblkcg_polsMEMORY_DEVICE_PRIVATEdriver_commandcor_error_detecteddev_releasebi_nextdefault_timer_slack_nskcsan_check_accessoffline_alreadysource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_t___GFP_NOFAIL_BIT__copy_overflowgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizepcie_cap_lockmce_kill_mephysical_block_sizeuuid_teh_noresumeproperty_read_int_arraySCSI_EH_DONE___GFP_UNUSED_BITatomic_write_hw_unit_mindividendcount_objectserrorq_sizedma_set_coherent_mask_stimezone_device_dataSDEV_EVT_INQUIRY_CHANGE_REPORTEDnr_active_requests_shared_tagsf_wb_errqueuelistphysfndefparamresid_lenfred_csq_lockdep_mapinquiry_lenfault_flagkprojid_tptracer_credtlb_genstoreio_lock_cls_keySDEV_TRANSPORT_OFFLINEposted_request_countpage_mkwritekobjectaudit_ttyirq_flagsvariable_test_bitmce_ripvstatfstag_setats_enablednumab_stateremovablefeatureson_listtw_compat_infosgl_entrieskgid_ton_cpuFAULT_FLAG_VMA_LOCKearlierfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistunit__hostideetlp_prefix_pathclass_groupsktime_divnsnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedcmndsysfs_registereddebugfs_mutexwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opserror_detectedsequential_iois_busmasterSHOST_CANCEL_large_mapcountsda_is_static__compiletime_assert_109formatfull_command_packetftopenclaveshost_gendevSDEV_CREATED_BLOCKcmp2bi_privateexit_hctxcreateiattrrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_listgetgeo__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115get_reserved_space__compiletime_assert_117__compiletime_assert_118__compiletime_assert_119non_seqstack_refcountinvalidate_lockbmapkey_payloadtimer_rand_stated_reallink_stateexpiry_active__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126dqi_max_spc_limit__compiletime_assert_128__compiletime_assert_129IRQ_NONEexception_table_entryvirt_boundary_maskevent_counttwa_chrdev_mutexfallocatei_spc_warnlimitbuddy_listcdl_enablei_ino_timelimit__compiletime_assert_50SDEV_RUNNING__compiletime_assert_52__compiletime_assert_53__compiletime_assert_130__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135__compiletime_assert_136mems_allowed__compiletime_assert_138tlb_flush_batched_ddebug_infoslave_allocevent_queue_wrappedis_noirq_suspendedtracepoints_ptrsleadertimetwa_scsi_eh_resetwakee_flip_decay_ts__compiletime_assert_60__compiletime_assert_61s_max_linksnr_wakeups_sync__compiletime_assert_64__compiletime_assert_65__compiletime_assert_66__compiletime_assert_67__compiletime_assert_68kallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tblocksset_infofileattr_getioctl_sem_lockvectorFORTIFY_FUNC_strncpyerror_sequence_idFORTIFY_FUNC_strcat__devices__bi_cnttimer_listheadsdevice_dma_supportedd_ino_warnshiwater_vmpending_headtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqsrcuunique_idrenamevm_area_structrpm_statussb_writersino_timelimitpci_bus_flags_tsplice_writemsix_capi_rt_spc_timelimit_raw_spin_lock_irqsavebeforefinishedrom_base_regconstant_test_bitqf_nextcdl_supportedio_window_1krangesiommu_mmats_stublk_features_tcutimeem_tableprot_flagspersonalityget_statepci_unregister_drivertask_sizes_inodes_addrbinfmtirq_domainnr_queuessigned charpriotimeout_msecprivgetattrsched_infod_fieldmaskquiesced_byuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsqueue_rqKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_tagtwa_host_groupsscsi_change_queue_depth_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timerSAM_STAT_RESERVATION_CONFLICTavx512_timestampfuncsend_datareadlsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasetwa_scsi_queuepinspacct_structmust_resumetwa_message_typelong intoldcommandfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ssproperty_presentexpecting_cc_ua__kmalloc_index__write_overflownr_iosprintk_index_sizesymtabsized_strscpyfree_disksg_tablert_mutex_waiterremount_fss_typeruntime_statusin_iowaitlun_in_cdbunregfuncegidpending_queueiomapcurrent_fw_branchdq_hashTAG_TW_SG_Entryput_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_doneis_thunderboltmark_dirtyeh_cmd_qnum_srcu_structsbdi_writebackkobj_completionSOFT_ERROR__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inodetwa_get_paramcancelled_write_bytessrcu_usagebitmapacpi_match_tablesc_data_directionmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_idmultifunctiondepthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_colddma_addr_tshiftcheck_eventsssize_tiopl_emultwa_pm_opsmax_write_zeroes_sectorswork_structdesc_lenflocktrack_queue_depthtask_io_accountingmremaphprobe__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structdriver_srl_highmax_target_blockedpr_opssecondspi_lockcapable___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirqevent_listTAG_TW_Command_Apache_Headersgl_entries__lunhclass_spinlock_irq_try_is_conditionaloom_mmehandlerFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lrufw_srld3cold_allowedFORTIFY_FUNC_strcpyqueue_depthunderflowtwa_drivergfp_maskpi_state_listrcu_segcblistout_disable_devicesubvoltwa_get_request_idioctl_locksubmitterspin_unlock_irqrestorefree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infomq_rq_statesrcu_structrlim_curnofaultmm_countdrv_groupsstackscsi_data_bufferfunctionki_flagsbvec_poolclear_bitbd_start_sect___GFP_IO_BITtwa_post_command_packetsrcu_have_cbsd_in_lookup_hasheh_timeoutmax_sectorssgidinitial_nsFREEZE_MAY_NESTscsi_transport_templatesdev_bflagsbucket_idrb_leftmostthread_infop_lensuspended_timedatastrtabtty_old_pgrpsector_countdl_throttledi_rwsem_oldget_projidsched_reset_on_forkmq_ctxHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountwake_indexrestore_noirqdma_pad_maskki_filpbitmap_tagscap_ambient__UNIQUE_ID_license593dma_configureruntime_erroractive_modesg_nextatomic64_tanon_vmaHCTX_TYPE_DEFAULTruntime_autoPROBE_DEFAULT_STRATEGYDID_TRANSPORT_FAILFASTrlimread_folioout_iounmapnr_eventstwa_load_sgliommubi_opfprivatest_infomap_counttwa_scsi_biosparamsp_reg__UNIQUE_ID_author591exit_signalsa_restorerbpf_run_ctxscsi_vpdtph_enabledsplice_pipehostdatashort_inquiryblk_mq_tag_setpasid_no_tlpspinlock_checkblk_independent_access_rangess_lock_key__pci_register_driversrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsslotsSUBMITTED_BY_BLOCK_LAYERtqheadeh_bus_reset_handlertwa_initconnections_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangemin_shallow_depthnr_hangssym_vvar_startgid_twake_cpuchainedio_uring_taskabort_worktask_worksmemory_failurerb_root_cacheds_cop__real_strscpydd_key_truekmalloc_array_noprofhres_activecurrent_fw_srlsdev_prefix_printkbpf_raw_eventsdma_alloc_attrsdq_dirtydl_deferTW_Device_Extensionround_robinbug_listdirect_completeblk_mq_tagswbt_flagsxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countlockablekey_restrictionnr_rangeexit_stateis_late_suspendedsg_countsysvsemadd_busshost_statebd_nr_sectorsFAILEDignore_childrenfirst_resetreset_printresourcerestore_earlyresponse_idclock_mutexfs_supersarch_set_bitqueue_stoppedvpd_pgb0vpd_pgb1vpd_pgb2vpd_pgb7dqb_bsoftlimitpendingmax_dev_sectorsno_vpd_sizef_task_work___GFP_NORETRY_BITiowait_countmatch_driverblock_countprot_sdbset_read_onlythrotl_datadma_io_tlb_memstringread_countfix_capacitytwa_aen_tablefutex_offsetlong long intmmio_always_onbdevatomic_flagssysvshmtimer_expirestrace_evalsactive_basesearly_initrcec_eacmd_sizemprotectsecurityxmm_spaceactivatescsi_targetmsix_basef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structbroken_fuaQUEUED___GFP_FS_BIT_raw_spin_unlock_irqrestorei_bytesflasheddomain_datarelax_countdma_devtagset_freedlinelinkstart_timekernfs_nodedev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchreschedule_countvfsmountextable_basenoinstr_text_sizeattributesset_child_tid_overruntmpfilercu_read_lock_nestingtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugrefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tUTF8_NMAXfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqia_vfsgidsize_tcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workatomic_long_tpreallocclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicdelayed_callmax_nr_cid_statusd_sibbin_attributepercpu_counternuma_pages_migratedgsindexexpires_nexti_io_listf_epsrcu_barrier_seqreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tHRTIMER_BASE_BOOTTIMEclass_srcu_is_conditionalnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionHRTIMER_BASE_REALTIME_SOFTstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registers_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrstate_in_sysfstty_structUTASK_SSTEP_TRAPPEDbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollnr_wakeups_idleio_cqelf64_symlatch_tree_nodedestroy_work__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerma_external_lockuid_tflush_requiredsum_block_runtimepgmapdq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditional_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitnuma_groupdescriptionclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinei_inodyndbg_infoindexthread_headmap_typef_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_len__UNIQUE_ID_alias473__UNIQUE_ID_alias474__UNIQUE_ID_alias475__UNIQUE_ID_alias476HRTIMER_RESTARTMOD_MEM_NUM_TYPESsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxcpu_basedquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_events_sys_privateUTF8_NFDIinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authHRTIMER_BASE_TAIvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherscompletionsw_reservedUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treequota_onvm_operations_structbin_attrs_newiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdatanrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupwake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlinedup_xol_worktotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramd_spc_softlimitreported_split_lockgfp_tseccomp_filterstimei_mmapthaw_superd_lrusignal_structperf_event_mutexcrcspgdval_tSB_FREEZE_WRITEsetattrf_mappingnoinstr_text_startbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activei_opldt_usr_semkobj_ns_type_operationsDQST_FREE_DQUOTSseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tis_dirty_writebacktrace_bprintk_fmt_startkstatfssitesptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutex_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupseqcount_spinlock_ti_wbclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedpagetrc_holdout_listget_inode_usagenormal_priodestroy_inoderelease_folioi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inameHRTIMER_BASE_MONOTONIC_SOFTi_mappinginblockrmidrseq_siglimit0limit1dqi_max_ino_limitmigrate_modeftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksd_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrDQST_SYNCSstack_vm_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalcg_listsrcu_barrier_completionrw_semaphoremnt_sb_ddebuginfofiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypeinit_modulemembarrier_statepage_poolinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_mempathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwrcu_syncvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstateueventlock_countrefcount_tplugsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttableslist_headtgidwrite_protect_seqcompat_robust_list_head_tids_inode_wblist_lockend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entity__UNIQUE_ID_srcversion477d_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextgpl_symsseq_showswait_queue_headblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfds_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceobjcgnodeDQST_READSvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvstatic_prioshrinkerdl_yieldeddqi_formatexec_update_lockDQF_PRIVATEDQF_SYS_FILE_Bl1d_flush_killi_versionprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symboltv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskSB_FREEZE_PAGEFAULTactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlock__rcu_headmce_vaddrquota_offdq_inusedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmod_tree_nodef_sb_errwritepagecodegtimesigactionclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listktypelockrefsrcu_struct_ptrsmm_structvlagi_uidspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesvm_mmmod_mem_typedebugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipMOD_INIT_RODATAqc_dqblkmmappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCi_write_hintfxsaveprocess_keyringlist_op_pendingllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyioveci_private_lockVTIME_IDLEstatic_keys_magicdl_overrunDQST_ALLOC_DQUOTSd_parentpayloadac_minflti_sbd_sbcommPIDTYPE_PIDatomic_write_segments_maxatomic_openreadahead_control__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupblockedi_securitystats_lockD_REAL_DATApt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colorbitsiopriocap_inheritablegp_waitlookupDD_CLASS_TYPE_LEVEL_NAMESvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vec__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATElf64_Symd_automountparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcestack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkDQST_CACHE_HITScmaxrsstimer_slack_nspolicysharedd_real_typelookahead_bandseq_startraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamerun_delaytailslinenoget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseattrscpumask_tswregs_statedqb_isoftlimitorig_axsched_rt_entitytimerqueue_nodeil_weightmem_dqblknr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pause_sigchldreservedlatency_record_countcgroupsprev_scan_seq_DQST_DQSTAT_LASTrcu_usersoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockUTF8_NFDICFcpu_bitmapstatic_call_keyutil_estucountsMOD_RODATAqc_statesoftirq_next_timercheck_flagsswp_entry_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aMOD_INVALIDmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalautogroupnr_threads__i_nlinkpushdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magicfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsMOD_INIT_DATAnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_infoshared_pendingi_gidmin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idHRTIMER_MAX_CLOCK_BASESkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsxa_flagsbin_sizegrphid_spc_timerjump_entriesassoc_array_ptrsuper_block_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_array__UNIQUE_ID_depends472mnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpref_node_fork__int128dqi_privrss_statmems_allowed_seqrefcntD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxresult_maskdquot_operationsmappinggrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizescheduledclass_raw_spinlock_nested_is_conditionalworker_privateis_relqstrma_flagsfutex_stateHRTIMER_BASE_TAI_SOFTacct_timexpd__rcu_icq_cacheDQST_WRITESsizef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tdl_server_has_tasks_frunnable_sumreal_credepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgcstimecfs_rq_uidst_spacemm_cid_next_scanac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysMOD_TEXTdqb_curinodesload__s8invalidate_lock_keyprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_marksdio_mem_alignbtime__u8is_roxlockrlim_maxruntime_deferred_listd_waitlist_lru_oneseq_stopkiocbclass_rwsem_read_intr_is_conditionalfsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeshrinker_idrootoom_reaper_listsym_VDSO32_NOTE_MASKbpf_storage__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingfsindexshstksrcu_ssp__page_1__page_2__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEi_sequencedqb_ihardlimitd_lockrefnum_bpf_raw_eventsaddr_perfi_dir_seqkqidKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typef_iocb_flagscmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagshrtimer_base_typestart_boottimevm_starts_flagsiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listhrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendings_listdqb_rsvspaceversionserialalloc_locks_dquotfolioqprev_posseqcount_spinlocks_umountis_bin_visiblesyscall_user_dispatchrcu_tasks_exit_listia_uidchildrenrb_subtree_lastbuild_idvfork_donenanosleeprt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelayquotalenf_pipei_wb_frn_historylast_wakeenextarch_spinlock_ti_mtime_nsecmmlistutf8_normalizationset_dqblkreg_offsetgsbases_quota_typesf_llisti_nlinkwrite_beginpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedHRTIMER_BASE_BOOTTIME_SOFTfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tquota_enablesched_avgntabmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextprealloc_bufprojiddrop_inodenum_trace_evalsllseeknext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeunfreeze_fsintervallast_mm_cidcookietargeta_flagstrace_overrunsession_keyringfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributerestrict_linkMOD_DATAi_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackloff_tthread_pidsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringma_locksched_delayedmodule_statelast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimemigrate_from_cpusrcu_barrier_mutexi_private_dataElf64_Halfnsproxyxol_areacleanup_modulerlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_datasignumfscrypt_keyrings_mountsuse_memdelay__state_sizethread_structcached_requested_keyenvpctimereleasesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_datasysv_semanon_vma_namefileattrDQST_DROPSlong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionali_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_ts_iflagsmce_kflagstotal_numa_faultss_countd_revalidates_opsysv_shmdq_countutf8data_tablefoliowake_entryxa_headsuidi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_lockiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_t_flagsnotify_nextshort intmynodeclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_ownerbp_regVTIME_USERsa_flagstesti_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivaltrace_event_callis_guestpoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keyGRPQUOTAi_private_listia_validi_rcuHRTIMER_BASE_REALTIMEi_atime_secqc_type_statekey_serial_tsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsi_wb_listxarray_startfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectordefault_timer_slack_nssource_listswap_readahead_info__fpstateactive_refgroup_infovdso_imagefile__user_state_sizemce_kill_meuuid_tcount_objects_stimezone_device_dataf_wb_errdefparamfred_cskprojid_tptracer_credtlb_genstorekobjectaudit_ttymce_ripvstatfsnumab_statefeatureson_listkgid_ton_cpufregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisti_mmap_rwsemwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadd_realexpiry_activedqi_max_spc_limitexception_table_entryfallocateHRTIMER_BASE_MONOTONICi_spc_warnlimitbuddy_listi_ino_timelimitSB_FREEZE_FSi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infotracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevfs_structclockiduint32_targ_startblocksset_infofileattr_getvectortimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrrenamevm_area_structsb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextiommu_mmcutimepersonalityget_statetask_sizes_inodes_addrbinfmtsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filercu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataki_posexecute_only_pkeysetleasepacct_structlong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typein_iowaitunregfuncegiddq_hashput_superMOD_INIT_TEXTpushable_dl_tasksf_flagsf_inodemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infoTT_NONEVTIME_INACTIVEcancelled_write_bytessrcu_usagebitmapmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_cold__UNIQUE_ID_name470ssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenDQST_LOOKUPSclass_spinlock_irq_try_is_conditionaloom_mmsrcu_reader_flavortv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idsrcu_structrlim_curnofaultmm_countSB_FREEZE_COMPLETEstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infodatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountki_filpcap_ambientatomic64_tanon_vmarlimread_folionr_eventsprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keysrcu_gp_startopenit_real_incrmodert_prioritymm_lock_seq__UNIQUE_ID_intree471KMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksrb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionexit_statesysvsemMOD_RO_AFTER_INITDQF_ROOT_SQUASH_Bfs_supersSB_UNFROZENdqb_bsoftlimitpendingf_task_workiowait_countstringread_countfutex_offsetlong long intatomic_flagssysvshmtrace_evalsactive_basessecurityxmm_spacef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesclass_rwsem_read_intr_is_conditionalclass_mutex_is_conditionalclass_preempt_notrace_is_conditionalMOD_INIT_RODATAMOD_TEXTclass_srcu_is_conditional_nameclass_rcu_is_conditionalclass_migrate_is_conditionallong long unsigned intNR_KMALLOC_TYPESclass_rwsem_read_is_conditionallong long intsigned charPIDTYPE_SIDclass_preempt_is_conditionalElf32_Wordorc_headerPIDTYPE_TGIDlong intclass_raw_spinlock_irq_is_conditional_descclass_local_lock_nested_bh_is_conditionalHRTIMER_BASE_MONOTONIC_SOFT__UNIQUE_ID_retpoline471class_rwsem_read_try_is_conditionalUTF8_NFDIDQST_LOOKUPSclass_spinlock_irqsave_is_conditionalclass_spinlock_try_is_conditionalclass_local_lock_is_conditionalhrtimer_base_typeMOD_RO_AFTER_INITn_descsz__u8DQST_ALLOC_DQUOTSSB_FREEZE_FSKMALLOC_NORMALDQST_WRITESunsigned int__int128class_irqsave_is_conditionalHRTIMER_BASE_REALTIMElong unsigned int__u32HRTIMER_MAX_CLOCK_BASESclass_spinlock_irqsave_try_is_conditionalclass_spinlock_is_conditionalshort unsigned intHRTIMER_BASE_TAIclass_local_lock_irqsave_is_conditionalclass_read_lock_is_conditionalelf32_noteboolDQST_DROPSclass_local_lock_irq_is_conditionalMOD_RODATAKMALLOC_CGROUPclass_rwsem_write_is_conditionalclass_spinlock_irq_try_is_conditionalclass_spinlock_irq_is_conditionalclass_write_lock_is_conditionaln_typeMOD_DATAclass_write_lock_irqsave_is_conditionalHRTIMER_BASE_BOOTTIMEn_nameszSB_FREEZE_COMPLETESB_FREEZE_WRITEclass_raw_spinlock_nested_is_conditionalMOD_MEM_NUM_TYPESDQST_SYNCSDQST_FREE_DQUOTSmod_mem_typeHRTIMER_BASE_MONOTONICclass_mutex_intr_is_conditionalclass_task_lock_is_conditionalUTF8_NMAX_nhdrPIDTYPE_PGID_Boolunsigned charKMALLOC_RECLAIMHRTIMER_BASE_BOOTTIME_SOFTcurrent_stack_pointershort int_note_18_note_19utf8_normalizationKMALLOC_RANDOM_STARTDQST_CACHE_HITSclass_irq_is_conditionalDQF_PRIVATEPIDTYPE_PIDDQST_READSMOD_INIT_DATAclass_raw_spinlock_try_is_conditionalclass_raw_spinlock_irqsave_is_conditionalPIDTYPE_MAXcharGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackSB_FREEZE_PAGEFAULTUTF8_NFDICFclass_mutex_try_is_conditional_DQST_DQSTAT_LASTclass_write_lock_irq_is_conditionalKMALLOC_RANDOM_ENDMOD_INIT_TEXTclass_raw_spinlock_irqsave_try_is_conditionalpid_typeHRTIMER_BASE_REALTIME_SOFTKMALLOC_DMAclass_read_lock_irq_is_conditionalHRTIMER_BASE_TAI_SOFTSB_UNFROZENclass_raw_spinlock_is_conditionalkmalloc_cache_typeclass_read_lock_irqsave_is_conditionalclass_rwsem_write_try_is_conditionalDQF_SYS_FILE_Bclass_raw_spinlock_irq_try_is_conditionalDQF_ROOT_SQUASH_B__UNIQUE_ID_vermagic470__int128 unsignedMOD_INVALID/home/thomas/Documents/kernels/stagingdrivers/scsi/3w-9xxx.c/home/thomas/Documents/kernels/stagingdrivers/scsi./include/linux./include/asm-generic/bitops./arch/x86/include/asm./include/scsi./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device3w-9xxx.c3w-9xxx.cfortify-string.hinstrumented-non-atomic.hbitops.hio.hscsi_cmnd.hspinlock.hinstrumented-atomic.hmath64.hdma-mapping.hfs.hpci.hdevice.huaccess.hthread_info.hktime.hkernel.hslab.hioport.hscsi_host.hinterrupt.hint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.htime.hasm.htime.hmodule.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hirqreturn.hdelay.hmod_devicetable.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hfwnode.hscatterlist.hdma-direction.hscsi_proto.hscsi_status.hscsi.hmempool.hblkzoned.hsbitmap.hblk-mq.hscsi_device.h3w-9xxx.htimekeeping.hsprintf.hspinlock_api_smp.hoverflow.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.hjiffies.h/home/thomas/Documents/kernels/stagingdrivers/scsi/3w-9xxx.mod.c/home/thomas/Documents/kernels/stagingdrivers/scsi./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched3w-9xxx.mod.cint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hirqflags.htypes.hshstk.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hquota.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.h3w-9xxx.mod.c/home/thomas/Documents/kernels/stagingscripts/module-common.c/home/thomas/Documents/kernels/stagingscripts./include/uapi/asm-generic./include/linux./include/linux/sched./include/uapi/linux./arch/x86/include/asm./include/asm-genericmodule-common.cint-ll64.htypes.hirqflags.hpreempt.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hpid_types.hhrtimer_defs.hslab.hunicode.hquota.hquota.hfs.helf.hmodule.hasm.hmodule-common.cint-ll64.hGCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910x s6lJEE K(A0A8 0A(B BBBE  0A(B BBBE $8\GBB B(A0A8Gh 8A0A(B BBBE ,hpp\h4FD` AE TAlGEE B(A0D8 0C(B BBBE  0A(D BBBE t_GHF B(D0D8D@ 8I0A(B BBBE * 8A0A(B BBBE $@,FN8 AE X8TKBB B(D0D87 0A(B BBBE \]KBB B(A0A8GPA 8A0A(B BBBE $ P$oFd,IJd E F E FLWGMF G(F0D@ 0A(A BBB_ $@LKAD t(G0G8G@GHGPGXc MABLGEE A(D0D8 0A(A BBBE $V8,3FI AE XD KHA \(J0L8B@BHI qAB,sFEL B(B0B8I$lW E 4KAA  ABE <GOH J( ABBlGDB B(A0A8GGGGGK 8A0A(B BBBE NPRBBI$<]GBA D(E ABB\* KEI B(A0A8G 8D0A(B BBBE $G<KOH m(V XABX TKBB B(A0D8 0D(B BBBE $8DKBB H(A0(A BBB     "$%')+-.023568:<>?@ABs6 %%&`:-M% p[t`020_$P jX=0 R ] fPoI20W`&V 3?X` .scll0pVw%@g`l ]P!* %` 2  G-c X0.h2 2  2$-: ,E`,P],h,s@,~, , ,`,,, ,P,, ,P `,+,6,A ,L`,W,b,m ,x`,,, ,`,,, ,`,,, ,P  ` , , ,* ,5P B` ,M ,X ,c ,nP { , , ,@ , , ,  ,` ,  ,,0@,,&,1,<@,G,R,],h0u`,,, ,`,,, ,`,,, ,`,,,' ,2`,=,HU,`0m@,x,, ,`,,,@,p,,, @,,#,. ;,F@,Q,\,g,r@,}p ,')+% +++)+ 6+(C+0P+8]+@j+Hw+P+X+`+h+p+x++++ + + +- +; +I +W +e +s + + + % + + + + + +  +( +0 +8+ +@9 +HG +PU +Xc +`q +h +p +x + + + + + + + + + +' +5 +C +Q +_ +m +{ + + + + +  +( +0 +8 +@ +H +P +X# +`1 +h? +pM +x[ +i +w + + + + + + + + + + + +# +2 +A +P +_ +n +} +   0 % %  : : (PO+c Bo7] sy ~ P @ 7 L `@ P(=`PaPz@!- .P /=#W+l+*+U+    5-6?JW`t% 0$1&:IOeoY6$$%-4DSes+@GViw,?I]j !3w-9xxx.ctwa_drivertwa_error_tabletwa_fill_sense.cold__already_done.106twa_aen_tabletwa_aen_queue_event.coldtwa_aen_severity_tabletwa_decode_bits.coldtwa_scsiop_execute_scsi.coldtwa_aen_read_queue.coldtwa_interrupt.coldtwa_device_extension_counttwa_allocate_memory.coldtwa_poll_response.constprop.0.coldtwa_initconnection.constprop.0.cold__twa_shutdown.coldtwa_majortwa_reset_sequence.coldtwa_chrdev_mutextwa_device_extension_listtwa_chrdev_ioctl.coldtwa_scsi_eh_reset.colddriver_template__key.251__key.252twa_probe.coldtwa_fops__func__.267_entry.266_entry.265__func__.264_entry.263_entry.262_entry.261_entry.260__func__.259_entry.258_entry.257_entry.256_entry.255_entry.254_entry.253__func__.250_entry.249_entry.248__func__.247_entry.246__func__.245_entry.244_entry.243_entry.242_entry.241_entry.240_entry.239_entry.238_entry.237_entry.236_entry.235_entry.234_entry.233_entry.232_entry.231_entry.230_entry.229_entry.228_entry.227_entry.226_entry.225__func__.224_entry.223_entry.222_entry.221_entry.220__func__.219_entry.218_entry.217_entry.216_entry.215__func__.214_entry.213_entry.212_entry.211_entry.210_entry.209_entry.208__func__.207_entry.206_entry.205__func__.204_entry.203_entry.202__func__.201_entry.200_entry.199_entry.198_entry.197_entry.196_entry.195_entry.194_entry.193__func__.192_entry.191_entry.190_entry.189_entry.188_entry.187_entry.186_entry.185_entry.184_entry.183_entry.182__func__.181_entry.180_entry.179_entry.178_entry.177_entry.176_entry.175_entry.174_entry.173__func__.172_entry.171__func__.170_entry.169_entry.168__func__.167_entry.166_entry.165_entry.164_entry.163__func__.162_entry.161_entry.160__func__.159_entry.158_entry.157_entry.156_entry.155_entry.154_entry.153__func__.152_entry.151_entry.150_entry.149_entry.148_entry.147_entry.146__func__.145_entry.144__UNIQUE_ID___addressable_cleanup_module598__UNIQUE_ID___addressable_init_module597_entry_ptr.0twa_pm_ops_entry_ptr.1_entry_ptr.2_entry_ptr.3_entry_ptr.4_entry_ptr.5_entry_ptr.6_entry_ptr.7_entry_ptr.8_entry_ptr.9_entry_ptr.10_entry_ptr.11_entry_ptr.12_entry_ptr.13_entry_ptr.14_entry_ptr.15_entry_ptr.16_entry_ptr.17_entry_ptr.18_entry_ptr.19_entry_ptr.20_entry_ptr.21_entry_ptr.22_entry_ptr.23_entry_ptr.24_entry_ptr.25_entry_ptr.26_entry_ptr.27_entry_ptr.28_entry_ptr.29_entry_ptr.30twa_host_groups_entry_ptr.31_entry_ptr.32_entry_ptr.33_entry_ptr.34_entry_ptr.35_entry_ptr.36_entry_ptr.37_entry_ptr.38_entry_ptr.41_entry_ptr.42_entry_ptr.43_entry_ptr.44_entry_ptr.45_entry_ptr.46_entry_ptr.47_entry_ptr.48_entry_ptr.49_entry_ptr.50_entry_ptr.51_entry_ptr.52_entry_ptr.53_entry_ptr.54_entry_ptr.55_entry_ptr.56_entry_ptr.57_entry_ptr.58_entry_ptr.59_entry_ptr.60_entry_ptr.61_entry_ptr.62_entry_ptr.63_entry_ptr.64_entry_ptr.65_entry_ptr.66_entry_ptr.67_entry_ptr.68_entry_ptr.69_entry_ptr.70_entry_ptr.72_entry_ptr.73_entry_ptr.74_entry_ptr.75_entry_ptr.76_entry_ptr.77_entry_ptr.78_entry_ptr.79_entry_ptr.80_entry_ptr.81_entry_ptr.88_entry_ptr.90_entry_ptr.91_entry_ptr.92_entry_ptr.93_entry_ptr.94_entry_ptr.95_entry_ptr.96_entry_ptr.97_entry_ptr.98_entry_ptr.99_entry_ptr.100_entry_ptr.101_entry_ptr.103_entry_ptr.104_entry_ptr.105_entry_ptr.107_entry_ptr.108_entry_ptr.109_entry_ptr.110_entry_ptr.111_entry_ptr.112twa_host_grouptwa_host_attrstwa_host_stats_attr__UNIQUE_ID_use_msi596__UNIQUE_ID_use_msitype595__param_use_msi__param_str_use_msi__UNIQUE_ID_version594__UNIQUE_ID_license593__UNIQUE_ID_description592__UNIQUE_ID_author591.LC59.LC9.LC60__pfx_twa_scsi_biosparam__pfx_twa_fill_sense__pfx_twa_aen_queue_event__pfx_twa_decode_bits__pfx_twa_post_command_packet__pfx_twa_scsiop_execute_scsi__pfx_twa_aen_read_queue__pfx_twa_scsi_queue__pfx_twa_interrupt__pfx_twa_free_device_extension__pfx_twa_chrdev_open__pfx_twa_allocate_memory__pfx_twa_show_stats__pfx_twa_slave_configure__pfx_twa_poll_response.constprop.0__pfx_twa_initconnection.constprop.0__pfx___twa_shutdown__pfx_twa_shutdown__pfx_twa_remove__pfx_twa_reset_sequence__pfx_twa_reset_device_extension__pfx_twa_chrdev_ioctl__pfx_twa_scsi_eh_reset__pfx_twa_probe__pfx_twa_init__pfx_twa_suspend__pfx_twa_get_param__pfx_twa_resume__pfx_twa_exit3w-9xxx.mod.c__UNIQUE_ID_srcversion477__UNIQUE_ID_alias476__UNIQUE_ID_alias475__UNIQUE_ID_alias474__UNIQUE_ID_alias473__UNIQUE_ID_depends472__UNIQUE_ID_intree471__UNIQUE_ID_name470module-common.c__UNIQUE_ID_retpoline471__UNIQUE_ID_vermagic470_note_19_note_18orc_headerscsi_dma_mapfree_irq__check_object_size_copy_from_userpci_enable_device__mod_device_table__pci__twa_pci_tbl__this_modulescsi_remove_hostfinish_wait__pci_register_driveriounmap__stop_alloc_tagspci_disable_msipci_request_regionsscsi_dma_unmapkfreeprepare_to_wait_event__wake_uppci_try_set_mwi_raw_spin_lock_irqsave_raw_spin_lockpci_unregister_driver__fentry__sysfs_emit__start_alloc_tagsschedule_timeout__stack_chk_fail__kmalloc_large_noprofstrnlencapablesys_tzinit_wait_entrypci_enable_msi__pfx_init_modulescsi_host_putrequest_threaded_irqnoop_llseekmutex_locksdev_prefix_printkdma_alloc_attrsscsi_scan_hostioremap__mutex_initmutex_lock_interruptible__fortify_panic_raw_spin_unlock_irqrestore__pfx_cleanup_modulememsetpci_set_master__x86_return_thunk_copy_to_user__init_waitqueue_headjiffiesdma_set_coherent_maskktime_get_real_secondssprintfdma_free_attrsmutex_unlockpci_release_regionssg_next__register_chrdevktime_get__warn_printkpci_disable_devicescsi_donesg_copy_from_bufferdma_set_maskscsi_add_host_with_dmaparam_ops_intscsi_host_allocpci_write_config_word_raw_spin_unlocksg_copy_to_bufferscsi_change_queue_depthmsleepblk_queue_rq_timeout__SCT__might_resched__unregister_chrdev`T|I" M S ePz.|#   *8=PB*a 0Xbh    #  M  T  Zfkpff .1 V [ 7 " 6 ; Q  f  5 N  ; C y    G.0F"Q 1B  P6Beszkp3 `JhOu< 8 (06@Ha Riy WK { v  " tP [  T   % -  T!9!U!{! `!  !!! `!","R""""I$Y$$$$F()))**6*H* **v--- - ---_ ..5.G.O.^.f.u... ... .. ./l///)/T/ / )// / =0 0 S0M0]0000001 11E1 # (/  6 = B#* ? xDIeP o @|e 8E !, `A R Wf   h  h O  % 46 ;K] Oi hnz   4 h  h  8 h" ) : ?D K 8\ af  p h  p   h   .L X h]q } h       !< cH hMa  m hr~ c   hU  U  "~4 @ hEe{  0 h"+ 0< AJ |Oho t  h  },  h    ) . K ^ xo t  ` h   h   x h  `  > J hO T [ @l q       h   h   / 4 @ Q V [ z  h    h          # ( : F hK n z h  @ h         h 6  M U _ n$}  h  -       1   1 ( / 4K  \ al0 P  h (  h   h t )0G x S hXd x u z    /R SY  ^|  0   1   ; 1 . 39<A 1S P _ hdi 1p P   t h  h0 [ h0" 3 8=0O [ h`l [} 0 %/\N SU  Z~   h     x  h x . 3D ` (008P @4 H PPX`0hpdxdt`T!-4.{|  !7 h( 0`h ph  @hH P h  ( 0`hh p h  ( 0h P P  ( 0`hh Pp Ph P ( P0`hh Pp Ph P ( P0`hh Pp Ph P ( P0`hh Pp P  P  ( P0`hh Pp Ph P (  P0 ` `h  P p  h  P    P  (  P 0 ` h  P p  h  P    P  |(  P 0  h  P    P  h  P  @ H  P P  h  P    P  h(  0 ` h  p  h   @hH 0P 0h 0 0@hH 0P 0h 0 0`hh 0p 0h 0 ( 00`hh 0p 0h 0 ( 00`hh 0p 0h  ( 0`hh p h  ( 0`hh p 8 @@H 0Px 0h  ( 0`hh p h @H Ph p ph p@H pPh p p @hH P h  @H P p```0 -`8XPP!h@`[h`pfxns P _~y 7 $6 ( , 0E48 <@ADAHyLjPT?X\8!`"d.h1lgpt xC `W $(j,0048< @Z D! H! LP P T X4 \M ` d h: lB px t x |S/O!.>P05dr"T  * $(=,t048<@ DHL'P/TGX`\`d#h/lhptHxr|g $ ,   !T!!!!+"Q""""H$X$$$$E(m)))**5***u--- --.4.F. ].$e.(t.,.0.4.8.<.@/D/H/L0P0TL0Xm0\0`0d0h0l1p 1tx'|"C{  V :m>`\Lq Dd $(,0!4@8N<s@DHL|PTX\- `s d h l p tN xp |   3 U     " J ~     L T     3`Wy. ]  $2(c,048<7@_DHLPTX\`$d.hYlptx|2  $*(@,p0q4s8u<w@yD~HLP.T/X1\3`5d7h<lFpPtgxi|kmnov|}~+@t 7<ACDH    $(,048<@DHLPTX\`dhlpt x, |- . 0 2 4 6 ; ? @ V d     ; = ? A E I                 ;<=? A$C(E,J0=4@8V<@DHLPT X\`d h7lDpJtQxW|[9:;=?AF`1>?AFP~ bcdf h$j(o,t048<@DHLPT+X7\9`;d=hFlSp`tx|<=?DNPgkmopqx,3:AHSAQcegp  $3!(4!,6!08!4=!8@!<[!@`!Di!Hk!Ll!Pm!Tt!X "\ "`"d"h"l"p"t"xz-|------ .... .;.=.?.A.B.F.111111#1I1F2j KPk s$t(,048<@dDeHgLlPTX\`dhlptx|   c  <=?ACH U M%VP ( 08@ @ H P@X` hpPxP`P@!- .S 0.0p     0ppxp,  C`~(8 H( XhH x+D[y(p 8HXhx0Fa{  (8H X,h x0 X x   J_u(8HXh x0 /P x KZm|(8HXhZx"3F bw  (8HXh@x&@xH  ( 08 `H X h x @ y         ( : 8 T H k X  h  x h  @     (   P  (  8  H 8 X xh x V    n  0       (  8 ! H `X h x  8 ( P N k        (  8  H  X 9 h R x  n    (      @    ( @0 8 @ H P ` X ` h p `x    `    `    `    `    `    `( 0 8 @ H P `X ` h p `x    ` `     @       `     `  ( 0 @8 @ `H P X ` `h p x     @    @  @   @     @    )P ! & 4 '' ' $` ' %. &&G` &]l &v &| & &/~ &8 & &l & &| & &i & &$ &  &! &+ &vQ &x & &} & &y &W &ǘ &Z &X &M  & &;# & ; &tB &G &gxS &y_ &)|k &ew &" &h &< &K & &:  &< &o & & & &f  & &$ &K0 &ek< &pM &Y & e &oq &%} &  &+l & &A & &A & &E & &* &7! &/ &J#< &I &Hq & ~ & &7 &K$ &i &O &fK &  &1 &tg% &^3 &d.@ &fKM &\ &Vy &u> &9p & & & & &PS & & & &# &! &k/ &I= &K &LY &}g &E|v &iM & & &9p & &Ѓ & & &7 &7] &x &{& &s- &ʾJ &Y &ih &Gw &}| & &ۀ & &Ր &x &= &zb &^ &MC &, &; &!J &]"Y &r$h &w &e &m & && & &? & & &{P &' &I &r+ &ާ: &I &H)X &%g &v &i &̒ &D &1 &2 &l &) &9 &Q &~ & &* &9 & H &xW &tf &au & & &}_ & &6 &ӏ &) &=7 &ӴR &` & & &6 &Z &g & &7m &1 &a &a &=8 &#1x &b &t &ϯ &M && & &/z &ۤ  &+ &+& & L &)r &x & &. & &! & &= &I & &' &+O &(; &E &>VR &޾f &t &;y &| &Q & &a &B &= &2 & &A &+ &b9 &@G &U &c &)q &ֲ & &!' &I &z &Χ & &U &# &I & /  &~D &S &!b &r &փ &u# &;Z &8 &Y & &eU &N &c &  &/ &)' &L6 &dE &T &c &BEr &: & &A &  & &|  &J  & & s &7 &Š && &xh5 &wD &.S &ob &q &B &, &2 &t &ט &1q &I &? &~ &&t &$% &4 &D &ZT &d &#t &, & & & & &lI & &{ & &uH & $ &%4 &D &FS &.q &E & & &` & &  & &o & &Ɨ &PR &;% &64 & C &4R &va &fp & & &0O &J & &e &p &* &: & &_ &T &$ &{4 &ױC &fzR &'a &p &V & &o &S & &R & &]# &@ &2 &2# &WZ2 &A &4P &O_ &9n &G>} && & &  &nB &; &3 &3 & &{q & &" &#1 &1!@ &%LO &,^ & m &$| &(C &! &XG & & &d0 &m &y & &  &w! &0 &t? &6sN &Ni] &:l &^{ &0 & &*P & & &vo &Pw & & &I& &Q  &U/ &x> &hM &t\ &ik &z & & &u &gm & &g &B & &%c & &i  & / &"> &CM &0\ &_k &Cz &ؓ & & &@ &ҋ & &x & &9 &h &  &9i/ &> &cM &S\ &ak &+z &O &# &K &N &O & & &a & I & &F &T. &ѝ= &Sm\ &oik &_z & & &b &d & &t &{. & &N &k &DC &i/ &? &eO &^_ &I,n &Mo} &! &bJ &0 &+ & & &ց# &; 1 &g? &M &[ &`i &-B & & &\ & &N & & &O &ށ! &d^,! &l[?! &PU! &jy! &! &#Q! &W.! &"! &t! &dI! &d! &Z! &" &\A" &A!" &v/" & \=" &8K" &Y" &g" &u" &x" &" &O" &O" &" &TF# &# &'# &BN# &q!`# &s# &J0# &\# &# &# &# &s# &N# &M# &d# &b# &$ &;~$ &ɓ$ &a,$ &.9$ &=F$ &S$ &a$ &l}$ &7$ &$ &%$ &W7$ &$ &$ &T$ &s;$ &X% &W% &. % &-% &#f<% &-K% &h% &x% &~% &v@% &% &[% &% &5% &C% &% &J_% &K/% && &ڹ& &7*& &L+& &/8& &Re& &xr& && &=& && && &q& && && &' &' &>' &cA+' &29' &gG' &CU' &Ac' &Xq' &R' &' &' &1' &\' &;~' &Y' &+k' &' &' &p ( &Y( &n'( &g5( &TC( &`Q( &Q_( &m( &K{( &49( &P( &T( &( &%( &( &*( &:) &=) &) &)() &7) &jD) &7X) &*h) &n) &Ct) & Oz) &J) &b) &ƻ) &e) &) &,) &E) &[) &"s) &) &) &k}) &) &r) &g) &= * & $* &%Z** &VM0* &96* &Ϭ<* &?B* &VCH* &N* &CT* &;jZ* &`* & :f* &pl* &$r* &_x* &Ir~* &د* &* &c* & v* &-* &** &* &A* &3* &q* &s* &* &9p* &2* &* &r+ &ng+ &go(+ &C+ &Q+ &_+ &+ &{+ &q, &[<}, &!, &, &, &h, &{ - &- & L- &g- &{- &δ- &ڳ- &2d- &-b. &<. &{;. &N. &H\. &#j. &Ix. &0i. &/. &Ϳ. &0. &$. &. &Ց/ &S/ &m/ &:[*/ &#yJ/ &Y/ &wg/ &7vu/ &#/ &S>/ &/ &/ &1/ &'/ &/ &\]/ &uY 0 &0 &>90 &̔G0 &U0 &c0 &(q0 &P0 &`Q0 &0 &@^0 &K/0 &w0 &0 &0 &q1 &1 &c8F1 & K1 &\U1 &b1 &o1 &#f|1 &X1 &W1 &.1 &El1 &1 &[1 &T1 &1 &iD1 &2 &Sp2 &F+2 &%-82 &<v2 &@[2 &U2 &2 &`2 &U/2 &2 &${2 &22 &)2 &? 3 &rm3 &s*3 &fK73 &S3 &C`3 &=s3 &*3 &R3 &'3 &+3 &fK3 &3 &D3 &#u3 &-}3 &g4 &.4 &J4 &AW4 &d4 &G q4 &4 &4 &T4 &N4 &84 &c4 &j4 & W4 &+4 &5 &o.5 &4t5 &P5 &!5 &</5 &-y95 &F5 &/T5 &Ba5 &x5 &g5 &P5 &(5 &d5 &w+5 &#5 &5 &J05 & 6 &^6 &#$6 &16 &%?6 &2L6 &N[Y6 &uf6 &#y6 &76 &26 &6 &76 &56 & h6 &/I6 &*6 &}y6 &77 &H7 &Q7 &7 &ˈ*7 &/I87 &E7 &WR7 &K/_7 &l7 &vy7 &i!7 &g7 &L7 &7 &7 &C7 &_7 &8 &8 &i(8 &58 &6B8 &*O8 &W\8 &8 &38 &y8 &8 &Z8 &%8 &l[8 &H8 &!8 & 9 &C9 &4Z%9 &29 &@~@9 &M9 &Z9 &3g9 &29 &_9 &9 &H9 &^9 &X9 &,9 &z : &: &<+: &,8: &y{O: &F\: &)i: &v: &: &,: &y{: &: &,: &y{: &k : &!: & ; &<>; &#; &{:; &,G; &.^; &,k; &sx; &; &; &; &%K; &tf; &N; &; &= &@K= &\X= &e= &Ns= &l= &= &= &i= &z= &Y= &d^= &\= &.> &i> &w> &X,> &zb9> &uF> &T> &a> &yn> &K{> &> &r> &> &\> &> &> &I> &> &> &b> & ? &*? &{7? &E? &#R? &nv`? &"m? &Jz? &Q? &D? &? &Y? &C? &? &n,? &^? &S @ &@ &'&@ &`3@ &A@ &M-V@ &c@ &;~q@ &>@ &@ &ϲ@ &J@ &f@ & &@ &;~@ &' A &]A &3VA &гA &Q%A &,A &:A &HA &eVA &rA &fA & &A &0OA &BA &A &fA &hA &iA &A &B &?B &)B &u3+B &l9B &YzGB &LUB &@cB &+{qB &EB &ZB &jB &XYB &TB &)uB &ŀB &?B &B &B &B C &8GC &A)C & 7C &EC &SC &JmaC &oC &\}C &KC &/C &nC &C &C &C &C &?C &DC &b D &>xD &b>%D &3D & BD &FQD &|_D &KnD &S|D &$qD &eD &}D &UD &КD &#nD &fD &?D &^D &E &LE &P$E &92E &q@E &NE &`\E &e{jE &xE &8E &e{E &gE &\E &RE &pE &IE &UE &F &"F &CzAF &OF &2^F &lF &MzF &}F &1F &F &o~F &SF &F &F &IF &FF &lVG &G &q.G &Q>G &BNG &]G &-yG &>G &G & G &dHG &eG &օG &+G & H &`$H &WZ2H &@H &I &ZLI &#&ZI &!hI &byvI &qI &I &sI &UI &3I &xI &I &3I &W7J &;~J &O.,J &,9J &xFJ &՛`J &J &J &J &J &'J &J &J &J & K &K &]%K &%A2K &8?K &~[LK &YK &^fK &MbsK &@K &K &\K &SK &fK &K &K &K &K &jK &!L &.L &BL &\L &iL &|L &HL &PL &YL &6xL &L &L &M &M &9M &="M &,M &@6M &;&DM &6QM &A^M &nkM &HxM &M &M &DaM &pM &$!M &܅M &(XM &M &'M &M &ryN &/N &i%N &w2N &̮?N &3LN &ZN &lsN &zN &N &VN &eN &nN &+N &rnN &jZN &fN & & O &O &F{)O &0O7O &EO &JSO &paO &*oO &3}O &UO &_O &TO &qO &O &0O &d%O &xO & mO & P &cP &m%P &uO3P &AP &)OP &]P &CkP &yP &(P &P &>P &`P &P &(JP & P &P &3P &sXQ &Q & $Q &.Q &$ U &U &d7U &YRU &N`U &l\nU &pb|U &U &YU &U &U &GU &nU &U & pU &AV &V &ΦV &#V &-V &07V & JV &6HXV &vfV &tV &^V &V &@TV &,V &>nV &yDV &:V &DV &uV &@W &$W &;!W &_/W &=W &u_W &!lW &7yW &bW &#W &#W &W &W &LW &7W &9pW &jW &sN X &;X &%X & OX &F[X &tX &X &X &X &P"X &MX &yX &GuX &yX &MtX &X &Y &Ύ'Y &8NY &w[Y &`hY &>uY &Y &)~Y &lY &Y &~Y &-%Y &CY &IY &Y &FY &6WZ &!Z & d.Z &;Z &4HZ &7UZ &6cZ &!Z &(Z &;~Z &iYZ &bZ &6Z &tZ &^Z &[ &R[ &%[ &:[ &F[ &4S[ &mf[ &ws[ &K[ &R;[ &3[ &[ &J0[ &[ &UO[ &([ &2[ &Ge \ &U\ &G#\ &;~0\ &K?\ &tL\ &")m\ &z\ &b\ &6\ &7\ &o\ &\ &G\\ &P\ &(\ &iY ] &f] &3] &p@] &~] &] &J] &] &] &;~] &*] &] &?(] &Q] &>%^ &^ &0? ^ &v.^ &Ϋi^ &v^ &;~^ &^ &^ &?(^ &~"^ &u^ &Cr^ &^ &M^ & 3 _ &_ &+_ &/I8_ &W7E_ &R_ &s*__ &;~l_ &(xy_ &ߗ_ &_ &?(_ &D_ &wU_ & _ &@_ &8_ &_ & _ &Ӝ` &:` &9#` &.1` &?` &M` &v` &^` &F` &e` &_0` &` &` &` &a &ca &(a &4a &@a &nMa &ta &ea &@a &ta &o_a &sa &5\a &Ha &a &^a &a &a &ga &la &b & b & b &$b &M1b &NL?b &NLRb &M_b &Rxb &$b &b &b & b &7b &@b &kb &b &klc &c &,@6c & Cc &lc &H2yc &Sc &Sc & c &;~c &3c &c &cc &Zc &c &t'd &d &;~*d &87d &Dd &%Qd &^d &4ld &vd &d &bd &wd &nxd &d &Wd &xd &}d &d &e &He &+e &N,e &C9e &͖Fe &}Se &`e &me &e &-e &+e &e &e &GRe &e &Df &u,f &4Cf &wu\f &Nif &Lvf &.f &=f &Bf &f &"f &$Yf &*f &f &= g &g &p1g &>g &@sg & g &bg &ykg &?kg &+g &h &4#h &tD;h &Oh &u]h &qh &ykh &!h &h &.h &6h &"h &|h &h &X i &eEi &M86i &!Oi &?]i &"ki & <yi &i &i &Mi &~mi &pi &w~i &*i & j &2j &@j &QNj &Ȭ\j &'jj &xj &&j &=j &lj &j &ʄj &Xj &j &wj & j & k &sk &N&k &c Fk &xck &_mk & {k &k &9pk &3k &;~k &!k &k &6k &P'k &Ak &Vil &φ"l &b@l &/ Yl &fl &mCl &l &l &~ l &Rl &0rl &Q3l &l &m &Km &`)m &*m &xA8m &.Fm & Tm &?{bm &9ppm &r~m &m &m &Cm &2m &l%m &, n &n &)n &Ln &Zn &BGhn &8vn &n &2n &n &=n &n &pMn &{n &/n &G o &Y+o &6 o &D,o &ec:o &Ho &Vo &do &Aoro &o &$o &o &fo &o &/o &88o &ao &Eo &̐p &fp &KF&p &5p &Dp &bp &qp &Tp &+p &2p &p &9Cp &tp &p &Įp &p &;$q &ijq &%q &4q &RCq &ULRq &:aq &`pq &iq &q &ȹq &H2q &q &Xq &{q &Zq &1Mq &r &}F;r &XcEr &uTr &/0^r &;,wr &r &>r &r &Gr &.s &zs &±%s &]+s &1s &ى7s &F=s &dCs &xvIs &pOs &f2Us &\s &pcs &vjs &qs &ݲys &$:s &s &Rs &ls &s &]fs &Qs &ls &=s &rs &wVt &Ht &>t &UKt & Xt &kt &F$xt & t &t &^^t &F$t &t &Kt &^t &,Mt &{]u &u &u &(3u &ޟBu &^Pu &^u &qlu &u &3u &3u &nu & ?u &u &}u &v &$ v &bv &4v &"Bv &,Pv &-^v & 'lv &4zv &`v &Ďv &\v &v &v &v &Hv &;~ w &3 w &C2w &gPPw &Tyw &w &ww &9pw &5&w &~w &V^w &w &x &mx &]x &&*x &17x &VDx &QQx &^x &0kx &XSxx &Vx &Bx &!x &x & x &E!x &5x &Sy &y &Py & q,y &2:y &.jHy &^Vy &c'dy &Vry &0y &_Zy &}y &`qy &My &y &y &y &7y &Ҍz & z & z &Q.z &m| &+K| &1X| &2e| &r| &| &x| &.| &:| &d| &*`| &<| &| &r| &҉} &S+} &r} &A,} &:} &H} &V} &d} &r} &.} &!} &2} &dV} &_} &} &} &} &>} &J} & ~ &K~ & (~ &r|6~ &7D~ &_R~ &r`~ &Wn~ &c|~ &~ &~ &~ &~ &4~ &~ & u~ &k~ &7+ &$ &P" &U1 &@ &O &^ &cRm &| & && & &H &8  &lL &x/ &> & &7 &! &@ &O &^ &m &} & &F & &&d &uZƀ &t & & &l;Á &Ё &us &i? &m` &hm & &m & &^ &'& &: &cD &1N &Xx &F &FŨ &HL &Xq &V &q & &g & &qb &: &t &w˫ &*Fث &3 & & &jN &;~% &72 &? &4Ŭ &x &:< & & &5F &ۏW &] &nc & &~) &j &%m9 &;F &9pS &6` &`m &Lz &aP & &9 &s &#Ͳ &Jܲ &Z &K & " &-/ &P< &IpI &V &\Kc &&\p && & & &=P &ڋ &Pų &,ҳ &H߳ & & & &Sf &V9% &Kk4 &@ &^9L &*PZ &i &#pu & &x &s & &0 &< &Lʹ &C=ڴ & &n? & ` &: &e+ &8 &S &h] &A@j &x &E &3 & &` &9pѵ &T޵ & &y &5 &7 &bQ &R^ &wk &2y &q &R & &G &Jd &+Ͷ &~۶ & &1 &  & &g! &X/ &H &g & s &, &o &W & &t &5˷ &#ٷ &} &k & & &1 &S/ &3? &\AO &_ &e &Zk &:r &' &= &, &* & & & &x & &9p &y6 &&B & O & ] &,k &wy &4 && & &jX & &Kjͺ &ۺ &X &;) &c87 & &L & &Uj &1 &l9Ӽ &M\ & &; &J &k &N! &R &> &1 &Ԟ˽ &" &h_( &5 &ZB &9pO & Cվ &w% &9p &P &W7# & & & & &fԿ & &< &h& &3 &/IS &` &:m &a{ &P & &R &I &a &1 &; & &{ &D* &,7 &c8D &Q &¬^ &ek &= & &q & X &* &*' &NC &/IS &yla &K/o &/} &4~ &w & & &! &g &" &/K. &8 &tQ &` &~ &H &1 &` & &= &\' &2 & &# &n% &4 &_jC &R &p &  &} & &^ &; &/ & &I & &ߊ & &.)$ &n3 &P &`[_ &0n &ғ} & & & &' &; & &5X &W & &ju &V' &n7 &gR &b &h &=n &u &p &^ &MA &9 &T & &I &Fb &H &}V &; &ғ$ &q1 &> &-Q &mj & &} &@- &9p &= &"g &b &* &D &9pQ &^ &k &`x &  &x[ &P &ߌ &T & &[ & &w &( &E &hR &_ &bl &y &C & &l &F3 &k &U &Qv && &g &= &# & r! &t/ &= & K &S:Y &_;g &su &LZ &{1 & & &. &} &HU &z & & &$ &ƏG &Y &u_ &e &Vk &v!q &!x & & &Q &‰ &yi & &( &;~ &R &" & &cg &} & &[$ &b2 &HA &rP &oP_ &Cn &Wa} & &T & & & &1; &;~ &6 & &`: &~ &. &> &N &^ &In &K} &[ & &t &{^ &A8 &-C &L &k & &% &q! &1 &A &Q &a &q &M & & &R & & F &q &u &:/ & &S &3! &PK0 &[O &w\ &9pu &6 &;~ &{^ &G\ &[ & &N &W &|W &X &J &% & &r+ &E &T &xi & & &1 & & Y & &i &d & l6 &cC &9pP &L] &Ťj & w &5 &% & C &W &" &]V &p &$ &W &= &# &ܒ &c &m9 &3Ae &5zr &9p & &C &B &di & & &W &" &]V &p &= &#( &5 & N &, &ғ &9p &U & & & & &? &A' &{4 &NA &R &H &9p & & C & && &di6 &< &B &LS &c & & &, &c8 & &~S && & 4 &VC &. T &ϡZ &&` &f &*m &-~ &J & &"z &0h & &^ &,@ & & & &"] &b &r &E$ &J* &zE0 &`n6 &< &S~B &ǩH &WO &T ` &)f &l &Ss &~ & & &) & &- &K &ht & &? & &( &x= &G &.Q &`^ &U &^ &,@ & & &KO & &6r &E &2u &n &e( &5 &B &O &Y\ &>i &v &C &z & &W &I &!a & &l &/ &] &#8 &$ &T &U7 &zD &] &~p &^} &.) & &e^ &Xx & &a &Pa &1 &aD &/I &` & &* &Y & & &`, &B+H &yV &Id &Par &D &m &8 &9p & &| &C &\ &J &] &+ &\?5 &A & M &~Y &Ҽe &s &;~ &c & &h8 & & , &W &y &" &CL0 &> &FbL &HZ &Th &-gv &ғ &jG & &f &h & &ye & &M{ & & &b &2< &J &>YX &\'f &}t &/ &3 & &B &l &Ĉ & & & &a &8B &c. &i`> &N &2^ &k1n &h'~ &r8 & &]S &8 &m &FN & &E & &C &p 3 &blQ &` &ٮo &~ &V & &9 &i & &b &Iw & &+# &W\ &gq. &> &{N &]^ &n &{~ &Z& & &f &RP &+ &Tq &q &St &b &w &. &> &N & & &FX &t &go & &$ &2 &P &|] &\w & && &i &J_ &Æ &za &[ & &Z% &V8 &;F & _V &P\ &M<b &<h &8o &Z & &GQ &؆ &@ &KD &4 &޿ &U &% &} &vx &E9 &> &g & &֭ &: &f &k &  &( & &r$ &* &sG0 & 6 &V< &B &v?I & Y &[` &]g &n &<u &| & &-, &3 & & & & &1= &B &oW & & & " &i0 & r> &tW &9d &kq &} &\! &a- &օ &I? & &Y & &^ &_ & & &M^* &.8 &/NF &b1T &ib &Kp &Us~ &G &UB & &LG & & & &u &6 &\C &;~P &^] &j &I;w &ւ &wV &= & &? & &[ & &= &W &\& &4I3 &@ &_M &0i{ & & &q &= &` & &z &Z & &Ѐ &} &- &sF &zS &l & y &b &V{ &Ф &mK &ގ &9 &j & & & & & & i &V( &v+ &g7 &KE &S &9a &Ro &} &]8 &A & & &a & & &% &$= & &k &% &3 &QL &V &)e &\vo &y & &1 & &#w & & &f &6` & & & &7% &<3 &WA &wO &] &*k &y &j &e & &} &Ns &b &Q_ &0w &* & & &]! &i/ &P= &8K &NJY &g &\u &h &Ȱ & & &F &aB &+ &< & & k & & &, &R\ &j &1x &G &ur & & & &` & &* & &j &) &R, &g: &gH &^V & d &=r & & &# &g & &>p &R & &l^ &d= & ' &ƍ4 &RA &N &oh &<{ &= & &$ &n= & &/" &K &@M &R & & &S> &K &X &e &Ry &2 &Α &˟ & & &, &jA &4 &@ & O &* &;~) &W3 &Œ= &G &q &xC &EP & & & &n &R & & &R & & &o' &; &zI &iYW &f &w &T} &j &y+ & &3 &$C &AI &|(P &l{p &| & &+ &pR & &| &Q &T &j &2 &` &5N &|na &Vw & &d^ &i &݇ & &4{ &$ & &j & &&  &=/ &A> &XM &w\ &k &dz &R &C &n &P &R &Q &  &1 &; & &% & 2/ &2@ &rF &&Y &;~g &yu & &s & &  &  &L & &A &M & ~ & &͋ &IV & & &} &T & &}0 &` &iM &9p! &{;. &]8; &AH &N]U &0b &?o &H| &l & &U} & &s & &\X &e &]  & &{ & &g* &U|8 &F &hT &b &(p &`~ &S & &d &}$ &q& &k) &9 &k & & &" &R1 &7@ &#O &o^ &n &~ &Z  &/ &( & &- &( & &C &+)  &5'8  &ڻF  &TdT  &Ub  &;p  & ~  &'  &:  &  &g  &T  &d,  &f  &\  &1(  &  &y  &'  &76  & E  &T  &gc  &sr  &U  &n#  &i  &  &  &k)  &q&  &#  &9  &k  &  &z&  &5  &D  &RS  &7b  &EPq  &xC  &  &  &  &*  &L  &  &(  &  &-  &  &,T0  &@  &1cO  &^  &(m  &T|  &  &K/  &Bd  &v  &  &  &۴  &@B  &6@  &#  &x2  &H  &,V  &Hc  &p  &  &ڪ  &  &C  &2  &X  &~{  &z  &  &n  &+  & &3 &@ &M &Z &g &t & , & & &  & &C# &c" &P// &N< &S?I &0|V &c &p &f~} &Uj &/ & & &| & n & & &k" & &% &2 &? &=L &dY &f &їs & &` &Fb &W &u7 &߫ &֫ & & &% &. &7$ &XI2 &@ &N &(o] &l &V2{ &m< & &ڳ &# &' & &z &6O &Ah &$ &o0 &? &#N &w,] &Ol &M{ &J & &· &_ &( &; &Z &H &< &/ &  &d/ &%.> &jM &\ &Bk &z & &4 &S & &1L & & &f &2 &D: &  &1. &= &<L & [ &j &Ey &g &Y & & &} & & &^ & &=1 &v & g& &ׄ5 &|tD &SS &:c &s & &7k &-< &Ý & &>; &" &C &z &d  &F &Y' & & & &S? &* &ͭ & &/ &b? &yO &%_ &9Jo &~ &7b &q& &q &d & & &< & &7l &$ &o* &r0 &6 &>g< &wH &R &Jc^ &En & t &z &z & & & & &P & & &} &3 & &*f &A &Q & &*D &A &< &] & &b7 &-A &ZkK &k\ &b & h &F}n &t &{ &F &Av &J_ & & & & &h &+O &D & & , E &$R `k & x &{J &D & &J_ &t & &K & F & U &d<{ &[ &nk &SU &w &s &6 & & &U1 &  &nk &y% &|3 &$|A &O &] &k &( &^F &  &F &0i & &  &PW & &0i+ &w: & H &|V &hd &dr & &إ & &Ȝ & &0 &^ &]  & &|( &w6 &sD &nR &` &n &| & & &V &Gv &1 &C# &  &W% &H &i/  &ZR  &=$  &W2  &@@  &YxN  & ]  &Oj  &x  &  &  &  &H  &W  &o  &  &)  &  & ! &! &o6! &(RC! &LQ! &(_! &>m! &|! & ! &! &! &]! &! &b! &W! &Z! &" &օ" &"" &ep+" &^d9" &_G" &%U" &I%c" &aq" &"" &" &;" &f" &O" &" &a" &y" &E" &e" &[p # &a# &z)# &j8# & G# &7e# &t# &&# &# &# &*# &# &# &# & c# &X# &Ք $ &3$ &ò($ &07$ &{F$ &KU$ &*d$ &P/s$ &$ &$ &l$ &N$ &$ &$ &$ &D.$ &'$ & % &c% &]'% &% &z% &V%`% &G% % &. && &;"&@@& &hL& j& &%v& o& &L& c& &$& O& &$&& & ] ' P' & ' >' &oJ' :h' &xt' }' &' ' &'' &ab' ' &B'' &(  ( &z( 1( &Ϊ>( H( &CU( &b( k( &x(( &(( &nT(( &̽( &q( &( ) &) &}70) &Q) &fFm) &) &U) &6) & ) &d * &R(* &I* &0U* &m:q* &* &&* &* &* &X* &.* &%+ & + &7+ &X+ &zp+ &. + &Vb+ &+ &Y+ &+ &W+ &, &&W5, &H, &_, &I, &dN, &, &, &r, &s`, &$e - &'- &:- &>j- &r- &- &t\- &- &I- &[- & . &U#;. &}BH. &1O. &g. &&. &. &. &-. &^. &. &. &g . &/ &)2/ &o:/ &2L/ &^/ &P/ &8/ &a/ &:/ &./ &L/ &u 00 -080 &9EC0Z0 &h0 &{u0 ~0 &100,000F00 1 &h*121 "61 " ;1 &F1 "{J1 "gO1 &Z1 "^1 "c1 &P/n1 "r1 "w1 &21 " 1 " 1 &1 &61 1 $ 1 &5.1 "*1 "1 &{1 1 &1101 &{2 @2 &12(+2 &{82 A2 &1N2 ]2 &{j2 s2 &122 &{2 2 &122 &{2 @2 &1222 $. 3 "w3 "u3$3 $. 13 "53 "@3J3 $> [3 "_3 "h3 "l3 "q3 $> z3 "~3 "3333 $N 3 "3 "3 "3 " 3 $N 3 "63 "24"4)B4;L4;h4 "Ql4 "Ou4 "by4 "`4 "z4 "x4 "4 "4 "4 "4^4 4S44 5 "5 "5 "5 "&505H5 "L5 "U5 "Y5 "b5l55 "5 "5 "5 "555 "5 "5 "/5 "-5556326G6h_6 i6~66 6666 6h7x 7&7777O7x Z7 &Re7`7 "B7 "<7 &7 "h7 "d7 &P/7 "7 "7 &27 "7 "7 &7 $7 &5.7 "7 "7 &{8 ` 8 &18P*8 &{78 @8 &1M8H\8 &{i8 r8 &18@8 &{8 8 &1888r8 $8 "8 "8r8 $8 "9 " 9939 "79 "@9 " D9 " N9X9t9 "x9 "9 "+9 ")999 ">9 "<9 "N9 "L999 "a9 "_9 "q9 "o :Z:Z/: "3: "<: "@: "F:[:e:}:::&:h:0;E;1;0;;SL;|X; &"_;v; &; "; "; &P/; "; "; &2; "; ";; $1; "; ";; $1; "#; "!<<*< "5.< "37< "D;< "B@<]<l<v<< "\< "Z< "l< "j<<< "< "}< "< "<< = "= "= "= "#=0=H=U=m= =,=4=L= &q= $ = &= "= "= &~= "= "= &P/> "B > ".> &2> " > "%> &֊0> "4> "9> &jD> "H> "M> &X> "b\> ",a> &j> &6q> 1z> &?>0> &o>0> &>0> &>> &{> `> &1>> &{> ? &1?#? &{0? 9? &1F?U? &{b? k? &1x?? &{? `? &1?? &{? ? &1?? &{? @ &1@@ &{*@ 3@ &1@@O@ &{\@ `e@ &1r@@ &{@ @ &1@@ &{@ @ &1@@ &{@ @ &1AA &{$A `-A &1:AIA &{VA _A &1lA{A &{A A &1AA &{A A &1AxA &{A `A &1BpB &{B 'B &14BhCB &{PB YB &1fB`uB &{B B &1BXBj.B $ B ".B "*B "FB "BB $ B "bB "^By.C.'C}.1C $ BC "|FC "vOC "SC "XC $ aC "eC "jC.C.C.C $ C " C "C $ C "A C "7 C "t C "h C8D/D " D " &D " *D " 3D/=D/VD ": ZD "8 cD "L gD "J pD "] tD "[ }D "o D "m D " D " D " D " D " D " D/D/D " D " D " D " D/E#/)E $ 2E/KE)XEgE/|E0E=EE.E /E8FF( (F=FhTFP ^FsFhF( F\FhFx F~FFx GG(GP 8G;0YGa0cGa0G " G " G "& G "$ G0G $ G "7 G "3 G "O G "K G0G11HH8H "e N TN3lNNNNNNNO O"Oh7OhOOP YOnOhOtOOhOOOhO[O<P+P5PdJPhbPlP}PP[P &-P`P &ZP " P " PwQ &6UQ &Av Q &+O-Q &AQ &wHQp_Q &jQ "4 nQ "0 sQ &P/~Q "Q Q "K Q &2Q "u Q "o QyQyQ " Q " QyQyQ " Q " RR &iR $ !R &2,R " 0R " 5R &CR &{PR ` YR &1fRuR &{R R &1RR &{R R &1RR &{R R &1R SS $%S " )S " 2S "6S "@S{JS{fS "jS "sS "'wS "%}SS!S`SBSxT T Th8TBTSTkTT &!T &2T &sT &T $T &2T "\T "4T &sU "! U "U "U ""U &-U "1U "g6U &AU "JEU "(JU &UU "YU "^U &\iU "$mU "rU &֠}U "eU "[U "U "U &fU "U "U " U "U "#U "U &U "_U "WUx U &U; V &V "#V "(V &N3V "7V "lMylllx llxl lhmxm 1mhImSm hmhm m mm m mmm nh$n.n ?nVnenon $0n " n " n "!n "!n $0n "r!n "`!n "!n "!n "B"n "("n ""n ""n ""n ""n ""n ""o "#o "#o "l#o "`#o "#!o "#*o7o $zDo "0$Ho "$Qo[oto "$xo "$o "$o "$o "$o "$o $o "$o "$ooo "'%o "%%o "'%o "%%o "'%o "%%p;p "G% p "5%)p;3p;Lp "%Pp "%Yp "%]p "%fp "%jp "%qpwpppS phqq $q;qEq Zqhqq{qZ qqq' qqqO qhrr'r2 )4yz>yzZy "O)^y "M)gy "^)ky "\)zyyy "n)y "l)y ")y "~)yqyqy ")y ")y ")y ")y|z|"z ")&z ")/z ")3z ")=zGzcz ")gz ")pz ")tz ")zz$z &ez &2z &cz &z &Nz &"z &{ &{ &`{ &*{ &`9{ &,>K{ &2X{ &ce{ &r{ &N{ &"{ &{ &{ &`{ &{ &`{ &{ &2{ &s | &| &#| & 0| &#=| &J| &W| &a| v| &{| | &1|| &{| ` | &1|| &| &2| &| &s} &|} &J_!} &.} &Ȝ[} &Yf} $|} ")} ")} &} "%*} "*} &s} "n*} "X*} &} " +} "*} &N} "+} "+} &} "+} "+} &} ",} "+} &2~ ">, ~ "4,~ &j~ "y, ~ "q,%~ &,~$5~ &C~ &{P~ Y~ &1f~u~ &{~ ~ &1~~ &{~ ~ &1~~ &{~ @~ &1~  &{ ! &1.= &{J S &1`j $ $ &J_ ", ", $ $ ", ", $,  "- "- $,$. $HDNpvzv $Z "P- "N- $Z̀ "_-Ѐ "]-ـ "n-݀ "l-0: $jQ[ $l "-p "~-y "-} "- $́  $ "- "-! 3 = Y "-] "-f "-j "-t ~  "- "- "- "-  ւ "-ڂ "- " . " .   ". ". "..# ",.//9/U "A.Y "?.b "P.f "N.uRR "`. "^. "r. "p.tt܃ ". ". ". ".{{ ".! ".* ".. ".7{A{Y ".] ".f ".j ".t{ $ ". ". ". ".DŽф " / " / "/ "/. "//2 "-/; "?/? "=/HRj "R/n "P/w "b/{ "`/ "u/ "s/ "/ "/Džх $ "/ "/ "/ "/ $ "/ "/ "0 "0 "B0 "<0( "e0, "_05 "09 "0BPO\f "0 "0 "0 "0 "0 "0 "0 "0 "1 "1͆ $چ "1ކ "1  ")1 "'1 ";1 "91$ ";1( "913L "L1P "J1Yc| "_1 "]1 "q1 "o1 "q1 "o1 $Ň "1ɇ "1҇ "1և "1 "1 "1 "1  "1 "1 "1  "1$ "1- "11 "1;U_x "1| "1 "2 " 2 "2 " 2 "2 " 2 "2 " 2 "2 "2ň҈PP "/2# "-2, ">20 "<2:wDw` "R2d "P2m "b2q "`2zww "u2 "s2 "2 "23̉C  "2 "2 "2 "2' 1 M "2Q "2Z "2^ "2mGwG "2 "2 "2 "2Ԋ "2؊ "2 " 3 "3$ $  "3 "34%&/ $@ ".3D ",3M "A3Q "?3WuX ыT&,hCM#byahΌh%6Mm &1 &2 & & Í &{Ѝ ٍ &1 &{   &1' &{4 `= &1JY &{f o &1| & &x &{  &1Ύݎ &{  &1 &a' &a4D &V &2c &p &u} &' &br &* &ew & &=Kˏ &a؏ &y & & &X  &s && &0 > &Q &{^ g &1t &{  &1 &P &2͐ &sې &t &2 "T3  "N3 &s "y3  "s3% &0 "34 "39 &D "3H "3M &]X "3\ "3a &l "3p "3u &\ "4 "4 &[ "4 "4 & ",4 "(4 & $Ađ &֑ "F4 "D4 "X4  "V4 "X4 "V4 $Q( &:FDF] "i4a "g4j "{4n "y4w "{4{ "y4 &{  &1  &{ƒ `ϒ &1ܒ .ChZdu &J &2 &sƓ &͓P &2 "4 "4e $ "4 "4$ "4( "41 "45 "4> "4B "4Gfp $' " 5 "5 ")5 "'5 ";5 "95 "J5 "H5͔۔ &U@ $ &2 "g5 "Y5 &s "5 "5 &`$ "5( "5- &28 ">6< "(6A &L "6P "6U &` "6d "6i &t "/7x "7} &x "7 "7 &m &{ @ĕ &1ѕ0 &{  &1(  $ &! "7% "7* &N5 "79 "7> &-I "7M "7R &[] "7a "7f &[3q "7u "7z & &7} &T &(ʖ &ؖ & "7 "7 "7 "7( "7, "75 "79 "7B "7F "7O "8S " 8_i $6z ""8~ "8 $6 "J8 "D8 "x8 "r8 $P "8ŗ "8Η "8җ "8ח $j "8 "8 "8 "8+@Uj˜ט'&;Pezҙ3= $N "9R "9[ "_9_ "Y9d $m "9q "9| $ "9 "9 "9 "9 $ "%: ":H֚x@ &$ &21 &D> &"K &d &q &` & &` &, &2 &Nț &3՛ & &- $ &2  "d: "N: &N ":# ":( &6 &ES &{` i &1vp &{  &1h &{Ĝ `͜ &1ڜ` &{  &1 X &{( 1 &1>PM &{Z c &1pH &{ ` &1@ &{ ǝ &1ԝ8 ";  "; "%; "#;",D "8;H "6;Q "H;U "F;^h "[; "Y; "k; "i;Þ "~;Ǟ "|;О ";Ԟ ";ޞ "; "; "; ";C)CE ";I ";R ";V ";\[qhȟݟh*O4R?g~4rhOӠh4' &HI2I &5T ";X ";] &h "'<l "#<q &| "L< ">< & $:¡ "<ơ "<̡ & $ & "< "< "= "<) "=- "=2 &5= "\>A "X>F &RQ "v>U "t>Z &moe ">i ">n &C`y " ?} " ? & "? "? &| &s "P@ "<@ &HŢ "@ɢ "@΢ &K٢ "Aݢ "mA &B "C "yC & &' "#D " D &f#% "D) "D. &9 "D= "DB &M "DQ "DV &ka "De "Dj &Du "=Ey "9E~ &2 "[E "SE & "E "E &~e "E "E!ɣ &>УN"٣ &.Vr$ & & &` $8  && "F* "F/ &N: "F> "FC &-N "FR "FW &[b "$Gf "Gk &[3v "SGz "MG ) & &7} &T &(Ϥ &ݤ & ) ) "G "G  "G$ "G- "G1 "G: "G> "GG "GK "GT "GX "G` $i &Bt "Gx "G}) &cG "G "G $ &ң:* &C]Х &Bۥ "Gߥ "G $ &z* &cG "H " H$ *<*\)y:*)))˦ &{ئ  &1xL*  & "AH "?H! &N, "TH0 "RH5 &-@ "fHD "dHI &[T "xHX "vH] &[3h "Hl "HqL* & &7} &T &( &ϧ &L*L* "H  "H "H "H "H# "H, "H0 "H9 "H= "HF "HJ "HW &d &`r\% & "H "H &N "H "H &- "H "Hè &[Ψ "IҨ "Iר &[3 "I "I\% & &7} &T( &(; &I &\\%f\% "%I "#I "6I "4I "6I "4I "6I "4I "%I "#I "GIĩ "EI̩n# & "WI "UI &N "iI "gI  &- "{I "yI &[( "I, "I1 &[3< "I@ "IEn#V &h &7}u &T &( & &n#n#٪ "Iݪ "I "I "I "I "I "I "I  "I "I "I "I& $/ &: "I> "IC &NN "IR "IW &-b "Jf "Jk &[v "Jz "J &[3 "+J ")Ju& & &7}ë &TЫ &( & &u&u&' "=J+ ";J4 "NJ8 "LJA "NJE "LJN "NJR "LJ[ "NJ_ "LJh "_Jl "]Jt|+ & "oJ "mJ &N "J "J &- "J "JŬ &[Ь "JԬ "J٬ &[3 "J "J|+ & &7} &T* &(= &K &^|+h|+ "J "J "J "J "J "J "J "J "J "J­ "Jƭ "Jέ' & "J "J &N " K " K  &- "K "K &[* "1K. "/K3 &[3> "CKB "AKG'X &j &7}w &T &( & &'®'ۮ "UK߮ "SK "fK "dK "fK "dK "fK "dK "fK "dK "wK  "uK,!6 $M!W $&n+"x $6 "K "K "K "K "K "K0"ѯ"ۯ $F "K "K "K "K "K  "K "L "L"J"T"p "Lt "L} "1L "/L "BL ">L"" "\L "XLʰ "vLΰ "rLװ "L۰ "L "L "L"  "L "L"4">"W "N[ "Nd "/Nh "+Nq "GNu "ENz""ȱ+$ұ $Y "WN "UN "kN "gN "N "N +$ $k% "N) "N2 "N6 "N? "NC "NH $kQ "NU "N^ $}k "No "Ny $ ".O ",O8$8$ "BO ">O "ZOŲ "XOβ "iOҲ "gOײM$]$"r$, $= "{OA "wOJ "ON "OW "O[ "Od "Oh "Om$$$ "O "O "Oij "Oͳ$׳$ "O "O "O "O  % %1 " P5 " P> "PB "PL %V $b "-Pf "+Pp %z $ "DP "BP "[P "YPA(A(ɴ "oPʹ "mP״Y( $  "P "}P "P "P ( $ ( "P, "P5 "P9 "PB "PF "PO "$QS "Q\ "GQ` "AQe $ n "nQr "dQ{ "Q "Q "Q "Q "Q "Qr) $H  "Rõ "R̵ "%Rе "#Rյ)** "4R "2R"*, $X = "IRA "GRP*Z $k k "XRo "VRx "hR| "fR*++ "wR "uRƶ "Rʶ "Rж!`!!`&V">$V$cJ(pr)*z-Q  طY  &9# &20 &u= &J &W &=Kd &aq &y~ & & 0 &{ @ &1͸ܸ &{  &1 &{ $ &11@ &{M V &1cr &{ @ &1 &{  &1ǹֹ &{  &1 &{  &1'2 &%D &NQ &f &.q $J| &2 "R "R &w "R "R &Z "S "S "TSź "LSʺ &|ٺ &mo "S "S & "S "S &% &{+ 4 &1AP &{] f &1s &{ @ &1 &{ ʻ &1׻ & "'T "#T4 "@T8 ">TA "OTE "MTN "OTR "MTX|~ $a "bT "^T "T "T "T "T "T¼ "TǼ $z  "T "T "T "T' "T+ "T4 "U8 "T=]j Qh̽cֽvh  4c? &9FM &2Z &sg &t & &\ &[ &s) & &Ͼ &ܾ &N &- &[ &[3 &# &7}0 &T= &(L &Z &l &`~ &:I & &! $ &2 "Uſ "Uʿ &sտ "QUٿ "KU &?N &  "|U  "zU &  &/8 $B &T{ ^{ w "U{ "U "U "U "U "U $* &   "U "U "U "U "U "U  && 0 I "UM "UV "UZ "Uc "Ug "Us &{  &1 &{ @ &1  $h;pEVmp & $ &2 "U "U &0 "V " V &s) &k "LV "FV "xV "pV &P/ &x "V "V &$ $- &8 "_W< "YWEOh "Wl "Wu "Wy "W "W "W $ & "W "W &N "W "W &- "W "W &[ "X " X &[3 ".X "*X $= & "LX "HX $R  &7}-6 &TA "hXE "dXJ &(U "XY "X_ $ih &s "Xw "X| & "X "X "X "X "X "X "X" "X+ "X/ "X8 "X< "XE "XI "XT^ $k "Yo " Yt $} "FY ">Y "yY "sY $ "Y "Y "Y "Y $  "Y "Y "!Z "Z "VZ "RZ "7Laz0EZo%' &{4 = &1JXWb $s "uZw "oZ| $ "Z "Z "Z "ZW $ " [ "[ "-[ ")[ $8 "N[ "J[ "q[ "k[ "[ "[*?Ti\%:Ody 2< $UM "[Q "[V $U_ "[c "[l "\p "[y $o ":\ "6\ "W\ "S\ $ "x\ "t\ "\ "\ "\ "\*?Xm $y "\ "\% "4]) ".]. $y7 "Z]; "T]FP $a "{]e "u]j $s "]w "]o8 &  &2 &Y, &sF &?NS &)` &3m &z &0 & &$ & & P  & & & &{  ) &16 E &{R [ &1hw &{  &1 &{ @  &1 &{  &1  &{  &1,7 &H &2T &s` &l &\x &0 & &> &E &  "] "] &, "] "]# " ^' "^- &P/7 ".^; "(^A &2K "]^O "W^U &_ "^c "^t "^x "^ &5. & &` "^ "^& $ "^ "^  "_ "^:+8!OP\g &Su &h_ &h &h_ &0 &L & &4 &0YR & d &P/ & &( & &w &mo &| &}- &w' &|B &P &] &bk &|} & &# &: & &: &ٞ &b &q( &uH &w9e &7kq &} &9p &8c &( &9p &  &( &9p &+i & l &*) &5< &Y &wf &s &T &V &w & & &_ &w & & &v & &! &= &*FT &p &*F &@t &x &Tg &g: & & &b  &- &< &M &Y &f &w & & &x &;~ & & &` &B &;~ &| &;~  & &;~- &QD &nV & l &r~ &Z &: &T &31 & & &a &w &3 &=$ &Z2 &)QB &wO &\ &i &v &R &7 &C &% &> &W &p & & &  &  &( &6 &D &R &.` &Go &7~ &p & &R  & & &w & & & &h  & &( &7 &̵F &U &d &o &*| & &w & & &B &N &! &;% &]3 &uA &cO &L=^ &m &| &ٺ & &  &} & &  & &h  &̸ &$ & 3 & B & Q &:\ &;i & & & &M &B &N &! &X  &Ŷ &ݶ & & ) &35 &E A &]7M &u U & ^ &Fo &} &g &8 &: &h &: &s &: &f &:* &ij@ &wM &c &wp & &w &[/ &: &W &: & &?  &: &da6 &:O & If &:s & &: &K &: &( &"j & &K+  &d &j0 &w< &=I &Ld &wq &c &w $ "_ "_ "h_ "\_ "_ "_ "_ "_>. "_2 "_; "_? "_H " `L "`U "1`Y "+`b "P`f "J`o "o`s "m` "` "}` "` "` "` "` "` "`  $# "`' "`, $5 "`9 "`Ip z  "` "` "a "`'1 1( "a, "a5 "2a9 "0a?Yg|h $ "Ia "?a "a "{a "a "a  "b "b "Nb "Db% "b) "b2 "b6 "b? "bC "bL "bP "bY "b] "bf "cj " cs ""cw "c "Kc "Ec "c "wc $ "c "c "c "c "c "c%'/KmIh &S &S &4j  &Lh !  &;" ' & ' * %T1 &dM &>Y &c &;q &U4v & & & &y, & & &O & &E &"> &Z &v)a &o &5t & &V & &r &# &3 & & &+ & &G7 & &;  &n  &^'# &/ &o; &G &+S &|f &*k &w &< &*# & &H8 & &3 &;5 & &$ &r & &( &],' &(5 &H;A &|N &[ &3n &{ &r% & & &# &` & &1 &( &4 4 &:A &N &s9\ &:i &v &s9 & & &^ & & &( &n &> & &=  &;. &%< &; J &X &Mf &t &@ & & & & & &M &t &% & & &Q &C5, &: &H &4e &pt &R" & & &h" & &u* &| &' &Q  & &&) &O8 &=G &k&V &2e &t & & &i  &  && & & &a &2 &7  & &( &<7 &F &E,U &&d &s &K & &E> &  &( & & & & &  & &' &w66 &c$E &M/T &c &/r &I &{ &0 & & &/ &f6 &5 &L3C &%Q &[1l &z &# &/ &f6 & &7  &G &!  & & & &%R & & & &l & & &` &1 &i &G5 &VB &Y &%e &$q &~ & & &!! &! & &4 & &w &* &y7 &'D &;R &,` &%n &} & &: &j% & &0: &6 &G & &m0 &+  &= &2& &4 &5,B &<P &h ^ &a4l &z & &; &= & & &z &  & &+ &: &J &wY &h &w &5 &7 & &  & &>6 &y &[ & &n  &G &\=+ &: &I &X &4g &0v & & &G &  & &n & & &s4 &  & &69 &#H &SW &=f &vu &; & & &4 &: &m &- &7 &{ &w &6! &01 &-A &Q &-a &&q & & & &^ &t &0> &a & &  & &* &49 &H &JW &f &(,u &1# & &> &V & & &= &  & &  &I &4) &8 &G &kV &e &Yt &* & & & & 0 & & &&' &) &7  &= &=>) &8 & U &d &s &0& & & & &f &$ &= & & &  &< &0' &6 &BE &Z7T &.c &+r &} & &8 &K & & & &` &_ &6 & && &5 &D &_S & b &=q &> &$ & &2 &8 &G &  & &- & &" &% &94 &4"C &yR &aa &p &: & &1 & & &_  & & &h & &) &O%$ &G 3 &'B &.Q &a &>p &2 &* &F  &  &p1 & & & &s &! &% &8$ &4 &C &;R &a &p & &  & 9 &  &7 & &6/ &# &  & & &$ &0!3 &B &pQ &)` &o &~ & &' &#1 && &=  &#  &} & & &$ &13 &^>B &Q &Q` &;o &Y~ &* &F &90 & &;( &/ &> &\ &%  &0 &x( &> &'M &> & &! &  &j &% & & &m* &v$ & &P8* &2: &H &U0V &sd & & &i & &  &3 &+ &- &! &/ &= &L &C"Z &S;h &|v & & & &) &Y/ && &I0 &+ & &=  &L!  &O  &c  &x  &  &  &  &F   &P  &'  &:  &8  &  &  &#(  &A5  &C  &GO  &w\  &i  &!v  &o  &a  &  &G  &  &   &1  &/  &  &  &$  &<0  &,=  &&J  &W  &6:d  &q  &O1~  &   &  &G  &#  &(  &  &  &  &  &  &j  &$$  &y1  &>  &V  &2c  &p  &}  &  &  &4  &G  &  &5  &>  &N!(  & 6  &D  &R  &,`  &cn  &|  &  &  &z  &"  &  &;  &  &F'  &:  & & &$$ & 2 &o8@ &3N &\ &j &5x &2 &  & &h< &. & &x &u &9 & & &G# &40 &.T &%` &8<l &y &e &  &1 &  &' &/ & & &  & & 0 &= &2J &t0 &q &!6\ &h &N & = &% &  &q &g> &$7 &  &q &V1 &0 & & & &. &U) &Y7 &E &S & r &@ &5 &* & & &.  & &^ &C &_# &J=2 &@ &N &\ &x & &T- & &Z & &] &c & ' &/ &! &5- &J=; &I &W &Ie &m/z & & & &t & &R  & &  & &r%( &5 &Q &] &(!j &w & &I &s7 &( & & &G  &N &2# &? &SK &R ] &j &w &s9 &3 &% &[ & &u1 &% & &s9  & &x+ &a7 &D &aQ &@= &: &G & &!6 &W &. & &$) &E & & &K) & &i& &*3 &A &N &e &P&r & & & & &+ &> &P &( & &a4 &- &, &9 &WF &S &.+f &,$s & &< &,$ &: &O  & &[ & &,$ &* &g &  &2 && &`3 &6:@ &M &Z &Lg &t &  & &> & &3 & &n. &8 &-  &S3# &80 &[= &6:J &Gm &Z7z &; &4 &# &x &i &% &> &5 &+ & &:  &. &7; &H &5U &2 & & & & & &z1 &) &" & &% &l< &I &V &7c &z & &l &7 & &l & & &/ & &f* &' &$4 &K &X &*e &f,| &# & & &  &3 &H4 &  &  &  &H#+  &c8  &55D  &u\  & h  &[t  &  &  &4  &  &6  &L  &Q  &n  &   &! &! &! &*! &&7! &,D! &;Q! &_! & y! &! &-/! &- ! &! &S! &! &(! &i! &- ! & " &I" &%" &2" &,@" &u8M" &Z" &g" & t" &" &" &2" &7" &\" &" &=<" &" & " &" &1# &## &g1# &+># & L# &p1Y# &sf# &$s# & # &G# &# &s# &# &Y# &# &X# &$ &$ &$ &-$ &B$ &O$ &]$ &-$ &9=$ &f0$ &I$ & $ &$ &$ &1$ &{7$ &% &0 % &,% &% &4&% &4% & B% &^% & l% &z% &% &s4% &-;% & % &6-% &C%% &-=% &% &% & & && & %& & 3& &qA& &8O& &U]& &k& &y& & & &M& && &~& && &X& &=& &H& & *& &v' &' &'#' &R=1' &?' &4 M' &[' &!8i' &w' &' &"' &' &' &2' &9' &4$' &' &' &( &( &( &.( &-=( &6K( &Z( &!h( &Fv( &_ ( &H5( &h ( &%( & ( & ( &( &4( &( &) &) &) &,) &7:) &H) &eV) &Ed) &) &e) &? ) &1) &) & ) &u) &h ) &^0) &* &-* &N';* &J* &MX* &f* &t* &/* &* &* &!* &G* &:* &* &* &* &= + &=+ &*+ &:+ &;)I+ &e+ &s+ &O+ &+ &+ &\+ &+ &:+ &n.+ &?, &, & #, &1, &>@, &e, &s, &, &= , &, & , & , &, &, &, &1- &9- &s2 - &%.- &<- &NJ- &X- &f- &Gt- &`- &- &.- &0- &&- &5- &- &- &% . &. &$'. &x%A. &Xd. &Cq. &(~. &f&. &. &6. &+. &g:. &a&. &6. &Q/ &e/ &[ / &u-/ &:/ &G/ &T/ &<;a/ &n/ &>!{/ &/ & / &/ &^>/ &9/ &b%/ & / &/0 &60 &"0 &:<0 &9I0 &^>\0 &/%0 &0 &0 &0 &0 &G0 &"0 &70 & 30 &V1 &< 1 &0&1 &$1 &!11 &>1 & K1 &gX1 &e1 &0r1 &c1 &11 &1 &1 &1 &1 &$51 &G1 &1 &1 &[ 2 &2 & /2 & ,2 &!:2 &;S2 &ga2 &o2 &.}2 &2 &:2 &22 & 2 &2 & 2 &2 &42 &^ 3 &3 &'%3 &I33 &A3 &kO3 &7]3 &kk3 &*y3 &3 &3 &+3 &3 &.3 &3 & 3 &3 &3 & 4 &(4 &\;!4 &/4 &=4 &/0K4 &Y4 &(g4 &u4 &4 &Y94 &!4 &4 &84 &64 &54 &4 &+4 &05 &65 &_5 &,"5 &,5 &95 &F5 &w/S5 &n`5 &m5 &-z5 &p5 &#5 &(5 &5 &;5 &5 &5 &5 &>5 &6 &"6 &6,6 &66 &>U6 &K_6 &!y6 &6 &6 &6 &p6 &6 &76 &6 &j6 &6 &6 & 7 & 7 &+ 7 &;*7 &;47 &x>7 &>K7 &X7 &e7 &r7 &7 &,7 &7 &U7 & 7 &7 &397 &7 &+*7 &7 &t8 &8 &8 &W#(8 &D8 &8Q8 &1^8 &:k8 &a4y8 &8 &-8 &68 &8 &u38 &8 & 8 &8 &b78 &8 9 &549 &@9 &Y9 & f9 &s9 & 9 &9 &)9 &9 &9 &;9 &9 &9 &9 &- : &&3: &@: &M: &Z: &@'g: &t: &/3: &7: &: &: &: &9: &: &: &:: &+; &; &^"; &.; &M<:; &J(F; &R; &_; &m; &+; &,; & %; &|; &t ; &X; &; &; &5; &>< &P!< &(/< &;< &;G< &,S< &> _< &Rk< &x< &< &< &m< &Z8< &:< &8< &1< &C< &g= &*= &89= &9F= &^S= & `= &qz= &= &G= & = &,= &= &`9= &> &0> &c"> &/> &<> &#I> &gW> &-f> &,t> &-> &5> &> &H:> &p5> &> &> & ? &? &9*? &.D? &Q? &d? &7q? &~? &? &? &&? &? &? &<#? &c? &? &;? &@ & @ & @ &'@ &A14@ &EA@ &&N@ &[@ &i@ &w@ &m@ &g@ &@ &@ &@ &:@ &ZA &!A &;%A &42A &!IA &_VA &!mA &#yA &/A & A &)A &4A &A &"A &A &A &B &:B &B &Z B &'B &8B &*>B &U$DB &JB &:QB &8^B &kB &.xB &@B &@B &"B &B &B &B &_B &8C &1C &0:"C &3/C &<I &/J &J &g.J &+J &9J &GJ &&UJ &7cJ &6qJ &J &J &SJ &J &J &,J &/J &J &@K &+K &)K &T)7K &EK &TK &1bK &qK &K &K &K &QK &VK & K &hK &<%K &L &%"L &_IL &=]L &S;gL &|L &sL &2L &6L &:L &L &7L &7M &)M &7M &:EM &:SM &aM &54}M &6M &'M &M &zM &7M &M &M &M &;M &K N &$ N &;%N &<3N &PAN &j3PN &_N &$+nN &*}N &GN & N &N &N &N &sN & N &N &O &5O &1O &.@O &%3OO &.^O &XmO &|O &;O &/O &N4O &/O &GO &O &0O &>O &b%P &P &G!P &70P &-?P &NP &]P &2lP &`{P &iP &P &4P &,P &P &(P & Q &>Q &#Q &5-Q &0FQ &RQ &^Q &jQ & Q &Q &Q &+Q &Q &Q &+Q &Q & R &7R &"R &.R &ER &|TR &'cR &qR &=R &R & +R &5R &R &R & R &.S &.S &!S & :.S &;S &yUS &&cS &4;qS &5S &%S &v;S &?:S &#S &S &r%S &S &S &#T &+T &5AT & ST &qT &T &GT &ST &T &T & T & U &V:U &i(#U & 0U &s=U &JU &WU &dU &qU &~U &U &vU &$U &$U &EU &U &U &V &cV &%"V &"0V &>V &@LV &IZV &o hV &#vV &]V &V &V &V &V &vV &V &:.V & $V &S5W &W &.$W &2W &@W &NW &>\W &jW &xW &= W &W &:W &RW &u&W &W &6W &W & -W &X &X &{9!X &0X &.GX &?VX &eX &_tX &JX &,X &+X &X &D)X &"X &lX &X &` Y &5Y &>Y &)KY &*XY &eY &rY &Y &Y &Y &Y &YY &"Y &Y &Y &gY &1Y &Z &Z &*Z &W8Z &FZ &v!TZ &6bZ &*pZ &~Z &V,Z &Z &qZ &*Z &Z &Z &Z &*Z &D<Z &n [ &[ &<&[ &4[ &nB[ &P[ &^[ &El[ &&z[ &[ &&[ &V[ &$[ &[ &q[ &[ &[ &n\ &\ &\ &-\ &E$<\ &K\ &'Z\ &.i\ &#x\ &\ &2\ &(\ & \ &\ &!\ & \ &^\ &\ &y] &] &,] &';] &Z] &8i] &s+x] &9] &] &?4] &] & ] &] &] &P^ &~^ &^ &^ &!^ &_ &F,_ & {_ & _ &9_ & _ &_ &7_ &_ &/_ &J_ &$_ & ` &G` &%` &(?` &&L` &e` &>r` &` &` &[` &_"` &` &` &` &a &a &*a &J7a &Ea &_a &Jra &qa &a &a &{a &8a &)b &X b &2b &'b &4b &:Bb &Nb &_[b &hb &avb &b &T.b &)"b &Vb &6b &b &f8b & c &4 c &*c &%7c & Dc &IRc &Lfc &1sc &c &:c &]!c &v=c &d &xd &#d &"9d &Ed &.[d &hd &"ud &%d & d &Id &-d &nd &d & d &0e &me &\ "e &/e &"=f &Jf &<Xf &wff & tf &of &f &l;f &f &y<f &f &)f &f &=f & f &5g &G'g &$2-g &$.3g &9g &?g &Eg &Kg &Qg &mWg &g &5g &sg &Zg &?g &g &P6g &g &g & g &[h &h &+h & *h &7h &4Eh &Rh &`h &mh &X!zh &h &h & h &h &h &h &  i &_i &i &c,i &X!:i &sGi &ETi &m=ai &ni &!}i &i & >i & i &:i &i &j &/$j &09j &Ej &Zj &#fj &Nsj &j &Gj &j &j &8k & 'k &3k &Dk &Jk &Pk &%<Vk &\k & bk &5hk &ok &k &$k &$k &*(k &.k &Lk &9k &Ik &k &Bk &k & k &k &k &l &l &u6l &'@l &*Xl &-dl &3zl &/l & l &j1l &.l &#l &ol &l & l &%l &)m &Gm &6-m &m;m &+Im &<Wm &em &vsm &*m &2m &m &- m &m &m &9m &0n &=n &!n &n &k&n &n6,n &-2n &9n &fn & sn &Cn &%n &i n &n &=n &8n &n &n &( n &(n &~' o &u.o &T$o &1o &9>o &Ko &vXo &Keo &Gro &1o &o &&o &o &1 o &Xo &o &4o &&9o &k)o &p & p &xp &p &p &!p & (p &- 6p &!Dp & Rp &4`p &np &|p & p &fp &p &q &hq &!q &5/q &=q &Kq & 7Yq &gq &1uq &:q &q &r &G,r &~4:r &THr &NVr &Cdr &0rr &r &!r &5r &r &^3r &r &+r &ir &r &Mr && s &F.s &G)s &7s &3Es &kSs &as &os &bs &/3s &]s & s &"s &s &k7s &|>s &I t &t &V2)t &37t &;2Et & St &bt &f+pt &s~t &ct &t &t &+t &63t &t &`t &Ut &+4t &1)u & u &Gu &u & v &.cv &o(pv &~v &'v &v &v &a;v &Bv &!v &w &w &+!w &1/w &%=w &Kw &(Yw &o-gw & uw &Uw &w &yw &mw &fw &w &kw &|`x &`y &H5z &Bz & Zz &gz &.z & z &9z &z &z &U*z &9z &@z &"{ &{ & { &.{ &<{ & J{ &RX{ &c1f{ &t{ &1{ &'{ &W{ &<{ &{ &3{ &{ &k4{ &\*{ &3| &| &T| &*| &48| &IF| &RT| &?3b| &{| &)7| &6| &| &| &S| &g| &/| &| &W} &a&} &&} &N ,} &:} &H} &$V} &d} &# r} &} &q>} &} &=} &} & } &} &V& ~ &=~ &~ &&~ &f2$~ &:+~ &3:~ &-H~ &_V~ &d~ &~ &~ &l~ &~ &9~ &!~ &9~ & ~ &\~ &6 &4 &$ &2 &@ & N &B0\ &6j &(x &x &w  & & & & & &s  &8 & &)( &{A &(P &&Z &n &x & &@ & & &  &:  &$ & &]- &l &? &4+ &Ey &yF &b)i & &  & &Ç &ɇ &w:| &S &n ] &  &'0 & &8Ɖ &Ӊ & & & &f &$ &3 &VB &V+\ &*h &t & & & &%& &f & &Ί &-ۊ &~; &z & &N# &K &) &+6 & C &4P &k & u & &~" & &5 &n. &ċ & & &G &;" &f4/ &j1O &hi &;v & &m, & &; &F' &Ɍ &׌ &6+ & & &m' &5 &+ &9 &G & ` &_5 &' & &- & &/ȍ &4Ս &f4 &+ &T &L   & &y ) &m'7 &PG &W &|g &x &H~ & &{# &n &% &y- & &̏ &l:ُ &0  &B &!+ &8 &;O &[ &h &v & & &v; & & &ʐ &ؐ &u  &  &4 &1B &P &!0 & & & ̒ &5ْ & & &F' &1 &  &# - & : & &ʓ &8ד &;' & &@ &xM &#Z &g & &A &! &. &; &G &$ &9 &>ҕ &  &9 &0 &(= &] &(6j &.w &u & & &) &(ϖ &ܖ &5 &i &77 &' &4 &A &N &!0[ &a.h &,u & &"% & &$ &r* &E1 &M &] &1n &t &"z &  &= &6 & &7 & &h  &}  & &Ϙ &ݘ & &7  &6 &.% &:3 &G & &M & &C- &x( &48   &<+ 4 &k? ] &Ph Uq &e| * &z  & š &:͚ ֚ &A&ޚ &* ! &F ' 'f %/W  &?B &F &A% &?* &A8 &[E? &EF &BR &QB` &?g &?~ &S@ &B &L &-C &UE &E &Eě & Bћ &@ޛ &? &? &J &#F &F@ &HE &@  &F' &,K4 &HFA &~DN &\@[ &Kh &nFu &J &B &HA &C &C &"AÜ &oBМ &Cݜ &J &aK &C &DJ &D &>* &J6 &DB &o?O &?[ &@g &>s &{C &K &O? &jA &=C &B &@؝ &E &A &D &)B & &AJ &DW &Dh &F?n & Dt &aCz &A &{J &:F &6? &D &"L &;@ϟ &BEٟ &i? &@ &E  &BE* &i?5 &@F &ERp &K|  &@ | +x!7CR;c;n {;;S; 0C`irx`rr ,?ObrZZ$6EP]m0. 0. C0.p . ;0 I0cK. /j.Gj.cy.}}. }. .  .  B 3/u . 0   /  #/ -; /M /^ /p / / / /  / / a0' a08 0P 0f u    7 7 7 7 ? ?   ?% ?0 S= ?L \ o             `5 pR pv p p p  l {({]"WK%Kf $- C`; ; ; ; ; ; ; ; ; &565G5X5h5y555 o   0 40 `U p 0 U   6\ _\ o\ \ \ \ \    W]   & 8 N1 f1 u G G p p -c -"c 9-_c s%%%PU|%%d` *`O _w 2 ' :G Xe ~   ,;Me}99@ @  V@ Y@v `c $6DXiu d dO  d d  d d% d:PO O   * J j    !7! s!! !! C"~" """#7# m## ## 1$W$ $$$$ (%H%;h% %;%%G&U&2!h&&! &r &r &t &&&&'!'0' B' Q' f' x' '!'!' !' !' !' !(0H(0(0(z(Z)o)o0)vA)zP)z_)zo)))q)q)|)|))) *&* K*o**+ +++2+K,,?, d,z, ,,,-Q-`-o---- - -- - -  . . /. B./Q./a.Rs.R.t.t.{.{.{.{../ } //0/@/S/c/v/////0C0f000000R11*1<1M1`1r1111 1111112 202P?2PS2wc2wv2w2w22 2 2 2G2K2 33$/3&B3&U3z33333 4$4F-4G4Y4j4F|4F4P4e4e4e4e 5*5<5K5h555556?666667'07t7777777778#888K8d8y888888888 99*9:9D9MO9`9u9M99M9999'99:'&:A:'e::2::2;&;9;I;\;l;;;;;;C;C;(<M<<<P!< =P!= =P!J> ]>!w>)>"!?!?!Q@!@!`A An#C&$D"D$D(D\%E%>E$\E!yE E!E E!F F )F F )F F )G %G )?G TG )pG G )G )G )G)G)G)H)BHL*UHL*gHL*yHL*HL*HL*HL*HL*H\%H\%H\%I\%I\%&I\%7I\%HI\%XIn#jIn#|In#In#In#In#In#In#Iu&Iu&Ju&Ju&,Ju&>Ju&OJu&`Ju&pJ|+J|+J|+J|+J|+J|+J|+J|+J'K' K'2K'DK'VK'gK'xK'K+"K+"K+"K"K"K"L"L"2L"CL"]L"wL"L"L"L"N"0N"HN"XN+$lN+$N+$N+$N+$N+$N+$N+$/OM%CO8$[O8$jO8$|Or$Or$Or$Or$O$O$O$O$ P %P %.P %EP %\P %pPA(PY(PY(P P(P(P(%Q(HQ(oQ(Q,Q(Q(R Rr)&Rr)5R*JR*YR*iR*xR+R+R0RR0SS0?SUSSSS~T(TATPTcT~T~T~T~TTTUUP ?UjRUP kUj}U{ U{ U{ U U U`UV`9VMVcVyVVV'W`WzWWWWWWX/XMXiXXXXXXXXY'YGY\YzYYYYYYY Z"Z;ZWZcZvZWZZWZZfZ [W[.[W<[O[W][r[W[[\[[[[[\\;\G\X\f\y\\\\\\\] ] ]$] 5]H][]|]]]] ^/^^^^^&^^&_&_P_i___3____`2`Q`p```````` a a1a33a3Jaoaaaaab5bObybbbbbbbc#c9cLchccccc  0@f   % +7FQ`k}M`##.9#KVuepuu!3>Sjz2  o P jd + >U V i {   "-I[k$&e(;K0Vb:{!ir l2BR+b`m y @ O 1[ { ! _  P!  t!'!7"Gf"Z+$l+$~+$8$k$k$)r$ %m& J( (9  )I r)Y *l *| - c 0.  j. }.  .   / 0 / ? O a l w  " '>& 'e* 'r. '2 '6 ': '> 'B 'F ' J '"N '=R 'LV 'ba 'yf 'k 'p 'u 'z ' ' ' ' ' ' '  ' ' ' '( '6 '> 'G 'N 'W 'c 'o 'z ' ' ' ' ' ' ' ' ' '  ' ' ' ' '$ ' ) '-. '93 'A8 'M= ']B 'oG 'L 'Q 'V '[ '` 'e 'j 'o 't 'y '~ ' '% '- '5 '@ 'H 'P '[ 'e 'o 'w ' ' ' ' ' ' ' ' ' ' ' '  ' '* '= 'M '\  'j 'z ' ' '# '( '- '2 '7 '< 'A ' F 'K '2P 'GU 'NZ '^_ 'md 'si 'n 's 'x '} ' ' ' ' ' ' ' ' ' ' ' '  ' ' '- '9 'I 'T '[ 'e 'v '| ' ' ' ' ' '  ' ' ' ' '" '' ', '1 '6 ' ; '@ '$E '+J '9O '@T 'JY 'U^ 'dc 'sh 'zm 'r 'w '| ' ' ' ' ' ' ' ' ' '  '  '  '1  ':  'F  'N  '`  'o  't  '  '  '  '  '  '  '  '  '  '  '  '  '  ' ! ' & ' + ') 0 '7 5 'A : 'T ? '_ D 'n I ' N ' S ' X ' b ;@;T;T ' ?T ' CT ', GT 'G KT '] OT 'r ST ' WT ' [T ' _T ' cT ' nT ' sT ' xT ' }T ' T '" T '* T '2 T '; T 'H T 'M T 'V T '\ T 'c T 'l T 'x T ' T ' T ' T ' T ' T ' T ' T ' T ' T ' T ' T ' T '5 T 'G T 'P U '` U 'n U 't U ' U ' U ' "U ' 'U ' ,U ' 1U ' 6U ' ;U ' @U ' EU ' JU ' OU ' TU 'YU '^U ''cU '8hU 'GmU 'UrU 'cwU 'r|U 'U 'U 'U 'U 'U 'U 'U 'U 'U 'U 'U 'U ',U 'JU 'UU 'eU 'zU 'U 'U 'U 'U 'U 'U 'U 'U 'U 'V 'V ' V 'V 'V '!V '(!V '0&V '7+V 'B0V 'O5V 'W:V '_?V 'qDV '}IV 'NV 'SV 'XV ']V 'bV 'gV 'lV 'qV 'vV '{V 'V 'V 'V 'V 'V 'V ' V '+V '8V 'GV 'QV 'XV 'fV 'mV 'wV 'V 'V 'V 'V 'V 'V 'V 'V 'V 'V 'V 'W 'W '  W 'W 'W '!W '. W '=%W 'O*W 'XQW 'UW 'YW ']W 'aW 'eW 'iW '*mW 'AwW 'W|W 'gW 'rW 'zW 'W 'W 'W 'W 'W 'W 'W 'W 'W 'W 'W 'W 'W 'W ' W 'W 'W ' W '&W '6 * 4 *8L *P * *`D *Ht *x *2 *0< *@ * *P  *j, *00  *  *  *P4 *8d *h0 * *, *0`D *H\ *` * * *$ *(`l *p *l *p * *T *X` *  *L *PP! *  *- * c 4 *8 0. *  * .symtab.strtab.shstrtab.rela.text.rela.init.text.rela.text.unlikely.rela.exit.text.rela__mcount_loc.rodata.str1.1.rodata.str1.8.rela.smp_locks.rela.rodata.modinfo.rela__param.rodata.cst2.rela.return_sites.rela.call_sites.orc_unwind.rela.orc_unwind_ip.note.gnu.property.note.gnu.build-id.note.Linux.orc_header.rela__bug_table.rela__patchable_function_entries.codetag.alloc_tags.rela.data.rela.exit.data.rela.init.data.rela.printk_index.data..once.rela.static_call_sites.rela.gnu.linkonce.this_module.bss.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.rela.debug_rnglists.rela.debug_line.debug_str.debug_line_str.comment.note.GNU-stack.rela.debug_frame @I1@@0D+1F&@HD;1H6@"DO0F J@0D_PFZ@D l20G {2SSDi@XD `i @DЉ(@=`D|@=Dv@@0D@\"D@!$40@Q(L@~`D b@]@0D" (@ @0D%P@D'X@0D)`(@Hx D+@0D.@@0D0@  @@ D3*Vg=Vkc8@ VD6R%M@X D8f a@ xD:{PWv@x &D<0?2.L0m~A0T @= DB+E 5E