ELF>` @@HGH=f.UHSH0f~eH%(H\$(HH$HD$HD$HD$HD$ tIG,HSHt$E1A1D$IBD$HHT$ HD$HG@H@hH HHD$(eH+%(u H]ff.SH+Vx%1|HS HcH|xHuH[fFG ff.UH'vF]G HFHV HG(HW0G ]DAVLAUATUSHHeH%(HD$1HD$D$ I9twILl$ HL9tdH{uC,K0HL  ID$(1LHHCH=HL9uHD$eH+%(uH[]A\A]A^ff.USHvHuC4EC H[]FuG0Hv9GЉW4H(fDATE1UHSHtHIL+%I1HtHHH+Ht =tJu#HHtGHLIА[]A\=uHLI[]A\HL[H]A\HL%THnff.fATIUHSeHHH4L&^t,u"fN1ҿf[]A\N݈NؐAWAVDAUATAUHSHLo@IEhH(H$+~Xփ4~^MMcLA4M,uFII։ uzfE&XH[]A\A]A^A_IH,$HD$H2HIDLHHD$HLH[]A\A]A^A_E&E&fDAVIAUIATIUHSeHHH3HSHމk.ft.uCA$[]A\A]A^CA$[]A\A]A^CA$[]A\A]A^ff.fAWIAVIAUAATUSHcލHHHt HcH[]A\A]A^A_Mf@I|$hHO(H $=I$HHcAN,A$4I$HӉ AAAHHH[]A\A]A^A_ ~Z+e0/S4~ ;E=~>7<.AH[]A\A]A^A_HHtHcH[]A\A]A^A_ZI$L4$HD$H2LH:LDHLHD$!fHHtHcH[]A\A]A^A_fDAWAVAUATU1SH@LpeH4%(Ht$8HD$4Mt%HIHH?HIHH(Lfx1Mt"HIH?HIHHHH4$HHD$(H4$HD$ LHHD$L9L<$Lt$4IH\$LIHL.L$4HߺL$4AHL9uLL<$H\$HMHt$MLHD$H9LIL HD$E15EEIcЋTxH H HH HI9EAAPIcŋDxHHtuHH HI9uDHMB40AxA~H|$vzHmHD$H9\LIILL tWHD$HٺHD$F,0DHAuHH LD,$$HD$8eH+%(u0Ht$ H|$(H@[]A\A]A^A_HHt$MLff.SHHC(H@Hx0t H[[AUHHATUSHH0LeH,%(Hl$(1H|$Ll$D$HD$HD$HD$HD$ HM$HE1A1ɺH Ht$D$IBŅt@I$(HD$(eH+%(uNH0[]A\A]LHuH tހ=뜽fSHpHt,HHt HhHHpH8HH)H{xt-HHt!HhH[HpH8HH)[f.AWAVAUATUSHHHLoeH%(HD$@1I}HD$HD$ HD$(HD$0HD$8H$Hs0HH@LHHl$IeHH AL4IF@IFI~HD$IFHHHD$D)IF8H@H$HIHAFHFAFFAFIOhR8Aq qI IF@AF(A8AN,Iu@HH=sIF@HD$AH1HDH|$HH)H$HNH Hc‹H?IqHcI|0?)HHD9ADM5HcH;Hr@HD)HIF8EA}~IIm@1AH HcL HI ~0HcHH9rʿ~1LVHMuUu[HC(H@Hx@tHHD$@eH+%(u@HHH[]A\A]A^A_MttA`tff.HWGt ~ Hff.fFG ff.AWAVAUATUHSH`H=I()HHHHCLLHHCLHCHk HCHLLH$LHHL$tHL$LM4$IL$L!H4$LM9tH1H[]A\A]A^A_H(Hڿ@ո@AWAVAUATUHoSH(LgeH%(H\$ HH$HD$Ml$@HD$LHD$1C ID$(HtILLM$LHItHSHCHBHHLLHCH"HCH{HtCE11Ht$A H$D$ID$hHD$H D$IBHD$HHHLHD$ eH+%(uH([]A\A]A^A_DAWIAVAUATLcUH SH@eH%(HD$8HH=HD$HD$HD$ HD$(HD$0HD$HIH|$HHH\$D$NtIEIEI]H$AEIBEH4$ALI AAEAątHHu,I tހ=I_(AT$0ygYHD$I9bI(HAHD$8eH+%(uH@D[]A\A]A^A_ff.AVLAUATAUHLSHHIH9u9fDHH9t+D9c,uH{Ct0P y1LLH[]A\A]A^@AWAVAUATUSHĀH eH%(H\$xHHD$`HD$HD$hHD$pHD$8HD$@HD$HHD$PHD$XHD$ 3H@PHD$(0Ld$(DhyPnD$(IB@,D$,`E11AH LDD0At HAu:HHuDAuǃ0H|$@HHHl$`H\$8HD$`HD$hD$8AHHD$`Ht$pH\$hD$pIBjH|$LD$(Zu HHd1HT$xeH+%(jH[]A\A]A^A_HLd$(HLd$(HD$Ld$0LHD$HH$M/LI9uCH|$Ht$II"Ll$(I]LM9ujH+IHtIIGHBHLt$0LHLtH\$0M'MwIH $IELMI9ueHtIMIEHAHI}M}MuHtL)LIHHL9uHuHt$ H|$HfDUSH HHH`pD$E`uE`H pu4H(H0Ņu H []ff.AUATIUSH{`tr1LI$ HH H8HH H{0HC(H[]A\A]H H`pD$C`I$ pH(LHǃ(HC(HHI9tH}Ht HEHmL9uHC(HUHSHGHW8H@HHtHhhHHXp1[]ff.fAUATUSHG(LIl$(I(I9t]IH/HmL9tGE8L@4HHt@4tP8=9}`[]A\A]@AU@EAT@AUSHHt(HHDDHu1[]A\A][]A\A]AU@MAT@AUSH5Ht(HHLDH1[]A\A][]A\A]ATUHSHH@HxLc0Mt:H}@HC0@8@HHt LHH[]A\V[]A\[L]A\AWAVAUATUSHHLeH%(H\$@HHD$0HD$8A~8HD$HD$ HD$(H$HD$L<$ LIH~DE1Hl$D$ DLIHH$LHHIDL$ 1HH|$ D$I$Il$A~8AD$IBAG,AD$LH T$It$AALt4HHuSH tހ=L$$HT$@eH+%(uoHH[]A\A]A^A_T$8E0AA1AD$IBAG,AD$*H$HD$efAW AVAUATUSH(H<$eH%(HD$ HGhH=D$HD$L HIǽLl$M$LD$LLLÃClDD$E^AvAftVf LHt$HLHHZHxLHT$HLdAWIBIB IB@AAwH<$HHHP@z`HxCH HHC`@HCHHCPHCPHCXHCHH(HH)L|$ HIHxHD$ eH+%(iH([]A\A]A^A_AAGHHI9H)H)H<HHAwptMHcӃHH)HHHETEDLz DTDDHȉxz$R(x P$9uH<$HHL$HL$HIBAAWHH)H<I9)HH6AwptNHcӃHH)HA|H|A||Lx zx$z x0H@(fz,HB$9uH<$HHL$HL$HAAwH<$BHHH@hHt IwH{pHlLHT$HT$bHT$HT$IHLH$HT$HH@hHx(HD$UHAWIAVH(AUATARSHHeH%(HE1HHhHfHDžfH)HEbHHDž IGLpAFTuNA~vGIG0HP VHP@FHEeH+%(sHe[AZA\A]A^A_]E1LI_HP@8HH@HWhHL bHH"Iw0Ht EdH= HHHEhAGA9HEv=1ɋHHHHLcD%Dž Hn1HfHDžfHHEHHH)bHH0Dž(H(HDžfHnH@8==C,fDuDžvIBzƅ~HEHC@HvAL HfH@hH jZI`ApD$LkI fDHLfAMLIIH LLH(:DžL{@MMghLA4K,OII|$(HHL"LEHI$HDHHLApH HfLHHHH@NIO0IVHHHQAFA+AAVVAVFIG0H@ H=HHnLAHH@H@Lc="C,1fDuDžvIBRzfM~HBfufE:C,IcfDuDžvIBzƅ~Hf}NfELApHHHPHHXHHXHVHIw0HTBH=AUS1B0u []HH1HHHu"GHsP1HHHt';HHu H[]1ff.AWAAVAUATUSH0eH%(H\$(HH$HD$HD$HD$HD$ LH= HHH|$HIH$HEHuHHeH AEIBIAHHEAŅt5LHuQH tހ=AHHD$(eH+%(u0H0D[]A\A]A^A_T$ yEyAAUPI1ATE1PUSHLeH%(H\$HAD$`H HǀH HǀH ǀ@H ATZŅt%HD$eH+%(H[]A\A]AD$8Ht$H߉D$<ŅuHŅtH Ml$@LHeŅuHwŅt LLoID$(1HHLAD$`3f.AW1AVLw(AUATUSHLHHH=8 HIH^Hh(Lh@HHLDcAG`ALJ0DAHrHs"¾H=vff9AIG(HDE'I_hILJA4IIIIIIIG(I(HPE11ɺPH IHǀH HǀH ǀ@H AW^Ņt9I(IG(LH[]A\A]A^A_LHHbŅt$H fEIwhjA1HIA YŅuI HhIH8IHHSH HH1H1HIG0I0HILJHIILJALJILJILJMI HIW(HH(Ņt:I I0II H8~LH*ŅMGpM^MGxMHŅLIGhMg(AG`H(M$LID$@IDŽ$ŅuSLI$L/I$AG`LvLHiL@IIwhjIH?IHIHXIHH IH`IG(IHIIwhj1H?IIIZŅIHH IH`IG(IH/DHLL$L$ff.AWAϹAVIAUAATUSHhHWL$H\$HLeH%(HD$`1HD$@HD$HHD$PHD$XHAE HH|$HHD$AV8AAHt$PHL$@Hl$0ºDl$8H\$HD$XID$hHD$@H D$P IBD|$TDl$\t#HT$`eH+%(uzHh[]A\A]A^A_Ml$hHHu$I tހ=렋D$(L$<H$ 뀸vfDAWAVAUATUSDkHHWL$Lt$@LeH%(H$1H|$LHD$HD$ HD$(HD$0HD$8HH$A|H|$ HIHHl$D$H$LD$HT$`DL$Hl$HHD$P IBHAH8DL$THD$@\$\D$XAHLILHLDHID$hSHt$PLAAH u;I\$hHHu{H tހ=H$eH+%(utH[]A\A]A^A_u8cAD$`RALfL@D$8tAD$`ALLyAWAVAUATUSHxHo eH%(HD$p1HD$ HD$(LHD$ HD$ HD$(HHH$HIL9"IH"LLtI$ID$HBHM4$I\$HL9tLHL9uH$LHMNLu@LLHHHI9t A<H L9uH<$1AD$Lt$H<$HHL9AE1JL)I HAHL9t*y 9z,ux9z uy$9z0uB<HAL9uH<$EA;\$wLt$H<$Ld$III$I9uqfDHL9tc{<tHZHtHHCHBHHl$(HT$ HHtHD$ H\$(HHkH]I$I9uH<$LLLd$IH"HD$ Ht$ H9tWHl$Hl$ HtHMHEHAHH}L}H]HtHHD$ Ht$ H9uHl$E`u*HE(HHHLLHD$peH+%(hHx[]A\A]A^A_H<$H= HD$0HD$8L|$XHD$@HD$HHD$PHD$XHD$`HD$hIHHh@H|$8HHHD$XHD$`HD$hD$0ALHD$0Lt$PHt$hAHD$`JAL)D$hIBAD L\$HD$XD$lHEhH u7L}hH|$0Hu>I t܀=LHEhHHx(L\$I~JL)IDHPIV HP IV(HPIV0@AFAF8AF{P PH<$LLLHD$LtLM.M~M7Ht$H<$8E1LMH}pH}xH<$HHI9HD$Ld$IL|$MMI10HcADxH H IMxHH HDIEx@HcHADtuHIEpHHDIEp~M$$M9uMLd$Ht$L|$H<$LH<$HtC HHHHHHHC HH@@HxhH(LH1HCAL[HH]HA\H<$HH[]A\A]A^A_[AL]LA\HA]HA^H<$HH[]A\A]A^A_H{(HIhKHHH(IhHHH(HhHH(I(HA5I_(HHI_(DHHLUHD$I(HP8H}(H$$H{(HH{(HH$HH@hHx(HD$H$HH@hHx(HD$H$HL$HH@hHx(HD$HzhHH(H$HH@hHx(HD$H$HH@hHx(HD$H$HH@hHx(HD$HHHxhH(HHHxhH(HHHHxhH(HHHxhH(H{(HLc(HLHAdž0…u+HE1H{(HAHLT$ DHLIGhIWpHHx(HLIGhHHx(IGhIWxHHx(IHtHpH8HH)I}(HI|$hHH(H{(HI|$hHH(IEhHHx(ADI(HXHH1HHHlmuuupci_hyperv%u4pci_create slot %s failed &x->waitThe device is gone. %s() can not unmask irq %u %s() failed: %#llxInvalid transaction ID %llx bus relations too small bus relations v2 too small eject message too small PCI VMBus EJECT: ignored invalidate message too small the device has gone Retrying D0 Entry &hbus->state_lockhv_pci_%x%pULedge3%s %s: 46hv_pciHyper-V PCIe MSIquery resource requirements failed: %x MMIO write hypercall error %llx addr %llx size %d Attempt to write beyond a function's config space. MMIO read hypercall error %llx addr %llx size %d Attempt to read beyond a function's config space. PCI VMBus BUS_RELATIONS: ignored PCI Pass-through VSP failed to request version: %dPCI VMBus probing: Using version %#x PCI Pass-through VSP failed version request: %#xPCI pass-through VSP failed to find supported versionCouldn't send resources released packet(s) resource allocated returned 0x%xUnimplemented protocol message %x unhandled packet type %d, tid %llx len %d Unexpected vPCI protocol, update driver.Sending request for interrupt failed: 0x%xRequest for interrupt failed: 0x%xdrivers/pci/controller/pci-hyperv.cRetrying D0 failed with ret %d PCI Pass-through VSP failed D0 Entry with status %x Unable to use dom# 0x%x or other numbersPCI dom# 0x%x has collision, using 0x%xUnable to map a virtual address for config space Failed to build an MSI IRQ domain Need %#llx of low MMIO space. Consider reconfiguring the VM. Need %#llx of high MMIO space. Consider reconfiguring the VM. Read Config Block failed: 0x%x, bytes_returned=%d Write Config Block failed: 0x%x couldn't record a child device. There's an I/O BAR in this list! hv_read_config_blockhv_write_config_block hv_pci_allocate_bridge_windows zhv_arch_irq_unmaskhv_pcie_init_irq_domain/hv_pci_probeQXhv_compose_msi_msg_hv_pcifront_write_confighv_pci_read_mmio#hv_pci_write_mmioA_hv_pcifront_read_confighv_send_resources_allocated hv_pci_bus_exithv_pci_enter_d0& 8 = hv_pci_protocol_negotiation> F M W hv_pci_eject_deviceN survey_child_resourcesohv_pci_assign_slots wait_for_responseq_resource_requirements pci_devices_present_workJ hv_pci_start_relations_work hv_pci_onchannelcallback DDDDR.'license=GPL v2description=Hyper-V PCIsrcversion=5852BC00DD0D6A24B9EC98Dalias=vmbus:1df6c444444400449d52802e27ede19fdepends=hv_vmbus,pci-hyperv-intfintree=Yname=pci_hypervretpoline=Yvermagic=6.13.0-rc1-MANJARO+ SMP preempt mod_unload  (0HH0( H       (08H80( H80( H (0( 0( 0(  (08H80( H80( H80( H80( H80(  (08x80( x (X( X (0880(  (08H80( H (08`80( ` (08x80( x (00( 0 (0880(  ( ( (  ( (  ( (     (0880(  (08`80( ` (08h80( h (8@8( 8 (08@H@80( @H@H@H@ (0880(  (08(80( ( (0880( H H80( 0( H80( XHx`h@(0GNUGNU7Y{7tG! QLLinuxLinux]2X;,[%$ pci_hypervY+v++L+XYQY]$xY$Y$Y$Y$int$]$,Y$*Yls8llu8vls16lu16.v.ls32Blu32QvQls64lu64vo]G &Y&+&&1]&2]&H&I&X&]&^&_&`QYY'<]( Q(]((( 2(#Y(%(&(*+(4(=(B(hB(nQ(} e( o( o( ]( ]( o(R(+3( ((v3( (e( ((( ( (1 (1(1(6 1QK+;(s(s( Ksxv++WBpH) ) L) ) ) ")  ) ()  0)  8) @)  H)  H)  H) H)  H)  H)  H)  HI@* ***I*Q`P*Yh*&*L*L*** *]*>Lkp* *](*],*0* 8*@*A*B*]D* H*Pqmem*@**+* ]****>** *>(*i0*]8*i@*]H*]L*P*]X*`*]h*p* V x*]*]* **]**]*]*F*i* ]*!F*"]*%*&*9]*:*?*A*D *F *P  *Q](*T 0Z,E- --E-- -.-..-M Mval- 5 5 -a %- -,M E. ..  +.. . 5m .  % .a . //  0 0a 0 1 1 111 11]1+,2 !fmt2L2L2L2]2L2L$ .3e! 3f+3gV 3h` 3uV 3vB3wB key3x! [ 3U 3V % 3j !key3ke 3n !key3oe 46 47 48 ;84^ 4L4L4L4LV4]V4]V44] key49 (=]4=  84U 4V mod4W 4XL4Y 4Z (4[ ,4\^ 0L 4u<4v<4wA4x]4y]  +]Q`+ 5/51] set53 get5557 ;`r)) )) ά) )  ) () 0)<8)!U@)" xH)# P)$ X)%`)&ȭh)'p)(ȭx)))*")+J),r)-w).J)/ )0 Ǯ)1 )2)3 )5 ;)9 h); )>)?)@֯ 6 6!B key6"B.6?6A+6B6C 6=6>i%7 8D88  7 l7 7 9;Ncs9=oNsl9?oNwfe9Ao 9E:Nss9GoNsti9Io9KoNnmi9Mo9Po 9So09Vo8Nlm9Xo99]o:9do<.9gMcs9.Mcsx9o9l.9Mss9.Mssx9o9 9g r159m+ r149n+ r139o+ r129p+ bp9q+ bx9r+( r119u+0 r109v+8 r99w+@ r89x+H ax9y+P cx9z+X dx9{+` si9|+h di9}+p9+x ip9+%:9+ sp9+%g :BR:C.:D.:E. :E.(Ns:E.,Ndpl:E.-Np:E'./:F.0Navl:F.4Nl:F.5Nd:F.6Ng:F%.7:F+.8 :wNist:x.:y.:z.Ndpl:{. Np:|. ::.:.:R:.:Q:Q : :9::+;+;+;+;+;+;+3;  pte;>;"3;  pmd;J;"<%<%%zR<%/A<' !pgd<'nR<'"A;><$>=$>? ] >@ ]$>A ](>B ]+b?l+I-@@ &@k=@]@]@ i @2B(@ ],@!]0@( 4@)L;8@*]H@++P@,&X@5 `@6 d@8 h@: l@; p@< t@=]xsse@?gM@Lrt@@Nqdl@AfO@BaO@FQ\@I`?@J+@K]@OQ@XQ@]Q\@`"K@@d@h]@k] @l+@m @nQ @oQ(@p30@q iX@s`@ub@x d@yQh@zp@{ R@+@@@ @@ @@ @ @Q@@@ @J@@+?(\@`?PLmm@.h@.p@Rx@ @ @ @ @+@]@ ],@ ],@ ],@ ]-@ ]-@ ]-@ ]-@ ]-@ ]-@ ]-@ ]-@ ]-@ ] -@ ] -@ ] -@ ] -@"] -@+@%=Lpid@ @ @+@&@ &@@@&(@0@@@SP@SX@ @"S@%+@(+@+ i@- o@. o@3 o@4I@6QJ@: (@=+0@>+8@A o@@D oH@G+P@H+X@K H`\@NNH@T3U@W3U@Z3U@^#V@k ":@m-V@p5> @qZ>(@t+8@u+@Lfs@x7VH@{AVP@~KVX@UV`@Yh@ :Zp@ Bx@ B@ B@-F@+@ @]@s@DZ@ I@]@A@F@ o @ o @> @  @Q @?( @&8 @NZ@ @ iH @XZP @bZX @lZ` @Zh @Zp @+x @Z @xG @] @ o @ o @ o @B @eI @ @[ @ @ Q @ Q @" [ @)H[ @  @ R[0 @ >8 @ ]X @W[\ @l[` @>h @ @v[ @ @ @ @  @!] @"] @# @$+ @& o @' o @( o \@)K @3[ @CF @D+ @L[ @N+ @R[ @SQ( @TQ, @Y+0 @] 8 @^ < @_ @ @` D \@aKH @dCGX @g[ @iG @l[ @w @x @z+ @} @~[ @ o@ o@ @ @F@@@ @ @+@]@[@[@[@L\ @](@],@Q0qrcu@K0@2B@@ D@&H@IAP@V\x@2B@ i@ "`\@ j\@t\@i@ @ o@ @@>\@K@ @!":@$":\@.K@<~\\@F`)@@)&+? A'Ai A,J'A. A/ A0  A4(A6 A9(A: )A< )A= ) A? )(AB 0AC 1)8AD 1)@AE F)HAF )PAG *XAH *`AI *hAK *pAM +xAO ++AP ++AR )AU AV AY A\ J+A`^+Aa x+Ag+Ah+Aj+Al +Am + +(()+(p+))+),),)9!)F)]6)[)[)]`)I@@B*BB:!spB+!esB !dsB"B$B&B+(B+0BR:8B+XB+`!cr2B+hB+pB+xBq:B+B]BQB+B+B 9sfpuB 9@K)*]******* + ++ *++*]+J+KKKK0+ o^+]O+x+]]]c+ o+]+}+ +]]]+ o+++&+ (Aq,,Az&A{&A|&A~ A  wXAX.A A A )A .A . A .(A /0A&8A )@A )HA )PA .XA $/`A >/hA S/pA S/xA S/A S/A )A )A )A )A m/A /A 0A 0A&A&A&A&A 0A&A&A&A&A 1A& A&(A 10A'8A 71Ph.h... (C .C 2m...X...i.....I@@=.[u@=z@./+. $/./9/.9/)/S/.+C/h/h/X///r/ //+h//h=0[s=.= %t =(=,=Rt0]=)t8=X=\th=%Uup=+x=r= i=Zu=23=v[=_u=r/0/+h/000[[01155019/ 171]R"1 (A1A 1A&A 1A A& 11QM 1111wA2 cpuAJ' irqA+xmmuA,,A<1pZA'1 D 72D D 72 E!~2E% E+ E-E/ =]32     +3+C ;m.3C?"3m.23+F ]H3      0Ic<4IdLIeǼIgIi Il %λ(3Z]Ztm.Z+Z+ J4Jo endJo6K 6K  pL85 cwdLQ swdLQ twdLQ fipLQ fcsLQ fooLQ fosLQL85LQlQH5+EL*l5 ripL+o rdpL,oEL.5 fipL/Q fcsL0Q fooL1Q fosL2Q .L)55H55l5.0L@5LA5LB5Q5+ L$6 cwdL%. swdL&. twdL'. fopL(.%5L5QL6QL96 L<6L>55Q6+Q6+? LQ7 cwdLRQ swdLSQ twdLTQ fipLUQ fcsLVQ fooLWQ fosLXQLZ85L[lL\mL]nL^o rmL_pL`qLa7xLbQ27+o7+@L:7L; oL< oL= 7o7+I@@LO,8]LP5LQ7LR,8@;8P+@L^8&L_4mL`5&La6mLb7@&Lc88+I@@LfG9Lh]Lk]LnoLqo!xfdLtoLw]Lz]L]L]]L;8@@L9L oL]L] fpu@L9L]L+L9L9LG9 LG90]L8@@8 M ":M oMoQ2:+QB:+'R:+b:b:+g:l:; N:N]N]NLNLNL6O6O6O P8 ;P9%; P<%;P=%; ;.Q<L;Q=]Q>  Q:;Q; ;%*; srcQA. dstQA .;;i=]R;3(R<R< valR QR!Q R"QR#oR$< Q.R*9<R+&9<R,#f< Sf<S^S B><3R'<R(R);%<R.o3 R1<R2<R3R4 R5+R6+<.(R%=R%;R/k<R7< 8RR=R+ fnR f=%< a=a=%=R= T>=T?+T@+TAQ cpuTCQ U=UoUo;(U=cctUv:U&= ==]V0> WP>W U>P> X u>X Y >Y .Z>Z Z>%>Z>3[ >[ ["> \)+?\*23\+  osq\-u> \/ (] `?] ] ];^?^+^?^?`? ^ ?^ ? ^?^?^?; _@e_ `?_  _ !@_?=]` >@;@`'@e`(?`)  `*@(`+DA0`,8`-9`.:`/; !@@@>@@;@@a/DAa0{a1]a2  seqa3>Ia4@a5@ a60a7 8@ (bAb  b+b AbQ AAIAA cAcc cAA3d AdA+B+d8AB e2Be eB f+fBf,f- xgBgBg]`g+h maxg+p+B+ 3h B sighAhBiRiSBBiUiVCByj;Cj j ij C3j'kCj(j)3j-Cj.&j/j0 ;Cj13j5Cj6j7j8 ;C3 j<%Dj=j>j?j@jA3jSVDjT PjUijVi3 jYzDjZ Pj[ 3j^Dj_+j` ja .jJDjLjQ jW%Dj\VDjbzD3 jEEjFi%D3jg2Ejh _fdji3jmcEjnijojp] y j%Ej*GCj2kCM_rtj9CjBCjdDjjEjq2EE0k Fk k k k cE 0k F%EkF#F k UFk!k" B k%Fk'Bk(+k.Ck0 B k3F sak4UF l Fl >l + lenl +l  (mGm m. n$CGn%un'n( 0nDxGnM#FnP(nW) 8o Goooooooooo o#o(o,o0 p) Hp*op+@ Pp8>Hp9>Hp:]Hp;]LGNH+;8pDHepEKpF>pG]0; q>HqKqZqpqqq endqHQHP+ r!Ir" ]r&H rD>IrDIrD#I rEeIrEIrEJI3rT IrYeIrZ >r[qI3s I valss I3s I vals s I@S J@U o@V o@W B]@[QJ0@hJ@iI@j@k J!cpu@l]@mo@no @oo( @ K@+@@@@4K@+@ Qh@@@K@ o@ o@ o@ Q@ Q@+ @+(@+0@]8I@@gM@ o@ o@ o@ o@ o @ o(@ o0@ o8@ e@@ oH@ oP@ eX@ e`@ oh@ op@ ox@  o@  o@  o@  o@ o@ o@ o@ o@ o@ o@ o@ o@ oI@@N@ K]@ `?@! o(@" o0@# o8@%@@&P@'Q@(R@)S@, oX@- o`@. oh@/ op@0 ex@1 o@3 o@6 @7N@9N@;N@=+savg@G4K@gMN0@K;O@L@M+@N+@O] @P$@Q&@S;O(NR@]MORO aOaOfOh@`P]@a`?@h o@i o @j o(@k o0@l o8@s e@@t oH@u]P@]@]@]@]@]@]@]@]]@>@X]@>@!rq@P@@O@P@aOR@^PP &PaOrqP@?Q)@] )@] )@])@]A@Q@@@@z@Qnb@?Qns@Q@Q@QQ@QQQPQ+33Rh)R))})a) :@) D) H)?P)+`) +h))̥p)+x) r)>))a) iRpidpt7St9 2Bt:]t; >t<o inot=ot? t@@tB`HcrcutCK`tDpS S+ S ] obS;uo.Uup23 uiduq I gidur I us Iut Iuu Iuv Iuw I ux I$uy ](uzD0u{D8u|D@u}DHu~DPuXu#V`u#Vhu#Vpu#Vxu iuquzu(Fuv[NS.Ukeyv#Vv2Bv[vs semva(v}Pv iX%`v h uidv Ip gidv Itvxv|v~v v+%%Qv8U(V2V@w  itwwrw Hwhw wSwxttyww#w Iwow owowowowowIw+w+w+w'+w+ w+(w"+0w,+8w+@w+Hw"+Pw,+Xw+`w+hwxGpww(ww=w ]wGwwww.w>wa0ZVw w:Zw>w2Bw`w Y?ZIZSZ]ZgZ XxcZxd23xe xg xk >xm}xn (xo0xqb8qZZFZ[ yH[yyy[M[g[+g[q[{[+[+H[[fB[+[[[;hzyL\zzqiz|]z}j[Mjzi(zIA0z+Xz#j`[Q\[\e\o\y\6  6 6 6 !6 %6 '6 ,6 />6 36 56 96 <6 A6 D6 H6 L6 Q6 U6 Y2 ] {]{i{i{ { ^{!{" {$] H{'^{(L key{) {*^{+i {,i({-i0{. ^8 ext{/^@]]{3; {8^ tp{9^{: i{;Q{<Q^SB |Q`|Q| u|]|  |o|o ino|)o dev|* i(|+ i, uid|, I0 gid|- I4|. 8|/D@|0DP|1D`|2Dp|3o|4o|5Q|6Q|7o|8o|9Q|:Q|;Qa`+ }#`}$>}%}' a`S~>S~S~B]aBa+ba=]lPa ka 2B6 "ya.a>~a a%a]ii (0.b123723 osq9u>; <SSSSS +b, - bbbbb b23b=]dc+=]Wcf@ XqcrbsIA wqvcH cpuwPcB]qJd @f///b!cb!cb!cb!cb!cb!cb!cs xesee( len23H&ePpde++&e+6e+@fff e>@@ dH!+"+#$IA%b&K 'f0(+8xcpu*@xssp+fH23"f+ `6f7>8e:e(;+H<fP=X>\"f eff] sdag%hh i*hfwxDhEfFhH I>(J>HK>PL+pM+xN+O+P+Q+R+S+TU+V>WSY \+]+^c_fpf%h+6ef6._h773"h#B$%3'h()3+h,-.!i&_h*h.h -i%=h ops7i%h-i2i 2qi4+6]7] =]z@i=]zHi zpizqizrzsiiEz&jzH:ih;9mp= xC.|D$~%l 4mi+ alt+++ +(08@HPX`hpx !/l4mFkE=\nm=^ i=`].=XmMlru=Y5Jm=d=e.=im=j +=k+E(=Rm%nm=hR%m=s+ E(=u=n=z+ pp={Bn=|+=}+=~23 =nE=^n=+E=n= o= i  oc{ ref}8SHh]l+p ops xi%n{(=Q:o5m5m5Gn5^n=K.=\o=]= A= uo!val=+R=\o^=Mo=N i=P]T=Jonlru=K5oT=Wo&=X i&=Yuo^@=GVp=I+%o=UR=V + %o(=[ 0=\ 4=^+8|@=Ftp5om=jz^(=mp=n+=o+=q =r =s =t =v] |@=lp5tpm=zz^0=}^q=~+=+= i= i= i = i(^ =q=+=+=|@=|q5p5^qm=zh=Dq[Vp[p@[qR=+qh) r) ) >) F ) A)R) i )()]0)]4)3U8)@%'P) p)  ix)#)$ r)% r)'[Lq=5s!ctx=6ss==Ms=>Pa=@H(=Xjs=Ya(=\s=b+=h+=t<=w =}$^=s=+=+|=t5sm=KT=)t&=q&=q =Rtsrb=`?=+MsWtbPuc h jkq s~(t0u 8w@{~H~~PGX[`thpxatPu"sjs=u=o!cid== @@= u= A =u==+= [@@=y[u@=a@=+P=+X=+`=+h=+p!pgd=  9/x=) =5 =?y=E+=L]=S =Z =]23=_=a>=pa=r==+=+=+=+==+ =+(=+0=+8=I@=>D=+H=+P='+X=3+`=+hLbrk=+p=!+x=+=+=%+=0+=y=y@=y=>m=+h=>p=yx=&=z=r=&z=+=+== = =%k=23=b=z=+=+=23= udu+y+3Jky+yy^ zz+,zP+R= ]>zp/z%O7z(!pmd9 /0!pud; 08%T@EuHFuP!pteL h/X!ptlP\`T hhB]=/{ @fffffS6S9S<SG 8{+22++ +(0 #|##L ops#^# i #](#],#>0#|P#X#.` gc#"ch dev#+p#+x#|## #j#]#}#{p|II #}i| P}i (}.B}D}E}F}G}H~Ii#}P}}}}},~- >/ :0i}EA*~%U}K .:E~@|5 ~.Ns~O+PQ  (+~,-./ %*~%E~ 0)p*)qr)r )s R)t i)u )v.$%(~s~ "O#w &w'w' |OwE> {5;[E34Q len4Q.256o 15%8.i\jk\`rs tOuK;RjT]UeIVOWoX Y0[8_"l``7ha+pbixed%:m ncd_uvaIx){)| u)})~ I) I)] )))! )7()R0) i8)+@%ѥH) iL) P) X) `) h)Qp)Qt)Qx)Q|)>)))) .)Q)a)+)+) ))&)).).))) 0)@)H) P) T) X) \`)0h\)Rp)8VH) P)(:X)D`)Nh) ipt+';@gmm̉ ( 0 8 @ #HPΊX`gI@)7)) i))+)  ) ()!0)!8)@)"H)+P)+X)+`)oh)ap)) )i)&)#ӫ)ݫ)$)))4) ) ) r) ) ) )] )y(\)`) i)Q)))!Q)")/ )0 f)1)4 .)6])<> )BL@)D"lH)FP)I23X)L`)O rd)Rch)Sp)Zzx)a3)b3qrcu)cK)db)f>)k0\)n>@@)oH)q>X)r`q=]Y mo]Y jr ]L5 ̉ oщoo >#o> EjFoG7HI yy~(  mnt y oj ɊɊ oo<ӊ ";#: nid&-+4+7[;R S)U)XYZ ]c 2B dS(crcueKHgiXj` idmpptqLxrou. +$; 23 034ތ678  xa9}  " $>;@@-ތ lru/023  t2 nrt3 nst4 0>+-P+3 D valo-=] ss  S +vv ;vl>crcuvmKvn2Bvo Evvbvx.vy ;.vu{5>Mxv+ (vrÎvt+%bv͎vҎvL ÎÎ y vviv ׎i+v# A#VAF#VȎ vv keyv#Vv͎{vƢvv`?.vďv v E(vv+v+v͎vҎv > .(v*v{5ď^ vQvv T vn&v׎5*nxK   2BJk+0238 @ uid IP23X `$" h u?u 2Bu gidu ?INP+{uqurcuuK @@ag{ah cpuai]aj]ak] al]am]an]ao]ap]ar]asatau]a{  a|@(a} 0a~@8ea@@{p@@+F+? 8ww w! w"+w#ow#o w$+(w$+0 w'=w(ow)o w0rw1 w2 w3  wCwD= wLwM&wN 8wQwR wSwTS+S+>B8+8B g&;0`eK ;` crss gK0L8`@ X   fn ; arg i3 5 b5E+ 3 f b5Q Q.xSxTxUx{xW•xX xYK;8xI qxJ iocxKZ%~[ x\]0•3 2 val3 U val><mxx} in+v;8_`23abc d crcueK reffx0a3 / v +%B]Txx++ bnx= З3. 0 4З 4(5]6(7Q88+B=GL.)x) I) 2.)) I) U P))]) u%V%x ) )D)D()D8) rHЪ(ϙ) *+ ,0->@. >`/ d07h1[p2 x3+4|3 val ϙۙ=]6!B.E[MuidF IMgidG IH D|%-J H ! ! ! ! !  !( !0 8 @ Hɛ+ ](], !0 !8i@ ɛ!t ɛ@8M9f:f;f<f=z >z(?z0@8Λ f7R zk 7[XDFEzF_G oHzIz Jz(Kf0N 8O@QHSP _7Kod !t  xYZ[o\o]o^o _o(`o0ae8ce@dHeLfoPgoXho`iehjp8N]]]] ]]]!ino  .( .0y]y+ ]]] ]]]]XԠff (30Q83@oHP Ԡ7Ɋ 7]٠ 7  .7[.ĝ Q7.8 j7jNVMr8 ϡ ] a ϡ0 ߡHLops! ߡ++t+T)w$&)})&) =$ =i.R*B)~)))أ) ) )=()o0) 8) @) H) ˤP) X)`)h) 9p) Xx)q)) )ǥW u rq أRģ Rݣ 8rR]8a orR]]iB "R"t :ˤ */Ф RP  9 SSS> qR] r"vr ǥ*/~T)&)d&)]|)&)m)KT)A&)!A&) QQFT)&)[&)&) >&) ]I@)Z)[)\)]5)^S)`q )b()d0)eа8)f@)hH)jаP)k>X)mk`)oh)pp)r ٱx)s)u)vG)yj){)})Ӳ))/!+5?I()Ĩ)r) >!pid)S)>!uid) I)I )$ )') +)])] )])]) T )L&)>&) o| ))m)*K&)+ ;&),Ĩ&)-/SP+R)PiI0))) ) ]) +))h) Q) Q) }) )() Q0) 8)f@)ӳH)P)ӳX)`) h)(p) x)A)A)A)A) i) )) ô) ô) FīɫΫث Q.+Q>+$R)KP xxLo]})) >!pos) R) ] άr r>|Ӭ rL| 2*2]7 UrxA QnrnsZ r]+} r/ ȭr rͭ r "r @r@E' +rr++++O] [r|]| Ǯr|[] ra̮ r11r6! hrr]@ rr]m ] ֯2] oo]ۯ Lo 5 S: qo>X ouv oo аo oLհ ou >oui koo]C op ɊQ]^ ٱo> ooޱ  Gor]u$ jruL oo o ɲoɲβ oɲز) !mt) a) + **B])Y h7Y}m  7 ӳ74 7س o (7+> A1o- i7>F 7Ln  ô7$ ״״ܴȴ o Li (+ @@۵ALBCDo Eվ( sdFӷ0GPa8VI]VJ]VK]VL]VM]((* B. Qyy 2&>J +? rev+ ӷ;ӷ  ӷLcrb`? ns0]8< u>%@ ido` ih&pcrcuKx  ops! ӷh߸ ",$ E% c & x(( 02 89@: H= P@ͺXA `߸. !Mdirط!  knӷr1 i> >@`h >x    @  A %Uu + ,1i iE1|1 ic1i|Jx1ih >} Qn ͺ/ Һ=] 0'o() |* y+, - ;(pit ~p IλILI u.ImInIo&XI0I1I2 I3 iI4 I5 ?(I7 l0I9 ?8I; l@I= HI?P u¼¼ u̼ ¼pR ?r> lr>D rq r/II I ( ¼> (¼L `o >( XX- 0tоu vw!x*y& z @(tоھ<4  o۵ & @ ||+w }~xbuf >+>+?Qɿ+ 0Sɿ   L+ + I IE5N qLq (5E5FL mod5G  ops5H!5I 85J5K% v] >q.5L)Marg5M iMstr5NVMarr5O 5VQ5W]5X>)Q 5\ max5^]5_] num5`K ops5a!5bi[;0(e)`?+  + D ] + DQY+7 `*-*.( mod*/ @*0H mp*1P*2SX 8*5 *6*7 0*9 S*; h *<|(*= 0 &&+>Y S&+L5h LX | m B]*>h8*E!mod*F ]*GhP*p>*qi*ri*s*t]smtn*w ** *]*>*>Lv}+<2>^f^  + (,--.. //01   id5 clsȴ( -@Q=+h E=Q}+X+}Q+ @^ end^L++ (0&8Q7+/ (+++++ ;0crcu1K2Pa37P+ H&I&JK LM+Nz 0I  ( +@!p QH LP |X!bus ` h  ip  ix > ] p V [ e Lmsi ;( t8 y@ oH oP X  ` h x   D    iLid Q >   !! #  $ % '# ) + ` , a - b . c / d 9 e < f0 :;<w  !"# $(%0&8'@(H)P*X+`,h-p.x/012345& +|+BUB]lHxfy >z]|]}>~0k@fI8)  ) !) ") #) $) %) &) ') () )Q> S @ @ A B C D E]>@Pob`  ]                ]oooo  (Lqos0 +,L id-./> 0(1IA02+X3 `4 h5 p6 x7 8+9+:+;+<+ dev=+V> V? +Bc!ops& s  s+c +]x MNLOLP!Q!R! T(U0V8W @X HY P[X\`^h_paxcd pmfh + `aL busbd eLg h$j(k0m8n @oHp PqXr`s!ht!p pmvxw py I +w `23L5!6!89 ; (< 0>8@(@AHC P pmEX >u || 0 Xw YL Z! [ \  ^ pm `(w=]-( >|| i j k = m ` 8+8> `+8LB  ] ] +B] B] 8 ;     0 f !| "kfB] 1B] BB] O cL d&p e2 f4 g !lid h L`joo~ecma 0D1L2 3L4I6VX7V`8Dh9Dp:Dx>+?i @/0 ops1" dev4+56(78II6 =] h *i;@z{| i}i~ &(0 irq]8]<+@+HLP dirX*S8 R!irq ]Pab g( |0bbQRwwPal023m.4]@B]T& )& i  (i + %+ =]  getD put T h h ( 08@ H P!X:`Shp:x!D QR] idS]T Pf5gh]i7 D5TI hY m n L L]i L  L  ! :& SL? LL]]X  i ] =] y!1"oMptr#i hL busMNOP Q((I (8@Pp!opsn i' 1+qdev0] ]  ]""(5v6>!len7] !cap8$T&&I` JK!busLMO i P(Q0S]8T<U>V@WBX]DYHZI\.J]P`Xa`cQhdlemfngxhp!piniqj.rkFxmnotev yz](|]-}].~]/]0]1]2]3]4]5]6]7]8]9]:];]<]].]]]sdev0Lirq]@]B] B] B] B] B] B]B]B]B]B]B]B]B]B]B]B]B]B]B]B]B]B]B] B]!B]"B]#B]$B]%B]&B]'B](B])B]*B]+B],B]-B].B]/B%F H >LP## ]@M. ]`M]aM i  Lvpd= . ]PO 8 v .  . Q ]`P .  . B } .0 2 LromR8  @ LH  +P #GX 1rLy  t  ( t0 8 @ H#P!X!`h+Q#+3+3=W+I@IsdevJ0LbusKLopsLnMnN iOPQR(S8T@U HV iPW]X]Y]Z][]\]]]^]_]`]a]b]c]f`\kz@(n  ! "9#a$  1s W ^"^^^+  i9] a]<> ]Qf;<>=RH ]8_7aPedhdk tl t o t(r t0 P< dUti y~    Q7=]E% NZT jZ~e%ju_ ,z~9zo  o++Eq4P+.q45Z^(0O!vma1/2 :3 +4+5+ T>y&? &@ /y /+ / /+++ ,z9z] ,z 9z++ +/ G/+i$ L[/L t/v[` v[/+Fy u/+6G ( i i IQi IP`[$p$t!pnp<&x'K)(Ldir%),8Lhp,@%,H"),PiXqdev0`]P]TX>h # efLg hi%Sjd  !@@CDEhFGHI]J]K]L]M]N]O+P]Q RS TUh.Wh.XbZ3]+0^ 8_`@a]Xb]\c]`d]dxdirghrcunKpo(q>rs tLv  ht]] i 33@ hdz irqǵ]Ƕ] devǷ+ msgǸ ǹ  ǻ(Ǿ80 8i@ .H% Pt 8Q irq]jh| m( i0rhL    ( 0 8 @ H P X ` h p x        + + I g   ! # $ &+ ]mrm mh. m m]m1m =+%% %=  ImS0 gmN milm]mh.  cnt]m.=]" ,a pin-./Q@0QA1QB 4567+8 >.RSMuvTa HI3JKQLQMjNh.O P i(%0 X[Y]Z]0+++!ack+!eoi+ +(rP&[8Q@QD <Hx!1" #i$ @% U& j ' j((]0)]4*Q8+Q<,Q@-]D. iH/+P0+X1|`2h3ox Q@i1UQiEee&Z~P+B]@ RS]T]U]V] W~X j!gcY e.P+=]      =]POPQQ]R7LLQLl&mG&n&o&pnstrq.+Q+o+L+Tj&k&rV Q V>i V P#?#@#A#B P#e #f>#ha map#j#k #l #q(#s 0#u!8#v 6@#wYH >|D.% \|\.[C |]jf|] |D]FK[ |]]i|]] !|m6|m& Y|\FK;  ?@QAQBQCQ DLE h|mP+]#Z|EQQQ Q QQ.5,Q %E1 Q!Q"Q#Q$Q%Q &Q E()Q*Q+Q,Q-Q.Q .551 %1 67Q8Q9.> ? Q@.B= C QD.F_ G QH.m nQoQ3q rstuvw x ].z {|i l5 %_ y % yNJg NjoMptrnjiǍi Ǜ ǜ5 ǝ . Mpci g   i =] PǮ ǯB DZ j ǵ Ǹ ǻ  ǽ (ǿ 0 8 @ 1 H j  =  H=  Q.]!ops6 h i ( i0L8 i@   j | ]j= G  | ]o  |+=   |=    =    |+  |+  , |\, Kj  ]  @fff///////  +||   # mQ sh1 sh2 ^Ϳ)Q)Q)Q)Q)Q )Q zͽ&;Q5#^ )Q)Q)Q )Q)Q)Qz-&Q5^T! zt&o5-ΝΞoΟoΠoP+B]2^:);Q)<Q)=Q )>Q )?Q )@Q)AQ)BQ)CQ)EQ )FQ8^IJQKQz7&8o55TR&ST&TO-PQQQ%TaR&bo&ct^_Q`Q%-h@ghoiojko l$R(Y!gpaZo[Q\Q @_.`&Pcu!gpadoeQfQ g&E  Q 5u Qw q sQ vQ xQ Q  5 @ D ,81+ P   Q    > Q Q >  i@ QHAx 7 8+wAx B  C Q D +sx 5?nstd 9& E ( ) E * E /o  0o( 2.0 3.2!u F4 M. N. [ \. ]. ^. _. `oB]      B] 5      ` " Q  &5    &5 ? Q    *. +. ,Q ag b&5 cQ dQ  eQ i j&5 kQ lQ  p q&5 rQ  &5 Q Q  Q = &5 Q  &5    .  Q B]  & *`& $ & '& && )=& /g`    S  @ H Q\!msg `I H I K/ M O% T U W X YS [ ^u  _Q( `Q, a10 b1 d go@ hoH noP uX x` y ; zi | I  > Y  o Q  Y  Y   iqrcu K ( @ A .B bH oh op ox  Q !Q $r &r ) *Q -Qp  !msg %`( % &y 'F (Q )o * >  AY BQ CQ Di EB] ~IP /  E  E .  ."] "0( 'L )  *o( +e0 ,o@ /oH~IQQ4YN oro^A  >  G L   E  #G  ( w `  p  p  h `/GLp/e /uQ+     K  i]]K  i]] 6 i6 ; K io b $π oRϨiRτ QAώ Ϗv ϐoAϓ ϔv ϕQϖ >Aϙ!Ϛv ϛQϜ1AϟI!Ϡv ϡQϢ!zό!&ύv &ϑ &ϗ &ϝ &ϣ!&ϩ!&ϰ!&϶A"I!I!Aϥ!Ϧv ϧv Ϩi AϫA"Ϭv ϭQϮ] ϯQA ϲv"ϳv ϴQϵQ"+"+ Xu"v(w"@x #HVyVz ""#" ƒ#„ ids…† #‡# ˆ #(‰ #0Š 8‹ @Œ"H #L## ##”## #Q•## $Q–# ˜[$™š#›#œ $ $QQQQQQ %QQQQQQQQQQ Q Q Q Q Q %P o2:m <&QQQQQ p&%% %>!ids %0%X.')Q)Q)Q)Q)Q)Q)QAf'))) '.' !$'%&!&'!'(f'(+6"()7A;K()<)=:(>"(?@AD(EF (GH!(K(L ))M)NQ6)R F)!devS+A)A) )6)PV)Wi XoYoZ["((\$ )0!ws]@^H_L0q*r*st*u !B]‡`*B]‘*B]—*r(¸\+¹º »\+,¼7P½]¾l+|+ +Ql++|++++++++,,) ,],+Q* #$+,$,Z+ Z-iE +q, ,Q -Q. ), *Q5K,E 2, 3Q 4Q 5Q 6Q 7Q . 0, 1Q5, 0 - !Q "Q #Q $Q  %Q &Q 'Q vtl (%q, %,$ :o(Z <,Z ?aZ <Z Q=]@-////--+M$- =]j//IB/IB/IB/IB/IB/IB/IB/IB/ IB/ IB/ IB/ IB/ IB/IB/IB/IB/IB/IB/IB/IB/IB/IB/IB/IB/IB/IB/IB/IB3S/NdevQQQyy//Q /.. revQS/ serQ=]0 0.. revQS/ serQQ.. 1.Qo Fa1..a1.q1+J1Q..a1 2..Qo!82"Q%c2&2'S/*2!hdr+,2/2!hdr01B425 37i933i3222 3P+JK3K2LQT3U2VQWoZ3[c2\Q]"3y/3P+`4ac2bQc#404P+,fM4!hdrghBiM4Q]4+{4|2}S/~4Q44++Q4+-52S/4Q-5=5+Ev52S/0(52Q1N52S/1R!62S/q1Z62S/162QS/Q 6!hdrQ66+?72QS/Q 6 x7c2S/o7c2S/ 72S/Q  B]8r8|9(0-8>@7`/h^p^xS > >i | Lwqc(04(9!wrkb!bus9 8U:..!revQS/ !serQQ.":#$Q%:9:P+(8;*+ 2B,-9 .</9@!wrk0bH2 6 h3ip9M4x(<c;=S>B 6 8T;U8;!bufVi(!lenW]0X]48;8;1(   (l B<m Sn B< :+Y<+ G< h<+o<(< < i i X<+<< X%=+=%= C US=S=Cnk=k=C=k=>z=C=C =mCǐ=mH +=]]++H +>]++HB>F]]]CǑU>mC h>m> >mh.C >m>#Nm>|]H >|+= >ǒ|> |C ?H#6?]L6?R> Yp?p?/^^^^H+?]++H>?:LoHi?^+>c?L]oO~Y @`L @ >{+@+C ]C@^^C#V@C# i@|O {@{@@C@C@CB @cC@ O" @+O" @+" CA H+.A]]+H^DADAm3>;]oAh.H s AS>njA OA+H A+] >-mA]H B+] OB+CT4B4Bi9B MBi,> .ozBooo E4W4UO;B:OE]BLo> BoBoo>  "CiQoyQCT 5Cc CRCCeC>C]]>J CcbH5#CH2CLo>}DLH %D>+LoH]@D]]H([D]H`#qDOtDD!a2BH k+DS+OE DDL @ob8DO=D<O v ES>  HEiQoQ>]iECEO8ELo4>2iE:>8iEx:>?iF:O4FLoO20FLo> @oQFooCdF>  FiQ<yC  FO~ F`O~ F`>  FQQiQ;i> DoGo> ?o3Go> RTGS= L(t_KH7ret :HFQ<"TGW3GU Q `,H@=U t fJ#,/ 9JL7retoutJM"_I_0 >  JIJBT Q0FIT PQ PR0X0Y xJUsTLQ1o&JUs"FFKJU}rcJUsj{JUsFJU} JU|FJU}"-J+8 J?9* oK32arg?i m  Fret- - tW cN#W-/ Y9 Z77ret[? L7_wq{c""CMY"fL_0 >  opM bM'V  d '  '  "@ kv8Ny'7 $E ' Q '  oRUNUsT1"F`/ ?oR#/-/ 19M3 N_0 >  wMAOw+@T 5KP =P'V  d '  '  "@ k7Qy'7 $E ' Q '  CQ+dtQd&Q'"sEoRQU|T0"F"i@xQUs"V@"C@"iuQF"@"iE"@"@"HEi\#./#9 9 AR2W[pktR8; B<7tmpB< +o~7retQ,(Y~S + +,S i,S i,T i?AT i?kT i?T i{TDD  U(gUU(uU~T~8}VD (j[j+jj~jjjM "Z_0 > dj2[j'  % 2 ? "]Ek[T|Q8R0X6Y0ͬUsT}[GDUT Q B!\U~TQ4RvX~Y6D@\UsT B`\U~Qv"FUv(T  i*i#*+/#+%G - .9 /.7dom/. 0>7ret1QiJJJJJJJJJJJ,_ 7 i 7 i07 0  G   ^ET Q 8?\_< ?U}T Q _Q Q\ _X X\ _ \ \jNanj+{j  ` <+ H ;FaR :S  `a <+ H ;FaR :S0u?U T@<$ {m"bDD {nbDD mc{' 9wkcw+w;?UQ0R X Y  c?U1T0QvR0d++4Jd*7>cdTFT  wdw+@T wfw,ewwx l Xe~;?~eUQ@L$R "=;?eUQ0R "=FeT "+@FT If[+hu=gfU|"iEfU"p=6fU"X="HE@fU~T0?gU T Q1FNgT PQ PR0X0Y "@"iQFgUxgUsT Q4"F?gT ?gU T QsQFhUvo,hUs"V@"C@"i@FkhU}rhUsjhUs hUFhU}xhUoRiUsT1FiU}EKiU~T QvRDFviU~T Q|FU~T Xi+ i=` \jdom .U'  "-<_ *kv*  .j2dom .Fi ]* j 9/  9Fpkt 82  B<  Fret -  i n# :/ 9 !n "n 8; B<7pkt n  7ret Q o?pl i i' EUT ,l  '  (% (2 (? l   \ M ":m_0 >  mGDUT Q  >n((+ #n+GFUs(T DUvTNͬ\nU~T}]tnUEnT|QR|X6Y1QFnU|"FUs(T ]442X o+niR r#R 5/ T 9U 2V S7retW ? Tp [ r [ S6[ S [ Sp [ rp [ r+p [ r [ r?p ^ ' ^ % 2 ? ? q7_wqv c""CZ bqGDUT Q MT "q_0 > d Rr((+ 7r+GFUs(T DU}TNErTQ4RvX6Yv"S=`yi w# ./ 9 w 8;7pkt n 7ret J JF Q?t6 i  i'  '   a  {tET Q t&  & \ t8  8 \ 0u=  = \ M "~u_0 >  " uGDUT Q  v((+ sv+GFUs(T DU|TNEvTvQ@RvX6Y1QFvUv"FwU|T oR"wUsT1QF:wUvF_wUs(T FU|T K38 w <9* w ?9Fret * x D9  ^Fret }x  Ux   \ -   \ Xx+x8e xe A9i }# :/# (}#   9  } 8;7pkt n7ret! 7i" Q oJ[ ,z6* i * i0 * 0   G  ozET QHz>  > \ zF  F \ #{M  M \ U{W  W \ M "{(_ > ( *. {GDUT Q ; |((+ u|+GFUsT DUsTNT |E|TQ8R}X6Y1F }U(T "F?}U(T Fj}UsT Q|QF}U}EU(T - 3^ #^ ,i ` 7reta  b 9 c d Qe o e o f  g ., h  i n j 3 k  l  m  n  o  p B< q +Q,6s i s i0s G  ET Q ,  i  i0 EUvT ,  ΀  +  +  U~>   \ ,1y   \   2?+L    +FU#(T ,$l   \   2?+L   +FU#(T V   \    \    \    \  u(+:'g <(uU~Ts  n.+;HGR U00_+g   g  <<   N Y '     a   qD~T1qDT2~'{S DDZT QlxCU @QsET   9(ŒҒߒd   =2?+L    +0 0  ET )"UTQFU V (dq~d Q'  '   ET )sUTQFU   (:'g <(uU~TsdFJU|TQvR}X0FhU|Q }TͬU]UsQFNjUͬU]UsQFUF:U#(T "FpU#(T FU#(T FŒU#(T FU#(T c233?7x7X+8H H 4B< J 9 K /} N  N \ - S  X+` Q# 6b  Q 9 B<  + A  !pkt 2 " i,  iގ ' + ' +,A6.  ' . % 2 ? } }+ ' 8( ȐD_Q]L+[DUv9 $Fdr Fi -  i  iU:8  =9 "Fdr Fi -  i  ii ϗ# A9Kdr  ϗ + Q oƓ   \ ,Д i i0 0  G   ET )Q(,6   0{ DDV  +  +  ~_:gJVb+nCU|T@Q~D  ȖD g  &uU}T Z lxCU @QsU}QFUsET |9j Ȭ# :b Q   Ȭ  B<  9 ~  ϗ7dr   +Q  iݘ  +  +?  i' 0 + 0 +,E 1 i?o 1 i ; + ; +, < i,˙ < iJ  J \  P + P +,; S i?e S i? ` i { DD   J8 rD97dev6 7bus7  8 B<? : i?E : i; y+:  @ (e+'9  (IU<   ( + 0 (_ a)(+ CG Q^]Usͬ״U}@DT18% 6% :9 ' B<& ) i- ) ij # :9  B<   Q,  i   \ ,   i} F+ w {DU}T;Q CʶTv3&Q}R0"CU T}Q + ` G#79 ^ ^ ^ ^ ^ B< + oQ 7i1 + +,O i?y i, i? img yukUT"UUsT4Q2R~ݹUsT4Q2UvT}2$#Q4'UvT}Q4UvT}Q48Q XQ=9 SB< T^ U+ VS WoFiX}h  [ r- [ S e+ e+ liHo o\ - liXh+X*G oGo*! !=9}< -/ /\ jt#1mKmsgG 9  B<   h.;v~ t  $. %QAb&'2,R(Onv1) =5nv2*!5nv3+!5- v~ ./ov~ 0Q7ret17cpu2JJQJJ," D i,= Q i Q i0Q 0  G  ET Q@ET Q@, z' z% 2 ? ؿ \   \ ,$ +, x \ FT  + +>P+]jwv~d |(' )5 g uU~=~|Uv~T|Q4pUv~T| Q2Rv~U~  g MuU~T| F R@U  g uU~T| U~}Uv~V \  4B F +:@n +~  WguU Tv~U IAR0{FGDUv~T Q   'V  d '  '  @U} kdy'7 $E ' Q '  yp +.AUr U0   (* _ (AUv~#@ ' e -0ky07  $E 0 Q 0  AU~ͬ/Uv~B[Tv~Rv~Xv~Y6oAtUv~BU}Qv~QFUv}]Us]UsUs] Us"F9T FXT FT 1X+y* Q 2cpu-QQ.5* Q; ;2cpu-Q.5*  >   +Fcpu- + +* =h.* QQ.=5` ;#(i#F3#  "outEUUWEUU;v5jy#y,m{~(,U:)6CP]} g(d / TNf  a( :):6:C:P]ajkDx' a:::::dm:( ("UvT}  &'  &2>JVb   R  <0o =Uv  [ (0(<HT=Uv_ \ "A,T~Q0FT Q FT Q U>UsB>UU"`r 0#r*m=UsW=UU`W #W,|#WL KirqX] Z9 [B< \ ]t ^m7msi_  _ (c N: h :>UUTQ"A"ͬUsT|u]uQF`4 R#41B<#5t 7RA(8|!pkt92:v";Uw? A' A% 2 ? E,TvXQHR0X6Y0QFDUs"!6t SP#9#Ei# 6  "9 %B<, #i ' 5:"ͬ"]i#2Kbuf>iKlen]#$] 9A!pkt2!bufQpkt~8;} - Q7retQB, i, ' % 2 ? ,9          - '        k   \ GDU}T Q  ++ +GFUs(T DUvTNET~QsR~X6Y1"FT Q-+6XB+2 -iK3 8;i#1Kbuf=iKlen]#$]#K 9A C!pkt2!buf":pkty;~ 7retQ$, i?' ' % 2 ? Y \   GDU~T Q (++ +GFU}(T DUsTNETQ@RX6Y1"FT Z6X$+`b Z#b,i#bJ3#c e f" h]6h]outy,+ r] r]4r,m s6s?X s s s s s- s' s      TvWEUUy;6t$ hKbus$5#$G]#% #%Kval%"Q '9 )B<,Y (i+ (+:"ͬUsTvQ|R}]Ust hKbus4#F]#  # Kval "< 9 B<, i (+:"ͬUsTvQ|R}]Usj)#:B<#E#KvalQ 97dev+  +Q9 + +,I R"UvQ4UvT~QsR|,S i | | 0 \  (g(uuUWFUT X9+)* .9B< 9Fdev+FvalQFret. + + + R- ijT#T9B<#TD#UKvalU< W97devX+ Y Z+Q," ` ` ` ` `? `W ` ` `y `- `' `      WURTT $ &U"# Q Q $ &, c c c c c?s c c c c c- c' c      WURTT $ &U"#Q Q $ &,0 g g g g g? ge g g g g- g'  g      WURTT $ &U"4Q Q $ &P w+ w+, yRU~Q4pU~TsQ}R, i |  R B R^' )5 \  w2(gm(uuUvWFUT j'VKdev'.+Kgpa'?R#'HKval'RQ7in)V7ret*oQkM 0?p 0+A A\  @< \ %U Q0WFUUT RTXQ.Xk+[j^Kdev-+Kgpa>R#GKvalR<7in^7outc7ret oQx( ?K +^  q  +# #\  < \ -U TsQsWFUUT RTXQXx+h* Q S/* Q S/* ]0/S}k - - \ ` 3G#-B<90E &10?3 Qg\+t p     '   % 0 '     a   WqDUU#T3uQF8 c-B<8 (iF3 8e te1m g h't it j9 kh.Ftmpl3 m n o+ pQFcpuq q Fresro} out w iz z\  + +    +% E + +- \ *R]Ri* i2dev :8 C2dev 6+2d N|8 l2dev 0+ 9*^2resD"* %i ; G:*|.i|D|P:- ]*%]-<-4*z0;ZzC:zX+*2wq8cb8  4b >9 a1x a9S9 T1x T7S- W *C!2rCCD*1!?2r1ED1M+*2i"2r1D9+Fold82r-D91r/D$7+91i1r(D$0+Xold9{1r{-D1n{4*9<`@b$=b$P]B8  @\ T+- + +* D(\ DC\O+\+H +\9$B+@/$C+@&+T1xH+Xy+*&+rFf+8- + + + + +8- + + + + +*&+-  +  +  +  +  +-  +-4 8<*>J:3*z z"z>h.{h.@]7 $6h.$Sh.8NQ 2vNQ 8p 2vQ * 2i2v+Q @ 1i1v+Q 9A 1vAQ 1iA8 2vQ 8 2vQ *< 2i"2v/Q *e 2i"2v/Q 8 2vQ 2i!@[ 1i[61v[CQ -k] 9: 1v:7Q 93 1v37Q 9 1v7Q 1i>*]9 2src1]C]*B 2dstB FB:]C]C+]# #:$%&'( 4U 4U 4U 4U) 4U{ > 4UUN 4UU^ 4UUn 4UU-4UU 4W 4W 4W 4W 4W- 4WU 4WU 4WU 4WU-4WU :[ 4j 4y 4 4 4- 4U 4U 4U 4U-4U*!# !3!C ! *! #Z! 3! C !  @!3!w$!3<@A!1ptrA<*P+P7]Q]R+-FvalU+@+ $7]$K+$+-Xval+@U+o$U6]$V]$V-+$W+-XvalZ+@8+$82]$8F+$9+-Xval<+*ss6-4u *jj8jV8383549Q$/9j$79$2$K-91new4$K91new1$$-@j:$jFXretl-kokp@A{1newA@$B$CXretE9#$#5%-&@_&+1w_A+91nr+$67@D1nrD3$DO9':1nr',$'H9^1nr*$F9^1v^O$^Y9P1vPJ$PT9&1v&C$&M@ +&+1w +=Xres -+* &+ A+@&++$B+@_1nr$8-Xc 9H1nrH$H19B1nrB+$B:941nr4$4/91nr!+$=k+XpF961ptr<$H$@,]1p,;$,K]cq~WEUUxvx ln !~xe xlt r~u+@"+@JKK:)K:6KCK0J KK+)K6KCK~PKdQKG^K_KB|UvAUvTsQ2TsAUvT0Q2"AAUvH  5A : F ^  q q     Iint F ,  * +s8R+u8e+s16}+u16 +s32+u32+s64+u64P \    1F 2F Hc IP X ] ^P _ `:   <F  '   o   #SB  %{ & 4 = B h n' } 1  ;  ;  F  F   $1  XXX0xx : JKL Wx K  s \x1MH  5  G "V y  ( ;$0 t8 ]@ "H "H "H ~H "H "H "H "H$@    0  RP h  5 5 F @  E F 1/kp J  F( F, @0  E8 B@ BA BB FD  OH sP9mem T@ t   F 0 e j  t ~  ( 0 F8 @ FH FL P FX ` Fh p  x F F @$  F  F F $  F !$ "F % &r' 9F : ?0 A0 D } F  P  QF( TE$0N  ; cs =;sl ?;wfe A; Ex ss G;sti I; K;nmi M; P;  S;0 V;8lm X;9 ];: d;<  cs  csx ;    ss  ssx ;   g r15 mr14 nr13 or12 pbp q bx r(r11 u0r10 v8r9 w@r8 xHax yPcx zXdx {`si |hdi }p xip x  sp   B  C  D  E   E (s E ,dpl E -p E' / F 0avl F 4l F 5d F 6g F% 7 F+ 8  % %% )%/ :' pgd' )'"  @H? I!_0_0 48em f g h u vwkeyx\m  U V ? j keyk n keyo ;l<=? F @ F$A F(B F+$-@ (y0FF  4( F,!F0( 4)Y.8*FH+P,(X5 `6 d8 h: l; p< t=Fx5se?@@/rt@A9dlABBBFD%I2JKFODXD]D%`"w>@d]hFkF lm nD oD(p'0q Xs`ubx dy/Dhz0p{D 0 0  /D00 x=01(%2P/mmhpEx    F F, F, F, F- F- F- F- F- F- F- F- F- F - F - F - F -"F -30/pid * *( (00((000@>FPCFX 0"{F%v(v+ - ;. ;3 ;4<6=: (=0>8A ;@D ;HGPHXK:`%N;TGWGZG^Hk -mHp0 q1(t8u@/fsxHH{HP~HXI`Lh Lp 5x 5 58 ~FL o<F\4h9 ;  ; u1 2" TD p2( (8 L@  H MP  MX M` Mh Mp x M /: F  ;  ;  ; 4 <  M 0  '  ' "M )M  0  M0  18  FX N\ N` 1h 0  N      !F "F # $ & ; ' ; ( ; %) 3*N C$ D L/N N R?N S'( T', Y0 ] 8 ^ < _ @ ` D %aH d9X gIN i9 lSN w x z } ~XN  ; ;  $  FmNwNNN F(F,vD09rcu04@ D(H4POx4  " O OO  ; >% !"-$"-%.<(O%F-@@l$@@q-spes ds"$&(0-8X`cr2hpx-F' i-5fpu ,@F(  '$@@!d@&i@ , !c c B(,Gd0&d80XQdh%`dpxb ed' Njdb !  >!val   R!! ,>!!! !!  ^! !!R! ! " \ " ?? 2"R! " "2" F, #fmt555F55$O6,# 7 8 8#5555'F'F'4Fkey9 #("F=#   8U;$V0modW;$X5Y@$ Z ([ ,\#05u$v$w$xFyF,## :$ /$1Fset3Cget5\7 .$D&;$ 5 X {  -( -08!@" ߙH# P$ X%`&/h'Hp(/x)k*+,ٚ-ޚ./ 0 .1 2`3 5 9 ϛ; >k?@=$ !'% + -/  :' !key " ?h' A Bm' Cr' h'' =' >:' '  ;{' ! $0"c("d5"e."gL"i j"lo 5('# N# Np$(cwd$'swd$'twd$'fip$' fcs$'foo$'fos$'$($'l '($*(rip$+;rdp$,;$..)fip$/'fcs$0'foo$1'fos$2' $)B)((0$@d) $Ad) $Bd) 't) ;$$*cwd$% swd$& twd$' fop$( .)$5'$6'$9* $<*$>d)@B) '* '&*?$Q+cwd$R'swd$S'twd$T'fip$U' fcs$V'foo$W'fos$X'$Z($[l$\m$]n$^orm$_p$`q$a+x$b'! +@$:Q+$; ;$< ;$= Q+ ;a+$@@$O+&$Pt)$Q+$R+@ +2P@$^,$_9(-$`t)$a&*-$ba+@$c, ,E$@@$f,$hF$kF$n;$q;xfd$t;$wF$zF$F$F&$+@@$,$ ;$F$F Qfpu@$d-$F$$d-$d-$, $,0&$,@@,% -% ;%; :- - --- -&N&N&N'8.'92.'<2.'=2..(<Y. (=F (> (:.(;.7.src(A  dst(A .."F).  () /) /val) ')!' )"')#;)$ / ')*G/ )+&G/ ),#t/#*t/*uQ* L/)'/)(6)).%/).; )1/)20)3)4 )5)6 /()30 )%. )/y/ )7/8)`0)fn) t00\o0o030`0+>0+?+@+A'cpu+C'"F,0     - 1- 1  1. 01.0/ K1/ 0a1 0"0u1K1 0a11 11! 1"1 2)12*'2+2"osq2-01 2/0(3 23 3 0304P244P24P224 p24 P2424U24P2 52(5 25 5 25p2"F6 2 @6'q3(6(26)  6*3(6+406,86-96.:6/;2332q3@@7/470~71F72 6 seq73;743752 76077 83(8G48 x88 W48' R4R44G49499 94 4: 4:4 4 :84;4;  ;4<+5<,c<-cx=_5=_5=F`=hmax=p o5 > 5sig>4 >o5 ?RE ?S55 ?U ?V55A@5 @  @  @ 5@'"6@(o@){@-`6@.@/@0 5@1@56@6o@7{@8 5 @<6@=o@>{@?@@@A@S 7@T $@U@V @Y17@Z $@[ @^b7@_@` @a @J7 @L @Q @W6 @\ 7 @b17 @E7@Fb7@g7@h\_fd@i@m8@n@o@pF A @%|8 @*5 @2"6_rt@9`6 @B6 @d7 @j7 @q70A 8A A A A 80A 8|8 A8 8A  9A!0A" 5 A%N9A'5A(A.5A0 5 A3h9saA4 9 B 9B B lenB B B(C9C {D$9D% D'D( 0DD/:DM#9DPB(DWB)8E :E;E;E;E;E; E#;(E,;0F):F*;F+2PF8:F9:F:FHF;FL :;8FD;;(FEFF1FGF0 G>;GKGZGpGGGendG; :;2H!;H" F H&;HD;HD; HD;HE<HE; HE<HT L<HY<HZ u1 H[(<I o<valIZ I X<I <valI f I {<S<U ;V ;W2"6F[=    0hx=i;jk<cpulFm;n; o;( == ',@@w> ; ; ; ' ' (0F8$@@ ; ; ; ; ;  ;( ;0 ;8 1@ ;H ;P 1X 1` ;h ;p ;x  ;  ;  ;  ; ; ; ; ; ; ; ; ; ;$@qA=& 2! ;(" ;0# ;8%0@&qP'qQ(qR)qS, ;X- ;`. ;h/ ;p0 1x1 ;3 ;6 7qA9{A;{A=5avgG=@@ vA0KAL0MNOF P$Q&SA(A)]BBBBBB,`C&a2h ;i ; j ;(k ;0l ;8s 1@t ;HuFPFFFFFFFF&2X&2rqCACB)^CC(CBRrqCC<F <F <F<F:/DSTDBbCBs'qDqDTD? ~DD D CD'' D,EqRjS @ D Hp2P` h)px u10S DFpidpJ7>FJ9 4J:FJ; u1J<minoJ=;J?y J@]@JBSH.rcuJC`JDypE xSF K{FKFKZTSFLoGLp'uidLq o<gidLr < Ls o<Lt <Lu o<Lv <Lw o< Lx <$Ly F(Lzy0L{y8L|y@L}yHL~yPLqXLH`LHhLHpLHxL L}L iL8L}!}FGFkeyMHM4Moz!{M| semMS(M|PM X|`M huidM o<pgidM <tM{zxM|M~M M||M|G H H H H H;XN^LN_4N` NaNb Nc0NeS Nh(8Nk8@Nn]XNq`NsdNt(hNwpNxFtNzx'NF'NFNFN]N](N2N itNN4N:NƀhN N>FN=ttyNۀNN L<N;N ;N;N;N;N;N<NNNN'N N(N"0N,8N@NHN"PN,XN`NhN/:pNNNnNN FN NBNNNN1NS0IC NLNu1N4NSN^ L L L L M MXOcMOd'Oe Og Ok u1OmRjOn(Oo]0OqT8M M8 M M PMPcPKPWM M N N N %N ?N;; DN NN 5hN hN rN |NhQyNQzYQ|FQ}`[!ZQzZ(Q40QXQ#e[`N N O O O #ORNRNRNR!NR%NR'NR,NR/NR3NR5NR9NR<NRANRDNRHNRLNRQNRUNRYN3PShPSSSS PS!sS" }S$FHS'QS(5keyS) S*QS+ S,(S-0S. Q8extS/Q@w'3PhP S3 S8pQtpS9pQS: S;'S<'P * TRT'T TFT  T;T;inoT); devT* (T+ ,uidT, o<0gidT- <4T. r8T/K@T0KPT1K`T2KpT3;T4;T5'T6'T7;T8;T9'T:'T;' qRU#SU$u1U%0 U' R#VN#VN#VNW\SW 4XNTY Y"iSYS Yu1 YnSYSzSYFY(Z0TZ1'Z7'osqZ901Z;2"Z<0#ZN#ZN#ZN#ZN#ZN[+T[,2"[-0 \ TTTTT \T\'\0\TX]qU]rT]s4 wq]vUHcpu]wP Ux^U^^U^U(len^'H^UP^p #UU U \U;@_V_V_V_ (_u1@@_ (UH_!_"_#B_$4_%TU_& _'W0_(8=cpu_*@=ssp_+NWH 'V`_6W_7u1_8U_:U(_;H_<WP_=X_>\V_eNW_fFsda_gX_h"_iX WCx_DX_EW_FX_H _I1(_Ju1H_K1P_Lp_Mx_N_O_P_Q_R_S_TB_U_V1_WSF_Y _\_]_^T__NWp WXUSW`NaX a+ a+a" Ya#a$a%a'/Ya(a)a+SYa,a-a!Y a&X a* Y a./Y aYXopsaYSY YYa2Ya4a6Fa7F "FQ@Z   "FQH@Z   QpuZQqZQrQszZ uZQZQYQVQZ(QQ3QZZWZ@Q`[Q@ZQQQ Q B(Q,Q`[0.rcuQ8Q[HZYQ[QidQ j[[2Q[Q[ [(b\b2"b1b0b  c \c;c& $c)Sldtc*\8c.@c91Hc:hc;]pc= xcC |cD~ \d ]ddaltddd d(d0d\8d\@d\Hd\Pd\Xd\`d\hd\pd\xd\d \d!\\] cF\\]^ `FX^lruY0] d0 e0i>^ j  k(Rn^]hE^s (u^zpp{^|}~' ^^^_  ^3(Q0_>^n^^^7R_ F  : k_val)R_0M_N PF*J_BlruK0x_*W_X Yk_0@GL`I_UEV  _([ 0\ 4^84@Fj`_-j 0(m`noq r s t vF 4@l`j`-z 00}Ta~     (0 a04@|a`Ta- ,Da!L`!`@!a)a, b  u1   E  q(F0F4G8w@pP rp  x#Օ$ % 'ڕ!a5cctx6c c=Cc>AS@;(X`cYS(\cbht%w }$0c4cc-*daaX Gd5rb2Cc Ld Vd[dc`cd;cid Y@@ d : d0 mNZ@@h!d@S@PX`hppgd  x) 5 ?hELFS Z2"]'_au1pSr0$ (08;@u1DHP'X3`h/brkp!x%0hh@h]hu1pix( ib&i  ['T!i' dod h3 [h h iQ i i 5i2#e6N#e9N#ej gGMj gHj gIii 4j9j CjHjh,jh- u1h/ h0RjgAjigK ~g:j g@~ijgNj gO gP gQ r(g+Dkg,g-Bg.Bg/ ~jj 0pkqbr rs t u v $H(Dkji"ki#ki&ki'ki' kkkj(lju1j 3jBl7jljWl!(lk3{lk4'lenk4'k2lWl k6;k1l{lk8lkil kj0 kklS[krm ksx ktk7kukRmkTFkU<kVkkWmkXl kYq0k[q8k_"q`k`uhkapkbx(kdBllkmxkn].d_ukvlmm$x{q| }~ o< <F !e u(E0 8@H L rP X ` h'p't'x'|u1^ 'Sx0o  000 \?0$@$H P T X \@e`yh%Dp08@H P(X`h pm q-q'@kqkukukvk6vkJv k^v(k nv0k nv8k v@k vHk.wPkLwXkew`-qq$@u0 q r t(!0!8@"HPX`mhSp &!#:D$SXk 0 b b l vxF (%` '!'"/ 0 14 6F<1 B5@D"qHFxPI'XL`O dRUhS]pZ ixaxbx9rcucdTf1k0%nu1@@o0Hqu1Xr0`q"Fku umFuvv vmlu1vvF51vlvJvv;v^vmOvnvmcvvmqsvvmv lEvlFmlGulHlIvvvvwm)wmntm vm mwvGwGwB)w3wmewmuQw n"wn#nidn&n-n4n7mNnRxnSxnUxnX\nYnZ Fnc 4 ndSF(.rcuneHngXnj0`idnmpnptnq5xnrmnuxxxxwjwx'0o3xo4\yo60o7o8 Bxao9Rj  o4yo 0o" \o$u1@@o-\ylruo/xo0' 4yJ2ynrJ3nsJ4y0 ]y ayy2p yvalp; py"Fq y   y r1zrr r#sNteztjzt ez M MMlz.rcuMmMn4Mo BMvzMx My MuzzxM(MrA{MtzMK{MP{M5 A{A{zA M{{ M M {U{ { M{{{H{{HF{{{M{M{keyMHMK{3M| M07M2MA| M  M (M|MMMK{MP{M  (M| MzA|0 M|M0M =z* M|MU{| | |{u}u 4u[u0u'8ux@uidu o<Pu'Xu `u$>"hL}L 4LgidL } <}23L} L]rcuL}};@@7g~7h2"cpu7iF7jF7kF 7lF7mF7nF7oF7pF7rF7s7t7uF7{  7|3(7} 07~38(7M@@}1~"F7:M        >3@^ N9n?8NN N! \N"N#;N#; N$(N$0N'N(;N);N04N1 $N2 $N3 $NCONDNLwNM(NNwO8NQNR NSONTSF| ƀ >Fր ր  4  v)v(0wlwwwS(w `x .rssx )xq0x8xS@x Xy fny .argy  ez bz z { 'OSA OT0 OUy3OWb OXx7OY8OIqOJiocOKM!A O\F0 b | ҂val|Z || val|f |ނ} v}  }%6F}T^    "q~      . 0 $ 4"F.ۃ   45F679 * % /4`  o<  ҂  <  PF >`  rKK(K8 bHЁ()x*0+0 ,00-1@. u1`/ d0uh1bp2 rx34 { څval ÅGF  "F6(   BEbuidF o<gidG < H څD4JH ( ( ( ( (  (( (0 8 @HЇ0 F(F, (0 (8@ Ї!;$ЇGF        @89:;<=È >È(?È0@8uÈ܈u܈bȈXDEÈFG HÈIÈ JÈ(K0N щ8O@QHSPủ̉q(qڅ։q̉xYZ[;\;];^; _;(`;0a18c1@dHeLf;Pg;Xh;`i1hjp8FFFF FFFino  ( 0‹F‹ ҋ QFFF FFFFX66 Y(|08|@H6PQuGw6uF"TuTҋ;wubw ^u܈wuD8  F S 0 (H/ops!8  q( 8 H*wm}r mwk\Ǐ! : T (0 ѐ8 @ H P -XP`dh p x   ̏ba!E B:E&JJO ?bErFSYbErFFѐE~~֐B -kkPEy2dUB~~iBEؑؑbݑ bkkǏ*?MF4e]-*! &q*ޒIN  F ޒ $@Z`[[\~]^`؜ b(d0e78fZ@h}Hj7PkXmҝ`ohp"pr @xsmuvyў{}:S` j t ~  ( b 1pid>F0uid o<o< $ p FF FF r* 1 ;4 )Օ-*+., -])P^F    $0c  &c>ltΟ    ( 0 8@9HMP9XM`php x Ϡ  ) ) y  +& 05 ? INۃ ] g q { : :$)Bߘߘ5r;F pos r) Fr5brXb~oi:{b5~oi]kF bߘՙbՙڙ \bFb/qbHbߕ4kbrrMbpb ٚb$PINboi~F.boiIN~F QbQSV[ 3\brreb ϛbrbr~FrbrbrrFԛF =F$m[qmFB5ymqy`qqB؜mqmBݜmqm7qm#Zqm5<}qm_qmҝqmqmFmםGw'FQ@m~'cqc;;h EqrqmbFўqbm֞m0m05 Sm0? mt S qX6F   qΟuqӟqq u9u%Mu>fmfk RuvumϠu~ru5~rԠ q\)ux==B . LQmyt5[ "@@AA5B0CFD֪ E<(sdF90GAS8'IF'JF'KF'LF'MF *  . 'PPW     qq  ZU2_rev Z99  95.rb2ns0F8< >Y@id;` hp.rcux opsJ!T r9hEi y"$ % ɦ & ަ(( 02 ~89B@: H= P@3XA Q`E O dir d > Ukn9b 1 1@`0h x  ~  B@  BA %`dddUydn~oiɦoiަΦd~rdՙ3drQdr8"Fz  0'֧(V) ji* +, - .(z1ۧ 1"5"5" "mW "n "o&X"0"1 "2 ~"3 "4y "5 ("7 ө0"9 8"; ө@"= H"?PWW )F) LF3~jFQ)1EtbFr~~өbFr~rbFrةbF"N" l" #lF)SF)5~q`֪0 u1 X0t7u LvQw!Vx*yy z (۪7LFAN[(oot֧A`t~ttiyiC }~=buf  ? :/Ed}/xtix5ttd׬5׬>(E>F5modG;$opsH!I JKa ܬì\׬HLargM strNarrOVWFX \max^F_Fnum`qopsa!b$0(;();>2L t F v   :7` -  .mod /;$@ 0FHmp 1P 2{FX  8 5r 6  7  9  ; ͯ  <( = 0r5~ͯ;$5;$ү;$6F >   ,8 ELmod F;$& G6 J       _,P p q r sB tF5mtn w  1  1 F   6;"ܬy>e& o y#QNW/Q  "L Aϱ8ϱ `   A 8  A3 #83  A\,L8\  A"u8 a M b L % Kint 1u8? #W   1 <!%',/359<ADHLQUYɲʲ˲  6 9 < GK 1 :@ 1T| 1.111-  g l - - - `J 9   % V9  `/V ,4p ,   : ;9 I8  : ; 9 I8 I !II~1B : ;9 I8( 'I  : ; 9  4:!;9 IB : ; 9 I8 4: ;9 IH} : ;9 I k : ;9 <: ; 9 IIH}4:!;9 I41B!I/  &I1RBUX YW  : ; 9 I: ;9 I' : ; 9 I k  : ; 9 I8 1RBX YW ! : ;9 I8 "H}#:!;9 IB$: ; 9 I% I8 & : ;9 I'1RBX YW (1) : ;9 I k *.: ;9 'I + U, U- . : ; 9 /(01RBUX YW 1: ; 9 I2: ;9 I3 : ; 9 4.?: ;9 '<5 I64: ;9 I 74:!;9 IB8.: ;9 ' 9.: ; 9 ' !:41;  : ; 9!<1RBX Y W =>! I: ; 9!>.?: ;9 'I<? @.: ; 9 'I !A : ;9 B> !I: ;9 C.?: ;9 '<D 1E : ; 9 F4: ;9 IG 1UH.?: ; 9 'I<I  : ;9!J :!;9!K:!;9 IBL : ;9 I8M : ; 9 IN : ; 9 I k O.?: ; 9 '<P!IQ4I4R: ;9 IS4: ; 9 I T : ;9 U V : ; 9 I kWH}X4: ; 9 IY$ > Z4: ; 9 I?<[ I 8 \ : ;9 I 8] : ;9 I 8 ^ : ;9 _1RBUX Y W `.:!;9 '@za 1b4: ;9 I?<c : ; 9 I!8 d 1e : ; 9 I 8 f(g1RBX Y W h  : ;9!i.:!;9! 'IU@zj.:!;9! 'U@zk4: ; 9 Il:!%; 9!Im : ;9 I n : ;9 Iop'Iq : ;9 I 8r : ;9!s : ;9 I 8 t.:!;9 'I@zuH}v5Iw : ; 9!x : ; 9 I8y : ; 9 z : ;9!{ !: ; 9!|  : ;9!}4I4~ 1U1RBUX Y W   : ; 9! : ; 9 I!411UX!YW  I8!I/I  : ;9  41 H}.?:!; 9!'< !: ;9!.?: ; 9 '<.?: ;9 '< :!;9!4:!;9!I 14:!;! 9!I!:!;!9 IB4:!; 9!IB.1@z>! !I: ; 9! : ; 9!< !: ; 9! !: ; 9 >! !I: ;9!4: ; 9 I4:!;9!I!.?:! ;9!'I< :!;9! 1U.:!;9 'I !.?:!;9!'I !% U $ > &4: ; 9 I?'  : ;9   : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9   : ; 9  I 8 : ; 9 I (  : ; 9  : ; 9 I 84: ;9 I?5.?: ; 9 'I<.?: ; 9 '<1X YW 1X YW 1RBX YW : ;9 I1UX YW .: ;9 'U@|H} U.: ;9 ' : ;9 .: ; 9 'I@z.?<n.?<n: ;  : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 'I : ; 9 I8 < ( : ; 9 I : ; 9 I I&I!I/  : ; 9 I8 : ;9  I8  : ;9 I k : ; 9  : ; 9 4: ;9!I '  : ; 9! : ;9 I I : ;9 I8  : ; 9 I k  : ; 9  : ; 9 I k  : ; 9 I $ > ! I 8 ">! I: ; 9 #4: ; 9!I $  : ;9!% : ;9 I 8& : ;9 I 8 ' : ; 9 I k( : ; 9 I 8 ): ;9 I* : ;9 +:!; 9!I,  : ;9!- : ;9 I . : ; 9 I!8 / : ;9 I80 : ;9 1'I2!I3 !: ; 9!4  : ;9!5 : ;9 I 8 6> !I: ;9!7 : ; 9 I!84:!; 9!I!9 : ;9 I 8: : ;9 ;  : ; 9!< :!;9!I k = : ; 9 I8>I ? !: ;9!@ I8A : ; 9 B : ;9 IC : ; 9!D : ;9!E!I/F !: ; 9!G>! !I: ; 9!H% I$ > J K&L4: ; 9 I?M'N4: ; 9 I?<O : ; 9 P  : ;9 Q  : ;9 R<S : ;9 T : ; 9 U : ; 9 I 8V  : ; 9 W I X  : ;9 Y  : ;9 Z  : ;9 [  : ; 9 \ I 8] : ; 9 I ^> I: ;9 _( `4G: ; 9 a.?: ; 9 '<b.?: ; 9 'I<( 4: ;9!I $ > 4: ; 9!I &II!I/ 4:!; 9!I  : ; 9 I :!; 9!I!8 >! !I: ; 9  :!;9!I8 > !I: ;9!>! !I: ; 9! !!:!; 9! :!; 9!I8!% $ > : ; 9 I4: ; 9 I?> I: ;9  : ;9 ( ~C00 0 USUSq\x\P V .P.FVFQPQTVTXPXfVfrPr}V}PVPVPVUu(\#U#SUSVVotV*PSZPPV vUu(pU pUppps#s#s#s#U\UU\nSnwUxSUu(SpU pUppp|#|#|#|#+SV$VVVUVUUVUVVTTTTT vvZPZ~Puv~~_>S>V]VS]SU]U]SU]4CSCH}HKPK]PSPP~v0vP ~_]PK[P]S}PG[P ~ \#~U$]U]U]1PPR@S@\SS1PPQ&S&\!S!^!\S^\1)P@@ @ HVVVv P U]ePenUPT}TX]X]P]d}dhTht}tx]x}P}} PPPVv(N888 8 SUS~XU SS T TT!P!gV&P&__ __`\`V\V \\P\ P D PPVVVP(V=WPWZVZ^P^lVPV0PVPVPPV0V0PV "606; ;T0TY 00 00&P&__ __ 8  8 99 99  8 1H\"P#/P P  P  Q  Q  @<$ p QPPS_s(_@_ P VPVo__ Q P_____T_r %??x(@/0( 1$#/?' %ur %??x(@/0( 1$#/?' %P>VtPVPVTVPg_P@Vg\ U  U USUS6S^^6^|| P ___6_ P \\P\6\2]]]6]0PP0 0 0060 P \\P\6\# Uu(V VVV SSS<U<SUSS\\\PV2fVttVVl|s||1PP n]nss]]l|s||<4]444 4 |]Uu(] ]]S SS]U]SUSS^^^1T1xvvvv*P*VVPVV1____]0x0P5];C]iz0]] I0IWPsx xP*P*VVPVV      13U3u("\ \hh\\ ShhSSBUB_U_w_!T!VTVTwTQ\QwQPwPw5P5]P]w] P <\U> )P)SSSPSSSSPSSnSS\\\PP_____P_P___# #VVVV P#_____D_n__"__"_F_"____]_ P SPSSPSP2SSP  ! !10 P v  L|| |  D1pDHpD1pD#  L)  LH  LU S SPiSSPS+QQQQ+qqqq P !SSUUsUsUUsUs001100UUsUsPPP 1 U  1  U  1  U 1PPqTsPs_PqRq0 S MsMQS0PqRq    L pL H pLpL#  (pL#  )_PrRr0 S JsJRS0PrRr U  (  U   ) S SRURSvUSTM\~\VUHV P "^P^^QSvUS  sdP|U4VUVUV 1PPQ|T^'U'VUVUUV4T4\T\T T TPSSPSPK^t q. D~.Wm~.00PSSPS( (( )66 ( 1PU)\ Q )^)\ R )@ Q )^ \ R @ Q ^ 1 4PQ v vSHUH U:U0SS S SS70[d10100 R RAhQhQQSSvSVQ0^V\}~V~}~~ V }~ ~~ ~ V ~ ~~~~:V U U:U\0\\ 0P_PPTP_TP P _\~ \ \ \\RR$QQQ*7QSsxSSMV~P v ]]d]%\\\ 1PPQ]v v_ P _ v P vvTPHS$~$.Q.8~8HPSS1PPQ.S ~ Q~.P)S)V~Q~)PSV~Q~1P}tT'VVV 1PPR~RW~VVVVVGPG^^^^TWpP+~ P0000GPG^^^^^  2222  1HHHHH H 3_TY__  U3TY  __^^^UU~U~UU~U~000111000UU~U~PPP 1 U 1 U 1 U 1P ~ 1 ~ 1 ~ 1 ~ 1U^Q]U^_Q]U^_Q] 1*Pv~`}~`~~~~~~~$Q$\\\\`0gz(s $ &#2$|"#  $ r  !#r  !#p   !#$P$~~~P_P~~~R s $ &#2$|"#  $r! p2$|"#  $r!  s $ &#2$|"#  $r!JNRNRr@L$!RVp @L$!0Ss,s,]S]ovdoSSS `v`}}} 0 Z_Z~~~$Q s $ &#2$|"#  $r!r@L$! \ ~TUV~~UV!T!\T\$P$@]@BPBV]]i]SBS]iSN0NsSsu0uSPSSu=v@Bu]fvS u%SBNSU!s>GUGJsU!s>GUGJs!0>J0!1>J1!0>J0U!s>GUGJsP4=P 1 U  1  U  1  U 1P v ]U=S=AUABUBGS$S9T9BTBGTT$TQGQGGQQ$QU0S04U45U5:S$S,T,5T5:TT$TQ).QPR)U)]UVhV \ po|XS&@P@XSVV P 0    PvPOUO\~~U\\SwSwSSSv3&T8v3&^^v3&v3&SSdiS%s,PPUTU0U\P\\\(0(/P/_^__0_SSSS202VU__U_VU P:_PP,],aSarS# VVV]PP x $ &#2$v"#  $p! q2$v"#  $p!  x $ &#2$v"#  $p!+5x $ &#2$v"#  $} $ &2$v"#x !?IPIMp@L$!Mz} $ &2$v"#x @L$!z~} $ &2$v"#x @L$!5x $ &#2$v"#  $} $ &2$v"#x !5x $ &#2$v"#  $x $ &2$v"#x ! p4 $0.+} $ &2$v"#x4 $0.DM p4 $0.Mz} $ &2$v"#x4 $0.z~} $ &2$v"#x4 $0.} $ &2$v"#x4 $0.x $ &2$v"#x4 $0.0-0X04}4:]#,]]S# Vut x $ &#2$v"#  $p!q2$v"#  $p! x $ &#2$v"#  $p!5x $ &#2$v"#  $} $ &2$v"#x !EIp@L$!IU} $ &2$v"#x @L$!-@E-@E U _U_v}U _ v} _ U _ v}Gv}G_T}T } T }} U v~ v~v~ ] ]]0P0SP S SS P(s(v~#@v~#@PPRv}Rv}TP-^U^^ ^^1^^F^Y Yv}Pv} v}Fv}1 1H0QRNPP\P\\F\ U v~ v~v~00 0 00P2R2{v}Rv}P@@  @@  44 4 44  @@  11bbbb bP'\P\SS__|(|(Uv~ \\PPv} q Qq \  P !| !,T,5| } } \ d } P \__Pv~\   Tv~v~6v~!P!6s,6v}6^} }}}}}}}}/_Pv~#@v~#@Uv~#@QDv~D\'P'Ds,Dv}D^\Hv~H\$P$Hs,Hv}H^\} }}}-U-.U.:U:;U-T-.T.:T:;T!Q!.Q.:Q:;Q-U-.U.:U:;U-T-.T.:T:;T2U2SUUSCSU^^ ^TTTs0__C_pPNqPPPQQQ\0}U}000#0Pp+P,;P] PI]1___C_ P\ P    @@ @ @  S PVV~0V0~0V P ^QhvPvQ)P-R p@U1U]Rp6% QPUPUV T q $ & QP q  p $ &R PR PRU%S%)U)*U*+S+0UUUTcVcjTjlVlsTsxVxTQQv#UCEvELT#@PSU%0PPCLP:\?C\HO\OSUP4SPQSp# pPSPUU^T^STS  vX HTHIvXI( ()U)SU"T"FSFLTLSSQGVGLQLSVPP#PPQTUT}U}U}U}U=UT_T_TT_=_$Q$SQSQSQ=Q2R2}R}R}R}R=R\\=\@~@ZTZ~~~=~ss'Q'1s1gQ#Q#Q#=Q# P0 &0\\=\=  s  %P%V s V Q  s  Q  s  Q = Q =   = =   =  s     8 V RP).PPP1SSS1VVV VVV SSS5U5^U^=^TVTVTTV=V)Q)]Q]Q]Q=QR_R_=_X~X~=~\\=\T"E=P'.Pd0 &0\\=\< _  =    S P1]gg]]1SggSS SCCSS ]CC]]'U'1S16U67U7ZS'T'*V*7T7ETEZVQ'q'ZQUS#U#$U$GSTV$T$2T2GVql Q QD/Q/?QDs0 Q QD q  Q  q     8&U&hUThT*Q*OVOXQX_V_hQ*R*Q\QXRXa\ahR*X*S]SXXXc]chXUP#S-3PU&U&hUThT*Q*OVOXQX_V_hQ*R*Q\QXRXa\ahR*X*S]SXXXc]chXUP#S-3PUWUWVUVUVUUVU9T9s~`sTT~`TT[Q[SQSQSQQQ[R[\R\R\RRR)P)]]}P}PPA^A]T# ]v^v}T# }^T# ^^T# 3PSuPu@P^^^v,Q\^\^\^P6U6>^>EUEWUW^UU^U^U^U^U^^U0T07S7ETETTTSTTSTTTST3Q3<]TS\cScmQnwSP'PTtxTTtx\TQqxqxQqxSqxUUTTQQUU0U0]S]pUpqSqvUPS-UP)U)-u~-v~U-T-TTfTosT U u~fv~osUP*6PP"S"-P-=SNRPSp0)*6p0)  \@j_,nG$((dg%  `^&~~   ,   !!!EU(E05fk05fk/ -CEICIIOTZ] 5 cc*   '*.26 $$ A:II(.:  )2AJw (/afIN *3##  %BN!>J//<7<y    #  ,W     6 ,3AS-;M_-;MRZ_/   ,3KPXXX`orXX  i!'(#"    *"   '  O'5A0!+0 !(.6!#**k'  [ "%)/!.!&D$+1?DH18fos*1/1,3"/  H]`5:@eho  Tw=''  661/ =,,,1(#(  (+ %1/  :  gn]]@    $'-- s{#(2MQYRWRR^f..;6;31 ;Y  / (  KKKOV_ _,`          XM` F% Y  Yd<pXyX,2w=KXKWYJZ8=f&I%J;%K&Il=XXt$<=X O\-@'=zX(uXJX3oot<Yw u=  u X Y V0 ,>L!nx< XJtXXxt=<2w.$t<<= wXu=JX=y* J.Xut29X&i>,5.8X&i>-XJX Jt[ Y  W )f W )<  W. X@)Yx.6K = =K.XY xy .xX=y.=.YMq!K Y'-"[ (x t/<<X95t?v. <vJ  X ` .(.'^tvJV'>>ZJ y yJf < yfXv< v. v< v.XYv.qX vt   =N :>Y xy JK ...zX  <K ...tX JK  ...X1Y.@ w< JY{* ;EJX<<; X.E.X  vKXJ J  (y f/><XG?w.<Dw. y << y yJff yJX) \ .  & \ *"Y/tXH{* 8HJX<<8 X.H.X%w. =X'pJV'>>Zw< =X[{* 4LJX<<4 X.L.XXX  sJY  g t? qJ.Y   h t? (q   q&l f<  qf  |t K~&uP0<07-<KN18"KM&95;<<"0&KI=-d,/./hFZ ' Yf<6L[\} (. }J |O&# )sX# fO#)#b< Y~.%J  u<~  f ~<  ~f<  . >ReI{  {<{r I<X {yJJJuI= xX{r{X{Xf {yJXzY!zJ!lSy   ]JzXzXX   0Y  qt< %r.~%~    mtwt<kJk<JkJJ (mlX tfJm tl[ =M  Vu K Y< mY /fo <. X.<  tJ XsJS7 ` q q.= X Y[ (l  j<<kp Yg K<" ~fK lX JYZm=FKTr]J .J.XX nX nJX  oX YJt  o-X%o.~%~ X ht HKK!! =!K ozXt _!JR h  hJ #X U2fXX{Y (n  n.t8$Yts<tf<Yg szJmEz XX  L  <K. . oJ ...mXXX  itJ qtY!- } n | 0f  0ukg<LZ %<;pt0JY tX=%X;p<0JXe |.X bX! b X&!UY&[ T:.I'b  t}Xb<X  }XX (dYsXtJ< e~ XXJ  itX<d Jrg K<~[X =M Y = K<JJXBcp YJg K<" cJKJYZz<BzX<  itX" X/X k |.it  h#J=#K;/YhX %y.~%~  u <ufZ| tf t<| Jf  ~s X <X  ~<"!-$\xX ~Xg"iGg s' t$L'HLsX  ~< s! <$\yXg"~tt~f s' t$> J'~XLqXtv~wf   x< oKpM= YRX 0~Xf O j Y vy Yt=X.^JnXz"X3a p |  m,t %n.~%~  f suX N7Ku(v(d<LX?mfzXt mt fPt %J  AXf .u .u  hft k |*t'tttv0$J .`t Y KuM/J j.M/ Jw. T,;Y _|y 5y. 5yJ y< QY j< %k.~%~ X< KX= dJ? Uxd.? -<e  e.<;< Jkvs=  <Mp ctttcttt  vx*p'tt0JJttt m |t<0J~$X. |'0 Jt|Xhv u#d ;KY J ryut Xw vJ jXM {X .zXt   XcXJk<X t)X. tJ! ztZlXXX (n t  nzWYzY&&d;&X"ULM tJ .XzXt  ~Xt Jl+KmD| szmEz     <m tfXm[ =M u = K< o0X {   yt<g #J; H8y<#XID GJ9&k<YP /N H8 EJ;&iJ \<;&iWJX r pX nmXXX8 >Xvhhv,XJHv.f,X~h>,>,v,XLHt t,X~t}tXJt oJttJ#iX$<Y=[.ZitXlX|XDX%X~<XXXpwXt XQtXvxXtXmX .  vK o<<Y nXc[xXVZ|XJ?XVZsX sX |Xw  tYhJ<tntX|Xj |tX{Xi ?vtX K%        acpi_device_statusstartparentlookupkernel_siginfo_sigpollinitializedkill_sbnum_bugskmalloc_cachestasklet_disablestate_entry_ptrrelease_ptestatshv_pci_eject_device__compiletime_assert_114active_basesDEV_DMA_COHERENTrelease_pudunsafe_warnstart_databool___GFP_RECLAIMABLE_BITdep_unmetmodsctimedestroy_inodeirq_domain_chip_genericfutex_pi_statecallback_eventphysical_node_lock__compiletime_assert_127hv_vp_indexi_mutex_dir_keybus_tokendevice_physical_location_vertical_positionget_aclset_acl__compiletime_assert_525valid_bank_mask__vmbus_request_addr_matchs_voppercpupci_dynidszerodesciterate_sharedp4d_valdestarch_test_and_set_bitcma_areafeaturesrcu_tasks_exit_cpumigrate_from_cpuMSI_DESC_ASSOCIATEDwriteerror_codecrs_csi2_localbuddy_listldt_structcred_guard_mutexbus_groupsd_timedsw_presentUTASK_SSTEP_TRAPPEDget_nameVTIME_INACTIVEclass_preempt_is_conditionaltimeoutfree_irq_domainuring_cmdshrinker_idnr_dirtiedgetattrsetattrvmbus_request_addr_matchpci_bus_add_devicessystem_long_wqHV_INTERRUPT_SOURCE_MSIfixupblocksubsystem_iddevtlast_cpupost_ejectprocdirnr_wakeups_locallow_baseuidhash_nodeunlock_requestorworker_privatex86_vector_domaincontrolipi_send_masklineMSI_FLAG_ALLOC_SIMPLE_MSI_DESCSlinkphysfnmodemonitor_allocated___GFP_NOWARN_BIThv_irq_unmaskbase_addressMSI_FLAG_DEV_SYSFSatomic_setnode_idpacket_sizetargetget_nextdqblkof_compatiblercu_tasks_idxint_respjournal_infostore_trtqheadDEV_PROP_STRINGlast_used_atirq_affinity_notifyhres_active__UNIQUE_ID___addressable_cleanup_module527mod_namenotes_attrsdelay_workMSI_FLAG_PCI_MSIXhv_pci_resumeoffset_ctxFREEZE_HOLDER_KERNELlast_switch_timewakeup_countsystem_freezable_power_efficient_wqrunnable_weights_encodingclass_releaseput_pcichildlast_sum_exec_runtimedd_key_truesa_handlerhv_pci_restore_msi_msgcg_listlocked_vmaddressstart_timecookielistWORKER_DESC_LENsig_okextabledevice_list_lockPCI_BUS_RELATIONSi_sizeentry_eipsplice_pipexstate_headerout_full_totalCHANNEL_OPEN_STATEdma_addrpmd_valem_perf_domaind_flagsenter___GFP_HIGHMEM_BIT_large_mapcountend_context_switchcomp_packetpid_namespaceliveclock_was_set_seqread_msr_safeseqcount_tmin_fltblock_devicehv_pcifront_opsload_sp0pkruprojid_tvendormax_vcpu_bankhv_vpsetkey_payloadadd_linkspinnedsubsys_datais_virtual_dummy_bndWQ_FREEZABLErefcount_saturation_typehandle_irq__WQ_ORDEREDhv_cpu_number_to_vp_numbersaved_stateparent_exec_idutil_sumdd_key_falseMSI_FLAG_FREE_MSI_DESCSmask_cache_privsigvalfsnotify_mark_connector__ubuf_iovecsize_is_constantcputime_atomicdeadlinereset_methodswait_queue_upperclass_write_lock_irq_is_conditionalIRQCHIP_STATE_ACTIVEswap_readahead_infovtimes_rootstack_refcountgrpmaskdevice_attributepm_caps_remove_countlru_genwrite_newuser_namespacedmar_base_addressclass_rwsem_write_is_conditionalpids_active_resethlist_nodesuper_operationsautosleep_enabledwrite_file_infoload_sumresourceaddress_spacecpus_maskdl_yieldedshow_in_uifile_dispread_newd_spc_softlimitkrefrseq_csleaveacpi_device_power_flagss_lock_keydqi_flagspdevjump_entrypi_top_taskrequest_addr_callback__print_oncepacct_structRPM_REQ_RESUMEbus_addressuser_sizeats_cappci_protocol_version_tring_buffer_mutexshow_fdinfoPCI_CREATE_INTERRUPT_MESSAGE2PCI_CREATE_INTERRUPT_MESSAGE3child_opsFAULT_FLAG_MKWRITEfadvisevcpu_offset_hv_pcifront_write_configHV_CALL_ISRclass_read_lock_irq_is_conditionalvmbus_channel_modifychannel_responsesupported_flagslinenoMODULE_STATE_LIVEtask_listversion_supportedFAULT_FLAG_RETRY_NOWAITdestroy_wqread_foliodq_countdriver_gpiosnlinkdestid_8_31signalnr_wakeups_passivethreads_handledself_exec_idstate_syncedf_epsriov_set_msix_vec_count__this_modulercu_specialhv_register_block_invalidateentrybackWORK_STRUCT_FLAG_BITSd3cold_allowedcntssock__write_overflow_field___GFP_THISNODE_BITthreads_oneshotWORK_STRUCT_PWQ_SHIFTstart_prevent_timepgd_tsigset_tbucket_iduse_callsu32_datagraph_get_port_parentremovableirq_chip_ack_parent__list_del_entry_validi_inoserver_has_tasks_killDEV_PROP_REFi_spc_warnlimitf_posperformancesoftowner_trapnoload_weightio_windowhv_retarget_device_interruptsymlinkclass_rwsem_write_try_is_conditionalkmalloc_noprofin_iowait__compiletime_assert_4DEV_DMA_NOT_SUPPORTEDpids_activeget_inode_aclbdi_writebackrb_leftmostset_pgdbug_addr_dispmigration_pendingd_realdevice_get_match_datahdr_types_max_linksthread_headacquire_dquotclockid_tacpi_hp_notifybattery_presentFORTIFY_FUNC_strlensurvey_child_resourcessig_eventpref_64_windowif_instancepgdval_tenable_countd_managepv_lock_opsMIGRATE_SYNCwcharseq_filerestorecommandpci_bus_relations2HPROBE_LEASEDthaw_superis_managedalt_lenfallocatenotify_online__ret_call_addri_mmap_rwsemundo_listis_probedattribute_groupdma_poolspersonalityprintk_index_sizeuprobe_task_statestimeset_pmdstatic_priotmpfiledqi_formatnvcsw_nr_pages_mappedfrequencyACPI_DEVICE_SWNODE_EP_DATA_LANESdev_pm_ops__refcount_sub_and_test__kmalloc_indexno_updateiter_typeirq_flags_to_setDEVICE_PANEL_BOTTOM__const_udelaynr_wakeupsenabledirqreturnki_filpwork_func_tpp_magicisolation_config_aisolation_config_bfpu_state_perm__refcount_dec_and_testfwnode_reference_argsdevres_headbus_listdpc_rp_extensionsRPM_REQ_IDLEfilenamebased_prunerestore_noirqpci_read_block_responserlocki_rt_spc_warnlimitbytesnuma_migrate_retrypercpu_dev_idvmd_devMEMORY_DEVICE_COHERENTenclavefilterd_revalidatesystem_power_efficient_wqrelationstracepointset_ptei_opbladequota_syncsrcu_have_cbsslot_noslot_nrasync_in_progresssignumhv_pci_irqchip_initu64_datadqi_dirty_listpi_lockCHANNELMSG_ALLOFFERS_DELIVEREDmonitor_grptimespec64set_pudnr_forced_migrationsumount_beginchannelkernfs_nodecpumaskwake_activeptrace_messagelengthgpadl_createdCHANNELMSG_OPENCHANNEL_RESULTi_wb_frn_avg_timeacpi_object_type_pincountrevmap_sizereclaim_statesourcemsi_prepareruntime_errori_sb__poll_tsubvolon_dispatchdirty_inodesymtabPCI_INVALIDATE_BLOCKhv_pci_generic_complX86_IRQ_ALLOC_TYPE_PCI_MSIXd_rt_spc_timerrcu_tasks_idle_cpuget_dquotsvfsmountvm_operations_structfs_parameter_specnested_featuresrcu_data0real_blockedruntime_suspendx86_msi_data__s16backtracerefcount_incs_umounton_listX86_IRQ_ALLOC_TYPE_HPETfree_windowsdata_vmneeds_force_resumerqstor_sizerpm_statushandle_edge_irq_find_next_and_bitparam_countsurvey_event__s32port_nrirq_nmi_teardownirqs_unhandledp_sizechildrendqi_bgracei_wbf_inodeserialburstaer_cappci_read_blockmessage_typehostmsi_device_datamaskkallsymsi_ino_timelimithv_pci_removesrcu_idxutil_est__s64hugetlb_usagesect_attrssrcu_size_statewrite_inodei_rdevacct_rss_mem1___orig_eipsrcu_datadevice_physical_location__keycgtimepagefault_disabledrescindindexs_time_maxhandler_name__mutex_initacpi_device_perf_statedelayed_workwakeup_listsa_maskmmappedElf64_Wordactive_timeatomic_flagscallernum_jump_entriesPIDTYPE_PGIDelemirq_suspendquotalensrcu_data_have_cbsnivcsw_tidms_hyperv_infohv_pci_restore_msi_statemce_vaddrdl_dev_stateshowrb_subtree_lasts_listadd_busnr_segsof_match_table_entryino_timelimitcpu_numberi_readcountACPI_DEVICE_SWNODE_PORT_NUM_ENTRIESincrfreepasid_enabledxlatelock_countlist_lru_onei_pagesmxcsrWQ_POWER_EFFICIENTrom_bar_overlapclass_rcu_is_conditionalarchdataptrace_entryguest_permPCI_QUERY_STOPwait_queue_headhvpci_block_opsnum_srcu_structscond_suspend_depthprev_sum_exec_runtimei_flagsgendisku_flagsinvalidate_lock_keyinfol1d_flush_killms_hypervhwirq_maxhv_pcifront_get_vendor_idwrite_beginwrite_infohrtimer_restarts_encoding_flagssessionidd3cold_delays_time_minnuma_nearest_nodeWORK_STRUCT_PWQ_BITvdsoclass_raw_spinlock_irq_try_is_conditionallistxattrs_stack_depthvmbus_channel__vm_flagsrelease_data__dummy2pm_messagefred_cschangedinitexplicit_getpci_incoming_messagefop_flags_tgroupsoffstty_structnotify_nextvirtual_dr6dma_opsirq_chip_regsmmap_basesyscall_workACPI_DEVICE_SWNODE_DEV_CLOCK_FREQUENCYunmaplockdep_mapnum_trace_evals_addr_bndno_inc_mrrsresource_sizenumberzone_device_dataquota_readnum_vfpinned_vmset_debugregwritepagesnuma_faults_localityqrwlockHV_PCI_DEVICE_FLAG_NONErw_semaphorebufferPCI_QUERY_STOP_FAILEDi_blockstask_fragsource_listsum_block_runtimedelivery_statusN_CPUnuma_scan_period_maxtotal_timepowerrequest_queuenum_ei_funcsi_generation__bitmap_andflushiommu_cookievmbus_channel_offeronline__cpumask_to_vpsetring_bufferstate_countformatlast_switch_countlow_mmio_reslast_wakeeswapwake_enabledget_pcichilduint32_tvmbus_channel_open_resultssize_tinterrupt_maskhv_isolation_type_snpvtime_statepci_ers_result_tpci_q_res_req_responsewin_slot__ret_condCHANNELMSG_UNLOAD_RESPONSEs_blocksizeprevent_sleep_timeset_bitpartition_idhv_compose_multi_msi_req_get_cpuclass_spinlock_irqsave_try_is_conditionalclear_bits_readonly_remounti_io_listchild_countpcie_bwctrl_dataVTIME_IDLEcompat_uptr_ttasklet_unlock_waitDEVICE_HORI_POS_LEFT_hugetlb_subpoolend_pfnACPI_DEVICE_SWNODE_EP_NUM_ENTRIESuclamptgidreleasenr_wakeups_migratepci_resources_assigned2stack_vmi_fieldmaskupidhv_mmio_write_inputinsntrace_evalsia_vfsuidvisitedACPI_DEVICE_SWNODE_EP_LANE_POLARITIESquota_format_opsprocentdr_wrkIRQ_GC_INIT_NESTED_LOCKsig_eventsi_datafsverity_infocore_threadclosidreserved2reserved3sched_avgphandlelevel_assertcodearch_atomic_fetch_addDOMAIN_BUS_PCI_DEVICE_MSIXenable_tasklethv_pcifront_write_configsyscored_id__i_nlinkpmd_tvmbus_channel_offer_channelsrcu_barrier_cpu_cntuv_alloc_infoload_tlsreadaheadhrtimer_cpu_basehwirqirq_domainwait_liststatic_call_trampfsverity_operationscoublockgpadl_handlehpdevbug_tablemigrate_modeusing_gplonly_symbolsremovedhandlersym_vvar_pagemembarrier_stateirq_eoibin_sizePCI_BUS_D0ENTRYFORTIFY_FUNC_strlcatrcu_read_lock_nestinghv_pci_compose_complrcu_tasks_nvcswfred_sshrtimer_clock_base__signalfn_tfuzz_testing_stateio_bitmapDEVICE_VERT_POS_CENTERphysical_node_countinrush_currentlong unsigned inthv_pci_devmax_timeread_file_infoexec_startia_sizeprefixRPM_RESUMINGMODULE_STATE_COMINGsym___kernel_sigreturninit_completionirq_set_typeuser_cpus_ptrd_opstate_initializedinterruptsrelease_dquotplugsoftirq_activatedACPI_DEVICE_SWNODE_DEV_ROTATIONinv_weight_raw_spin_lock_irqsavesecuritykernel_symboldl_timerlockdep_map_pmodule_param_attrs__user_state_sizechainedVTIME_GUESTsysvsemstashedpci_resources_assignedhaltpasid_no_tlpuser_xfeatures__kmalloc_cache_noprofuse_memdelaynr_cached_objectshas_timeoutpci_scan_root_bus_bridgecommcallback_headchip_dataexception_table_entryin_hrtirqfactor1factor2_overrunbank_contentscpumask_to_vpsetIRQCHIP_FWNODE_NAMED_IDDEV_DMA_NON_COHERENTcoredumpd_sbnative_pmelist_move_tailksetno_msichange_target_cpu_callbacksleep_maxxmm_spaceprobe_typenum_trace_eventsnodesysvshmREFCOUNT_ADD_UAFfirstpci_msi_unmask_irqPCI_MESSAGE_BASEwrite_ldt_entryfree_busWORK_OFFQ_BH_BITN_GENERIC_INITIATORpercpu_enabledactive_countnum_tracepointsreported_missingueventsharedpm_devwin_slot_encodings_sysfs_namesigval_tbitsbase_pfnclass_mutex_try_is_conditionalresource_size_tvirt_to_physsem_undo_listcompat_rmtpcore_internal_state__do_not_mess_with_itclass_local_lock_is_conditionalcompose_comp_ctxtlist_is_headaddress_histatic_key_true_stimeperf_event_ctxpcostxcomp_bvio_contextmsix_enabledCHANNELMSG_MODIFYCHANNEL_RESPONSEPIDTYPE_PIDwakee_flipsmsi_domain_infovlagufdssegment_boundary_maskprev_cputimeis_dock_stationsaved_cap_spacehorizontal_positionresource_orderem_perf_tableprivatechanswp_entry_tcharmatchnr_failed_migrations_hotreg_offsetX86_IRQ_ALLOC_TYPE_PCI_MSImmu_gatherFORTIFY_FUNC_UNKNOWNvmbus_channel_gpadl_torndownbin_attrscpu_itimerdevres_lockfiles_structDOMAIN_BUS_PCI_MSIfind_next_zero_bithv_pci_drvvmbus_channel_state__ret_onceaddress_loicq_treevfsuid_tacpi_device_swnode_port_propshv_vmbus_device_idf_lockexec_vmkernel_paramvmbus_request_addrvertical_positionraw_atomic_fetch_add_relaxedshutdown_prerelease_foliopri_capkstat_irqsvendor_idhv_compose_msi_req_v1hv_compose_msi_req_v2mtimearchrobust_listasync_probe_requestedthaw_earlyvectors_securitysplice_writeparam_locki_opflagsdentry_operationss_blocksize_bitskfreeexp_hintclass_srcu_is_conditionalprealloc_mutexbpf_raw_event_mapshared_gpa_boundary_bitsCHANNELMSG_GPADL_TEARDOWN_head_2asym___kernel_vsyscallimm_readyfortify_funcvmbus_channel_message_typeq_res_req_complacpi_deviceget_timePCI_POWER_STATE_CHANGEki_flagss_inode_wblist_lockpermdestroy_workuprobes_statemm_counttrace_overrunargsCHANNEL_OPENING_STATEargvuclamp_reqswap_info_structdynidss_qcopchip__kernel_long_tsrcu_usagefaultablephysical_node_listirq_set_irqchip_stateget_next_idhv_ring_bufferin_execverlim_maxtarget_listmutex_lockset_dev_nodecoherent_dma_maskdriver_flagsfile_ra_statek_sigactionirq_unmask_hugetlb_hwpoisonarch_msi_msg_data_treg_writelint_entryreadahead_controlfwnode_operationsswait_queue_headmemory_typevm_userfaultfd_ctxirq_dataTT_NONEmap_pagesmod_tree_noderqstors_bdev_fileeffective_affinitydev_pagemapcheck_quota_fileMEMORY_DEVICE_FS_DAXhv_driveri_writecountalloc_ldtdevice_typemax_segment_sizehiwater_rssunfreeze_fssoftirq_expires_nextlatencynr_to_scanFAULT_FLAG_KILLABLErb_nodereturn_consumeri_private_datamsi_descriptor_countvar_sizeptracer_credWORK_STRUCT_COLOR_BITSsrcu_barrier_headvmbus_channel_version_supportedleadercheckTT_COMPATload_gs_indexcap_effectiveirq_nmi_setupexit_statefaultsubvendormulti_capnbitsWORK_STRUCT_COLOR_SHIFTnuma_pages_migratedmmio_megabytespci_bus_relationspci_p2pdmano_cgroup_migrationprintk_index_startcreate_root_hv_pci_busindex_keytasklet_disable_in_atomichv_msi_irq_chipmsi_domain_first_descneeds_fresetdom_reqrcecintervalbug_entryirq_enablenum_classesvma_lockCHANNELMSG_18CHANNELMSG_19d0_entrydl_throttledseccompDEVICE_VERT_POS_UPPERstatic_key_modCHANNELMSG_20msi_descriptorsfilter_countatomic_decmknodnode_listlatch_tree_nodebusnrfuzz_testing_interrupt_delaychn_rescind_callbackumode_t__init_workdestroy_workqueueinitial_nsnon_compliant_barsno_pmGRPQUOTAenablesysfs_attrshv_put_dom_numia_vfsgidioctx_locktimer_slack_nss_bdixarraycan_wakeuppdeath_signalnr_wakeups_idledqi_igraceqf_nextmaple_treensproxydefparamblock_id__write_overflow_pkeykernfs_rootlist_entryucountsoffset_lowDD_CLASS_TYPE_LEVEL_NUMhigh_mmio_resrefcount_tif_typeDEVICE_PANEL_TOPold_stateint32_txol_areasrcu_gp_mutexprotocol_versionwakee_flip_decay_tsprio_listout_full_firstlast_timerequestPCI_READ_BLOCKdr_listcontextrwlock_tvm_fault_tuse_autosuspendclass_spinlock_irq_try_is_conditionalcfs_rqis_64cgroupscore_occupationget_policycore_cookiedel_listrefcount_struct__kernel_ulong_tfwnodestatic_call_keyhv_interrupt_sourcenamespaceacpi_device_perfparametersshared_gpa_boundarygroup_leaderrunnable_avgirq_bus_sync_unlocklookaheadiowait_countshstkfree_domioac__kernel_clock_thwsize___GFP_DMA32_BITgp_seqmaj_fltcached_requested_keydqb_rsvspace___GFP_NOMEMALLOC_BIT__s8high_mmio_spaceinode_operations__kernel_size_tdma_configurefile_leasespc_warnlimitirq_compose_msi_msgclass_local_lock_nested_bh_is_conditionalWQ_BHgpl_symsraw_atomic_incpci_vpdpercpu_rw_semaphorearch_spinlock_tseqcount_raw_spinlock_thighhv_pcibus_initthread_piddl_non_contendingcurr_ret_stackpgtable_tmax_bus_speed__u8wakeirqi_atime_nsecproperty_presentclass_raw_spinlock_is_conditional_sigsyspci_msi_preparecore_forceidle_sumirq_chip_typetrigger_modeget_offset_ctxreleasedexport_operationsqc_statehv_isolation_type_tdxVM_PKT_DATA_USING_XFER_PAGESd_inodeworkqueue_structi_lock_keyuevent_suppresshv_pci_assign_numa_nodegraveyard_linkfs_supersonchannel_callback__read_overflow2__rcu_icq_cache___GFP_KSWAPD_RECLAIM_BITinstalledcap_ambientqstrtaskss_d_opi_rcu__counttasklet_structhv_allocate_config_windowhv_pci_write_config_complguid_tpcountpci_protocol_versionsbio_listwlockedtest_and_set_bitdevicemodule_kobjectirqs_per_chipvp_maskenter_mmappercpu_count_ptrpcie_mpssthawtlbflush_unmap_batchremovehintsoom_mmbpf_local_storagename_linkcompat_long_tincomingcnivcswhyperv_paravisor_presentats_stushort inttrc_reader_specialtran_int_descgtimethread_group_cputimersizemigrate_to_ramUTASK_SSTEP_ACKloginuiddesc_structi_wb_lists_umount_keyquota_type__init_swait_queue_headname_dev_errsetleasemnt_rootDEV_PROP_U8psi_flagspage_offset_basesighand__eaxaddr__rcu_headac_utimeksm_zero_pagesshow_optionsprivate_datafs_structopenidnuma_nodedev_archdatanr_perf_statess_flagsrcu_nodeorig_pmdrb_rightclock_baseclass_irq_is_conditionallaunder_folios_vfs_rename_mutexdev_get_drvdataElf64_Xword__edxflockcompanionhandler_data__paddingiowait_sumdescriptionis_msixUSRQUOTAdriver_private__flush_workqueueWORK_OFFQ_POOL_BITSd_rt_spc_warnsdevm_pci_alloc_host_bridgepgmapactive_refhv_interrupt_entry__irq_domain_alloc_fwnodekernfs_open_filemsi_desc_datas_iflagspci_dev_flags_tprintedinterrupt_polaritydata_lanescodetagint_targetcid_worki_versionswap_deactivateattachclass_rwsem_read_is_conditionalil_weightdma_parmsKOBJ_NS_TYPEScmin_fltirq_set_affinityirq_chip_genericarch_uprobe_taskis_hotplug_bridgewrite_protect_seqkobj_ns_type_operationsshutdownevent_countstatessched_statisticspci_ops__kernel_uid32_talloci_nlinkmsgsizeorig_ptekeysinit_namehv_set_drvdatafile_lockstatfsrw_semwrite_gdt_entrytasklet_disable_nosyncdevice_privatevm_policydl_deadlinetracepoint_extclass_mutex_is_conditionalfpregs_stateWORK_STRUCT_PENDING_BITmemcg_datadqb_curinodesdev_typefileattr_setmsi_parent_opsu8_datamax_pkt_sizePCI_EJECTCHANNELMSG_CLOSECHANNELDEVICE_PANEL_UNKNOWNPROBE_FORCE_SYNCHRONOUSsize_ttrace_recursioninstrument_writemce_ripvDL_DEV_NO_DRIVERret_stackreal_timeri_privatealloc_tagdestid_0_7extended_state_areanum_kprobe_blacklistaccesssubdirsvariable__ffsgpe_numberirq_domain_free_fwnodedev_releaseirq_shutdownmlock_countget_next_child_nodemempolicybus_select_maskperf_event_mutex_bandpollfddev_tring_lockCHANNELMSG_REQUESTOFFERSplatform_dataf_refprev_posacpi_device_swnode_dev_propsenv_endfileattrs_subtypehv_pci_remove_slotsusage_countstate_in_sysfstlb_remove_tabledqb_ihardlimitaer_statsunlocked_ioctluprobekmem_cachenuma_next_scansrcu_last_gp_endioapic_alloc_infoclass_local_lock_irq_is_conditionalproperty_read_int_arrayhv_pci_devices_presentholders_dirMODULE_STATE_UNFORMEDst_value__warn_flushing_systemwide_wqlist_headptrace_bpss_user_nsirq_alloc_info__esiarch_tlbflush_unmap_batchquick_threadsdefer_syncvmbus_close_msgmissedio_delaysum_sleep_runtimed_spc_timerd_ino_hardlimitproc_idchange_cookiedl_periods_dquotwq_flagsfsnotify_sb_inforecent_cida_opsperf_event_listrescind_eventacpi_device_name___GFP_LAST_BITdevfncca_seenhvpci_dom_mapki_completepgprotirq_data_get_effective_affinity_masktimespec_typefind_special_pagedquot_operationsposix_cputimers_workgsbasevmbus_openio_tlb_memseq_showcpusintr_in_fullfileshbusinblocktails_magicdma_alias_maskread_pmcnuma_faultsarch_addr_himem_dqblksubmsglistdevidstatusWRITE_LIFE_NONEread_countwait_for_completion_timeoutHRTIMER_NORESTARTlast_update_timesas_ss_spdpc_rp_log_sizepanel___GFP_ZEROTAGS_BITmax_allowed_capacity___GFP_ACCOUNT_BITnative_pcie_hotplugblock_maskD_REAL_METADATAgpl_crcskeep_devsclass_raw_spinlock_try_is_conditional__must_check_overflowkiocbACPI_DEVICE_SWNODE_EP_LINK_FREQUENCIESVM_PKT_ESTABLISH_GPADLpblk_address___GFP_MEMALLOC_BITirq_startupexecute_only_pkeyprepopulate_barsreturn_instancesacpi_objectma_lockdockcpuset_mem_spread_rotorFORTIFY_FUNC_memmovearch_addr_losync_fssecurebitsCHANNELMSG_GPADL_BODYdentryhigh_baseioremapsequential_iowait_pidfds_writersgroup_stop_countvm_opsdeadpropsioapic_rtepathget_unmapped_areamkobjsym_VDSO32_NOTE_MASKfrozenactive_uprobeget_parentPCI_BUS_D0EXITmin_vruntimel1ssdebug_dirclass_disable_irq_is_conditionalhv_result_successsyscrsyscwnum_bpf_raw_eventspgd_allocki_posavx512_timestamp_find_next_zero_bitdma_rangesfree_cached_objectstaints_Boolacpi_device_software_node_porthv_pci_read_mmiooverflowxol_vaddrlist_lru_nodepci_msi_descuclamp_ses_time_grankuid_tdev_pm_qospci_child_messagedriver_exclusive_resource_sifieldstasksched_reset_on_forkcompound_headnr_retrieswake_irqbranchi_cdev_dev_infoi_fsnotify_marksin_thrashingdl_deferdevfn_to_wslotDOMAIN_BUS_DMARvm_startmprotectquota_ond_automountDEVICE_REMOVABLE_NOT_SUPPORTEDromlenatimecompl_ctxtget_ownershipf_task_workmy_qhv_callback_modeeuidmxcsr_mask_sigfaultclass_rwsem_read_try_is_conditionals_wb_err__q_sizemake_p4dcloseiopl_warnload_gdtpasid_requiredptraceddrop_referencewaiteventWORK_NR_COLORSdonesym___kernel_rt_sigreturnsrcu_struct_ptrsinodesmemcg_awarei_atime_secbar_valqsize_t__fpstatelistentryfind_first_and_bitqf_ownersuspend_noirqd_inamecomparch_local_irq_restorelinks_countprealloc_pterdevd_ino_countprog_intfarg_lockN_NORMAL_MEMORYDEVICE_REMOVABLE_UNKNOWNreq_lockignore_childrenswnodesIRQ_HANDLEDIRQCHIP_STATE_PENDINGfreeze_fsraw_atomic_setactual_typein_eventfdresume_earlyhv_get_drvdatadup_xol_workalimitmsix_capnuma_groupkmap_ctrlfscrypt_operationsrangesfs_contextmnt_idpci_destroy_slotdrop_inodeorc_unwindbroken_parity_statusgraph_get_next_endpointVM_PKT_RM_XFER_PAGESETtasklet_unlock_spin_waitsub_channel_indexkprojid_t__u16x86_msi_addr_hisyscall_dispatchdl_densityon_rqaltmapmin_perf_statesafe_haltrcu_tasks_exit_list__UNIQUE_ID_x_523msi_enabledsp_regirq_calc_masks_master_keysflagsnr_threadsvm_mmACPI_DEVICE_SWNODE_PORT_REG__u32__bitmap_weightrcec_easeq_nextnum_versionhv_device_interrupt_targets_quota_typesvm_lockswizzle_irq_ddebugFAULT_FLAG_ORIG_PTE_VALIDrt_spc_timelimitdelaysf_modetimerqueue_headpercpu_affinityx86_msi_addr_lokioctx_tableksm_rmap_itemsclass_read_lock_is_conditionalptm_capKMALLOC_RECLAIMdmar_subhandle_valid__u64revoked_at_folio_nr_pageswritepageis_dirty_writebackpkey_allocation_mapvmbus_driver_unregisterlink_bwctrldq_iddisable_depthem_perf_statebase_classthread_shstkposix_timerswait_chldexitsas_ss_flagsrom_base_regmonitor_bitsrcu_cblist_invokingiopollbridge_ctlreserved_a1iov_lenlatency_recordacpi_device_powerlow_mmio_spacemsi_capMSI_FLAG_PARENT_PM_DEVreserved_b1reserved_b2d_releasekasan_check_writedestination_iddev_dma_attrexpiresnuma_scan_seqmnt_sbhashnodemask_tsignalfd_wqhhang_detecteddevice_driverHV_CALL_DIRECTread_respfsindexpgd_valraw_spinlock_thigh_sizes_coplimits_active__WQ_DESTROYINGnum_argslast_unhandleds_uuidclear_child_tidruntime_statusdqb_btimedq_opredirect_hintno_command_memoryshow_pathwrite_msi_msggpe_devicedl_serverVTIME_USERquota_disablesched_delayedringbuffer_gpadlhandleWORK_OFFQ_DISABLE_BITSirq_release_resourcessrcu_gp_seq_neededtask_structcurrent_may_mountREFCOUNT_ADD_OVFpushis_noirq_suspendedfwnode_endpointfind_next_bitcounterunique_idsuspendpending_droom_score_adj_minpreserve_configmmap_compat_basedomain_datacopy_file_rangesrcu_gp_startxa_flagsset_fixmapwakeup_preparedtv_nsecmsi_locksas_ss_sizes_incoredqsbyte_countbridge_d3s_inode_list_lockUTASK_SSTEPCHANNELMSG_MODIFYCHANNELhv_msi_get_int_vectortot_countdq_sbwindowss_mountssriov_configurewrite_blkhost_eventacpi_gpio_mappingsym_pvclock_pagehv_compose_msi_msgpage_fragvmbus_sendpacket_getidMSI_DOMAIN_FLAGS_MASKfsuidRPM_REQ_AUTOSUSPENDprocessorread_blkrom_attr_enabledsrcversionmisc_featurestrace_event_callwakeup_sourceis_partially_uptodatepci_sysdataport_propsdl_runtimemay_splitio_uring_cmdread_dqblkrelease_low_mmio__masklow_size__mod_device_table__vmbus__hv_pci_id_tablesrcu_parentsuppliersfile_operationspagesizeselfdirect_completexsavekernel_siginfo_tdquotdpc_capis_preparedpgprotval_tarch_msi_msg_addr_hi_ttrc_holdout_listasync_suspendq_nodeclass_mutex_intr_is_conditionalstrtabpage_freeftopHPROBE_CONSUMEDi_mmapdirty_paused_whenirq_get___GFP_COMP_BITdriver_managed_dmaversionidt_bitsVM_PKT_SYNCHarch_atomic_dec__WQ_BH_ALLOWSget_reference_argsllisthiwater_vmmax_perf_stateMSI_DESC_ALLfreeze_ucountKOBJ_NS_TYPE_NETconsumers_cntrseqirq_set_waketarget_knlimit0limit1pi_blocked_onirq_disablepid_tvmbus_requestorvmemmap_shiftusage__kernel_time64_tsc_creation_callbackACPI_DEVICE_SWNODE_EP_CLOCK_LANESprocessor_arraylink_active_reportingv_idvector_counti_securitydevice_physical_location_panelenvpIRQ_GC_BE_IOactive_memcgElf64_Halfallow_reinitoutboundoffermsgtimer_autosuspendspci_message_typeratelimitsysdatagpadl_softexpiresautosuspend_delaypte_vali_flctxlist_lockvm_faultoptimistic_spin_queuearch_irqs_disabled_flagspermissionDEV_PROP_U16PCI_DELETE_INTERRUPT_MESSAGEpreallocsystem_unbound_wqDEVICE_FIXEDlast_statusxfeatureshv_read_config_complDEV_PROP_U32slice_maxout_full_flagp2pdmaaffinity_notifyIS_ERRthaw_noirqcreation_statusaccounting_timestamppasid_capcan_matchtime_archhlist_bl_headqc_dqblkpasid_activatedhv_ring_buffer_info__fortify_panicPCI_PROTOCOL_VERSION_1_2hv_pcidev_descriptionDOMAIN_BUS_AMDVIarch_datahv_max_vp_index_oldirq_write_msi_msgshrink_controlegidDEV_PROP_U64paramsenvp_idxgate_structhv_pci_onchannelcallback___GFP_NO_OBJ_EXT_BITfeat_pending_send_szfolioruntime_autopref_node_forkclassslotsbus_select_tokenvmbus_gpadlprev_scan_seq_perfprepare_deschardware_idwait_queue_head_tnative_shpc_hotplugFAULT_FLAG_INSTRUCTIONuser_nsCHANNELMSG_UNLOADclass_raw_spinlock_irqsave_is_conditionalsymsthreads_handled_last_flagsacpi_io_addressdevcapsynccallback_moderefcount_warn_saturate__compiletime_assert_109d_childrendmar_formatddebug_class_map__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113chip_types__compiletime_assert_115__compiletime_assert_116__compiletime_assert_117__compiletime_assert_118__compiletime_assert_119prealloc_bufpci_delete_interruptaudit_contextfl_owner_t__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126i_pipe__compiletime_assert_128__compiletime_assert_129d_waitirq_flow_handler_tllist_headcurrent_stategc_flagswait_page_queueFAULT_FLAG_REMOTEvmbus_channel_gpadl_created__compiletime_assert_130dl_bw__compiletime_assert_132__compiletime_assert_133__compiletime_assert_134__compiletime_assert_135__compiletime_assert_136__compiletime_assert_137__compiletime_assert_138pci_device_idi_dir_seqheaderacpi_device_perf_flagswatchdog_stamprefcount_setlist_op_pendingdatasrcu_cb_mutexbroken_intx_maskinghv_pci_start_relations_workacpi_device_wakeupno_callbackssaved_trap_nrclock_listpci_dev_putfolioq_slotpgd_freeMODULE_STATE_GOINGxattr_handlerreciprocal_valuehv_compose_msi_req_v3version_responsedev_instancePCI_RESOURCES_ASSIGNED2class_preempt_notrace_is_conditionaldqb_bhardlimitdelivery_modenextentseventkeytypenr_bankselect__kernel_gid32_tdev_pm_domainhv_pci_assign_slotsmsi_instance_cookieMSI_MAX_DEVICE_IRQDOMAINSlen8exit_mmapuaddr2f_securityreq_addrbridgeirq_domain_opsstart_context_switchclass_raw_spinlock_irq_is_conditionalMSI_FLAG_USE_DEV_FWNODEPCI_BUS_RELATIONS2src1src2rcuwaitattributes_maskdl_defer_runningmake_pgdresourcessrcpia_validflush_tlb_userinstrument_atomic_writesrcu_size_jiffiesclassespasid_featuresstatic_call_sitethread_flagsis_virtfnenumeration_by_parentnotifysubdeviceACPI_DEVICE_SWNODE_DEV_NUM_OFsrcu_unlock_countma_rootregfuncerror_remove_foliopci_stop_and_remove_bus_devicedevice_is_availabled_rt_spc_hardlimitDOMAIN_BUS_FSL_MC_MSIrchari_verity_info_addr_pkeyrw_copyDOMAIN_BUS_VMD_MSIatomic_opendmar_reserved_0__mptrsigactionrlimint_pktsmce_addrf_freeptr__sighandler_trevmap_treeclass_spinlock_try_is_conditionaltasklet_enableDD_CLASS_TYPE_DISJOINT_NAMEShash_len_find_first_and_bitfs_flagsthread_maskvm_filei_countchannels_ksetuser_structaddress_space_operationsFAULT_FLAG_USERkey_perm_tnative_aer__already_donecvm_typetimer_listmake_pmdrun_delayarch_atomic_setnum_ftrace_callsitesmodify_responsesrcu_cblisttlb_ubcpme_supportpgtables_bytesi_lruGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacktrc_ipi_to_cpusubclass__WQ_LEGACYmin_slicemem_configdecryptedsysfs_ops_find_next_bitcmaj_fltset_desckparam_arrayFORTIFY_FUNC_strscpydev_set_msi_domainpercpu_refevict_inodehyperv_pci_block_opspci_walk_busCHANNELMSG_OPENCHANNELthread_keyringlist_delcpumask_ttry_wait_for_completionrb_leftchn_flagsgfp_maskirq_handler_tinactive_timerattributefuzz_testing_message_delaymm_lock_seqhotplugFORTIFY_FUNC_memchrkernfs_elem_symlinkhv_dr_workhv_pcifront_read_configportsMSI_GENERIC_FLAGS_MASK__kernel_dev_tpm_domainpower_removedmake_ptefree_cpumask_varfsgidsector_tactive_low_sys_privatesignal_structactive_mmlink_frequenciesPCI_REENABLEstate_savedkernfs_iattrsmake_pudshow_devnameN_HIGH_MEMORYthread_infoi_mmap_writablereadWORK_OFFQ_DISABLE_SHIFTnum_portssecondarydevicesgroup_exit_codepci_responseFORTIFY_FUNC_memcmpopc1REFCOUNT_SUB_UAFpriv_flagsPCI_QUERY_BUS_RELATIONSclear_retrain_linkexec_maxsync_statedev_groupswrite_blockkernfs_elem_dirport_namepercpu_counteracpi_device_data_printkDOMAIN_BUS_GENERIC_MSIhv_pci_query_relationsreq_idhv_int_desc_freesequential_io_avgptracePROBE_DEFAULT_STRATEGYtrace_bprintk_fmt_startbufferlenUTASK_RUNNINGopenseglenoverride_onlyMSI_FLAG_MUST_REACTIVATEFORTIFY_FUNC_memcpy__kernel_ssize_tvdso_imagesi_signoMSI_DESC_NOTASSOCIATEDrseq_sigrefsdelayed_calltime_slicenr_rangepci_power_tspc_timelimitkasprintfpv_mmu_opsresumeWQ_CPU_INTENSIVEreset_doneregserrorsyscall_user_dispatchdev_messageattrd_aliashv_msi_opsis_suspendeddqio_semspin_unlock_irqrestorerestore_sigmaskpending_maskset_ldtVM_PKT_INVALIDmmio_enabledkcsan_check_accessnr_deferredlist_emptysrcu_sspi_lockep_propsuser_event_mmbtrace_seqpci_create_int_responses_devsiblingacpi_hp_fixupreq_bitmapldt_usr_sem__udelayposix_cputimersRPM_INVALIDfreeze_kcountrequest_key_authblocksrescind_refpercpu_ref_datad_spc_warnssrcu_supfreeptr_tretryns_typepud_valRPM_REQ_NONEixolfree_ldtfasyncarg_startPCI_DELETE_INTERRUPT_MESSAGE2kprobes_text_sizefop_flags_addr_lsbget_pcichild_wslot_addrpfn_mkwriteuaddrKMALLOC_DMAis_dedicated_interruptchild_no_uids_fs_info__rb_parent_colorWRITE_LIFE_EXTREMEicq_listmm_users_pp_mapping_padpriv_highkey_serial_tteardown_packetfolioqiomapcputimernrpageswake_q_nodeMSI_FLAG_NO_AFFINITYinvalidate_context__news_maxbytesioctx_tabledma_io_tlb_memKMALLOC_CGROUPNR_KMALLOC_TYPESwrite_msi_msg_dataexpire_countwake_cpufunctionalvmbus_sendpacket___GFP_DMA_BITfreeze_superDOMAIN_BUS_DEVICE_MSItick_dep_maskof_compatible_okkey_typepci_busqc_infofault_flaghv_devhv_pci_id_tablehonor_depsmodnamepci_function_descriptionia_ctimetrace_eval_maprespasync_put_worknum_static_call_sitesinit_hv_pci_drvvm_lock_seqFORTIFY_FUNC_strncatprimaryElf64_Addrs_fsnotify_maskseqlock_thv_msi_desc2hv_msi_desc3latency_record_countmsi_alloc_info_tmay_skip_resumeVTIME_SYSalloc_tag_countersbase0base1base2block_cfg_accesslinksbasesfutex_staterseq_lenkobj_completiontimers_activei_spc_timelimitf_opresponsenargsbindnative_dpchv_msi_data_registermm_mtgid_trelease_workdevice_id__ret_do_oncercu_read_unlock_specialtls_arrayhv_pcibus_deviceeetlp_prefix_pathtask_io_accountingf_raDEVICE_PANEL_FRONTmodule_memorysitescompat_robust_list_headthread_nodestatic_call_mods_shrinkblock_invalidategp_countbpf_raw_eventsiommutimer_expiresoffset8bpf_storagekset_uevent_opsf_ownerPCI_EJECTION_COMPLETE__state_permIRQ_GC_MASK_CACHE_PER_TYPEsize_resDEVICE_PANEL_BACK_syscallhv_send_resources_allocatedsrcu_lock_countlink_statetrc_blkd_cpugp_waitacpi_bus_address__compiletime_assert_131WORK_OFFQ_FLAG_ENDiommu_mmfuncarch_clear_bitio_uring_task__WQ_DRAININGacpi_handlepri_reqs_allocdest_mode_logicaljit_keyrings_fsnotify_infoconnection_idwrite_cr0functionwrite_cr2write_cr3write_cr4ACPI_DEVICE_SWNODE_EP_REMOTE_EPacpi_bus_idignore_parentprojidmce_kill_mema_external_lockWORK_OFFQ_FLAG_BITStrans_idpid_linksACPI_DEVICE_SWNODE_DEV_NUM_ENTRIESpcie_flags_regs_dio_done_wqread_cr0read_cr2read_cr3desc_ptr__refcount_addq_sizesystem_wqPCI_PROTOCOL_VERSION_1_1intr_out_emptyPCI_PROTOCOL_VERSION_1_3PCI_PROTOCOL_VERSION_1_4ACPI_DEVICE_SWNODE_PORT_NUM_OFhlist_headioc_nodethrottle_diskbin_attrs_newresume_noirqrelease_dqblkFREEZE_HOLDER_USERSPACECHANNELMSG_GPADL_TORNDOWNrunningrw_hintdma_skip_syncDEVICE_VERT_POS_LOWERclass_spinlock_irqsave_is_conditionalutf8dataenter_d0_retryconnection_stateof_node_reuseddyndbg_infonotifier_presentFORTIFY_FUNC_strncpyElf64_Symsaved_config_spaced_rt_spc_softlimitpollhv_eject_device_workfree_file_infoin_lru_faultsched_contributes_to_loadtlb_genexit_d0bitmap_andruntime_idleacs_capmap_countmsi_entrypcie_capi_rt_spc_timelimitqc_type_states_dentry_lrus_bdevcrcsrun_listpci_create_interruptuevent_opssched_classutil_avganon_vma_pidsigcntbar_sizeDD_CLASS_TYPE_LEVEL_NAMESmodinfo_attrsst_spaceclass_map_typekparam_stringd_real_typemaxrsscredkernfs_open_nodehdevf_wb_errmm_cid_active__cpu_online_maskinvalkzalloc_noprofWQ_MEM_RECLAIMmodule_sect_attrsruntime_resumegroup_exec_taskrestrict_linkirq_countget_inode_usagekmalloc_typexarray_startbpf_ctxpm_domain_dataserver_pick_taskcan_masknr_actionsstate_lock__p_size_fieldflush_tlb_infoCHANNEL_OFFER_STATEload_avgcor_error_detectedi_private_lockget_dqblkrequestoroffset_highhv_get_dom_numpgoffporthandlematch_driverfreeze_lated2_support__list_del_entrycount_objectsvma_numab_statedma_map_opsdq_dirtyREFCOUNT_ADD_NOT_ZERO_OVFbus_idwrite_bytesresp_packet_sizepci_host_bridgeoom_reaper_listnumab_statefutex_offsethv_pci_bus_exitirq_chip_mask_parentsubsys_fmt_prefixdq_locksched_lockpte_tnr_scanned__statepci_version_requestslicedrv_groupspci_bus_d0_entryMSI_FLAG_ACTIVATE_EARLYcustom_slicepci_slothotplug_user_indicatorspadding1nestedatomic_write_segments_maxreturn_null_messagenr_dirtied_pausereal_addressinvalidate_lockhv_pci_free_bridge_windowsnum_exentrieswslotirq_domain_alloc_named_fwnodepmdval_tkvecarch_set_bitbacklightset_latency_tolerancedepthirq_ackd_ino_timerprobenetlink_nsdev_uevent__compiletime_assert_241hv_pcibus_installeddep_mappage_mkwriteMSI_FLAG_PCI_MSIX_ALLOC_DYNlast_busymax_vp_indexdomain_free_irqsvm_flags_tres_attrres_reqnr_failed_migrations_affined_in_lookup_hashptrace_dr7reschedule_countmax_hang_timeexternal_facingpv_opsmsi_desc__dummycutimelockrefsize_addringbuffer_pagetlb_flush_batched___GFP_HIGH_BITia_uidautogroupsequencercu_syncarg_endclass_spinlock_irq_is_conditionalhv_pci_read_config_compl_dummy_pkeyvruntimeirq_affinity_desc___GFP_HARDWALL_BITirq_domain_get_irq_databus_flagsnode_statesfeatures_locked__kernel_pid_tPIDTYPE_SIDcinblockmap_irqdcookie__kernel_loff_tnext_request_idset_performance_stateserial_nodeIRQCHIP_STATE_MASKEDstate_remove_uevent_sentnotify_countejectablehprobeswap_activatedqb_isoftlimitsaved_auxvnoinstr_text_sizedl_overruniattrdetachedloff_toom_flag_origindesc_lenoom_score_adj__UNIQUE_ID_license529close_msgwrite_indexVM_PKT_DATA_USING_ADDITIONAL_PKTksm_merging_pagesgraph_parse_endpointrmidbytes_returned_dev_warnN_POSSIBLEdevice_removablefxsavedev_pagemap_opsfull_nametcp_ptr__set_infoFAULT_FLAG_ALLOW_RETRYWRITE_LIFE_NOT_SETd_lockrefpkt_buffer_sizesession_keyringseeks__q_size_fieldd_deleted_ino_softlimitwhered_weak_revalidateexit_hv_pci_drvi_devicesdqb_curspacepci_stop_root_busalloc_lockearly_inittotal_numa_faultswritable_sizeobj_cgroupem_tableread_block__lstatestate_for_enumerationhv_msi_freevmpacket_descriptorinodehrtimeratomic_write_unit_maxFAULT_FLAG_UNSHAREhv_mmio_read_inputtask_sizemust_resumeRPM_ACTIVEend_codehv_dr_statepreempt_notifierstlb_flush_pendingbus_rel2migration_flagsDEVICE_PANEL_RIGHTacpi_device_swnode_ep_propspci_drivercap_inheritableacpi_device_flagskobj_sigval__stack_chk_failsrcu_n_exp_nodelayseqcount_spinlock_tacpi_scan_handleracpi_device_pnppriv_read_indexgraph_get_remote_endpoints_roots__int128 unsignedCHANNELMSG_GPADL_HEADERwait_sumuprobe_xol_opsmin_align_masknextevtringbuffer_pagecountper_channel_statercu_segcblistreported_split_lockpref_windowreturn_instancewait_countconfirm_switchnr_wakeups_affine_attemptspud_ti_ino_warnlimitrmtpnext_offsetmulti_msiacpi_device_idctx_idutaskpoweroff_noirqbroken_cmd_complis_bin_visiblecompat_ioctls_countnr_wakeups_affinefutexauprobeperiod_contribnr_hangsIRQ_GC_INIT_MASK_CACHEcss_setfwnode_handlegfp_tdemand_offlinetype__vpp_verifyqf_fmt_iddevice_classpagethread_fnload_idtatomic_write_unit_minsleep_startmemalloc_noiobegintypetabi_crypt_infovmbus_next_request_idDEVICE_HORI_POS_CENTERaudit_ttyVM_PKT_DATA_USING_GPA_DIRECTmutex_unlockvcpu_is_preemptedjobctlsi_errnopci_dev_inval_blocknr_leaves_on_treesleep_stateHV_PCI_DEVICE_FLAG_NUMA_AFFINITY_sigchlddqb_itimeHPROBE_STABLEquota_format_typeatomic_incpercpu_ref_func_tpm_message_tac_mempprevino_warnlimitmapcountint_descparent_datamnt_flagsac_stimememcg_nr_pages_over_highsw_reservedproc_dir_entrydmar_index_15native_ltrdest_apicidobjcgblock_startvm_area_structnum_gpl_symsvariable_ffz__compiletime_assert_2__compiletime_assert_3paravirt_patch_template__compiletime_assert_5__compiletime_assert_6map_busIRQ_WAKE_THREADlong long unsigned intWRITE_LIFE_MEDIUM__builtin_memcpyhuge_faultpci_msi_mask_irqreq_arri_fopacpi_hp_ueventautasklast_task_numa_placementirqd_cfgmsi_translatefortify_memcpy_chkrefcntdev_propsfreeze_holderqueue_work_onacpi_device_wakeup_flagssubordinatecdevperf_eventkernel_ulong_tnvec_usedunregfuncreserved_0reserved_1seqcountgeneric___set_bitclass_idbitsetlist_lruWORK_STRUCT_LINKED_BITvpsetof_device_idmsgtypebusn_resclass_migrate_is_conditionalsriov_get_vf_total_msixclass_write_lock_is_conditionals_xattricookiestatus_use_accessorsil_prevadd_channel_workd_initmax_slack_shiftdomain_alloc_irqsget_name_prefixhv_devicefileattr_get__kmalloc_noprofpci_get_domain_bus_and_slotclass_groupscpu_next__ret_warn_on__call_single_nodeunicode_mapN_ONLINEpv_cpu_opsmulti_msi_cpu_lockhv_arch_irq_unmaskMSI_FLAG_USE_DEF_CHIP_OPSrecent_used_cpuruntimeno_64bit_msiold_time32_thv_send_resources_releaseddev_flagsspinlock_checkfree_fwnodeX86_IRQ_ALLOC_TYPE_AMDVI__state_sizeunsigned intclass_irqsave_is_conditionalpci_write_blockcore_kallsymsno_suspend_depthis_physfnscan_objectsslotalloc_p4dDD_CLASS_TYPE_DISJOINT_BITSstartupkeyring_index_keyiov_iterd_rcustatic_key_false___GFP_DIRECT_RECLAIM_BITuintptr_tudelaywake_entryrcu_tasks_holdoutpblk_lengthfreezeassoc_array_ptrbatchold_timespec32rcu_blocked_nodeirq_hw_number_tst_namegroup_nodeejct_pkti_mtime_secbus_dma_regionACPI_DEVICE_SWNODE_DEV_FLASH_MAX_MICROAMPdmar_index_0_14legacy_ioac_majfltmce_kflags___GFP_NORETRY_BITFORTIFY_FUNC_memsetmsg_conn_id__oldfree_configscheduledbus_dma_limitubufCHANNELMSG_COUNTbtimep4d_tia_gidltr_pathmigrate_folioalloc_cpumask_varextable_baseblksizenum_symssrcu_gp_seqmmio_basenext_posix_timer_idmsi_basehv_msi_entry_mapcountstarttimerelease_fnreschedule_jiffies__list_delWORK_BUSY_RUNNINGdomain_nrhprobe_statei_sb_listmask_basequota_offshm_clistptm_rootdev_set_drvdatacb_headarch_atomic_incac_flagHV_CALL_BATCHEDpt_regsload_tr_descmmap_missexpires_nextdestination_modedefault_irq___GFP_ZERO_BITnum_trace_bprintk_fmtflush_tlb_kernelDOMAIN_BUS_WAKEUPfoundvmbus_recvpacket_rawwork_structtruelast_queuedri_timercpumask_andpipe_bufsbp_offsetkmalloc_cache_typeacpi_device_classsaved_scratch_registertracepoints_ptrsDOMAIN_BUS_PLATFORM_MSIblock_maxstatic_keymsi_indexFAULT_FLAG_VMA_LOCKdma_range_mapring_size_div10_reciprocalKOBJ_NS_TYPE_NONE_datamsi_domain_cookiepci_ring_sizeFAULT_FLAG_WRITEpci_dev_incomingi_uidexpirybmapACPI_DEVICE_SWNODE_EP_BUS_TYPEIRQCHIP_FWNODE_NAMEDfsavei_write_hintirq_chip_set_affinity_parentsuspended_timeread_bytesaffinitysum_sched_runtimeMSI_FLAG_LEVEL_CAPABLEDOMAIN_BUS_WIREDs_writers_key__UNIQUE_ID_y_524start_boottimepci_bus_flags_tentriesi_modecap_permittedVM_PKT_DATA_USING_GPADL_flags_2astart_codemsix_ctrlirqreturn_tvm_flagssi_codeseqcount_spinlockheadHPROBE_GONElast_siginfoirq_pm_shutdownqueued_spin_unlocksched_rt_entityFAULT_FLAG_TRIEDorig_axsym_vdso32_sigreturn_landing_padexit_signaldevice_dma_parametersdir_contextacpi_device_power_stateiopl_emulconsumersmsi_maskratelimit_statepower_statedq_flagsis_late_suspendedcapture_controlraw_atomic_fetch_sub_releasenodesvirtual_numa_nodeirq_descclass_device_is_conditionalnon_rcuput_supermsi_desc_to_pci_devsuspend_timerdumperunix_inflightrss_stat__kmalloc_large_noprofpkt_sizeFAULT_FLAG_INTERRUPTIBLEsave_fls_inodes_wbignore_hotplugfolio_queuethreads_activedisableinit_fs_contextuprobe_taskACPI_DEVICE_SWNODE_EP_REGreserved1f_mappingpci_create_slotPCI_RESOURCES_ASSIGNEDhvsockstart_stackDL_DEV_PROBINGirqactioni_linkhv_pcibus_maximumwaiting_channelsriovats_enabledstack_vm_aread_hashdl_server_pick_frefcount_dec_and_testtty_old_pgrpst_sizevfsgid_tintegerneed_parent_lockseccomp_filternr_migrationsrm_xquotaorc_entrypci_eject_responsechannel_callback_contextutimemmapmsi_freeupdate_io_bitmapshrinkeralloc_dquotring_sizeforce_resume_depthmappingdl_defer_armedrunnable_sumatomic_fetch_sub_releaseshort unsigned intmaxlenhv_statusdevice_nodeirq_flags_to_clearnew_pcichild_devicepcie_link_statep_size_fieldlong long intsym_vvar_startenable_cntread_indexpci_create_interrupt2pci_create_interrupt3_hugetlb_cgroup_rsvdsival_ptrpercpu_sizemsi_infoalign_resourceuser_defhv_pcibus_probedinvalidate_foliois_vallocclass_pci_dev_is_conditionalhv_mmio_read_outputnum_ctdrop_nsinit_packetWORK_STRUCT_INACTIVE_BITparam_raw_spin_unlock_irqrestoreno_pm_callbackscountd_parentsched_task_groupguidupdate_timepidsof_noderun_nodeinbounddata_source___GFP_UNUSED_BITs_instancesvm_rcuremote_epCHANNELMSG_VERSION_RESPONSEpage_table_locksysv_semquota_infoquota_enable__kernel_timer_tdomain_tagcmaxrssit_real_incrprobestubextable_lenlast_arrivalCHANNELMSG_RELID_RELEASEDswap_rwreservekstatfshv_pci_write_mmioerror_statesrcu_gp_seq_needed_expDEVICE_HORI_POS_RIGHTlist_add_taildirect_IOia_mtimenr_thpspci_scan_child_bussysv_shmsuppress_bind_attrsinsnlenACPI_DEVICE_SWNODE_DEV_FLASH_MAX_TIMEOUT_USirq_fwspec__page_1__page_2WORK_CPU_UNBOUNDgate_desci_mutex_keykey_restrictionquota_writedomainget_linkfree_folioprobed_bardata_lensnprintf___GFP_NOFAIL_BITpower_resourcesaddr1addr2sa_flagscancelled_write_bytestask_worksmm_cidcpumask_first_and_ddebug_infostats_locknum_kpIRQ_GC_NO_MASKinvalidate_io_bitmapipi_send_singleDOMAIN_BUS_TI_SCI_INTA_MSIMEMORY_DEVICE_PRIVATEreinit_completionirq_managedsuper_blockbus_typeget_named_child_nodeassoc_arrayredirection_hintactorkobj_ns_typedeferred_resumelong intcore_nodeCHANNELMSG_INVALIDfeature_bitsmem_dqinfodevnodesaved_sigmaskirq_retriggerMEMORY_DEVICE_PCI_P2PDMAdq_offpinsfree_int_deschv_ioapic_rteis_visibleACPI_DEVICE_SWNODE_EP_NUM_OFuuid_t__kernel_clockid_twritabledqb_bsoftlimitio_window_1kvfork_donetask_cputime_atomicki_waitqra_pagesirq_request_resourcesmmap_compat_legacy_basedevice_dma_supportedVM_PKT_COMPignored_posix_timerspipelockedsival_intia_filearch_local_irq_enableMSI_DEFAULT_DOMAINrequest_pendingdl_server_has_tasks_fkernel_param_opsnotifier_subscriptionsclass_read_lock_irqsave_is_conditionalpri_enabledd_spc_hardlimitcpu_id_startrobust_list_headunsigned charwake_qrethooksnuma_scan_periodsda_is_staticwakeup_pathresult_maskFORTIFY_FUNC_memscanei_funcs__func__num_node_statetableshv_is_hyperv_initializedpipe_inode_inforaw_spinlockktypecls_mskmigration_disabledbytes_recvdRPM_REQ_SUSPENDpgprot_ttracepoint_ptr_tis_inlineres_assignedCHANNELMSG_RESCIND_CHANNELOFFERphysical_locationioapicprimary_channelaffinity_hintp4dval_tPIDTYPE_MAXno_ext_tagssrc1phv_pci_protocol_negotiationwatchersvcpu_bankwait_maxclass_write_lock_irqsave_is_conditionalioveca_flags__nodes_weightpci_function_description2d_dnamenr_migrations_coldmnt_idmappv_irq_opsuse_callbacksrc2p___GFP_FS_BITVM_PKT_CANCEL_REQUESTWORK_OFFQ_LEFTnr_cpu_idsquotactl_opski_iopriosystem_levelhv_free_config_windowsched_remote_wakeuppci_msi_create_irq_domainmemcpyCHANNELMSG_TL_CONNECT_REQUESTtracing_graph_pauseread_itersuspend_latePCI_MESSAGE_MAXIMUMcfg_addri_rwsemis_addedmemory_rangesoftware_node_ref_argsexitCHANNELMSG_INITIATE_CONTACTio_uringchild_ns_typepci_devhv_irq_maskcommit_dqblkclass_local_lock_irqsave_is_conditionalmark_dirtykernfs_opsoom_reaper_timermodule_entire_mapcounterror_injection_entryf_pathstatic_call_siteself64_symvmbus_channel_version_responseunlinkcur_bus_speedcpumask_var_thv_pcibus_removingmsi_domain_opstime64_tdrivers_diri_gidFORTIFY_FUNC_strnlenvirt_destid_8_14dynamic_statusREFCOUNT_DEC_LEAKicq_hintrmdirdq_dqbACPI_DEVICE_SWNODE_DEV_LED_MAX_MICROAMPmemory_failureselectors_mtdmod_kallsymss_typeirq_domain_removevmbus_channel_close_channelremount_fstask_delay_infopi_seX86_IRQ_ALLOC_TYPE_UVsubsystem_vendorin_usePCI_RESOURCES_RELEASEDexplicit_setMIGRATE_SYNC_LIGHTerrseq_ttransparentflush_tlb_one_userid_tablevmbus_packet_typemems_allowed_sequnusedbug_listctxtmax_nr_cidmod_arch_specificIRQCHIP_FWNODE_REALnative_cxl_errorsharebpf_net_context__arch_hweight64__vmbus_driver_registeris_msi_managedftrace_timestampd_ino_warnsalloc_pmdkernfs_elem_attrreset_preparei_ctime_nsecpackagei_private_listbinfmtftrace_sleeptimei_stateno_d3coldrelease_state_lockpcpu_cidcompletion_funcsupported_speedssched_migratedflush_tlb_multichilddup_xol_addrpci_error_handlersPROBE_PREFER_ASYNCHRONOUSrcu_node_entryno_vf_scanfile_system_typeorig_ret_vaddrirq_gc_flagsmmu_notifier_subscriptionshv_compose_msi_req_get_cpudefault_groups__sifieldsinputnr_watchesDL_DEV_DRIVER_BOUNDDOMAIN_BUS_ANYPCI_RESOURCES_ASSIGNED3curr_ret_depthirq_print_chip__fillerdestroy_dquot__task_fpstatefilldir_thv_msi_address_registerget_reserved_spacenew_messageioprioKMALLOC_NORMALcreatedirtied_time_whenstart_scan_seqperf_rdpmc_allowedtarget_cpusym_vdso32_rt_sigreturn_landing_padspinlock_tdq_inuseclass_maskmsi_msginstance_nolist_nodeofflinehv_pci_probedev_pm_infomremapin_memstalltph_enabledpoweroff_latealloc_ptewakeup___GFP_IO_BITcpu_idreferencepushable_tasksdriver_overridetty_audit_bufkernel_cap_tsoftware_nodealloc_pudptm_enabledpbuspci_bus_assign_resourcesIRQ_NONEbpf_funcmems_allowedvmbus_allocate_mmiovmbus_channel_message_headers_inode_lruhotplug_notifyd1_supportdev_prop_typepreparenum_chipsclock_op_might_sleepf_sb_errkick__ai_ptrneed_mbd_namecheck_flagsi_sequencert_prioritykretprobe_instancesiov_basecpus_ptrloadfuncscpu_bitmapshared_gpa_boundary_activeatomic_write_lensaved_tfcfg_sizexa_headdetachhv_read_config_blockirqstatproperty_read_string_arrayget_statereg_blk_invalidatetracepoint_funcd_seqnuma_scan_offsetcpus_allowed_lock_statuslocklinux_binfmtreg_readlirqchip_irq_statemax_lp_indexhv_msi_descnum_symtabexec_update_lockfscrypt_inode_infosplice_readneed_qsnumbersWRITE_LIFE_SHORTsigpendingpi_entrys_inodesarch_local_save_flagsdirtied_whenMIGRATE_ASYNCprepare_countnext_scangsindexcompleteDOMAIN_BUS_WIRED_TO_MSIbitmap_weightwatch_listd_sibVM_PKT_ADDITIONAL_DATAmodule_attributeacpi_hotplug_profileslot_resetpv_lazy_opsin_dpm_listdevice_namewordwork__list_add_valid_or_reportcallbackmultiprocesspending_send_szinput_addressclass_task_lock_is_conditionaltask_groupf_pos_lockshpc_managedX86_IRQ_ALLOC_TYPE_IOAPICstate_use_accessorswrite_endsrcu_barrier_completionpacctirq_mask_ackplatform_idoutput_addresscurr_targetarch_local_irq_savevm_page_protbitmapplist_nodefile_ref_tdqi_max_spc_limitFORTIFY_FUNC_strcatperf_event_contextatomic64_tnoinstr_text_startHRTIMER_RESTARTqueue_workis_thunderbolthv_pci_allocate_bridge_windowsNR_NODE_STATESstack_canaryptep_modify_prot_start_utime__fortify_size_flags_1_flags_2__ptrtaskstatshv_pci_devices_present2ring_datasizeMSI_FLAG_MSIX_CONTIGUOUSvp_setinit_dev_msi_infoposix_acli_dio_countacpi_device_software_nodes__UNIQUE_ID_description528outputarch_rwlock_taddend1addend2driverpropertysym_timens_pagewaitersoffsethv_pci_suspendparent_irqdev_iommumap_typeclass_rwsem_read_intr_is_conditionalmsi_initcompletionnode_stampclass_raw_spinlock_nested_is_conditionalfiemaprcu_userspci_remove_root_busvmbus_free_mmiobacking_dev_infoi_mappinghv_tdx_hypercallshow_stats_reshv_hypercall_pgs_vfs_rename_keyetypehv_write_config_blockhyperv_pcpu_input_argi_bytes___GFP_WRITE_BITnormal_prioWQ_UNBOUNDofferirq_data_get_irq_chip_datasrcu_nodeconfig_rrs_svlast_mm_cidhv_pci_complhdr_lenis_busmastervaddrerr_handleris_softgrab_current_nsCHANNELMSG_TL_CONNECT_RESULTclass_namestranslatelock_class_keymsglistentrysum_exec_runtimecompatiblesetupdev_pin_infopoll_table_structmce_whole_pageis_relia_modercu_tasks_holdout_listsched_rt_mutexpower_manageables_pinsrenameirq_basektime_tonstackirq_chip_unmask_parentPRJQUOTAkprobe_blacklistjump_entriesdio_offset_alignwslot_res_allocatedptep_modify_prot_commitdma_masksa_restorerdatalenmkdirnextrelax_countrestore_earlyPIDTYPE_TGIDilendevice_physical_location_horizontal_positionVM_PKT_DATA_INBAND__list_addkobj_uevent_env___GFP_MOVABLE_BITkprobes_text_startpid_typelane_polaritiesfown_structwrite_idt_entryi_default_aclfregs_statehv_pci_get_root_domainFORTIFY_FUNC_strcpypendingopen_resultmsi_post_freeint_pktnr_eventskstatanon_vma_namedq_hash__iovgp_stategrphintabiommu_mm_dataVM_PKT_TEARDOWN_GPADLma_flagsarch_uprobeDL_DEV_UNBINDINGpci_pktKMALLOC_RANDOM_ENDrefcountmmap_lockwake_depthrelease_p4dprobe_donesrcu_reader_flavortimerqueue_nodereal_parentdev_msi_infoiov_offsetnotify_page_enc_status_changednr_cpus_allowedlow_uint32rt_mutex_waitermmio_always_onlegacy_mempage_pooldq_dqb_lockf_flagsflush_requiredattributesgrploreg_basekgid_terror_detectedkey_userpci_channel_state_treadlinkoffline_disabledd_comparei_wb_frn_winnerqspinlock__compiletime_assert_451sighand_structirq_alloc_typeirq_maskstart_brkqueued_spin_lock_slowpathchild_reliddio_completelocked_pendingirq_cfgpci_messages_idcore_statemonitoridalignsym_int80_landing_padngroupspme_pollbytes_requestedsp_offset__sigrestore_tRPM_SUSPENDEDsystem_highpri_wqMSI_FLAG_PCI_MSI_MASK_PARENTmutexattrsfsbasesrcu_barrier_mutexswregs_state__kernel_timespecWQ_HIGHPRId_lruraw_atomic_decd_fieldmaskcountersfaults_disabled_mappingnameidatapci_packetCHANNEL_OPENED_STATEpoweroffuntrustedmsi_attriblazy_modeelemsizerlim_curget_bar_sizeFORTIFY_FUNC_memchr_invfortify_memset_chkkey_tagirq_data_get_msi_descpipe_modereadbreadldebugfs_entrywait__list_add_validreadwst_shndxgpadl_torndownreservedirq_domain_bus_tokeni_wb_frn_historyparavisor_presentprocess_keyringset_dqblkirq_bus_lockrestart_blocks_opkobjectposix_cputimer_basepci_unlock_rescan_removemask_cacheleveluser_definedrequest_mutexcow_page__warn_printknanosleepmessagefalsemultiplepi_state_listtv_secac_exitcodeirq_cntsuidKMALLOC_RANDOM_STARTN_MEMORYpropertiesdismissi_hashmm_cid_next_scansrcp1srcp2freeze_noirqoublockia_atime_timerhotplug_slothost_datavm_private_dataDOMAIN_BUS_IPIwork_bitsirq_set_vcpu_affinitymask_posmsi_next_descdq_freerootfind_next_and_bitpolicycpu_basesize_mulpresentcap_bsetVM_PKT_ADD_XFER_PAGESETnr_itemsseq_startbp_regrb_root_cachedwritebcpuidwriteli_blkbitswritervm_pgoffwritew_refcountbin_attributemath_emu_infopushable_dl_taskstestsched_infogroup_infoproperty_entrytailsdqi_fmt_idsoftirq_next_timerrevisionis_child_subreaperexit_codefile_lock_contextwriteback_indexfiemap_extent_infopci_lock_rescan_removefilert_spc_warnlimitget_debugregtimer__empty_rangesdev_namei387__p_sizehv_do_hypercallnew_descparavirt_callee_saveWORK_OFFQ_POOL_SHIFTd3hot_delaynodeptrswb_err__ecxpld_crc_hv_pcifront_read_configwrite_dquotf_llisturing_cmd_iopollpudval_tpi_state_cachestore__UNIQUE_ID___addressable_init_module526st_infodescsdqi_max_ino_limitllseekiobase__edilocal_fwnodeRPM_SUSPENDINGclass_raw_spinlock_irqsave_try_is_conditionalinaccessibleno_d1d2get_projidversion_reqarch___set_bitacpi_pnp_typecnvcswmsix_basecallsHV_INTERRUPT_SOURCE_IOAPICkqidmem_cgroupfree_inodesiglockperf_recursionnr_wakeups_remotedev_idd_spacei_ctime_secdebugfs_idnext_timer_typeTT_NATIVEcomp_pktq_res_reqhlist_bl_nodenum_descs_head_1_head_2clockiddevice_count__read_overflow2_fieldcpu_maskFREEZE_MAY_NESTsym_hvclock_pageremap_file_rangemsi_unlock_descsmmap_legacy_baseend_dataxa_lockfutex_exit_mutexiommu_groupDOMAIN_BUS_PCI_DEVICE_MSIpci_add_resourcedevice_get_dma_attralloc_inodepayloaddirty_foliovmbus_closeMSI_FLAG_MULTI_PCI_MSIfscrypt_keyringmsi_desc_filteris_hardasync_sizetrap_nrdstpconfig_lockres_assigned2f_iocb_flagshweight_long__flagsmultifunctiontotal_vmhv_pcie_init_irq_domainiteratorqf_opsforce_atomicskip_bus_pmCHANNELMSG_OFFERCHANNELreal_credblkcnt_td_rt_spacesigned charhv_pci_enter_d0deactivatepcie_cap_lockhas_child_subreapermountmsi_domain_idsres_attr_wcsched_entitydev_links_infopci_devices_present_works_uuid_len___GFP_RETRY_MAYFAIL_BITacpi_device_wakeup_contextdqi_privINIT_LIST_HEADfmode_tsweventremove_busactivatefxregs_statewrite_msr__bad_udelay_loweroffset_middlepaddingDEVICE_REMOVABLEget_hwirqphys_basellist_nodebpf_run_ctxread_msrCHANNELMSG_GPADL_CREATEDstate_add_uevent_sentsc_listenv_startmodule_notes_attrsio_cqsystem_freezable_wqunbindDOMAIN_BUS_NEXUSrangebvecacct_vm_mem1on_cpuPCI_QUERY_PROTOCOL_VERSIONsubnodesstringatomic_fetch_add_relaxednuma_preferred_nidwait_for_responsevmem_altmaprevmapresend_nodewait_startbus_relspinlocksrcu_barrier_seqi_aclptm_granularitycoherent_dmacommonnofaultq_size_fieldpteval_twrite_msr_safeDEVICE_PANEL_LEFTorc_unwind_ipis_levelrel_deadlinekobj_typesb_writersdma_cleanupdriver_dataphys_addr_tirq_get_irqchip_statedma_iommuvalidirq_safeMEMORY_DEVICE_GENERICdefault_timer_slack_nsxregs_states_state_deferred_listset_child_tidbio_vecacpi_match_tablenfdsrlimitX86_IRQ_ALLOC_TYPE_DMARsize_windows___set_bit__list_del_entry_valid_or_reportiteridle_notificationmodule_stateWORK_OFFQ_FLAG_SHIFTignore_reset_delayscan_dependentwait_lockf_pipewrite_iterD_REAL_DATAprocessor_countacct_timexpdclock_mutex__phys_addr_nodebugnr_failed_migrations_runningcompletion_statususerfaultfd_ctxpkt_bufferthread_structoldpmm_context_tvmbus_channel_msginfodio_mem_alignIRQCHIP_STATE_LINE_LEVELcstimePCI_QUERY_RESOURCE_REQUIREMENTSatomic_long_trpm_requestirq_reroute_variant__refcount_incpci_srioviounmapio_comp_batchf_credtrace_eventsd_iputacpi_hotplug_contextnr_wakeups_syncstackset_p4dblockedirq_get_irq_datamce_countweightblk_plugtrc_reader_nestingarch_local_irq_disablefpstatedmar_subhandleis_roxprevseqcount_raw_spinlockinstrument_atomic_read_writepci_device_description_flagsmsi_lock_descsnum_orcsFORTIFY_FUNC_kmemdupbuflenringbuffer_send_offsetWRITE_LIFE_LONGcpumask_next_wrapari_enabledexpiry_activemtd_infoas_uint32MSI_FLAG_USE_DEF_DOM_OPSis_confidentialPCI_QUERY_RESOURCE_RESOURCESi_dentryfixupswq_misc_constsvm_endvm_structmemcgfsyncsgidcompat_robust_listnuma_workirq_chippriowait_for_threadsprivvalueacpi_device_dirhv_pcibus_statehv_resultcurrent_stack_pointerq_resource_requirementsac_minflt_hugetlb_cgroupset_policythreadas_uint64ftrace_callsiteslow_latencymmlistusecpage_typeclass_spinlock_is_conditionalnext_request_id_callbackarch_msi_msg_addr_lo_tusermynodeseq_stopWORK_BUSY_PENDINGalloc_workqueueactionpi_waitersirq_resumedoe_mbspower_resourcemsi_domainremote_irratomic_tpcp_listhigh_uint32PCI_WRITE_BLOCKrequired_flagsrb_rootsubsystem_deviceutf8data_tableexe_filePCI_CREATE_INTERRUPT_MESSAGErelease_pmddevice_objuid_telementspointerd_fsdatakey_restrict_link_func_tepoll_watchespm_subsys_datairq_common_datadef_flagssrcu_n_lock_retriesraw_locksrcu_structthis_cpu_offsegmentis_guestwslot_to_devfnsplice_eofs_sync_lockanon_vma_chaini_mtime_nsecu16_datarseq_event_maskem_pdi_fsnotify_maskshared_pending__int128__mce_reservedwriteback_controlmm_struct__restorefn_ttrc_blkd_nodebuild_idwbinvds_export_opvcpulen_descWQ_SYSFSanon_namesched_dl_entitypp_ref_countactivest_otherlinelinkstart_timekernfs_nodedev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchreschedule_countvfsmountextable_basenoinstr_text_sizeattributesset_child_tid_overruntmpfilercu_read_lock_nestingtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugrefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tUTF8_NMAXfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqia_vfsgidsize_tcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workatomic_long_tpreallocclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicdelayed_callmax_nr_cid_statusd_sibbin_attributepercpu_counternuma_pages_migratedgsindexexpires_nexti_io_listf_epsrcu_barrier_seqreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tHRTIMER_BASE_BOOTTIMEclass_srcu_is_conditionalnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionHRTIMER_BASE_REALTIME_SOFTstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registers_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrstate_in_sysfstty_structUTASK_SSTEP_TRAPPEDbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollnr_wakeups_idleio_cqelf64_symlatch_tree_nodedestroy_work__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerma_external_lockuid_tflush_requiredsum_block_runtimepgmapdq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditional_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitnuma_groupdescriptionclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinei_inodyndbg_infoindexthread_headmap_typef_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_len__UNIQUE_ID_alias473HRTIMER_RESTARTMOD_MEM_NUM_TYPESsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxcpu_basedquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_events_sys_privateUTF8_NFDIinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authHRTIMER_BASE_TAIvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherscompletionsw_reservedUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treequota_onvm_operations_structbin_attrs_newiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdatanrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupwake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlinedup_xol_worktotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramd_spc_softlimitreported_split_lockgfp_tseccomp_filterstimei_mmapthaw_superd_lrusignal_structperf_event_mutexcrcspgdval_tSB_FREEZE_WRITEsetattrf_mappingnoinstr_text_startbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activei_opldt_usr_semkobj_ns_type_operationsDQST_FREE_DQUOTSseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tis_dirty_writebacktrace_bprintk_fmt_startkstatfssitesptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutex_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupseqcount_spinlock_ti_wbclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedpagetrc_holdout_listget_inode_usagenormal_priodestroy_inoderelease_folioi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inameHRTIMER_BASE_MONOTONIC_SOFTi_mappinginblockrmidrseq_siglimit0limit1dqi_max_ino_limitmigrate_modeftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksd_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrDQST_SYNCSstack_vm_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalcg_listsrcu_barrier_completionrw_semaphoremnt_sb_ddebuginfofiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypeinit_modulemembarrier_statepage_poolinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_mempathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwrcu_syncvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstateueventlock_countrefcount_tplugsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttableslist_headtgidwrite_protect_seqcompat_robust_list_head_tids_inode_wblist_lockend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutask__UNIQUE_ID_srcversion474sched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextgpl_symsseq_showswait_queue_headblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfds_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceobjcgnodeDQST_READSvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvstatic_prioshrinkerdl_yieldeddqi_formatexec_update_lockDQF_PRIVATEDQF_SYS_FILE_Bl1d_flush_killi_versionprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symboltv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskSB_FREEZE_PAGEFAULTactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlock__rcu_headmce_vaddrquota_offdq_inusedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmod_tree_nodef_sb_errwritepagecodegtimesigactionclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listktypelockrefsrcu_struct_ptrsmm_structvlagi_uidspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesvm_mmmod_mem_typedebugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipMOD_INIT_RODATAqc_dqblkmmappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCi_write_hintfxsaveprocess_keyringlist_op_pendingllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyioveci_private_lockVTIME_IDLEstatic_keys_magicdl_overrunDQST_ALLOC_DQUOTSd_parentpayloadac_minflti_sbd_sbcommPIDTYPE_PIDatomic_write_segments_maxatomic_openreadahead_control__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupblockedi_securitystats_lockD_REAL_DATApt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colorbitsiopriocap_inheritablegp_waitlookupDD_CLASS_TYPE_LEVEL_NAMESvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vec__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATElf64_Symd_automountparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcestack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkDQST_CACHE_HITScmaxrsstimer_slack_nspolicysharedd_real_typelookahead_bandseq_startraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamerun_delaytailslinenoget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseattrscpumask_tswregs_statedqb_isoftlimitorig_axsched_rt_entitytimerqueue_nodeil_weightmem_dqblknr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pause_sigchldreservedlatency_record_countcgroupsprev_scan_seq_DQST_DQSTAT_LASTrcu_usersoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockUTF8_NFDICFcpu_bitmapstatic_call_keyutil_estucountsMOD_RODATAqc_statesoftirq_next_timercheck_flagsswp_entry_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aMOD_INVALIDmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalautogroupnr_threads__i_nlinkpushdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magicfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsMOD_INIT_DATAnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_infoshared_pendingi_gidmin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idHRTIMER_MAX_CLOCK_BASESkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsxa_flagsbin_sizegrphid_spc_timerjump_entriesassoc_array_ptrsuper_block_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_array__UNIQUE_ID_depends472mnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpref_node_fork__int128dqi_privrss_statmems_allowed_seqrefcntD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxresult_maskdquot_operationsmappinggrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizescheduledclass_raw_spinlock_nested_is_conditionalworker_privateis_relqstrma_flagsfutex_stateHRTIMER_BASE_TAI_SOFTacct_timexpd__rcu_icq_cacheDQST_WRITESsizef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tdl_server_has_tasks_frunnable_sumreal_credepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgcstimecfs_rq_uidst_spacemm_cid_next_scanac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysMOD_TEXTdqb_curinodesload__s8invalidate_lock_keyprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_marksdio_mem_alignbtime__u8is_roxlockrlim_maxruntime_deferred_listd_waitlist_lru_oneseq_stopkiocbclass_rwsem_read_intr_is_conditionalfsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeshrinker_idrootoom_reaper_listsym_VDSO32_NOTE_MASKbpf_storage__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingfsindexshstksrcu_ssp__page_1__page_2__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEi_sequencedqb_ihardlimitd_lockrefnum_bpf_raw_eventsaddr_perfi_dir_seqkqidKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typef_iocb_flagscmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagshrtimer_base_typestart_boottimevm_starts_flagsiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listhrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendings_listdqb_rsvspaceversionserialalloc_locks_dquotfolioqprev_posseqcount_spinlocks_umountis_bin_visiblesyscall_user_dispatchrcu_tasks_exit_listia_uidchildrenrb_subtree_lastbuild_idvfork_donenanosleeprt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelayquotalenf_pipei_wb_frn_historylast_wakeenextarch_spinlock_ti_mtime_nsecmmlistutf8_normalizationset_dqblkreg_offsetgsbases_quota_typesf_llisti_nlinkwrite_beginpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedHRTIMER_BASE_BOOTTIME_SOFTfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tquota_enablesched_avgntabmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextprealloc_bufprojiddrop_inodenum_trace_evalsllseeknext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeunfreeze_fsintervallast_mm_cidcookietargeta_flagstrace_overrunsession_keyringfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributerestrict_linkMOD_DATAi_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackloff_tthread_pidsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringma_locksched_delayedmodule_statelast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimemigrate_from_cpusrcu_barrier_mutexi_private_dataElf64_Halfnsproxyxol_areacleanup_modulerlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_datasignumfscrypt_keyrings_mountsuse_memdelay__state_sizethread_structcached_requested_keyenvpctimereleasesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_datasysv_semanon_vma_namefileattrDQST_DROPSlong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionali_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_ts_iflagsmce_kflagstotal_numa_faultss_countd_revalidates_opsysv_shmdq_countutf8data_tablefoliowake_entryxa_headsuidi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_lockiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_t_flagsnotify_nextshort intmynodeclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_ownerbp_regVTIME_USERsa_flagstesti_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivaltrace_event_callis_guestpoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keyGRPQUOTAi_private_listia_validi_rcuHRTIMER_BASE_REALTIMEi_atime_secqc_type_statekey_serial_tsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsi_wb_listxarray_startfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectordefault_timer_slack_nssource_listswap_readahead_info__fpstateactive_refgroup_infovdso_imagefile__user_state_sizemce_kill_meuuid_tcount_objects_stimezone_device_dataf_wb_errdefparamfred_cskprojid_tptracer_credtlb_genstorekobjectaudit_ttymce_ripvstatfsnumab_statefeatureson_listkgid_ton_cpufregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisti_mmap_rwsemwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadd_realexpiry_activedqi_max_spc_limitexception_table_entryfallocateHRTIMER_BASE_MONOTONICi_spc_warnlimitbuddy_listi_ino_timelimitSB_FREEZE_FSi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infotracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevfs_structclockiduint32_targ_startblocksset_infofileattr_getvectortimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrrenamevm_area_structsb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextiommu_mmcutimepersonalityget_statetask_sizes_inodes_addrbinfmtsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filercu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataki_posexecute_only_pkeysetleasepacct_structlong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typein_iowaitunregfuncegiddq_hashput_superMOD_INIT_TEXTpushable_dl_tasksf_flagsf_inodemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infoTT_NONEVTIME_INACTIVEcancelled_write_bytessrcu_usagebitmapmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_cold__UNIQUE_ID_name470ssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenDQST_LOOKUPSclass_spinlock_irq_try_is_conditionaloom_mmsrcu_reader_flavortv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idsrcu_structrlim_curnofaultmm_countSB_FREEZE_COMPLETEstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infodatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountki_filpcap_ambientatomic64_tanon_vmarlimread_folionr_eventsprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keysrcu_gp_startopenit_real_incrmodert_prioritymm_lock_seq__UNIQUE_ID_intree471KMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksrb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionexit_statesysvsemMOD_RO_AFTER_INITDQF_ROOT_SQUASH_Bfs_supersSB_UNFROZENdqb_bsoftlimitpendingf_task_workiowait_countstringread_countfutex_offsetlong long intatomic_flagssysvshmtrace_evalsactive_basessecurityxmm_spacef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesclass_rwsem_read_intr_is_conditionalclass_mutex_is_conditionalclass_preempt_notrace_is_conditionalMOD_INIT_RODATAMOD_TEXTclass_srcu_is_conditional_nameclass_rcu_is_conditionalclass_migrate_is_conditionallong long unsigned intNR_KMALLOC_TYPESclass_rwsem_read_is_conditionallong long intsigned charPIDTYPE_SIDclass_preempt_is_conditionalElf32_Wordorc_headerPIDTYPE_TGIDlong intclass_raw_spinlock_irq_is_conditional_descclass_local_lock_nested_bh_is_conditionalHRTIMER_BASE_MONOTONIC_SOFT__UNIQUE_ID_retpoline471class_rwsem_read_try_is_conditionalUTF8_NFDIDQST_LOOKUPSclass_spinlock_irqsave_is_conditionalclass_spinlock_try_is_conditionalclass_local_lock_is_conditionalhrtimer_base_typeMOD_RO_AFTER_INITn_descsz__u8DQST_ALLOC_DQUOTSSB_FREEZE_FSKMALLOC_NORMALDQST_WRITESunsigned int__int128class_irqsave_is_conditionalHRTIMER_BASE_REALTIMElong unsigned int__u32HRTIMER_MAX_CLOCK_BASESclass_spinlock_irqsave_try_is_conditionalclass_spinlock_is_conditionalshort unsigned intHRTIMER_BASE_TAIclass_local_lock_irqsave_is_conditionalclass_read_lock_is_conditionalelf32_noteboolDQST_DROPSclass_local_lock_irq_is_conditionalMOD_RODATAKMALLOC_CGROUPclass_rwsem_write_is_conditionalclass_spinlock_irq_try_is_conditionalclass_spinlock_irq_is_conditionalclass_write_lock_is_conditionaln_typeMOD_DATAclass_write_lock_irqsave_is_conditionalHRTIMER_BASE_BOOTTIMEn_nameszSB_FREEZE_COMPLETESB_FREEZE_WRITEclass_raw_spinlock_nested_is_conditionalMOD_MEM_NUM_TYPESDQST_SYNCSDQST_FREE_DQUOTSmod_mem_typeHRTIMER_BASE_MONOTONICclass_mutex_intr_is_conditionalclass_task_lock_is_conditionalUTF8_NMAX_nhdrPIDTYPE_PGID_Boolunsigned charKMALLOC_RECLAIMHRTIMER_BASE_BOOTTIME_SOFTcurrent_stack_pointershort int_note_18_note_19utf8_normalizationKMALLOC_RANDOM_STARTDQST_CACHE_HITSclass_irq_is_conditionalDQF_PRIVATEPIDTYPE_PIDDQST_READSMOD_INIT_DATAclass_raw_spinlock_try_is_conditionalclass_raw_spinlock_irqsave_is_conditionalPIDTYPE_MAXcharGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackSB_FREEZE_PAGEFAULTUTF8_NFDICFclass_mutex_try_is_conditional_DQST_DQSTAT_LASTclass_write_lock_irq_is_conditionalKMALLOC_RANDOM_ENDMOD_INIT_TEXTclass_raw_spinlock_irqsave_try_is_conditionalpid_typeHRTIMER_BASE_REALTIME_SOFTKMALLOC_DMAclass_read_lock_irq_is_conditionalHRTIMER_BASE_TAI_SOFTSB_UNFROZENclass_raw_spinlock_is_conditionalkmalloc_cache_typeclass_read_lock_irqsave_is_conditionalclass_rwsem_write_try_is_conditionalDQF_SYS_FILE_Bclass_raw_spinlock_irq_try_is_conditionalDQF_ROOT_SQUASH_B__UNIQUE_ID_vermagic470__int128 unsignedMOD_INVALID/home/thomas/Documents/kernels/stagingdrivers/pci/controller/pci-hyperv.c/home/thomas/Documents/kernels/stagingdrivers/pci/controller./include/asm-generic/bitops./arch/x86/include/asm./include/linux./include/asm-generic./include/linux/atomic./include/uapi/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/acpipci-hyperv.cpci-hyperv.cinstrumented-atomic.hbitops.hfortify-string.herr.hmshyperv.hio.hpage_64.hmshyperv.hspinlock.hcompletion.hdevice.hhyperv.hioport.hirq.hparavirt.hirqflags.hcpumask.hbitmap.hinstrumented-non-atomic.hfind.hrefcount.hatomic-instrumented.hatomic-arch-fallback.hatomic.hslab.hlist.hworkqueue.hinterrupt.hnodemask.hbitops.harch_hweight.hoverflow.hdelay.hirqdomain.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hasm.hinit.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.htime64.htime_types.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hpercpu.hsched.hparavirt_types.hprocessor.hcpumask_types.hmath_emu.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hof.hfwnode.hirqreturn.hmsi_api.hpci.hpci.hacpi_bus.hproperty.hdelay.hirqhandler.hirqdesc.hmsi.hhw_irq.hirqdomain_defs.hirqdomain.hmsi.hreciprocal_div.hhyperv-tlfs.hhyperv-tlfs.hactypes.hsprintf.hnuma.hdev_printk.hspinlock_api_smp.hinstrumented.hgeneric-non-atomic.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/pci/controller/pci-hyperv.mod.c/home/thomas/Documents/kernels/stagingdrivers/pci/controller./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/schedpci-hyperv.mod.cint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hirqflags.htypes.hshstk.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hquota.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hpci-hyperv.mod.c/home/thomas/Documents/kernels/stagingscripts/module-common.c/home/thomas/Documents/kernels/stagingscripts./include/uapi/asm-generic./include/linux./include/linux/sched./include/uapi/linux./arch/x86/include/asm./include/asm-genericmodule-common.cint-ll64.htypes.hirqflags.hpreempt.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hpid_types.hhrtimer_defs.hslab.hunicode.hquota.hquota.hfs.helf.hmodule.hasm.hmodule-common.cint-ll64.hGCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910x _,FC E E $GJs E $,;JC I X H LGIB A(A0DH 0A(A BBBE $H,ZJFa AE TBDD  ABE V ABE G DBE 4`GDD  ABE , GGIt GBI B(D0D8FH~ 8A0A(B BBBE | 8G0A(B BBBE DHH8H0A(B BBBtGEJ D(J0z (A BBBE H (A BBBE I(A BBB4 0A(G EEIGEE E(A0A8JHI 8L0A(B BBBE  8G0A(B BBBE P 8A0A(B BBBE D 8L0A(B BBBE X8L0A(B BBBDHH8H0A(B BBB\GBB B(A0C8Dxi 8A0A(B BBBE $0J[ E A,D'GPA A(GX (C ABBE $X,vFW S A\5KBB B(A0A8G 8D0A(B BBBE $C3T GBB B(A0D8DH 8A0A(B BBBE $H\KBB B(A0E8D`l 8A0A(B BBBE \GEB B(I0I8Dxr 8D0A(B BBBE $wxLGIB D(G0g (A BBBE dJGBB B(A0A8DPt 8A0A(B BBBE $,JAz AE <?KBD A(u  ABBE ,SJDx AE <GBA A(w ABBLhKIH C(o  ABBE A FBBLhKIH C(o  ABBE A FBBTKAF P ABE A ABE ADB\GBB B(A0A8D 8A0A(B BBBE $6\KLB B(A0A8D` 8A0A(B BBBE $`DIJH BZ BBBBBA E , <JAN AE i AE \yGHB B(A0A8Dh' 8D0A(B BBBE $hLfKPI A(D8_@F8^ (C ABBE tKDF B(A0A8J@HF@n 8C0A(B BBBE KHb@HHq@LHe@$@\KJE E(A0A8D 8A0A(B BBBE $=\KBB B(A0A8M 8A0A(B BBBE $=\KBB B(A0A8DE 8A0A(B BBBE $:    !"#%'(*,.0134679;=?@ABC _3 ( + `5F 7 SEZ@q G$;9$Zp p`R>,  iZL x c   P 0  ,  '30  v ` 5C 3 0 0 b @9R Pm 23w  JS  ? P- hd phe w h6   P%I3(0 + `,yu -f p/3(((8( PC((Se==0: ,P,, , `,,!. ,9P F`,Q,\,gt@,,,,0`,, ,P, ,% ,0P=`,H,S,^j@,t,~,,0`,, ,P  ,  ,  @ ,p " ,, 8 ,B@ ,L ,V ,` ,j@ ,t ,~*, 0...,.9. F.(S.0`.8m.@z.H.P.X.`.h.p.x.....!./.=.K.Y.g.u.......... .(.0.8+.@98?T0kp` `& F ] |  @      P   *  L @g   p    @" A `_ q p   @% + P, - `/% P5@ 7\ 09{     '# J- w!   ( 8  Q 5i !r !{ "       %6H1V_hv'i ,(5Ofv_'1Jem~$-8K\p 6Gc x 0!1ELUhx6E_rL3KXlpci-hyperv.chvpci_dom_mapq_resource_requirements.coldhv_pci_assign_slots.coldhv_pci_write_mmio.cold_hv_pcifront_write_config.coldhv_pci_read_mmio.cold_hv_pcifront_read_config.cold__key.85__print_once.45hv_pci_query_relations.coldhv_irq_unmask.cold__func__.130hv_pci_start_relations_work.coldhv_pci_protocol_negotiation.coldhv_pci_bus_exit.coldhv_send_resources_allocated.coldhv_pci_onchannelcallback.coldmulti_msi_cpu_lock.121cpu_next.122__print_once.30hv_compose_msi_msg.coldhv_pci_enter_d0.cold__key.123pci_protocol_versionshv_msi_irq_chiphv_msi_opshv_pcifront_opshv_pci_probe.coldhv_read_config_block.coldhv_write_config_block.coldpci_devices_present_work.cold__func__.139_entry.138__func__.137_entry.136__func__.135_entry.134_entry.133_entry.132_entry.131__func__.129_entry.128__func__.127_entry.126_entry.125_entry.124__func__.120_entry.119_entry.118_entry.117_entry.116__func__.115_entry.114__func__.113_entry.112__func__.111_entry.110__func__.109_entry.108__func__.107_entry.106__func__.105_entry.104__func__.103_entry.102_entry.101_entry.100__func__.99_entry.98_entry.97_entry.96_entry.95__func__.94_entry.93__func__.91_entry.90__func__.89_entry.88__func__.87_entry.86__func__.84_entry.83__func__.82_entry.81__func__.80_entry.79__func__.77_entry.76_entry.75_entry.74_entry.73_entry.72_entry.71_entry.70__UNIQUE_ID_license529__UNIQUE_ID_description528__UNIQUE_ID___addressable_cleanup_module527__UNIQUE_ID___addressable_init_module526_entry_ptr.0_entry_ptr.1_entry_ptr.2_entry_ptr.3_entry_ptr.4_entry_ptr.5_entry_ptr.6_entry_ptr.7_entry_ptr.8_entry_ptr.9_entry_ptr.10_entry_ptr.11_entry_ptr.12_entry_ptr.13_entry_ptr.14_entry_ptr.15_entry_ptr.16_entry_ptr.17_entry_ptr.18_entry_ptr.19_entry_ptr.20_entry_ptr.21_entry_ptr.22_entry_ptr.23_entry_ptr.24_entry_ptr.25_entry_ptr.26_entry_ptr.27_entry_ptr.28_entry_ptr.29_entry_ptr.31_entry_ptr.32_entry_ptr.33_entry_ptr.35_entry_ptr.37_entry_ptr.38_entry_ptr.42_entry_ptr.43_entry_ptr.44_entry_ptr.46_entry_ptr.47.LC46__pfx_hv_put_dom_num__pfx_hv_int_desc_free__pfx_q_resource_requirements__pfx_hv_pci_generic_compl__pfx_hv_pci_compose_compl__pfx_hv_pci_assign_slots__pfx_hv_pci_read_config_compl__pfx_hv_do_hypercall__pfx_hv_pci_write_mmio__pfx__hv_pcifront_write_config__pfx_hv_pci_read_mmio__pfx__hv_pcifront_read_config__pfx_prepopulate_bars__pfx_hv_irq_mask__pfx_hv_pci_query_relations__pfx_hv_pci_free_bridge_windows__pfx_hv_irq_unmask__pfx_put_pcichild__pfx_hv_pci_write_config_compl__pfx_hv_pci_start_relations_work__pfx_hv_eject_device_work__pfx_hv_pci_protocol_negotiation__pfx_get_pcichild_wslot__pfx_hv_pci_bus_exit__pfx_hv_pci_suspend__pfx_hv_pci_remove__pfx_hv_register_block_invalidate__pfx_hv_pci_assign_numa_node__pfx_hv_pcifront_write_config__pfx_hv_pcifront_read_config__pfx_hv_msi_free__pfx_hv_send_resources_allocated__pfx_hv_pci_onchannelcallback__pfx_hv_compose_msi_msg__pfx_hv_pci_restore_msi_msg__pfx_hv_pci_enter_d0__pfx_hv_pci_resume__pfx_hv_pci_probe__pfx_hv_read_config_block__pfx_hv_write_config_block__pfx_pci_devices_present_work__pfx_init_hv_pci_drv__pfx_exit_hv_pci_drvpci-hyperv.mod.c__UNIQUE_ID_srcversion474__UNIQUE_ID_alias473__UNIQUE_ID_depends472__UNIQUE_ID_intree471__UNIQUE_ID_name470module-common.c__UNIQUE_ID_retpoline471__UNIQUE_ID_vermagic470_note_19_note_18orc_headerirq_chip_unmask_parentvmbus_driver_unregisterpci_scan_child_bus__list_add_valid_or_reportalloc_workqueuehyperv_pcpu_input_argwait_for_completion_timeout__kmalloc_noprofcpumask_next_wrap__this_modulesnprintfcompletequeue_work_onpci_dev_put__init_swait_queue_headirq_domain_removethis_cpu_offmsi_unlock_descsvmbus_sendpacketiounmap__stop_alloc_tagsmemcpykfreex86_vector_domainmsi_desc_to_pci_dev__bitmap_andpci_msi_create_irq_domainpci_lock_rescan_removehv_hypercall_pghv_isolation_type_snp_raw_spin_lock_irqsavevmbus_closenode_statesmsi_lock_descshv_max_vp_index__fentry__numa_nearest_nodeirq_domain_free_fwnodehvpci_block_ops__start_alloc_tags__x86_indirect_thunk_rax__vmbus_request_addr_match_printk__stack_chk_failrefcount_warn_saturate_dev_infopage_offset_basevmbus_recvpacket_rawpci_add_resourcepci_stop_root_bus__sw_hweight64devm_pci_alloc_host_bridge__pfx_init_module_dev_errvmbus_open_find_next_and_bitirq_get_irq_datapci_bus_add_devicesdestroy_workqueuepci_get_domain_bus_and_slotmutex_lockvmbus_next_request_idphys_base__list_del_entry_valid_or_reportioremap_find_next_bit__cpu_online_mask__mutex_inithv_isolation_type_tdxpci_destroy_slot_raw_spin_unlock_irqrestore__pfx_cleanup_module__mod_device_table__vmbus__hv_pci_id_table_dev_warn__flush_workqueue__x86_return_thunknr_cpu_idspci_create_slothyperv_paravisor_presenthv_tdx_hypercallkasprintfpci_msi_prepare_find_first_and_bitpv_opsirqd_cfgpci_msi_unmask_irqhandle_edge_irqvmbus_free_mmiopci_bus_assign_resources_find_next_zero_bitirq_chip_set_affinity_parenttasklet_unlock_spin_waitmutex_unlockpci_unlock_rescan_removehv_vp_indexhv_is_hyperv_initialized__const_udelay__irq_domain_alloc_fwnodevmbus_request_addr__vmbus_driver_register__kmalloc_cache_noprofmsi_domain_first_descpci_scan_root_bus_bridgems_hypervpci_remove_root_busirq_chip_mask_parentpci_msi_mask_irqpci_stop_and_remove_bus_deviceirq_domain_get_irq_datapci_walk_busvmbus_allocate_mmioirq_chip_ack_parenttasklet_unlock_waittry_wait_for_completionmsi_next_descBUG_funcvmbus_sendpacket_getidkmalloc_caches@"iA@.3iI%@2^'c@'@''@h  &k iI@3'T2LLbl:9ili.m>\J\q@,!:i@&V8;tVid@!(,Gtfizii@2/;di2v2@- ; d1 IU @^ v | i @  + *= .P hq i~ "   I @ u< uB ie @ 5  q q ,!rj `6?5|j_j| `Uj<bs|qI@i3J@'1@LS,e @9;d3i/(U@ZY8){;]BdPc.ziI@>$u  +* .f "&-G<jP/p uSz?iI@;=JLd\ifJ@k.s  +* &8"ji;d]R]{cI@ ?h^<gi@</u+C37fXv8Oc{@(iQ@=PBi@DiTiu@ii@5_ik3@#J Q +u*} ."  39 iE  I @ <!:!Mu!;}!;!G!F!d! "eS" P{"("3"#"i""###3#~#~##n$3}$$F$3$J$J%d% x%%S/%I4%9%U%@(&i3&5&&& &;&&j& `&$' ''dN' U' +w'*'  ()(+=(yk(d(;(d(~((;f)d))3 **0*r=*jD* `V*p*|*|"+ o+{++I+Q+Q+@+i+>+ ,,V1,-:,ia,@,$,, , +,*- B-.X-"s-z-q-3-i---I-@.  H. [Z. y.T.i.<.Z/z+/ +7/H/zR/Iu/@/Q/D// / C/a0020  70wC0p0 U~0 0 1  1 [ 1 ?1TR1Xj131i1 1<112^#2:.2 _82nU2a23y2 242  2 t2 d272S2+2C 3/3u*3Z3 3383v3W3{3z4zb4m4q4N445N$5 05K>5e5@5 5 +5*E6 c6.6i6"66666I7@7 7 +7*8 ^8.v8"888i9 )9IE9@939;9]:3):dE:ZM:;s:d:;:d;;Z;];;d;]<cK<8[<p<{x<z<3<i<d< =/= 6= +^=*=  =.="==J>3> P>S>;>>d>;p?,?d?'?J?d?J@I@}%- 4 %;  BDF `5MDQ 7XD\ aki S U* /H:LO (VSe `tS S S 4g  Ig%  e S% %K/: ?SR 4Xagf1t 0|S3 hK SC 4g  0S  Xg%!$ 6S;%!N `Se%!p yK~{" S%! S%! S%! S f) &S+)? LSQ)_ lSq)| 4gz- 0S|3, S- `S-  Sb1, p5S:4A NSS 3^ HlSq2 Su44 4g6 Sg6 4g 8 ("S,87 x@SJp?U 4[agf=F   %D,D3D 8i  * .8 <F JTzXbzfpt@$ (08@pHPX`hT p x d 0TPt T%+`, -(t/0d587@D9" '+/ P$-"(4(,j)0+4080<h>  ( 0 8<iDl ( P 8il p  8il  ( 0 8<iDl`Ih p 8|tle  8il  H( 0 8<iDl` h Pp 8|il  P 8wl  P 8il@ H P 8\idl   8il  8il   8i$l` `h 0p 8|il   8il  (( 0 8<iDl  P 8il 0  8il  ( 0 8<iDl`0h Pp 8|il ` P 8il  P 8il@ 0H P 8\idl h  8wl   8il   8i$l`h 0p 8|wl x  8il (  0  8 4  P  8 t l    8 i l@  PH   P  8\ id l    p  8 w l x    8 i$ l@ H  P  8\ id l    8 i l    8 i l     8 i$ l@  XH  P  8\ td l     8 i l!$! e y$(,{ 0p 4A 8<@DH[LiPfT'X\C`Sdhl^p8 t"x'&|+9,-.~168<j7@ $ $(,04S8<@pDHL7PTX\=`d.h1lBpt, x} | c   0 T ]   < O }    d  ;0d.T   $A(O,048<@DHtLPT Xt\`dh<lKpetxK|j%7Qz >K]6eu  P| $(,04.86<t@DHLPTX6\I`dh/ltptx|   !9!|!!!"z""""####X$m$$$$$$%$%.%T%2&i&&&&'v'( <(j(((( ($(((,&)0F)4e)8)<)@)D)H)L*P/*TU*Xc+\+`+d+h+l+p ,t,x0,|`,,,A-W----x......///6/G/Q/t////600>1Q1a1i1111272T2 `22222 3$3()3,130]34o383<3@3D3H3L3P3T3X4\4`4da4h4l4p5t/5xd5|5b66677]8u8(9D9999 :(:D:L:r:::;Q;Y;;;;< <J<Z<b<j<o<w<<< =]===> >$>(>,>0>4?8?<?@?D?H@LPTX.\`d h$l>p`t{x|5_x%Kk4Mk!?`&0 FI $*(],b0g4p8<@DHLPTX\`dhlptOxP| 127Z`rvz '+-2S`w{  $(,048<@DHLPTX\`dhlptx| $^_acejrsuwy~  v$}(~,048<@DHLPTX\`dhlptx|`lmoqsuz        5 @ Z u z {      h k l n p u $ ( , 0- 4@ 8A <F @P Dk Hm Lo Pq Tr Xs \z ` d hTlXpYt[x]|_af 79;=>BF<@[]_abgk  $(, 048<"@&DHLPTX\`dhlptx| TUWY[`lp+_`aceginefkr  $(,0!48<@D&H'L,P3T@XW\Y`Zd[hlptx| >?ACHIOQSX`{RS UZ[\^ c$d(h,j0o4p8<@DHLPT. X/ \0 `2 d4 h6 l8 p= t x |       """"""""=%@%Z%b%'&,&+++++++8,9,>,B,P,g,o,q, s,t,u,y,- -$-(-,-0-4-8-<-@-D-H .L.P.T.Xx.\~.`.d.h.l.p.t.xV/|`/{///////>1D1r1u1v1x1z1|1~111184i444B5P5k5u5z55555666 66666 6$7(7,7074!78"7<#7@07D8H8L8P8T8X8\8`8d-9h09lK9pM9tO9xQ9|R9S9W9:;@;<<<<<<<<@o$>ELUZbjkmoqsxy         $ ( , 0 4 8 3< @ D H L uP T X \ 0` jd h <&,0 p(08@`H`PX`hp@ x  P  @p@`p @% +(P,0-8`/@P5H7P09 z@ p/-08oP ` x8P%p1A    `  ( 0 8 `@ H P X ` h @p x @     @   `  @         @   `   ( 0 8 @ `PA1 ! &q '' ' $F' %. &O(T &.` &m &<{ & &> & &  &VA &ZV &H & &:W & & &X & & &¢ & 3 &t &{; & &E &l &< &y & &a &J<' &3 &FF &GM &R &^ &vj &Hv &8 &a & &  & Q & &6 & &Ɛ &G &" &N:  &" &[# &%w/ &; &ٖG &S &^_ &,k & &\ &n &\ &v &J &  &! & &+  &  & $ &L &*Y & f & & & &B &pp &  &; & &K! &/ & = &c?K &_ Y &Ag &[u & &!? & &( & & &{ & &B & &O &w &`- &^; &MJI &fW &e &s &&1 & &s &[= &N &' & &0 &Ì & &6 &0E &QT &Sc &r &' &o &Y & &T &2 &X &: & & &W, &8& &5 &SD &PS &<b &q & &b &oy &_ &+ &$ &W  &4q &l & &| &% & H4 &C &R &ra &7p &I! &3 &߶ &֚ &s &! &Ȇ & & &5 & &LN &b &=w &a@ & &a & & & & &K &ij & &Z# &0 &= &7J &+W &Dd & Kq &W~ &_ & & &m & &H & & &) & " &y / &%< &\ &8f &ks & &- & &9 & &W &W & &Q &1"$ & 3 &B &W_ &o &u &9{ &6p &] &lg &  &K &| &W &Z &d &h & &Mn" &M/ &7a &n &W &  &_ & &| & &w & &v  & &Y& &t4 &*B &IP &_^ &l &yz &! &$ & &| & &O &ۿ &hC &1 & & &B" &0 & > &\L &Z &{ h &v &V &dn &eB & &2 &߁ &  &; & &< &* &7 &/]E &R &_ &/]m & &' & &1 & & &E, &+[ & &' & \ &{ &W &A &a & & & &aD &S &`n &j| & &e &9 & &, & &Q & & & &A, &y? &K &W &gc &o &l{ &_ & &=& &L &L & &6 &\ &i &={ & &W &u &F &~ & & &V &* & & &* &$\9 &wG &U & c &q &a &W &Qy & & &. &~: &W" & &~ &V  & &' &5 &n &[} &* &} &V; &;; &9 &2 &t$ & & &{ &$ &M3 &B &Q &(` & o &~ &߳ & &' &a & &t &' &* & &{ & # &2 &VA &P &t_ &`An &!`} & &$ & &? & & &Tw &c &m6 &" &71 &c9@ &O &f^ &Qn &`~ & & &$ &t3 & &{ &S &6 &P &P* &8. &5U> &dN &~^ &2Rn &} & &{$ & &\ & & &{ &; &vS &" &=1 &@ &O &~^ &m &*[| & & & &A &C. &  &~ & &0 & & ! &0 &z<? &|N &cL^ &5m &| & &< &* &{ &) &+ &8" & &L &  &9/ &> &WBM &\ &k &z &5 &}M &@] &NY &D &h &A & &7 &pV &  &. &= &L &[ &+j & y &a & &X@ &1) & &- &Ѧ &H &! &E<! &- &K- &"X- &7e- &r- &- &- &8c- &w- &Z- &m- &- &0- &q- &|- &w. &. & . &ES.. &<. &J. &]n. &4{. &,. &. &/. &q. &// &d/ &W/ &/ &/ &/ &W 0 &,0 &)0 &?70 &OE0 &eS0 &pa0 &`o0 &}0 & 0 &zF0 &D0 &k4=1 &J1 &W1 &ڥd1 &Yq1 &~1 &ۗ1 &1 &2 &o2 &2 &*2 &z=2 &7J2 &W2 & d2 &q2 &W2 &22 &2 &W2 &2 &Su2 &'2 &O2 &2 &82 &y2 &-O2 &^2 &,x2 &vv2 &2 &2 &!2 &/3 &u3 & 33 &K3 &~Q3 &UW3 &b<]3 &c3 &i3 &o3 &ou3 &{3 &R3 &3 &3 &?3 &3 &,3 &T3 &3 &%3 &N3 &`3 &<3 &^3 &3 &M3 &M3 &e3 &K3 &L3 &B4 &4 &P4 &g')4 &B4 &ʵN4 &Z4 & f4 &FBr4 &4 &4 & C4 &,4 &5 &+5 &M5 &<5 &5 &:6 &DG6 &RT6 &a6 &+n6 &6 & 7 &7 &x`'7 &47 &<A7 &8Z7 &iUg7 &<t7 &7 &7 &c7 &-7 &7 &7 &8 &j8 &G=8 &FM8 &]Z8 &h8 &u8 &_8 &C8 &8 &A8 & 8 &c8 &**8 &9 &9 &)(9 &89 &zH9 &V9 &d9 &r9 &)9 &Y9 &P9 &9 &9 &29 &9 &T9 &&Y: &Z: &Ah: &-m: & (w: &D: &W: & : &W: &: &Q: &: &Ql: &: &i: &+ ; &*; & 4; & @; &#M; &Z; &!a; &2L; &4; &"; &96; &.}; &W; &; &d< &)m!< &-< & -?< &eL< &Y< &/]u< &g< &< &NZ< &(.< &< &o*< &< &/]< &H= & = &= &*&= &3= &/el= &wy= &W= & = &M= &r= &= &= &G= &Z> &> &-> &(> &$> &*> &1> &6> &C> &8Q> &,[> &h> &v> &[c> &L> &> &> &ӽ> &> &:> &> &? &? &&,? &'9? &F? &:S? &`8a? &5n? &o}{? &B? &v? &? &5? &1? &? &s? &L? &+? &NZ@ &W@ &"@ &2@ &ZM8@ &?@ &DL@ &+Z@ &cg@ &t@ &Z@ &{@ &@ &G@ &@ &'@ &@ &O@ &gA &6A &*A &H27A &9JA &qWA &1dA &NZqA &~A &WA &7A &A &B8A &A &WA &,B &pZB &k;%B &+z3B & :?B &LB &YB &~3gB &YtB &B &*B &dB &B &'B &oB &{C &C & #C &/C &0E &zE &E &E &QF &'F &_$F &9.F &;F &HF &VF &ocF &EpF &%}F &F &F &3F &zF &F &9F &F &JG &4G &6^G &)G &96G &ADG &@QG &0^G &kG &YyG &G &boG &G &PG &PG &G &G &.G &G &AG & H &|H &$H &ـ1H &OH &cL\H &jH &wH &jH &{aH &H &}H &9 H &WH &wH &OH &q I &I &$I &&1I &q?I &=KI &XI &qfI &{I &qI &I &I &QI &+I &C.I &J &J &!J &"3J &r9J &#?J &hEJ &[KJ &)RJ & `J &qnJ &<|J &{J &J &J &AJ &J &;@J &qJ &HJ &Ǣ K &K &&K &h)5K &%CK &lMQK & _K &"mK & {K &K &K &;K &6K &K &EK &wK &K &K & L &)<L &C%L &E3L &+AL &KOL &X]L &akL &U!yL &xL &dL &\L &L &-L &.L &L &L &L &$M &uM &!M &t/M &ȕ=M &KM &q9YM &t>hM &wM &$M &hM &l M &BPM &tM &M &VM &[M &$M &N &(N & N &.N &C\ &N\ &\ &om\ &\ &f\ &\ &\ &p ] &] &;(] &j6] &#D] &7XR] & `] &n] &|] & ] &] &] &] &6k] &] &F] &n] &Q^ &&3^ &,$^ &B>^ &;K^ &&X^ &Ke^ &2r^ &)^ &^ &1^ &^ & [^ &Ғ^ &^ &? ^ &i _ &R_ &&_ &3_ &@_ &M_ &mt_ &T_ &A_ &R_ &0_ &7_ &_ &A|_ &U_ &` &` &SK` &*` &/7` &LD` &Lb` &o` &|` &` &Yf` &F` &,` &G`` &` &` &3` &T` &w` &` &w!` &',` &a &"a &{ 2a &8a &B\>a &+Da &ExJa &Qa &4 ^a &la &ma &)a &Oa &a &9a &a &na & !a &*a &b &!b &&/b &Dn &Qn &Qhn &Dun & n &4n &Vn &Sn &n &Wn &an &n &Hz.o &*Do &Po &2vo &.o &o &xHo &.o &b"o &W p & p &O,p &2:p &uHp &Ffp &p &&p &Wp &hp &p &p &p &Xp &j q &/q &_&q &9$4q &@Bq &Pq &3iq &^wq &1q &q &sq &eq &q &mq &I r & 0r &W%r &3r &LAr &BOr &]r &kr &yr &Xr &r &r &0mr &r &وr &r &r &k4s &\#s &o1s &4 ?s &BNs &7\s &ks &ys &s & s &Ks &s &,fs &gRs &us &t &t &SDt &Xt &?bt &pt &y~t &NSt &_t &1t &pRt &x6t &St &4t &_t &t &"} u & Hu &B&u &P4u &K;Bu &@Leu &Osu &du &Ku &2u &u & u &v &0v & v &,v &\:v &űHv &dv &N'rv &}v &bv &v &v &+v &v &yqv &v &Ьv & v & w &bvw &=5(w &'a7w &*Fw &oUw & dw &`sw &0w &$w &vw &Ew &Tw &hw &w &w &w &x &'x &|6x &Ex &Tx &3Icx &rx &x &%x &:x &Wx &19x &@~x &x &fx &x &y &Iy &&y &VZ5y &ГDy &Sy &2by &qy &y &vy &By &(Xy &~By &- y &"y &X z &2z &-z &:?z &RcSz &Wz &iz &z &sTz &*z &z &h z &בz &Bz &}5z &{ &p{ &i { &f{ &{ &b!{ &W({ &0{ &B-={ &IJ{ &8W{ &+=d{ &Xq{ &,~{ &J${ &w{ & { &V{ &E{ &,{ &&{ & { &B| &V| &W| &Ș(| &5| &B| &;O| &u| &,| &| &G| &߶| &Z| &| &o| &d| & } &} &Y)} &6} &C} &Y_} &k} &w} &} &}} &Q9} &} &} &} &Q9} &} & ]} &x~ &*4~ &? O~ &[~ &kg~ &t~ &Ԟ~ &B~ &~ &y~ &u~ &WN~ &~ &P~ &K~ &. &h2 &5 &dB &+P &?] & j & & &* &$ & &kZ &Sp &?( &BD &9P &im &zy &$ &ݞ &xO &G & &ǀ &0Ԁ &Կ &? &CT &) &?+ &B" &'/ &C &hP &Ugu &> &1 &11 & &Q &ʁ &؁ & &? & &  &jb &F2 &@ &N &S\ &j &x &> & & &! &{ &̂ &Tڂ &c &6! &= & & &p. &< &#J &X &f &t & &q & &A &Dǃ &փ &p & & 5 & &@c) &m%9 &P &(_ &!Rn &m} &ho &G &;1 &˄ &_؄ & &x &@ &s &Z &_& &l3 &T@ &RM &Z &r & & &{ &M1 &4# &5~Dž &Յ & &S[ &2 & &B &sD) &L7 & E &*S &la &Zo &1} &5 &Z &V &R &Æ &ц &߆ &] & &4 &K9 &' &6 &WE &kKT &Od &e}s &zQ & &U & & &<͇ &#[܇ &I &, & &3C &DI' &?6 &E & T &#c &3Sr & &D &J & &Z͈ &2܈ & &7 &m] & &q2( &Χ= &M &S &M) &6 &'BC &dZP &] &o &O &xO &`e &v &r5! &. &< &٩I &V &c &_p &+} &W & &S &B &׋ & &B &K &i{4 &A &+N &[ &h &S &/ & & & &UQь & &$E &Q & 'a &g &m &t &I~ &* &$ &; &6k &3 &4͍ &ڍ & &O &} &p &$ &a1 &0'H &ݐU &o| &ž &kZ & & &CĎ &؎ &/ & &6k &0L &Y &36s &l &T? & & &XΏ &kZۏ & & & &C &.75 & AC &F\ &io &]y &A &p &? &I &v &ɐ & &o & &c & &a% &rW &;} && & & & &͑ &*ۑ &Z &6) &! &_ &Q &, &Q9 &(F &S &U5` &m &C & &ǒ &Ԓ & &uB & &6 & &K/# &NZ0 &> &K &X &e &s &A &] &% &Q & &Aȓ & WՓ &o & & &؎9 &>C &M &mZ &Qh &u & &3 &1 &١ &{=Ŕ &3MҔ &^ߔ &1 &A &0zF &4@g &?s &¹ &@` &? &ą &jBÕ & &W &! &o3 &/V &5b &~ &{u &@ &6k &T| &* &$͖ &ږ &[ &b0 &y|< &N &ZT &Z &` &^Xf &4}l &[~r &j~ &\ &> & &#M & &0ė &ʗ &}ڗ &֚ &2 &' &` & &> &H &` &юl &$ & &'9 & & n &Θ &(ۘ &9 & &x &) &_' &}5 &޽C &Q &݊_ &m &{ &p &] &X & & &Й & &PV &A &C &8 &" &SO &q\ &o &} &M &vl &b & &< &I˚ &ؚ &F &I[ &Y & & &' &4 &j A & N &9[ &=h &u & &q & &T &,T &9ϛ &*%ݛ &4 &u( &  &D &2_# &+1 &? &Y3 &RL &B &Ȝ &֜ & &#) &` & &4 &A* &o8 &Y3ŝ &dӝ &N &۲ &$ &;K &I &' &T5 &>C &/KQ &̺_ &d|m &9o{ & & &l &C &ڇž &WО &]zޞ & &W & = & &r2 &A|@ &lO &>] &L]k & &" &$ & &Ÿ &xП &LJޟ &p & & &յ &yR% &3 &A &[O &J] &Αk &=y & & & &tz & &W &z &L &< & & % &iX &pf &Xt &e & &q && &~ &Ȣ &$֢ &x &x0 &Ϯ & & &%C* &^8 &XF &nT &rb &Dp &o &_ &*4 &2ܥ &E &3& &V &?' &w4 &a &Sin &R{ & &j &( & &< & Ǧ &Ʈզ &c &W &^ &i &  &) &7 &E &S &Z8a &Ko &} & &- & &O &oç &ѧ &ߧ & &G & &>" &e, &!6 &' @ &J &t%T &b &mp & & &R &Ũ &3Ө & &A & & & & I2 &]? &W &Re &Nr & &o &h &;© &PЩ &"|ީ &Na &=F & ! &]/ &== &K &Y &g &Uu &u &C &OO &~ &U &ɪ &I5ת &6F &< & &B &w &y[+ &;9 & G &U &c &]*q &P &E &> &kʫ &U٫ & && & & & &|K? &~ &Y &Q &8 &Jt &F &,F &<7 & &%_ &Cϲ &;I & &5 &G &M &S & &ݴ &U &) &6 &BC &1P &] &^+j &ѳ &4 &) &nI &c &;̵ &,? &A &$ & &  &' &b3 &? &VCK &ηX &e &r & &u &oJ &- & &x &'HͶ &ڶ & &9 &v &a &(' &*4 &A &N &Bs &kZ &W & & &ٷ & &y &A & &k) &y7 &$E &LS & a &XWo &} &w &U &c & &*ø &Ѹ & &È & &z" &w, &TDE &mR &_ &m &{ &1 &l & &ih &U &ѹ &> &O &W & &\a &#E &E! &. &0\; &OH &PU &8b &˫ &f &=v &B &ػ &A/ &ۅ & &z &A &.) &L7 &wE & S &a &5 o &} & &u˽ &{ٽ &. &^+; &H &HcU &Wb &u &1 &$ &u &h & &;þ &RF &S &2` &bm &e &ʿ &s׿ & &B &x,w &0 &B &2 &H &W* &7 &[D &\ &Fuv & & &j8 &+ & &eB &l &6 &* & 7 &UZ &@g &W &E &ɀ &) & &z &{ & & & &  & & &( &k &YJ &4 &+ &с &Z &o &! &A? &M &[ &di &g`w &e &) && & &^ & &8! &j. & ; &z@H &~6U &nb &fo &| &R &y & &R &׳ &› &B & & &6k> &/L &JZ &R & & &B &W &o & &{ &8 & YE &R &_ &!l &-y &W &. &4 &{ &8 & &B &V &2a &W &L1 &z@@ &WN &h &Fv & & &H &R & & &! &v &" &# &2 &A &3P &t_ &n &E} &\ & &L~ & &` &; &B &T &V/ &! &f0 &? &$N &] &Kl &_{ & &g & & & &d &F & &t &l &' &5 &C &.Q &\_ &zm &H{ &@ & & & &@U & &0 &P & &5T & &$# &Ud1 &0? &gM &[ &8i & & &| & &( & & & &| &D & &s^ &  &W & &. &< & J &kX &\g &q &% & &X9 &2` & &_ &z &X\ & &8 & &_$ &32 &@ &1N &\ &hj &Fz &&& & &s & &X &a &Q & &  &> &bI &#- &X= &rM &Z] &dm &h} &e &T &k & &: &b &Q &gT &: &:[ &c% &3 &&cA &čP &_ &n &pd} &L & &^ &B &1 & &> & &Q &! &l(, &:9 &F &@#S &E` &J,m &z &~ & & & &R &Q &l & &+ &9 &gG &U & & &B & &7 &x &ڋ &. &x, &J &x &@! &E. &!; &H &\U &zb & o &<| &F &F &Z &B & &K & &+ &) &6 &JC &xP &@] &Ej &\w &z & &x &6+ &f &B( &5 &xB &[O &\ &i &_Hv &k0 &| &; &R & 5* &B7 &D &x,Q &^ &$ &+ &Xy &ѻ &iG &C &B & &z &{ &f &Ct &,5 &2 &-. &n &G & & & & &R &T &c & &! &_ & &J- &M< &hJ &X &6kg &Zq &ub &3: &] & & & &҂ &TG & &7 &( &T &: &$$ & & & &M &<0" &p.0 &OM &kFa &k &ъ & &L &l &B &% & &; & &O & & &{* &f7 &6kJ &˖W &w~ &_ & &W & &Z & & & &T & &} & v+ &8 &8'E &R &_ & l &y &[ &w &W &un &yp &B & &^P & &4 ( &6 &nD &$ &L &j & &9 &T & && & & & &? & + &{9 &*G &[ &6ko &AZ &5 &!+ & &<4 &%o & &ݱ &I &)> &J & &i! &. &(P; &HH &U &ab &Uo &Δ| & &T &} &` &; &k\ &r & & &; &( &2 & &G &m &l &2 &L &Y &nvf & s &W & &+ & & &x &_ & f & &m &כ & c* &m8 & F &T &>b &p &B~ &Y & &Dm & & & & &I &Qz &J& &|D2 &> &s=L & &Ҩ & &8 & &) & & c &;% & &K & % &z@3 &sA &O &f] &k &y &1 &I &PW &7 & g & &Y &pU &@ &[Y &߄# &L1 &? &M &E[ &ii & w &mq &z &E & &1 &u & &9 &E &c] &R' &7 &]G &hW &ڧg &$w &yx & & &OP & & &* & & &o* & 9 &QH &~W &˹g &w & &Q & &( &c+ & & &U & &V &-' &7 &بG &W &ϲg &Dw & & &x7 &|w &x &n &mE &h & & &_' &Ik7 &qG &W &8g &Bw &Bb & &g[ &] &^ &ԝ &٪ & & &`. &! &0 &?@ &VXO &_ &o &~ &| &7] &_ &2 &M &X & &NA &0 &, &gS< &dK &UnZ &7di &Ax & &{ &R & &Vx &u &I &PW &* &B! &/ &J= &@K &\Y &zg &Eu &] & & &; & &x & &2 &` &4 &#> &6X &$ &^ & c &z8 & &] &P &W &ԏ &F &^* &: &J &q Z &pj &Mz &kf &D+ &; & &\ &\ &4 &X &O &. &E( &6 &D &R &w` & &_ & & &" & &2 &I{ & & &z &z) & &_4 &֯ & &4 & &ְ& &3 &n`@ &AM &ܸ & &U & &v% &l3 &yA &_ &Fl &B & &^ & &+ &nC &K &; & &<2* &!8 & 5F &wT &;b &p &b;~ &M &W &! &h & &6k &8' &T &y- &RL &,([ &(j &03y & &@ & &B &W &( & &z &i# &1 &f> &~4K &0X & e &$r &E &- &0 & &] &e &[ & & &f & &;, &W &( &>d6 &%{D &R &` &n &ʉ| &g & & &W &[ &O & &B &k &f& &3 &+@ &xCM &vZ &g &4u &v &G & &! & 9 &[ &{~ &v &~4 &j7 &&D &Q &3^ &k &ژx &* & &B &N &kH &7 &a &6 & & &3 &_'% &:E3 &ȰA &(O &a] &k & <y & &6 &ʥ &V &ݼ & &[ &= &Ne &j &C3 &! &/ &= &_6K &Y &W & & & &u &; &. &P & & &] &I* &+7 &E &.wS &b &t&o &Z| &D &9 &B &q &J & &W &M && &j &o &6k4 &(A &FN &1\ &j &9x & &j & &> &3 &z &8' & &  &=' &KE5 &C &"Q &/_ &4m &\{ &z &R & &= &g" &< &ī &. &? & & &# &g &% & &J% & & &b &K &@ & &x &L &i &߶/ &? &E &٤K &xQ &o/W &I] &c &pi &Loo &u &{ &o & &% &WR &e &~ &7 & &0B &c &d &te & &c &ȶ &+ & &2 &Ⱦ" &B0 &> &b &Go & | & & & &  &% &" &B/ &W< &I & \ &_i &;v & & &Km &. &l &E  & &E &  & & &i &Gw &  & &f &H &( & &H &H & + &! &G6 &1D &lR &ʃ` &n &.w| & &  & &4 &[ &ʃ &Y[ &f &l &G# &L; &oI &-W &nXe &`gs & &N  & X & &`V & & & `  &/  &BO%  &-1  &LG  &6kS  &/ei  &u  &s  &C  &  &6  &  &-;  &X  &F  &  &  &cQ"  &6  &գC  &[  &h  &eDu  &܏  &=  &6k  &  &Aa  & z  &  &-  &  &  &'  &5  &@fC  &=uQ  &_  &ۍm  &I{  &  &.  &W  &  &[<  &3  &*  &8'  &xC!  &`/  &6kI  &O  &mU  &[  &ya  &Yg  &m  & s  &my  &Y  &  &v  &W^  &  &k  &¤  &n  &  &~  &k. &B= &5L &@[ &%j &2Zy & & & &1 &l &B &% &> &% & &8 &yF &6kU &%b &bu &&  &1" &' &* &; &# & &1 &l &5 &g!" &D1 &c@ &>O &"^ &Bm &%| &2Z & & &  &b & &O &'D  & &B8 &@E &S &mWa &1o &W & &[# &I & 4 &% &D &u &A & &  &6k/ &$K &AY &g &6k &e & &e3 & & &" & &B & &% &!2 &d? &"L &Y &f &Hs &` & &  &l &  &^ &5 &^2 &@ &!N &+:\ &`j &Bx &% & v &6 &>V &% &* & &_ &m &W &  &2 &:{8 &`> &D &VJ &NP &V &g\ &>b &Fh &n &t &z &! &n &2 & &t &? &H & &u &l & &طL &jZ &0h &v & &L &/ & &2 & & &0 &= &~ &^ &l  &Iq && &4 & MB &SP &¨^ &l &E &E &T & &{ &b & &hY &G &H| &K &[% &4 &IC &R &ba &qp &  &) &b% &Y &)d &r &m? & &j+ & &g &@}$ &G3 &B &aQ &8` &yo &x~ &^ &W &} &. &I &b &L & &: &'$ &83 &GvB &Q & ` &Go &{~ &%G &J &< &a &o &{ &A & &T & f! &&/ &A= &!K &uZ &Rl &r &Zx &  & &F &,l &0 &I &z@ & &  &p &E &  &TP & & &4 &B &} &F & & &2 &J &@ &E+ &\9 &z &u & &x &Q  &^  &fj  &w  &  &  &  &  &W  &  &  &W! &! &-! &*;! &J! &NW! &d! &>q! &~! &!! &! &! &^! &I! &! &)U! &w " &" &KK%" &N3" &<L" &Z" &h" &." &" &W" &" & " &" &ߖ# &# &5# &.B# &DO# &\# &bi# & v# &# &nv# &# &}$ &{$ &s'$ &_4$ &nA$ &x,N$ &;\$ &i$ &w$ &$ & $ &~$ & $ &$ &E$ &}$ &$ &a$ &3% &~% &?% &$-% &f;% &P.I% &W% &e% &Ks% &n% &L% &% &% &1% &W% &9% &K% &% &g% &Mf& & & & & &.& &=& &J& &W& &d& &q& & ~& &\& && & & &G & && & & &@(& &v' &c' &I' &9' &H' &W' &g' &eu' &m' &W' &!' &j5' &Y' &{' &W' &E' &( &j( &-( &<( &L( &zZ( &Wh( &!v( &( &j5( &;( &{( &W( &%"( &E( &( &( &Ԇ ) &m) &L) &ykZ) &[h) &=Hv) &#) &m) &W) &:) &) &u) &x) &) &* &* & $* &I6* &H)<* & B* &H* &̟N* &3T* &nZ* &a* &/s* &Wy* &* &* &* &7* &)* &(* &b* &* &%* &]N* &"* &R$* &Q* &x* &D* &+ &^w+ &#+ &1+ &_?+ &{M+ &+ &+ &ݚ+ &+ & + &v+ &w , &^4, &5A@, &KU, &c, &Y{, &, &p, &Y, &:, &1, & Z, &, &<- &- &}- &^,- &@9- &F- &΍S- &Ky- &;- &P- &- &- &9e- & - &@- &d- &h- &- &B@ .. &b#. &+,. &5. &ax>. &Q2G. &P. &9Y. &p'b. &3Pk. &:t. &}. &2G. &. &ow. & !. &. &f. &. &&. &. &. &c. &9l. &" . &|. &m/ & / &@ / &7/ &E/ &T/ &,a/ &,m/ &z/ &_/ &Xb/ &.&/ &T/ &t/ &Y/ &G/ &#/ &Y 0 & 0 &/0 &:'0 &Xb40 &.&N0 &T[0 &th0 &Yu0 &G0 &#0 &W0 &0 &0 &X0 &10 &l0 &]b0 &1 &1 & 1 &1-1 &l:1 &]bG1 &T1 &2br1 &%1 &11 &l1 &1 &]b1 &1 &2b1 &sA1 &1 &]b1 &6k 2 &y2 &0*2 &92 &QG2 &HU2 &ьd2 &2 &H2 &x2 &M2 &2 &k2 &R2 &!3 &/3 &H=3 &m:L3 &Z3 &Hh3 &v3 &3 &63 &$A3 &o3 &3 &3 &$A3 &o3 &4 &"14 &M?4 &ڮ^4 &*l4 &Hz4 &ь4 &4 &284 &4 &$4 &H4 &ь5 &5 &55 &>5 & L5 &HZ5 &ьh5 &јw5 &{5 &5 &5 &ј5 &5 &H5 &ь5 &ј5 &5 &H6 &ь6 &ј"6 &vh06 &H>6 &ьL6 &ј[6 &9i6 &Hw6 &96 &ь6 &6 &u6 &M6 &6 &I6 &H7 &97 &ь#7 &X]17 &@7 &N7 &$A\7 &ьj7 &My7 &7 &$A7 &ь7 &7 &H7 &ь7 &M7 &7 &7 &=8 &g8 &8 &8 &8 &)8 & c78 &DmE8 &;S8 &m:a8 &Չo8 &{}8 &Ԉ8 &Y8 &<8 &u8 &J"8 &:8 &8 &8 &8 & 9 &9 &%9 &:39 &FA9 &&^9 &m9 &}9 &v9 &e9 &Xb9 &.&9 &T9 &t: &Y: &G: &#9: &WG: &V: &d: &9r: &o: &: &a(: &9: &+z: &: &o: &g,: &L; &"; &~*; &ڮ9; &G; &]U; &Jd; &q;z; &c; &,; &n; &b-; &,; &ј; &R7;< &z< < &,2&< &]4< &&Z< &Kg< < &<< < &^_< &/< < &<< &<= & = ,= &8= A= &XY= &q= &= &{*= &8= &m= &^= &= &%u> &!C> &+V> &ki> &p> &> &r> &d>> &#> &? &:DB &jB &:iB &|B &?B &rB &B &@^#C &C7C &xJ@C &kSC &ofC &ԜC &C &C &xC &VD &&D &@WAD &\D &LrD &%gD &>MD &AD &dD &kD &9E &.E &~JE &$SE &kE &VtE &UE &RE &E &ÜE &9*E &F &}F &B1F &7RF &^1eF &F &}F &ΗF &3F &LF &)0G &z4G &VG &aG &lGG "G " G"G"G "G "G ".G ",G"G"G "FH "D H "VH "TH#He4H AHLH &qSHjH {H H &}H-H &ԈH "tH "lH &LH "H "H &`H "H "H.I &O I/I1. I $W 1I "<5I ":>I1.HI $W UI "KYI "IdI!/nI!/I "\I "ZI;/I+I}.I I.J.'J.4J.LJ.dJ /|J/J!/JL/JV/J &KJ &LJ &PK &t *K &~47K &1RK &`K &pK &@{KK &ԈK "qK "iK &LK "K "K &D:K "K "K "K "K7L "L " LCL'L $8L "P;PPHZPHwP "{P "PPPPP "P "PPPPP "P "PPPPQ "  Q "Q"Q $03Q " 7Q " \ "2 \ &\ " \ "z \ &Dm\ " \ " \ &L\ " \ " \ &7] " ] " ] "F ] "< "] &B-] "z 1] "r A] " E] " J] &|S] & ,Y]f1b] &<<h]V1q] &Zw]J1] &NS]1] &^] 3] &E ]3] &]2] &]2] &O]4] &] 4] &S]4] $~ ^ &Ie ^ " ^ " ^ &F ^ " $^ " -^/7^ $~ D^ " H^ " Q^ " U^ " ^^/h^ $~ u^ "+ y^ ") ^ "= ^ "; ^ $~ ^ "U ^ "M ^/^/^ " ^ " ^ " ^ " ^/_/_ &'%_._/E_CR_b_ &o_ `x_ &__ &_ _ &__ &_ _ &__/` $ ` " ` " ` $ $` " (` " 1`0;`0X` " \` " e` " i` " r`0|`0` " ` " ` "` "`0`0`0` "` "` ",a "* a0a0.a "D2a "B;a "S?a "QHa0ea(0oa $ |a "ka "ia "a "a "a "a;0a a0a0a "a "a0b0'b01b0Nb "Rb "[b0pb0b1b1b "b "b "b "b1b1b "b "b "b "c1c $ !c "%c "*c $ 3c ""7c "f "Gf " Kf "Pf3hf3uf3f3f3f3f3f/f0gUgC1Eg OgV1\gf1ign1g1gg1g2g<2g_ge2h2-h2:h3Gh 3Th.3lh63hb3ht3h3h 4h4i4i454i Ligi wiRi i &9iiij "/ j "-j ">j "<"j,jDj "VHj "TQj "eUj "c]j &]j &j &Ԉj &Lj &&j &ьj &j &k $ k &Ԉk "k "{!k &L,k "0k "5k &2@k "Dk "Ik &Tk "Xk "]k &,mk &&xk "|k "k "Ik "=k &ɂk "k "k &ьk "k "k "k "k &|kk &Iek "2k ",l &Fl "dl "Xl%l>l "Bl "Kl "Ol "Tlql $zl &l@l@l &l l &l ll $ m "m "m#m $0m "4m "?mgIm $Zm "^m "gm $lmym+mm $.m $.mm $Hm "m "m "m "m $Hm $Hnn4$n?n4]nunn n nn 0o &yo $&o &Ԉ1o "J5o "@:o &LEo "Io "|No &^o &KTyo "}o "o o &ÿo "o "o o &o " o " o &Xo &/~o "+o "#o &8 p &8p &8-p >p &8Ip "ZMp "TUp jp &up "yp "p p p "p "p "p "p "p "pG p "p "pT q q $ q "$q "-q $2q Jq+Wqgq qq $q "q "q q $q "q "q $q $q q $q "q "q "4r ".r $r $r+r48r SrA r r &r $ r &Ԉr "^r "Tr &Lr "r "r &7r "r "r &,s "s "s &|)s "M-s "?=s "As "Fs &Ls,Us &߶[s-ds &|ms,s &Ies &Fs "s "s,s,s ":s "8s "Ks "Is,s,t "] t "[t "nt "l"t,>t,Ht,et "it "~rt "vt "|t,t &t `t &t8t &t t &t0u &u u &'u(5u,?u $ Pu "Tu "]u,gu $ tu "xu "u,u,u "u "u $ u-u+uu $# v $# vq-v $= ,v "0v "9v "=v "Bv $= Kv $= Pvgv4tv\-vF-v-v-vv0w#w;wVw `www `w &w &Lw &@w &Lw &w &Lw &V x &|x x &=_)x &6x ?x &LxHWx &dx mx &zx@x &x &Lx &x $7x &Ԉx "0x "&x &`x "nx "bx &aWx "y "y &Ly "y "y &L&y "*y "/y &,Jy "NNy "D^y "by "}py "ty "yy &|y &߶yy $My &Iey &Fy "yy "oyty $My "y "y "y "yty $Mz " z "z "z ""z $M2zt("H $T ""X ""a ""e ""n " #r "#w $ "@# ":#("(" "_# "]# "o#ą "m#ͅ("ׅ(" "~# "|# "# "# ("(", "#0 "#9 "#= "#F("[ "#_ "#h$$ $ d"d"ˆ "#φ "#؆d"h"l" $  "## "#, "$0 "$5"R}cs"}" "($ "&$ "<$ "6$ "`$ "X$Ƈ"߇ "$ "$ "$ "$" $o  "$ "$! "$% "$* $o 3 "$7 "$B"L $ ] "$a "$j "%n "%s $ | "% "%" $  "% "% "*% "(%"ƈ $ ӈ "<%׈ ":% "Q% "O%####>#H#j "c%n "a%w "w%{ "q% "% "%# "% "% "% "%ĉ#Ή# "% "% "& "%# #$ "&( "&1 "!&5 "&:#R]$tr$$$ "3& "1&͊$׊$ "B& "@&%>!K!j!~ """ȋ$$$)%1x;3%Hg Xqd Ìތ! &/ &&< &LI &ԈV &|` 0n &{ ` & &' &/ǍPލ & "Y& "O& & "& "& &L "& "& &&% "&) "&. &t 9 "&= "&B &WM "'Q " 'V &ьa "1'e "/' &! && $ &o "F' ">'Ď &ю &kߎ $! &TT "s'! "q'* "s'. "q'7 "s'; "q'FP $a "'e "'j $s "'w "' "' "'  $ҏ "'֏ "'ߏ  $ "' "'   $ "'  "'% $. "(2 "'7Q[x "( "( "&( "$("͐Aא $ "5( "3( "I( "E(F1HUmT,DW &He &Lr &" &Ie &F &6Jƒ &LӒ &" &Ie &F &]k $/) &L4 "k(8 "](G "(K "(P &C%[ ")_ "(d &Wo "6)s "0)x &\ "Y) "S) &| &  &Ǔ $EГ &Ieۓ ")ߓ ") &F ") ")Z $E ") ")  ")$ ")-Z7 $ED ")H ")Q "*U "*^ $Eg "*k "*tZ~Z "7* "5* "H* "F*iє $Uڔ &' $k "X* "V*$< &I &k[e $~v "g*z "e* $ "v* "t* "* "*Õ $ϕ "*ӕ "*ܕ "* "* "* "* $ "* "* "*! "** "+. "+3 $< "+@ "+El "6+ "4+͖ז "E+ "C+ "W+ "U+ +5R "h+V "f+_ "y+c "w+h3 )ŗ ՗ &0ۗ $ & "+ "+ &W} "+  "+ & ", "+" &/ &&: "R,> "8,C &LN ",R ",W &0'g &C%r "-v "y- "- "- &W "- "- &| &oØ &И &kޘ9 &o "@. "4.  & &k( $1 &o< "|.@ "z.Fd:[ &of ".j ".u & &k $  &o ". ". $0 &o™ ".ƙ ".љ &ޙ @  & & &k $U' &o2 ".6 ".<@;Q &o\ ".` ".f;{ &o ". ".99 "/ "/Ț9ݚ99 $ "/ "/9& $7 "1/; "-/E $O9Y $j "G/n "E/w99 "V/ "T/99̛ "e/Л "c/ٛ "v/ݛ "r/999"9,9D "/H "/Q "/U "/^9w99 "/ "/9:˜ $ܜ "/ "/ "/ "/-:?1l:; $L "/P "/Y "0] " 0bw:}: $C " 0 "0 "@0 "<0:ȝ<V;V;  "X0 "V0 "m0 "e0$V;.V;K "0O "0XV;bV;~ "0 "0 "0 "0^;i;i;Ԟi;ޞi; "0 "0 "0 "0m;(p;2p;K "0O "0X "0\ "0eu;ou; "#1 "!1 "21 "01 "G1 "?1u;u;ԟ "m1؟ "k1 "|1 "z1 "1 "1 "1 "1;*;B;L $e] "1a "1j "1n "1s;; $x "1 "1;;ؠ "1ܠ "1;;  "2 "2 "2 "2!;:<D<a<k< "/2 "-2 ">2 "<2<; $ѡ "O2ա "K2ߡ $< $ "s2 "i2 $ "2 "2( "2, "2I "03M ",3V "H3Z "F3d>q $~ "]3 "U3 "3 "3= $ "3 "3 "3 "3ɢ=Ӣ $ "3 "3 "4 "4 $ "4 "4==7 "K4; "I4D "\4H "Z4N=q $~ "t4 "j4'='= "4 "4 "4 "4ȣ "4̣ "4ףU= $ "4 "4 $b=+)9=C $T "4X "4a "4e "4j $'s=} $< "65 "25 "Y5 "U5 $< $<eɤ4֤=c> $Q "x5 "r5c>( $k5 "59 "5Bc>L $Y "5] "5f " 6j "6sc>} $ "36 "-6 "Y6 "S6 "6 "y6 $ "6 "6¥c>̥c> "6 "6 "6 "6c> c>$ "6( "61 "75 "7>c>Hc>a "7e "7n "%7r "#7{c> "67 "27??Цc>ڦ $ "R7 "P7 "c7 "a7c> $ "s7 "q7( "7, "75c>? $K "7O "7X "7\ "7ec>o $| "7 "7 "7 "7> $ "7 "7§ "7Ƨ "7ϧ>٧ $ "8 "8 "8 "8 "/8 "+8 > $& "G8* "C83 "]87 "[8@ "n8D "j8I $R "8V "8[>>>> "8è "8̨ "8Ш "8ը>=" >:>V>` $q "8u "8z $ "9 " 9 "K9 "C9 "9 "9 "9 "9 "3: "%:ȩ ":̩ ":թ> "+; "#;> "i; "_; $, ";0 ";:3?D $-U ";Y ";c?| "; ";?? "< "; "<ª "<Ǫ?ު>? D x)9B9\:tI:Q:: ;ثV;<%<O<"_</g<Go<_t<l|<<> P@ά & }٬ &L "(< "< &ь "`< "X< &W# "<' "<, &m7 "<; "<@ &&K "<O "<Y &f &kt $} &o "= " = &o "B= "@=ʭ $ۭ "Q=߭ "O= $ "e= "a=" $( "=, "y=5"? $L "=P "=Y "=] "=f"p $| "= "= "> "> "#> "> $ "I> "E>""ۮ "_>߮ "]> "o> "m>"" "~> "|>$ ">( ">1";"T ">X ">a ">e ">n" "> ">AjɯEӯE "> "> "> ">P!6 &H &LU &ob &&o &| &, &ӫ &! &Wذ &z &Ie &F & &  &k4 &: $ E &:P "?T ">Y &d "A?h "7?m &x "}?| "s? & "? "? &5 "? "? &M "-@ ")@Ʊ "E@ʱ "A@ϱ &|ݱ &  & b$5 J &7\ &Li &zv &Dm &  "aM "]M "M "|M& *> $p G &R "MV "M_$'i$' "M "M "M "M "M "M & @¿ &Ͽ޿ &  &  $  &W "M# "M( $ 1 & >L &Y b &oy  & &k( $  "N "N $  ".N "*N "LN "DN  "zN "vN "N "N$P(= "NA "NJW(TW(v "Nz "N\(\( "N "N "N "Nd(d( "N "N " O " Oo((# $ 4 "O8 "OB $ O "0OS "*OX+)}K)(z(z( "QO "OO(( "cO! "aO* "uO. "sO3(R(\(y "O} "O(_)_) "O "O "O "Oj)((* &7 @ &M[%e% "O "O7& $  "O "Oi& $  "O "O $ & $P  $P  "O "O "O "O'&1&N " PR " P\'f $` w "$P{ ""P ">P ":P'&&e' $  "VP "TP $ {'.+;K'U $ f "hPj "fPs "|Pw "xP "P "P "P "P-( $  "P "P-(-( "P "P4(4( "P "P'4(14(J "PN "PW4(a4(z "P~ "PA(j)j) " Q " Qj)j) "Q "Qj)j)( "1Q, "/Q5j)?j)X "CQ\ "AQi&*s $*  "UQ "SQ $*  "dQ "bQ4*U* $@  "sQ "qQU* $S  "Q "Q U* $f  "Q$ "Q2 "Q6 "Q;Z*Zp*d $v u "Qy "Q "Q "Q "Q "Q "R "R "R "R** "$R ""R* $  "3R "1R "ER "CR "VR! "RR* "mR. "kR7 "~R; "|RD*N $ [ "R_ "Rj+t $  "R "R+ $  "R "R+ $  "R "R+ $  "R "R7&n&0$(\(u))))*h++*0 :PO Ypj  &l &W & &1 &]b &0 &W &! &1. &]bA &h#S &G`i &v &W & &k &M & &0 &W & &1 &]b" &')@ &:K "RO "RT &_ "Sc "Sh &s "BSw ":S| &, "nS "fS & "S "S &> $* &6k  "S "S ! $@3 $@@ "TD "TM "TQ "TZ "CT^ ";Tg "tTk "nT "T "T "T "T "U "T "U "U "uU "mU "U "U "U "U  $c  & "U* "U4 > [ "U_ "Uh r   " V "V  "V "V   " S r| $v $zzz "KV" "EV+5N "vVR "tV[ "V_ "Vh "Vl "Vw $ "V "V $ "V "V $ "V "V $ "V "V(ISp "Vt "V} "V "V "V "V "W "W "W "W "/W "'W "PW "NW "_W "]W "nW "lW "W  "W "W "W"2,2I "WM "WWoao~ "W "W "W "Woo "W "W "W "W $ "X "X "X "X "'X  "#X+5R "EXV "CX`j $ "TX "RX "mX "iX% $  "X "X% $  "X "X $  ->IK Vget @f &P  &6k "X "Xb z  &&= &H "YL "XQ &<\ "&Y` "Yp "`Yt "\Yy &L "Y "wY && "Y "Y &t  "Y "Y &ј "Y "Y &~4 "Z " Z ",Z "(Z  $ "GZ "EZ(E "VZI "TZS/]/z "eZ~ "cZ;NZo &.y@ &&% "vZ) "rZ. &ј9 "Z= "ZB &WM "ZQ "Zn &!} && & "Z "Z "Z "Z "Z "Z "Z "Z-EX &cz &t  "[ "[ &: "&[ "[ &" "O[ "G[ &L "r[ "p[ && "[ "[ $@ &o "[ "[ ' "[+ "[6C#Q &r[ $ f &t q "[u "[ "B\ "2\ "\ "\ &9 "] "\ &L "q] "k] & &, &]* "]. "]3 &> "]B "]R "R^V "J^[ &|d $ m &ox "^| "^ $  & "^ "^77 "^ "^ "^ "^ "^ "^ $0 & "_ "^ & "_ "_ &`Y8j &S| &p &# &/ & &88 "z` "x` "` "` "`  "` "` "`! "`% "`. "`2 "`? &L U &bp7z $  "` "` $ 7+8 $  "` "` $  "` "`k8 $G) "$a- "a6 "La: "Fa? $aH8R ${c "tag "nap "at "ay ${ ${ 4z8b8-9& (I &@V &:c &p &} &, & $$  &t  "a "a " b "a "fb "Vb &9 "b "b &n "b "b  &L "9c "3cT &,d &^o "fcs "\c "c "c &| $:  &o "c "c/6 & " d "d/6/6 "=d ";d "=d ";d "=d! ";d- &: C &P^5h5 "Nd "Ld $M 6+X6 $]  $]  "]d "[d6  $p  "qd "kd( "d, "d1 $ :6D $ U "dY "db "df "dk $ t $ y46g66 * &1H &:S " eW "e\ &g "=ek "3ep &{ "ie "ce &KT "e "e &Z "e "e & "e "e & * $g &V ""f " f & "4f  "0f>! &, $w5 &@ "QfD "MfJ &T &k " "nC &LN "nR "nb "nf "nk &9v "nz "n &W "|o "to &| $ & "o "o & "o "o & &pK &#X &/k &y &\\ "Fs "Ds "]s "[s "]s "[s "]s "[s "ns "ls "s "sz6 &C &kQ $Z &eBe "si "sn6G $ &eB "s "sQQ "s "s "t  "tjj< "t@ "tI "#tM "!tWa~ "2t "0t "At "?tQQ "Pt "Nt "_t "]t &  & 7rA $W "nt[ "lt`n3  & $ "t "{t "t "t &A "$u "u "ju "`u "u "u) "u- "u2 &|@ &Nuc &đv &  &  "u "u "u "u&Z> (q &1Qw $ "v "u "v "jv &A "v "v "`w "Lw "w "w "w "w "Bx "8x  &| &)> &đQ &d &đw &  &(BB "nx "lxBB "}x "{x B.F ~ & &ь &c &HR &K &ь &F &Ԉ &KT &| P  & %/ &< E &R0^ &e| && "x "x $ "x "x $ "x "x " y "y $ "%y "!y "?y ";y "[y" "Uy' $0 "}y4 "yy=Gd "yh "yq "yu "y~ "y "y "y "y "y "y "y "y  "y "y:H &t"V &&d &;r &: & & &, &Z &6k &v &e &ј &L & & &t * &W7 &5Q &lk &|u  &o & ` &@ & &k & &đ &+ &8 &kG &T ] &j8z &] &6k &  & &* & &L &" & &L &3 &? &K & W &lc &  &  & &P &M & &M &p & "z  "z & "fz "`z% &. "z2 "z8 &%A "zE "zK &T " {X "{^ &bg "4{k "0{t~ $ "N{ "H{ $ "z{ "r{ $ $ "{ "{ $ "{  "{ $+82N &MUn &F &6k & &  &W &4 &׌ &B & L  &) &G &S &` &,p &y} &M &eB &n &eB &@ &eB &E &eB &o* &eBC &?S &eBl &'p &k &87 &TF &ɡ &6k &FC &huD &3_ &+m &}  & &A &W & &A &W &O &( &A &L # &. &@ &WM &[ &y & &8 & &c & &( &' &  &2 &@ &h & & &) & &  & &k &, &{: &+J &nV &6h &zv & &W & &k &ޝ & & &s) &PT &W &qc# &W0 &U &s &1 & &J &bC & &_B & & &J &bC & &_B &* &7 &JD &bCQ &^ &_Bl &N_z &f &w &j &  &j &W &ܢ & &  &  &V  &+  &8  &O8W  &q  &/  &  &l  &?  &d=  &=  &N0f  &U  &%  &  &`  &  &$q  &O,  &6:  &Y  &mf  &ms  &6  &Ú  &A  &  &/  &  &  &  &Ph  &h  &h  &h  &h4  &iD  &!iT  &:id  &p  &Zi  &si  &j  &J  &%j  &>j  &Wj  &pj  &j  &j  &j  &&  &A3  &@  &R  &| ":| "Y| "U|  "z| "p|   "| "|& 0 $ A "|E "|N, X $i "|m "|s@  + "| "| "} "}+ $  "0} "*} "W} "O} $  "} "~} "}! "}* "}. "}7 $ D "}H "}Q $ Z "}^ "}e+}+,,,5, &d &d  &=  &B ! ! &S& ' * 'e . %`5 &| Q &V] &g &S)u &mHz &) &2 &, &@ &* &( & &+ & &:R &r- &=e &&s &Jx &) & &' & &7 &G &, &( &? & &_K &5%  &3O & &v;' &"3 &2? &K &?W &j &>o &{ &P &B7 &j &`L &3 &4G &SI & &{ & &  &/< &u@+ &/<9 &`OE & R &11_ &Gr & &9 & &11 &7 & &11 &I &, &L8 &RE &R &M` &Rm &z &M & &" &v+ &( & &< & &R &11 &Q$ &O2 &9@ &S N &\ &j &x &X) &( & &1 &K &" &e0 &, &9 &/ & &i" &[I0 &> &$L &Hi &/x &j6 &  &) &6 &+ &> &3 &?' &i &  &>- &g < &'QK &:Z &Gi &x & &  & &! &} &  & &y  &F &0K & &3,, &Q; &$J &]@Y &:h &w & & &]R &4 &@  & &/ & & &  &-  & +  &J:  &{8I  &eCX  &g  &G'v  &a%  &  &D  &  &  &D  &~J! &29! &dGG! &=U! &sEp! &~! &7! &D! &~J! &" &O" &" &9!" &# &# &"# &=V# &# &# &# &+# &# &# &$ &I+$ &$ &9$ &nF$ &.]$ &=i$ &8u$ &11$ &$ & $ &95$ &x$ &$ &I$ &-% &'!% &().% &;% &;H% &OV% &@d% &=r% &% &0% &N% &9% &,% &HN% &+J% &% &% &D& &?& &U& &F*& &&18& &M@F& &PT& &4b& &yHp& &~& && &P& &U2& && && &,' &' & ' &,/' &>' &MN' &]' &l' &{' &I' &O+' &' &$' &' &VJ' &*' &s ' &'( &( &_  ( &tQ/( &>( &M( &\( &Hk( &H$z( &( &10( &_2( &( &+( &( &"( &( &H) &) &) &K=) &8L) &k#[) &Qj) & y) &O) &%) &) &7H) &N) &-) &A) &O) &* &/* &J%* &D5* &AE* &U* &Ae* &;u* &* &.* &* &v* &* &HR* &y2* & + &3+ &+ &&.+ &L0=+ &HL+ &b3[+ &+j+ &@@y+ &I7+ &+ &+ &n0+ &+ &F+ &U&+ &+ &, &, &a, &L--, &=<, &#K, &Z, & i, &q.x, &->, &73, &, &(, &$D, &0(, &, &>;, &A- &K- &Q- &UR-- &4<- &$Y- &Xh- &w- &H:- &- &- &- &~3- &8- &Q- &- &- &) . &P. &E+. & :. &ZI. &rKX. &Bg. &?v. &#. &/. &L. &c. &. &2. &1. &x-. &w. &N  / &/ & */ &M9/ &H/ &wW/ &!f/ &U.u/ &R/ &+8/ &&/ &F/ &P%/ &_$/ &/ & / &E/ & 0 &60 &)0 &M80 &L6G0 &"V0 &y&e0 &,t0 &R/0 &0 &E0 &0 &20 &w0 &&%0 &80 &*0 &1 1 &=1 &g9(1 &_!71 &;F1 &BU1 & e1 &t1 &J1 &>1 &^1 &d1 &E1 & 1 &1 &1 & 1 &&5 2 & :2 &M(2 & 82 &0G2 &OV2 &&e2 &+t2 &2 &2 &%M2 &2 &K2 &2 &NC2 &372 &$2 & 3 &'3 &(3 &H573 &F3 &U3 &=d3 &s3 &3 &P3 &? 3 &;E3 &:3 &U!3 &;3 &23 &* 4 &54 &(4 &E74 &vRF4 &*U4 &id4 &Os4 &q4 &>4 &^ 4 &QD4 &>4 &S<4 &C4 &V4 &t"4 &= 5 &H5 &,5 &B5 &0;Q5 &R5 &+5 &x5 &5 &15 &95 &5 & 5 &>6 &86 & 6 &hL.6 &>6 &L6 &mDZ6 &h6 &+6 &6 &6 &6 &6 &G6 &C7 &E7 &%7 &$37 &A7 &P7 &[6^7 &kOl7 & z7 & 7 &&7 &7 &=7 &qC7 &:7 &aD7 &C7 &8 &Q8 &d%8 &0S8 & g8 &61|8 &28 &( 8 &8 &^48 &h8 &?38 &R-8 &L 9 &%9 &$$9 & 7,9 &Y99 &G9 &_+S9 &`9 &)m9 &5z9 &9 &y9 &9 &9 &,9 & 9 &I9 &C9 &: &: &(: &P4: &DA: &>N: &[: &NNh: & u: &gE: &: &: &: &7: &<: & : &.: &: &,: &; & ; &9(; &5; &B; & Z; &Fg; &t; &3; &; &5; &L'; &; &< &I< &R< &f5,< &4:< &SH< &'V< &@d< &{r< & < &< &Z< & < &7< &< &O< &-< &^;< &R< && = &)= &<(= & 6= &LD= &GR= &"`= &n= &I|= &2F= &#= &3= &P= &B= &= &= &= &Q= &0 > &> &'> &L4> &F,X> &=d> &PPp> &}> &> &> &I> &)> &~> & C> &"> &? & 0? &#? &#4? &-A? &N? &D? &(? &9J`@ &l@ &f@ &8Q@ &|@ &@ &(@ &RA &8;A &3A &(A &nEA &EA &A &A &A &F B &-B &q;B &,IB &WB &vB &B &IB &BB &B &B &F4B &B &vB &[C &w''C &bQ6C &&DC &&RC &,`C &|C &C &lAC &7C &r2C &%C &uC &{C &#;C &CD &5#D &I1D &bQ?D &4MD &[D &aiD &C~D &D &D &&D &D &D &j D &E &&E &E &9,E & 9E &11UE &"aE &@5nE &{E &E &aE &KE &E &E &F & F &f(F &F'F &CF &k OF &j!aF &$nF &{F &MF &,GF &=F &sF &F &EF &9F &G &MG & #G &%/G &y0;G &ZHG &y2UG &XQG &NG &G &qG &9JG &G &FG &G &<=G &]G &%H &H &c=H & H &'*H &>7H &EH & RH &0iH &h:vH &H &)H &H &H &C+H &RH &hH &@/H &I &yHI &2A"I & 0I &=I &oJI &%WI &F?jI &D8wI &I &PI &D8I &NI &gI &I &sI &'I &D8I &BJ &J &J &J/J &*J &x7J &NNDJ &QJ &1^J &d&kJ &xJ &J &J &VJ &J &,GJ &J &BJ &MK &EK &kG'K &L4K &sAK &NNNK &qK &rK~K & PK &HK &,7K &K &K &9K &RK &K &C  L &L &N$L &*2L &K?L &LL &MYL &FL &L &3L &+L &L &L &EL &=L &6M &M &)M &(@M & MM &ZM &KgM &~M &M &(M &KM &M &(M &9M &M &CM &N &~>N &(+N &<8N &ON &\N &B$iN &~@N &8N &\N &N &N &K,N &`HN &O & O &!O &`7/O &{ ;P &AHP &OUP &cP & }P &0P &ECP &EP &1P &P &P &@P &P &EQ &&Q &aQ & )Q &6Q &@DQ &LQQ &'^Q &kQ &!2xQ &2Q &Q &JQ &KQ &t/Q &Q &UPQ &Q &8Q &*Q &ER &('R &+5R &C+BR &"&PR &E]R &jR &8wR &8 R &R &R & R &CR &qR &-R &pR &C S &S &/#S &C1S &FS &CSS &)aS &AS &QQS &~DS &aS &S &S &)S &IS &KT & T &DT &@T &T &L-*T &C8T &1FT &1bT &pT &~T &T &HT &EOT &T &NAT &[9T &EQT &-T &. T &(3 U & U & )U &#(7U &EU &P SU &m(aU &/oU &}U &U &eU &U &%U &+U &p U &RU &`-U &!>U &  V &'.V &<'V &jQ5V &CV &L!QV &*_V &9LmV &{V &3V &:"V & V &]V &GV &MV &L8V & V &V &'W &W &_#W &42W &_ AW &N)OW &^W &9.lW &^#zW &wW &`IW &4W &,9W &!W &W & W &LW &W &X &X &"X &#0X & L>X &&LX &}(ZX &]3hX &X &}(X &WX &X &X &##X &X &4X &vDX & Y & (1Y &f;?Y &NY &e\Y &jY &)xY &GY &.Y & *Y &9.Y &Y &NY &Y & Y &Y &U2Z &QZ &-.Z & >Z &S=MZ & iZ &wZ &Z &Z &Z &Z &-Z &NZ &BZ &W [ &[ &c'[ &5[ &RD[ &:i[ &w[ &11[ &U![ &[ &&[ &5[ &[ &[ &[ &E\ &M\ &F$\ &92\ &@\ &fN\ &'\\ &#j\ &x\ &\ &\ &B\ &D\ &.:\ &M\ &\ &)\ &=] &] &8+] &9E] &ph] &[u] &<] &~:] &] &+J] &+?] &N] &y:] &J] &i* ^ &} ^ &s$^ &1^ &q>^ &0K^ &X^ &TOe^ &r^ &V5^ &^ &^ &^ &vR^ &M^ &z9^ &^ &C_ &+J_ &/&_ &R@_ &MM_ &vR`_ &G9_ &_ &1_ & '_ &1_ &_ & 6_ &K_ &"G_ &n` &P` &H:` &(` &55` &mB` &!O` &\` &i` &Dv` &{` &I#` &` &-` &` &8` &a &OWa &ea &sa &Ba &=a &Na &Fa &!a &a &a &a &0Ha &v( b &b &<)b &a7b &#Eb &Sb &Lab &ob &->}b &73b &b &C-b &b &Fb &6'b &!b &-b &b &! c &@c &tO%c &3c &MAc &GDOc &-]c &<kc &Lyc & c &qMc &5c &c &c &1Jc &Mc &c &?c &Ed &Jd &wd &&d &0d & =d &Jd &CWd &dd &)qd &~d &d &7d &<d &Md &S"d &d & d &Kd &-Rd & e &'&e &N0e &:e &Ye &cce &9#}e &e &e &e &e &1e & Le & e &e &*e &"e & f &!f &?$f &O.f &O8f &Bf &Of & \f &,&if &Wvf &f &@f &f &f &!f & f &KMf & f &C>f & f &g &5g &3g &o7,g &%Hg &LUg &Ibg &Nog &yH}g &.g &Bg &Jg &g &Gg &"g &g &g &zKh &Lh &I8h &. Dh &]h &4jh &!wh &4h &h &Ah &'h &%h & Ph & %h &@h &h &E2i &:7i &&Di &-Qi &^i &X;ki &)xi &GGi &Li &)i &*i &,i &Mi &Hi &ri &Ri &C j &)j &v&j &2j &eP>j &b<Jj &Vj & cj &qj &?j &@j &$9j &j &!j &p&j &j &*j &Mj &Rk &h%k &@/3k & ?k &SKk &D*Wk &Vck &jok & |k &)k &k &k &rLk &Nk &Lk &Ik &["k &+l &.l &L=l &MJl &vWl &dl &~l &2#l &l &24l &@l &l &xMl &) m &Dm &{)&m &3m &@m &;Mm &+[m &E jm &@xm &Am &m &)m &`Nm &Im &m &n &%n &$!n &N.n &BHn &Un &,hn &Kun &n &n &sn &>n &)n &&n &T7n &{)n &n &On &o &o &$ o &0+o &YE8o &Eo &:Ro &_o &tmo &.{o &o &+o &+o &o & o &o &rp &5p &.O)p &I6p &5Mp &w1Zp &5qp &7}p & Dp &"p &>p &Hp & p &yp &p &$q &q &Rq &q &r$q &+q &Bq &m8Hq &,Nq &OUq &Lbq &1oq &B|q &Xq &Xq &:q &q &q &@q &q &L r &Ir &HN&r &G3r &P@r & Mr &11gr & r &r &25r &xr &P:r &P:r &Ur &)r &Ms &Ks &}%s &72s &1D?s &zYs &fs &)ss &Ms &Cs &:s &'2s &Is &s &Cs &Ns &&s &.'t & t &\t &?''t &P4t &At &6Nt &`[t &ht &*ut &W?t &6t &)t &0t &t &^t &t &8t &Au &cF$u &:u &Fu &2bu &%uu &Ou &"u &u &u &$Eu &_u &Gu & v &Cv &N8v &Nv &Zv & v & v &8v &Av &Ov & w &w &%"w &6w & Dw &nRw &.pw &w &x &=Lx &Zx &sx &v!x &L.x &*x &+x &?x &Rx &Cy &Vy &B!y &6/y &=y &Ky &:Yy &Kgy &Kuy &6-y &y &k-y &&y &y &@y &Dy &y &z &C#z &-z &l=;z & Iz &"Xz &Efz &)uz &-z &Yz &z &iz &n z &z &.z &T9{ &{ &9&{ &w M{ &U0a{ &kOk{ &{ & { &F{ &N{ &,N{ &K{ &K{ &K| &-| & ;| &RI| &W| &3e| &MH| &N| &;| &| &(| &O+| &.| &| &| &O| &c } &<4} &S1)} &P7} &h"E} &GT} &c} &*g &LOu &I &= &O &WN &;2̂ & ق &9 &3 &11 &7" &)/ &ME &8 W &u &5 & &k& &"ڃ & &!* & &nN &<' &!4 &A &ZN &0[ &h &u & & & &< &8 &]Ä &),ׄ &A &  & &9& &64 &B &X#P &a^ &l &7z &u &7 & & &ƅ &#ԅ & &RB &88 &kI  & &F1( &U6 &fD &R &R` &-n &| &U & &N &j' &:† &І &ކ & &"A &  &1 &M% &4 &BK &WZ &,i &wx &b/ &A &0? &5 &\=ˇ &76 & &) &x &M &-B &=O &>\ &i &0v & &, & &' &q & 7Ĉ &ш &ވ & &E &6$ &/  &. &o*< & J &5X &Jf &>t & &n@ &) &. &> &ȉ &։ &0 &> &\P & &1 &P* &8 &F &)T &b &]p & ;~ &+ &> &n/ &9 &2NJ &1֊ &/ &3 &% &'/ &" &1 &]8@ &O &;^ &Fm &7| & &F &< &8 &7Nj &9֋ &b &v & & &! &0 &;? &g^ &m &?| & &2 &WH &  &&4Ό &ߌ & &h% &ȍ &PՍ &7 &5 &$ &^ 0 &! & &M &! & &KΎ &ێ &C & &8 &0 & &) &<C &:P &Ki &Vv &" & &sƏ &w6ӏ & &K &* &  &(*! &K. &; &)I &c &v & א &3/ & & &&L &= & &F & + &/8 &NF &R &w$_ &*l &yz &&$ &lB &A6 &n+ &+JÑ &ڑ &~L &> &L4 &5. &=; &" H &V &dj &Ew & &N &u5ޒ &Q &  &+ &"' &6= & I &B_ &5l &6y &= &"  & & BƓ &ԓ &2) &% & E  & &t4& &3 &:(@ &[M &Z &qJt & & K &](X &Qe &r &5 & &"R &8 &R˜ & И &! &C( &D= &(I &&^ &7j &fw &o & &ƙ &$ &P  &!+ &.7 &0+H &#N &T &=PZ &` &!f &-Il &s & &8 &8 &B< &B & &M &a% &2̚ &Z1ݚ & & &N &  &/  &23 & : &;D &?\ &E0h &G~ &C &` &E &-B & 8ʛ &כ &0 & &: &= &_# &J1 &? &?M &Q[ &i &)w &> & &2 &E! &. &$̜ &M &D &Q  &9 &- &#* &J0 &B6 &,= &Fj &4w &[, &= & &^ &Q &P(̝ &/ٝ &, &@ &@) &;  &B &l( &5 &NB &O &\ &i &_v & F & &>% &0 &I  &p Ȟ &+֞ &H &>M &= & &&  & &  & & % &), &E: &5H & V &Hd &r &. &4 & & &%  & &% &M3 &A &0O &%K] &-k &Ey &N & &" &_0 &H> &l L &fZ &[h &v &" &5 &I & $ &vG &."ʡ &ء & &" &e &> &^B &- &$; &GI &0W &)e &s &z &GG &u3 & &7Ȣ && &K &R &a &  &nF- & H; &SFI &4W &-f &~?t & &{ &3 & &? &NGȣ &֣ &x% &m1 &CH &I=פ &  & & &X &Fg &<t &" &? &å &ѥ &yOߥ &Z & 6 &&+  &1 &% &E3 &9A &O &=] &Ak &y &m &' & & &~, &kͦ &  &d &x &`9 &1F & "^ &k &6B &8  &M &˩ &ة &m> &Q, &X3 &: &F &$ &2 &@ &N &j \ &{Ej &x &I  &< &o3 & & &G̪ &ڪ &H &t> &K &  &l  &. &H< &aJ &jX &WGf &% &AK &J & &2 &k & &Cͫ &) & &y: &:" &f40 &h> &&L & 8Z &h &;v &/ &R &1 &R¬ &1Ϭ &cܬ & &n: &Q & &>" &~F( &5N/ &G> &AL &wZ &Gh & & & & &Mƭ &9 ԭ &Q &4 &t &J  &H &2( &6 &D &5R &ZD` &Jn &@| & & &  &. &® &hЮ &ޮ & &L & &*=, &E &<T &:^ &r &-| &h &X &  &  &"  &R$ &8 & &uA &#p & &H/ &]'} &J &z=m &3 &4 &3 &Ƕ &(Ͷ &N &W &4a &'! &?D &" &Lʸ &&׸ & & &  &~ &( &7 &nF &n?` &>l &x & &11 &" &=: & &$Ź &uҹ &E߹ &O & & &f7 &c ! &- &@: &G &L0T &*o &y &  &6 & &M &B &&Ⱥ &" &5 & & P& &~H3 &ES &m &Oz && &@ &# &O &^; & ͻ &ۻ &N? &5* &S &; &! &'/ &Z= &K &4d &wI &< & &A & &C̼ &Hټ &~H &C+ &l) &d  &K &4- &;; &hK &[ & k &)-| &`, && &7 & &= &A &þ &Xо &Nݾ &D &" &6/ &"< & PS &_ &l &Gz & && &O & &S &ο &'ܿ & &4 &8 &1EF &-T &9D & &K & &M & & &^;  &1E &K$ &; 1 &4> & &  &L &S; & &D &Q &,7^ &"k &1  &Y &"% &2 &? & &9 &7M &R & &M &4 &A &a &@Jn &F,{ & & &  &A &7< & &M & &OK! &(+ & 8 &E &-R &9D_ &yBl &Ay &  &:9 &#" &( &. &]5 &Q &a &Ir &7)x &.6~ & &Q &J &# &O & &! &  & &* &) && &K  &J &F) &N7 &-K & & &$ &[A &< &LL %$ &'P/ M &$X wv & J &E  ' &Y: &B ! &Z 'Y '2 %c &WV &Z &V &T &U &sY &Y# &V/ &iV= &TD &S[ &kTb &Vi &(`n &EW &mY &Y &Z &$V &+T &)S &S &^ &;Z &^T &`Y &T &Z &D_ &`Z &X+ &tT8 &_E &ZR &^_ &Vl &`Uy &W &W &:U &V &W &^ &y_ &W &\^ &,X &S &+^ &Y &S, &S8 &TD &RP &W\ &_h &gSu &U &UW &V &T &1Y &U &X &AV &TX &V &T &^ &Y &"_ &oV &f_ &U &Y% &^+ &Y1 &^7 &W= &SD &YT &#UZ &^` &PYr &_x &_~ &/Z &-U &JW &GZ &V &Z &U &X &X &J^ &8_ &X & ^ &U &sX &HT &:W &jX &U' &X4 &XE &^SK &#XQ &yWW &U] &^c &RZi &NSo &Xu &:` &ST &ZY &S &T &Y &ZY &S &T# &Y/M &`Y w &T ""/": G"W"b u-1..=1.L1.]!/rR70I[m$+++.=N_(z(///HPP P!2HWt0h4QfwNnQ3QKQcQzbb   )8GVet  <M -  o    <  <& ? p/m  p/  / /  /0 G G0{ ?2 W F1j  /  /  / /, /> /V /v  / / / 0 0 0  00 0-08 E0T0_ l(0w (0(00011111#1;H2Sr2_Wn2}2 3@3!F4h4!3 3!30?J Wfq e 71J s))3Ke g 4K p C   , H[ u  G     "5 H_`,u,u-u ,2uN,quI-u,+u;,L,^,o,,,,,,q-uq-u1V3o33t363Oyq33?3zy3tttttt.$:KU$aKpT @!1!GY!ye! !!-!<!U!y"#w$!i' "Oii! !!!!!""" "% y!C y!U "n "~ " " " " # # # !#!#8!#G!!V!!m!"!i!"!i!" "i!"$"F"(""(""(""(""(" #("A#2"`#("p#("#("#("#("#("#("#2"#d"#l"$l")$"=$#a$+#$"$#$"$"$"$"%"%"+%"=%"R%"d%#x%#%#%#%#%#&#&#"&#4&$C&$Z&P&&&&' 2'G't'T'''' ' ' ( ('(6(AJ(Al(0((0()l7)Z))Z)l)Z)Z)Z *Z*Z8*ZI*ZY*h*w*******+ +7+F+X+i+z++@9+0+w:+N,:S,[:,}9c-0-}9-0-}9-9A.9n.N}.[:.g:.:.:.3;.C;.;/9/92/9H/9W/9f/9w/9/9/9/9/:/:/l:0l:!0:A0:Y0V;n0V;0V;0V;0V;0i;0i;0p;0p;$1u;31u;H1u;n1u;}1u;1u;1u;1;1;1;1;2;2;02<?2<P2;t2<2N2=2N2=3N13>I3=^3=~3N3=3N3=3=3=4=4=<4NL4=]4=u4'=4N4'=4U=4=4N4=#5N75=F5NZ5=f5Ny5c>5c>5c>6c>46c>Z6c>6c>6n>6c>6c>6c>7c>7c>&7c>77c>D7n>S7c>d7c>t7c>7c>7c>7c>7c>7c>7>7> 8>8>08>H8>^8>o8>8>8>8>8>809?790L9>9?909>:04:0?:,?;0,;>P;0j;>;0;?;3?;~?;?<?<?)<a<<<<=C=R=f=="="="=">"$>"J>,`>"p>">">">">">">,>E>E? +?B? ]?~? ??-??-@.@9F@@`@P@k@f@y@k@@AA)A:AIA[AtAA$A@A$AB$-B@>BSTB_dBttBBBCFCCC DA ID: vD E F FA G G ,Gz =G cG ;H WH HP%HIP%QIiIb&IIi&IIq&IJ7&JI&UJ%J%J$'J/ K&=K/PK%pK'K$(K/K'K/Kb&L0L&XLsL&L&L&L&M&'M&OMbM&oM*M&M*M$'MM$'M(NP(/NP(MNP({Nd(NP(NW(NW(N\(Nd(Nd( Od(O(1O)ROz(dO(vO(O(O_)O_)O%O7&Oi&O&O' P&P%P'0P?P'WPe'iP'}P'P'P'P-(P-(P4(P4(P4(Qj) Qj)2Qj)DQj)VQ&*eQ4*tQU*QU*QU*QU*Qp*Qp*Qp*Rp*Rp*%R*4R*FR*WR*nR*R*R*R+R+R+R+RSCSoSSS` ST T/TDT ZTuT TT TT TU U `UvUUUU UU V V 7VLVfVwVVVVVVVVVWW0W2QW?`WSoWSWWW2WoWoWoWoXX(XFXUXnXX%XX%XXP Y'YaYYY>YYZ -Z HZ WZfZ/wZ@Z@ZZZ['[P[s[[[[[7#\C\7\\7\]7\]r]\7]]8]]:89^S^b8i^ ^\7^^7^^7_8{__8__8_ `80`G`8j`{`8`8`8`8`8`7`8`8%ak8:aMak8baua8aa8aa`5a b`5Jbgb`5bb`5bb`5%c:c5PcgcI6ccg6cc5c d/6-d>d/6Od5^d76rd6dd6dd6dd6de>ejeeee#f>5f>RfMpfMfMfMfMfff*g]gggggpgphp6hpihphhhhiZGiiZiiZj@jZejjZjjZk<?kPkShkSxkSkfkfkkkkklll(mjmmnynnnnXo}o3oooo pppppp+qtpt>%upEu>kupu>uuu>uuvOvxvvxv1wxawwxw0wxw0*xxCxB`xxoxB~xBxxx y&y@y\y~yyyyyyyyzzpgzpzpz{5{O{{{{{ |$|?|Z|{| | | |, |+}+1}+X}+}+}+}-,}+}&,  0@f    "-$8HPX_h>xAp> Z13IGZRbqZ|x+Fr  \2= M1 ] r      u    , +` 6Az Ydz wT 00;FPVulb/"T8C3Nd&tK$KT" ,CVi|nnn6!1^ATdty{ /9ISc nz !!!!!"i$"(" E" W"& "6 "@ P "` "p " " " #  # # P%  7& ;& P&* &? &Q &a &q $' K' K' ' -( P( m+  P( ( (+ &*A 4*T 4*g A*w p* * *  + + + + `, u , ,$ O-. u> q-H uX .h p/s  / / (0 1 r2 W 2 @3 ! t3% `50 ; 5N 5^ "6q 6{  6  6  7  07 7 7 7!818Hk8Rbm8l|8@909999:Q:l:!:1:D:V+;f;y;;;<N<'='='==N(=2N==GNR(>lc>c>c>c>W>>>>>0>.3?GS^h" 'K& 'r* '. '2 '6 ': '> 'B 'F '*J 'EN 'TR 'jV 'a 'f 'k 'p 'u 'z ' ' ' ' ' ' ' ' '& '/ '8 '> 'I 'T '^ 'g ' ' ' ' ' ' ' ' ' ' ' ' '  ' '% '1 '< 'G$ 'U) ']. 'e3 'j8 's= 'yB 'G 'L 'Q 'V '[ '` 'e 'j 'o ' t '!y '*~ '7 '@ 'L '_ 'o 'z ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' '# '- '7 '? 'K '[ 'd  'r '~ ' ' '# '( '- '2 '7 '< 'A 'F 'K '$P '2U 'BZ 'S_ 'dd 'oi '|n 's 'x '} ' ' ' ' ' ' ' '& '5 '; 'B 'H 'Q '] 'f 'p ' ' ' ' ' ' ' ' ' ' ' '  ' ' ' ' '#" '.' '3, '@1 'F6 'L; 'U@ '_E 'iJ 'rO 'zT 'Y '^ 'c 'h 'm 'r 'w '| ' ' ' ' '  '  '  ',  '>  'H  'S  ']  'e  'n  'x  '  '  '  '  '  '  '  '  '  '  '  '  '  '  '  '  ''  '3 ! '= & 'C + 'I 0 'T 5 '_ : 'g ? 't D '~ I ' N ' S ' X ' ] ' b ' g ' l ' q ' v ' { '  '  '  ''  '<  'K  'Z Xl`` ' ` ' ` ' ` ' ` '# ` '8 ` 'H ` '_ ` 'v ` ' ` ' ` ' ` ' ` ' ` ' ` ' ` ' ` ' a ' a ' a ' a ' a '% a ', !a '5 &a 'A +a 'T 0a 'd 5a 'o :a '| ?a ' Da ' Ia ' Na ' Sa ' Xa ' ]a ' ba ' ga ' la 'qa 'va '){a '7a '=a 'Qa '_a 'ga 'ra 'za 'a 'a 'a 'a 'a 'a 'a 'a 'a 'a 'a 'a 'a 'a ',a ';a 'Na '^a 'ma '{b 'b ' b 'b 'b 'b ' b '%b '*b '/b '4b '9b '.>b 'CCb 'XHb '_Mb 'oRb '~Wb '\b 'ab 'fb 'kb 'pb 'ub 'zb 'b 'b 'b 'b 'b 'b 'b ' b 'b ' b '(b ':b 'Fb 'Vb 'ab 'hb 'rb 'b 'b 'b 'b 'b 'b 'b 'b 'b 'c 'c ' c 'c 'c 'c 'c '$c '!)c '/.c '63c '@8c 'K=c 'ZBc 'iGc 'pLc 'yQc 'Vc '[c '`c 'ec 'jc 'oc 'tc 'yc '~c 'c 'c 'c 'c 'c 'c '!c 'qc 'c 'c 'c 'c 'c 'c ' c '#c '3c '>c 'Fc 'Qd '[d 'f d 'nd 'yd 'd ' d '%d '*d '/d '4d '9d '>d 'Cd 'Hd 'Md 'Rd 'Wd '\d ' * 4 *8L *P@| *  * * *  *\ *`$ * *p  *pD *H>t *x *Z4 *8 *x * * *\ *`P  * *  *  * < *@`  * * * *0L *Pt *xP *4 *83\ *` * * < *@ l *p  *  * P * l *p p *  * t *x  *  * $ *( P%l *p  * + * `,< *@ ud *h - * p/, *0T *X`5 * *7< *@d *h@9 *0.symtab.strtab.shstrtab.rela.text.rela.init.text.rela.text.unlikely.rela.altinstr_replacement.rela.exit.text.rela.altinstructions.rodata.str1.1.rela__mcount_loc.rela.smp_locks.rodata.str1.8.rela.rodata.modinfo.rela.retpoline_sites.rela.return_sites.rela.call_sites.orc_unwind.rela.orc_unwind_ip.note.gnu.property.note.gnu.build-id.note.Linux.orc_header.rela__bug_table.rela__patchable_function_entries.codetag.alloc_tags.rela.data.rela.exit.data.rela.init.data.rela.printk_index.data..read_mostly.rela.gnu.linkonce.this_module.bss.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.rela.debug_rnglists.rela.debug_line.debug_str.debug_line_str.comment.note.GNU-stack.rela.debug_frame @@ @!-E+P@o&@OPE;@j6@ Q EO)F"J@^`EjPF<e@p^E zF~u@_E 2GHH@`EI@@dE2(JO @fE\]@y0E]@@yEn^ @}$Erd",rl '@08E;|@N@|$ad|0m|~| y@0E#|X@E% ~ ~ @E(@pE*@E,H@E.X@@x0E10 :5@hcE4FW[Yk ~T@G iE7ni@ E9r}@H @E;ad@ H'E=0d`F`0 0T @ EC%F  p