ELF>0=@@RD0GNUAWAVAUATUHSHHDERIE17HL|DAIĬE9LE,$E$AAA9EtAL$At$ɉ D x9lt 9AD$ A|$ \D9El$fAAŃA|$I|$ELcLHv I9I9 AED$D$ HD$ D$D$ D9}hDeLfAAEAH<$ED$ AGfD9u|$ tH$IwHAIǬE9||$HŬ9|$ o1$DHHDLH[]A\A]A^A_HHDDLĹDt$IDHHDH}DDL뼹똹HHxndDHH H > 4ff.AWAAVAUATIUHSH(HL$ DH= IH"Mc$ LHHIc$I91HAAIc$I]D|$HI]HLIH=(D$CLLCCHCCC HHHHHC(AwuJE$AWLDD$$$DD$uuA$|Ht$ LuwAtqIO HU(Hu(HHt$HT$H $H $HT$Ht$HJIW Iw(HM(HLA$tLH$$$I}L$H([]A\A]A^A_eHJHHAAWHLE1ILH$LADŽ$tHL;f.ATIUHS9MLA$I$HcL1HiɬHHHyI$HHH)H)΁HHHcHDLpLÅu HDLHu []A\HHtHH I(f.AWAVAUATIUSHHH9HLpzAELsffCMc}IEILHLIcE1)I<HcH޿ȉILpH9tlIHHc`AHi۬I$WHH{HHHHHH)H)ށìHIc$I$1LE$IpHulI$HLE$H[]A\A]A^A_=LH$HH H$H[]A\A]A^A_AWAVAUATUSH(xeL,%(Ll$ Ik=HcIH/ H⸀LH9NAlAiD!AHH}PrHD$HD$DH{8HHIcHkHHcE HtHIA|ULEt{tvHHHuLt$H\$MuLLxz`HIcHLHMLMeHHHE1HLLHIDžHD$ eH+%(H([]A\A]A^A_AL$tnIcHHHIc~oHiЬI1H9HHCH)HH5HLHHyH1H5HHH)LH)΁HH9u1HLLa HLLFIHAA\A+`A]HE1E1oDLHtGPt@H9HcHcHHHcHHH@AHŬE;EtH=X HHEȉ|EȉMPɉU ЈP}uELfAx)ʉf=HHLHHcƄD`tPtAEMcKp|KpAhAƃLX?HcHHHH H HHj=7HHLD$H4$ LD$H4$)ыHLPE1E1H=X HHǀHHH|Hlayout vHH volumeHAxǃ +HHHHHH`IcIpAHDLXIpAAh9)EAAAT$lA@9AT$p9 1IA9HtHLHLAH9LMpHMttA|tHt;C;CA9{ ;CA9CtIXHHLHCI14HHL HL1HLL/HcIHcLt$H\$ILHIILDHHILrHLLLL]HLHLIHLOH$Hc,$yoeHLHLH\$H|$HIDžHHLA`uAHLCHLHLHLpf.f.AVAUIATUHSLXHMxLHc`IpHxdLHHHHHHHIHLdL[L]A\A]A^HtHLLcHHڋ|HLLcPHLA\HLLc?HLLc"PHLHHLLcLIff.@S1HH[AWAVAUATAUHSH~ LxHcMcLMiHpH|D|EDEx9lt JA9KPШ D;\D);LHcLHH $H>HcIH9HcHcHHH;|9HHH9H)H9HLPpLPHDX L$Afx DuA9L9@PD9E9D9H<$LL1H[]A\A]A^A_H $H9P@;|;H9H=HB(vHHDHH)HHDHHHHDLL HHHHHH|HcHHDHHmHGH;H/HHHHDHHHcHwHAVHAUATUSHHG@eH,%(Hl$HD$HD$Hx@H1HIHHLl$Lt$LHHuHcH|$HuoLHHu D$9`uHIwID$HtH@HtLHD$eH+%(uSHH[]A\A]A^HLHHHIwID$HtH@HtL1AWIAVAUATUSH.eH%(H$1H|$HAtH=IX HHHIGhHǃHC@HǃHǃAF=MxLDHcIHpHD$SIcIvE1Ht$&}ff.ff.fII9t\KpHtꀿxuAF9uHt$HǤH$H$uHT$DHLAxșA~)IVHcHD1HA|9)ALIAAxAN쉫`AFIFIHH$H H HIIH<$LLLXH3HHLAąIL|A)ALHDLHH$eH+%(BHD[]A\A]A^A_PeHAXAHHIFPAFPMNZYHLACDIcD1ff.fHH9&IpuA+HLA`lA|HHAH=HHc9H1HLLHD$LHpAhHLAG`UHߋ`HHǃ0% I\HLAą1H|$(HD$%HDŽ$H|LcȉD$ȉD$ȉD$ DffD$&D$$PtƄ$IIH4$LH|$(LHT$AąN1HLA(A1A;LyteHHHj=<HLH HL|HH HH HHHHHLLHD$LHǀpAhHLAHL례=mHLH DAADAWAVAUATIUSHL?A`IX$A|D$fA|$Hc$L4M9ptLxLAd~QL$$H[]A\A]A^A_eHXHHD$bAƇxLLHLLIdžpA|E1OAE9|~BDLHt$HH߉D$LMpD$ LILLD$)HhLLHt1H[]A\A]A^A_t⋃ փ;}ˉHt1뻋4$1HVff.AWAVAUATUSHL/eH%(H$1H|$0HL$,H)IXHD$,HDŽ$HA`DtD$EKDA5A9|LHD$H=TLxLLt$AddH|$AE|E)D|$ EDA)D$$BAE95DLHtALAH|$H$eH+%(pHD[]A\A]A^A_eHE|HXVHDD$ AZA9HHAbH|$D9lDL|$L)LD$ A|IHH|$MHA|HD$Hct$H|$4HL$,HHT$,IHiH)HHHD$,HH)΁H$HDHȉD$,ADžKAu(IcHcHHH H IIH|$LH.AD;DHLtH|$D$ HߋD$$L|$LLIHH|$MHA|HD$t$HH|$D$E|D$$D$ Dd$Ht$LNDd$3fDAWAVAAUIIcATIUHSHHσt6E1)HcEAL[DHL]A\A]A^A_AlD|A!D)HcDLLuf[1]A\A]A^A_[LDHL]AA\E1A]A^A_1eHHHff.@AUIATIUHSfAP0APHcxI@HLHIÅu,A|[A9|~OLHtÉ[]A\A]`eHMHHUHÅuMtIBeHDD$HHHL$AAT$@HLLHHLLeHLQeHHHIcH@GeHA|HHeHAHHUeHAHH#eHHHP@LHIcTAdžtHLAdžt^AHLgHLSHL?A@HL%A A5ff.ATAUSHHZH|H|tE9H\HHƃHLch1ҾHHLHcHH9X1ҾHHHHP@H(HtHHHHHHHHHHߋP@HL1[]A\Hݸf.f.f.USHG H_(HHØHXHXH߉[]fDUSHn H]fPuq tDPH@H1[]HXDMHHD`XeHPt`HXHP PH@H1[]HXL0HHH8DXeH`PXff.AUATIUHoLx7E1AD$ AŁAfDH=wID$ 1H]A\A]eHEAHHD$D$fATUHSHHXHxlhptu@HǃhHǃpDeEHXHxD[]A\`HXHAAWIAVAUIATUSH(HG H4$L I$XHD$DA$PkIMI$MH9tDJ4HH)H9Ic$LBI9lHLT$HL$IHDLT$HL$A$I9HHL$MIF1LT$ HIEHD$CHLH<$HLHD$H,$I9IFHMALALA$jH|$)9LMT$AZ/A;$uD$1HcImI)H9S LHH([]A\A]A^A_eHLHLE$`HLT$LT$2HD$lBL!HcxH(1[]A\A]A^A_eHA$`HHLT$IMLT$I$LT$ LL$H$H([]A\A]A^A_L$Hc$I$XHHI$XHHHfDHG HPu HHXHHff.ATUSH eH,%(Hl$HAo@H@o@t!HT$eH+%(H []A\H$HD$HD$DHHHHut$Hx<$|1HH=wHE1ɀ|$4$A|$T$HAL$ EHAEDHHcfHӅutH1HHceHHHeHHHHHwHIcgUHSHHXHxHhtp}HXHǃlHxE[]AWAVAUATUSHHhHo eH%(HD$`1LmMXO@O@&O@[O@H|$PHHD$PHD$XI|$PIIİLHMH|$XLE1P ЈPO@POthO@HӅx}ItZAtPIxEA;|}<DLLoLcH HIHHHD$`eH+%(HhL[]A\A]A^A_H|$PHHD$PIut$PHLc럁O@HօHLcqOHօdHLcCL|$PHHD$PHD$XLI }IAD$PIA;|D$TA;HCLcELLL|$TLcHSxIlH$IKHHI,}IIc|IcH$HH9Hy_IIeHA`AHH|LzH*LcEH$LLH<$LckLLH)Nff.@AWIAVAUATUSHH0Ho LmIXHD$AP0H$H|$HLL$AEtZAP A`H|$H|$McԺLAPL$H9L$LH0[]A\A]A^A_L$AEyH|$DLHIcH0[]A\A]A^A_@IDAtI A1HHHD$HD$AԋlFzIM II)L9HcMBLsHcI9s D!HcL\$ LT$H<$HHUH<$LT$HI9IFIMDH|$EMH$ALT$(H<$1HH<$HHH $T$EEH|$LEE;uD$E1HD$ I)HH(HD$I9IFIMAC f.f.XxF|FlF FtFG`FwYSHHHtRXxC|ClC CtCG`C1[[@SHtA;$|}4A$PuqLLuA$`L[]A\A][]A\A]eHA$`AHHd뽸DATAUSHt%HÉHDH߉[]A\AUATUHSL'M$Xf}A$x>A;$|}4A$PuqLujL[L]E1A\E11A][]A\A]eHA$`AHHd뽸붸ff.USH/fx;|}Pu@H[]`eHAHH릸ff.fHHATIUHHS ʼnt []A\HLH[]A\LXH`xQA;}HxD9}:AA x2;(tPu 19u;~fAWAVAUEATAUSDHL?HT$IXE`H $fLD#A…uuQHD[]A\A]A^A_eHAEH|$HHATHD$YH8똉D$AEAUHT$LH|$ZDT$tAƒyAt AdH<$DHAPff.@AWAVAUEATAUSDHL?HT$IXE`H $fLDA…uuQHD[]A\A]A^A_eHAEH|$HHATHD$YH8똉D$AEAUHL$LH|$ZDT$tAƒyAt AdH<$DHAPff.@HHHX`pX|HHHHHPH PH$H(H,H0HHH8PHPHH@@HЋ`PX|PHHPPPP PP$P(P,P0HHP8PHpHP@ff.AVIAUATIUHSHeH%(H$1Lt$HH$HD$LHLÅt-H$eH+%(H[]A\A]A^1HLHuD$f%f= u9|$<ED$<%A$t EukaUSHHeH,%(Hl$$D$fHHt;uDHT$eH+%(upH[]eHHAHHHT$HHtHHD$eH+%(ut$<$H[]f.f.LJtHDAWA׺PAVAUIATUS@ HH=H;@ HHx(HHM]LD}MLMu D;x|H@Ht;X}H@HuMMf.Ml$IEHtIA9\$}^ID$Ml$HuLeLH1HEHEImE LHHH[]A\A]A^A_AD$D9MmIUID9LOgHHIMtHfAT@ UHH=SHt^Lc@ HLHt:HcI91HHHCHcHH H[]A\H1ff.AVLAUILATAUSIHt;k|=D;c|5~ H[Huk H{(C t[L]A\A]A^H[IHHL[]A\A]A^AVLAUILATAUSIHt;k|=D;c|5~ H[Huk H{(C t[L]A\A]A^H[IHHL[]A\A]A^AWAVIAUATEUSH HX`HT$HHL$DD$D$AŅIHLcHBD$fHT$DH@EIHH8HF,D$xL$t$E1HE1EeHHDHAUUDD$ DL$_AXbH8H D[]A\A]A^A_t$HHt$L$ED|HD$ADHAUDD$ HL$H8ZDL$GT$HHT$EHH߉D$H8DL$t$ADHDL$DL$uEDHHDL$DL$HHtt Hff.ATLUSHLHLHEHH[]A\ff.2HHHcHBff.fUH=S HttHHcH<H>uR HEHtE~1t&ٸHHUHH9uH[]1HEHHff.HtSHH?H[ATAUHSHHHLHMIc1HE~f.I H HH9u[]A\fATUHSLHHMtI<$LHH[]A\HHHcHff.fAWAVAUATUSHDtD`EIDHH=Hx(I$HHcHDEHT$8Ht$HT$XHHAH|$PHH|$PAHPHD$HHHD$HDHE} HT$HIE(D$hAEAEADžtlH|$0H8t$DDAHDHHHHl$,D$LHL|LHDDD$hH|$0AESHD$ DLt$`H8Dl$(HHHB t$DDAHHHL|$IL|T$(HADžtJtEH|$0H8t$DHADDHHVH|$@HHHtDHHA}H8Et$ DH=D$ABHD $D $;HHtt4H|$0AH{DHHYH\H|$0AWAVIAUATUSH(`HL$tT$D$lAIHEEύP9DDl$HIHT$t$HH(H=Hx(AHHHD$HH|$HPHD$ Ht$HD$ IcտAHHE(ȉED$Ht$ȉE EAȉEEDmD}E IHHcD$HLt$ AIDL$HL$E1Lt$H|$ |ŃtEH|$LH|$INHLHHHIU(AuA틃ttfT$t$HI|$LH(D[]A\A]A^A_D!ЉD$7AŅtAAAHfDAWAVAUATUSH0DtHL$EcHIEE`D$AIH;HL8HHL$ t$HH=VHx(HHH$HH<$HPHD$HL$HD$IcHt$HIG(ȁAGAG AGAAGDAWfAOAG DD$,Ll$Dd$(DL$(HL$E1LH|$-AŃtEH<$LH<$IL$HLHHHIW(l$,uD苓tt$H߉$Q$H|$ $I~L$H0[]A\A]A^A_tH0[]A\A]A^A_H0LHE1[E1]1A\A]A^A_q^eHL$AHH뉸H߉$($AWAVAUATUSHH8H8L)4$T$HL$HAmEe ADA}AEx)L$L$ A~DLxMcLL|$NpLMDH~IH=Hx(IHIc $Ht$ H9 DADHVH8D[]A\A]A^A_eHEHHD$PDL$A}YAEȉ‰D$lT!‰T$ LLAG AG LDAKDHeHEHHPDL$ZHHHD$(D|HHDD$ $t eA}yHcT$HAD$~AAEAEE} HH|$0LH|$0IGIHM}(t$HHT$ADžqH|$(eHHHAeHEHHmLHLDeHL$ HHHT$t$H߹ADžD$KIHHt$ $H9 Ll$LIHHt$ LL$H HL|T$LHDD$ AǃA{L$HHA\AG w`H¸DC< $HHAHT$HD$D$ gAHHtt AHff.AWAVAUATUSH8H<$]Ht$HcHT$ L,H=: LAIHL HD$0IHHcM1HL$ELt$(-ff.ID$IIL9d$nIH$DNpMtIc|H<H> IHIc|1H<H>@ IEHaA|~EIA|~'IMHcЃIA9|H$H|$ Dd$ )D9OHHx8HHtOHcWI HHuH$L$ H|$)9LHHx8HHtOHcWIE HHuA|+Uff.f.HA9|/ID IEDAE9uAtA`H<$HeH=HHIELt$(Hu.LH|$0H8[]A\A]A^A_Lt$(1Ll$0L$$HcHcIptI<I|HuLILt$(mLt$(`Lt$(I?Kff.AWIAVIAUATUSH0DAdžHE1IHIcMG(IdžIDjHHIEDl$,LIՉT$(L$fHCL9[HIpHt|HH=LHMtI<$HD$LHD$HHAL)9ڍOHoH8HHD$HUL`Ll$ MH\$HLt$IcE ;|}1HHAuH4HHHt[LhIcE ;||Ht$Me LMw0H$LLtH$Mg0HMu(IE M&HHuH\$Ll$ Lt$HCL9l$(Dl$,AAAAD1H0[]A\A]A^A_HLIpMxLeMt*M$HMtI}LIDŽ$HHL9ueHHHMHeHH1ۋJHLA`uLEHc0LAA9|-A)AAHLAIv!HcHigfffH")D9/HLA`uAA)x1oHLfSHHHNVFv@u49|9unHHwI1H[@κHH<$H<$HHHHH<$H<$ljHH<$H<$뭉HH<$H<$ATUHSD^HDVNDN DfCv{DxAaɉAD  4Q~G EAT$v~AAA҃(DD9A9At>Et![]A\S -tHHM$D9~A)D9uS[1]A\}HHHHHHHdHHHHHHHHHHHHqHH]HHIHH5HH!HH Dt-ATAUHSH=UBI!uVHtu1[]A\1DHHDHHH븉A!IBUHff.ATUSHHL9Pu1H[]A\HcTHcLHxtfӉ‰HH߉D$D$eHD$HHD$ff.fAWIAVIAUATAUSH eH,%(Hl$DHD$DA9PEBD%A;TAAAIcTHcAHIcHHD$HcH$IH$MHL$Ht$A…3t?mHD$HAt6PHAAATDLY^HD$HAuPDAAATHLDT$XZH$H9D$DT$uXHD$eH+%((H D[]A\A]A^A_eHAɉAHHAuLHL$D$EeAZH$H;D$A=D$D$iЃ7vf HLH$H;D$AeHHHf.AUA@ ATIUSHcH1DA@HLHƒtu@<H޿K<9u:A$t=UBI#udHLu(1H[]A\A]HLDHLH߽봽ȹ#IBUHLfATUSHHL9PtuXu H[]A\HcTHcLHtىHHD$D$H[]A\HHAWAVAAUIATIUSHDA9PA@1ɉLLÅA$AA=UBI#@LjEKDH[]A\A]A^A_eHHHGtUuA<$UBI#t먺<LEL$H9uHtHHCHBHHHH"HCf1[HH9uKSH[eHKHH1AVLAUATUSHLDEunHDǃL0@ H=IHYH@t6HH%D[]A\A]A^E1LD[]A\A]A^HHLHHD[]A\A]A^eHHH2HtHuHHIHH Hu"8ff.ff.fHHtHJHr;z~HHHA+MfeHHHsLA1ATIUHSHI$HË@HtB H"ff.ff.HHHtHHHP;pHHuA$u&A$HHH[]A\HHuˋKSIHL묐UHSHHu'[]ff.ff.H^HtHH[HtHH[HuHHHHvH9st,HCHcVHHH=xHCҐAWAVAUATAUHSHHLcvMDEHc@ IHuDHD$Aąx7HuIIDIMwLHAąLHD[]A\A]A^A_eHNMHHD}=EHc@ D$Ht$1HHHD$LD$txtsLeHMHHu D$ADmLLU;~LI@IcHH9zHH)HjT$HHLD$HD$HT$HDHH|$ALHHAbA_ff.AWAVAUATUHSHHLfDv D~$El$fU(LHŅDHHE 1HrE1ADDLHH[]A\A]A^A_eHED$EDHHAW^NHHHD$uHHLWIH|$HH$H|$HcHHHLHMeMI9tv"IDLtIUIEHBHMuH4$LH"IE HcI4$MMHHHI9u B H|$H߾H[]A\A]A^A_AMeHHHEE+LLIcT$HLHH=LtHvA|$?OLǃOH|$ZLLIcT$HLHH=Ll^LxLtL牃DHHDHŅLHXHHH!HHH1HH!H1Ѕ tHXH߉HHL1UǃHHIcT$HLHH=HDHHLLLDHHDHŅHXHHH HHLHH?ff.ATUHSHtkLffHHIcT$L1HH=[]A\eHAL$HHED$ H߉[]A\@UAHAWAϹAVEAUATISHHHPeH%(HD$H1Ll$LHfLLH\$(DL$0D|$4Dt$8vHT$HeH+%(uBHe[A\A]A^A_]eHNT$ HHDL$ ff.@AWAVAUAATUSHHH8Et1H8[]A\A]A^A_H=@ IHH Lc@ LHH HcI91HHcIl$HH8I,$HHD$HHHD$HHH$HHDEHHHHHkHHHD$HIIHtHL^ Ht$LDD$ LH<$LAv1LHvmt ANHH߉D$D$AWANAHAHR‰D$ AYD$H,$D$HHLHǃHǃǃǃIcNHH=IcOHLHH=HI|$LD$DtEH|$$H|$$IH8[]A\A]A^A_E1HHHA1HeHǃH<$H|$H|$I|$L|HHHD$HI3IHtD@AND)=DHLocH-DPANeHHHEGREAWLHAvȉD$E ȉ-P<d;hD$4D$(D$0D$$D$,|$DH<$D$(D$,/D$ D$4D\$$EHǃH<$HǃǃI|$LDD$0T$LHYE T$ALHh,tHLsHt$LDD$ t$ I|$LH<$HǃH<$HǃǃǃT$E1LHDT$E1LHHDH|$H|$cDD$4AD$,D$(D$0D$$fD$eHANAHEGHHL DEHǃH<$HǃǃI|$LHQLH_DD$$D$4D$,D$(D$0 DD$4D$,D$(D$0D$$D$ HL'deHHHwEFEOHHeHANAGPAXCHL[eHAND$HHD$eHANHHeHAND$HHD$HL H<$HǃHǃǃǃT$E1LHt8AVEOAHߋL$H4HL3eHHHeHANAHHPAGPDD$(XZeHAOAHDD$H D$$D$,D$(D$4D$0+D$$D$4D$,D$(D$0|$9ANEGHHD$D$@L4$D$LIcOHLHH=LD$D$,D$(D$0D$$D$4UHH߉D$ D$ CLyH߉$b$;ANAVHHLD$ANAVHHLD$|@AUAATI UHH=SHHI$HHCH HEu0AL$ AT$E1E1HHu=E1[D]A\A]1HHAąuHHAHHcSHHH=D[]A\A]AfAWAVAUAATUSHHt$T$DD$ DED9PH`McHHH$IeL5.L9fHLLLHHN< MuH1H<$H[]A\A]A^A_ADHHeHHH L9HLLtbtHLLLHDD$ HE1ɋL$T$LÅudH<$HLetcL!LLDǃHLL+H|HLAƅtrLtHLLLdDt$ eHDHH;AwH*DHHttzHH<$HLAOAWMHHAOAWMHH HyAOAWMHHff.AWAVAULcHATDMIUSHLeL=>HH1uGHHu4H9ucLfLHJ,(H9uL1[]A\A]A^A_ADHHHHt0LtHH|ttLHuH u+HHmLH1[]A\A]A^A_DHHtt4L(MUMHHjHAWAVAAUATAUHSHDHHH$LH<$HLILM9AAt+E9g$t%HHI9IAHE9g$utIIGHBHHIH"IG H1IGLHHHH<$&HLIHE9w AHHII9tHE9w &HHII9uHH<$H$HH1H[]A\A]A^A_eHD EHHbH<$D$ D$ H[]A\A]A^A_fAWAVAUATUSHT$H9PrLLLcLLHN,MLHLHt*LLH[]A\A]A^A_HL uL;tL;tLT$LHJ,HHHjHHSH;FH;9HHHH9ufHH9H9uuHHHULH߾ËD$ ظDLLLLL$H1ɉDTHH|$1xHH93HHtHH7HHltXHHLD$HHAAEALff.AWHAVE1AUL4ATLUeH-SHLuNfLHHH9t tt}EL1Efǃ01[]A\A]A^A_Ht1q|LHH맋0uhLHADžt[LHHE~A ~= LHHtt)ǃ0EEH͐AWHAVAUATIHǠUSHH GHLJPHLJ@HLJ8HLJ0Ht$HI$HHA$XI$4HA$I$I$I$Ic$PH<H= I$HxI$I$ff.@HH@HH9uHL$1ADŽ$ADŽ$HA(Li(H8HXLwI9uIF IV LH I9tuIH1LxÅtLI$L I$LI$LI$H []A\A]A^A_HL$HALiLxI9tsM$H= HHAGCACLH߃I$HcSA$HIG LxI9uH|$HD$HHxI$eL5HD$H8HHLxI$H$H= IHBIcWPA7pI$HAG>DH4$L"H߃HHsLxHL$HAHLiHLpI9tvI$IcVH^HcOH HH9<H;SuI$H+HH8HIF LpI9uDA9$\A$K1LA$A$ÅI$IDŽ$I$ADŽ$fHt$LHAHHD@HAHHD@H|$HD$H{HxI$H<1A~LL ÅeHHHYHLA$`u/1I$`HLff.AWAVAUATIUSHDLI$II"]I$H$L}ILL9uRHtIIGHBHM7IcWLMoI$IHH=HHH9uH$HH9uI$LAI$L1I$L!I$LI$H[]A\A]A^A_eHHHH1@AVL8AUeL-ATLUHSLLH - t*LfHLu8HtLLAHHyL[]A\A]A^LLLH@+C=,HHnLHDHHLsHT)[AąXHHD?HHHHEH9L[]A\A]A^KeHHHDCAHHKSMHHLHË@HHHPHH;pHHHPHH;p~HHHHf.AVAUIATIUSHH^8Hu9HL[]A\A]A^ff.ff.fDH]HtHH[HtHH[HuHEHHHvH9kt]HCHt3LrHH$LH$eHjHULuI.QIHuH$H$4HCff.@BtRUHSHHF9uBz uU9ukE9CuE9C1H[]HL$ H<$H<$L$ HHHHL$ H<$H<$L$ HL$ H<$H<$L$ HL$ H<$L$ H<$fAWAVAUATUHSH8Lm8HI9tfH_L`II"ItHS HC(HBHL{ HLs(HLID$ I|$ H L9uH}(Lm(II"HH_L`I9uHItHS HC(HBHL{ HLs(HLID$ I|$ H L9uH}LmII"HH_L`I9uHItHS HC(HBHL{ HLs(HLID$ I|$ H L9uH}LmII"HH_L`I9uHItHS HC(HBHL{ HLs(HLID$ I|$ H L9uH}HLmHII"HH_L`L9uHItHS HC(HBHL{ HLs(HLID$ I|$ H L9uH]Hu0HH[]A\A]A^A_fHXHtHH[HtHH[HuHHpHHHvH9CtHC1HHCDAT UHH=SHt^Lc HLHt:HcI91HHHCHcHH H[]A\H1ff.AWIAVIAUATAUSHHuHCHkHtH]D9c|HCHkHuE1t^H=@ IHD E9fp}EfpI} I] LIE(IE0H}AFlAf[L]A\A]A^A_H IALE[]A\LA]A^A_eHDHHL[]A\A]A^A_H"I|AWAHWHAVAAUEATAUDSHH\$@H9HW(H9HW8H9XD@`H H+D`(DxDp EtML#Hh HH$HLtH $Il$H+La HY(1H[]A\A]A^A_DHkL` HH$LHtH $LcHY Hi(LefKeHH<$HHH$eHH<$HHH$eHH<$HHH$ @U SHHt hH@[]Hff.AWIAVAUATUSHHi(LvHI9E1yD$IIEaLL$HH$ẢEA|ILLL$D$L$„t EI IIcԿADL$DL$A9|DI9A@@H<$MtI}LDD H[]A\A]A^A_IFuD1H[]A\A]A^A_tIHA\$1HLD$tvD$MMfweHAHHeHHH1JeHHHeHHHfDDd$D$I9@A @EuH<$D$MD$I}D$LD$neHHHqeHHHXAƉHLEANkHfDAWAVAUATMUSH@Mx(Ah H|$H4$M͉T$IΉL$DL$eL,%(Ll$8EhDȉD$ DD$7t$ H<$HL$7IH=f|$7t5AD$AEAD$AEAD$AEA|$AE H$L9I]8ME8HC9t"HSLKLOIHHËC9uDHCL9su MT$H|$LHADžsL$H|$LLH<$SEDCKAHG(sPZkD$AD |$k‰CD$CD$ CC ЈCAT$Ls ЈCA9mu AD$AEE1HD$8eH+%(H@D[]A\A]A^A_D$eHAHHPAVD$(PDD$$L$ D$OHE;l$L]KDKHHeHLCHCL9slpH<$EAHG(PDD$ T$t$xAXAMD|$H|$LLLD$(DLL$ BH$ HHHLL$ LD$(DxD$j LrD$ BAD$D$ J ȈBA9mAmAD$AEAEHz LHZ HB(HB0I9#H|$LHH$H<$1LAAff.fHeH %(HL$HL$HT$eH+%(u HHHuHPH@HtH;ptHPH@HuH UHSHfH} HHS(HH2kl[]eHHHfAWHFAVAUATUSHHHVH9SLn(IIELl$M}LpHF(HD$I9Au AAOhL$=Ic$ IHHct$1LHHhxlt$LLLuWAH|$tIW IG(HBHHIG H"IG(fHL[]A\A]A^A_LIF HL$Iv MHt$H H9IAOeHHHEL~LtIIGHBHHIH"IGfI PeHAOHHEGI HLIT$HLf.AW AVAUATUSHheH%(H\$`HH=HZ IH@HT$@1IA8HIAHD$ IAIAHD$IA IA(IA(HD$IA0IA8IA8HD$0IA@IAHIAHIIAPL $HD$8HD$DHD$LD$TD$@HD$XL $IH Hc L $L $IHHL $IHu DPeL-E1EMAFdAD;PDIMHEH$DDHu1LDHA…AQAF\E1t$ADLZQ AD;PSMHHL $L $AtI1HADPAA`AAdAQXA)IcDHigfffH#)ŸDAAhAQ\A9 LL $L $HH?HxMH8HHt!HGu A$HHuHHHHx봃@C AAT$DID$HHD$H=AT$DEZEE1AHHDDHMIHt!H{T$L $HL $T$IT$L $L $T$Lω$$HD$`eH+%(8Hh[]A\A]A^A_ADHH&MTHD$A1HDHDT$(#DT$(kBpH$h́2&H @< { < <u%HHDT$(DT$(ǃtE= DT$(L$kI HHH4$IVHDxLe D$HELH$EFȉEHF(Ht$8HHEDT$(tH$HD$8LbHU HE(MfHDD9DHHL4$LL $MIQHL$HBH9T$t8u AHP HBH9uIQHL$ HBH9T$ t+ff.D8u AHP HBH9uIQ(HL$HBH9T$t,ff.fD8u AHP HBH9uIHD$(Lt$(MtI~L $LL $IL $L $PAAd)H H AHXAAXH `AH HDLHL $L $LHL $u-LHL $lH߉D$L $T$H߉T$L $HL $T$/AF\At$tAAEt$ADD$D$t$DD$DLAlA[D$EHt$IcIAH9~ D$AIcF|Ht$H9Av|HD$(LLL$L8LL$HH$D$LhML|$8MEftD$E_ AEWEEOEAG yEGElAW`ATq~Avp9 U x9 I8IHhHUAx|MxuAF|9A9P9BA AWBE A9GLIHHhAUyHHL4$ML $U HHL $1HLL $L $L $E 9kHHL4$ML $E;gHt AG9E / H<$H$Ht>LxeHIL $HHL $&L|$8MAQlD$9 LL $L $HsHD$Lt$(LhI}8IHAt$LH߹Il$t AuA9E pIG(HUHH9GAGAU9bAWA9UAG U 9AGAU9AGAU9tLIH;Ht$AG AU9AGAU9GH|$HD$HFLhAwADHHML4$L $&$HAAtHL $HL $EL$L$EDLH9E D$t$E1DD$DL`YMHHHL4$L $%LjHHHcxH1|DHHDxt,t'xH HAt$LMDEDD$eHHHD$<HHL4$L $HHL4$L $DHHL$L$EDLHAFh#D$0H$$l$fI IH.AFXIV(Ht$ Hh DxHH@H$H$HD$ HjIT$ ID$(IneHDD$DHHaHH߉ $At$DD$L$HH߉ $E1t$0DD$L$HHL4$ML $$HHL4$ML $L $HH߉$LL$$LL$O6HHL4$ML $HHL4$ML $L $HcP L $L $HHyE1䃻PMRtBD%ID9P6DHyHLl$$$LL$rHHL4$ML $DHHDT$(DT$(HߺL4$HL $HHL4$ML $AUHHL $LL $HHL $L $HHL4$LL $XHHL4$ML $tMLL $L $IH@MtCMHx8HHtHcGDHHuLIHtH@MIQHBH9T$tHcPDHP HBH9T$uIQHBH9T$ tHcPDHP HBH9T$ uIQ(HBH9T$tHcPDHP HBH9T$uIQ8HBH9T$0tHcPDHP HBH9T$0uE1E1탻PM+ff.f.ID9PB|%uDHHAHHL $AUHHL $LLL $HHL $HHL $HHL $HHL $yHHL $aHHL4$ML $FHHL4$ML $'HHL $ HHL $HHL $HHL $L $|HHL4$ML $1DHHHHH<$xD|HA jHcxHHPLH]A\gL$EDLHDT$(HHL4$ML $HHL4$L $pHHL $HL $IAMLhIE H9D$ HL $L $IHD$(MHL4$EL $tf.f.f.ATUHSlӍAx7HcHt(ff.ff.fDHt>t []!A\ff.@AUHc1ATUSHHptH[]A\A]IHcIH~K1,DjE1LHLZuG9~9uD1LD$D$H[]A\A]DԸI~(HcHf.HH9t @87t1)ȅ~ff.fUHH`HT$@HUHD$HL$HLD$PLL$XeH %(HL$(HHT$HT$0HT$ HUH4$XHHD$HD$D$HD$(eH+%(uX)x LJH@UHH`HT$@HUHD$HL$HLD$PLL$XeH %(HL$(HHT$HT$0HT$ HUH4$XHHD$HD$D$HD$(eH+%(uHWpHHcPH9HMH2HOpHHVHHcPH9ʺHMff.fUHSHF HHxpHH[]DAVAUATIUSH6LoptsLŅt[]A\A]A^MLHcIHHtLDhLExDLH[]A\A]A^H"3uL[]A\A]A^ff.fAWAVAUIATUSH LH eL$%(Ld$ID$HD$HD$HLt$HI9LIF1HHLLHHL9xHL9hHL9pL9`%D$<1<0ug1D$L90L98L9@ L9H0L9PL9Xu ЈNHHHD$eH+%( H H[]A\A]A^A_H1LuL봸>L ЈL ЈwL ЈZ1HT$L<T$L? Ј!L ЈL ЈHff.AWAVAUATIUHSH LH eL,%(Ll$IHD$HD$HHLt$HL90L98L9@L9H$L9PL9XL9x!L9`SL9hHL9puoHLLIHu(0AD$ fD$ LLLHHH$H$HT$eH+%(4H []A\A]A^A_tbPHLLIH-HLLIHHLLIHHfATIUHHSHÅt []A\A$pHm HEpHuۻff.AWHcLcAVAUAATIUSHHcTLeL4%(Lt$A։L$HD$HHcHHHL$ILHI$Ht't"t$L$ EEHLYET$EDLHIAj HHAWXZHHD$eH+%(uH[]A\A]A^A_ff.@S1HHHH=1ۉ[fH=ff.ATLHUSHcXHLHH5LIH龀H(HHH(HIH0HH(HIH8HH(HIH@HH(HIHHHH(HIHPHH(HIHXHH(HIH`HH(HIHhHH(HIHpH1[]A\ff.H(ff.tRS Ht [ 9r1[) 11lI Q\yJe'tOD LWoo{  X  ("alj 'h7 &@O>W>mou*  8j> &l)5PJo 4$- Ul<jJ.9 G X  o5 l`   t B R\  \  * P      I oe      m   T  | < Uh o ~ X&Tu L #+.rIS h &U] (> & ]+ ]+ Q (Ye m      w%#Ul|U ` @      'U4<LoZ c k       ) 1Hul>lU'Oo-Ls  p   h     ( o1 |@ HR Zf ,r ~  D @   Vl 3ICi qO ,o C;D#elT6 p . Uz ;q<U $ Nob*s z P   5OU  7    _ < x M4!*;! `B! M!X!k! @u! p{!!! !! =!!U!" $"4"<"O" Y" p_"e"|"#"l""#U1#G#oO#*\#  c# r###M#U### X$ $U($0$$8$UP$_$o$M$o$x%l%%U%2&I&S&f&o&*& & && &&U8'\''x(f(Mc(U(((((U )!)U[)q)) ))) ))#*l*O**U*<**M*o*+ ( + p+ ++l+ ++ +5, p., 7@, .K, P,c,k,d,o,*, X, ,,,$,o- --%->7-oU-l~---*- p- --lV..o.*. H. ..*. H . ./K./x?/I/#a/l0"0C0KT0xe00o0*0 0 p 01#!1l^1j1_1j1~1o11*1  2 0 252lT2Ch2H22o2*2  2 23J3om33l3s 4H!4o04 ( 74 h?4*P4s44lr555*5  6 h 6O6_66o6617A77l/8=8e8-w8o8*8 8 h 88j8~9,9-K9]9or9o9o9l9o9l9 99o:lJ:V:>|:o:o:l:>:l];;  ;+;o<x/<  ;<K<  P<&^< j<x<#<l<[ <='=O=='=5=C=<\= h=|==\ = ===<=>+>+N> $g> (t>C|>>  >C>> ,>C>k> 0>C>?[ 0?oD?  e? ,? 0?+?#?+?l? ?  @ `@ @#@ 0@ =@ J@ W@ d@ q@ `~@ @@ @@o@ @@o@ @@o@ @@oA  AAo A (A/AoCVFMV@VVouVlVV0VoV XV 0 V*VW W&#WL6W>W0GWo\W cW yW*WWlWWXoX*.X h5X h DXaXl~XUX|XXoX Y%YlYH%Z4Zq]ZZZZoZ*Z  [ [U[o][*l[ s[ [[[o[[ [ \ \E\la\Qo\ t\\o\l\/]o=]g]m}] f]K]] f]])]] f]K]^ f ^^*$^ +^ X6^@^*G^ PN^ Y^~^X^#^l^U^^^^ __o5_l__K"`U```}`oa"ah;aMa6ia{a5a3b8sb/bb*b c c%cMckkcM}c#clc;,dA[dM}dodd (ddoXeHeee)f^fxfof*f f Pffofg9g XDg&gg gg *gglh/6hkhhhKhhh0idi+i>i>Mi9}ioiiijMjKWjjek'tkBkKkkk)kkk*k l ll*%l ,l 7lDl*Kl Rl 8]ljl*ql xl pll All&:m'CmfLmUm>6nz\n ]dnnn o<.ovo oop02p\^php uppp*p p pp#pp @p xppq  q&q>\q0dqWq>q0q>vr\rer rsJs*Qs as 0sss ss0sKs=stlUtoutltt9tototoul u#v$+v92v =v1uvlvov*v v  vvww1w 6wSw>ew jwrw9wUwP xxK0xAWxwx~x x1y #y&;yCy0uyly'ywyoy*y @y  yz)zUjzzxzzz9zozzl{{o{ {*{  {%|l||o|*}  }  }U}l}}o}*}  } }~ll~~~o~*~ H ~  ~~l"9-oUl%o*   HElr%|o*  pՀl߀ ?l ?i.o5 f:KBDI fNYoqlǁoooljor*   ł &5lo*  ( ʃ. 3&eloloŅl!lTofpgˆ#l;oC*P W  btP#݇ &l(-K d R ^mU Q>4oBʼnډjo >1lPU~@R>ˊlU.7NcRk>{lϋ*,IT^*e 8o 0o1ʌ7 &'< 0D&Y e&qT 0&ʍ ҍ&l+UEQoulolώ:oH>ul>>olˏaԏaao5lT>\>loloŐl>;yYlTo h* lByRJ.o6*= D pa2 >>' /+cxjJ h &* ǔ I>R>| 8 &ŕll Wm3xoĖolC>g t7ȗoЗ*ח  ޗ 9UVԘU 5 +> >2  >&m>u>7*P ![+pT˚ Ӛ&>> -KNju<JUÛ'T1 9&@ EH+y7ܜT (!+>>0RFRjTt |& &  &؝# +&>[  c&zl0 4>HUiJ .UJT 5c+>>olnK>UġJ}U 5+>>o.of*t H!{  ţl XUhwo* p!  ZUk {*  "  ۥKR0J8cUĦ*˦ !Ҧ X ݦ* !  "R*>7*B x"I  T^t` Uͧ7= "E&{ "&~ʨ Ҩ&l`yCȪڪt"4tOǫ #̫ԫ* p >#>->Bol>v>>l d ! O&aҭ>ڭ>teR8ol>t>* 0# x  $*ǯ @ ԯ h#K #S #&ɰ #Ѱ&lAoQ @$Ze jrw  $ $ñlDzoݲ Mo -#, 4; CKiPa ir z    ʳ wҳ޳ `  ; "Alwo~o  iɴ $δl  5oK` H%lz* x% Hŵl  T -T 5$ ]  &϶&Զ  P& KoS*b %i (t ; ַ  % +/ B*I &P [b#lRJ>+o4 &<F N[`y &lR ͹R o< '/o6 >el  R޺To*% , 8'7iJ* 'û λ* ( h h((&0C p'K&*  (  '¼&ʼռ l/ < [RoTʽ*ӽ ڽ )JB*I h)P [s* ) P )&iо 8)ؾ&*!  (( 3M 'R&Zie rl;^jz o (*|#! Elom] T"#) X*1E *MW _o t+  2 *lF S [! l! ~Q   $> so* + ; 4Cg jRJ$>,>I@r +zm]9N>V>e m  ,  + H,+  2 x, +% , ;2DXe#w +|> + H+ i >>5lP&]&J* 0 , ,&3o= EMRj %r&wlVVJB*K R -]o @-&o %&l;Hv -& >o* p- ";P@w - #l6 \@ !N !S+[KRTj7jR:TX 8.f+no;  -$,= .BJU p.]f nl o* . 7alQ "&'Al]eymUWNo  /"Alyo~olU+7Gal, `o* @/ H/yBalWolQWo /o* / (l U>O,Th ooyo* 00 8t-t* 0 pUltvDRo `0loW\Ll?->CoK*X 0_ j>* 0 U.a s > 0l&< 1Do* 01 U 5UyWt$*+ h12 AUUsxLUL 0U]g o+zU +'JUhmLz 1U + 02 & h2 &-4 2<el>Lo* 2 >olo* 2 #l>+o2Aa}jyKUCtR 4/ @6;QULL>>$o6 2= N*\oy>>t* 3& 05]UUT^>f>R>>UX* 5 +|>>I*P @3W bv 3} h** 3 * h4  *'  4. 9 5+*   * 5 5D*R H5^ Pit 6U.3L;x 4> `0 `0!l;ApoLo%lTagy*KUo x6 X!*( / / :RR&U9R7* 6   L  < `0AF` `0ej `0l ] +*3:BU^oo 6 R L .H `0PUlyU!WU]n~U>@ o*( 07/ :Lcol>U @"oOcU>WKqR}RR9eln 7*+:EUEo!c,I 7P xUz 7 { + l d v  {a d    >o'.8pYgt*tpEr7I b% 8 @ @8 )*0 87 B] 8e 8l$W^cL>* 9 l!(oElX*nyvUU 09 ` ot'`R 9  o * `9 `&R `0Z_lt  l >LlZo_of  s 9i     /  lT W L W L@ Wm L W L, WY L  ># ) E Z d j o > l , V Qs o o *  9    olgpo*  P' x:2C*P W :bs*  @:lpol!LElKRJ5C>K>poo* ; 8* ;$ p/@*G X<N Yh*o <v >>* : !*( ;/ :M `;Um :rlo* < X % =,  4*CpdQx h=(i#lo#5lBokotolRo*  =l?>Wo&>\*c 8>j xxW* =  ^  >Elu z r )uR*;o  {+tt;K > @;>>;>zo h> E  AR + p )! @?5!=!'">/">C">"3""""#$t0$$t$[%t%%  %% C%%(%%% [ %&9&*K& DR& ]&&t&t&&s''' hC'(  %(+6(a(j( >((>(K )j*)RS)Tc))*) A) )) A)) @)) A*&*jI*k*p**** X@* *+ @ ++0+ XA;++Y+ HCh+x+  C++  ++ = ++  +,g,;{,>, p ,, A,&, >,,  -- C-%-5- BA-V- ?b-j-z-  --t-t--. . ..  . / C/!/)/i9/  A/N/  V/c/  k/x/  //  //  //  //  //  00  000 C<0L0  [0n0 x?v0}0 ?00i0 (@00  0  0201j1  *1?1 BH1b1 HBn1u1  z1111#1>1>2l/2\}2o2l2o2H3.3R3e3o3l3o3o3l4H 4o4o54l4 m 44o4#4l5o5 D55l5  55o5#5l6o%6lN6ou6lz6o6l6966l6; 7o7U87L7  Q7`7og7 0Eq777o7l7'8589989oI9=9C0:#U:l:;;  H;U;'b;i;;;9;o2<  ?<L<'Y<d<r<  <<'<<<  <<'<|<<#=l%= @.=?=oP==l=H=]> XE%><> EA>+]>  d>  k>2u>>o>#>l> 1>>d >,>D>o?l?d !?NE?lU? 5q??d ?? @? ;?? @? C?? @? J@@ @$@ V)@:@ @M@ fR@c@ @v@ {{@@ @@ @@ @@ @@ @@ @A ?A A*AoUAlaANAlAoAoAAoHPLeH`HHeHHHH5eHL$HHL$eHHH`|=eHcHHHPL⾜L⾴eHqHHeHpHHeH1HHeHSHHeHxHHeHHH4eHD$HHL\$ DT$D$DT$L\$ eH]HHH8H0eHHHH8H0HHHHHH HHH@H޿LH@LHHMkTHHADŽ$1HeH HH|eH1HH|eHHHHAAt$@HeHHHApAleHHHAlApAt$@HAt$@HeHHHAlHeHeHHeHHHeH3HHeHLHHeHMHHL¾L¾Ht$L¿HPHPHƿHPL1H!eHL$HHAD$L$LeHHHeHTHHeHHHeHHHLHeHHHeHlHHeHHHLL$LL$eHHHLL$LL$eHHHA$eH?HHeHHHeHHHeHkHHeHHHeHHHAG eH#HHeHLHHeH|HHeH{HHeHD$HHD$eHHHeHzHHeHHHAeHjHHeHHHeHHHeHHH@eHHHeHHHHο"eHL $HHL $eHHHeHHHeHSHHeHlHHeHEHHeHHHeH9HHeHHHAD$UeHHHeHHHeH1HH eH[HHeHHHeHEHHeH!HHeHHHeHHHLeHHH11H<$HHI|$LeHHHeHHH11H<$HHI|$LeH)HHeH9HHeHHHeHHHeHHHeHfHHHcSI$HeHHHeH:HHeHyHHLHHAuHMm I HL4$L $A9iXHHL $f.eHIHHA$lDUIHH`HT$@HT$HL$HH׹LD$PLL$XeH%(HD$(1H4$AXHT$HHEHD$HD$HD$0HD$ HD$(eH+%(t9N)‰H;f.HPHPHPHPSHH3HsHHsHHsHsHsHsC"0K*W ^  insT2{*   3* p  A7* p   -65*A H  SXk,9u  z?  ? 8 ? 8 ? x ?bb  ? h ?!  &+?9  >F $O?_bg*s  z ( D*   ( E*   ( L X AO  %*S2*9  E ( PUhPJp*w   ( XJ  S  S*   (  eJ $*0  7 ( BGLTT*` g rw|#W* P X*  ^*   ^b0bBbUbfbwbb*  Bb* 0 ~ *  ',1.9*E L W\ai*u | *  *  c *  # ( 2 : *F M ] b l t * P     *      *     g *  & + 0 8 *D K V [ ` h *t P{     *     k * P     *  %  $ , *8 !? %J O T 5\ *h !o %z   - * ! %   ַ * ! %   / * ! %   $ *0 !7 %B G R !Z *f m %x }  ͹ * p %    *  %   < *  %   z! b) *5 < %G L Q lY *e l %w |  ~ b *  %   > *  %   S *   %!&.*: A %LQV]^*j Pq %|* P %H* 0 %* P$ . ** #1 .<ANV*b "i .ty~* p' .* # .* & . *( !/ .:?DL*X $_ .jotv|* P& .* % .* % .b*  %, .7<]g>o>tf|* % .* % .>>* p(" .-27?*K p(R .]bgo*{ p( .a* p( .T* P# .U*  " ."7?*K "R .]bgo*{ " .Y* ! .b * <  1   )7> pBFO(d*s p,z HD/2l _ -B#Hof xDbbbbbl       %0 " 8B : IS P Zd f ku | | E    2ol E         %0  5?  FP  Wa hr y 0 A T F    2ol g% *7 <I N[ `m r    $ ; T k  B'`bx  @Fl pF  # *5 :E JS Xf p'b  @F %l0 F5> CM R\ &ak <pz R h ~ l F   # +6 =Doel F          G !#,o: 8G?D>UISHeH%(H$1HH\$H.HLtH_H1ɺHHHcÅu NU fZh"ot{  .Zcheck_attaching_info5init_volumesubi_io_read_dataprocess_lvolubi_io_write_datacreate_vtbl`ubi_change_vtbl_recordubi_free_volumeubi_add_volumeubi_resize_volumepqubi_remove_volumecvol_attribute_showubi_create_volumeubi_more_leb_change_datawrite_leb4]ubi_more_update_dataubi_start_leb_changeSclear_update_marker1set_update_markerxubi_start_updatebytes_str_to_intubi_mtd_param_parseubi_init_attachubi_init=I[weubi_detach_mtd_devuif_initio_initubi_attach_mtd_devgv1ubi_get_by_major ubi_get_devicemtdctrl_cdev_ioctlrename_volumesubi_cdev_ioctlvol_cdev_readvol_cdev_direct_writeLMrevoke_exclusive3get_exclusivevol_cdev_ioctlvol_cdev_openvol_cdev_releaseubi_is_mappedubi_leb_mapubi_leb_unmapubi_leb_eraseubi_leb_changeubi_leb_writeubi_leb_read_sgubi_leb_readubi_close_volumeubi_open_volume_pathubi_open_volume_nmubi_open_volumeubi_eba_init=self_check_ebaleb_write_trylock#ubi_eba_copy_lebubi_eba_atomic_leb_changekubi_eba_write_leb_sttry_write_vid_and_data?try_recover_pebubi_io_write_dataubi_eba_write_lebubi_eba_read_leb_sgTleb_read_unlockubi_io_read_datalubi_eba_read_lebleb_write_unlock!ltree_add_entryubi_eba_unmap_lebubi_eba_copy_tablelubi_io_write_vid_hdrubi_io_read_vid_hdrSubi_io_write_ec_hdrubi_io_read_ec_hdrjubi_io_mark_badLubi_io_is_badEdo_sync_erase}torture_pebnor_erase_prepareubi_io_sync_erase"ubi_io_writez{|ubi_io_readZwl_get_wleproduce_free_pebyubi_wl_get_pebubi_wl_closeshutdown_work:fubi_wl_initdo_workubi_threadubi_wl_flushubi_wl_scrub_pebwl_tree_add1__schedule_ubi_workdo_sync_erase9prot_queue_addEget_peb_for_wlwear_leveling_workerensure_wear_leveling!serve_prot_queue__erase_workererase_worker[schedule_eraseprot_queue_del in_wl_tree)9ubi_wl_put_pebubi_sync_eraselate_analysisadd_fastmapadd_corruptedcheck_corruptionscan_pebscan_allubi_attachubi_early_get_pebubi_remove_avadd_to_listfind_or_add_avadd_volumeubi_add_to_avubi_io_read_dataubi_compare_lebsubi_errubi_warnubi_msgubi_calc_data_lenubi_debugfs_init2ubi_dump_mkvol_requbi_dump_aebubi_dump_avubi_dump_vtbl_recordubi_dump_vol_infoubi_dump_vid_hdrfghijklmnopqstubi_dump_ec_hdrSTUVWXYZ[(0F`(hpF(F(@(HpP(F@@HP!@!@!   p@ HpP  0` hp @ H P  8  h (0` hp 8  x (0` hp  ( 0 ` 8h P p  p P    P  ( P 0 ` ( h  p  (   (    @ ( H  P  (   X    (  0 `  h  p        (  0 ` ( h  p  (  (<` &   (P00\84PgX4 0@\8 Y@cp0_x4WpVV@HpP__P_ (P0___`hp_u (P0__u (0_`hp__0_`hp__ %(P0x%x%x@%HpPx%x%x %(P0x`%hpx%x%0x`%hpx%x%x %(0x`%hpx%!x%!x %( !0 x` %h !p x % ! x % ! x`!.h!!p! !.!!! ".""" @".H""P" ".""" ".""" #.(#P#0# #.### #.### $.($P$0$ `$.h$$p$ $.$%$ $.$%$ %.(%%0% `%.h%%p% %.%%% &.(&P&0& &.&&& '.'p'' @'.H'p'P' '.'p(' '.'p(' (.(p(( @(.H(p(P( ( (((E ) )()E @) H)(P)E )(@)))E *<***E *<*+*E + +`++ +m +++ ,_ ,+, @,HDH,p,P, ,8G,,, -F(-,0-`- h-,p---,-- -,- . (.,0.`. h.,p..G.,..F... /(/.0/`/h/.p///.///./ 0(0.00`0Fh0P0p000P0000P00 1&(1P001`1<h1P0p11R1P011h1P01 2~(2P002`2h2P0p22pF2223323@3H32P3332333234424@4H42P4442444245@F525@5H52P55g5p5555p55 6(6p506`6h6p5p666p5666p56 7(7p507`7 h7p5p77$7p577;7p57 8T(8p508`8kh8p5p888p5888p58 9(9p509`9@Fh9p5p99E999: :9:@: H:9P:: :9:: :9:; ;9;@; H;9P;; ;9;;;9;<<9<@<0H<9P<<A<9<<T<9<=F=9=@= H=0=P== =0=== =0==>" >0=>@>: H>0=P>>P >0=>>f >0=>?| ?0=?@?EH?0=P???B??=?6@5@p6@ 6@6@@P:@7(ABbad CRC at record %u: %#08x, not %#08xtoo large reserved_pebs %d, good PEBs %dvolumes %d and %d have the same name "%s"volume table check failed: record %d, error %dUBI DBG gen (pid %d): create volume table (copy #%d) XXXXX emulating a power cut when writing data XXXXX2UBI assert failed in %s at %u (pid %d) field "vtbl_rec->name" at drivers/mtd/ubi/vtbl.c:138memcpy: detected field-spanning write (size %zu) of single %s (size %zu) LEB size too small for a volume recordthe layout volume was not foundtoo many LEBs (%d) in layout volumeUBI DBG gen (pid %d): check layout volume volume table copy #2 is corruptedboth volume tables are corruptedvolume table copy #1 is corruptedfield "vol->name" at drivers/mtd/ubi/vtbl.c:546more than one auto-resize volume (%d and %d)static volume %d misses %d LEBs - corruptednot enough PEBs, required %d, available %d%d PEBs are corrupted and not usedfound %d volumes while attaching, maximum is %d + %dbad attaching information, error %d2UBI assert failed in %s at %u (pid %d) no volume info, but volume existsself-check failed for volume %dalignment is not multiple of min I/O unitupdate marker and corrupted simultaneouslybad usable_leb_size, has to be %lldtoo long volume name, max is %dUBI DBG gen (pid %d): search for vacant volume ID UBI DBG gen (pid %d): create device %d, volume %d, %llu bytes, type %d, name %s not enough PEBs, only %d available%d PEBs are corrupted and not usedfield "vol->name" at drivers/mtd/ubi/vmt.c:251memcpy: detected field-spanning write (size %zu) of single %s (size %zu) field "vtbl_rec.name" at drivers/mtd/ubi/vmt.c:318cannot create volume %d, error %dUBI DBG gen (pid %d): remove device %d, volume %d cannot remove volume %d, error %dUBI DBG gen (pid %d): re-size device %d, volume %d to from %d to %d PEBs too small size %d, %d LEBs contain datanot enough PEBs: requested %d, available %dfield "vol->name" at drivers/mtd/ubi/vmt.c:600UBI DBG gen (pid %d): add volume %d cannot add character device for volume %d, error %dUBI DBG gen (pid %d): free volume %d UBI DBG gen (pid %d): set update marker for volume %d 2UBI assert failed in %s at %u (pid %d) UBI DBG gen (pid %d): already set UBI DBG gen (pid %d): clear update marker for volume %d UBI DBG gen (pid %d): all %d bytes contain 0xFF - skip UBI DBG gen (pid %d): start update of volume %d, %llu bytes UBI DBG gen (pid %d): start changing LEB %d:%d, %u bytes UBI DBG gen (pid %d): write %d of %lld bytes, %lld already passed skip auto-resize because of R/O modecannot clean auto-resize flag for volume %dvolume %d ("%s") re-sized from %d to %d LEBs3UBI error: too many parameters, max. is %d 3UBI error: parameter "%s" is too long, max. is %d 4UBI warning: empty 'mtd=' parameter - ignored 3UBI error: too many arguments at "%s" 3UBI error: incorrect bytes count: "%s" 3UBI error: bad value for max_beb_per1024 parameter: %s 3UBI error: bad value for ubi_num parameter: %s 3UBI error: bad value for enable_fm parameter: %s 3UBI error: bad value for need_resv_pool parameter: %s 2UBI assert failed in %s at %u (pid %d) 3ubi: mtd%d is already attached to ubi%d 3ubi: refuse attaching mtd%d - it is already emulated on top of UBI 3ubi: refuse attaching mtd%d - MLC NAND is not supported 3ubi: refuse attaching mtd%d - zero erasesize flash is not supported UBI DBG gen (pid %d): sizeof(struct ubi_ainf_peb) %zu UBI DBG gen (pid %d): sizeof(struct ubi_wl_entry) %zu multiple regions, not implementedmin. I/O unit (%d) is not power of 2bad write buffer size %d for %d min. I/O unitUBI DBG gen (pid %d): min_io_size %d UBI DBG gen (pid %d): max_write_size %d UBI DBG gen (pid %d): hdrs_min_io_size %d UBI DBG gen (pid %d): ec_hdr_alsize %d UBI DBG gen (pid %d): vid_hdr_alsize %d Invalid VID header offset %d, VID header shift(%d) + VID header size(%zu) > VID header aligned size(%d).UBI DBG gen (pid %d): vid_hdr_offset %d UBI DBG gen (pid %d): vid_hdr_aloffset %d UBI DBG gen (pid %d): vid_hdr_shift %d UBI DBG gen (pid %d): leb_start %d bad VID header (%d) or data offsets (%d)UBI DBG gen (pid %d): max_erroneous %d EC and VID headers are in the same minimal I/O unit, switch to read-only modeMTD device %d is write-protected, attach in read-only modefailed to attach mtd%d, error %dcannot register UBI character devicesUBI DBG gen (pid %d): %s major is %u cannot initialize UBI %s, error %dattached mtd%d (name "%s", size %llu MiB)PEB size: %d bytes (%d KiB), LEB size: %d bytesmin./max. I/O unit sizes: %d/%d, sub-page size %dVID header offset: %d (aligned %d), data offset: %dgood PEBs: %d, bad PEBs: %d, corrupted PEBs: %duser volume: %d, internal volumes: %d, max. volumes count: %dmax/mean erase counter: %d/%d, WL threshold: %d, image sequence number: %uavailable PEBs: %d, total reserved PEBs: %d, PEBs reserved for bad PEB handling: %d3ubi: only %d UBI devices may be created %s reference count %d, destroy anyway3UBI error: too many MTD devices, maximum is %d 3UBI error: cannot register device 3UBI error: cannot open mtd %s, error %d 3UBI error: cannot attach mtd%d 3UBI error: cannot initialize UBI, error %d 3UBI error: block: cannot initialize, error %d UBI DBG gen (pid %d): release device %d, volume %d, mode %d update of volume %d not finished, volume is damaged2UBI assert failed in %s at %u (pid %d) UBI DBG gen (pid %d): only %lld of %lld bytes received for atomic LEB change for volume %d:%d, cancel UBI DBG gen (pid %d): open device %d, volume %d, mode %d UBI DBG gen (pid %d): read %zd bytes from offset %lld of volume %d damaged volume, update marker is setUBI DBG gen (pid %d): read from corrupted volume %d UBI DBG gen (pid %d): attach MTD device UBI DBG gen (pid %d): detach MTD device UBI DBG gen (pid %d): erase LEB %d:%d UBI DBG gen (pid %d): requested: write %zd bytes to offset %lld of volume %u cannot accept more %zd bytes of data, error %dvolume %d on UBI device %d is corruptedUBI DBG gen (pid %d): create volume UBI DBG gen (pid %d): remove volume UBI DBG gen (pid %d): re-size volume UBI DBG gen (pid %d): re-name volumes cannot open volume %d, error %dfield "re->new_name" at drivers/mtd/ubi/cdev.c:754memcpy: detected field-spanning write (size %zu) of single %s (size %zu) UBI DBG gen (pid %d): will rename volume %d from "%s" to "%s" cannot open volume "%s", error %dUBI DBG gen (pid %d): will remove volume %d, name "%s" UBI DBG gen (pid %d): close device %d, volume %d, mode %d UBI DBG gen (pid %d): open device %d, volume %d, mode %d volume %d on UBI device %d is corruptedcannot open device %d, volume %d, error %dUBI DBG gen (pid %d): open device %d, volume %s, mode %d UBI DBG gen (pid %d): write %d bytes to LEB %d:%d:%d UBI DBG gen (pid %d): atomically write %d bytes to LEB %d:%d UBI DBG gen (pid %d): unmap LEB %d:%d UBI DBG gen (pid %d): erase LEB %d:%d UBI DBG gen (pid %d): map LEB %d:%d UBI DBG gen (pid %d): test LEB %d:%d UBI DBG gen (pid %d): read %d bytes from LEB %d:%d:%d UBI DBG gen (pid %d): open volume %s, mode %d 2UBI assert failed in %s at %u (pid %d) UBI DBG eba (pid %d): write VID hdr and %d bytes at offset %d of LEB %d:%d, PEB %d failed to write VID header to LEB %d:%d, PEB %dXXXXX emulating a power cut when writing data XXXXXfailed to write %d bytes at offset %d of LEB %d:%d, PEB %dfailed to return physical eraseblock %d, error %dUBI DBG eba (pid %d): erase LEB %d:%d, PEB %d UBI DBG eba (pid %d): read %d bytes from offset %d of LEB %d:%d (unmapped) UBI DBG eba (pid %d): read %d bytes from offset %d of LEB %d:%d, PEB %d corrupted VID header at PEB %d, LEB %d:%dCRC error: calculated %#08x, must be %#08xUBI DBG eba (pid %d): write %d bytes at offset %d of LEB %d:%d, PEB %d failed to write data to PEB %drecover PEB %d, move data to PEB %ddata was successfully recoveredUBI DBG eba (pid %d): change LEB %d:%d UBI DBG wl (pid %d): copy LEB %d:%d, PEB %d to PEB %d UBI DBG wl (pid %d): volume %d is being removed, cancel UBI DBG wl (pid %d): contention on LEB %d:%d, cancel UBI DBG wl (pid %d): LEB %d:%d is no longer mapped to PEB %d, mapped to PEB %d, cancel UBI DBG wl (pid %d): read %d bytes of data error %d while reading data from PEB %derror %d while reading VID header back from PEB %dLEB:%i:%i is PEB:%i instead of %i!UBI DBG eba (pid %d): initialize EBA sub-system no enough physical eraseblocks (%d, need %d)%d PEBs are corrupted and not usedcannot reserve enough PEBs for bad PEB handling, reserved %d, need %dUBI DBG eba (pid %d): EBA sub-system is initialized node with incompatible UBI version found: this UBI version is %d, image version is %dbad VID header offset %d, expected %dbad data offset %d, expected %dbad VID header magic %#08x at PEB %d, must be %#08x2UBI assert failed in %s at %u (pid %d) error %d while checking if PEB %d is badUBI DBG io (pid %d): PEB %d is bad UBI DBG io (pid %d): read %d bytes from PEB %d:%d fixable bit-flip detected at PEB %derror %d%s while reading %d bytes from PEB %d:%d, read only %zd bytes, retryerror %d%s while reading %d bytes from PEB %d:%d, read %zd bytesUBI DBG gen (pid %d): bit-flip (emulated) bad CRC, calculated %#08x, read %#08xbad magic %#08x, must be %#08xcannot mark PEB %d bad, error %dUBI DBG io (pid %d): read EC header from PEB %d no EC header found at PEB %d, only 0xFF bytesUBI DBG bld (pid %d): no EC header found at PEB %d, only 0xFF bytes bad magic number at PEB %d: %08x instead of %08xUBI DBG bld (pid %d): bad magic number at PEB %d: %08x instead of %08x bad EC header CRC at PEB %d, calculated %#08x, read %#08xUBI DBG bld (pid %d): bad EC header CRC at PEB %d, calculated %#08x, read %#08x UBI DBG io (pid %d): read VID header from PEB %d no VID header found at PEB %d, only 0xFF bytesUBI DBG bld (pid %d): no VID header found at PEB %d, only 0xFF bytes bad CRC at PEB %d, calculated %#08x, read %#08xUBI DBG bld (pid %d): bad CRC at PEB %d, calculated %#08x, read %#08x cannot invalidate PEB %d, write returned %dcannot allocate memory to check for 0xFFserr %d while reading %d bytes from PEB %d:%d, read %zd bytesflash region at PEB %d:%d, length %d does not contain all 0xFF bytesUBI DBG io (pid %d): write %d bytes to PEB %d:%d bad VID header CRC at PEB %d, calculated %#08x, read %#08xcannot write %d bytes to PEB %d:%d (emulated)error %d while writing %d bytes to PEB %d:%d, written %zd bytescannot allocate memory to check writesself-check failed for PEB %d:%d, len %dhex dump of the original buffer from %d to %dhex dump of the read buffer from %d to %dUBI DBG io (pid %d): write EC header to PEB %d emulating a power cut when writing EC headerUBI DBG io (pid %d): write VID header to PEB %d emulating a power cut when writing VID headerUBI DBG io (pid %d): erase PEB %d error %d while erasing PEB %d, retrycannot erase PEB %d (emulated)erased PEB %d, but a non-0xFF byte foundpattern %x checking failed for PEB %dPEB %d passed torture test, do not mark it as badread problems on freshly erased PEB %d, must be bad2UBI assert failed in %s at %u (pid %d) UBI DBG wl (pid %d): added PEB %d EC %d to the protection queue work failed with error code %dUBI DBG wl (pid %d): schedule erasure of PEB %d, EC %d, torture %d UBI DBG wl (pid %d): deleted PEB %d from the protection queue self-check failed for PEB %d, EC %d, Protect queueUBI DBG wl (pid %d): schedule wear-leveling UBI DBG wl (pid %d): schedule scrubbing self-check failed for PEB %d, EC %d, RB-tree %p UBI DBG wl (pid %d): erase PEB %d, old EC %llu erase counter overflow at PEB %d, EC %lluUBI DBG wl (pid %d): erased PEB %d, new EC %llu UBI DBG wl (pid %d): erase PEB %d EC %d LEB %d:%d UBI DBG wl (pid %d): PEB %d EC %d protection over, move to used tree failed to erase PEB %d, error %dbad physical eraseblock %d detectedno reserved/available physical eraseblocksno PEBs in the reserved pool, used an available PEBlast PEB from the reserve was usedUBI DBG wl (pid %d): cancel erasure of PEB %d EC %d UBI DBG wl (pid %d): sync erase of PEB %i UBI DBG wl (pid %d): cancel WL, a list is empty: free %d, used %d UBI DBG wl (pid %d): no WL needed: min used EC %d, max free EC %d UBI DBG wl (pid %d): move PEB %d EC %d to PEB %d EC %d UBI DBG wl (pid %d): scrub PEB %d to PEB %d UBI DBG wl (pid %d): PEB %d has no VID header UBI DBG wl (pid %d): PEB %d has no VID header but has bit-flips UBI DBG wl (pid %d): PEB %d has ECC errors, maybe from an interrupted erasure error %d while reading VID header from PEB %dtoo many erroneous eraseblocks (%d)scrubbed PEB %d (LEB %d:%d), data moved to PEB %dUBI DBG wl (pid %d): PEB %d (LEB %d:%d) was put meanwhile, erase UBI DBG wl (pid %d): cancel moving PEB %d (LEB %d:%d) to PEB %d (%d) UBI DBG wl (pid %d): cancel moving PEB %d to PEB %d (%d) error %d while moving PEB %d to PEB %derror %d while moving PEB %d (LEB %d:%d) to PEB %dUBI DBG wl (pid %d): PEB %d is being moved, wait UBI DBG wl (pid %d): PEB %d is the target of data moving UBI DBG wl (pid %d): the PEB %d is not in proper tree, retry UBI DBG wl (pid %d): flush pending work for LEB %d:%d (%d pending works) background thread "%s" started, PID %d%s: work failed with error code %dUBI DBG wl (pid %d): background thread "%s" is killed UBI DBG wl (pid %d): add PEB %d EC %d to the used tree UBI DBG wl (pid %d): add PEB %d EC %d to the scrub tree UBI DBG wl (pid %d): found %i PEBs no enough physical eraseblocks (%d, need %d)%d PEBs are corrupted and not usedUBI DBG wl (pid %d): close the WL sub-system UBI DBG wl (pid %d): do one work synchronously UBI DBG wl (pid %d): PEB %d EC %d new PEB %d does not contain all 0xFF bytesinconsistent VID header at PEB %dUBI DBG bld (pid %d): added volume %d UBI DBG bld (pid %d): add to free: PEB %d, EC %d UBI DBG bld (pid %d): add to erase: PEB %d, EC %d UBI DBG bld (pid %d): add to alien: PEB %d, EC %d unsupported on-flash UBI formatUBI DBG bld (pid %d): second PEB %d is newer, copy_flag is unset UBI DBG bld (pid %d): first PEB %d is newer, copy_flag is unset VID of PEB %d header is bad, but it was OK earlier, err %dUBI DBG bld (pid %d): PEB %d CRC error: calculated %#08x, must be %#08x UBI DBG bld (pid %d): PEB %d CRC is OK UBI DBG bld (pid %d): second PEB %d is newer, copy_flag is set UBI DBG bld (pid %d): first PEB %d is newer, copy_flag is set UBI DBG bld (pid %d): PEB %d, LEB %d:%d, EC %d, sqnum %llu, bitflips %d 2UBI assert failed in %s at %u (pid %d) UBI DBG bld (pid %d): this LEB already exists: PEB %d, sqnum %llu, EC %d two LEBs with same sequence number %lluUBI DBG bld (pid %d): remove attaching information about volume %d UBI DBG bld (pid %d): return free PEB %d, EC %d erase counter overflow at PEB %d, EC %dUBI DBG bld (pid %d): return PEB %d, EC %d UBI DBG gen (pid %d): process PEB %d UBI DBG bld (pid %d): scan PEB %d 'ubi_io_read_ec_hdr()' returned unknown code %dthis UBI version is %d, image version is %derase counter overflow, max is %dbad image sequence number %d in PEB %d, expected %dPEB %d contains corrupted VID header, and the data does not contain all 0xFFthis may be a non-UBI PEB or a severe VID header corruption which requires manual inspection3hexdump of PEB %d offset %d, length %dUBI DBG bld (pid %d): add to corrupted: PEB %d, EC %d 'ubi_io_read_vid_hdr()' returned unknown code %d"delete" compatible internal volume %d:%d found, will remove itread-only compatible internal volume %d:%d found, switch to read-only mode"preserve" compatible internal volume %d:%d foundincompatible internal volume %d:%d foundvalid VID header but corrupted EC header at PEB %dUBI DBG bld (pid %d): add to fastmap list: PEB %d, vol_id %d, sqnum: %llu %d PEBs are corrupted and preservedtoo many corrupted PEBs, refusingMTD device is not UBI-formatted and possibly contains non-UBI data - refusing ithighest_vol_id is %d, but vol_id %d is theretoo high PEB number %d, total PEBs %dincorrect highest_lnum or lnumbad leb_count, %d objects in the treebad ai->vols_found %d, should be %dbad attaching information about LEB %dbad attaching information about volume %dUBI DBG gen (pid %d): max. sequence number: %llu 2UBI assert failed in %s at %u (pid %d) reserved more %d PEBs for bad PEB handlingnumber of bad PEBs (%d) is above the expected limit (%d), not reserving any PEBs for bad PEB handling, will use available PEBs (if any)physical_block_number erase_count err %d while reading %d bytes from PEB %d:%d, read %zd bytesdumping %d bytes of data from PEB %d, offset %d3erase counter header hexdump: 3Volume identifier header dump: 3Volume identifier header hexdump: 3 1st 5 characters of name: %c%c%c%c%c 3Volume table record %d dump: 3Volume attaching information dump: 3eraseblock attaching information dump: 3Volume creation request dump: 3 1st 16 characters of name: %s 3UBI error: cannot create "ubi" debugfs directory, error %d bad data_pad, has to be %dswitch to read-only modeself-check faileddrivers/mtd/ubi/vtbl.cvolume table was restoredtoo large volume ID %d foundfinish volume %d removaldrivers/mtd/ubi/ubi.hubidynamicstatic%d %s %lld negative valuesbad alignmentbad data_pad, has to be %lldbad vol_typetoo large reserved_pebsbad name_len %lldcorrupted dynamic volumebad used_ebsbad last_eb_bytesbad used_bytesbad skip_checkvolume info is differentvolumesvolnamevolidout of volume IDsvolume %d already existsvolume "%s" exists (ID %d)drivers/mtd/ubi/vmt.c%s_%dcannot add deviceubiupd_markerdata_bytesusable_eb_sizealignmentcorruptednametypereserved_ebs./include/linux/thread_info.hdrivers/mtd/ubi/upd.cubi%d cannot auto-resize volume %d,3ubi: ubi%i already exists &ubi->buf_mutex&ubi->ckvol_mutex&ubi->device_mutex&ubi->fm_protect&ubi->fm_eba_semattaching mtd%dunaligned VID header shift %dubi%dcannot add volume %d%scannot spawn "%s", error %ddetaching mtd%dmtd%d is detachedubi_wl_entry_slabdrivers/mtd/ubi/build.cubiro_modemtd_numbgt_enabledmin_io_sizemax_vol_countbad_peb_countreserved_for_badmax_ecvolumes_counttotal_eraseblocksavail_eraseblockseraseblock_sizeversionubi_ctrl%d users for volume %dupdating./include/linux/thread_info.hunaligned positionunaligned write lengthbad volume creation requestduplicated volume id %dduplicated volume name "%s"drivers/mtd/ubi/cdev.cubimark volume %d as corruptedubidrivers/mtd/ubi/kapi.cswitch to read-only mode&le->mutexforce data checkingfailed to write to PEB %dtry another PEBtry again&ubi->alc_mutexdrivers/mtd/ubi/eba.cdrivers/mtd/ubi/ubi.hubibad erase counter %lldbad EC headerbad copy_flagnegative valuesbad vol_idbad compatbad vol_typebad data_padbad data_sizezero used_ebszero data_sizetoo high lnumnon-zero data CRCnon-zero data_sizezero data_size of copybad used_ebsbad VID headerself-check failed for PEB %d (ECC error)read-only modevalidation failed for PEB %dhex dump of the %d-%d region7data differ at position %dswitch to read-only modecannot erase PEB %d, error %drun torture test for PEB %ddrivers/mtd/ubi/io.cubiswitch to read-only modeself-check failed for PEB %dread EC is %lld, should be %dmark PEB %d as bad%d PEBs left in the reserveUBI DBG wl (pid %d): done UBI DBG wl (pid %d): PEB %d PEB %d not foundschedule PEB %d for scrubbing%s: %d consecutive failures&ubi->move_mutex&ubi->work_semubi_bgt%ddno free eraseblocksdrivers/mtd/ubi/wl.cubiinconsistent vol_idinconsistent vol_typeinconsistent used_ebsinconsistent data_paddrivers/mtd/ubi/attach.cno free eraseblocksubi_aeb_slab_cachescanning is finished73Corrupted PEBs are:c %dc empty MTD device detectedbad is_empty flagnegative valuesbad vol_idbad vol_typebad data_padbad ai->min_ec (%d), %d foundbad ai->max_ec (%d), %d foundbad lnum or used_ebsnon-zero used_ebsbad highest_lnumVID header is not OK (%d)bad sqnum %llubad vol_id %dbad compat %dbad lnum %dbad used_ebs %dbad data_pad %dbad highest_lnum %dbad last_data_size %dPEB %d is not referreddrivers/mtd/ubi/ubi.hubi5ubi%d: %pV 4ubi%d warning: %ps: %pV 3ubi%d error: %ps: %pV drivers/mtd/ubi/misc.c%-22d %-11d 0x%04x %u 73Erase counter header dump: 3 magic %#08x 3 version %d 3 ec %llu 3 vid_hdr_offset %d 3 data_offset %d 3 image_seq %d 3 hdr_crc %#08x 3 magic %08x 3 version %d 3 vol_type %d 3 copy_flag %d 3 compat %d 3 vol_id %d 3 lnum %d 3 data_size %d 3 used_ebs %d 3 data_pad %d 3 sqnum %llu 3 hdr_crc %08x 3Volume information dump: 3 vol_id %d 3 reserved_pebs %d 3 alignment %d 3 data_pad %d 3 vol_type %d 3 name_len %d 3 usable_leb_size %d 3 used_ebs %d 3 used_bytes %lld 3 last_eb_bytes %d 3 corrupted %d 3 upd_marker %d 3 skip_check %d 3 name %s 3 name NULL 3 crc %#08x 3 vol_id %d 3 highest_lnum %d 3 leb_count %d 3 compat %d 3 vol_type %d 3 used_ebs %d 3 last_data_size %d 3 data_pad %d 3 ec %d 3 pnum %d 3 lnum %d 3 scrub %d 3 sqnum %llu 3 alignment %d 3 bytes %lld 3 name_len %d ubiubi%dchk_genchk_iochk_fastmaptst_disable_bgttst_emulate_bitflipstst_emulate_io_failurestst_emulate_power_cuttst_emulate_power_cut_mintst_emulate_power_cut_maxdetailed_erase_block_infodrivers/mtd/ubi/debug.c`T 4 (T0t8@HdP"X%`*h+pT-x-`/ 14234799:::<?B BB4CDDD $E(tE0$F8F@FHGP4TX`VhtVpWx`X$YD\\^4_cgtttututvtyz$|T}~~TD Ԁ(0p8@4HdPXą`hp0xtt4Đĕģ@ (ĵ08@dHPXD`h4px`@@``d $ (0d8@HPDX`h p xD4D2233444455$6t6 6(6078T:@=H=PX`hp$xd>?D?TAAlicense=GPLauthor=Artem Bityutskiydescription=UBI - Unsorted Block Imagesversion=1parm=mtd:MTD devices to attach. Parameter format: mtd=[,[,max_beb_per1024[,ubi_num]]]. Multiple "mtd" parameters may be specified. MTD devices may be specified by their number, name, or path to the MTD character device node. Optional "vid_hdr_offs" parameter specifies UBI VID header position to be used by UBI. (default value if 0) Optional "max_beb_per1024" parameter specifies the maximum expected bad eraseblock per 1024 eraseblocks. (default value (20) if 0) Optional "ubi_num" parameter specifies UBI device number which have to be assigned to the newly created UBI device (assigned automatically by default) Optional "enable_fm" parameter determines whether to enable fastmap during attach. If the value is non-zero, fastmap is enabled. Default value is 0. Optional "need_resv_pool" parameter determines whether to reserve pool->max_size pebs during attach. If the value is non-zero, peb reservation is enabled. Default value is 0. Example 1: mtd=/dev/mtd0 - attach MTD device /dev/mtd0. Example 2: mtd=content,1984 mtd=4 - attach MTD device with name "content" using VID header offset 1984, and MTD device number 4 with default VID header offset. Example 3: mtd=/dev/mtd1,0,25 - attach MTD device /dev/mtd1 using default VID header offset and reserve 25*nand_size_in_blocks/1024 erase blocks for bad block handling. Example 4: mtd=/dev/mtd1,0,0,5 - attach MTD device /dev/mtd1 to UBI 5 and using default values for the other fields. example 5: mtd=1,0,0,5 mtd=2,0,0,6,1 - attach MTD device /dev/mtd1 to UBI 5 and disable fastmap; attach MTD device /dev/mtd2 to UBI 6 and enable fastmap.(only works when fastmap is enabled and fm_autoconvert=Y). (e.g. if the NAND *chipset* has 4096 PEB, 100 will be reserved for this UBI device).  GPLGPLGPLGPLGPLGPLGPLGPLGPLGPLGPLGPLGPLGPLGPLGPLGPLGPLGPLgI(}8HeXNh0xDV[G6h5FS($$$$$$$$$$$$$$$$$$$$$`  `( @0 8 @ H P X SP^PiPxPP 0P@PP`pP9B@   ` @       ` @@*P?`2p?:?F?R?`?n? 0?@P?`p??? 9ff(0??P@  (@0`8@HPP"X$`)h+p@-x-P/1 234799:::<?ABB C0DDE `E(F0F8F@FH TPVX`V`WhPXpYx0\\^ _cgt`tt`u`v`yz|@}~~@0 `(0 8P@HPІX`hp xЊ`` pЖЬб0 (0p8@PHPX0`h pxP00PPpP (p0p8P@HPX0`hp x   0 02233 44 556 `6(60687@@:H=Pp=X>`?h0?p@AxpAqb  * -$^(z040!8@"DK#HBP%T&X `+d,hpa-t-x,..rZ..:/011ZH223%445"7{8HOHoO J$P(0J4P8j@JDYPH2PJTQX`JdPhp@Kt'SxEKRRJKROKRKoRLQJVVZ VKW" WX UYZYY[ ,]$<^(0]4^8@`DbHBPdT|fXz`|hd@lhbphtkxil*sjflQop 8s?suu vv2 yy {{ S|| o}}: /~$~(r 0o48 @PDH P<TnX `ldhR pt?x Zb* a2H^̗*0b  ¤ J  ߥ$3( 048 @ DHj PUTvXr`dOhRpt>x:Y{&ƽ"<,oz <FZ $>(B0148@D HPTXr`|dhRp+txbG*p{Y:ZE( $( 04k8@xD@HzPTXB`dhptx"JJ7s=-j $#(0k482@DHPTX`kdhpc t x"Qzo?bWb}:* $(J048@ DTHPTX`d~h2ptxj!v) "5&\**Bk " > X      (F FF$!(p0i"4p<$+@pH6LTv9X`ZdVlXfpVxp|W ` @(08@@HP@X`hpx`` ` @   `  `    ` ( 0 8 @@ H P X` ` hpx @ ` ` `  (@08@HP`X ``h px`  `  `!`$"@""! #@((''%`%  %($0$8&@#H &P $X@'`'h"p#x@))()**++,@,,.`. .--`- - 0// `/( /0.8`2@ 2H1P1X`1` 1h0p0x`0@5544@4433@332`9 988`8 877`7  7(6068`6@ 6H5P5X=`<h<p@<x<;;@;;::@::9@??>>@>>==@=%qowP2.[Z%qT.zjrJ_Iz`i\R=( qik& R VDx[WSu(\0.7-$];?sO;a@5(FP8@HFPpOx!O!XO !O (!0 POX0`!hO0!`h ph 08@H hpx(  0p  (H HPX`& & 8& (&0 8@`&h px& & &  @&H PXxx& H& & X &( 08X` hp P@@8@@HPpx@000 `(0PX``hPP   0 8 @ H Xh p px  h  0  p  @  H  P ( H P `X `    p          ( 0 8 @ ` h p x h        @    @ H  P _X $x    _ 0#  P _ x"  P _  " ( P0 _8 !X ` Ph _p !  P _ p!  p _ H!_ 8@0H_P0px___h P(x0-PX`xh)x (xh)x)08@xH,hppxx(px (px'p x(8'HPXx`x%Pxp-x+!x&(0!8x@%` h0!p x09 ! 9 " 8 " @8@ H"P X8x " 7 P# 07 `# 6  (p(0 86X `p(h px6 p( /  x& 2 h& 018 @%H P00p x% 0 % 5 % 5 %( 0 P X%` hH5 % h4 %  4 % 30 8%@ H3h p%x 3 % @3 % 2 $  (2H P&X `@/ P& h1 ( 0 ( 0( 0&8 @/` h !p x`9 P$ .[ *E D[ *E h>@[ H)PE X>x[  *E 8>[  *E =[ 8*E = [ (*0E 8=X[ `*hE p<[ 0+E X<[ 0+E <[ 0+E ;8[ @0+HE P;p[ x0+E ;[ 0+E :[ p)E A[ )(E 0X@P[ XH*`E hx:[ H*E @:[ H*E :[ X*E 98|SF 5(h068G@[HVPXD`0hNpex}Ig (08PGCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910   ! k" &+ 6 x9 Z Zf$ q<) <u< l:<+<<)m<<N6<+<<#   F &5P@`  e- k9o6 m@VPPv t{ %, m 6  @Pv   < 2` b 5"56++G+XG6Q6] u6 6 6 6 int ] ,6 *6Ps8iPu8|Ps16Pu16&Ps325Pu32Ps64Pu64V] z  6 +  1] 2] H I+ X ] ^ _ `Q66 % ' ) <]  D o      #6 % & *+ 4 = B U h5 l nD qX } N  X  X  ]  ]  X !  ! N   8` ``e8`Qz+$ z V]n     w+W.0        X +     &(  *0-@ )3]]  7( ],!]0( 4)38*]H++P,X5 `6 d8 h: l; p< t=]xMse?!G@1rt@H^dlA IBIFK:I7J+K]OKXK]K:`"{E@dh]k] l+m nK oK(pj(0q Xs`ubx dy+8A X@D XHG+PH+XKiB`:NBTNWNZN^Ok 2mOp: q:(t+8u+@1fsxOH{OP~OXO`Sh Sp =x = =A+ ]S sC]<A X  X =4 " bK 8( 8 S@  H SP SX S` yTh Tp +x T A ]  X  X  X 6 6  T   D  D "T )T    T0  58  ]X T\ T` 5h  U      !] "] # $+ & X ' X ( X :)z 3U Ca% D+ LU N+ R'U SD( TD, Y+0 ] 8 ^ < _ @ ` D :azH dE7X g1U i7 l;U w x z+ } ~@U  X X  a%  +]UU_UiUU ](],K0^rcuz07@ DH}<PfVx7  "pV zVV  X >:z !"k3$"k3:.z<V:F@@@ *}4pad !+? @  )@  *!5 key"5?XA+B]Cb X =>*'''XH  G   "* M  (  %0 8 @ "H "H "H RH "H "H "H "H0@\P$hGG^ c]51kph ](],^0 c8@AB]D mHP^memr@+ ] ,(0]8@]H]LP]X`]hp >x]]%]]]a% ]!a%"]%&b9]:?AD F P Q](T%0e f+g>hH u>v5w5 keyx  C UnV jkeykMnkeyoM5 ;<=,? ] ,@ ]$,A ](,B ]+ BC&D&,E& ,E&(5sE&,5dplE&-5pE'&/,F&05avlF&45lF&55dF&65gF%&7,F+&8 + + + + +!  pte "! @ pmd ")%i%%;%/L_' pgd';'"v_p pudp;p";$@HI+7^cc0 4+80@@Z 2sp+es ds"$&+(+038+X+`cr2+h+p+x$3+]D++ 2Mfpu C2@] (   Z( 0@@ 7:j@on@@ G!73h  iQh (,h0<vh8Xhh%ip+xCg i{(UiHg.!."&&6"4val *!*! J"" ,6".z"z""+" *V"  ""J" "s s  !"!J" !" "r#""""" ""]"+,##fmt#G#G#G#]#G#G$r#$6#$7s$8$8$y$$G$G$G$G8$]8$]8$4] key$9#(-]$=$ 8$U %$V mod$W %$XG$Y% $Z ($[ ,$\y$0G $uW%$vW%$w\%$x]$y]#$+Qv%+ %/%%1] set%3 get%5%7 4v%' %  , O  ( 0w8!@" H# ѦP$ ѦX%`&h'p(x)?*]+,-./ ڧ0 1 243 W5 v9 ; Ш>??@% &!'&% &+ &-&/ -]3Z(     +j(+  ;d j( '  0(c((dG(e4(gR(i p(lu ;((') ') -]*)!(*v)*v) val* D*!D *"D*#X*$v) D**)*+&)*,#) +)++ ) ,),W, 5)!*'.**(*)({)*.X! *1y**2~**3*4 *5+*6+ y*(***%)*/)*7.* 8***+ fn* ****** -+-X end-X .;U+5cs.=X5sl.?X5wfe.AX .E+5ss.GX5sti.IX,.KX5nmi.MX,.PX ,.SX0,.VX85lm.XX9,.]X:,.dX<.,4cs.&4csx.X.+.G,4ss.&4ssx.X.U+ .gM- r15.m+ r14.n+ r13.o+ r12.p+ bp.q+ bx.r+( r11.u+0 r10.v+8 r9.w+@ r8.x+H ax.y+P cx.z+X dx.{+` si.|+h di.}+p.+x ip.++.+ sp.+, / u-/ / u-G, p0- cwd0D swd0D twd0D fip0D fcs0D foo0D fos0D0-0DlD .+.0*1. rip0+X rdp0,X.0.o. fip0/D fcs00D foo01D fos02D 0).* .*1.00@.0A.0B.D.+ `0$G/ cwd0%& swd0&& twd0'& fop0(&o.05D06D09G/ 0<W/0>.t.DW/+Dg/+? 0QD0 cwd0RD swd0SD twd0TD fip0UD fcs0VD foo0WD fos0XD0Z-0[l0\m0]n0^o rm0_p0`q0aD0x0bDM-Y0+Xi0+@0:00; X0< X0= 0X0+0@@0O0<0P.0Qi00R0@0Q+@0^S1(0_z-R0`.(0ag/R0b0@(0cS1e1+0@@0f 20h]0k]0nX0qXxfd0tX0w]0z]0]0]<00@@0C20 X0]0] fpu@020]0+02020 2 0 20<0e1@@e1 1 21 X1XQ2+3+33+3 3 2>k32?+2@+2AD cpu2CD 383393 3<33=334<34=]4>  4:44;33 src4A& dst4A &4 45)45" 5=44 5)4!6 `46" 6"I4'7'7'7'7!'7%'7''7,'7/=4'73'75'79'7<'7A'7D'7H'7L'7Q'7U'7Y 8#58$=48% 8' h5 9 59  :)5:*{(:+" osq:-5 :/9;ɷ9;ʷ9;˷ 7> d ?$E7?%?'?( 0?Dz7?M#6?P(?W) @7@  @z7 A7A 7$B7B+B7B777 B 8B 77 BC8B7B7'CD D"P8D8D=4DU8 D8a8D]D (E09E1{(E7{( osqE95E;"E<9E9E9E9E9E F+i9F,"F- G9G]GA9 H H 9H 9H$ I:I]I]IGIGIG J<:JXJX$(Jc:=ctJ9J&c: :-]K: L:L : : M :M (N ;N N N$ O:;HO 7O Q O U;O8-]P r;$@P';HP(;P) Q P*;(P+x<0P,8P-9P.:P/;U;;;r;;$@@Q/x<Q0=Q1]Q2  seqQ3_6Q4;Q5:; Q6G0Q7 Q8< (R<R 8R+R <RD <<}<< S =SS S=  = T+;=T,T- xU}=U}=U]`U+h maxU+p+=+ !V = sigV6 V= WRz WS== WU WV==uX>X X  X =!X'@>X(X)!X-~>X.X/X0 >X1!X5>X6X7X8 >! X<>X=X>X?X@XA!XS+?XT f%XUXV! XYO?XZ f%X[ !X^?X_+X` Xa XJ?XLXQ XW>X\+?XbO?! XE?XF?!Xg@Xh _fdXi!Xm8@XnXoXp] u X%@X*>X2@>4_rtX9~>XB>Xd?Xj?Xq@@+.0Y @Y Y Y Y 8@ 0Y @@ Y@ A Y :AY!Y" = Y%|AY'=Y(+Y.=Y0 = Y3A saY4:A Z AZ ,Z + lenZ +Z  8[ AB[X[X[X[X[X [#X([,X0 \)iB\*X\+:; P\8B\9B\:]H\;]LABB+$8\DBH\Ez\F5\G]0$ ]>MC]K]Z]p]]] end]MCQ\CQ+!^ sC val^ ^ \C!^ C val^  ^ CSCU XV XW">][ D0h|Di86jkCcpul]mXnX oX( D+D+ DG@@{E X X X D D+ +(+0]80@!G X X X X X  X( X0 X8 N@ XH XP NX N` Xh Xp Xx  X  X  X  X X X X X X X X X X0@uHD< 7! X(" X0# X8%@&P'Q(R)S, XX- X`. Xh/ Xp0 Nx1 X3 X6 7uH9H;H=+MavgGD@!G zH0KHLM+N+O] P$Q&SH(H;]I III IG`J<a7h Xi X j X(k X0l X8s N@t XHu]P]]]]]]]]<r;X<r;rqJHJI;^JJJIrqJJ+] +] +]+]_0f?8U kV uV V VV gVggg g  Wg!g" ,g$] Hg'Wg(G keyg)g*Wg+ g,(g-0g. W8 extg/W@gVV g3$ g8W tpg9Wg: g;Dg<D W ,5 h WX X XX hFXh{(hhW XiqXirXis}< wqivXH cpuiwP X xjXjjXjY( lenj{(HjYPjpXY++Y+"Y+`@kYkYkYk Hk=4@@k XHk!+k"+k#k$}<k%Xk&z k'vZ0k(+8icpuk*@isspk+ZH{( Z+ `k6vZk7=4k8Yk:Y(k;+Hk<vZPk=Xk>\ Z keZkf] sdakg\kh"ki\{ZaxkD\kEvZkF\kH kI5(kJ=4HkK5PkL+pkM+xkN+kO+kP+kQ+kR+kS+kTkU+kV5kWi9kY k\+k]+k^FXk_ZpvZ\+"YZ'l m33\8\Q\Q\+V\ m6\m7'\m8Q\m9n\nI0nI0!n"\n#5n$n%!n']n(n)!n+&]n,n-n!T]n&\n*\n.] n{]\ opsn]&] {]] n2]n4+n6]n7] -]e@]-]eH^ epF^eq]eresK^ F^.et^e]e+e^Heze+Ye^*P^t^$@e3_e^e+e+e+ e (e,e3_0=rcuez8ed_H^T] ed_e ide=_s_Q+ e_e_ _ (o_o"oNoo !p s`pXp& p)8 ldtp*x`8p.+@p95Hp:hp;app= xpC&|pD~ s` q aqq+ altq+q+q+ q+(q0q8q@qHqPqXq`qhqpqxqq q!}`a pF_.\a^ `]Xa4lruY*adeibj +k+.(RAbahLas+ .(ubz+ pp{b|+}+~{( b.b+.bYc  rYcrq refr=r8ri9Hrjhr]lr+p opsr mxrrRbY(Qc*b*Ab*b*bbzc] _ cval+;cSMcN P]IJdvlruK*cIW8d(X (YcS@GdI+cULV + d([ 0\ 4^+8Z@Fd*8dRjS(m.en+o+q r s t v] Z@lLe*dRzS0}e~++     (S e++Z@|f*Le*eRGD'f7d7.e@7e;+'fG Cg L =4   xL  x(]0]4N8~@P p  x#$ % '7ڞ9f5egctx6jg eg=g>7@MC(XgY8(\ hb+h+t7w }$S3h++ZQh* hRzIvh(4f('f hMrb7+g hsbisc sh sjsk%sqH ss(sta0su8sw@s{Hs~PsXs`shspsxhioggiXcid @@ j _ :j+ UU@@n7i@8@+P+X+`+h+ppgd  x) 5 ?nE+L]S Z"]{(_a=4p8r+++++ +(+0+886@=4D+H+P'+X3+`+h1brk+p!+x++%+0+n-n@Bna+h=4pLnxVnCg&`n++  s_{(Xjn++{( ji+-n+3_=n+ =n Gn Qn [n en+~nQ+; ]nps/ os7 o(pmds9 0puds; !8@sEHsFPptesL XptlsP4`sT h>]o @ccccc9t69t99t<9tG-]u}o-]uUp    -]uq        !"#$%&'()*+,-./0 8r rr+r2r2r+r+ r+(r0  rXr v<-r 8r8r=r viervn+vvr$8v_rv`{(varvbr,vc ,vd =rcuvez refvf8r0!rer! r v + %r>]T7sXQBj<@]+|Am+? 8bֈb b! b"+b#Xb#X b$+(b$+0 b'b(Xb)X b03b1 b2 b3  bCNbD bLvbMbNvN 8bQbR bSNbTi9{ֈʼn+MMՉ+ Չ ߉=+   ($0k5Hz $` =rss (Z 0 85@ X   fn 4 arg |+!  b   DcS@cTcU7sYcWacX8bcYz$8cI qcJ ioccKyT7@ c\]0 a ! ы val ! val ݋- 5!. L0  45 45]67+  |ˌ+Ќ0p9qCgr s 6t u v&$([ sC ы} C P] 9[  99(98 CgHБ()8*+ ,0-5@. =4`/ d0b}h1>p2 x3+4_ ! Վ val -]6 BE>4uidF sC4gidG CH Վ D_J H       ( 0 98 9@ He+ ](], 0 8@ !W %e@809I:I;I<I=] >](?]0@{8Ib}5]Nvb}v>bXD)E]FBG RH]I] J](KI0N k8O@QHS{PBb}. RGffxWxՎpxfxYZ[X\X]X^X _X(`X0aN8cN@dHeLfXPgXXhX`iNhjp81]]]] ]]]ino  i( i0\]\l+ ]]] ]]]]XIЕЕI (048@RHЕPb}~Еb}]b}lՕb}>4b}vMb}M1908  ] 8 0 ÖH1ops!Ӗ xÖ+Ӗ+W+Iw(} ( ! ! 6ˌ&b ՘ !(S0 l8 @ H P X>`Rh pp x՚ ;{{ gCgfL{՘L  ژCgL]8SCgL]]&]lL]X qu șˌș͙ (+,-./ . >L  RCpW uLƚƚCgК˚ ] CgښˌșbI-(d(]ZS(RzIx(!x( ' x}I̛(1U((( ,( ] h(b %@ ops xHP dev{`]d̛ -0@Z[/\R]p^` bԩ(d0e 8f.@hQHj PkyXm`oɪhppr xsAuZvy{ë}'j7   Ý ͝ ם(RCg `4pidMMh:uid sCsC $  +]] ]] I ڞ(5( XZ )R*z(+3(,R(-r;P00z  <zjk+    Ь ( 0 8I@ H!P X!`Dhbp x{{{{  ˭    ) $ .B3= GL V `eX t ~`@J  9 E 9 9  9  9  9 ]$](],]0 ]4#G8$@'"H*#P-]X0]\5`6 h<p=x?=@jBDFHJLjNPjRU=W=Y [ \8]8^8_Q`QaQ b=(ce0d 8e @jeHk PqXsV\`vxxz| %^dev}ù~71dbg1RRRJL OQi+Qy+$;GX] ypos ; ] Cg,Cg,uOCgGu1mˌm]r TCg|cCg ѦCg]+Cg ֦xCgCg$?Cg!]CgD{Cg{ b+Cg++++Vڧ1UCgu]Cgu1U]ߧ%Cg%8*/ WCg9 llCgq \CgCg]{ШCgCg]] ըm]u/xu]GMuxM4pxW2xuu,ԩxuuxu٩ xu.xuGQxu3yxu{Vxuxu]~ĪuĪ}~D]Ϊu,7x7XX< ZxFxuCg]_xCg2ëuu2ȫu 'u Vmt 8 +eex,V>]xb} xЬx{xլ b} b}o!b}:u:? &bb}_ ,I{lugb},˭b}G߭߭xЭb}   %uMG/"b+ @@AGBCDܶ EB( sdF@0G788I]8J]8K]8L]8M]bb a+7f rev+ a @$@  @G=rb7 ns0]8< >`@ idX` hp=rcuzx  opsQ![ @hLp "$ % в & (( 02 89@: H= !P@:XA X`L V 4dirkE  \ kn@Cgl 5 5@`h ,x    @  A %ikk\ kulluвlu lղk,c!k :k &Xk?-] 0'ܳ(]) r* +, - 4(X X (;(G( (m](n(o&X(0(1(2 (3 (4 (5 ((7 ٵ0(9 8(; ٵ@(= H(?$P]] //R 9p W/XLzCg,ٵCg ,Cg ޵$Cg  (T( r( )r/,Y/Gw `ܶ =4b ŸX 0t=u RvWw!\x*y z (= RGTa(uuzܳfz zza }~ibuf$ ,+,$+?Q6+ k6zpGzzk (+++++ $0N=rcu1z273Nʸ]Q+ HIJK LM+Non ù0b@pHGP Xbus`h p x5e< 1msi(8@XHXPX `hx  {1idD=4 u!!\# .$"%,'#1);+ `, a- b. c/ d9 e< fù :; <   .!"# $(%0&8'@(H)P*X+`,h-p.x/012345 .#>Ud>]lHxy =4z]|]}5~0@ 08;+  + !+ "+ #+ $+ %+ &+ '+ (+ )D=4 i9 P@ @ A B C D E<r;PXX5Z  ]                ]d33XXXX_  t(1qos~0 +P,G id-./=4 0Z(1}<02+X3 Q`4 Qh5 Qp6 Qx7 Q8+9+:+;+<+ dev=8> 8? ; U t5d yops  . . ] M3NGOGP!\Q!\R!\ TX(Uv0V8W .@X .HY .P[X\`^h_paxcd . pmfh"LLS `SaG busbd %eGg h$jL(k0m8n .@oHp .PqXr`s!\ht!\p pmvxw . pyQ8qq]{ 3 `2G3G5!\6!\8v9 e ; z(< .0>8@(u@AHC P pmEX,`q`L uuGjq qz 0XYGZ!\[v\ ^ . pm`("+ J" w OBDEFGHIJw  .A|K :.@"*N\O+PQ  * 5 . Dddh      =G= (%E%FG mod%G % ops%H!%I 0%J%K B),=%L4arg%M 4str%N"4arr%O{ %V%W]%X, %\v max%^]%_] num%`Z  ops%a!%b'v%$0(H)j7+  +  ] _  Q$+7 `-r.b mod/ %@0H mp1wP2bMX r 8567 9 ; 3 <G(= W0,|$G 3 %G#G %8 W %L>]>G8EmodF %<GGPpqrst]Mmtnw O O],, TY?B/j+'  WZW  r#-]-ȦGYY _@G  idS clsQ Q,q`z]]+>];>]e8 0!r" >]1>]BA>]Oecd&e2f4Ag lidh ]  X cma  01G2 3G46MX7M`8h9p:x>+? @/0 ops1" dev456(78  'e'|S+ +Qo+Q+-]  getU put e y y ( 08 @HP2XK`dhpKx2U Q R] idS]T  PfFgh]iY0UF eZy j q~  G G]  G%G 2 #K 7d GP GG]]i  ]  D M, M W 12345   E len E! E $O% E& 9' 9 (a% +,]-].] HFG] lenH I J K  L 9(M 0N 8O @-O \9]D^D ja ecckm9Jf  , J 'J' Lu (XXD H55 8]a JJp8=J$eJpeBJpoJJp\ J+p J8JEQJ=eJV-]rE rNrT rZre ~nnYc++r.rCrrC*RQ+rmr**S(s0vmas1 s2 us3 +s4+s5+ rIs>(s? (s@ @   +% H +++*~nan]M~nn++f+  +G  UU +a% + -]v     -] j      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuV]V]'V]RV]b @X K | C ec W K K K X K<|h+@ W  K | | | | K K  \ K K K K  \$ W( l0 K<h|l+||+ cd Ke Kf Kg | h | i ?j k |l crcm K||,+V]iV ~ hdr~hrb7$ =u ec &_Q{Qvol|Y}&a e@+a +0XJMdevKùL̛1ubiMJXN`OdPhQlRpStTxV|WXYZ[ \]^__a$b(c 0d 8e@gTHh]"i]"j]"k]"l]"m]"n]"0,E-̛Mdev.ùh/X0o\1h2p3 =4x4|5689:;<>?@AB5DFIJ =4K7L5O1fmPQ R, S88T8`UV WXXYZ[\_7`7a7bc71pqdef =4g5h8ijklmno p(q0r4u HvPwTxXy\z`{d|h}l~ptx|]]1mtdJ55V\1dbg^ Ox+]+]+]+]+]+]+]]]] ]ju u(u0u8u@uHuPuXu`uhupY+|V+ Q+ rb7(G8ec +]+]Mu G@7 Mrb7 787(8HX\`dhlptx |     E7sech<Vd9| B +B -7k@ <J99EB+V9G[T,7ll7T.78T5#JJB/9G[T < JJ2/uJ8P7suJ?luk~k:J;JWJJJA JB$$W%G[Tf:+kLJBf ^J> zzGl9T GG+B ,B3 9G[J4JYW8ZUB;zB=l:l<B&]G[T DDnl#T#G[md &ubid69 nubi.JnaiKwerrwav xZ2.A @ M YCer~oNNy3  4 4Co4e04 U T NN 2?$@* + * * + +U}2., . . .C./5U~Ts24 U 4qmUs8VUs6U}T~LUsU}T LU~LUs6.U}TsSU}T M|U}T|Q0RsLU~LUsU}T MU}T|Q1R~>U}T >DU}T L\U~LvULUs24B 422 , 9CEPK]Qbo$UsN}pyH0 X0 e0 r0 0 0 000000K0011&161=UAQp@4 e 4MU}T|Q0RvMU}T|Q1RvLUv@43 42 Ln   A>     @-?K  ! L- 2- %- 2-L@-  R- _-ql-m-@|-   - -/T Q XN/ 4 A N [ h Nu vv 2H0" X0 e0 r0 0 0 000000K0011&161=UATN   p  K  > U TQ R 5TvK L-r 2- %- 2-L@-  R- _-ql-m-@|-   - -/T Q XN.3@MZgqtuLH0z X0 e0 r0 0 0 02* * *e045e04^>U|TcU}T U}T RlUsU}T U}T #U T Q 5??U T Q 2 T   A     @- ?2C   U  b Cn o{  T  UsU~e04> U}T  U|Ts^9 U|Tvc U}T R1 U}T ?U T Q ^ U|T ?L: U}1 U}T V U}T { U}T ?5/ ) &ubi:9&ai#3err3i 3av 3volY\9  D# D>  X9 +) #/  &vol.&av%3errbad/ &ubi,J&ai "z" "3i 3err   3av  3volY\ /    """""" D" """"D5# D5>  .rrzzzzzzzzzzzD# D>  X+ <:/ .&ubiEJ&ai 3i}  3err/i =&ubii@J&aij"&avk" 3errm3rbn73aebo3lebp=q\ #  -M+ !nubi+JnaiHwerr f  f!f"~f#1-xYxOA7%# g%Af%y3% 4 4Co4e04% U T R2+' % + +C ,,K$,),6,L- E 2- %- 2-L@-   R- _-ql-m-@|-  - -/T Q@KD,TE,R,L@-I R- _-U~T 2a,O o, |, ,p,,214 1 1 22#222A2P2K_2`2p2222=U?T~5UsT0lU}@4/Z 42.*B g* @*M* Z* t*C2+ +U|T ?,U|T4]U|T@QXU|T 2".U .. :.zG.A S. _. k.]. . . ..UTQw.@+Z +L+X +?llU}@+L +L+X +U|TvU|Q}~UvTU|TvXsY0~UvTX1+ ! F rubi09{'OiOn % ))&%0d:P%OerrOcrc 9%Gbad A)%UvTQUsT Q~R|XvUvpT~UT|]. . . ../5U|T Q]-?|2C 2 2C22223@3N3\3j3Kx3 y33333(U|T=U2TgU T|QUsT Q~U|T~UsT Q~U|T~ UsT UsT Q}y%rubiy0J{zOre|%A %~A$Ocrc 9OvolY%g;O"%%%%%)!)))!))zH0 X0 e0 r0 0 0 0A$%%%%%A#%A#d %%A#%g]#%U TQ RH0 X0 e0 r0 0 0 0 5U~Qg$%]1$ 1 1 25T0U TsQg$%~) )C)))]*Dw% * * %U|TsQ0 UUQ1Z)rubiZ/JridxZ8{[Oerr]Ocrc^ 9\) v&d`# d`>  A'%i%i%i%i%i)i&')i)i)iF')i)izH0i X0 e0 r0 0 0 0|)j( )C)))]*DL( * * o(UvT|Q0 UvT|Q1|l%) @,f( ,6)UvUvT 04`l)U T|Q)U T Q`?X)+)W? *Uubi?5J)AYhiBherrB /.*&ubi79"@/*&ubi8J&bufI" "&len#\* D# D>  X*+*/|q+&ubi|=9&buf|H"} "}&len}"\+ D# D>  X++q+mn+&ubin3J/e#~+"eJmX+"X</@a,&ubi@,9"@7uB3bufCD,E E IIm/,&ubi/>9"0 &buf14/,&vol@Y"I/ t,&ubi t<9/-&err%/ %@-" ;" Gu/|.|-"|D"|Pu]/%]-"<"/z0r-"zCu"zX+/j."j8."jV.}G.Unew/EF}.Unew1EEFWA.UnewA@EBEChretE~H0&p$&q?"R ///>/M/\//q/#/#/#/##///// 0#0#*0#:0##~#1"#:"$"%"&"'"(0U0U0U0U0UC11U#1U#&1U#61U#U#R1Wa1Wp1W1W1W1W#1W#1W#1W#W#~2":""#222A2P2_2p2#2#2#2##"3UpALET))hret 23h__p,)))@3FN3F\3Fj3Fx3F3F#3F#3F#3F#F#}3E2GE<E]W"&4Ukey"J+4E"Z(M&4W ,,4) 1 `4) 1 r4) 1 4) 1 &4) 1 D) 1 XWA!4UptrA<W4!4Uptr4=W'#5E'006++G+XG6Q6] u6 6 6 6 int ] ,6 *6Is8iIu8|Is16Iu16&Is325Iu32Is64Iu64S] z 6 +  1] 2] H I X ] ^ _ `Q66 % ' <]  D S     #6 % & *+ 4 = B U h5 l nD qX } N  X  X  ]  ]  X q   N   D DDIDQ^+! ^S]M     +W+0   X+   &( */-@ 3]]  7( ],!]0( 4)38*]H++P,X5 `6 d8 h: l; p< t=]xTse?G@0rt@HcdlAIBIFK;I7J+K]OKXK]K;`"xE@dh]k] l+m nK oK(pX(0q Xs`ubx dy8Khzp{K+    8K yD:(;7P0mmn hn pLx    +] ], ], ], ]- ]- ]- ]- ]- ]- ]- ]- ]- ] - ] - ] - ] -"] -+*0pid w w+ (0@IMPNMX "^M%N (N + - X. X3 X4C6D: (=+0>+8A X@D XHG+PH+XKfB`;NBTNWNZN^Ok 2mOp: q:(t+8u+@0fsxOH{OP~OXO`Sh Sp =x = =A+ ]S pC]<A X  X ,4 " ^K 8( 8 S@  H SP SX S` uTh Tp +x T A ]  X  X  X 6 6  T   D  D "T )T    T0  58  ]X T\ T` 5h  U      !] "] # $+ & X ' X ( X ;)^ 3U CP% D+ LU N+ R#U SD( TD, Y+0 ] 8 ^ < _ @ ` D ;a^H dL7X g-U i7 l7U w x z+ } ~;^ !"Z3$"Z3;.^<V;F@@@%\3pad!+? @)@   !5 key"5?7A+B<CA 7 =g> """XH  G   "% H  ( $0 8 @ "H "H "H MH "H "H "H "H/@V PhGGX ]]50kpb ](],X0 ]8@AB]D gHPcmeml@+ ]} (0]8@]H]LP]X`]hp -x]]$]]]P% ]!P%"]%&A9]:?AD F P Q](T%0ef+g-h7 u-v5w5 keyx 2 U]V jkeyk<nkeyo<5 ;<='? ] '@ ]$'A ]('B ]+ BC&D&'E& 'E&(4sE&,4dplE&-4pE'&/'F&04avlF&44lF&54dF&64gF%&7'F+&8 + + + + +  pte " / pmd "%X%%<%/;d' ~pgd'<'"edp pudp<p"<!@HI+7[cc0 4+8/@@ I  2sp +es  ds " $ & +( +0 28 +X +`cr2 +h +p +x 3 + ] D + + 2Tfpu 22@] (! n ! H(s /@@ 77j@ln@~ / J!70hn  XNh (,h0=sh8Xhh%ip+x@g ii(UiEg+"!""+"""&"&"%"3val" %!%! "9"" ",%"+#i"##i"y"+#"# %E" # "y"#9" #"r$r$  %"%9" %" &a#&"&&& &&]&+,'#fmt'G'G'G']'G'G$a#(6#(7b(8!8(h$(G(G(G(G8(]8(]8(4] key(9#()](=$ 8(U$(V mod(W$(XG(Y$ (Z (([ ,(\h$0G (uF%(vF%(wK%(x](y]#$+Qe%+ )/%)1] set)3 get)5)7 3e%|'$ޥ  ' J  ( 0r8!@" H# ̦P$ ̦X%`&h'p(x):*X+,-./ է0 1 2/3 R5 q9 ; ˨>:?@ % *!'*% *+ *-*/ )]3H(     +X(+ ! ;S X( +  0,c(,dG,e/,gM,i k,lp 6(u("- "- )].)(.f).f) val. D.!D ."D.#X.$f) D.*).+&).,#) /)// ) 0)0W0 5).'*.(.)(k)..X .1i*.2n*.3.4 .5+.6+ i*(.*.%)./).7* 8.*.+ fn. *s***** 1+1X end1X 2;E+4cs2=X4sl2?X4wfe2AX 2E+4ss2GX4sti2IX'2KX4nmi2MX'2PX '2SX0'2VX84lm2XX9'2]X:'2dX<2 ,3cs2&3csx2X2+27,3ss2&3ssx2X2E+ 2g=- r152m+ r142n+ r132o+ r122p+ bp2q+ bx2r+( r112u+0 r102v+8 r92w+@ r82x+H ax2y+P cx2z+X dx2{+` si2|+h di2}+p2+x ip2++2+ sp2+ , 3 e-3 3 e-7, p4- cwd4D swd4D twd4D fip4D fcs4D foo4D fos4D4-4DlD-++4*!. rip4+X rdp4,X+4._. fip4/D fcs40D foo41D fos42D 4)s.%-%!.04@.4A.4B.D.+ e4$7/ cwd4%& swd4&& twd4'& fop4(&_.45D46D497/ 4<G/4>.ss.DG/+DW/+? 4Q40 cwd4RD swd4SD twd4TD fip4UD fcs4VD foo4WD fos4XD4Z-4[l4\m4]n4^o rm4_p4`q4a40x4bD=-I0+XY0+@4:04; X4< X4= 0X0+/@@4O0=4P.4QY04R0@0K+@4^C1$4_j-L4`.$4aW/L4b0@$4cC1T1}+/@@4f14h]4k]4nX4qXxfd4tX4w]4z]4]4]=40@@4224 X4]4] fpu@424]4+424241 410=4T1@@T1 5 25 X5XQ2+2+33+ 3 3 6>Z36?+6@+6AD cpu6CD 78u3793 7<37=3u38<38=]8>  8:38;u33 src8A& dst8A &34949" 9,44 94: O4:" :"84"""""!"%"'","/,4"3"5"9"<"A"D"H"L"Q"U"Y ;#5;$,4;% ;' o5 < 5<  =)6=*i(=+" osq=-5 =/9>ɛ9>ʛ9>˛ ?!?6?" ] ?&$6 ?Df6?D?6 ?DK6 ?E6?E?6 ?Er6?T 6?Y6?Z ,4 ?[6@ 6@6+6+ @86 (A7A S B$L7B%B'B( 0BD7BM#6BP(BW) C7C  C7 D7D 7!E7E+E7E77 E 8E 7 E@8E7E7"F~G G"N8G8G,4GR8 G8^8G]G (H09H1i(H7i( osqH95H;"H<9H9H9H9H9H I+f9I,"I- J9J]J>9 K K 9K 9K! L:L]L]LGLGLG M9:MXMX!(M`:>ctM9M&`: :)]N: O:O : : P :P (Q ;Q Q Q! R7;DR 7R 5 R R;R8)]S o;!@S';DS(;S) 5 S*;(S+u<0S,8S-9S.:S/;R;;;o;;!@@T/u<T09T1]T2  seqT3f6T4;T57; T6C0T7 58; (U<U U+U <UD <<z<< V=VV V = = W+8=W,W- xXz=Xz=X]`X+h maxX+p+=+ Y = sigY6 Y= ZRz ZS== ZU ZV==t[ >[ [  [ =['=>[([)[-{>[.[/[0 >[1[5>[6[7[8 > [<>[=[>[?[@[A[S(?[T U%[U[V [YL?[Z U%[[ [^}?[_+[` [a [J?[L[Q [W>[\(?[bL? [E?[F}?[g@[h _fd[i[m5@[n[o[p] t [%@[*>[2=>3_rt[9{>[B>[d?[j?[q@@++0\ @\ \ \ \ 5@ 0\ @@ \@ A \ 7A\!\" = \%yA\'=\(+\.=\0 = \3A sa\47A ] A] ] + len] +]  8^ >B^X^X^X^X^X ^#X(^,X0 _)fB_*X_+7; P_8B_9B_:]H_;]L>BB+!8_DBD_E^_F5_G]0! `>JC`K`Z`p``` end`JCQYCK+a pC vala a YCa C vala  a |CSCU XV XW"?][D0hyDi?6jkCcpul]mXnX oX( D+D+ DJ@@xE X X X D D+ +(+0]8/@G X X X X X  X( X0 X8 N@ XH XP NX N` Xh Xp Xx  X  X  X  X X X X X X X X X X/@rHD= 7! X(" X0# X8%@&P'Q(R)S, XX- X`. Xh/ Xp0 Nx1 X3 X6 7rH9|H;|H=+TavgGD@G wH0KHLM+N+O] P$Q&SH(H<]I IIIIJ`J=a7h Xi X j X(k X0l X8s N@t XHu]P]]]]]]]]=o;X=o;rqJHJI<^JJJIrqJJ(] (] (](]d8K^KubJusD{K{K^Kr KK KJK+d(X( KJLx8 Y@ D H8P+` +h)p+x ,48 Kpidpb7IMb9 7b:]b; ,4b<u inob=Xb?Ƃ b@@bB5H>rcubC^`bDւpL^M+f9!coNcpi( uidcq pC gidcr C cs pCct Ccu pCcv Ccw pC cx C$cy ](cz0c{8c|@c}Hc~PcXcO`cOhcOpcOxc c0cSnc Ac57cMNkeydòOd7d7Ad3 semd8(d=Pd Xb`d 9h uidd pCp gidd Ctdxd|d~d d+υdBN O O O O OeXe^Se_7e` eaeb ecee5 eh8ekA@enXeq`esdethewpex]tezx8e]8e]e]eeDeo;e 5 itee/efBehe eIMemttye։ee 6eXe XeXeXeXeXeCe+e+e+e'+e+ e+(e"+0e,+8e+@e+He"+Pe,+Xe+`e+heApeeeiee ]eeeeen e5e80Of eSe,4e7e5eY S S S S S S XfcuTfdi(fe fg fk ,4fmfn(fo0fq X8S zT@ T T gTgngVgbT TT+ T T  U+#U+B (U 2U8=LU+ LU VU `U!hhyUhz]h|]h}0_7^hH^(hz<0h+Xh#5_`jU @i4bVi5bVi6 i7+i8+i9n i;](i=],i>q0i?8U gV qV {V VV jVjjj j  Wj!j" 'j$] Hj'Wj(G keyj)j*Wj+ j,(j-0j. W8 extj/W@FVV j3! j8W tpj9Wj: j;Dj<D W 05 k WWXX X kBXki(kkW XlqXlr Xlsz< wqlvXH cpulwP X xmXmmXmX( lenmi(HmYPmpXX++Y+Y+e@nYnYnYn Dn,4@@n XHn!+n"+n#n$z<n% Xn&^ n'rZ0n(+8mcpun*@msspn+ZHi( Z+ `n6rZn7,4n8Xn:X(n;+Hn<rZPn=Xn>\ Z neZnf] sdang \nh"ni\wZfxnD[nErZnF[nH nI5(nJ,4HnK5PnL+pnM+xnN+nO+nP+nQ+nR+nS+nTnU+nV5nWf9nY n\+n]+n^BXn_ZprZ \+YZ"o p30\5\N\N\+S\ p6\p7$\p8N\p9q\q90q90q"\q#5q$q%q'\q(q)q+#]q,q-q!Q]q&\q*\q.\ qx]\ opsq]#] x]}] q2]q4+q6]q7] )]h@])]hH^ hpC^hq]hrhsH^ C^+hq^h]h+h^Dh^h+Yh^%M^q^!@h0_h^h+h+h+ h (h,h0_0>rcuh^8ha_H^Q] ha_h idh:_p_K+ h_h_ _ (r_r"rNrr s p`sXs& s)8 ldts*u`8s.+@s95Hs:hs;aps= xsC&|sD~ p` t att+ altt+t+t+ t+(t0t8t@tHtPtXt`thtptxtt t!z`a sF_+\a^ `]Xa3lruY%adeibj +k++(R>bahLas+ +(ubz+ pp{b|+}+~i( b+b++bVc  uVcuq refu:r8uf9Huhu]lu+p opsu xuubY(Qc%b%>b%b%bg^c] d cval+<cMMcN P]EJdulruK%cEW5d$X $YcM@GdI+cULV + d([ 0\ 4^+8Z@Fd%5dLjM(m+en+o+q r s t v] Z@lIe%dLzM0}e~++     (M e++Z@|f%Ie%eLJD$f7d7+e@7e<+$fJ @g H ,4 e  sL  x(]0]4N8~@P p  x#$ % '7՞6f5bgctx6gg bg=g>7@JC(XgY8(\ hb+h+t7w }$M0h++ZNh% hL^Esh$1f$$f hTrb7+g hvbivc qvh qvjvkvq vsl(vt0vu8vw @v{lHv~lPv4XvH`vahvpvxhilggiXcid @@ j d 7j+ QU@@n7i@8@+P+X+`+h+ppgd  x) 5 ?nE+L]S Z"]i(_a,4p8r+++++ +(+0+8?6@,4D+H+P'+X3+`+h0brk+p!+x++%+0+n*n@?na+h,4pInxSn@g&]n++  p_i( Xgn++i( ji+*n+3_:n+ :n Dn Nn Xn bn+{nK+< ]npv/o<v7o(pmdv9 0pudv; !8A@vEHvFPptevL XptlvP4`vT h?]o @hhhhh9w69w99w<9wG)]x}o)]xRp    )]xq        !"#$%&'()*+,-./0 8u ru+u2u2u+u+ u+(u0  rXr y<*r5r5r:r yibryn+yvr!8y_ry`i(yarybr'yc 'yd >rcuye^ refyf5r0rbr r v + %r?]T4s9s 4sTs++ vn>s z"|sz#s z&sz'sz' s|ss+{s{,4{ Y{sg{%s!{t7s+|3%t|4D len|4D|2@t%t|6X |1at%t|8]@t|it|j|kt5|rt|s|t|sg|u^!|Ru|T]|U6|V|s|Wu|X@t |Yx0|[x8|_"y`|`^}h|a+p|bxD|dsft|m|n>d_u|vttt/x{x| k}~ pC C] --! ^}(L0 8+@H _L P 9X 9` 9hDpDtDxD|,4 MD8++&& (0@H P T X \sN`h;Kp8sH P(ÝX͝`םh pux+'!@|y|}|}|}|}|} |~(| ~0| ~8| ,~@| J~H|~P|~X|`xy/@^} _+  (! 0!8@"$H+P+X+`uh8p &3#LV$ejas  t @g ~ E] X(;,` D99!D"O/ T0 14 d6]<5 BG@D"yHFPIi(XL`O dRXhSpZSnxabcrcuc^d Xf5k0;n,4@@oHq,4Xr`y)]|}}u]}}}}u@t}}}]G}at}}}}~u}~u ~,~ux~J~u1~ }E~}Fu}G^}}H}I~~~O~~ ~~ mnt~ ~~ u~~~~~~uuc}~ fD k]  XX ino)X dev* _(+ _, uid, pC0 gid- C4. 8/9@09P19`29p3X4X5D6D7X8X9D:D;D "#Y nid&-+4+7QU!RSUXYZ ]c 7 df9(>rcue^HgXj` idmpptqGxruu+fi(,- ,4/ Y0 0394678  xa9 n " $,4!@@- lru/90i( n b2 nrb3 nsb4:ւ+K+ valX )] + ` 9pCC +  d d!dl>rcudm^dn7do +dv#dx&dy Ndu<%3xd+ (drdt+#dddG ʃt ddd Äӄ+ d߄OO dAdӄ keydOdYdbdgd7dd 9d 9+(dυd+d+ddd  (dd<%M ddd E d.$d% . 8 ʆ 7_+0i(8@ uid pCPi(X `$"h cc 7c gidc CK+Yc0crcuc^Gʆe@@Tg9Th" cpuTi]Tj]Tk] 'Tl]'Tm]'Tn]'To]'Tp]Tr]TsTtTu]T{ 5 T|;(T} 50T~;8DTH@@:X5>n;@Y+yAi+? 8e҈e e! e"+e#Xe#X e$+(e$+0 e'e(Xe)X e0/e1 e2 e3  eCJeD eLreMeNrJ 8eQeR eSJeTf9w҈+IMщ+ щ ۉ=+   $!0g5D^ !` >rss $I 0 85@ X  ݊ fn 3 arg |+  b݊   DfS<fTfU4sYfW]fXgfY^!8fI qfJ iocfKuT7< f\]0 ]  ͋ val  val ً) 1. H0  41 45]67+  |nj+̌0p5q@gr s 1t u v&$ޖ(W pC ͋y C P] k5W  99(98 @gHГ()*+ ,0-5@. ,4`/ d0^}h1:p2 x3+4[  ю val )]6 BE:3uidF pC3gidG CH ю D[ Jݎ Hޏ      ( 0 98 9@ Ha+ ](], 0 8@ !S$a@8,9E:E;E<E=Y >Y(?Y0@w8E^}1YJr^}r:^XD%EYF>G NHYIY JY(KE0N g8O@QHSwP|>^}*NCbbxSxюlxbxYZ[X\X]X^X _X(`X0aN8cN@dHeLfXPgXXhX`iNhjp8-]]]] ]]]ino  M( M0X]Xh+ ]]] ]]]]XE̕̕E (008@NH̕P^}~̕^}]^}hѕ ^}: 0^}r I^}I-5,|8  ] 8 0 H0ops!Ζ x+ޏΖ+Sޖ+Ew$}$   1nj!] И (N0 g8 @ H P X9`Mh kp xК 6vv{ b@gfLvИL ՘@gL]8N@gL]]!AgLASlYÙnjÙș (+,-./  ( 9LM>kRpL@g˚ƚ A@g՚njÙ]E($d$]ZN$L^Es$!s$ 'xxEǛ$-U$#$ $ ] h#]$@ ops sHP dev_`]dǛ (/@Z[*\M]k^` bϩ(d0e8f)@hLHjPktXm`oĪhppr xs<uUv}y{} "e2    ȝ ҝ(M@g O4pidIMe:uid pCpC $  +]] ]] E ՞$5$ XZ )L*^$+u3$,M$-rܝ<P/0u  =ung+   ˬ ߬( 0 8E@HPX`?h]p xvvvv  ƭ߭   %  )=.8 BG Q [`T o ye@E   )         ]$](],]0 ]4#G8$@'"?H*#DP-]X0]\5`6 Ih<gp=x?@BDF4H4J\LN\PRUWY[ \]^_`a b(c0d 8e @jHk PqXsS\`v xxz|$cdev}~70dbgE JQd+Qt+$<GX]ޥ tpos < ]@g'@gq J@gGq,hnjh]m O@gwG@g ̦@g]+@g Ѧx@g@g:@gX@g?v@gv{ ]+@g++++Vէ-U@gq]@gq-U]ڧ @g 8%* R@g4gg@gl W@g@g]v˨@g@g]] Ш h]u*xu]GHuxH/kxR-xpuϩxukuxuԩxu)xuG Lxuk.txuk_Qxuxu]yuy~D]ɪu2x2XX7 UxA}xu@g]kZx@gk-uu-ëu "u Qmt 8 +``x'Q?]x^}xˬxv߬xЬ^}^}j^} 5u5: !]^}N Dvgub^}{ƭ^}Gڭڭx˭^}     uHG*"]+ @@AGBCD׶ E=( sdF;0G788I]8J]8K]8L]8M]]] \+7a rev+ \ ;!;  ;G>rb7 ns0]8< k>[@ idX` hp>rcu^x  opsL!V ;hGk {"$ % ˲ & (( 02 89@: H= P@5XA S`G Q 3dirf@  W kn;@gg 5 5@`h x    @  A %iffW{fpggq˲gqgвfGf5f !Sf:)]{ 0'׳(X) r* +, - 3({Xܳ X ,6,G, k,mX,n,o&X,0,1,2 ,3 ,4z ,5 (,7 Ե0,9 8,; Ե@,= H,?PXX k**kM4kR*XLu@gԵ@g@gٵ@g ,O, m, $m*T*Gr `׶ ,4] X 0t8u MvRw!Wx*zy z (ܶ8MBO\(ppu׳auuv{f }~mbuf ++?Q0}+ e~0yujyGuue (+++++ !0H>rcu1^273HĸWK+ HIJK LM+Nln /]@p4HGPXbus`h p x5=9>H 0msi!(W8\@XHXPkX p`hzx & _0idD,4 o!!W# ($%'#)+ `, a- b. c/ d9 e< f :; <  (!"# $(%0&8'@(H)P*X+`,h-p.x/012345 (?U^?]lHxy ,4z]|]}5~0@ /85(  ( !( "( #( $( %( &( '( (( )D,4 f9 J@ @ A B C D E=o;PX X5T  ]                ]^--XXXXY  n(0qosx0 +J,G id-./,4 0T(1z<02+X3 5`4 5h5 5p6 5x7 58+9+:+;+<+ dev=8> 8? 5 On5^ sops  ( (] M-NGOGP!WQ!WR!W TR(Up0V8W (@X (HY (P[X\`^h_paxcd ( pmfhFFM `MaG busbd$eGg h$jF(k0m8n (@oHp (PqXr`s!Wht!Wp pmvxw ( pyK2kkWu- `2A3G5!W6!W8p9 _ ; t(< (0>8@(p@AHC P pmEXZkZkFooAdkykv{ 0XYGZ!W[p\ ^ ( pm`(+ D q IBDEFGHIDq  +A vK :(@%NVO+PQ  * 5 . Dggb      7G7 ()E)FG mod)G$ ops)H!z)I 0)J)K <#7)L3arg)M 3str)N3arr)Ou )V)W])X )\p max)^])_] num)`I  ops)a!z)b!p%!0(D)n7+  +   ] N   Q+7 `-l.] mod/$@0H mp1qP2^MX l 8567 9 ; - <A(= Q0vG-$GA$2Q$F?]>J8EmodF$=GJPpqrst]Tmtnw I I] NS?<+n}+'  WZW  a#)]-ȨATT @A  id݊ clsK KkZv{ ijk %m H  H G*]]+?]?]8! 0L!r"Q L?]1?]B?]Oc/d&Ve2f4g lidh /}W C MRX afMcmau  0&1G2 y3G4+6X7`8&h9&p:&x>+? @/0 ops1"M dev456(78++  " +Q+X+Q+)] H get put     ( 90a8@HPX`hpx.G`tH QR] idS]T Pfgh]iI0 k 9G%aG]>G$fGG GG]] ))RG3`]Lte  D    1R2345  ) len )! ) $% )& '  (P% +,]-].] HFG] lenH I J K  L (M 0N 8O@ \]D^D j ecckmE + e0EjE+ u (XXD H?55 8]ebEbRNEl8}lEEl El /E/WElW9E+laEE)EE)]uE uNHuT XuZlueXM{nln]Vc++q~u+uuu*K+uu*%HM(v0<vmav1 v2 Yv3 +v4+v5+ Ev>f$v? $v@ /q f +v  +++{nn]{nn+++  4 +GH 9a UMU +P%f +)]v     )]       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuS]]5Z[\]^i_|`abi+S]"S]S]' S]R%cd ;e ;f ;g | h | i /j k |l crcm ;%|+rb7! )>u ec x{vol|}xf e@ +f TTd+/XJjTdevKLǛ0ubiMXN`OdPhQlRpStTxV|WXYZ[ \]^_a$b(c 0d 8e@gHh]"i]"j]"k]"l]"m]"n]"d/,-ǛTdev.h/X0\1h2p3 ,4x4|5689:;<>?@AB5DFIJ ,4K7L5O0fmPQ R, S88T8`UV W XXYZ [\_7`7a7bc70pqd"ef ,4g5h8ij2k l mno p(q0r74u HvPwTxXy\z`{d|h}l~ptx|]]0mtdE55S\0dbgoo dx(](](](](](](]]]] ]Nu u(u0u8u@uHuPuXu`uhup+%2+  QG+ v2%'v3A- - - - -! -# -% -' *+-h -s( \S+-sC G.z@##B-F#_]BHGnGo GbBu@`G@ ,ww@ +jWU@;w:8@=w<F?%Gf)F EGG+FHeG$FFkGB2YB84sYB?YGw'F'.G[F JG[G\B}@!#BFF #BG[@#sGqBl7BXGo@*]G[F GG@3G[@(F%G[G/HB iubiB2ierr  0\ubi1]:1idx *4>1vol1n G22) W $) 1)2* **U~2- - -N.-.-.- . ". 0. >. L.xZ. [. j. y. . .@UT@U2T*/b **U~*8 **U~%U@TUvT UvT Q|2Uv]UvT Q||uUs`T|OUvUvT Q|UvT QUvT Q|e\ubi)\volAo#ep# C#"U.  . .N^._.U T z~UshUTyl1\ubil'\voll?1errnn 1devo_oA#pq# C`q#qU. q . .N^._.qU T R0 .. Z)F l)UvTsH%{$ V%.b%UsT0Us<U~_U~T}Q1UsT Qv"UsXUsUszU~JUsUvT QR|XA+1yEuM\ubiE+]EB1errG1reHM#N#S1volT#XXXXX#X#VX XX#AXC XoU TQ RU*+X :+ G+ T+ a+ n+ {+O02*V`**U~*Y3 **U~\U}TvQ3C}N<_ .. Z)F l)U}Ts9U}T|= T1)y( ]/]91i1err 1vol1ubiV%~o8 P7P,#cp# C#U.  . .N^._.U T X}/ /* **U~2* **U}2*[ **U~*  **U}2* **U}A) .. Z)Fg l)UsT*  **U}2*   **U}2*-c **LU}*U}/  02*6 **U}2*  **U}2 U}TvV UsT}Qp U} UsT Qv U}T UsT}Q~ U~\ UsT}Q2 6 UsZ U}TQv7 UsT}Q  U}T~Qv U}T~ UsT Q~ UsT O0X8 +( i]i/]i91volk1ubil1im1errm mm$8  PP# po# Cb o# oU. o . .N^._.oU T X@I Vp# Vp { Vq# Vq *v  **U|2* **U|*I **U|* **U|2* **U|* **U|*` **U|* **U|.G .. Z)F, l)UsTv_.q_.p\UsTQ4UsTQ}UsT Q@RD}$UTJ<U TUs\wUsTQ1UsT@Q0U T Q qOU T Q pO#"jubi*jreqE"aiaerr ,avol-%~,o8 PXPTPOPH#3,",k) ) ) ) )U)  * *(*.)*9*   K* X*T Q X## CpA#,k.  . .N^.z.U T # # CXA#,k.  . .N^.z.U T Xv#,,,,,#,#- ,,#L,C,oU T|Q Rk*+  :+ G+ T+ a+ n+ {+ + + + + +x+ + + + , ,UATQ|0U}T~Q|C$V1,1 , , ,#:>>>>>#>#(V> >>#>Co>oU T|Q RU*+> :+ G+ T+ a+ n+ {+ + + + + +x+ + + + , ,UATQ|0U~T}Q|Q* **U}lU/ e/ q/N.}/k/ / / /l*B **U}*U **U}*Y **U}/  //X / / /2* **U}2*" **U}DEn .. Z)FS l)UTs*P **U}2*S **U} Us% T~X UT Q~R|"p UsX Us7 UTvQ J Us UT QvR| !UT QvE!UT ]!Usu!Us!U~!UsT Q!U~Ts!UTvQ~\"UTsQ0D"UT i"UT "UT }"U~TsO09:XH%jvolD,,"-G@-Dlz)# ) ) )UsT Q~R1Q)$#$ )Q/ $ /U|Q)$$ )Q/ $ /U|$T e$U|T0E%UsT Q}%%Tve:%U|TsO0v }%bdevv(qvolx:5x6(jdev627 jbuf7,aret9avol:qubi; ) '&5:#C&atpIGs&-c# -c l*=&`**U|Q*D&`**U|Q*a&'`**U|Q*df'`**U|l*?'`**U|z.c.'U}T .(U}T .)(U}T .N(U}T .s(U}T .(U}T .(U}T (U T QcOX )+(H?)iubi7&@{Z)ivolDH tz)iubi t<H)&H&Gival$f))R<H %)& ;& GYH|.9*&|D&|PY:]H%]q*&<&:Hz0r*&zCY&zX+{*&54{]*&]34@'*i4@*i4Hj%+&j8%+&jV%+#,&#:&$&%&&&'&(+U+U+U+U+U%,+U*+U*,U*,U*:U*4,WC,WR,Wa,Wp,W:,W*,W*,W*,W*:W*-&:&&--#-2-A-:R-*b-*r-*-*:*".bpALRT55qret .q__p55:5".A0.A>.AL.AZ.A:j.A*y.A*.A*.A*:A*W ".bkey "J.R "Z (<.W,,U/:51 /51 !/51 3/51 &E/51 D:51 XW X/R XR -D5 DW X/R #XR 1DR ?f)WO!/bptrODWA!/bptrA<W4!0bptr4=H%0 V%.b%i0UsT0UU(, ++G+S, L, X p, , , , int X ,, *,?s8d?u8w ?s16?u16 !?s32 0?u32?s64?u64oX u  , +  1X 2X H I X ] ^ _ `L,, % ' <X  ? N     # , % & *+ 4 =  B U  h0 l  n? qS } I S S X X S l     I      : : : ?:LT+ | | T|+W0#0&   S+   !( *%-@  -2 X X    Z7( X, !X0 ( 4 )28 *XH ++P ,X 5 ` 6 d 8 h : l ; p < t =XxEse ?B@&rt @DUdl AD BD FG1 I4 J+ KX OG X!G ]!G1 `"@@ d hX kX  l+ m  n1G  o6G( p)0 q X s` ub x d yFh zp {@G +               F     ?  X4(1 4P&mm -!h -!p 4Hx         + X  X,  X,  X,  X-  X-  X-  X-  X-  X-  X-  X-  X-  X -  X -  X -  X - "X - + 1&pid  r  r +     ( 0 @ HP HX  "I % ! ( ! +  - S . S 3 S 4? 6? : ( =+0 >+8 A S@ D SH G+P H+X KA=`1 N= TiJ WiJ ZiJ ^XK k / mbK pb3  q3( t+8 u+@&fs xlKH {vKP ~KX K` 'Oh  nOp  7x  7  7 e; +   X | xO  > X 6 ;  S   S  3  #  F  4(  8  O@   H  OP  OX  O`  Ph  %Pp  +x  *P  <  X   S   S   S  37  >    4P     ?   ?  ">P  )|P    P0  48  XX  P\  P`  4h    P           !X  "X  #  $+  & S  ' S  ( S 1 )T  3P  C<&  D+  LP  N+  RP  S?(  T?,  Y+0  ] 8  ^ <  _ @  ` D 1 aTH  d{<X  gP  iF<  lP  w  x  z+  }  ~P   S  S     <&       + X P Q  Q Q  X( X, G0Urcu T0 Z7@  D H v6P Rx Z7   "R R &R     S    >1 T   !"2 $"21 .T <0R1 F@@&@'pad! +?@& )&@>KHH G G   " *  ѩ( %0 h8 @ #H #H #H /H #H #H #H #H%@e8PhGG: ?X4&kpD X(X,:0 ?8@ABXD IH9PUmemN@+ X_dnx (0X8@XHXL}PXX`Xhp xXX%XXX<& X!<&"X%&)9X:?AD CF P QX(T%0;)cs=S)sl?S)wfeASE3)ssGS)stiISKS)nmiMSPS SS0VS8)lmXS9]S:dS<`'cs!'csxSe'ss!'ssxSgr15m+r14n+r13o+r12p+bpq+ bxr+(r11u+0r10v+8r9w+@r8x+Haxy+Pcxz+Xdx{+`si|+hdi}+p+xip+3+sp+`BKC!D!E! E!()sE!,)dplE!-)pE'!/F!0)avlF!4)lF!5)dF!6)gF%!7F+!8 + + + + + pteK " pmdW "%%%{2%/V' pgd'o2'"Vp 6pudpc2p"2PU@HI+-bb0 4+8ef+ghuv0w0keyx U*V jGkeyk ndkeyo ;<=? X @ X$A X(B X+%@@!/sp+es ds"$&+(+0 08+X+`cr2+h+p+x,0+X?++ /Efpu K/@X( -! )2!%@@X!-di@m@l!@w"-]g-! {g (,g03g8Xgh%hp+xmf h)Phrf6#"  #"!!"'val |"""" ,"#(# (# 8#+S# # t#8#" S# #  #ee #" # M$# X+,$fmtGGGXGG$ M$ 6$ 7* 8G8 T% G G G G. X. X. 4Xkey 9$((X =}%   8 U% Vmod W% XG Y%  Z ( [ , \T%0GG u2& v2& w7& xX yX$}%+LQ&+ !/&!1Xset!3get!5!7 5R Q&pv(%   ,  ( 0T8!m@" H# P$ X%ǣ`&h'p(x)*:+b,-.b/ 0 ߤ1 —23 45 S9 ; >?Х@ & "!("% "+ "-"/ # (#!0key#"0#?)#A+#B)#C) )(#=C)#>((X3)           +)+  ;! ) $ 0%c<*%dG%e%g/%i M%lR ( )&i*&Send&S' ' p(+cwd(?swd(?twd(?fip(? fcs(?foo(?fos(?(+(?l?++#(*:+rip(+Srdp(,S#(.x+fip(/?fcs(0?foo(1?fos(2? ()++:+0(@+(A+(B+?++ W($P,cwd(%!swd(&!twd('!fop((!x+(5?(6?(9P, (<`,(>+f+?`,+?p,+?(QM-cwd(R?swd(S?twd(T?fip(U? fcs(V?foo(W?fos(X?(Z+([ l(\ m(] n(^ orm(_ p(` q(aM-x(b?# b-+Sr-+@(:-(; S(< S(= -S-+%@@(O-3(P+(Qr-(R-@ .A+@(^\.(_*B(`+(ap,B(b-@(c\. m.q+%@@(f/(hX(kX(nS(qSxfd(tS(wX(zX(X(X3(.@@(K/( S(X(X fpu@(/(X(+(/(/(/ (/03(m.@@m.) /) S)SL/+ 0+00+"0 '0(X*T0  (*0*0val* ?*!? *"?*#S*$0 ?**0*+&0*,#(1+0++ 0,(1,V, 01*'d1*(~*)100*.S *11*21*3*4 *5+*6+ 1(*1*%T0*/-1*7d18*2*+fn* (21#2#212->o2-?+-@+-A?cpu-C?.../82/92/<2/=220<20=X0> 0:.30;22src0A! dst0A !(X1]3     2}32 3 }33 334 34 535#533 536 46t# 6"3 7)X47*)7+#osq7-3 7/(8 48 8 8949+949449 49 49 59494 :359: 4: 0: N5:4(X; k5 @;'59;( 5;) 0 ;*5(;+q60;, 8;- 9;. :;/ ;N555k55@@<45<535 <6K0<7 085(=6= =+= 6=? 66v66>7>> >7 7? #7?#7+37+ ?8 7@Z7@  @?7A+7A,A-xB7B7BX`B+hmaxB+p+7+ C 7sigC#7 C7 DRu DS88 DUH DV88 8gEc8E E  E =8E'8E(E)E-8E.E/E0 c8E1E59E6E7E8 c8 E<M9E=E>E?E@EAES~9ET A&EUEV EY9EZ A&E[ E^9E_+E` Ea EJ:ELEQ EWM9E\~9Eb9 EE6:EF9EgZ:Eh_fdEiEm:EnEoEpX g E%:E*o8E28'_rtE98EB9Ed:Ej6:EqZ::+#0F ;;F F F F :0F O;: F;; [;F ;F!F" 7 F%;F'8F(+F.,8F0 7 F3;saF4; G +<G G +lenG +G (HF<H !I${<I%PI'I( 0ID<IM#+<IP(IW)8J =JSJSJSJSJS J#S(J,S0K)A=K*SK+35PK8v=K9v=K:XHK;XL==+8KD=9KETKF4KGX0 L>%>LKLZLpLLLendL%>L4>A+M!O>M" X M&4>MDv>MDO> MD[>ME>MEO> ME>MT >MY>MZ 3 M[>N >valN N >N ?valN  N > SX? U S V S W#6X [?    0 h? iO> j kX?cpu lX mS nS  oS( @@ +    k@ +  ?@@@ @  S  S  S  ?  ? +  +( +0 X8%@ B  S  S  S  S  S   S(  S0  S8  I@  SH  SP  IX  I`  Sh  Sp  Sx  S  S  S  S  S  S  S  S  S  S  S  S  S%@ C @@3 4 ! S( " S0 # S8 %@ &P 'Q (R )S , SX - S` . Sh / Sp 0 Ix 1 S 3 S 6  7C 9C ;C =+Eavg Gk@@B C0 KrD L M+ N+ OX  P$ Q& SrD(D2 ]DDDDD@ `F3 a4 h S i S  j S( k S0 l S8 s I@ t SH uXP X X X X X X X X3 k5X3 k5rq %F wD F D2 ^ FF!FDrrq!F uF! X ! X ! X! XV F         Fhb uFhs ? F FFe  G G G*F1G+)) ;G@4HXt}S T@ D H4P+` +h)p+x 3S EGspidpO7HO9 Z7O:XO; 3O<.qinoO=SO?~ O@@OBTH4rcuOCT`OD p9HH+ PIPXPTHQodJQp)uidQq >gidQr ? Qs >Qt ?Qu >Qv ?Qw > Qx ?$Qy X(Qz/0Q{/8Q|/@Q}/HQ~/PQXQXK`QXKhQXKpQXKxQ Q8QmQ`;Q=- IdJskeyRXKRZ7R-JR< semRS(RFPR Xk`R ThuidR >pgidR ?tRxR|R~R R+؁RKnJ ]K gK qK {K KWXS^'OS_Z7S` SaSb ScSeT Sh8Ske;@SnXSq`SsdSthSwpSxXtSzx.SX.SXSXSS9Sk5S 0itSS7SA=SɅhS SHS_ttySޅSS >SSS SSSSSSSSSS?S+S+S+S'+S+ S+(S"+0S,+8S+@S+HS"+PS,+XS+`S+hS<pSSSqSS XS SSSS-!S4SS0KX SnOS3SZ7STSa ,O sO }O O O OXTcPTd)Te Tg Tk 3Tm}Tn(To0Tq;W8O  PO; /P 9P U|PUPU8UDCP P P+ P P P+P+= P P7P+ P P QhVyQVz\V|XV}]^-]Vu](Vv60V+XV#b^`Q@W4RW5RW6 W7+W8+W9m W;X(W=X,W>l0W?8Q  R R !R +R:RERXXXX!X%X'X,X/3X3X5X9X<XAXDXHXLXQXUXYY\SY Z7Zt[ ["iS[S[3[mS[SyS[X[(\0T\1)\7)osq\93\;#\<*\*\*\*\*\]#T]$3]% ]' ^T^+T^,#^- __ T_ T_ `=U`X`X`G`G`GaeUaSaS(aU4ctaTa&U =UUbUbbbb  Vb!9b" Cb$XHb'Vb(Gkeyb)Gb*Vb+ b,(b-0b. V8extb/V@")UU b3 b8Vtpb9Vb: b;?b<? V ,0*c4*c*c d &W+W6W6W;W dpWd)ddWXeqWer;Wesv6 wqevWHcpuewP W|xfXf|fXf,X(lenf)Hf\7YgeYgfXsdagg:[gh#gi?[YXxgD*[gEYgF*[gH gI4(gJ3HgK4PgL+pgM+xgN+gO+gP+gQ+gR+gS+gTgU+gV4gWHgY g\+g]+g^pWg_YpY:[+LXYh i3][b[{[{[+[i6[i7Q[i8{[i9j[jR-jR-j"\j#0j$ j% j',\j( j) j+P\j, j- j!~\j&[j*\j.,\ j\[opsj\P\ \\j2\j4+j6Xj7X (XV@]   (XVH;]   Vpp]Vq]VrVsu] p]#V]V\V+V]9VTV+LV]z]]@V]^V;]V+V+V+ V (V,V]^04rcuVT8V^H]~\V^VidVg^^A+V^V^ ^(k_k#kIkk l _lSl& l)Sldtl*_8l.+@l94Hl:hl;`pl= xlC!|lD~ _m `mm+altm+m+m+ m+(m0m8m@mHmPmXm`mhmpmxmm m! _` lF_#\`^ `XXa'lruY`dei;aj +k+#(Rka`h4Has+ #(uaz+pp{a|+}+~) a#a+#ab nbnw}refn 8nHHn5hnXln+popsn 7xnnaL(Qb;akaaaYTbX V bval+2bCM cN PX:J=chlruKb:WbcX YbC@GcI+ cU4HV + =c([ 0\ 4^+8M@FcbcBjUC(mXdn+o+q r s t vX M@lvdcBzUC0}d~++     (C  e++M@|-evddBU@DQe-c-Xd@- e2+ Qe@ mf * 3 `  U4H  Xt(X0X4iJ8@z@P p  x#$ % '-ce5fctx6f f=f>AS@%>(XfYS(\6gb+h+t7w }$C]g++M{g6gBT:g^eQe gErb4+f gobhoc oh ojokoq os(ot+0ouI8ow]@o{Ho~PoXo`ohopox ghffiScid @@ /i V di+ P@@Bm-i@S@+P+X+`+h+ppgd  X!x) 5 ?BmE+LXS Z#])_a3pSr+++++ +(+0+8O>@3D+H+P'+X3+`+h&brk+p!+x++%+0+GmWm@lm`+h3pvmxmmf&m++  ^);Wm++) /ih+Wm+3^gm+ gm qm {m m m+mA+2 XPmpo/Jno7Jn(pmdo9 b!0pudo; w"8@oEPHoFPPpteoL ]!XptloPR`oT Ch6Xn      @ ZZZZZ pnpp p nKnq"oq#;oq&;oq';oq' @oo;o#rior3r LroYrEoro-io#s3os4?lens4?s2oos6Ss1oos8 osipsjskpTusrQpssstoYsuTsR)qsTXsU>sVosW.qsXo sYXt0s[]t8s_")u`s`xhsa+psbx9sdoosmsn4d_usv$p QpQp%x{Xt| f}~ > ?X ! x(4H0 8+@H ZL P TX T` Th?p?t?x?|3 ވ H?S++!!  0@H P T X \f0`h1EGp8fjH P(X`h p3qmt+'@s$us*ys*ysMysuysy sy(s y0s y8s y@s yHsmzPszXsz` mt$u%@x Z+  h(!0!8@"H+P+X+`.qhSp &#.8$GLn  V mf ` 'X :(1` ?TT!?"1/ 60 1 4 F6X<4 BG@D")uHF/}PI)XL`O dRWhSpZmxa~b~UrcucTd;Wf4k01n3@@oHq3Xr`.u(Xsy *y.qXyCyCyHy)qo/ypyCyXGpyoRyyCyzyy.qyy.qyy.qXtyy.qy tE'ztF.qtGxtHtI6z6z;zy@zuhzmntu 6zu .q @z'zzzhzrz.qz.qxzv{v?v fvXv  vSvSinov)S devv* Z(v+ Z,uidv, >0gidv- ?4v. 8v/T@v0TPv1T`v2Tpv3Sv4Sv5?v6?v7Sv8Sv9?v:?v;? w"K|w#Tnidw&w-+w4+w7PwR}wS9}wU9}wXwYwZ Xwc Z7 wdH(4rcuweTHwgXwj`idwmpwptwqGxwr.qwu>}+/}/}4}K|{})*x6*x9*x<*xG8n}n+n2n2n+n+ n+(n0y,~y- 3y/ Ty0}0z3l~z4~z6z7z8 xaz9}  z~z z" z$3@@z-~lruz/l~z0) ~O2~nrO3nsO4~]3 +~A+{ /val{S {(X| ^   ^*}>?~~~+  R RRl4rcuRmTRnZ7Ro #Rv,Rx!Ry DRuE'xR+(RrRt+,RRRG g RǀRR ̀ ܀+ R XK XKǀRJR܀keyRXKRLRkRYR4RR TR T#(R؁R+R+RRR  (RREC RRR : R7R 7 Aӂ Z7^+0)8@uid >P)X `$#hQQ Z7QgidQ ?A+LQ8QvrcuQTPӂW@@ Շ[ ? PԊX f9  TT(T8 mfHيЌ()*+ ,0-4@. 3`/ d0xh1p2 x3+4=  val (X6   BE'uidF >'gidG ?H D=JH      ( 0 T8 T@HC+ X(X, 0 8@ !5%C@89':';'<'=; >;(?;0@Y8 'x;Ԋ,TxT@XDE;F G 0H;I; J;(K'0N I8Og@QHSYP ^Ԋ x 0Ԋ%DDXt5bXtbNXtDlxYtZ[S\S]S^S _S(`S0aI8cI@dHeLfSPgSXhS`iIhjp8XXXX XXXino  H( H0:X:tJ+ ɑXXX XXXXXr'' ђ(08@0HP ɑxzwxX̒x̒Jx֒xT+x+p8  X S 0 H&ops! Xt++5+:w} ?b  ̕ (00 I8 c@ |H P X`/h Mp lx —ۗ XPX] D{mf{-eg4HX4H{••Ǖ mf4HXS{ѕ0mf4HXX{<I4H<5c{N|{Th{(+, -./  4H{{;/{ M{4g{ggR4H{qmf <—mfۗǗ?: _XM0BT:U!U ev(eXtZ:P  Xh?%@ops UHPdevZ`Xd  %@Z[ \/]M^k` b(dϦ0e8f @h.HjPkVXm`ohpӧpr xsu7v_y{}èG      (/mf 4pidH.3uid >> $  +XX XX : 4 SM )B*T+2,/-҈2P%0W  3W`oh+J e e  ( e0 ѩ8'@HPX`!h?p ѩxXXXX   ڪ ڪ ѩ mr    $) 3 =B6 Q [W@'   $         X$X(X,X0 X4#G8$@'"H*#P-XX0X\5`6 h<p=x?@5BbDbFHJL5NP5RbUWY[ \]^_`a b(c00d 8e @j0Hk PqXs[`v\xxz|%Udev}~AS&dbg'Ye ,LF+LV+$2chGSX Vpos 2 Xmf͢ mfz,mfGzJJXO 1mmfYBmf rmfX+ǣmfg!Xtmf̣mfmf:mf!XmfX] ?+mf++++gUPmfzXߤmfzPXmfS 4mfIImfN 9mfmfXXmfmfXƥƥX˥ ƥJXե.q Xt.qXG*.qXt*MXt4kXtR.qpXt.qfϦ.qXt.qXt.qԦ Xt.qG.Xt.qfVXt.qfZ3Xt.qXt.qX[.q[ΧzΧ?Xz.qاXtSS 7Xt#_Xt.qmfXf<Xtmffd.qè.q.q Ȩ.q 3mt S +BBXt 36Xp   XtxpXtXtXXtѩxƩxL֩x.q ?x !&XI.qDx]xGXtԊڪx4}ƪ ߪ .q*hG #?+@@AGBCD E(sdF0GAS8.IX.JX.KX.LX.MX ?? >+4Crev+ >c  G4rb4ns0X8< f>=@idS` hpp4rcuTxc dops.!8 h)M ]"v$ % & ¯(( 02 89@: H= P@XA 5` d) 3 k'dirH" k9knmfI 4 4@`h x    @  A %hHHu9]HRvIbIz{Iz¯IHǯBHHg!5H(X]  0'(:) n* ð+, - 5R( ]Kװװܰ ȰK%%G% f%m:%nڱ%o&X%0ձ%1%2 %3 %4\ %5 (%7 0%9 8%; @%= ޲H%?P :߱:ձ f  f/M4 K4HWmf߱amf޲mfmfg!%1% O% r O 6r GT` 3? Xw0tu /v4w!9x*\yp z ( /$1><*RRWCpWaWuX }~_buf ++?Lq+G`y [WL [GtWe tW~ G(+++++ 0*4rcu1T2AS3*9A+ HIJK LM+Nm %i?@pHGPXbusu`h p x4A3ݻ &msi(8@SHSPX `hx  Z&id?3 Q!!9# $%'# )+ `, a- b. c/ d9 e< f :; <n  !"# $(%0&8'@(H)P*X+`,h-p.x/012345  6U@   6Xlp    Hxӻy 3zX|X}4~0ػ@ ӻ%8!  ! !! "! #! $! %! &! '! (! )?3 H ,@ @ A B C D E3k5PS;WT6  X                X@SSSS;  P(&qosZ0+,,Gid-./3 06(1v602+X3 0`4 0h5 0p6 0x7 08+9+:+;+<+dev=.> .?  1pP0@ Uops   XMNGOGP!9Q!9R!9 T4(UR0V8W @X HY P[X\`^kh_paxcd pmfph ((/`/aGbusbud%eGg h$j((ks0m8n @oHp PqkXr`s!9ht!9ppmvpxw py} -MMi9kW`2#3G5!96!98R9 A ; V(< 0>8@(R@AjHC PpmEpX z<M<f(QQ#FjM[Mo0XYGZ!9[R\ ^ pm`p( +& S  +BDEFGH~I&S  #AXK : @N8O+P Q  * 0 . ?UmUD    ym G(!E!FGmod!G%ops!H!\!I +!J!K  !L'arg!M 'str!N'arr!OW!V!WX!X  !\Rmax!^X!_Xnum!`!ops!a!\!b R&0(}9)}`4+ + X  ! dL+7`-N.?mod/%@0Hmp1SP2IX N8567 9 ;  <#(= 30XG%G#%3%(6X>b   @8EmodF%3Ga@PpqrstXEmtnwb + +X 05:n`_+{( i sVYV  M$(X-  ȡ#66 *@ # nidcls -n x-M<XX+6X   6XA   8 0!n" 6X1      6XB  6XOA  cd&e2f4g lidh _9  S rcma 01G2 3G46X7`8h9p:x>+?@/0ops1"dev456(7 8   A +L:+LJ+(Xm  get put 0 D] D q( 08@HPX`/hapx  mQRXidSXTPfghXib- 0%D5]MIJqbGvGXG%G/G\GGXX\4zzfX  ?  "  \12345  $len $! $$% $& '  (<& +O,X-X.XHFGXlenH I J K  L (M 0N 8O@ \]?^?j,ecckOmO J'J1| T 'T'|.q(YSS? H44 .X,''uSx'0'u0 ]'u]:'Og'u''+u''$'0'!(XnEd     nNnT nZne dPmmb++tn#n nn A*A+n7nA*C(o0vmao1g!o2 To3 +o4+o5+ <:o>o? o@ g!g!+g!g!+++m+mXmIm++0+]g!Ng!+bGg!g!PPg!+<&Pg!+oX  MdR db+cd 6e 6f 6g w h w i *j k wl crcm 6w +u-vrb4 _4u ecXe:+-X   +%XJ!EdevKL&ubiMNXN`OdPhQlRpStTxV|WXYZ[ \]^_*a$b(c 0d 8e@gXHhX"iX"jX"kX"lX"mX"nX"%,I-Edev.h/X0:\1h2p3 3x4|5689:;<>?@AB4DFIJ 3K4L4O&fmPQ R, SS8TS`UV W;WXYZ[\_4`4a4bc4&pqdef 3g4hSijklmno p(q0r4u HvPwTxXy\z`{d|h}l~ptx|XX&mtd'44[&dbgb !! Sx!X!X!X!X!X!X!XXXX XD.q .q(.q0.q8.q@.qH.qP.qX.q`.qh.qp]+b_+ L+ 8F=-a<G~cN]G|N]G_IF +F+aai++GAN]Fc SVGFrNFc VFW GNGuN]iW+ai GwF !2&Gwx|fNubi|1NNvol|I]Nbuf}y}%berrOv  z$ ;5 KHjd t7D[$ U  T  yblen @H{$ T Q  $ &v^ U} Q$ U} Ts"P$ P{ kJZeql|7>mo>|>} $ U Tv Q0$ U T~ Qv[+X U  T  Q +Sv+ f$x !Nubi -NNvol E]Nbuf y !H H  berr blen H  O1  Mz$ ;5 Hjd t7D[$ U  T  R $H."P4$ P4{ [46 U Ts Q| U  T  Q 4+"VP]$ P]{ k^ nzkJK Zeql|7>m[>|>}$ U T} Q0$ U Tv Q}{J1( DZeqc|!">m>j$ U@ T} Q0$ U@ Tv Q}[]6 U Ts Q| X~ U~ T Q ^ U~ Ts+ U  T  Q ]+S1+ ! /ubi)N/volA]dJ/buf/lend errP \l 8cg$ T Q s $ & nQ$ ;R *Id t7D<$ U  T  R0 U} T| Q~c UU TT QQ RR X0 H8c+$ U|s" T0~5 UU TT QQ RR XX YYS+ /ubi-N/volE]/req&O1 "&=$ ={  Q$ ;aR 8Id t7D<$ U  T ;S88+< UU TT R0 X0 U  T  Q+MeUrI/ubir)N/volrA]ds\iu\erru OY  VQw$ ;Rw 8wId wt7D<w$ U  T  X|"=x$ =x{ ; 8{8{+l)S9E7>QI^ nz<x Uv T} Uv T} Qs Uv T Q ^ Uv T} Q0+; U  T  Qx+SY+ IJ/ubiJ3N/volJK]dK\errM=Nb~O   QP$ ;RP |8PId Pt7D<P$ U  T "=S$ =S{ c^ YBnz<Srz U|S Uv Q}A U|+! U  T  QS+S + )5/ubi)1N/vol)I]\err+=,b~OE  fQ.$ ;R. 8.Id .t7D<.$ U  T "=1$ =1{  zQ2$ ;R2 182Id 2t7D<2$ U  T <1r U}S Uv Q|A U}+!' U  T  Q1+SE+ 5S+|]to0-]nA+S00*06szTT0&0:+)]ptr;]nN+0SS^0S0-?J?SS0#S01?0?0dn:nn"5"5"5"5"5T"&5^"65^"F5^"V5^T5^S"]key"J0"Z(  S,,TJ1 "J1 "J1 "J1 !"J1 ?TJ1 SPB++G+XGBQB] uB B B B int ] ,B *BSs8iSu8|Ss16Su16&Ss325Su32Ss64Su64p]+ z B +  1] 2] H I X ] ^ _ `QBB % ' <]  D X     #B % & *+ 4 = B U h5 l nD qX } N  X  X  ]  ]  ]  X    N   (P PPU(PQj+$ j+W5     & +_5H 4 G   "( K  ( e&0 8  @ ,$H ,$H ,$H PH ,$H ,$H ,$H ,$H:@R ǾWPh\GGɿ ο]5;kpӿ ](],ɿ0 ο8@AB]D ؿH&Pfmemݿ@E+ ]s (0]8@]H]L P]X`]hp x]]j& ]/]]& ]!&"]%&)9]:9?AD 0F P C Q](To&04 ; Acs=XAsl?XAwfeAX E- AssGXAstiIX.KXAnmiMX.PX .SX0.VX8AlmXX9.]X:.dX<Z =cs&=csxX_  =ss&=ssxX g r15m+ r14n+ r13o+ r12p+ bpq+ bxr+( r11u+0 r10v+8 r9w+@ r8x+H axy+P cxz+X dx{+` si|+h di}+p+x ip+- + sp+Z BE C&D&.E& .E&(AsE&,AdplE&-ApE'&/.F&0AavlF&4AlF&5AdF&6AgF%&7.F+&8 + + + + + pteE "  pmdQ " % %%u H%/ g'  pgd'i H'" gp 0 pudp] Hp"HJO$@HI+Cd#e0 4+8ef+gh uv5w5 keyx  U$V jA keykn^ keyo ;<=.? ] .@ ]$.A ](.B ]+600   X+   &( *:-@  [4 ] ]    9( ], !]0 ( 4 )<28 *]H ++P ,X 5 ` 6 d 8 h : l ; p < t =]x[se ?aD@;rt @Efdl A`F B FHI IP6 J+ K] OH XH ]HI `"B@ d  h] k]  l+ m  nH  oH( pJ*0 q X s` ub x d y|Hh zp {I +             |H     A  6(I P6P;mm !h !p Ix         + ]  ],  ],  ],  ]-  ]-  ]-  ]-  ]-  ]-  ]-  ]-  ]-  ] -  ] -  ] -  ] - "] - + 4;pid  |  | +     ( 0 @ JP JX  "J %! (! +  - X . X 3 X 4@ 6KA : ( =+0 >+8 A X@ D XH G+P H+X K?`I NI? T.L W.L Z.L ^M k 1 m(M p%5  qJ5( t+8 u+@;fs x2MH {Q  @ ] 8 =  X   X  5  W$  H  6(  8  HQ@   H  RQP  \QX  fQ`  Qh  Qp  +x  Q  s>  ]   X   X   X  8  `@    Q     D   D  "R  )BR    LR0  58  ]X  QR\  fR`  5h    pR          !]  "]  #  $+  & X  ' X  ( X I )j  3zR  C&  D+  LR  N+  RR  SD(  TD,  Y+0  ] 8  ^ <  _ @  ` D I ajH  d>>X  gR  i >  lR  w  x  z+  }  ~R   X  X     &       + ] R R R FS  ]( ], H0frcu j0 9@  D H 98P Sx 9   "S S S     X    >I j   !"1 $"1I .j <SI FC @@0@ )=pad!  +? @0  )0 @:@@!51 sp+ es ds"$&+(+0E18+X+` cr2+h+p+xd1+]D++ 0[fpu s0@] ( ! :*!:@@!Ck@p@   !T"Ci! i (,;j0Jj8XEjh%>kp+xh Ck[*pRHkh06#6C#&&c#=val )")# w#C# ,c#6 #  ##+ #  )#  ## w# # ! '$! ! '$ x"x"  #W$#w# #<$ $$$W$$$$ $$]$+,%/% fmt%G%G%G%]%G%G$$&6W%&7$&8A$8&%&G&G&G&GD&]D&]D&4] key&94%(4]&=% 8&Ue&&V mod&We&&XG&Yj& &Z (&[ ,&\%04G &u&&v&&w&&x]&y]W%%+Q&+ '/''1] set'3 get'5-'7 w2&(e&  * M  ( 0u8!@" H# ϨP$ ϨX%`&h'p(x)=*[+,-./ ة0 1 ޜ223 U5 t9 ; Ϊ>=?@' (!=)(% (+ (-(/ ) e))!5 key)"5)?))A+)B))C) )=) )=))>e)4]3:*     +J*+  ;!J* * p],+      0-cd+-dG-e-g-i ;-l@ (+ .+.X end.X%/ %/  p0., cwd0D swd0D twd0D fip0D fcs0D foo0D fos0D0.,0DlD>,+60*b, rip0+X rdp0,X60., fip0/D fcs00D foo01D fos02D 0),)>,)b,00@,0A,0B,D,+ h0$x- cwd0%& swd0&& twd0'& fop0(&,05D06D09x- 0<-0>,y,D-+D-+? 0Qu. cwd0RD swd0SD twd0TD fip0UD fcs0VD foo0WD fos0XD0Z.,0[l0\m0]n0^o rm0_p0`q0au.x0bD#.+X.+@0:.0; X0< X0= .X.+:@@0O /J0P,0Q.0R /@//U+@0^/'0_+V0`,'0a-V0b.@'0c//z+:@@0f:00h]0k]0nX0qX xfd0tX0w]0z]0]0]J0//@@0s00 X0]0] fpu@000]0+00000:0 0:00J0/@@/ 1 11 X1XQ%1+Q51+? E1+U1U1+Z1 _1$ 212]2]2G2G2G%3%3%3 481492 4<24=215<<25=]5>  5:w25;12 src5A& dst5A &|224]62(6363 val6 D6!D 6"D6#X6$3 D6*)36+&)36,#V3 7V37MV7 5.36'36(6)236.X 6136236364 65+66+ 3(646%26/[3673 86B46+ fn6 V43Q4Q44B4 8>48?+8@+8AD cpu8CD 949X9X$(94Kct9i19&4 44]: 5 ;@5; E5 @5 < e5< = 5= >5><$ >55 >5? 5?# ?"5 @)6@*[*@+W$ osq@-e5 @/ (A P6A A A$B6B+B6B6P6 B 6B 6 B6B6B6$ C6OC P6C : C 7C64]D .7$@D'7OD(6D) : D*7(D+480D,8D-9D.:D/;777.77$@@E/48E0[E1]E2  seqE39@E47E56 E6e0E7 :87 (F{8F (F+F 8FD 8898{8 G8GG G8 8H 8H8+8+ H88 I9I  I9 J+Q9J,J- xK9K9K]`K+h maxK+p+9+ L 9 sigL8 L9 MRz MS99 MU5 MV99{N&:N N  N :N'V:N(N)N-:N.N/N0 &:N1N5:N6N7N8 &: N<;N=N>N?N@NANSA;NT &NUNV NYe;NZ &N[ N^;N_+N` Na NJ;NLNQ NW;N\A;Nbe; NE;NF;Ng<Nh _fdNiNmN<NnNoNp] { N%<N*2:N2V:=_rtN9:NB:Nd;Nj;Nq<<+60O <O O O O N< 0O =< O< = O P=O!O" 9 O%=O'9O(+O.9O0 9 O3= saO4P= P =P P + lenP +P  (Q >Q ! R$>>R%JR'R( 0RDs>RM#=RP(RW) 8S >SXSXSXSXSX S#X(S,X0 T)?T*XT+6 PT89?T99?T:]HT;]L>I?+$8TD?OTEjTF5TG]0$ U>?UKUZUpUUU endU?Q?U+ V!@V" ] V&? VD9@VD@ VD@ VE`@VE@ VEE@VT @VY`@VZ 5 V[l@W @ valW W @W @ valW  W @ SA U X V X WW$L] [KA0 hA i@ j kA cpu l] mX nX  oX( B +    .B +  DT@@ B  X  X  X  D  D +  +( +0 ]8:@ aD  X  X  X  X  X   X(  X0  X8  N@  XH  XP  NX  N`  Xh  Xp  Xx  X  X  X  X  X  X  X  X  X  X  X  X  X:@ E BJ P6 ! X( " X0 # X8 %@ &P 'Q (R )S , XX - X` . Xh / Xp 0 Nx 1 X 3 X 6  7E 9E ;E =+[avg G.B@aD E0 K5F L M+ N+ O]  P$ Q& S5F(EH ]GFLF[F[F`FT `GJ aP6 h X i X  j X( k X0 l X8 s N@ t XH u]P ] ] ] ] ] ] ] ]J .7XJ .7 rq G :F G [FH ^GGG[FrqG 9H1 ] 1 ] 1 ]1 ]g |H     H|b 9H|s D H HHx  HH HGH+V*J* HTIk{tX ^@ D H6P+` +h)p+x 05X  IpidpX7JX9 9X:]X; 5X<Ax inoX=XX?ރ X@ @XBWHKrcuXCj`XDpI(J+ YJY]Yp\\\\\ ]\&\\\\!\5\X0UMi \4Q\5\9\W\{ P 9Q CQ MQ WQ aQ X]cQ]d[*]e ]g ]k 5]mt]nɌ(]o 0]qY8kQ Q= Q Q ^BR^5^^) R GRaR+ aR kR uR+R+? R RQ9R+ R R R$h_yFS_z[__|]_}`C7`__(_980_+X_#``R @`4S`5S`6 `7+`8+`9"p `;](`=],`>0`?8KS S S S S%W$%%%!%%%'%,%/5%3%5%9%<%A%D%H%L%Q%U%Y U a@Uaaa a vUa!&a" 0.a$] Ha'Ua(G keya)Aa*Ua+ a,(a-0a. U8 exta/U@) U@U a3$ a8HV tpa9HVa: a;Da<DvU 75 bWbDb pb]b " bXbX inob)X devb* d(b+ d, uidb, @0 gidb- @4b. 8b/@b0Pb1`b2pb3Xb4Xb5Db6Db7Xb8Xb9Db:Db;DW+ c#Wc$5c% c' WEdɠ5EdʠEdˠ e9Xe 9%fg g"FXgyXg5gKX gXWXg]g (h0Xh1[*h7[* osqh9e5h;W$h<EhXEhEhEhEh i+dYi,W$i- j pYuYYYY jYj[*jjdY XkqYkrYks98 wqkvZH cpukwP Y xlfZllfZlvZ( lenl[*HlZPlpZvZ++Z+Z+h@mq[mq[mq[m Om5@@m  ZHm!+m"+m#m$98m%Ym&j m'[0m(+8qcpum*@qsspm+1\H[*[+ `m6[m75m8vZm:vZ(m;+Hm<[Pm=Xm>\[ me1\mf] sdamg]mh4$mi][ixmDt]mE[mFt]mH mI5(mJ5HmK5PmL+pmM+xmN+mO+mP+mQ+mR+mS+mTmU+mV5mWJmY m\+m]+m^Ym_1\p[]+Z6\%n o3]]]]+] o6]o7]o8]o9 0oA'^oBXoC](pI^pz.pz.p"z^p#5p$p%p'^p(p)p+^p,p-p!^p&I^p*z^p.^ p_'^ opsp!_^ __ p2[_p4+p6]p7] 4]_@_4]_H_ _p__q__r_s_ _6_`_&__+_7`O_j_+`_L`)_`$@_`___+_+_+ _ (_,_`0Krcu_j8_aHL`^ _a_ id_`aU+ _*a_/a *a (qvaqW$qNqq r brXr& r)X ldtr*b8r.+@r95Hr:hr;#cpr= xrC&|rD~ b s css+ alts+s+s+ s+(s0s8s@sHsPsXs`shspsxss s!bc rFva6\Xc^ `]Xc=lruY)4cdeicj +k+6(RcXchIcs+ 6(u'dz+ pp{,d|+}+~[* 'd6Hd+6ldd  tdt;s reft:8tJHtht]lt+p opst xttld`(Q#e)c)c)1d)HdjjEe] g ^e val+HEeWMeN P]PJe|lruK)kePWe'X 'Y^eW@G?fI+eUIV + e([ 0\ 4^+8a@F]f)eVjOW(mfn+o+q r s t v] a@lf)]fVzOW0}Gg~++     (W |g++a@|g)f)GgVOTDgC?fCf@C|gH+gT h  5 v  qI  k{(]0]4.L8S@P p  x#$ 0% 0'CӠg5i ctx6i i=6i>X@?(XSiYX(\ib+h+t7w }$Wi++ai)iVjPj'g'g ;j[rbP6+6i @jub9kuc quh qujukuq usk(ut0uu8uw @u{kHu~kPu4XuH`uahupuxJj9k iSikX cid @@ k g k+ R@@oCk@yX@+P+X+`+h+p pgd  !x) 5 ?oE+L]S ZW$][*_a5pXr+++++ +(+0+8@@5D+H+P'+X3+`+h;brk+p!+x++%+0+oo@o(c+h5poxoh&o++  a[*Yp++[* kMk+o+34ao+ o oYV o o+pU+H ]J,ppu/p<u7p( pmdu9 !0 pudu; "8A@uEJHuFJP pteuL !X ptluPhT`uT =hL]q @kkkkkEv6Ev9Ev<EvG4]w}q4]wq    4]w;s        !"#$%&'()*+,-./0 8tst+t2t2t+t+ t+(t0 s_s@@ xsxxs y&tyy syB}tyD}tyEtyFtyGtyHtyIs&t tt ttz,tz- 5z/ ^z0t6yAu+tyK y:uy@s)tyNIuyO+yPyQ  (y+uy,y-y.y/ uu 0pvqhr s t u v&$/(uIu {"%v{#Mv {&Mv{'Mv{' Rv%vMv6|{v|5| `|vj|)Wv$|vC{v6}3v}4D len}4D}2v)v}6X }1 wv}8v}i1w}j}k1wW}rdw}s(}t%vj}uj$}R(?0@Ǔ8B““XDuEFG HI J(K0N 8OՔ@QHSǓP̓BzBk{PДk{Д!k{ڔxYZ[X\X]X^X _X(`X0aN8cN@dHeLfXPgXXhX`iNhjp8}]]]] ]]] ino  R( R0]+ 7]]] ]]]]X ?(b08b@HP7]::!]]D“]g}|8  ] X 0 H;ops! k{+.+/+PwT'}Y' m Tm^vrњ ! ; m(0 8 қ@ H P X7`Kh ip xΜ ޜǚJǚ̚ hg֚Iǚ!I 116 &hhI]hX@hI]]rFIFқ^כvv7I K<iPnIhɜĜ FޜhӜvvP&'d']aL' VjPq'!q' (k{vPŝ'R'!' ' ] h!`e&@ ops qHP devd`]dŝ &:@Z[-\P]n^` bҫ(d0e 8f,@hOHj PkwXm`oǬhppr xs?uXvy{} %h0    Ɵ П(Kh 5 pidJ4 uid @@ $  +]] ]] P Ӡ'5' Xa )V*j'+1',K'-ڟ HP:0s  Jsr+7   ή ( 0 8@ HP X`Bh`p xyyyy  ɯ   u  ';,6 @E O Y^ m wh@C  " . " "  "  "  " ]$](],]0 ]4#G8$@'"H*# P-]X0]\5`6 h<-p=_x?}@BDFHJ"LN"PRU}W}YJ[ Z\x]x^x_`a b}(c0d Z8e Z@jHk ZPqXs]`vxxz|e&fdev}A~X;dbgqH MQg+Qw+$HGX] w pos H ]h*hs MhGs/kvk]p RhzLh Ϩh]+h!Ԩk{hh=h[hByhy~ `+h++++TةRhs]hsR]ݩ#h#X(- Uh7jjho Zhh]yΪhh]] Ӫk]Ax-k{Ax]GKAxk{K؋2nӌk{U+k{sAxҫӌk{AxpAxk{Ax׫ k{Ax,ӌk{AxGOӌk{Axp1wӌk{AxpdTӌk{Axk{Ax]|¬ӌAx¬ɏӌD]^V̬Ax5k{5XX: Xk{Dk{Axh]p]ӌk{hp+ӌAxӌAx+ƭӌAx %Ax T mt yX +cck{*TL]k{k{ήk{ǚk{Ӯ m8Ax8= $`!GyjAxe~ɯGݯݯk{Bί  #AxKG-,$`+ @@AGBCD E ( sdF 0GX8DI]DJ]DK]DL]DM]`` * 5 . D^R^)     ޱj^Rv  ,+61 rev+ , Q $    GKrbP6 ns0]8< p>+@ idX` h^pKrcujxQ R ops!&  h; K"d$ }% & (( ӵ02 89@: ӵH= P@XA #`R ! Y=dir6 Y ' kn hj 5 5@`h x    @  A %>k66c'K6@djP}jsijsjӵ6L6ص6!#6 4]K 0'(() s* +϶,ٶ - w2(K_ŶŶʶ _Զ --G- p-m(-nȷ-o&ҷX-0÷-1޶-2 -3 -4J -5 w(-7 0-9 w8-; @-= ̸H-?P(ͷ(ܷ÷׷p޶p׷;׷"_IEwhͷOh׷|̸h׷h׷!Ѹ-- =- `=$`GB ` 5` Xe 0tu v"w!'x*Jy^ z x(,d+@@E1^EOxEssci }Ϻ~Ϻߺqbuf ߺ++?Qz+ 5NgIE:IGbESbE}l5G ('E'FG mod'Ge& ops'H!'I 0'J'K2 -'L`=arg'M =str'N=arr'O 'V'W]'X` '\ max'^]'_] num'`! ops'a!'b'$0( O) rP6+  E+ z ] ! z^Q+7 `-ݽ.` mod/e&@0H mp1P2JX ݽ 85C6޶7 f9 ; <(= ¾0\\aC\aGke&Ge&¾e&L]>T8E modFe&JGTPpsqrst][mtnw  ]ޱ Ŀ?Mr+(s  U1\V % 4*>$ (+++++ $0Krcu1j2X3HU+ H7I7JK LM+Np A: `<@ pmHGPX bus`h p x5Jrw ;msiZ(8@XHXPX `hx e d;idD5 !!'# $%'#)+ `, a- b. c/ d9 e< fA :+; <  !"# $(%0&8'@(H)P*X+`,h-p.x/0123457<<LUL]lHxuy 5z]|]}5~0z@ u:8+1  1 !1 "1 #1 $1 %1 &1 '1 (1 )D5 J @ @ A B C D EJ.7PXYW  ]                ]XXXX  (;qos0 +,G id-./5 0(19802+X3 :`4 :h5 :p6 :x7 :8+9+:+;+<+ dev=<D> D?  <5 r ops7   <r<] MNGOGP!'Q!'R!' T(U0V8W @X HY P[X\`^ h_paxcd pmfh< `aG busbde&eGg h$j(k0m8n @oHp Pq Xr`s!'ht!'p pmvxw py  <+ `23G5!'6!'89 ; (< 0>8@(@@A HC &P pmEXp &ss 0XYGZ!'[\ ^ pm`(+ ޶   G4]-3ȥzWW @3z  idy cls ss i@j޶k ^m Y<Y @<YGc]]+L]L]8Z 0!s" L]1L]BL]Ochd&e2f4g lidh h | X cma  0`1G2 :3G4j6X7`8eh9ep:ex>+? @/0 ops1" dev4<56(78jj  % POyPQGR qST<(U<0V!'8WG@X pH +Q+X+Q+4]  get put   ( 0"8E@YHYPmX`hpxm!5 QGR] idS]TG Pfgh]i.GGGGG"GG]EGGj&'GYGJmG^GrGGGGG]]LG!G] 5&  D  F` 12345 M . len .! . $% .& "' " (& +,]-].] HFGG] lenH I J K  L "(M G0N G8OL@ \y]D^D j ecckmyHQ  +NlIHI0gHgS Ax (XXD H55 D]+M(H(ZHsXZ2}HdHsHsHHsJHt+s'ZHOxH._H}H  add Z Z4]tE tNGtT WtZkteWJLpk'p\d++pt6ttti+U+tti+)GW(u0< vmau1!u2 ^u3 +u4+u5+ Pu>f'u? 'u@ q!f!+v!!+++p'p]p'p+++ !4!+GH!9a!pRMpR!+&fJ!+4]v     4]       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu Pcdefg hij k$l(m,n0oG8pd@ devq<H  dp]@ pf di vi p]R~cd @e @f @g | h | i 4j uk |l  crcm @|)+KrbP6$ }Ku) ec{ vol|}}i e<+Ki YYi+:XJo[devKALŝ;ubiMXN`OdPhQlRpStTxV|WXYZ[ \]^_a$b(c 0d 8e@gHh]"i]"j]"k]"l]"m]"n]":,-ŝ[dev.Ah/X0\1h2p3 5x4|5689:;<>?@AB5DFIJ 5K6L5O;fmPQ R, SX8TX`UV WYXYZ[\_6`6a6bc6;pqd"ef 5g5hXij2klmno p(q0r74u HvPwTxXy\z`{d|h}l~ptx|]];mtdH55];dbgoo ix1]1]1]1]1]1]1]]]] ]ZAx Ax(Ax0Ax8Ax@AxHAxPAxXAx`AxhAxp+~2+ QG+ \/H\0%(\1%(\3\45\5&] T<=%1>@?D@HALBP2F +2I }GQ 2T a+2[Q }{^ 2a5 2j +2l 2pd+ ,+2p }ns 2| 2~ 2 2 2 2 2 2 2 2 2 2 -+  d+   z  (' X+( 7( Xz+ 7) XF+ 67?F Xr+'b7@r X+7A X+ 7B ~<8 +G>HKG]!>fsG9 x8) D]>: G]N8HH8HG>+Gs] 8PHEG]EjF ]H8 tH9O9\ FH~38 F 2>[ >N F 3H>XIFRaF$ yd]9!!<8Q> !<8<GX9!q8 !!]]Gd8OB8Fc>q .yyC9/GX9&&GX82^88H^8?^9` 'F:8  Q95c8z> GX>493GX8C>`+9hr YG,$9dY =XGF/P<FcFq{F<8<<~%>%GX9d X9d X>o +]9+%GXFBBF__> GX Yval,GYkpL+i+len +pbuf%1~~R&7x/% < /% < /% < /% < M+err]/% <  +UsT:Q v"U TsMJ+err/% <  +(UsT:Q v"U TsM+err/% <  +UsT:Q v"U TsM+err7/% <  +dUsT:Q v"U Ts,J K K-Kl$K0KtKKKKKbKKKKKK U}T@U2T Q0,8IIITI-_IlIyI3 J 1JxHFTFaF bFoFb#96(949@9L9W9bc9. d9p9|999!c3Lr )L3L )L(p6t!6(6)!6?L LL-,;(;+;?L LL-6/% < p6/% < 67W% 6"#67W% 6"#!77W% 7"#\77W% L7"#77W% 7"#77W% 7"# 87W% 7"#H87W% 88"#87W% s8"#"7W% 8"#X8+8/# 9&ubi#70#@#%#% #& .c9*x_? *n_? *d_? *q? *r? "*x_B*n_B*d_B*qB*rB9&ubi39&ubi.t uQ:Yubi6G?+i cC:T0!Pt V;Yubi*,;:;-;IUv y:UvTva/ ;&ubi(*i*err *devd] ;/% < "7W% ;"#n ;&ubi-*it v<Ydev(<+ubiM]<RmPUUh/X<&devX2<0Y Y&bufY,*ret[ *ubi\"#hEy=GE+iGRG MU=+ubiK,HI=HIU ?HRH I=U IU u(?G()+i*+ubi+] >1/% 1< ,H->HIU ,H8?HIU 3H 4f?HIU 54L1 ?Us ?U T Q 1!6@Yubi(,HZ@HIU ,H@H mIU {UsuKBG'+ubi][B ;A /%  < ,HAHIU 3H AHIU 54L  BUs =BU T Q !X[B+KBEBcnb2]iubiBT0Q|CDcubi'v0cnbN]nt@~i GCUsT} CU~CUvQ} %CUsQ~ DT~ $ &Q} 5DU~!yP0Ecubi*cvolBvKretnt@~ GDU|T~ %DU|T}Q "ETs $ &Q~!yPe'Eve1veVcbuffdUQT Q1nE&volD/ F&ubi9/6F&mtd:y#H/?"~F&sz?/.&mtd?DH"#C"#C"/F&mtd7H&ofs&len#H/#eF&mtdDH/XG&mtd7H&ofs@X/ H2G&mtd@H/E_G0EE0FG/#eG&dev></ %G0 ;0 G^/|.G0|D0|P^"#]/%] H0<0"/z0[MH0zC^0zX+/UHH0U!G0U4]0UG]0Vj0V"w2#XnH05hTn]H0]3hT/D(TI0DChT9'IT9*IT  J&p!&q9L###  IIIII"I@I@J@J@"@J&p9L#*reteJtJJJJ"J@J@J@J@"@"KopALdTNNret tK__pNN"NKQKQKQKQKQ"KQ@KQ@KQ@KQ@"Q@Ld2Gd<d]e -4Lon -"+e,,L"N1 cLN1 uLN1 LN1 &LN1 D"N1 Xe"Lokey"JLd"Z(LeA!MoptrA<e4!Moptr4=e'#+8 A X@ D XH G+P H+X K>`L ND? T,L W,L Z,L ^M k 1 m&M p5  qC5( t+8 u+@;fs x0MH {:MP ~DMX NM` Ph  2Qp  9x  9  9 #= +   ]    ]   X   X   X  8  [@    Q     D   D  "R  )@R    JR0  58  ]X  OR\  dR`  5h    nR          !]  "]  #  $+  & X  ' X  ( X L )j  3xR  C&  D+  L}R  N+  RR  SD(  TD,  Y+0  ] 8  ^ <  _ @  ` D L ajH  d9>X  gR  i>  lR  w  x  z+  }  ~R   X  X     &       + ] R R R DS  ]( ], H0qrcu j0 9@  D H 28P Sx 9   "S S S     X    >L j   !"1 $"1L .j <SL FH @@5 @ *=pad! ! +? @5 ! )5 @:@@ ! .1#sp +#es  #ds " $ & +( +0 >18 +X +`#cr2 +h +p +x ]1 + ] D + + 0cfpu |0@] (! !! A*!:@@!Fk@o@  !^"Fi! i (,j0Mi8X)jh%"kp+xh 'kb*nR,kh54"$#""4"H#"&"& "h#=val" *#*$# "|#H# ",h#4######+ ### *# # ###|# ## $ ,$$ $ ,$ %%  &^$&|# &C$ '$'^$''' '']'+,(6%#fmt(G(G(G(](G(G$$)6^%)7))8F&8)%)G)G)G)GG)]G)]G)4] key)9;%(2])=& 8)Ul&)V mod)Wl&)XG)Yq& )Z ()[ ,)\%09G )u&)v&)w&)x])y]^%&+Q&+ */'*1] set*3 get*5*7 p2&(l&Q w   ( 08!@" !H# ?P$ ?X%X`&qh'p(qx)*˨+,- ./ H0 p1 S23 ũ5 9 ; >>?a@' +!D)+% ++ +-+/ , l),!5 key,"5 ,?),A+,B),C) )D) ,=),>l)2] 3A*     +Q*+ ! ;!Q* - i]/+      00ck+0dG0eo0g0i 0l v(+ 1+1X end1X'2 '2  p35, cwd3D swd3D twd3D fip3D fcs3D foo3D fos3D35,3DlDE,+43*i, rip3+X rdp3,X43., fip3/D fcs30D foo31D fos32D 3),*E,*i, 03@,3A,3B,D,+ r3$- cwd3%& swd3&& twd3'& fop3(&,35D36D39- 3<-3>,,D-+D-+? 3Q}. cwd3RD swd3SD twd3TD fip3UD fcs3VD foo3WD fos3XD3Z5,3[l3\m3]n3^o rm3_p3`q3a}.x3bD$.+X.+@3:.3; X3< X3= .X.+:@@3O(/M3P,3Q.3R(/@7/_+@3^/(3_+`3`,(3a-`3b.@(3c//+:@@3fC03h]3k]3nX3qX#xfd3tX3w]3z]3]3]M37/@@3|03 X3]3] fpu@303]3+30303C0 3C00M3/@@/ 4 14 X4XQ.1+ >1+N1N1+S1 X1& 515]5]5G5G5G'6'6'6 781792 7<27=21 8<528=]8>  8:p28;12 src8A& dst8A &u2!22]92"(9292 val9 D9!D 9"D9#X9$2 D 9*"39+&"39,#O3 :O3:KV: 5'3"9'39(9)239.X" 9139239394 95+96+ 3 (949%29/T3973 89;49+ fn9 O43J4J44;4 ;>4;?+;@+;AD cpu;CD <4<X<X&(<4Nct<b1<&4 42]=5 >95> >5 95 ? ^5? @ y5@  A5AC$ A5y5 A5"B 5B# B"5 C)6C*b*C+^$ osqC-^5 C/ (D I6D D D&E~6E+E~6E~6I6 E 6E ~6 E6E6E~6& F6UF I6F A F  7F62]G '7&@G'7UG(6G) A G*7(G+-80G,8G-9G.:G/; 777'77&@@H/-8H03H1]H2  seqH34@H47H56 H6=0H7 A87 (It8I (I+I 8ID !8828t8 J8JJ J8 8"K 8K8+8+ K88 L9L  L8 M+J9M,M- xN9N9N]`N+h maxN+p+9+ "O 9 sigO8 O9 PRz PS99 PU: PV99Q :Q Q  Q 9"Q'P:Q(Q)"Q-:Q.Q/Q0 :Q1"Q5:Q6Q7Q8 :" Q< ;Q=Q>Q?Q@QA"QS;;QT &QUQV" QY_;QZ &Q[ "Q^;Q_+Q` Qa QJ;QLQQ QW ;Q\;;Qb_;" QE;QF;"Qg<Qh _fdQi"QmH<QnQoQp]  Q%<Q*,:Q2P:=_rtQ9:QB:Qd;Qj;Qq<<+40R <R R R R H< 0R  =< R< = R K=R!R" 9 R%=R'9R(+R.9R0 9 R3= saR4K= S =S S + lenS +S  (T>T ! U$9>U%OU'U( 0UDn>UM#=UP(UW) 8V >VXVXVXVXVX V#X(V,X0 W)>W*XW+6 PW84?W94?W:]HW;]L>D?+&8WDz?UWEjWF5WG]0& X>?XKXZXpXXX endX?Q?_+ Y! @Y" ] Y&? YD4@YD @ YD@ YE[@YE @ YE@@"YT @YY[@YZ 5 Y[g@"Z @ valZ Z @"Z @ valZ  Z @ SA U X V X W^$O] [FA0 hA i @ j kA#cpu l] mX nX  oX( A +    )B +  D^@@ B  X  X  X  D  D +  +( +0 ]8:@ \D  X  X  X  X  X   X(  X0  X8  N@  XH  XP  NX  N`  Xh  Xp  Xx  X  X  X  X  X  X  X  X  X  X  X  X  X:@ E AM I6 ! X( " X0 # X8 %@ &P 'Q (R )S , XX - X` . Xh / Xp 0 Nx 1 X 3 X 6  7E 9E ;E =+cavg G)B@\D E0 K0F L M+ N+ O]  P$ Q& S0F(EK ]BFGFVFVF[F^ `GM aI6 h X i X  j X( k X0 l X8 s N@ t XH u]P ] ] ] ] ] ] ] ]M '7XM '7#rq G 5F G VFK ^GGGVFrqG 4H1 ] 1 ] 1 ]1 ]k wH     Hb 4Hs D H HH  HH HGH+]*Q* H^IU{tX e@ D H6P+` +h)qp+x 5X Ipidp[7J[9 9[:][; 5[<$x ino[=X[?ȃ [@ @[BWHNrcu[Cj`[D؃pI(J+ \J\]\BYJ&]o'L]pb* uid]q @ gid]r @ ]s @]t @]u @]v @]w @ ]x @$]y ](]z0]{8]|@]}H]~P]X]M`]Mh]Mp]Mx] ]*]o]=]/FJ'Lkey^M^9^F;^- sem^X(^7P^ X\`^ h uid^ @p gid^ @t^x^|^~^ ^+Ɇ ^<1L !M +M 5M ?M IMrX_^P__9_` _a_b _c_eW _h8_k#=@_n X_q`_sd_th_wp_x]t_zxG_]G_]_]_ _ U_'7_ A it__)_>_h_ _J_{tty_Њ_ڊ_ @_X_ X_X_X_X_X_@_+_+_+_'+_+ _+(_"+0_,+8_+@_+H_"+P_,+X_+`_+h_n>p__ߊ_c__ ]_____!_5_X0SMs _2Q_5_9_W_S P 7Q AQ KQ UQ _Q X`cQ`db*`e `g `k 5`mt`n(`o 0`qY8iQ Q = Q Q a@RaaaR ER_R+ _R iR sR+R+z? R RJ9R+ R R R&hbyDSbz9_b|]b}`F`b_(b280b+Xb#``R @c4Sc5Sc6 c7+c8+c9p c;](c=],c>}0c?8IS S S S S'^$'''!'%''','/5'3'5'9'<'A'D'H'L'Q'U'Y U d>Uddd d tUd!+d" 5.d$] Hd'Ud(G keyd)Fd*Ud+ d,(d-0d. U8 extd/U@) U>U d3& d8FV tpd9FVd: d;Dd<DtU :5 eWeDe ke]e  eXeX inoe)X deve* _(e+ _, uide, @0 gide- @4e. 8e/@e0Pe1`e2pe3Xe4Xe5De6De7Xe8Xe9De:De;DW+ f#Wf$5f% f' WBg5BgBg h:Xh 9'ij j"GX jzXj5jLX jXXXj]j (k0Xk1b*k7b* osqk9^5k;^$k<BkXBkBkBkBk l+jYl,^$l- m vY{Y!YYY mYmb*mmjY XnqZnrYns28 wqnvZH cpunwP Z xolZoolZo|Z( lenob*HoZPop Z|Z++Z+Z+r@pw[pw[pw[p Up5@@p ZHp!+p"+p#p$28p%Yp&j p'[0p(+8{cpup*@{sspp+7\Hb*[+ `p6[p75p8|Zp:|Z(p;+Hp<[Pp=Xp>\[ pe7\pf] sdapg]ph:$pi][sxpDz]pE[pFz]pH pI5(pJ5HpK5PpL+ppM+xpN+pO+pP+pQ+pR+pS+pTpU+pV5pWJpY p\+p]+p^Yp_7\p[]+Z<\'q r3]]]]+] r6^r7]r8]r9 s'^s.s."s"X^s#5s$s%"s'|^s(s)"s+^s,s- s!^s&'^s*X^s.|^ s^^ opss^^ ^^ s29_s4+s6]s7] 2]b@b_2]bH_ bp_bqb_brbs_ _4b_b_b+b`Ubjb+lb*`*__&@b`b_b+b+b+ b (b,b`0Nrcubj8b`H*`^ b`b idb``_+ bab a a (tTat^$tNtt "u auXu& u)X ldtu*a8u.+@u95Hu:hu;cpu= xuC&|uD~ a v bvv+ altv+v+v+ v+(v0v8v@vHvPvXv`vhvpvxvv v!ab uFTa4\6c^ `] Xic=lruY*cde icj +k+4(Rc6chIics+ 4(udz+ pp{ d|+}+~b* d4&d+4Jdd  wdw#s refw8wJHwhw]lw+p opsw xwwJdl(Qe*c*c*d*&dtj #e] k X@?(X7iYX(\ib+h+t7w }$ai++mi*i`jVi(g(g jcrbI6+i $jxbkxc Bxh Bxj[xkoxq xs<(xt0xu8xw@x{<Hx~<PxXx`x2hxPpxix.jkh7ijkX#cid @@ k k k+ R@@oFjk@zX@+P+X+`+h+p#pgd  !x) 5 ?oE+L]S Z^$]b*_a5pXr+++++ +(+0+8 @@5D+H+P'+X3+`+h;brk+p!+x++%+0+oo@oc+h5poxoh&o++  `b*Yo++b* k1k+o+3ao+ o oWV o o+o_+K ]Oppx/p x7p(#pmdx9 !0#pudx; "8@xEOHxFOP#ptexL !X#ptlxPfT`xT BhO]q @uuuuuBy6By9By<ByG2]z}oq2]zq    2]z#s        !"#$%&'()*+,-./0 8wsw+w2w2w+w+ w+(w0 sjs@@ {s{{s | t|| s |B`t|D`t|Eet|Ftt|Gt|Ht|Is t jtot yt~t},t}- 5}/ e}0t4|Att|K  |:t|@s*t |N,u|O+|P|Q  (|+zu|,|-|.|/ tt 0puqhr s t u v&$(zu,u ~"v~#0v ~&0v~'0v~' 5vv0v4^v5 lxvt*:v&vF^v43v4D len4D 2v*v6X 1vv8v iwjkwWrGws(tvtuj&RxT]U[@VvW$xXv YU{0[Z{8_"&|``ha+pbxUdxvvm(n Nd_uvwGwGw:x{P{| k}~ @ @] ! (I0 8+@vH _L P X ` hDpDtDxD|5/ YDX++("&& 0@H P T X \`,hLIp8H P(6X@`Jh p)x)xj{+'&@!|''Jr ( 0 8 @ ݀HjPX`j{!|:@ _+  (!~0!8@"H+P+X+`$xhXp &#ɢ$آݢu   h  (] (L` D!D"¦/ Ǧ0 14 צ6]<5 BG@D"&|HFقPIb*XL`O dRZhS pZoxabqrcucjdYf5k0Ln5@@oHq5Xr`+|2]'$x]@@Exv,m@]GmvO@w$x!$x!$xU{݀$xĀ E$F$xGHI338= e mnt 3 $x=$eo$x$x "#e nid&-+4+7R&RłSUXYZ ]c 9 dJ(NrcuejHgXj` idmpptqGxr$xu+ققނłb* 03;4678  xa9t p " $5&@@- lru/;0b* p [2à nr[3 ns[4Ã5 ؃+_+" valX 2] - - l B +  ^ ^&^lNrcu^mj^n9^o 4^v^x&^y Z ^u5*=x^+ (^r}^t+^^^G }}Ä ^^^ ͅ+ ^مޅMM ^;^ͅ key^M^l^\^t^I6 ^~^ ^ 4(^Ɇ^+^+^^^  (^^5*~a ^ ^^ yV ^((^* ( 2 ć 9a+0b*8(@ uid @Pb*X `$j$h ]] 9] gid] @_+l]*]rcu]jAćr@@Hg3Hh^$ cpuHi]Hj]Hk] .Hl].Hm].Hn].Ho].Hp]Hr]HsHtHu]H{ A H|7(H} A0H~78UHB@@4jA8|7@S+=c+? 8_̉_ _! _"+_#X_#X _$+(_$+0 _'_(X_)X _0)_1 _2 _3  _CD_D _Ll_M_NlD 8_Q_R _SD_TJq̉+Jˊ+ ˊ Պ"9+   &0aWUj &` Nrss !08W@ X  ׋ fn p2 arg |+" b׋   D `S6`T`U2l`WW`X(t`Yj&8`I q`J ioc`KQF6 `\]0 W " nj val " val ӌ <!   i:n+v&8_`b*ab.c .d Nrcuej reff 0:" č v + %O] T 2"++ v n 2 d". {0  4d 45]67̎̎+֎ ю ێ|+  @ nj > @ P] k  (8 hHЖ(s)(*+ ,0-5@. 5`/ d0h1p2 x3+4 " val s 2]6Ő B E=uidF @=gidG @H D ѐJ H Ő Ő Ő Ő Ő  Ő( Ő0 8 @ H&m+ ](], Ő0 Ő8@ m!l&m&@89 : ; < = >(?0@<8r 77#XDEFG HI J(K 0N ,8OJ@QcHS<PA!''U{ŐEU{E1cU{'OxYWZ[X\X]X^X _X(`X0aN8cN@dHeLfXPgXXhX`iNhjp8]]]] ]]]#ino  Y( Y0]W-+ ]]] ]]]]XUx  (ח08ח@HPxZ]}-җҗh7җܗ8 t ] X t0 H;ops! U{+++Vwɘ(}Θ( ɘӘ!u#Fd}  (0 -8 G@ `H pP X`h ޛp xC Sl<O<A (_h_~gK}I<iI_! ݚhI]ݚX_hI]]_M-IM!G_2`_eL!p_euuuI__ _ޛ_ś!_I_44h>9 M!ShHluuX#V(d(]m( `jV(!( (!U{V:(R(( ( ] hЯl&@ ops HP dev_`]d: :@Z[\]ު^` bB(d`0ey8f@hHjyPkXm`o7hpdpr xsuȬvy{1}T|ح  ' 1 ; E(h 5#pidJ4#uid @@ $ # +]] ]] V H(5( Xm )`*j(+1(,(-čO KP:0  M|a+<y   %> R( 0 b8 @{HP{X`hЮp bx  9R k k byU    Ģ ΢Ӣ  r@   )         ]$](],]0 ]4#G8$@'"H*#P-]X0]\5`6 h<7p=ix?@BDFHJ,LN,PRUWYT[ d\]^_`a b(c0d d8e d@jHk dPqXs]`vxxz|l&qdev}~X;dbg{ Qצ+Q+$K!!GX]&Q #pos K ]wh^hs|hGsۧuۧ] §h!Gh ?h]+&Xh!DqU{h]hvh˨hh Ш+h++++THRhs]%phsR]MhX uũh!ککhߩ ʩhh]>hh]WW]\ CWۧ]f$xU{$x]G$xU{ުU{ŪU{$xBU{$xk`$xU{$xGyU{$xeU{$xG~U{$xkU{$xk_īU{$xU{$x]2$x2>__D]\V<$xiU{XX ȬU{U{$xh]kͬU{hk1$xT$x6r$xrw Y$xr ĭ#mt zX +ӭӭU{ĭO]U{!%U{>U{<*RU{C!bW{ݭg$x Ю!ک$xծ9GMMU{>kނW p $xG1$Я+ @@AGBCD E}( sdF{0GX8GI]GJ]GK]GL]GM]ЯЯ * 5 . Da°a     Nڰΰ°  +6 rev+  {&{  {GNrbI6 ns0]8< k>@ idX` hγpNrcujx ² ops! {h "Դ$ % & (( C02 89@: CH= \P@uXA `²  ɳ=dirZ ɳ  kn{hک 5 5@`h x    @  A %"kӳ!Դککsٴ کs! کC%G\Hu!az2] 0'() s* !+?,I - p2(j55: &jD 0v0G0 k 0m0n80o&BX00301N02 03 04 05 (07 009 80; @0= <H0?_P=L3GkjjNQkGtGjjIh=hG<hG_hG!A00 0 иdjиjG ` 5Я Xո 0txu vw!x*yι z (x!k+ι!ssӹs }?~?O{buf_ O+_+?Qq+ غqGӺĺӺݺG (*E*FG mod*Gl& ops*H!\*I 0*J*K  *Lѻ=arg*M =str*N=arr*OW *V*W]*Xѻ *\R max*^]*_] num*`! ops*a!\*bR'&0(}U)}|I6+  +  ] ! cQ+7 `-N.Я mod/l&@0H mp1SP2JX N 856N7 ׽9 ;  <#(= 30ͽͽҽXͽҽGܽ!l&G#l&!3l&(O]>b^8E#modFl&MGa^Ppqrst]cmtnwb + +]N 05?7|_+) i sU7\V  $i]ѿi]#T$%&' (i)i*Tid+]5{Z[\]^i_|`ab{i+Q+ pJqrk    i+i+ O+CiH iX+ii+||+ (9+++++ &0nNrcu1j2X3n}_+ HIJK LM+No 9:Я@#pHGP-X#bus`h p x5M!( ;msi(78<@XHXPKX P`h[x em _;idD5 !!# N$w%'#)+ `, a- b. c/ d9 e< f :; <*>  N!>">#> $>(%>0&>8'>@(>H)>P*>X+>`,>h->p.>x/>0>1>2>3>4>5>>/!NCOUO]lHxy 5z]|]}5~0@ :8[1  1 !1 "1 #1 $1 %1 &1 '1 (1 )D5 J p@ @ A B C D EM'7PXYWz  ]                ]SSXXXX  (;qos0 +p,G id-./5 0z(12802+X3 A`4 Ah5 Ap6 Ax7 A8+9+:+;+<+ dev=G> G? [ u!5 #ops> $> N N=!$=]) MSNGOGP!Q!R! Tx(U0V>8W N@X NHY NP[>X\>`^h_>pa>xc>d N pmfhBlls `saG busbdl&eGg h2$j(k0m>8n N@o>Hp NPqXr>`s!ht!p pmvxw N pyqX}*S `2g3G5!6!89 ; (< N0>>8@(@AHC P pmEXkl!g!ss 0X(YGZ![\ (^ N pm`((2]-UȪǦǦ @U  id׋ cls q(ss f]]+O]O]8 f0,!s"1 ,O]1rO]BO]Ocd&6e2rf4g #lidh } # -2X AF-cmaU ` 01G2 I3G4 6X7`8h9p:x>+?j @/h0m ops1" dev456(78  r |' +X+Q+2]  get put   ( 018T@hHhP|X`hpx|0D QVR] idS]TVh Pfgmh]i.mm!mVVV VG1VG]TVGq&6GhVYm|VmmVmmVGVGG]][V"m0V]Dm5  D  U 1"2345 W ) len )! ) $% )& '  (& +,]-].] HFQG] lenH I J K  L (M Q0N Q8OV@ \]D^D j ecckm[  5XvSS:qq] $x (XXD H55 G]5W22"dsXd<nss's' Tet+s1!dY)i2]wE wNwT (wZ<we_!(Oo< p-_d++Aw4wwdwp+_+ wwp+*ia(x0 #vmax1!x2 ex3 +x4+x5+ Vx>7(x? (x@ !B!7[!+Go!`!+++to p]o p+++!!+G! 2!nRnRP!+&7Oi!+U2]v     2]       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstui]" Pcdefg hij k$l(m,n0oG8p_@ devqHi]cgd ;e ;f ;g | h | i /j k |l g#crcm ;|w+ rb I6 &  Nu w ec       E  {E#vol |H }s e  <   +s      +:X J cdev K L:;ubi M9X N` Od Ph Ql Rp St Tx V| W X Y Z [  \ ] ^ _ a$ b( c 0 d 8 e@ gCH h]" i]" j]" k]" l]" m]" n]": ,4 -:cdev .h /X 0\ 1h 2p 3 5x 4| 5 6 8 9 : ; < > ? @ A B5 D F I J 5 K6 L5 O;fm P Q  R,  SX8 TX` U V  WY X Y Z [ \ _6 `6 a6 b c6;pq d e f 5 g5 hX i j k l m n o  p( q0 r4 u H vP wT xX y\ z` {d |h }l ~p t x |      ] ] ;mtd   5 5 ];dbg M  >x 1 ]1 ]1 ]1 ]1 ]1 ]1 ] ] ] ]  ] Z $x  $x( $x0 $x8 $x@ $xH $xP $xX $x` $xh $xpH+J+ Q+ v 0%(v 1%(v 2%(v 45; H O + j ~+ +C`#n 9C5# W U7 ;17 =Hn :n <+ Pt9CEG7+]GwC GG + 2e+ 82e+ ?$e 8A aG7/ss 9+ 9 + OE+ NE+ M9{+ 91+ WhC +w++ w9H + |9HCc++ a9+ [B9H+ Wh9H7 +7+nnC ++7 3Gw47E7g X7g (XCCEC^ECyE+ 9+ u9H+ Y9HC+ 9H+ U#9HC 9CEY+ p7E7c n(C(Gw7 /Gw7)&Gw7k  Y7k  YC+ >h]+ o*hdcmd=]darg+Herrx[ereq@HmtdW^% /8QsM  M M,9MXLU T / Z  R PH__x  5E E E EU@TvQH5"L  3LU0)~9Us)jUs#dW%^% /%%QsM % M M,9MXL%U T / & R& ]Qf& X)NUsT0)#UH)Q? T!o?)hdcmd?<]darg@+HerrBHubiC9DEExd!'ereqR{~WT^% /(TTQsM T M M,9MXLTU T / Je e Re PH__xe e 5EU  E E EU~T|Q0a$[  s$ $,$$9$0K~ K *K,6KBKNKKKKKK>KgKKKLLAU~Ts$U2TUvT aU~U}UvT~U} o0Wq^% /qqQsM q M M,9MXLqU T / r Rr ]Qfr X5"Ly 3L9Q3U}U|T0!ereq~%W^% /wQsM  M M,9MXLU T 0E  E E EU~T|Q<0/$  A$ N$5"L 3L0M z M M,MgM M N N5@L hQLU}pU|9Q3U}U|TsHreqi!* W^% /|QsM  M M,9MXLU T /(  n! pD E E(E)E58E   JE WET Q 5E  E E EUT|Q 0s!  ! !,!!!!~!!9!0>J  OJ,ZJgJ0K   K *K,6KBKNKKKKKK>K KKKLLA U}"T|$U2T|tJJJJJ>J JJJJK$U40ON OPP?" ""$"?Q"V"c"p"}""?""0Hb H H H H H HIIIII>I?IJJ J0JII%I4ICI>RI+WIgIwIII$HU@T$UAT?"""}"">""U T}Q RQUsT}0N- N N)O2 6O BO NOYO O O OOU}TsQ|ZO?" #?!#"#QsM M M,9MXLU T R}Y}?1"%6"C"QD D D D DQD  E E}(E)E58E   JE WET Q5"LZ 3L0#G 4G ?G JG,WGdGHH,H;HJH>YHZHjHzHHHQT}Q}$UFT}Qs0$0&5@L ' QL9GT}Q4{UvT Q}RsU}pU~U}?##?$ $0yN9 NN% NYeO vOOU}N N NN>$$5Ng .N;N>2#7#?E#{J#W#>d#i#>w#|#5#G xh4G ?GhJGWGdGQU}Q}5"L 3L>###pD$ D D D DpD  E E(E)E58E   JE WET Q0O- O Og)O 6O BO NOZO O O O,OU~T|Q}ZO>#D#>##psM. M M9MXL.U T 5@L  QLt5T}Q3fUvT Q}RspU~>##U|TsUvT Q}UvT Q|)p=U}UU}XsUvT|U}UUL / 1  R ]Qf XUvQ} /  R ]Qf XUvQ10RDJ ! dD#!!UH)xF!Uv)QXd!+T!4@ *$Iubi.9Ireqi![i[n [err [re*$[re1 *$6yd! 2#GQ"n!"$"R $$$W^% !#$E##Ew###$ n!$ $W.^% #.$.#$7$7$7@ \$Iubi6Ireq$\$J@Q $IubiQ6IreqR$s[nT[errT badz QO,oz)hdcmdz<]darg{+Herr}~EHvolHHubi9xd!&R 5~50E & E E EU~TsQ8##&UHB;&UvY&U|T}|&U|T}Q5PUv~A2'ereq0E ' E E EUTsQ@5DU' D !DBm'Uv'U|T}QPUv~A2) / (( R ]Qf X)W^% /f((QsM  M M,9MXLU T Xs5D\) D !D)U|T}QsyU|T Q 2*ereqX0E * E E EUTsQ8^Uv* / * R ]Qf XCUvR+  / =+ R ]Qf X(Uv+ereq0E + E E EUTsQ@+U|U| ,[vi2A,evi<~UvT~)QC)2oC,hdbufCEGoDoD sHerrFGEHvolHHHubiI902L w1 2 2 2 2,222222 33"3.3?N3.i3?x3\.y3QsM  M M,9MXLU T R0M  . M N N?30/33U0E) x0hE E EZnF U0hF F F,F?F/F}FFpF G G GhUTvQ0UTsQv5_F$0)0UT}QRXY|1U)))R1UT UT 1UT}QsR1U1UT}Q5P2Uv~A2)B>2UT R|P]2Uv~A2UT P33hDJDs3ETvolHTubi9Terr3 ToffTlen33 3x95z^% /+5653gsM M M,9M\LU T R6z^% /66{63gsM  M M,9M\LU T  73 n!3 UZM M7 M N NZE 8 EhE EZnF o8hF F F,F?F8F}FFpF G G GhUTvQ1WUTQvY_F8)w9UT|QRXsYv9U19UI9Uh9T T X9+ 9 J ;D(hD5endCD 3ETubi93U{TerrZD: DUsY/D: ADZD: DUs)D;D,hD9DE3ETvolH1;UUTTQQT u ?Du+U{Du?h3wETvolxHy? ,=zz^% /<6z<3zgsM z M M,9M\LzU T \=b6% b"? C>z^% /=6=3gsM  M M,9M\LU T \L)p>Uv>T )p>Uv>U T Q)X?+ ?6%\ }AD\(U{D\@cU{MDIfc;MDh@]rD-3rDP{@]D-3rD5D-5/U{0D-0-U{@ %D- ;- Ge@ |.8E- |D- |Pe$ ]@ %]pE- <- $ @ z0ЍE- zCe- zX+P +EJ- #:- $- %- &- '- (I U%I U4I UCI URI UIgI U%wI U%I U%I U%$ U%I WI WI WI WI W$J W%J W% J W%0J W%$ W%KIp 9L [ret J J J J J $J %J %J %K %$ % ""L+8A X@D XHG+PH+XK>`7N.?TLWLZL^Mk 1m Mp 5 q/5(t+8u+@*fsxMH{MP~(MX2M`Ph Qp 9x 9 9 =+ ] Q @]u8= X  X 5 R$ H 6( 8 *Q@  H 4QP >QX HQ` Qh Qp +x Q X> ]  X  X  X 8 E@  Q   D  D "Q )$R    .R0  58  ]X 3R\ HR` 5h  RR      !] "] # $+ & X ' X ( X 7)e 3\R C& D+ LaR N+ RqR SD( TD, Y+0 ] 8 ^ < _ @ ` D 7aeH d#>X g{R i= lR w x z+ } ~R  X X  &  +]RRR(S ](],H0_rcue09@ DH8PSx9  "S SS  X >7e !"1$"17.e<S7F> @@+@ ,pad!  +?@+   )+ @)@@!1sp+es ds"$&+(+0*18+X+`cr2+h+p+xI1+]D++ 0Rfpu h0@]( ! /*!)@@!1k@o@  !J"1i! i (,j08i8X!jh%kp+xh kP*RR$kh+&#&>#&&^#,val  " #r#># ,^#& #  ##+ #   ~# ## r# #! "$! ! "$ m"m" #R$#r# #7$ $$$R$$$$ $$]$+,%*%fmt%G%G%G%]%G%G$&6M%&7&8<8&%&G&G&G&G2&]2&]2&4] key&9*%(%]&=%8&U[&&V mod&W[&&XG&Y`& &Z (&[ ,&\%0/G&u&&v&&w&&x]&y]M%%+Q&+ '/''1] set'3l get'5'7 \2 &y([&9 _   q( q0ͧ8!@" H# 'P$ 'X%@`&Yh'rp(Yx)*+ۨ,-.ۨ/ 00 X1 ;23 5 ̩9 ; &>?I@g ' (!2)(% (+ (-(/ ) Z))!5 key)"5)?))A+)B))C) )2))=))>Z)%]3/*     +?*+  ;! ?* * e],+     0-cY+-dG-eW-gu-i -l ^( +.+.X end.X/ / p0#, cwd0D swd0D twd0D fip0D fcs0D foo0D fos0D0#,0DlD3,+&0*W, rip0+X rdp0,X&0., fip0/D fcs00D foo01D fos02D 0), 3, W,00@,0A,0B,D,+ a0$m- cwd0%& swd0&& twd0'& fop0(&,05D06D09m- 0<}-0>,n,D}-+D-+?0Qj. cwd0RD swd0SD twd0TD fip0UD fcs0VD foo0WD fos0XD0Z#,0[l0\m0]n0^o rm0_p0`q0aj.x0bD#.+X.+@0:.0; X0< X0= .X.+)@@0O/80P,0Q.0R/@$/K+@0^y/0_+L0`,0a-L0b.@0cy//z+)@@0f/00h]0k]0nX0qXxfd0tX0w]0z]0]0]80$/@@0h00 X0]0] fpu@000]0+00000/0 0/0080/@@/1  11 X1XQ1+ *1+:1:1+?1 D1 212]2]2G2G2G3334814914<14=115<!25=]5> 5:\25;11 src5A& dst5A &a2l2%]62(6262 val6 D6!D 6"D6#X6$2 D6*36+&36,#;37;37/V7 536'w36(6)l226.X 6136236364 65+66+ 3(636%26/@367w386'46+ fn6 ;4364643'48>48?+8@+8AD cpu8CD949X9X(949ct9N19&4 4%]:5 ;%5; *5 %5< J5<= e5= >{5>7$>5e5 >{5? 5?# ?"5 @)6@*P*@+R$ osq@-J5 @/(A 56A A ABj6B+Bj6Bj656B 6B j6B6Bo6Bj6 C6BC 56C 5C 6C6%]D 7@D'7BD(6D) 5 D*7(D+80D,8D-9D.:D/;67777@@E/8E0E1]E2  seqE3@E47E56 E6&0E7 587(F`8F #F+F p8FD k8k88`8G8GG G8 8H 8H8+8+ H88I9I  I8J+69J,J-xKx9Kx9K]`K+h maxK+p+9+ L 9 sigL8 L9 MRz MS99 MU0 MV99oN :N N  N 9N';:N(N)N-y:N.N/N0 :N1N5:N6N7N8 : N<:N=N>N?N@NANS&;NT &NUNV NYJ;NZ &N[ N^{;N_+N` Na NJ;NLNQ NW:N\&;NbJ; NE;NF{;Ng<Nh _fdNiNm3<NnNoNp] o N%<N*:N2;:,_rtN9y:NB:Nd;Nj;Nq<<+&0O <O O O O 3<0O << O< =O 5=O!O" 9 O%w=O'9O(+O.9O0 9 O3= saO45= P =P P + lenP +P (Q=Q !R$#>R%ER'R( 0RDX>RM#=RP(RW)8S >SXSXSXSXSX S#X(S,X0T)>T*XT+6PT8?T9?T:]HT;]L>.?+8TDd?BTEeTF5TG]0 U>?UKUZUpUUU endU?Q?K+V!?V" ] V&?VD@VD? VD@VEE@VE? VE*@VT u@VYE@VZ 5 V[Q@W @ valW W @W @ valW  W @SAU XV XWR$:][0A0hAi?jkAcpul]mXnX oX( A+B+ DJ@@B X X X D D+ +(+0]8)@FD X X X X X  X( X0 X8 N@ XH XP NX N` Xh Xp Xx  X  X  X  X X X X X X X X X X)@EA8 56! X(" X0# X8%@&P'Q(R)S, XX- X`. Xh/ Xp0 Nx1 X3 X6 7E9E;E=+RavgGB@FD E0KFLM+N+O] P$Q&SF(E6],F1F@F@FEFJ`G8a56h Xi X j X(k X0l X8s N@t XHu]P]]]]]]]]87X87rqGFG@F6^GGG@F{rqGH$] $] $]$]``HHpbHpsDHHHm HH HGH+K*?* HJIA{|tX e@ D H6P+` +h)Yp+x 5X H|pidpX7pJX9 9X:]X; 5X<x inoX=XX? X@@XBWH9rcuXCe`XDăpI#J+ YJY]YYJZo LZpP* uidZq @ gidZr @ Zs @Zt @Zu @Zv @Zw @ Zx @$Zy ](Zz0Z{8Z|@Z}HZ~PZXZM`ZMhZMpZMxZ ZZoZ=Z1 J L|key[M[9[1%[ sem[X([!P[ XF`[ h uid[ @p gid[ @t[x[|[~[ [+[&L M M M #M -MaX\^P\_9\` \a\b \c\eW \h8\k =@\nX\q`\sd\th\wp\x]t\zx2\]2\]\]\\B\7\ 5 it\\\>\h\ \pJ\ftty\\Ê\ u@\X\ X\X\X\X\X\@\+\+\+\'+\+ \+(\"+0\,+8\+@\+H\"+P\,+X\+`\+h\X>p\\Ȋ\L\݊\ ]\\\\\!\5\X07MX \Q\5\9\W\< P Q %Q /Q 9Q CQX]cQ]dP*]e ]g ]k 5]m|t]n(]o0]qaY8MQ Q< Q Q ^$R^^u^Q )RCR+ CR MR WR+qR+d? vR R69R+ R R Rh_y(S_z7__|]_}`1`__(_80_+X_#``R@`4S`5S`6 `7+`8+`9o `;](`=],`>}0`?8-S S S S SR$!%',/5359<ADHLQUYTa"Uaaaa XUa!!a" +#a$]Ha'Ua(G keya)<a*Ua+ a,(a-0a. U8 exta/U@)T"U a3 a8*V tpa9*Va: a;Da<DXU 75 bWbDb kb]b  bXbX inob)X devb* _(b+ _, uidb, @0 gidb- @4b. 8b/@b0Pb1`b2pb3Xb4Xb5Db6Db7Xb8Xb9Db:Db;DW+c#Wc$5c% c' W3dɛ53dʛ3d˛eXe 9f}g g"(XgZXg5g,XgX8Xg]g(h0Xh1P*h7P* osqh9J5h;R$h<3h3h3h3h3hi+@Yi,R$i- j LYQY\Y\YaY jYjP*jj@YXkqYkraYks8 wqkvYH cpukwP YxlBZllBZlRZ( lenlP*HlbZPlpYRZ++bZ+rZ+a@mM[mM[mM[m Bm5@@m YHm!+m"+m#m$8m%aYm&e m'[0m(+8fcpum*@fsspm+ \HP*][+`m6[m75m8RZm:RZ(m;+Hm<[Pm=Xm>\][me \mf] sdamg`]mh/$mie][XxmDP]mE[mFP]mH mI5(mJ5HmK5PmL+pmM+xmN+mO+mP+mQ+mR+mS+mTmU+mV5mWJmY m\+m]+m^Ym_ \p[`]+rZ\n o3]]]]+]o6]o7w]o8]o90oA^oBXoC](p%^po.po.p"V^p#5p$p%p'z^p(p)p+^p,p-p!^p&%^p*V^p.z^ p^^ opsp^^ ^^p27_p4+p6]p7] %]_@`_%]_H__p__q`__r_s_ _&_____+_`B_e_+Y_(` __@_`___+_+_+ _ (_,_`09rcu_e8_`H(`^_`_ id_``K+_a_ a a(qRaqR$qNqq r arXr& r)X ldtr*a8r.+@r95Hr:hr;bpr= xrC&|rD~ as bss+ alts+s+s+ s+(s0s8s@sHsPsXs`shspsxss s! ab rFRa&\4c^ `]Xgc,lruY cdeicj +k+&(Rc4chIgcs+ &(udz+ pp{d|+}+~P* d&$d+&Hdd tdts reft8tJHtyht]lt+p opst {xtt`HdY(Qd c c d $dbe!e] ` :eval+6!eMMneN P]CJeplruK GeCWeX Y:eM@GfI+neUIV + e([ 0\ 4^+8Z@F9f eLjJM(mfn+o+q r s t v] Z@lf 9fLzJM0}#g~++     (M Xg++Z@|{g f #gLJJDg1f1f@1Xg6+ gJ h d 5 q  ΜI  A{(]0]4L8)@ P p  x#p$ % 'u10g5hctx6h h=i>X@?(X/iYX(\ib+h+t7w }$Mi++Zi iLeCigg jRrb56+i jubkuc uh ujuk3uqV us(uto0uu8uw@u{Hu~PuXu`uhupu-x &jkh/ibkXcid @@ }k ` k+ R@@o1bk@ZX@+P+X+`+h+ppgd  !x) 5 ?oE+L]S ZR$]P*_a5pXr+++++ +(+0+8?@5D+H+P'+X3+`+h*brk+p!+x++%+0+oo@oc+h5poxoh&o++  `P*aYo++P* }k)k+o+3ao+ o o;V o o+oK+6 ]Eppu/pu7p(pmdu9 !0pudu; "8@uEEHuFEPpteuL !XptluPJT`uT 8h:]p @ccccc3v63v93v<3vG%]w}cq%]wq    %]ws        !"#$%&'()*+,-./08tst+t2t2t+t+ t+(t0 sWs@@xsxx sysyy  syBTtyDTtyEYtyFhtyGwtyHtyIss ^tct mtrtz,tz- 5z/ ez0|t&yAttyK y:ty@s tyN uyO+yPyQ (y+nuy,y-y.y/ tt 0puqhr s ߘt u v&$(nu u{"u{#$v{&$v{'$v{' )vu$v&|Rv|5| Y|lvb| .v|v1Rv&}3v}4D len}4D}2v v}6X}1vv}8 v}iw}j}kwW~}r:w}s#}tub}ue}Rx}T]}UE@}Vu}Wx}Xv }YA{0}[F{8}_"|`}`h}a+p}bxB}dlvv}m#}n9d_u}v w :w:w)x{A{| k}~ @ @] ! (I0 8+@^H _L P X ` hDpDtDxD|5 MDX++# && 0@H P T X \n`h7Hp8nH P(X(`2h pxV{+'@} |}}}6}^}r }(} 0} 8} @} ɀH}VP}tX}` V{ |)@ _+  (!f0!k8p@"H+P+X+`xhXp &#$Ţu  Ϣ h ٢ #] (7` D!D"/ 0 14 6]<5 BG@D"|HFłPIP*XL`O dRYhSpZoxaقbق_rcucedaYf5k07n5@@oHq5Xr`|%]}x],,1xvY,]GYv;r,cxwxxA{ɀx ~E~Fx~G~H~I$΀)Q mnt  x )ooQ[xxy "#e nid&-+4+7RRSςUςXYZ ]c 9 dJ(9rcueeHgXj` idmpptqGxrxuԂ+łłʂP*03'4678  xa9|t  \ " $5@@- lru/'0P* \X2 nrX3 nsX45ă+ӃK+ valX Ӄ%]   X 3+  [ [[l9rcu[me[n9[o &[v[x&[y U[u ,x[+([rh[t+[r[w[G hho [[[ |+ [ÅȅMMm[%[ key[M[rY[F[b[56[h[ [ &([[+[+[r[w[  ([Ά[ hM [[[ dC [[| Ά   9a+0P*8#@ uid @PP*X `$^$hZZ 9Z gidZ @K+YZZrcuZe+a@@EgEhR$ cpuEi]Ej]Ek] #El]#Em]#En]#Eo]#Ep]Er]EsEtEu]E{ 5 E|7(E} 50E~78BE+@@W5!g7@<+w=L+?8\\ \! \"+\#X\#X \$+(\$+0\'݉\(X\)X\0\1 \2 \3 \C-\D݉\LU\M\NU-8\Q\R \S-\TJZ+pJ+  9؊+ ؊ 0JWBe ` 9rss !08W@ X  fn \2 arg |Ћ+ b Ћ  D]S]T]UY]W@]X#b]Ye8]I q]J ioc]KQ1 ]\]0 @  val  ӌ val  <i#n+v8_`P*ab#c #d 9rcuee reff0ߌ# v + %:]T ++ qn% M. d0  4M 45]67Ύ+ ĎɎ|+ @ ' @ ӌP] k  (8 hHГ(\)#*+ ,0-5@. 5`/ d0h1p2 x3+4   val \ h%]6 BE,uidF @,gidG @H D JH      ( 0 8 @HV+ ](], 0 8@ V![&V@8ڒ9:;<= >(?0@%8 [ߒ   XDӓEFG HI J(K0N 8O3@QLHS%P *ؓA{.A{.LA{8xY@Z[X\X]X^X _X(`X0aN8cN@dHeLfXPgXXhX`iNhjp8ە]]]] ]]]ino  M( M0]@+ ]]] ]]]]X>azz (0ޗ8@HzP aoCz]fQޗ ŗەڒy8 \ ] X \0 lH*ops!| A{l+|++Cw} ʘ ʘߘuϘ .Le ~ ʚ(0 8 /@ HH XP qX`h ƛp x+ ;T $E$) GhG{g3eI$Q~IGj ŚhI]ŚXGhI]]GϚAIA/GHGe4XGMquu]IGGvGƛGG˛IGh&! A;h0Tuu@ Cd]ZLeCΜ!Μ ޜ(ޜA{ӜC"{R~  ]h~[&@ ops ΜHP dev_`]d" )@Z[\]ƪ^` b*(dH0ea8f@hHjaPkϫXm`ohpLpr jxsuvجy{}<d}     # -(h 5pidpJ4uid @@ $   +]] ]] C 05 XZ )pL*e+1,-76P)0Р  8РgJ+2a ޜ ޜ & :( ޜ0 J8@cHwPcXw`hp JxѮѮѮѮ  !: S S J aӓ> uz    p ʢ Ԣa@   )         ]$](],]0 ]4#G8$@'"H*#P-]X0]\5`6 h<p=.x?L@yBDFHJLyNPyRULWLY[ )\G]G^G_```a` bL(ct0d )8e )@jtHk )PqXs]`vxxz|[&_dev}~X*dbg@aaa[ޢ Q+QϦ+$6ܦ  GX]9 Ϧpos 6 ]_hFhsdhGsçuç]ȧ h ҧGh 'h]+@h!,YA{hErhz^hwhѨhѨ֨ +h++++T0{Rhs] Xhs{R]5{h{X ]h©©hǩ hh]ѩ&hh]??]D +g?ç]NxA{x]lGxA{ƪA{A{˪x*A{xkHxA{x/aA{xMA{xGfA{xkϫA{xk_A{xA{x]ԫx'GoGD]@V$jxQA{XX oA{جA{xh]kA{hkݬx<xZxZ_ A}xZi mt ZX +A{:]A{ A{&A{$:A{+J?cŭOwhx |!Ѯ©x֮!G55A{&Sʂ?ggl X v{xG'$+@@kAGBCpD Ee( sdFc0GX82I]2J]2K]2L]2M]  * 5 . D^^    6°ΰ ڰ +o6 rev+ cc  cG9rb56 ns0]8< k>@ idX` hp9rcuex  opst!~ cho "$ մ% & (( +02 89@: +H= DP@]XA {` o y ,dirBh  knch© 5 5@`h x    @  A %k©մ©s©sڴ©+ GD0]!I{b%]0'() s* +',1 - \2( W" W,-^-G- k-m-n -o&*X-0-16-2 -3 -4 -5 Ϸ(-7 0-9 Ϸ8-; @-= $H-?GP %4 /kRpR69kup/\p/zRWIϷhp%hp/Է$hp/Ghp/!)-w- -  LpR|pRG` 5 X0t`u uvzw!x*y z й( `upjwY+kйssX }'~'7fbufG 7+G+?QXz+ X G غغչĺ ݺGg('Eg'FG mod'G[& ops'H!C'I 0'J'K q'L,arg'M ,str'N,arr'O>'V'W]'X  '\9 max'^]'_] num'`! ops'a!C'b 9'0(dB)dg56u+ +Ҽ ] ! ҼYQ+7`-5. mod/[&@0pH mp1:P2JX 585667 9 ; < (= 0?Gý[&G [&[&:]>IJ8EumodF[&8GHJPp˾qrst]RmtnwI  ]6 ?#guF+(˾ P ZU \U }s $u(+++++ 0$9rcu1e2X3$3K+ HIJK LM+No )c@pHGPXbuso`h p x5p8 *msi(8@XHXPX `hx " _*idD5 K!!# $,%6'#;)F+ `, a- b. c/ d9 e< f :; <h  !"# $(%0&8'@(H)P*X+`,h-p.x/012345 :U::]ljHxy 5z]|]}5~0@ )8$  $ !$ "$ #$ $$ %$ &$ '$ ($ )D5 J &@ @ A B C D E87PXaYW0  ]                ]:  XXXX5  J(*qosT0+&,G id-./5 00(1802+X3 5`4 5h5 5p6 5x7 58+9+:+;+<+ dev=2> 2?  +jJ5: Oops   ]M NGOGP!Q!R! T.(UL0V8W @X HY P[X\`^eh_paxcd  pmfjh "")`)aG busbod[&eGg h$jW(k0m8n @oHp PqeXr`s!ht!p pmvjxw  py 'GGغc3eQ `23G5!6!8L9 ; ; P(< 0>8@(@AdHC ~P pmEjX t6G6k"KK@dGU~Gssi0XYGZ![L\ ^  pm`j( %]- ȥR Y@ R  idM cls \ 'G6ss]]+:]F:]p8 0!s" :]1(:]BL:]Opcd&e2(f4Lg lidh Y3  X {cma 01G2 3G46\X7\`8h9p:x>+?@/0" ops1" dev456(78  ' 1p +Qi+Xy+ iQ+%] getd put t  ( 08@-H-PAXZ`shpZxAd QR] idS]TPfUg"h]i."d"Ut"iyGGG]G`&G-"A2"Z"F"sG_GG]] x"] "  D \ \f  12345  ) len )! )$^% )& '  (& +,]-].]HFG] lenH I J K  L (M 0N 8O@^\H]D^Djp ecckm H u ; 66"[x(XXD H55 2]p)sX)L3tstQs~skYt+s)G).`Lte%]tEtNtT tZte$ Eop$d++}t&tQt)tQ^+`K+t{t^+ -M(u0vmau1!u2 eu3 +u4+u5+ Cu>u? u@ !!+ 3!$V!+++8oop][op++t+!!+G!!RRRR!+&E-!+%]v     %] x      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu  + ]]  Y]]e]e]"Pcdefg hij k$l(m,n0oG8p_@ devqHX~ sgx+? _cd ;e ;f ;g | h | i /j ӎk |l crcm ;|,+~ Lrb 56   ~9u , ec   {vol | }~X e  <   +LX  Z Z   j+)X JpRdev K L"*ubi MX N` Od Ph Ql Rp St Tx V| W X Y Z [  \ ] ^ _Y a$ b( c 0 d 8 e@ gH h]" i]" j]" k]" l]" m]" n]") , -"Rdev .h /X 0~\ 1h 2 p 3 5x 4| 5 6 8 9 : ; < > ? @ A B5 D F I J 5 Ko6 L5 O*fm P Q  R,  SX8 TX` U V  WaY X Y Z [ \ _o6 `o6 ao6 b co6*pq d# e f 5 g5 hX i j3 k l m n o  p( q0 r84 u H vP wT xX y\ z` {d |h }l ~p t x |      ] ] *mtd   5 5 ]*dbg  pp jx  $ ]$ ]$ ]$ ]$ ]$ ]$ ] ] ] ]  ] U x  x( x0 x8 x@ xH xP xX x` xh xp+3+ QH+ q 45q 5&]h$ h; h_ hߢ ' 'T 'y ' ' '2 '^ ' ' ' ' ' '3 U '^ 'k io((]]( D]io^(]( tz( ( u( ( |( yLL( wj( N o() oGD]i:G]$8$DGi^GG;(2e(8e(?eN 3Grjj [&N /GrNd -W( aINd [W(r( [&N&&Grj ( <g#Hnbg;][ U  TUG\\nbG9]4H serrJ<&H4&& &,!ubi(!err) UUz Us Tv Q| Us [  !ubi=;"HOUcu UU Us<s+5!vol>"sDM% .;"$+E$ 4@5?LF U  T  Xs ^ Uv TsX+ <)3!vol!ubi>"?DM% .;"+E$ 4@5?LF U  T  Xs= ^ U| Ts[ QT R0 X0 Y0X+ <+5!vol!ubi>"?DM% .;"+E$ 4@5?LF U  T  Xs= [ QT<ll+l5!voln!ubio!errp>"DrM% .b;r"+rE$ r4@5?LFr U  T  Xs=wR v U} T| Qs[z QT<CC,C6HbufCHHlenD !volF!ubiG+H>"5DJM% .;J"+JE$ J4@5?LFJ U  T  X~ Yv=Rv [ QT XRX+ <:+5HbufG Hlen!vol!ubi+>"kDM% .;"+E$ 4@5?LF U  T  R} X~ Yv= % [ QT XR YX<M-7HsglML Hlen !vol!ubi!err+ >y"DM% .;"`+E$ 4@5?LF U  T  Rs X~ Yvg Tv Q| RsU# U T Q Rv X| Ys U T  Q~<*4Hbuf@IHlen!vol!ubi!err+ >"8DM% .};"+E$ 4@5?LF U  T  Rs X~ Yvgf Tv Q| RsUQ U T Qv R X| Ys U T  Q~X+ S K4:4D4 \lensvolsubitZ} Z/!vol\!ubi]> " D_M% .;_"M +_E$ _4@5?LF_ U  T =?b Ll U}=$r& 1Z U}>  UvV  Usn  U|X + } <E E:GEH+G'G X'G\> " DIM% .T ;I" +IE$ I4@5?LFI U  T  Rs Xv=P =  a  Us TX Q\*{  QTP X + <" "%G"4!"B!+$'%)~'&@V~U  UU T1 Q~~  U~ T~ Q1 R0  U~PP T0TEGT Qi] QlenQubiQret>%"aM% .@"]$4@5?L U  T  R| Xv Y.)!volD Uv~"5OOGGGG,G:HGIGXGgGvG$ Uv T U2 T Q0=?kLl U@$ 1Z U@Z U@ U|* U| Ts Q UX%+ sATs-Ts:TsFQerru]vQubiwQvolx>yuuu"zM% .@@z"]z$z4@5?Lz U  T  Rs Xv Y|.] A]  O=  T Q@k?9Ll Uk$ 1Z U$1Z Uk  UsPr- U~^ U T  Qs Rvv U[ U}I Us- U Tv UsP U T  Qv, UsK U~4ZZ2Uvi[]CUubiC0UvolCHUviD .|T.di.>Qubi0k;7 UUPUubi0UdiMS f\vol f54 f>S;\err%vc\mtd.tS \mtd@S|.4|D4|PeVt]S%]4<4V;Sz0$4zCe4zX+v?45JTv]Z4]3JTN'lSN~S"UpALwTAAret /__pAAVA/@/@/,@/:@/H@V/X@d/g@d/v@d/@dV@dx'#w'0x,,$VA1 /A1 /A1 /A1 &/A1 DVA1 Xx"VUkey"J[w"Z( VlI^U^Tl#]g6BOO=# GEB6OPI-7 U|PD U  T|l~^T ^RO%O1O=l ^U^TDmF++G+SFLFXpFFFFintX,F*FXs8dXu8w Xs16Xu16!Xs320Xu32Xs64Xu64^X u "F+1X2XHIX]^_`LFF%')<X ?Z  #F%&*+4=BUh0l n?qS} I S S S X X S# # I  /W WW\/WLq++ q"^Xf                    4+W70   S+   !( *=-@ G3XX  7( X,!X0( 4)38*XH++P,X5 `6 d8 h: l; p< t=XxWse?lG@>rt@HldlAkIBfIFKLI7J+KXOKXK]KL`"E@dhXkX l+m nL oL(pj(0q Xs`ubx dyKhzp{L+      K D%;(L7P>mm h pMx    +X X, X, X, X- X- X- X- X- X- X- X- X- X - X - X - X -"X -+*>pid ~ ~+ (0@MPMX "M%_ (_ + - S. S3 S4C6VD: (=+0>+8A S@D SHG+PH+XKB`LNBTOWOZO^Pk 3m Pp: q ;(t+8u+@>fsxPH{!PP~+PX5P`Sh Tp =x = =]A+ X#T CX=A S  S [4 " K Y8( 8 -T@  H 7TP ATX KT` Th Tp +x T #B X  S  S  S '7 6  T   ?  ? "T )'U    1U0  58  XX 6U\ KU` 5h  UU       !X "X # $+ & S ' S ( S L)q 3_U Ca% D+ LdU N+ RtU S?( T?, Y+0 ] 8 ^ < _ @ ` D LaqH d7X g~U iN7 lU w x z+ } ~U  S S  a%  +XUUU+V X(X,K0lrcuq07@ DH<PVx7  "V VV  S >Lq !"3$"3L.q<VLF@@!@0u?pad! +? @)@  "!0 key"0!?PA+BUCZ P =>"...dH  G   "   \(  %0 8 @ "H "H "H H "H "H "H "H=@|zPhYGG X5>kp X(X,0 8@ABXD HPlmem@B+ Xp (0X8@XHXL PXX`Xhp 9xXX%X,XXa% X!a%"X%&Z9X:6?AD F P @ QX(T%0!ef+g9hC u9v0w0 keyx > UiV j$keykHn$keyoH0 ; <=4? X 4@ X$4A X(4B X+  B C! D!4 E! 4 E!(Cs E!,Cdpl E!-Cp E'!/4 F!0Cavl F!4Cl F!5Cd F!6Cg F%!74 F+!8!+!+!+!+!+#!  pte!!"#! ; pmd!!"$"%d"%%M"%/Gm"' $pgd"'M"'"qm"p $pud"pM"p"M"+@#H#I+Gcc0# 4#+8=@@$Z $3$sp$+$es$ $ds$"$$$&$+($+0$#38$+X$+`$cr2$+h$+p$+x$B3$+$X$?$+$+$ 2Wfpu$ a2@X (%  % Z( =@@# Gj@#n@; T#!Gh# # dh #(#,#h0N#h8#X#hh#%ip#+x#g# #i#{(#UU#i#g7&!& & 7&"&!&!!&6"?val& 0!0! &J""&,6"7'z"' 'z" "+!'"' 0V" ' ""'J"'"((  )")J")" *r#*"*** **X*+,+#$fmt+G+G+G+X+G+G$r#,6#,7n,8+8,y$,G,G,G,GH,XH,XH,4X key,9#(@X,=$    8,U %,V mod,W %,XG,Y% ,Z (,[ ,,\y$0G ,uW%,vW%,w\%,xX,yX#$+Lv%+ -/%-1X set-3 get-5*-7 !4v%' %K q   ( 0ߤ8!@" H# 9P$ 9X%R`&kh'p(kx)*ť+,-./ B0 j1 M23 5 ަ9 ; 8>?[@y% .!'.% .+ .-./ @X3Z(           +j(+% ;d j( {( 0/c(/dG/e/g/i س/lݳ ((.0 .0 @X1%)  #(1})1}) val1 ?1!? 1"?1#S1$}) ?!1*)1+&)1,#) 2)22 ) 3)31X3 0)#1'5*1(1)))1.S# 11*12*1314 15+16+ *!(1*1%%)1/)175* 81*1+ fn1 ******++ 6<+6S end6S 7;r+Ccs7=SCsl7?SCwfe7AS 7E ,Css7GSCsti7IS47KSCnmi7MS47PS 47SS047VS8Clm7XS947]S:47dS<!77,?cs7!?csx7S7<+!7d,?ss7!?ssx7S7r+ 7gj- r157m+ r147n+ r137o+ r127p+ bp7q+ bx7r+( r117u+0 r107v+8 r97w+@ r87x+H ax7y+P cx7z+X dx7{+` si7|+h di7}+p7+x ip7+ ,7+ sp7+7, 8 -8 8 -d, p9. cwd9? swd9? twd9? fip9? fcs9? foo9? fos9?9.9?l?*.+79*N. rip9+S rdp9,S79.. fip9/? fcs90? foo91? fos92? !9).0*.0N.!09@.9A.9B.?.+ n9$e/ cwd9%! swd9&! twd9'! fop9(!.95?96?99e/ 9<u/9>..?u/+?/+? 9Qb0 cwd9R? swd9S? twd9T? fip9U? fcs9V? foo9W? fos9X?9Z.9[ l9\ m9] n9^ o rm9_ p9` q9ab0x9b?j- w0+S0+@9:09; S9< S9= 0S0+=@@9O 1N9P.9Q09R 1@ 1Y+@9^q1/9_-Z9`./9a/Z9b0@/9cq1 1+=@@9f(29hX9kX9nS9qS$xfd9tS9wX9zX9X9XN91@@9a29 S9X9X fpu@929X9+92929(2 9(20N91@@1 : 3: S:SL3+ #3+3333+83 =3 ;>3;?+;@+;A? cpu;C? <83<93 <<3<=33!=<3==X=>  =:!4=;33 src=A! dst=A !&4"14!>G4>" >[414>G4#? ~4?"?"g4."...!.%.'.,./[4.3.5.9.<.A.D.H.L.Q.U.Y @#5@$[4@%@' 5 A 5A  B)/6B*{(B+" osqB-5 B/AC5ACAC D!v6D" XD&[6 DD6DDv6DD6 DE6DEv6DE6#DT 6DY6DZ [4D[6#E 7E7+'7+E87 (FN7F d G$7G%G'G( 0GD7GM#37GP(GW) H7H H7 I7I 7+J/8J+J48J4877 J T8J 4898 J8J98J48.KL L"8!L8L[4L8 L88LXL ( 0D9 1{( 7{( osq 95 ;" <A 8A A A A  M+9M,"M- N9NXN9O O :O 9O+ P]:PXPXPGPGPG Q:QSQS+(Q:IctQ:Q&: ]:@XR:     S;S ; ; T %;T (U Z;U U U+ V;UV 7V < V ;VY8@XW ; +@W'2<UW(Z;W) < W*F<(W+<0W, 8W- 9W. :W/ ;;A<A<;2<+@@X/<X0X1XX2  seqX36X4A<X5; X60X7 <8K< (Y=Y /Y+Y =Y? "==<= ZR=ZZ ZW= R= [+=[,[- x\=\=\X`\+h max\+p+=+ #] = sig]7]=^Ru^S>=^U^V.>>_Z>_ _ _ 3>#_'>_(_)#_->_._/_0 Z>_1#_5>_6_7_8 Z># _<D?_=_>_?_@_A#_Su?_T f%_U_V# _Y?_Z f%_[ #_^?__+_` _a !_J@_L_Q _WD?_\u?_b?# _E-@_F?#_gQ@_h _fd_i#_m@_n_o_pX  _%@_*f>_2>?_rt_9>_B>_d@_j-@_qQ@@+70` 3A` ` ` ` @ 0` GA@`3A SA ` A`!`" = `%A`'>`(+`.">`0 = `3A sa`4A a #Ba a + lena +a  8b BbSbSbSbSbS b#S(b,S0 c)Bc*Sc+; Pc8Bc9Bc:XHc;XLBB++8cD/CUcEqcF5cGX0+ d>CdKdZdpddd enddCLCY+#e C valee C#e C vale e CS&DU SV SW"OX[VD    0hDiv6jk&D$cpulXmSnS oS( E+9E+ ?T@@E S S S ? ?+ +(+0X8=@lG S S S S S  S( S0 S8 I@ SH SP IX I` Sh Sp Sx  S  S  S  S S S S S S S S S S=@HEN 7! S(" S0# S8%@&P'Q(R)S, SX- S`. Sh/ Sp0 Ix1 S3 S6 7H9H;H=+WavgG9E@lG H0K@ILM+N+OX P$Q&S@I(HM]RIWIfIfIkIT`JNa7h Si S j S(k S0l S8s I@t SHuXPXXXXXXXXN;XN;$rqJEIJfIM^JJJfIrqJDK2X 2X 2X2XmK    KbDKs?KKK KK KJL+v(j(  LTM,w8 l@ D HY8P+` +h)kp+x z[48 Lpidpf7Mf9 7f:Xf; [4f<t inof=Sf?0 f@@fB5HIrcufCq`fD@p M/M+9+goOgp{( uidgq C gidgr C gs Cgt Cgu Cgv Cgw C gx C$gy X(gzf0g{f8g|f@g}fHg~fPgXgP`gPhgPpgPxg ggngXAgGzMOkeyhPh7hGh semh8(hPh X΃`h 9h uidh Cp gidh Cth)xh|h~h h+;}hO P P P &P 0PnXi^Si_7i` iaib icie5 ih8ik]A@inXiq`isdithiwpixXtizxHiXHiXiXiiUi;i < itiiiBi-hi iMixttyiBiLi 6iSi SiSiSiSiSiCi+i+i+i'+i+ i+(i"+0i,+8i+@i+Hi"+Pi,+Xi+`i+hi#BpiiQiՆifi Xipiiii i5i80:Pe iTi[4i7i5iņ S T (T 2T 0m?80V V V V VV n$Wnnn n ZWn!n" 4n$X Hn'Wn(G keyn)n*Wn+ n,(n-0n. W8 extn/W@_V$Wn3+ n8,X tpn9,Xn: n;?n<?ZW30o IXNX"YXYX^X oXo{(oo=X XpqXpr^Xps< wqpvXH cpupwP X xq?Yqq?YqOY( lenq{(Hq_YPq pXOY++_Y+oY+n@rJZrJZrJZr Ur[4@@r XHr!+r"+r#r$<r%^Xr&q r'Z0r(+8xcpur*@xsspr+ [H{(ZZ+ `r6Zr7[4r8OYr:OY(r;+Hr<ZPr=Xr>\ZZ re [rfX sdarg]\rh"rib\ZexrDM\rEZrFM\rH rI5(rJ[4HrK5PrL+prM+xrN+rO+rP+rQ+rR+rS+rTrU+rV5rW9rY r\+r]+r^Xr_ [pZ]\+oY[.st3\\\\+\ t6\t7u\t8\t9!u\ug0ug0#u",]u#0u$ u% #u'P]u( u) #u+t]u, u- !u!]u&\u*,]u.P] u]\ opsu]t] ]] u2 ^u4+u6Xu7X @Xl@6^   @XlH_^    lp^lq6^lrls^ ^7l^l]l+l^Ulql+fl^0^^+@l_l_^l+l+l+ l (l,l_0Irculq8l_H^] l_l idl__Y+ l_l_ _ (v(`v"vIvv #w `wSw& w)8 ldtw*`8w.+@w95Hw:hw;apw= xwC!|wD~ ` x axx+ altx+x+x+ x+(x0x8x@xHxPxXx`xhxpxxxx x!`awF(`7#\ b#^ #`X!#X=b?lru#Y0a#d#e!#i_b#j +#k+7(#Rb b#hM=b#s+ 7(#ub#z+ pp#{b#|+#}+#~{( b7#b#+7#c#c#  ycyp refyp8y9HyhyXly+p opsy xyycf(#Qc0_b0b0b0bo#q!#c#X# m# d$val#+M#c[#MDd#N #PXV#Jbdlru#K0dV#Wd/#X /#Yd[@#Gd#I+Dd#UM#V + bd(#[ 0#\ 4#^+8g@#Fe0dZ#j[(#m}e#n+#o+#q #r #s #t #vX g@#le0eZ#z[0#}e#~+#+# # #  # ([ #/f#+#+#g@#|Rf0e0eZ#T#DvfGdG}e@G/fM#+vfT g  [4 x  M  ,w(X0X4O8}@P p  x#$ z% z'GBf#5g$ctx#6g g#=g#>7#@C(#Xh#Y8(#\[h#b+#h+#t7#w #}$[#h#+#+g#h0[hZ#qV#h/#f/#vf #hWrb#7#+g h bi c v h v j k q  sp( t0 u8 w@ {pH ~pP 9X M` fh p xhigh#9j#S$cid## @@# Tj# m #j##+# U@@#gnG9j@#8@#+P#+X#+`#+h#+p$pgd#  x#) #5 #?gn#E+#LX#S #Z"#]{(#_#a[4#p8#r##+#+#+#+##+ #+(#+0#+8#v6@#[4D#+H#+P#'+X#3+`#+h>brk#+p#!+x#+#+#%+#0+#ln#|n@#n#a#+h#[4p#nx##n#g#&n#+#+## # #_#{(#^X#n#+#+#{(# Tjj+|n+3_n+ n n n n n+nY+M# Xnp /ooA 7oo($pmd 9 0$pud ; !8F@ EH FP$pte L X$ptl P4` T hOX#o      @ pppppAz6Az9Az<AzG 8yqpy+y2y2y+y+ y+(y0 qpd{p{<p"ppp {ip{n+{v9q+8{_4q{`{({a4q{b4q4{c 4{d Ircu{eq ref{fp0pp# Sq v +%>qOXTq    q qq++ nq |"q|# r |& r|' r|' rq r7}:r}[4} f}Tro}0r+}irG:r7~3r~4? len~4?!~2r0ir~6S ~1rr~8ir!~ir~j~kr5~r#s~s/~tqo~uq+~Rs~TX~U6~Vq~Wt~Xr ~Y,w0~[1w8~_"w`~`{h~a+p~bxU~dTrr~m/~nId_u~vr#s#s=x{,w| r}~ C CX ! {(M0 8+@pH fL P 9X 9` 9h?p?t?x?|[4 h T?8++/!! 0@H P T X \`&hLLp8H P(0X:`Dh ptAw+'+@~w~{~{~!|~I|~]| ~q|(~ |0~ |8~ |@~ |H~A}P~_}X~x}`Aww=@{ f+  (!x0!}8@"H+P+X+`th8p &#ß$ҟןq   g  /X Ĕ(L` ?99!?"/ 0 n1 4 ѣ6X<5 BG@D"wHFPI{(XL`O zdRXhSpZnxaUbUlrcucqd^Xf5k0Ln[4@@oHq[4Xr`x@X~{ {tX{|||sr|D||XGD|r&|]||N|q|tb|"|tv|"|t,w||t| E|FtG{HI } }}|} <} mnt  } t}|Z}Z}<}F}tx}t{d} ~? rX $ SS ino)S dev* f(+ f, uid, C0 gid- C4. 8/9@09P19`29p3S4S5?6?7S8S9?:?;? "#l nid&-+4+7U+RS U XYZ Xc 7 d9(IrcueqHgXj` idmpptqGxrtu+~{(,P- [4/ l0 034678  xa9 ؀ " $[4+@@- lru/0{( ؀ f2+ nrf3 nsf4+:@+OY+# f valSO@X   ʁ ACC + h h$+hljIrcuhmqhn7ho 7hvhx!hy a!hu0j?xh+ (hrht+hhhG 5 h*hh /?+hKPnPnsP* hh? keyhPhfh΃hoh7!hh 9h 97(h;h+h+hhh  !(hVh0[ h}hh V h/h0V  x 6 7_+0{(8/@ uid CP{(X `$ #h gkg 7g gidg kCzY+fggrcugq6n@@XgXh" cpuXiXXjXXkX 4XlX4XmX4XnX4XoX4XpXXrXXsXtXuXX{ < X|A<(X} <0X~A<8UX@@d<yK<@ņ+AՆ+? 8i>i i! i"+i#Si#S i$+(i$+0 i'fi(Si)S i0i1 i2 i3  iCiDf iLއiMiNއ 8iQiR iSiT9>-+M=+ = G\=a+ a k +0ӈ5Uq +` "Irss Z 0u85@ X  I fn !4 arg wY+# n bIY ?!jSjTjUqfjWɉjX/ojYq+8jI qjJ iocjKTG j\X0  ɉ # 9 val"# \ valE@     #. 0 4 45X67+  w3+80pqgr s t u v!$K(!Ë C 9! C \ P^X rË  99(98 gHcЕ()/*+ ,0-5@. [4`/ d0{h1p2 x3+4Ǎ# = val &@X6l  B!E?uidF C?gidG CH = DǍxJI HJ l l l l l  l( l0 98 9@ H͎+ X(X, l0 l8@ ! %͎@89:;<=ŏ >ŏ(?ŏ0@8{ŏ^ޏ{ޏʏXDEŏFG HŏIŏ Jŏ(K0N Ӑ8O@Q HSP^{"^ΐΐ,wl,w=ؐ ,wΐxYZ[S\S]S^S _S(`S0aI8cI@dHeLfSPgSXhS`iIhjp8XXXX XXX$ino  T( T0ĒXĒԒ+ SXXX XXXXX88 [(~08~@H8PS{Z}8{X$V{VԒ=y{y`{ޏy{8  X 8 0 +H>ops!; ,w++J;+K+Vwp/}u/ pz"3ʖ $ = W (0 ԗ8 @ H P X`h ؘp x= Mf ϖgRf$M=M)"MMR BgMX8\gMXXHԗMH"ٗl" 0305 (+, -./ { Mrؘ"ݘM..g83 H"MgBf30RʖV/_/Xg/ZqV/!/ '",wV4/~U// / X hʬ %@ ops HP devf`Xd4 =@Z [\]ا^` b<(dZ0es8f@hHjsPkXm`o1hp^pr |xsu©vy {+}NvҪ  ! + 5 ?(g ~4$pidM:$uid CC $  +XX XX V B/5/ Sg )Z*q/+3/,/-SqIMP=0  Nyӈ+s    8 L( 0 \8@uHPuX`hʫp \x  3L e e \s     ȟ͟ ܟ n@  $ 0 $ $  $  $  $ X$X(X,X0 X4#G8$@'"CH*#HP-XX0X\5`6 Mh<kp=x?@BDF8H8J`LN`PRUWY[ \]^_`a b(c0d 8e @jHk PqXs\`vxxz| %ldev}+~7>dbg  Lѣ+L+$MGSX K $pos M XqgXg܁vgG܁դ3դXڤ gNg 9gX+ Rg >k,wgWgpgťgg ʥ+g++++VB~Ug܁Xjg܁~UXGg8 og"ԦԦg٦ Ħ ggX8ggXQQXV =yQդX`t,wtX~Gt,w"ا,w,wݧt<,wtrZt,wtAs,wt_,wtGx,wtr,wtrf,wt,wtX,t,YZ}Y?X}}6|tc,wSS ©,w,wtgXrǩ ,wgr+tNt0ltlq Stl{ $mt 8 +ͪͪ,wOX   ,w {",w8,w$L,w="\{Qu{תa{zt ʫ{_ Ԧtϫ {3{GGG,w^8e{Qyy~ j tG"ʬ+ @@}AGBCDD E( sdF0G78HIXHJXHKXHLXHMXʬʬ ɭ+98έ rev+ ɭ +  GIrb7 ns0X8< r>ȯ@ idS` hpIrcuqx  ops!ï hذ "$ % 8 & M(( p02 89@: pH= P@XA ` ! ?dirӭ  İ kngԦ 5 5@`h x    @  A %iӰӰİ"ӰݰԦԦ܁8Ԧ܁"MԦ=pӰRNӰuӰ Ӱ@X   0'D(ű) p* N+l,v - !4(dIbbg Sdq //G/ r!/mŲ/ne/o&oX/0`/1{/2 /3 /4 /5 (/7 A0/9 8/; A@/= iH/?PŲjŲy`tr{~rtسtdMgjAgtigtFgt n// ڴ/ ڴGߴ `D [4ʬ -X 0tu vw!ĵx*y z (I"ɵ(ݵݵD}ε"e }l~l|xbuf |++?L+ Ӷ(ضG #Ӷ (+++++ +0Ircu1q2732ŷY+ H!I!JK LM+Nn +=ʬ&@$p'HGPuX$bus`h p x5Ni,1; >msi(J8O@SHSP^X c`hnx x f>id?[4 !!ĵ# $%'#)+ `, a- b. c/ d9 e< f+ :;<r  !"# $(%0&8'@(H)P*X+`,h-p.x/012345!&w"&OU̼   OXl    Hx_y [4zX|X}5~0d@ _=82  2 !2 "2 #2 $2 %2 &2 '2 (2 )?[4 9 @ @ A B C D EN;PS^X5  X                X̼SSSS  (>qos0 +,G id-./[4 0(1<02+X3 <`4 <h5 <p6 <x7 <8+9+:+;+<+ dev=&H> H?  "&0 \$ops! l  "l&\&Xq MNGOGP!ĵQ!ĵR!ĵ T(U0V8W @X HY P[X\`^h_paxcd pmfh& `aG busbd %eGg hE$j(k0m8n @oHp PqXr`s!ĵht!ĵp pmvxw py &r `23G5!ĵ6!ĵ89 ; (< 0>8@(ݵ@AHC P pmEXr"" 0XpYGZ!ĵ[\ ;^ pm`(p+   !B6D6E;FJGYHPI @E OT7A{K !:@0^!NO+P Q * 0. ?kk )G (-E -FG mod-G % ops-H!-I +-J-K / *!-L]?arg-M ?str-N?arr-O -V-WX-X] -\ max-^X-_X num-`Z  ops-a!-b%+0( U) y7+  B+ w X _  wL+7 `-.ʬ mod/ %@0H mp1P2MX  85@6{7 c9 ; <(= 0YY^@Y^Gh" %G %" %OX>   T8E$modF %NGTPppqrstXWmtnw  X :y+'p  W [W " 1';r#@X-h  Ȫ @h  idI cls ;yXX+OX   OX   8 y0?!vp"D ?OX1      OXB  OXO  c"d&Ie2f4g $lidh "ŷ 6 @ES TY@cmah s 01G2 }3G46X7`8h9p:x>+?} @/{0 ops1"Q dev4&56(7 8  .w++L+S+L+@X   L get put   $( =0e8@HPX`hpx2Kdx L QRX idSXT{ PfghXiw0"$=G)eGXBG%jGGGGXX--VK7dXPxi ?   1V2345  0 len 0! 0 $% 0& $' $ (a% +,X-X.X HFGX lenH I J K  L $(M 0N 8O@ \]?^? j ecckm / i4n/ t ( SS? HC55 HXiffVRׁ8pׁׁ33[ׁ[=;+ׁe"0@XyE      yNLyT \yZpye"\Qnpnac++uy7yyy+Y+!yy+0L[( 0A$vma 1  2 l 3 + 4+ 5+ V >k/ ? / @ ;"v k +{  +++nnXnn+++ 9 +GM >f UURUU +a%k +  + X X   ` X X^X  e~O sgO_+?^X'w  ^Xb     @ 6 w  ec B 6 6 6  6<w-+@   6 w w w w 6 6   6 6 6 6  $ B( ,0 6<w,+w<+ cd 6e 6f 6g w h w i *j #k wl $crcm 6w+^Xi     ^XA       i hdri-rb7+ Iun ec+PIrb7 8(ea ea@qq+e + =XJWdevK+L4>ubiM*XN`OdPhQlRpStTxV|WXYZ[ \]^_a$b(c 0d 8e@gJHhX"iX"jX"kX"lX"mX"nX"=,%-4Wdev.+h/X0\1h2p3 [4x4|5689:;<>?@AB5DFIJ [4K98L5O>fmPQv Rv, S88T8`UV W^XXYZq[\_98`98a98bc98>pqdef [4g5h8ijkqlqmno p(q0r4u HvPwTxXy\z`{d|h}l~ptx|XX>mtd55\>dbgT 8J9/x2X2X2X2X2X2X2XXXX Xat t(t0t8t@tHtPtXt`thtpO+<+ qL+ rb7/T8$ec 2X2XWu T@- Wrb7 98898(8HX\`dhlptx |     0q$ech-A ,-_5#c*8CY <6G "83''Gh%_,48BB/8_.48]]T8P>~~_ Q9P_'WU8;:8C <6P2*8.]EGh8C W<6Pn*P*_<*P'88=<P8*_ ?X?i8+p'Gh8/'GhP*8( 48988 Q98' 488 r Q9G 8 !Q9PL*8 ^Q98 pQ98,W%Gh+_+GhP2lP8qlP? lqX)ubiX%*)aiXB(iZ(errZ Z(av[~(vol\O(aeb](rb^48r\J`# ;D``-f`ff%Df,f`pU T C&c" U~T Q D(tbljJ~~;;~fapes<ebX.xmXyXsY YsYY  U|\z3]]____@b&{LbXb UTs V UU T Q ]j#]^^^,^UsQXfaXfa\C\%R\`aHa.bU@ +^a-=,R.= ;= H= U= b=ao=,Rp=-bcM9rcccccc=mT~Q\Q{-\% \a?-a.bUJ'buf'len+SerrSidx **SvolO*3*1# ='vol#/O#8#B'buf$$'len$(%%*Subi'**(i*)Serr)*)*)+Scrc* ${aK {[=&?# &?" -=*B3*M*M*M*M*M3*M=*M*M*M3*M3*Mt?)ubi,*)volDO)sgl?55')len3(ret(sgK? >&# &" _ I?9__  +?9`-`  9 `,f ??UTQDX~Yv ?U T Q S?+?tPJ)ubiP)*)volPAO5PJ)bufQ5Q)lenQ#5Q,(errSS SSTUi(crcV $\K {w\iBJi# ;AiBi-f iff%Df,fipU T RXY@B&l# &l" 5Cmdm Cee!e3mUTQ  $ &Mf TbMUsT~Qv ^MU} LMU} !MUsT~QvRX03NUsT~Qvq#3Nvol+OU4TP)ubi1*5:5F(lePK N&# &" aOa.bU~XOX"X.X% :XcEX FXaOabOUU#zbUU#,f PUs( =PUsT} UPUs PU T Q 1| $Q'ubi|1*|:|FSle~PKP5 3&# &" 1f jQ'ubif.*f7fCSlehPMS)ubiM0*5M95ME(leOPK R&T# &T" aQORa.bU~XRRX"X.X% :XcEX FXaZSabSUU#zbUU#,fT LUSUs( tSUsT} SUs SU T Q T1< T'ubi<-*<6<BSle>P PX|ubiC*vvjlePjle1Pw%PK vUAw<```c`}`a  XUa aT @ QPU&" Uv(T Q V(pX48V* ;V&!# &!" a)vVa9aa,f! VUv VU T Q !a/Wa.bU~X2WX"X.X :XcEX FXa-WabU~ Us48E PbX:ubi@*6I6p483leP3]X:vol/O:tblJJY|vol,O|dstGJvjsrcJjiKY 9Y# " f YU T QSY+YY:tbl2JxJJ\|volx?Ovy jtbl{Jerr|tji}errN[Aw'0 'buf13*4b!_'av!A~'aeb"#1 _'sg 1E `:sg 81 .` E.`1S`'err%1 %` ; Gl1(`'nDNZl* 1|.a|D|Pl3*X1%X9a<31z0_qfazClzX+E Ia:sem I8Q9k;a6;1486;G486<Xba54b]a]341D(4bDC48'.b48@b4keb:new46Kkb:new1663EAb:newA@6B6CretE1r c'vr 'c(E##c:v#+c1 IAc'v %AcE Ibc:v AAc#d#:$%&'(cUcUcUcU dU]d dUB0dUB@dUBPdUB3UBldW{dWdWdWdW3dWBdWBdWBdWB3WBe:=eLe[ejeye3eBeBeBeB3BE3!e63<E A!f:ptr A<E 4!"f:ptr 4=E '#@f6 '0kqf62G6<6XkBf:vBIf6BSE"f:key"Jf6"Z(HfE,,Lg3]1 g]1 g]1 *g]1 !+8A S@D SHG+PH+XKhB`FNBTNWNZN^Ok 2mOp: q:(t+8u+@9fsxOH{OP~OXO`Sh Sp =x = =A+ XS rCX<A S  S A4 " aK 8( 8 S@  H SP SX S` xTh Tp +x T A X  S  S  S 6 6  T   ?  ? "T )T    T0  58  XX T\ T` 5h  U       !X "X # $+ & S ' S ( S F)` 3U CB% D+ LU N+ R&U S?( T?, Y+0 ] 8 ^ < _ @ ` D Fa`H dN7X g0U i7 l:U w x z+ } ~?U  S S  B%  +XTU^UhUU X(X,K0brcu`07@ DH|<PeVx7  "oV yVV  S >F` !"o3$"o3F.`<VFF@@@(^:pad! +? @)@   !0 key"0?9A+B>CC 9 =i> $$$]H  G   ") L  ( $0 8 @ "H "H "H QH "H "H "H "H8@[P#hGG] bX59kpg X(X,]0 b8@ABXD lHPbmemq@+ X (0X8@XHXLPXX`Xhp xXX$XXXB% X!B%"X%&C9X:?AD F P QX(T$0ef+gh) uv0w0 keyx $ UOV jq keyk.n keyo.0 ;<=*? X *@ X$*A X(*B X+ BC!D!*E! *E!(*\+,-./ ٧0 1 233 V5 u9 ; Ϩ>>?@%X"' %!'%% %+ %-%/ 4X3^(     +n(+ ;E n(&  0'c('dG'e3'gQ'i o'lt :(($( $( 4X)")()z))z) val) ?)!? )"?)#S)$z) ?)*))+&)),#) *)** ) +)+W+ 0))'2*)())()).S )1}*)2*)3)4 )5+)6+ }*()*)%"))/))72* 8)*)+ fn) ****** ,#+,S end,S -;Y+.v.?[/+?k/+? /QH0 cwd/R? swd/S? twd/T? fip/U? fcs/V? foo/W? fos/X?/Z./[ l/\ m/] n/^ o rm/_ p/` q/aH0x/b?Q- ]0+Sm0+@/:0/; S/< S/= 0S0+8@@/O0H/P./Qm0/R0@ 1V+@/^W1&/_~-W/`.&/ak/W/b0@&/cW1 i1+8@@/f2/hX/kX/nS/qS xfd/tS/wX/zX/X/XH/1@@/G2/ S/X/X fpu@/2/X/+/2/2/2 /20H/i1@@i1 0 20 S0SL2+ 3+33+3 #3 1>o31?+1@+1A? cpu1C? 283293 2<32=333<33=X3>  3:43;33 src3A! dst3A ! 444-44" 4A444-45 d45"5"M4$6$6$6$6!$6%$6'$6,$6/A4$63$65$69$6<$6A$6D$6H$6L$6Q$6U$6Y 7#57$A47%7' l5 8 58  9)59*(9+" osq9-5 9/C:ɢ5C:ʢC:ˢ ;!A6;" X;&&6 ;Dh6;DA6;DM6 ;E6;EA6;Et6;T 6;Y6;Z A4;[6< 6<6+6+<86 (=7= E >$N7>%>'>( 0>D7>M#6>P(>W) ?7? ?7 @7@ 7"A7A+A7A77 A 8A 7 AB8A7A7$BC C"O8C8CA4CT8 C8`8CXC (D09D1(D7( osqD95D;"D<CDCDCDCDCD E+h9E,"E- F9FXF@9G G 9G 9G" H:HXHXHGHGHG I;:ISIS"(Ib:IctI9I&b: :4XJ: K:K : : L :L (M ;M M M" N9;NN 7N < N T;N84XO q;"@O';NO(;O) < O*;(O+w<0O, 8O- 9O. :O/ ;T;;;q;;"@@P/w<P0<P1XP2  seqP3h6P4;P59; P6F0P7 <8< (Q<Q Q+Q <Q? <<|<< R=RR R = = S+:=S,S- xT|=T|=TX`T+h maxT+p+=+ U = sigU6U=VRuVS==VUVV==wW>W W W =W'?>W(W)W-}>W.W/W0 >W1W5>W6W7W8 > W<>W=W>W?W@WAWS*?WT G%WUWV WYN?WZ G%W[ W^?W_+W` Wa WJ?WLWQ WW>W\*?WbN? WE?WF?Wg@Wh _fdWiWm7@WnWoWpX w W%@W*>W2?>:_rtW9}>WB>Wd?Wj?Wq@@+60X @X X X X 7@ 0X @@X@ A X 9AX!X" = X%{AX'=X(+X.=X0 = X3A saX49A Y AY Y + lenY +Y  8Z @BZSZSZSZSZS Z#S(Z,S0 [)hB[*S[+9; P[8B[9B[:XH[;XL@BB+"8[DBN[E`[F5[GX0" \>LC\K\Z\p\\\ end\LCL[CV+] rC val]] [C] C val] ] ~CSCU SV SW"JX[ D0h{DiA6jkC cpulXmSnS oS( D+D+ ?U@@zE S S S ? ?+ +(+0X88@ G S S S S S  S( S0 S8 I@ SH SP IX I` Sh Sp Sx  S  S  S  S S S S S S S S S S8@tHDH 7! S(" S0# S8%@&P'Q(R)S, SX- S`. Sh/ Sp0 Ix1 S3 S6 7tH9~H;~H=+ZavgGD@ G yH0KHLM+N+OX P$Q&SH(HG]I IIIIU`JHa7h Si S j S(k S0l S8s I@t SHuXPXXXXXXXXHq;XHq; rqJHJIG^JJJIrqJJ2X 2X 2X2Xc;K    aKxbJxs?~K~KaKu KK KJK+z(n( KULx8 `@ D H8P+` +h)p+x A48 Kpidp^7LM^9 7^:X^; A4^<u ino^=S^?ɂ ^@@^B5HIrcu^C``^DقpLaM+h9"_oN_p( uid_q rC gid_r C _s rC_t C_u rC_v C_w rC _x C$_y X(_z0_{8_|@_}H_~P_X_O`_Oh_Op_Ox_ _3_Un_ A_8AfMNkey`õO`7`AD`6 sem`8(`@P` Xe`` 9h uid` rCp gid` Ct`x`|`~` `+҅`EN O O O O OdXa^Sa_7a` aaab acae5 ah8akA@anXaq`asdathawpaxXtazxBaXBaXaXaaNaq;a < itaa2ahBaĉha aLMaottyaىaa 6aSa SaSaSaSaSaCa+a+a+a'+a+ a+(a"+0a,+8a+@a+Ha"+Pa,+Xa+`a+haApaaalaa Xaaaaa` a5a80Oe aSaA4a7a5a\ S S S S S S XbcxTbd(be bg bk A4bmbn(bo0bqX8T }T@ T T cTcsc[cgT T T+ T U  U+&U+B +U 5U:=OU+ OU YU cU"hdyUdz]d|Xd}2_A^dJ^(d|<0d+Xd#7_`mU @e4eVe5eVe6 e7+e8+e9n e;X(e=X,e>x0e?8U jV tV ~V VV fVfff f  Wf!f" *f$X Hf'Wf(G keyf)qf*Wf+ f,(f-0f. W8 extf/W@HVVf3" f8W tpf9Wf: f;?f<? W+0g WX X XX gEXg(ggW XhqXhrXhs|< wqhvXH cpuhwP X xiXiiXiY( leni(HiYPi pXY++Y+!Y+d@jYjYjYj NjA4@@j XHj!+j"+j#j$|<j%Xj&` j'uZ0j(+8ocpuj*@osspj+ZH( Z+ `j6uZj7A4j8Yj:Y(j;+Hj<uZPj=Xj>\ Z jeZjfX sdajg\jh"ji\zZexjD[jEuZjF[jH jI5(jJA4HjK5PjL+pjM+xjN+jO+jP+jQ+jR+jS+jTjU+jV5jWh9jY j\+j]+j^EXj_ZpuZ\+!YZ$kl32\7\P\P\+U\ l6\l7&\l8P\l9m\mM0mM0m"\m#0m$ m% m']m( m) m+%]m, m- m!S]m&\m*\m.] mz]\ opsm]%] z]] m2]m4+m6Xm7X 4Xd@]4XdH^ dpE^dq]drdsJ^ E^6ds^d]d+d^Nd`d+^d^(O^s^"@d2_d^d+d+d+ d (d,d2_0Ircud`8dc_H^S] dc_d idd<_r_V+ d_d_ _ (n_n"nInn o r`oSo& o)8 ldto*w`8o.+@o95Ho:ho;apo= xoC!|oD~ r` p app+ altp+p+p+ p+(p0p8p@pHpPpXp`phpppxpp p!|`aoF_6\a^ `XXa:lruY(adeibj +k+6(R@bahLas+ 6(ubz+ pp{b|+}+~( b6b+6bXc  qXcqq refq7@LC(XgY8(\ hb+h+t7w }$X2h++_Ph( hW`Ouh&3f&&f hZrb7+g hrbirc rh rj%rk9rq\ rs(rtu0ru8rw@r{Hr~PrXr`rhrpr3xhinggiS cid @@ j c 9j+ TU@@nAi@8@+P+X+`+h+p pgd  x) 5 ?nE+LXS Z"](_aA4p8r+++++ +(+0+8A6@A4D+H+P'+X3+`+h9brk+p!+x++%+0+n,n@Ana+hA4pKnxUnBg&_n++  r_(Xin++( ji+,n+3_\(?\0@z8Ha}4\Mua}u=aXD(E\FAG QH\I\ J\(KH0N j8O@QHSzPAa}-QFeexVxԎoxexYZ[S\S]S^S _S(`S0aI8cI@dHeLfSPgSXhS`iIhjp80XXXX XXX ino  T( T0[X[k+ XXX XXXXXHϕϕH (038@QHϕPa}~ϕa}Xa}kԕa}=3a}uLa}L08/8  X 8 0 –H9ops!Җ x–+Җ+V+Ow&} &  5ʌ%a Ԙ  (R0 k8 @ H P X=`Qh op xԚ :zz fBgfLzԘL ٘BgLX8RBgLXX%HkLHWp`ǙʌǙ̙ (+, -./ - =L QBoVtLŚŚBgϚʚ HBgٚʌǙaO,&_&X_R&W`Ow&!w& }'x|O˛&0U&'& & X h'a$@ ops wHP devf`Xd˛ ,8@Z[.\Q]o^` bө(d0e 8f-@hPHj PkxXm`oȪhppr xs@uYvy{«} &i6    ̝ ֝(QBg d4 pidLMg: uid rCrC $  +XX XX O ٞ&5& S_ )W*`&+3&,Q&-rGP80y  Hypj+    Ϭ ( 0 8H@ H P X `Chap xzzzz  ʭ    ( # -A2< FK U _dW s }d@I  $ 0 $ $  $  $  $ X$X(X,X0 X4#G8$@'"H*#P-XX0X\5`6 h<p=3x?Q@~BDFHJL~NP~RUQWQY[ .\L]L^L_e`eae bQ(cy0d .8e .@jyHk .PqXsU\`vxxz|$bdev}¹~79dbgEfffI` NLh+Lx+$GGSX x pos G XBg+Bgt NBgGt0lʌlXq SBg{NBg ЦBgX+Bg զxBgBg#>Bg \BgCzBgz a+Bg++++V٧0UBgtXBgt0UXާ$Bg$8). VBg8kkBgp [BgBgXzϨBgBgXX ԨlXu.xuXGLuxL3oxV1xtuөxuruxuة xu-xuGPxur2xxurfUxuxuX}êuê|~?Xͪu6x6SS; YxExuBgXr^xBgr1«uu1ǫu &u U mt 8 +ddx+UJXxa}xϬxzxԬa} a}n a}9u9> %aa}@ Hzkufa}ʭa}Gޭޭxϭa}  $uLG."a+ @@AGBCD۶ EA( sdF?0G78BIXBJXBKXBLXBMXaa `+7e rev+ ` ?"?  ?GIrb7 ns0X8< r>_@ idS` hpIrcu`x  opsP!Z ?hKo "$ % ϲ & (( 02 89@: H= P@9XA W`K U :dirjD  [ kn?Bgk 5 5@`h x    @  A %ijj[jtkktϲktkԲjN j 9j %Wj>4X 0'۳(\) r* +, - 4(] ] ':'G' r'm\'n'o&X'0'1'2 '3 '4~ '5 ('7 ص0'9 8'; ص@'= H'?#P\\ r..rQ 8o V.]LyBgصBg Bg ݵ#Bg  'S' q' (q.X.Gv `۶ A4a ĸX 0t<u QvVw![x*~y z (<QFS`(tty۳eyyy~e }~obuf# +#+?L5+ j5~yo~Gyyj (+++++ "0MIrcu1`273Mɸ\V+ HIJK LM+Nnn ¹8a@ pHGP X bus`h p x5dH 9msi(8@SHSPX `hx  f9id?A4 t!![# -$!%+'#0):+ `, a- b. c/ d9 e< f¹ :;<   -!"# $(%0&8'@(H)P*X+`,h-p.x/012345-"JUcJXlHxy A4zX|X}5~0@ 88:2  2 !2 "2 #2 $2 %2 &2 '2 (2 )?A4 h9 O@ @ A B C D EHq;PSX5Y  X                Xc22SSSS^  s(9qos}0 +O,G id-./A4 0Y(1|<02+X3 <`4 <h5 <p6 <x7 <8+9+:+;+<+ dev=B> B? : Ts0c x ops  - -X M2NGOGP![Q![R![ TW(Uu0V8W -@X -HY -P[X\`^h_paxcd - pmfh!KKR `RaG busbd$eGg h$jK(k0m8n -@oHp -PqXr`s![ht![p pmvxw - pyP7pp\z 2 `2F3G5![6![8u9 d ; y(< -0>8@(t@AHC P pmEX_p_rKttFip~py~ 0XYGZ![[u\ ^ - pm`(!+ I! v NBDEFGHIIv  6A{K :-@!(N[O+P Q * 0. ?ccg <G< ($E$FG mod$G$ ops$H!$I +$J$K  A(<$L:arg$M :str$N!:arr$Oz $V$WX$X $\u max$^X$_X num$`;  ops$a!$b&u%"0(N)p7+  +  X @  L#+7 `-q.a mod/$@0H mp1vP2aMX q 8567 9 ; 2 <F(= V0{#G2$G"F$7V$KJX>U8E modF$HGUPpqrstXZmtnw N NX SX:A.p+'  WZW  S#4X-ȥFXX ^@F  idR clsP Pp_y~XX+JX:JXd8 0!r" JX1JXB@JXOdcd&e2f4@g lidh \  S cma  01G2 3G46aX7a`8h9p:x>+? @/0 ops1" dev456(7 8  &d$wR++Ln+S~+nL+4X  geti put y  ( 08@2H2PFX_`xhp_xFi Q RX idSXT  PfZghXi]0iZyn ~ p  G GX G$G2 #F 7_ Kx Gd GGXX%}  X ? a ak 12345 ! 0 len 0! 0 $c% 0& $' $ (B% +,X-X.X HFGX lenH I J K  L $(M 0N 8O @c \M]?^? ju ecckmMI%z  "@I;I;' `u (SS? H55 BXu!I.Io8.QI8yIoyVIoIIopI+o.I#LI03eIQyIj4XqE qNqT qZqe)}nn)Xc++ q6qWq.qW*fV+qq*(3X(r0 vmar1 r2 `r3 +r4+r5+ Or>&r? &r@ !  % +9 *\ +++>}nunXa}nn++z+  +G  UU +B%3 +4Xv     4X ~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuaX'aXb @< 6 w B ec B 6 6 6 A 6<wQ+@ @  6 w w w w 6 6  E 6 6 6 6  E$ B( U0 6<QwU+we+ cd 6e 6f 6g w h w i *j k wl crcm 6w+aXi: b hdrbQrb7" Iug ece e @+e ggw+8XJ}ZdevK¹L˛9ubiMXN`OdPhQlRpStTxV|WXYZ[ \]^_^a$b(c 0d 8e@gHhX"iX"jX"kX"lX"mX"nX"8,-˛Zdev.¹h/X0\1h2p3 A4x4|5689:;<>?@A&B5DFIJ A4K7L5O9fmP+Q! R!, S88T8`UV WXXYZ[\_7`7a7bc79pqd0ef A4g5h8ij@klmno p(q0rE4u HvPwTxXy\z`{d|h}l~ptx|XX9mtdI55U\9dbg}} wx2X2X2X2X2X2X2XXXX XPu u(u0u8u@uHuPuXu`uhup&+e@+ LU+ :o+!l_ h<Q IQIQIM:  6Qd'M: 9 6Me K" GGhe+`8M=<M @)Q2`Q876s`Q?S`gM yy<h ??OM QIoy*?y)!y( iIh5?)?M3AAGj_M/hAGjM+AGjQIoy"h"GjM#8%Gj,=ubi.+7+A=lenM! ,err,buf kk,UT @ >DE D T| $ &~v $ &"QRX} U}TQs 9U}L )UT  ))UT Q|RvXs )TUT Q| hUT QvRvs" KU T Q2R X1Y} 9U})UT QRsX|Yv;:-W -.ubiW0.bufWA#WJ#X .lenX?errZ?iZ %[ %\%] q%b ,%b D?cm ?c1n %oD%w%w-" .ubi"Dp D UsTv )UsT Q| )UsT Q| Uv)T R|X !IBU- .ubi;A#D?err?crc $%$%UqD% ,% - .ubi7A#@#"y?err% $q- M.ubi8A#A?err[c=ubic-+c6+dZfb,errg,crch $,piK Lk# ;=)kk7H k H I'3I/#IkU T Rv#!l# !l 0Cf L C04n F S'R`RmRzR>D DIUsTv0 F{@ F &FUsT20xC} C7xCn C PUsT /#Il ~U T|Q< *UsTvQ|S)KUUQT PpUsT  U T Q lS+#[=ubi,+5+Z+%,err ,crc $!$_$b,pK L# ;)h7H  H I'3I/#IU T Rv!# ! L # ;))  7H   H I'3I/#I U T RvL# ;)~7H  H I'3I/#IU T RvXY !IBUL&# ;)&&7H & H I'3I/#I&U T RvX0C  C/#I :EU~TsQv iU}TQ@ ~U T}Q< PU~T QvRXD U} P U~T Qv 'U~T} PaU~T QvRX !IBU yU} )U~T Qv U T Q S+zsKa =ubis6A+t"vwxyz{|}%~bad )9UvT  )^UvT  )UvT  )UvT  Us )UvT  )UvT  )<UvT  )aUvT  )UvT  )UvT  )UvT  )UvT  ) UvT  )? UvT )UvT [L =ubiL,+L5+MU,errO,crcP $K  LR# ;+ )R R7H R H I'3I/#IRU T R| !S# !S 0]$  '3 >D  D  UsTv ) UsT Q| g Uv0 Fas  F &FUsT10xCc  C7xCn C P UsT /#IS ~9 U TvQ<S)f UUTQQTR0 P UsT  U T Q S[=ubi++4+U+),err ,crc $!$_$K L# ;)C7H  H I'3I/#IU T Rv!# ! L# ;)g7H  H I'3I/#IU T RvL# ;)Y7H  H I'3I/#IU T RvXY #IBUL # ;) Z 7H   H I'3I/#I U T RvX/#I :U}T|QvR0X@ &U|TQ@ ~JU T|Q< PU}T QvRXD gU| PU}T Qv U}T| PU}T QvRX #IBU g6U| )aU}T Qv U T Q S+z)=ubi5A+ y,ec bad )vUhT Q1 )T  gUs )UhT  )UhT )UhT [e=ubie.A+e7,errg,mtdhIK~ !j# !j /#Ij U| )@UsT QvR\ )eUsT  U T Q j[H=ubiH,A+H5,mtdJIK <!L# !L ,retOKLV# ;)VV7H V H I'3I/#IVU T Rv cU|)UsT Q\Rv/#IL U T Q LS+ [=ubi*+3+=,err,ret K !# ! 0 % 2'?>DE D cUsTv )UsT Qv0+$4 * =$ J$'W$d$o$3$l$$>G H H $HLT}l$ $>G  H H $HLT} hKUsT Qv 'cU~ %UsTv :UsQvR0 T S)UsQvR0 :UsQvR0 T} hEUsT Qv ]U~ uU~ )UsT Qv U~ )UsT Q}Rv U~)UsT Qv/#I %jUsTv  UsTv )UsT  U T Q S++$=ubi1+:,err! ~ ! $~!~!:~!QkK  !!# ! 0MD" XD eD rDDD0G4" H H $H51H5@H5OH5^H5mHl|H"5}H5H5H5H5HU?T@LUvT0/#I #UsT|Q~R0 @#T}Q4R~X~ j#UsT|Q~R0 #Q4R~X~ )#UsT Q| #UsT|Q0L $U T Q -w $.ubiw+#w4?erry?iy %yK$ out$!}# !} $%D%S$+ $?S)=ubi?-+?6,errAA eiBK kL&LD# ;%)D=&D7H D H I'3I/#IDU T R|&!E# !E )'MrGM H H $H>E,c' Er4F# DF{GO|GsGG/#IE (T PG(U~T QsR|F )(U~T Q|Rs (U~T|Q0 )(U~T Q| ))U~T L E)U T Q E:`ubi%`buf6t?tI`lenerr1 \ K: +}# ;K*i*\~H  H I'3IE#IU T RvX|Ys7+1# 1 g+1# 1 +1# 1 +1# 1 +!"# !" , % 2'?>Ds, D ,U~T| ),U~T Q|04  d- F S'R`RmRzR0DH- DIU~T|0E- E7QF aF{GH|GsGG01% J1 C P ] j w'3>D_. Dm$/UT @ m0mx/R )/U~T Q|RsXX h/U~T Q h 0U~T QRs KQ0U T Q2R X1Y}" h0U~T QRs K0U T Q2R X1Y" 1QRX 91U9)U~T 0- o7 ? L'Yfs3>D*2 D0C- 5 C C'CDlD3D"DrFE F F FrF   G Gs$G%G>4G 3 FG SGT @ Q@m0D41D>D7FI G GUT @ 0MDO5 XD eD rDDD0G45 H H $H51H5@H5OH5^H5mHl|H55}H5H5H5H5HU?TLT0SU0CG}6 CS S66US S[6USSU :6U~Q|X ~6U TQ< 6U~T|Q )7U~T Q| )F7U~T Q| `7UE#IE#I/#I"E#IE#I ?8U~T|QsRv f8QRX} 8U~T|Qvs" )8U~T QvR|Xs )8U~T L )C9U~T QRvX|Ys z9U~T|QsRv 9U T Q 9U T Q +:U T Q " j:U T Q :U T QS:+ :qxC`ubiq*A`bufq5tq>tqH`lenrerrt\t 1u \v K$ <}x# ;;ixH<\x~H x H I'3IE#IxU T RvXsY|<1z# 1z =1{# 1{ 4=1|# 1| !?\G=1# 1 =1# 1 E#IE#I  P#>UT XvYsF )j>UT QXvYs h>UT Qs >U T Q ?U T QQ?1# 1 7@}# ;?i?\~H  H I'3IE#IU T ~ A % 2'?>D@ D @UTs )@UT QsE5A EnF, ~F{GA|GsGGE#I|E#I{E#IE#Iz nBTQRX~L BU T Q| BU T Q{ +CU T Q jCU T QznC.ubin3-e#bC#eJZXC#XA#0 Z.buf1D%4-oD.ubio;A-]D.ubi]HA#^X-N E.ubiN@A#OX-A6E.ubiADA#BX-2cE.ubi2;A#3X-%E.ubi%EA#&X-E.ubi?A- E.ubi FAPEYubiFAP FYubi@AP4FYubi<XPLQFYubiLBAPEnFYubiEBAP>FYubi>DUK D sKU|Ts)U|T R #IBU :KU|TsQ}R0X@ ~KU TsQ< S LUs )/LU|T  )ZLU|T Q} grLUsJ++G+SJLJXpJJJJintX,J*J`s8d`u8w `s16`u16!`s320`u32`s64`u64uX u )J+1X2XHIX]^_`LJJ%')<X ?Z  #J%&*+4=BUh0l n?qS} I S S X X Sx* * I  #K KKP#KLe+2 e)uXZ                    x+W=0   S+   !( *B-@ 3XX  7( X,!X0( 4)38*XH++P,X5 `6 d8 h: l; p< t=Xx^se?7G@Crt@HmdlA6IB1IFKPI7J+KXOKXK]KP`"E@dhXkX l+m nK oK(pY(0q Xs`ubx dyRKhzp{K+      RK D:(P7PCmmn hn pLx    +X X, X, X, X- X- X- X- X- X- X- X- X- X - X - X - X -"X -+*Cpid ~ ~+ (0@eMPjMX "zM%N (N + - S. S3 S4C6!D: (=+0>+8A S@D SHG+PH+XKB`PNBTNWNZN^Ok 2mOp: q:(t+8u+@CfsxOH{OP~OXP`Sh Sp =x = =(A+ XS CX<A S  S .4 " zK )8( 8 S@  H TP  TX T` Th Tp +x T A X  S  S  S 6 6  T   ?  ? "T )T    T0  58  XX U\ U` 5h   U       !X "X # $+ & S ' S ( S P)e 3*U CP% D+ L/U N+ R?U S?( T?, Y+0 ] 8 ^ < _ @ ` D PaeH dS7X gIU i7 lSU w x z+ } ~XU  S S  P%  +XmUwUUU X(X,K0mrcue07@ DH<P~Vx7  "V VV  S >Pe !"\3$"\3P.e<VPF@@%@7iDpad! +? @#)@  !0 key"0%?DA+BICND =t>#///eH  G  ( "7 Z  ( $0 8 @ "H "H "H _H "H "H "H "HB@MKP]h*GG' X5Ckp X(X,0 8@ABXD HPmmem@+ XA (0X8@XHXLPXX`Xhp -xXX$XXXP% X!P%"X%&N9X:?AD F P  QX(T%0%ef+g-h7 u-v0w0 keyx2 U]V #j(keyk<n(keyo<0 ;<=<? X <@ X$<A X(<B X+ BC!D!<E! <E!(GsE!,GdplE!-GpE'!/<F!0GavlF!4GlF!5GdF!6GgF%!7<F+!8+++++*  pte"* / pmd"%X%%Q%/;n' ~(pgd'Q'"enp (pudpQp"Q2@HI+Kwc#c0 4+8B@@ I  2(sp +(es  (ds " $ & +( +0 28 +X +`(cr2 +h +p +x 3 + X ? + + 2^fpu 42@X (! n ! I(s B@@ KTj@n@~ / [!KMhn  X#kh (,h0Rh8Xhh%ip+x]g ij( Uibg="!" " ="""!"!%"%"Dval" 7!7! "9"#"",%"=#i"# #i" y"+%#"# 7E" # "#y"#9"#"~$~$  %"%9"%" &a#&"&&& &&X&+,'#(fmt'G'G'G'X'G'G$a#(6#(7b(828(h$(G(G(G(GL(XL(XL(4X key(9#(EX(=$    8(U$(V mod(W$(XG(Y$ (Z (([ ,(\h$0G (uF%(vF%(wK%(xX(yX#$+Le%+ )/%)1X set)3 get)5)7 3e%'$  9 \  (( (08!@" H# ާP$ ާX%`&h')p(x)L*j+,-./ 0 1 2A3 d5 9 ; ݩ>L?@% *!'*% *+ *-*/ EX 3I(           +Y(+! ;S Y(+  0,c(,dG,eA,g_,i },l #H(v(/- /- EX.)  *(.g).g) val. ?.!? ."?.#S.$g) ?%.*).+&).,#) /)// ) 0)0W0 0)*.'*.(.)(#l)..S* .1j*.2o*.3.4 .5+.6+j*%(.*.%)./).7* 8.*.+ fn. *#t***** 1+1S end1S 2;F+Gcs2=SGsl2?SGwfe2AS 2E+Gss2GSGsti2IS<2KSGnmi2MS<2PS <2SS0<2VS8Glm2XS9<2]S:<2dS<%2 ,Dcs2!Dcsx2S2+%28,Dss2!Dssx2S2F+ 2g>- r152m+ r142n+ r132o+ r122p+ bp2q+ bx2r+( r112u+0 r102v+8 r92w+@ r82x+H ax2y+P cx2z+X dx2{+` si2|+h di2}+p2+x ip2+#+2+ sp2+# , 3 f-3 3 f-8, p4- cwd4? swd4? twd4? fip4? fcs4? foo4? fos4?4-4?l?-+=4*". rip4+S rdp4,S=4.`. fip4/? fcs40? foo41? fos42? %4)t.7-7".%04@.4A.4B.?.+ o4$8/ cwd4%! swd4&! twd4'! fop4(!#`.45?46?498/ 4<H/4>.t.?H/+?X/+? 4Q50 cwd4R? swd4S? twd4T? fip4U? fcs4V? foo4W? fos4X?4Z-4[ l4\ m4] n4^ o rm4_ p4` q4a50x4b?>- J0+SZ0+@4:04; S4< S4= 0S0+B@@4O0R4P.4QZ04R0@ 0a+@4^D154_k-b4`.54aX/b4b0@54cD1 V1+B@@4f14hX4kX4nS4qS(xfd4tS4wX4zX4X4XR40@@4424 S4X4X fpu@424X4+424241 410R4V1@@V1 5 25 S5SL2+2+33+ 33 6>\36?+6@+6A? cpu6C? 78w3793 7<37=3w3%8<38=X8>  8:38;w3#3 src8A! dst8A !3)4%949" 9.4#494*: Q4:":":4/"///!/%/'/,//.4/3/5/9/</A/D/H/L/Q/U/Y ;#5;$.4;%;' q5 < 5<  =)6=*j(=+" osq=-5 =/M>ɢ5M>ʢM>ˢ ?!F6?" X?&+6 ?Dm6?DF6?DR6 ?E6?EF6?Ey6*?T 6?Y6?Z .4?[6*@ 6@6+6+@86 (A7A S B$S7B%B'B( 0BD7BM#7BP(BW) C7C C7 D7D 72E7E+E8E877 E $8E 8 8 EQ8E 8E8/FG G"_8%G8G.4Gd8 G8#p8GXG (H09H1j(H7j( osqH95H;"H<MH8MHMHMHMH I+}9I,"I- J9JXJU9K K 9K 9K2 L(:LXLXLGLGLG MP:MSMS2(Mw:SctM9M&w: (:EXN:     O:O :: P :P (Q %;Q Q Q2 RN;\R 7R < R i;R)8EXS ; 2@S';\S(%;S) < S*<(S+<0S, 8S- 9S. :S/ ;i; < <;;2@@T/<T0JT1XT2  seqT3m6T4 <T5N; T6T0T7 <8< (U<U #U+U <U? )<<<< V=VV V"== W+O=W,W- xX=X=XX`X+h maxX+p+=+ *Y = sigY6Y=ZRuZS==ZUZV==[%>[ [ [ =*['U>[([)*[->[.[/[0 %>[1*[5>[6[7[8 %>* [<?[=[>[?[@[A*[S@?[T U%[U[V* [Yd?[Z U%[[ *[^?[_+[` [a %[J?[L[Q [W?[\@?[bd?* [E?[F#?*[g@[h _fd[i*[mM@[n[o[pX  [%@[*1>[2U>D_rt[9>[B>[d?[j?[q@@+=0\ @\ \ \ \ M@ 0\ A#@\@A \ PA\!\" = \%A\'=\(+\.=\0 = \3A sa\4PA ] A] ] + len] +]  8^ WB^S^S^S^S^S ^#S(^,S0 _)B_*S_+N; P_8B_9B_:XH_;XLWBB+28_DB\_Ee_F5_GX02 `>cC`K`Z`p``` end`cCLrCa+*a C valaa rC*a C vala a CSCU SV SW"TX[!D    0hDiF6jkC(cpulXmSnS oS( D+E+ ?[@@E S S S ? ?+ +(+0X8B@7G S S S S S  S( S0 S8 I@ SH SP IX I` Sh Sp Sx  S  S  S  S S S S S S S S S SB@HDR 7! S(" S0# S8%@&P'Q(R)S, SX- S`. Sh/ Sp0 Ix1 S3 S6 7H9H;H=+^avgGE@7GH0K ILM+N+OX P$Q&S I(HQ]I"I1I1I6I[`JRa7h Si S j S(k S0l S8s I@t SHuXPXXXXXXXXR;XR;(rqJIJ1IQ^JJJ1IrqJK8X 8X 8X8XnRK    zKbKs?KKzK~KKKJK+e(Y(K[Ly8 `@ D H)8P+` +h)p+x .48 Kpidp 7eM 9 7 :X ; .4 <v ino =S ?փ  @@ B5HSrcu Ce` DpL#zM+}92boNbpj( uidbq C gidbr C bs Cbt Cbu Cbv Cbw C bx C$by X(bz 0b{ 8b| @b} Hb~ PbXbO`bOhbOpbOxb bAbpnb#AbFKMNkeycOc7c„KRcD semc8(cNPc X#s`c 9h uidc Cp gidc Ctc΄xc|c~c c+##"cSNOOOOOoXd^Sd_7d` dadb dcde5 dh8dk(A@dnXdq`dsddthdwpdxXtdzxLdXLdXdXdd\d;d < itdŠd@dBdҊhd deMdvttyddd 6dSd SdSdSdSdSdCd+d+d+d'+d+ d+(d"+0d,+8d+@d+Hd"+Pd,+Xd+`d+hdApdddzd d Xdddddn d5d80Pp dSd.4d7d5dj SSSSTT XecTedj(ee eg ek .4emen(eo0eq)X8TTATT fTfffTT U+UU%U+?U+BDUNUO=hU+hUrU|U2hgyUgz]g|Xg}L_K^gd^(g<0g+Xg#Q_`U @h4~Vh5~Vh6 h7+h8+h9n h;X(h=X,h>x0h?8UVVVVV iViii i %Wi!i" <i$X Hi'Wi(G keyi)i*Wi+ i,(i-0i. W8 exti/W@SVVi32 i8W tpi9Wi: i;?i<?%W00j XX)$X$X)X j^Xjj(jjX XkqXkr)Xks< wqkvXH cpukwPX xl Yll YlY( lenlj(Hl*YPl pXY++*Y+:Y+o@mZmZmZm \m.4@@m XHm!+m"+m#m$<m%)Xm&e m'Z0m(+8vcpum*@vsspm+ZHj(%Z+ `m6Zm7.4m8Ym:Y(m;+Hm<ZPm=Xm>\%Z meZmfX sdamg(\mh"mi-\ZpxmD\mEZmF\mH mI5(mJ.4HmK5PmL+pmM+xmN+mO+mP+mQ+mR+mS+mTmU+mV5mW}9mY m\+m]+m^^Xm_ZpZ(\+:YZ/no3L\Q\j\j\+o\ o6\o7@\o8j\o9%p\p:0p:0*p"\p#0p$ p% *p']p( p) *p+?]p, p- %p!m]p&\p*\p.] p]#\ opsp]#?]]] p2]p4+p6Xp7X EXg@^   EXgH*^    gp_^gq^grgsd^_^=g^g]g+g^\geg+fg^7i^^2@gL_g*^g+g+g+ g (g,gL_0Srcuge8g}_H^m] g}_g idgV__a+ g_g__ (q_q"qIqq *r `rSr& r)8 ldtr*`8r.+@r95Hr:hr;apr= xrC!|rD~` s ass+ alts+s+s+ s+(s0s8s@sHsPsXs`shspsxss s!`arF_=\a^ `X%XbDlruY7ade%i*bj +k+=(RZb#ahL#bs+ =(ubz+ pp{b|+}+~j( b=b+=brc  trcto refthp8t}9HthtXlt+p opst xtt#bf(Qc7*b7Zb7b7bqe%cX n c(val+QccMdN PX]J-dlruK7c]WRd5X 5Ycc@GdI+#dULV + #-d([ 0\ 4^+8g@Fd7Rdbjc(mHen+o+q r s t vX g@lfe7dbzc0}e~++     (c e++g@|f7fe7eb[DAfKdKHe@KeQ+Af[ ]g Y .4 l  L  y(X0X4N8@#ŸP p  x#'$ % ',KSf5g(ctx6gg=g>7@cC(XgY8(\&hb+h+t7w }$cMh++gkh7&hbe]h5Nf5Af h^rb7+ghubiuc 2uh 2ujKuk_uq us,(ut0uu8uw@u{,Hu~,PuXu `u"hu@puYxhiggjS(cid @@ j n Tj+ mU@@2nKj@8@+P+X+`+h+p(pgd  x) 5 ?2nE+LXS Z"]j(_a.4p8r+++++ +(+0+8F6@.4D+H+P'+X3+`+hCbrk+p!+x++%+0+7nGn@\na+h.4pfnxpn]g&zn++  _j()Xn++j( ji+Gn+3_Wn+Wnanknunn+na+Q Xnpu/:o#u7:o((pmdu9 0(pudu; !8#@uEHuFP(pteuL X(ptluP4`uT hTXo      @ rrrrrMv6Mv9Mv<MvG 8t8pt+t2t2t+t+ t+(t08peBpw<Xp)cpcphp wipwn+wvq28w_pw`j(wapwbp<wc <wd Srcuwee refwfcp0Lpp* q v + %qTX Tbq    gqbqq++  nlq Bygtyoylt@(pyHyGPyFX(busy`yhy py xy5yRy:yyy Cmsiy(y8y @ySHySPy/Xy 4`yhy?xy IyyyQyy fCidy?y.4yy y!!iy# gy$[y%ey'#jy)ty+ `y, ay- by. cy/ dy9 ey< fqq z"tz#t z&tz'tz' ttt={t{.4{ f{tq{7t2{uKt=|35u|4? len|4?%|2Pu7u|6S |1qu#5u|8]Pu%|iu|j|ku5|ru|s#|ttq|ue2|Rv|TX|U6|Vt|Wv|XPu |Yy0|[y8|_"z`|`n~h|a+p|bx\|dt#vu|m#|nSd_u|vuuuBx{y| r}~ C CX ??! n~(L0 8+@#H fL P 9X 9` 9h?p?t?x?|.4   T?8++#!! :0@H P T X \``˞hPKp8H P(՞Xߞ`h pvy+'2@|z|~|~|~|~| |(| '0| '8| <@| ZH|P|X|`yzB@n~ f+  (!0!"8'@"6H+P+X+`vh8p &E#^h$w|qt   ]g  W#X i(P>` ?99!?"a/ f0 1 4 v6X<5 BG@D"zHFPIj(XL`O dRXhSpZpnxabmrcuced)Xf5k0Pn.4@@oHq.4Xr`zEX|~ ~vX~~~~vPu~~~XG~qu~~~v)'v)<vy,ZvA }E}Fv}Gn~}H}IŒ_ ~ mnt~ ~ vvvs~ v? rX $ SS ino)S dev* f(+ f, uid, C0 gid- C4. 8/9@09P19`29p3S4S5?6?7S8S9?:?;? "Ł#` nid&-+4+7mU2RSUXYZ Xc 7 d}9(SrcueeHgXj` idmpptqGxrvu+Łvj(,- .4/ `0 03I4678  xa9 ~ " $.42@@- lru/I0j( ~  2у nr 3 ns 4у:+a+* valSEX ;   p MCC +c c$2clSrcucmecn7co =cv3cx!cy U%cuL7Dxc+ (crct+#3cccG ڄ cυcc ԅ+cOOυ cRc keycOcfcscqc7%cc 9c 9=(cc+c+ccc  %(ccL7c c"cc ] c?5c7?I ۇ 7_+0j(8#@ uid CPj(X `$"h bb 7b gidb Ca+fbAbrcubeXۇo@@TgJTh" cpuTiXTjXTkX <TlX<TmX<TnX<ToX<TpXTrXTsTtTuXT{ < T| <(T} <0T~ <8\TY@@Ke<Ow<@j+Az+? 8dd d! d"+d#Sd#S d$+(d$+0 d' d(Sd)S d0@d1 d2 d3  dC[dD dLdMdN[ 8dQdR dS[dT}9Ҋ+eM+'=+ 520x5\e 2` NjSrss 5I 085@ X   fn 3 arg w+*  b ?%eSMeTeUbqfeWneX#qeYe28eI qeJ ioceKT#+KM e\X0n* ތ valnj*  valE B     *. Y0 4B 45X67Í+w؍+ݍ0pFq]gr s Ct u v!$#(%h C ތ% C  PX r#F#h  99(98 ]gHГ()#*+ ,0-5@. .4`/ d0n~h1Kp2 x3+4l* val ˏEX6  B%EKDuidF CDgidG CH Dl#J H       ( 0 98 9@ Hr+ X(X, 0 8@ !d$r@8=9V:V;V<V=j >j(?j0@8Vn~Bj[n~KoXD6EjFOG _HjIj Jj(KV0N x8O@QHSPOn~;)_Tssydy}ysxYZ[S\S]S^S _S(`S0aI8cI@dHeLfSPgSXhS`iIhjp8>XXXX XXX(ino  T( T0iXiy+ XXX XXXXXĖVݖݖV (#0A8#@_HݖPĖn~ݖn~Xɖn~yn~KAn~(Zn~Z>F=8  X 8 0 ЗHCops! yЗ++d+]w5}5 ..)C؍3oə  .(`0 y8 @ H P (XK`_h }p x  Ht]gfəLLΙ))]gLX)8`]gLXX3HyLHe)~`)՚؍՚ښ (+(, -./ #L#g KL-_P}d)Lӛӛ]gݛ؛H)]g ؍՚o]:5_5Xg`5be]5!5 ')y]ٜ5IU555 5 X h5o$@ ops HP devf`Xdٜ:B@Z[<\_]}^` b(d0e8f;@h^HjPkXm`o֫hppr !xsNugvy{Ь}4wDƞОڞ(_]g Q4(pideM|:(uid CC $ Ÿ +XX XX ] 555 Sg )'b*e5+w35,_5-qQPB0  Rwx+   ĭݭ ( 0 8V@H.PX.`Qhop x  خ   6,1;O@JTYcmreo@W  $ 0 $ $  $  $  $ X$X(X,X0 X4#G8$@'"H*#P-XX0X\5`6 h<'p=Yx?w@BDFHJLNPRUwWwYD[ T\r]r^r_`a bw(c0d T8e T@jHk TPqXso\`vxxz|$mdev}q~7CdbgkW\Lv+L+$QGSXŦ (pos Q X]g9]g\]gG>z؍zXa]gN]gާ]gX+ŧ]g y]g)]g1L]g.j]gQ]go+]g++++VIU]gXĨ]gIUX2]g287<d]gF)yy]g~i]g]gXݩ]g]gXXzXv<yvX#GZvyZNjA}Œyd?yvŒyvrvyvyv;ŒyvG^Œyvr@ŒyvrfcŒyvyvXѫŒvѫŒ?X#۫!vDyDSSI&gySyv]gXrlŒy]gr?ЬŒvŒv?լŒv4v  c(mt 8 +rry9cTX   yn~)ĭyݭyɭy)n~n~|.n~GvGL3on~N Vyvtn~خn~Gyݮ n~#-2vZG<"o+ @@"AGBC'D EO( sdFM0G78LIXLJXLKXLLXLMXoo n+ 8s rev+n M2M  MGSrb7 ns0X8< r>#m@ idS` hpSrcuex  ops^!h MhY} "$ % ݳ & (( 02 89@: H= .P@GXA e`Yc% Ddir,xR i knM]gy 5 5@`h x    @  A %ixxi)xyyݳyij)yxN.xGx 3exLEX   0'(j) Gp* +, - 3(e e ,H,G, r%,mj,n ,o&X,0,1 ,2 ,3 ,4 ,5 (,7 0,9 8,; @,= H,?1Pjjr<'< #r_'F}'d<eL]g']g']g'1]g' ,a, , 6'<f'<G ` .4o ҹX 0tJu _vdw!ix*y z (J)_'Tan("s)p }~!vbuf1 !+1+?LC+ x͹C}Gùùȹx (&+++++ 20[Srcu1e273[׹ja+ HƺIƺJK LM+Nn & :;<˺CW  g!W"W#W $W(%W0&W8'W@(WH)WP*WX+W`,Wh-Wp.Wx/W0W1W2W3W4W5WWltH)glt\TU   TXlͼ    Hx0y .4zX|X}5~05@0B8t8  8 !8 "8 #8 $8 %8 &8 '8 (8 )?.4 }9 @ @ A B C D ER;PS)X5  X                XllSSSS  (Cqos0 +,G id-./.4 0(1<02+X3 <`4 <h5 <p6 <x7 <8+9+:+;+<+ dev=ltL> L? tͼ)lt0-(opsW =W g gV)=lt-VltXB MlNGOGP!iQ!iR!i T(U0VW8W g@X gHY gP[WX\W`^h_WpaWxcWd g pmfh[lt `aG busbd$eGg h$j(k0mW8n g@oWHp gPqXrW`s!iht!ip pmvxw g pyqùgtltCl `23G5!i6!i89 ; (< g0>W8@(@AHC P pmEXr)) 0yXAyYGyZ!iy[y\ y^ g pmy`(A[+ [  %BDE FG*HI %=AL#K %:g@[7/%NO+P Q * 0. ?ff VvGv ()E)FG mod)G$ ops)H!)I +)J)K # {bv%)L.Darg)M Dstr)N[Darr)O )VV)WX)X.V )\ max)^X)_X num)`I  ops)a!)b`%20(\)w7+  + H X N  HL]+7 `-.o mod/$@0'H mp1P2zMX 856 7 49 W; l <(= 0**/]W*/G9)l$G\$q)$TX>   [8E(modF$RG[PpAqrstX^mtnw  XV:{;w+'AWZW a#EX-9  ȧff @9  id cls yJyXyXy+TXyt   TXy   8yyyy yJ0yy!=py"TXy1V      TXyBz  TXyO  ycyd&ye2Vyf4zyg (lidyh jS%*cma9D 01G2 93G46X7`8h9p:x>+?N @/L0Q ops1"  dev4lt56(7 8V`/yw++L+L+EX    get put   ( 0!8D@XHXPlX`hpxl 4 QFRX idSXTFL PfgQhXiJ0QQ)QFFFFG!FGXDFG$&GXFIQlF]QFQqQFGFGGXXKFQ FX 4Q% ?  E 12345 G 0 len 0! 0 $% 0& $' $ (P% +,X-X.X HFAGX lenH I J K  L $(M A0N A8OF@ \s]?^? j ecckmsWK  %HfCWC*aWaM v (SS? H55 LX%G"W"TW|8T,wW^W||W|WW|DW +|!)TWIrW0YWwWEXtE      tNtT tZ,teO) n,nOrc++1t=t}tTt}*a+%tt*7Yc(u0(vmau1 u2 `u3 +u4+u5+ ]u>'5u? 5u@ /)2 'K +7_ P +++dnnXnn+++  +G  "  U U@ +P%'Y +E @ 6 w } ec B 6 6 6  6<w+@   6 w w w w 6 6   6 6 6 6  $ B( 0 6<w+w+ cd 6e 6f 6g w h w i *j ȍk wl (crcm 6w+uXi     uX       , hdr,Srb72 Su1 ecp e@+Sp 11A+BXJG^devKqLٜCubiMtXN`OdPhQlRpStTxV|WXYZ[ \]^_a$b(c 0d 8e@g~HhX"iX"jX"kX"lX"mX"nX"B,o-ٜ^dev.qh/X0\1h2p3 .4x4|5689:;<>?@AB5DFIJ .4K 8L5OCfmPQ R, S88T8`UV W)XXYZ[\_ 8` 8a 8bc 8Cpqdef .4g5h8ij klmno p(q0r4u HvPwTxXy\z`{d|h}l~ptx|XXCmtdW55o\CdbgGGyAx8X8X8X8X8X8X8XXXX XUv v(v0v8v@vHvPvXv`vhvp+ + L+ Grb75[8(ec 8X8X^u [@a ^rb7  88 8(8HX\`dhlptx |     0bq(ech^0#+$%I(e'( )$*(DtD+/bqX/8rr$8X 0tX, j\X,87U bq`X Gh?Hr ! 9G!"?>Y B6G!X  XEX - {>Z > Uo?H  9?H  9_?' 8 8U .X5#N 8k? = <UtUtX.8rctU*?+BGh Zbq?/rGhX`#?( 8?> 6?> 6?H  9?H  9X'Gh U 2#`U 8Dbq`U ?``'Ut Ut?3GhUt?(F%Ghxn0ubin't&errp&eqHs@* !y# !y/ 4~ O>F"SFs1Fa$ [’"'Β[ U T Y XU|^2* jU| Uv30u* jU| XU|* XU|<6N"[ƒσ"܃F U}F# \U}V'J(I7Rp>IVc}V  U}i( " > UvT X}` Us3:}Fy1F$ ’"'Β U T  UsT} UvT  XU||y1z XU|y @U~ XU~ фvUvTs wUv UvT  Uv[T  U T Q y`S*+#9T 4ubiT0t:errV@ -+[#  [-,[S+y>0ubi>?t&e@@* @!E# !E/ 7BpIVc"}F UviC  z > U|T Xv` Us3:vE JUsTv }U T Q E`9/ 4ubi/64e09 4ubi;4e..9 r4ubi-t.64ec@:err, , -, r, P:s0n:j\;+0cmd"&ubit UU @0ubi&tdA+#  /$ ’"'Β U T G""-8ُNY? rUN &12VEJVX]"Bjkl _U| TU|3|! TU|3|! TU|3|! TU|3|!S+ _ {4ubi9t:i:e:tmpX,k,-,x 0ubi $t0ai A&err :i    &rb1 8&rb2 8&av&aeb&tmp&eH@2 !"  &U|#T Q ?!"  U|#T Q #/r$Ѝ"I  '4 T A%_%}%/2r2 T  !:# !:/ J/tDEHrH T  +S# /  S S$ S’"'ΒS U T  +W#   W~ W$ W’"'ΒW U T  E D; `m !f# !f/ 2 i  7U|T~ ` +#   | $ ’"'Β U T Rv !# !/ !^ .1:1F!! .1:1F& 0'F\a3cNjԋf: lU|$T  7U|TsQ0 U| TU|3|! TU|3|! T U|3|! 5UsT~ NU@ {U}T Us HU|T0 U|% U}T U -U|T R1 RU|T  U T Q f` U T Q ` U T Q :`aGS2+ "s0ubi)t0aebC;M&e&errH /r T "` BTs gqUvTsX0Y0 [yUvTsQ0 UsTv!?0ubi.t@O &wrkDG y!# !/ ُuNY# rUsN &12UvTsQ1 U T Q `I| 1SO+ ?zv0u&ubitd&err&I X,I rX * jU|kYs 5!X 6ky 6>F $>’"'Β BUv eU0|.1o> XU|-? XU|* Us _ Us30 UsT Q}R *UsT Q}R {+# F $’"'Β U T R}M=>^ *hUsT Q}S+ v_g 4ubig-t.gB:rbi8:ej-,sz"0ubi*t;3;=&err&eout]H[* jU|"/"" U}3:s! U}3:s!4l XU| XU|#* jU|"V3~"" `Uv3:s! Uv3:s!9 >·>ۇ"Vj<M  XU|+  XU|H  XU|Q! XU| (!U~ @!U~ X!Us w!UvTs! H!UsT1 !U@ !UsQvR0 !U@  "Uv3:s! )"UvTs! J"Uv3:s! i"UvTs! gqUsTvQ R X 0)Y19 "4ubi/t4eIxp(0ubi%t;.;:&err@ R$+# # #$ ’"'Β U T R~X|C(&wrkD&tmpD$$ %!# !/ '%p%* jUsُ,q&NY&rN &12& XUs'* jUsX' XC'Us XUs 'U'UvTQ0 'U 'U (U 5(U T Q ` [(Us Usz^-0ubi^)t;^2&e`Hdd)+u# !) u)u$ u’"'Βu U T R~*&err~/* Usx* XU| *Us UsT Q~t+ XU|eJ+* jU|i+ XU|{,  ," ,> {,UsT X}` Uv3:s!, XU| *-UsT Q~ <-Uv3:s! ]-Uv3:s! -Uv3:s! -UvT} -UvTs!{HUUT0x:0ubi't;0;<; ;&err&e@* H/+# . E/$ ’"'Β U T /!# !/ /!# !/ 0+# 20 0$ ’"'Β U T R}1+(# $1 (1($ (’"'Β( U T R} 2!)# !)/ <2!9# !9/ y2 XUv2* jUv+2 XUv04 v3 3> 3UsT X|` U3:|GO4 XUv3c5 4$ E5> 75UsT X}` U3:s!K5* jUv M5 XUv6 7 l6$ 6> 6UsT X}` U3:s!@F7 UsA7 XUv)9 %8U =8U U8U o8U 8U3:| 8UT| gq8UsTQ@RDXY0 9U $9U3:s! B9UT} `9UT| 9U3:s! 9UT} 9Us 9UsT Q} 9U /:U T Q )` o:U T Q 9` :U T Q ` :U T Q `9 ;4ubi,t.BD. :ret@ -:e-+# ; -,yT H0ubiT.t;TDD&eVWXY&errZZ d*H^=+\# < \=\$\’"'Β\ U T R}Y~>=* jUv#> BT|X> XUs# gqUsT|Q~RX0Y1a>* jU@p? XU@^xv/ClxByxxx'xُr@NY @ rU}N &12  @* jU@Vx@xFx@xFxA1xF yA y$ ’"'Β U T FyAy "0B XU@ zB XU@B! BU}T` U T Q !C* joCU} jU~C BCT| BT|;D X&DU} XU~D UsD* jU|"E X EU| XU|kE* jU|E XU|E* jU| :F XU|F XU| [yFUsT| FUsT Q}Rv FU|Ts!HGU@ T1 *?GUsT Q} ]GUsT} uGUs *GUsT  GUsT Q} *GUsT Q} HUsT} &HUs ZKHUsT  ZpHUsT  UsT sO0ubi4t;=&err &wrk DHEdOHBhK&e1:e2I( Us!-J+.# I .PJ.I .’'Β. U T $7)pIVc"}VNK Us!iTL+0# K 0 L0$ 0’"'Β0 U T PM5r5I5'4jABQ  2Mcp #T @ Q0 M* jU~3M XU~FN XU~Gu"?NUubu xNUv puNUsT} UvCN* jU~ puUsT}SO+Oy o0ubi4t0wrkJD; &err '4(&e1&e2,@O HHHHQ!# !/ 3Q!# !/ R+# qQ Q$ ’"'Β U T SR U?S+# R R$ ’"'Β U T +T+# }S S$ ’"'Β U T _T UKU+# T U$ ’"'Β U T 7V+$# U $U$$ $’"'Β$ U T #W+-# uV -V-$ -’"'Β- U T X+7# aW 7W7$ 7’"'Β7 U T AX!# !/  ~aUsT X` U~3: a XU'b* jUvqb BT~"b BTc XUv)c7I)X7 U|c Us d XU)d7I)X7 U| d* jU~e X3eU XMeU XgeU XU)\f7$)X7 eU| fU| 9fU| U|sg f& Tg> FgUsT X` U~3:)g7I)X7 U| Eh* jUh XhU XUh* jU~"1i BTzi XU~  jUT +jU EjU ]jUs }jU~T jUsQ|R0 jUsT Q kUsT QX Yv "kU mUsT~ ]mU~Ts! |mU~Ts! mUTs! omUsT~QRvX0 *nUsT RXv  nU~Ts! NnUsT Q snUsT  nU T Q ` nU T Q ` &oU T Q ` foU T Q ` oU T Q `s{gq0ubi{-t0e{G;| ;|;|!~wdO;q+# p p$ ’"'Β U T  ;YqU|T} yV Gu0ubiV.t0eVH;W ;W;W ;W.YD@* Lr![# ![/ >s+]# r ]r]$ ]’"'Β] U T Yv:t` r` I` '4jABQ  tcp #T @ Q0Gu%mtUubu tUv putU|Ts Uv[ puuU|Ts 9uU T Q [`_@ pu4ubi@2t4wrk@HD-Ix0ubi-4t0wrk-JD@Yx u!1# !1/ /,v* jU};,0FwHTNa%nzYߐ/w .UvT|Q~1-3{w?5wXwUU##{XUU##1 ;xU T Q 1`SYx+Ix_ [y4ubi1t:e:tmp, @ x, x, y+#  y -,,y, -!!# !!/ zR0ubi't0eA;H&err&ecd*Hz+# Gz z$ ’"'Β U T X}{ r $ $  '4 T @ |+# { `|$ ’"'Β U T X~~ "&3@M N}FU}Vc$ $  '4 T @ i*~UsTQR0 D~U r~UsT Q ~UsT QR` U@* jU} [ XU} yUsQ| UsQ U UsT R~s<0ubi.t;7&ed*!+# y ր/$ ’"'Β U T 7 25 >·>ۇ"Vj )T `Iُ/NY rUsN &1294ubi;t:e@ -+#  -,9n74ubinCt.o:eq,q,q#,s ',t -,w9Hф4ubiH>t.I.I".J :pL8:eM:maxN,P-:e1U-,W30ubi3/t0e3I5@* b!9# !9/ N+;#  ;;$;’"'Β;{U T ;/:YHTanzkߐB" .UvT}Q|19 U T Q 9`94ubi24eL:p:i,"-,"Z Ae,6?lp8@ -le1W!# !/ -! # ! / Z vAubi't61N lerrlwrkD@ IW-|# |/ S+vO Aubi1tAeK <e.Ap<8@2 e1RW|# |/  ׊U T Q`kŎҎ>ގ{UUTT8ZuAubiCtAe"6OAubi8t6BN OAubi9t9$4ubiO.:i_n 4ubin3t9e#,).eJ_XE.X<9@Ȍ4ubi@,.@7`,B:bufC,E r,E -,Ir,I_/ 4ubi/>.0 4buf1-,49 t-4ubi t<9 jM4ubi jDZ ~kAtsk 5 3Z "Ap "1-W $9 %Ѝ. ;. G`9 (4n D. N. Z`,  9 |.Q. |D. |P`-, X9 %X. <. - 9 z0&q. zC`. zX+O;6;186;G86<<F_.54_]8.]349D(k4X.DC4?'jk4?|k49s.s6- u 9jُ.j8.jVO6/O 67O;626K-}OaAnew46KOAnew166-}Zjߐ6jFlretl-WoWpZA!AnewA@6B6ClretEO#O6#5F}%-}& #. :. .    ő ԑ - t t t t- tZ3!A63<Os62G6<6XGO^Av^O6^YZ"ؒAkey"Jݒ6"Z(<ؒZ,,X-W1 W1 $W1 6W1 !HW1 ?-W1 SOAptr<6H6Z,Ap,;6,KX ZUUT ` kvk* jU}Y|1V7"<Yُ1)NYו rUvN &12Yq XU}k XU} U|UsTvQ0 U| KUsT Qv cU| U T Q`T0F:icd EU T Q `I$}B:;;);6;: ݚ);;;"6;iV;W;Fb;p1y;F;%;$ ’"'Β U T %ƚ BT| Us; UscF++G+SFLFX pF F F F int X ,F *F[s8d[u8w [s16[u16![s320[u32[s64[u64aX u "F+1X2XHIX]^_`LFF%')<X ?Z  #F%&*+4=BUh0l n?qS} I S S X X X S# # I   /W WW\/WLq+( q"aX`                    x+W70   S+   !( *:-@  D3 X X    7( X, !X0 ( 4 )38 *XH ++P ,X 5 ` 6 d 8 h : l ; p < t =XxVse ?WG@;rt @Hjdl AVI BQI FKL I7 J+ KX OK XK ]KL `"E@ d hX kX  l+ m  nK  oK( p(0 q X s` ub x d yrKh zp {K +               rK     D  ;(L 7P;mm t h t p Lx         + X  X,  X,  X,  X-  X-  X-  X-  X-  X-  X-  X-  X-  X -  X -  X -  X - "X - + *;pid  ~  ~ +     ( 0 @ MP MX  "M %T  (T  +  - S . S 3 S 4C 6AD : ( =+0 >+8 A S@ D SH G+P H+X KB`L NB TN WN ZN ^O k 3 mO p:  q:( t+8 u+@;fs xPH { PP ~PX  P` Sh  Tp  =x  =  = HA +   X  T  C X = A  S   S  X4  "  K  N8(  8  T@   H  "TP  ,TX  6T`  Th  Tp  +x  T  B  X   S   S   S  7  6    T     ?   ?  "T  )U    U0  58  XX  !U\  6U`  5h    @U           !X  "X  #  $+  & S  ' S  ( S L )q  3JU  CV%  D+  LOU  N+  R_U  S?(  T?,  Y+0  ] 8  ^ <  _ @  ` D L aqH  dx7X  giU  iC7  lsU  w  x  z+  }  ~xU   S  S     V%       + X U U U V  X( X, K0jrcu q0 7@  D H <P Vx 7   "V V V     S    >L q   !"3 $"3L .q <VL F @@ @/o?pad! +? @)@  !0 key"0 ?JA+BOCT J =z>,,,bH  G  ̬ "۬   ( %0 <8 @ "H "H "H H "H "H "H "H:@ PhGG˭ X5;kp X(X,0 8@ABXD HPjmem#@+ X49CM (0X8@XHXLRPXXW`Xh\p 3xXX%fXuXXV% X!V%"X%&T9X:?AD F P QX(T %0 ef+g3h= u3v0w0 keyx 8 UcV j$keykBn$keyoB0 ;<=4? X 4@ X$4A X(4B X+ BC!D!4E! 4E!(EsE!,EdplE!-EpE'!/4F!0EavlF!4ElF!5EdF!6EgF%!74F+!8+++++#  pte"# 5 pmd"%^%%M%/Ak' $pgd'M'"kkp $pudpMp"M(@H I+Gcc0 4+8:@@O 3$sp+$es $ds"$&+(+0 38+X+`$cr2+h+p+x?3+X?++ 2Vfpu ^2@X ( t  r(y :@@ Gtj@n@5 R!Gmht  ^h (,h0Nh8Xhh%ip+x}g i(@Uig7 !    7  " ! !  +"?val  /!/!  ?" " ,+"7!o"! !o" "+ !"! /K" ! ""!?"!"""  #"#?"#" $g#$"$$$ $$X$+,%#$fmt%G%G%G%X%G%G$g#&6#&7h&8(8&n$&G&G&G&GH&XH&XH&4X key&9#(@X&=$    8&U%&V mod&W%&XG&Y% &Z (&[ ,&\n$0G &uL%&vL%&wQ%&xX&yX#$+Lk%+ '/%'1X set'3Z get'5s'7 4k%'%  ݤ  ̘( ̘0(8!A@" dH# P$ X%`&h'ͥp(x)*+6,^-c.6/ 0 1 23 5 '9 T; >?@§%X%'   (!'(% (+ (-(/ @X3r(           +(+ ;Y ()  0*c(*dG*e*g*i !*l& ((,+ ,+ @X,8)  #(,),) val, ?,!? ,"?,#S,$) ? ,*),+&),,# * -)-- ) . *.X. 0)#,'H*,(,))),.S# ,1*,2*,3,4 ,5+,6+ * (,*,%8),/*,7H* 8,*,+ fn, +*++** /9+/S end/S 0;o+Ecs0=SEsl0?SEwfe0AS 0E,Ess0GSEsti0IS40KSEnmi0MS40PS 40SS040VS8Elm0XS940]S:40dS< 04,?cs0!?csx0S09+ 0a,?ss0!?ssx0S0o+ 0gg- r150m+ r140n+ r130o+ r120p+ bp0q+ bx0r+( r110u+0 r100v+8 r90w+@ r80x+H ax0y+P cx0z+X dx0{+` si0|+h di0}+p0+x ip0+,0+ sp0+4, 1 -1 1 -a, p2. cwd2? swd2? twd2? fip2? fcs2? foo2? fos2?2.2?l?'.+72*K. rip2+S rdp2,S72.. fip2/? fcs20? foo21? fos22? 2)./'./K. 02@.2A.2B.?.+ l2$b/ cwd2%! swd2&! twd2'! fop2(!.25?26?29b/ 2<r/2>..?r/+?/+? 2Q_0 cwd2R? swd2S? twd2T? fip2U? fcs2V? foo2W? fos2X?2Z.2[ l2\ m2] n2^ o rm2_ p2` q2a_0x2b?g- t0+S0+@2:02; S2< S2= 0S0+:@@2O 1N2P.2Q02R 1@ 1\+@2^n1.2_-]2`..2a/]2b0@.2cn1 1+:@@2f%22hX2kX2nS2qS$xfd2tS2wX2zX2X2XN21@@2^22 S2X2X fpu@222X2+22222%2 2%20N21@@1 3 33 S3SL3+ 3+0303+53 :3 4>34?+4@+4A? cpu4C? 583593 5<35=33 6<36=X6>  6:46;33 src6A! dst6A !#4".4 7D47" 7X4.47D4#8 {48"8"d4,9,9,9,9!,9%,9',9,,9/X4,93,95,99,9<,9A,9D,9H,9L,9Q,9U,9Y :#5:$X4:%:' 5 ; 5;  <)'6<*(<+" osq<-5 !k6>" X>&P6 >D6>Dk6>Dw6 >E6>Ek6>E6#>T 6>Y6>Z X4>[6#? 7? 7+7+?86 (@C7@ Y A$x7A%A'A( 0AD7AM#(7AP(AW) B7B B7 C7C 7(D$8D+D)8D)877 D I8D )8.8 Dv8D.8D)8,EF F"8 F8FX4F8 F88FXF (G099G1(G7( osqG95G;"G<IGIGIGIGIG H+9H,"H- I9IXIu9J J 9J 9J( KH:KXKXKGKGKG Lp:LSLS((L:OctL9L&: H:@XM:     N:N : : O ;O (P E;P P P( Qn;SQ 7Q < Q ;QN8@XR ; (@R'<SR(E;R) < R*1<(R+<0R, 8R- 9R. :R/ ;;,<,<;<(@@S/<S0S1XS2  seqS36S4,<S5n; S60S7 <86< (T<T /T+T =T? "<<<< U==UU UB= == V+o=V,V- xW=W=WX`W+h maxW+p+=+ #X = sigX 7X=YRuYS==YUYV>>ZE>Z Z Z >#Z'u>Z(Z)#Z->Z.Z/Z0 E>Z1#Z5>Z6Z7Z8 E># Z</?Z=Z>Z?Z@ZA#ZS`?ZT [%ZUZV# ZY?ZZ [%Z[ #Z^?Z_+Z` Za ZJ?ZLZQ ZW/?Z\`?Zb?# ZE@ZF?#Zg<@Zh _fdZi#Zmm@ZnZoZpX  Z%@Z*Q>Z2u>?_rtZ9>ZB>Zd?Zj@Zq<@@+70[ A[ [ [ [ m@ 0[ 2A@[A >A [ pA[![" = [%A['=[(+[. >[0 = [3A sa[4pA \ B\ \ + len\ +\  8] wB]S]S]S]S]S ]#S(],S0 ^)B^*S^+n; P^8B^9B^:XH^;XLwBB+(8^DCS^Eq^F5^GX0( _>C_K_Z_p___ end_CLC\+#` C val`` C#` C val` ` C SD U S V S W"PX [AD    0 hD ik6 j kD$cpu lX mS nS  oS( D +    $E +  ?R@@ E  S  S  S  ?  ? +  +( +0 X8:@ WG  S  S  S  S  S   S(  S0  S8  I@  SH  SP  IX  I`  Sh  Sp  Sx  S  S  S  S  S  S  S  S  S  S  S  S  S:@ H DN 7 ! S( " S0 # S8 %@ &P 'Q (R )S , SX - S` . Sh / Sp 0 Ix 1 S 3 S 6  7H 9H ;H =+Vavg G$E@WG H0 K+I L M+ N+ OX  P$ Q& S+I(HM ]=IBIQIQIVIR `JN a7 h S i S  j S( k S0 l S8 s I@ t SH uXP X X X X X X X XN ;XN ;$rq J 0I J QIM ^JJJQIrqJ /K2 X 2 X 2 X2 Xk rK         Kb /Ks ? K KK  KK KJK+(( KRLvwa8 `@ D HN8P+` +h)p+x ÉX48 Lpidpa7Ma9 7a:Xa; X4a<Jt inoa=Sa?z a@@aB5HOrcuaCq`aDpL/M+9(boNbp( uidbq C gidbr C bs Cbt Cbu Cbv Cbw C bx C$by X(bz0b{8b|@b}Hb~PbXbO`bOhbOpbOxb bbnbCAbGÅMNkeycOc7cfGc semc8(cPc X`c 9h uidc Cp gidc Ctcrxc|c~c c+ƄcO O O P P PlXd^Sd_7d` dadb dcde5 dh8dkHA@dnXdq`dsddthdwpdxXtdzaxHdXHdXdXddSd;d < itdfddBdvhd dMdwttyddd 6dSd SdSdSdSdSdCd+d+d+d'+d+ d+(d"+0d,+8d+@d+Hd"+Pd,+Xd+`d+hdBpddddd Xdddddt d5d80%Pm dTdX4d7d5d S  T T T 'T 1T XecTed(ee eg ek X4emaen\(eo0eqIX8;T T2A T T fUf%f fT U 1U+ 1U ;U EU+_U+C dU nUo=U+ U U U(hgyVgz]g|Xg}l_G^g^(g<0g+Xg#q_`U @h4Vh5Vh6 h7+h8+h9n h;X(h=X,h>0h?8V V V V VV iWiii i EWi!i" 4i$X Hi'Wi(G keyi)i*Wi+ i,(i-0i. W8 exti/W@YVWi3( i8X tpi9Xi: i;?i<?EW.0j 4X9X"DXDXIX j~Xj(jj(X XkqXkrIXks< wqkvXH cpukwP X xl*Yll*Yl:Y( lenl(HlJYPl pX:Y++JY+ZY+l@m5Zm5Zm5Zm SmX4@@m XHm!+m"+m#m$<m%IXm&q m'Z0m(+8wcpum*@wsspm+ZH(EZ+ `m6Zm7X4m8:Ym::Y(m;+Hm<ZPm=Xm>\EZ meZmfX sdamgH\mh"miM\ZmxmD8\mEZmF8\mH mI5(mJX4HmK5PmL+pmM+xmN+mO+mP+mQ+mR+mS+mTmU+mV5mW9mY m\+m]+m^~Xm_ZpZH\+ZYZ,no3l\q\\\+\ o6\o7`\o8\o9 p\pd0pd0#p"]p#0p$ p% #p';]p( p) #p+_]p, p-  p!]p&\p*]p.;] p]\ opsp]_] ]] p2]p4+p6Xp7X @Xg@!^   @XgHJ^    gp^gq!^grgs^ ^7g^g]g+g^Sgqg+cg^/^^(@gl_gJ^g+g+g+ g (g,gl_0Orcugq8g_H^] g_g idgv__\+ g_g_ _ (q`q"qIqq #r `rSr& r)8 ldtr*`8r.+@r95Hr:hr;apr= xrC!|rD~ ` s ass+ alts+s+s+ s+(s0s8s@sHsPsXs`shspsxss s!`arF`7\a^ `X X(b?lruY/ade iJbj +k+7(RzbahL(bs+ 7(ubz+ pp{b|+}+~( b7b+7 cc  tcto reftp8t9HthtXlt+p opst xtt cc(Qc/Jb/zb/b/bnq cX k c$val+Mc^M/dN PXTJMdlruK/dTWrd.X .Yc^@GdI+/dULV + Md([ 0\ 4^+8d@Fd/rd]j^(mhen+o+q r s t vX d@le/d]z^0}e~++     (^ f++d@|=f/e/e]RDafGdGhe@GfM+afR }g  X4 x  )L  vw(X0X4N8^}@fP p  x#˝$ É% É'НGsf5g$ctx6g g=g>7@C(XgY8(\Fhb+h+t7w }$^mh++dh/Fh]qTh.nf.af hVrb7+g hubiuc uh ujukuq us(ut0uu18uwE@u{Hu~PumXu`uhupuxhigg$jS$cid @@ ?j k tj+ U@@RnG$j@8@+P+X+`+h+p$pgd  x) 5 ?RnE+LXS Z"](_aX4p8r+++++ +(+0+8k6@X4D+H+P'+X3+`+h;brk+p!+x++%+0+Wngn@|na+hX4pnxn}g&n++  _(IXn++( ?ji+gn+3_wn+ wn n n n n+n\+M Xnpu/Zouu7Zo($pmdu9 0$pudu; !8z@uEHuFP$pteuL X$ptluP4`uT hPXo      @ oooooIv6Iv9Iv<IvG 8tXpt+t2t2t+t+ t+(t0 Xpbbpw<xp"ppp wipwn+wv q(8w_qw`(waqwbq4wc 4wd Orcuweq refwfp0lpp# :q v +%%q qX!X'X=X AM 4PXTq    q qr++ nq y".ry#Vr y&Vry'Vry' [r.rVr7zrzX4z czrnz/`r(zrGr7{3r{4? len{4? {2r/r{6S {1sr{8cr {i:s{j{k:s5{rms{s/{t.rn{uq({REt{TX{U6{V.r{WJt{Xr {Yvw0{[{w8{_"Gx`{`|h{a+p{bxS{drs{m/{nOd_u{v?smsms:x{vw| r}~ C CX ![ |(L0 8+@H fL P 9X 9` 9h?p?t?x?|X4  T?8++/e!! ޙ0@H P T X \`ohLLp8>H P(yX`h pOtw+'(@{Bx{H|{H|{k|{|{| {|({ |0{ |8{ |@{ |H{}P{}X{}`wBx:@| f+  <(!0!Ɵ8˟@"ڟH+P+X+`Jth8p &# $ r  * }g 4 /X  (L` ?99!?"/ 0 1 4 6X<5 BG@D"GxHFMPI(XL`O ÉdRXhSpZnxabjrcucqdIXf5k0LnX4@@oHqX4Xr`Lx@X{4| H|JtX4|a|a|f|EtrM||a|XG|sp||a|||Jt|"|Jt|"|Jtvw||Jt| |EE}|FJt|G||H|IfT}T}Y}}^} }} mnt} T}} Jt^}E}}}}}Jt}Jt|} ~~?~ r~X~ $ ~S~S ino~)S dev~* f(~+ f, uid~, C0 gid~- C4~. 8~/9@~09P~19`~29p~3S~4S~5?~6?~7S~8S~9?~:?~;? "i#` nid&-+4+7U(R9SWUWXYZ Xc 7 d9(OrcueqHgXj` idmpptqGxrJtu\+MMRi9(,- X4/ `0a 034J678  xa9a " " $X4(@@-J lru/0( " a2u nra3 nsa4u:+O\+# valS@X ߁    ICC \a+ \c c$(clOrcucmqcn7co 7cvׂcx!cy a cu/?xc+ (cr8ct+ׂcBcGcG 88~ cscc xL+cOO=s cc keycOcBcccnc7 c9c 9c 97(cc+c+cBcGc  (cc/9^ cƄcc 4T c.cL/    7_+0(8/@ uid CP(X `$"h bb 7b gidb CÅ\+cbbrcubql@@SgSh" cpuSiXSjXSkX 4SlX4SmX4SnX4SoX4SpXSrXSsStSuXS{ < S|,<(S} <0S~,<8SS@@b<x6<@+A+? 8dd d! d"+d#Sd#S d$+(d$+0 d'd(Sd)S d0d1 d2 d3  dCdD dL'dMdN' 8dQadR dSdT9,v+M+  G=+   و(05Sq (` kOrss وO 085@ X   fn 4 arg w+# b ? eSeTeUqceWeX/neYq(8eIR qeJW ioceKTωG e\X0 R a# valk# val@     #. 0 4 4>5X6>7gNN+X S ]bw|+0pq}gr s t u v!$(   C . C PX r  99(98 }gHВ(c)/*+ ,0-5@. X4`/ d0|h1p2 x3+4# val co@X6  B E?uidF C?gidG CH DJ H      ( 0 98 9@ H]+ X(X, 0 8@ ]!%]@89:;<= >(?0@,8b|'|'XDڐEFG HI J(K0N 8O:@QSHS,P1|ߐ"vw5vw5!Svw?xYGZ[S\S]S^S _S(`S0aI8cI@dHeLfSPgSXhS`iIhjp8XXXX XXX$ino  T( T0 X G+ XXX XXXXXEh (ǔ08ǔ@HPh|}J|Xm|”|”X|'”̔|8 d X 8 d0 tH;ops! vwt+++Tw.}. ҕ ҕÕ"|ו6Tm  җ(0 8 7@ PH `P ̘X`h !p @xY ,,1 O}gO=f;mL,YLOr" ͗}gLX͗8O}gLXXOחHLH "7O"PO`<"`OUy|y~ (+̘, -./  eLOOјO!O";O;;&YLOEww}g| H^"}g|yTޙ._.Xd.]qT).!). 9'"9vw.T}.iU.ٚ. . X hٚ%@ ops )HP devf`Xd} ޚ:@ZV[\]!^?`] b(d0e8fߨ@hHjPk*XmW`ozhppr ũxsu v3yV{t}تV ` j t ~ (}g {4$pidM:$uid CC $ f +XX XX T .5. Sd )˝]*q.+3.,.-:qMP:0+  N+x<+S 9 9 h ( 90 8@HҫPXҫ`hp x,,,, T |   AڐE П՟ ߟ    % /l@  $ 0 $ $  $  $  $ X$X(X,X0 X4#G8$@'"wH*#|P-XX0X\5`6 h<p=x?@BIDIFlHlJLNPRIUWY[ \]^_`a b(c0d 8e @jHk PqXs\`vCxxz|%jdev}t~7;dbg@9 L+L*+$M7<ddGSXi *$pos M X}gݤ}g%}gG%|X# A}gd-NZ}gZ_ F}gX+i}g vw}gͥ}g՝}gҥ}g,}g,1 +^}g++++;ViU}g%Xh}g%iUX֦}g֦8ۦ }g"}g"  T}g}gX,}g}gXYX §XJtvwJtXǧGJtvwk!fvw?vw&]JtDfvwJtrbJtvwJtvwJtߨfvwJtGfvwJtr*fvwJtrfWfvwJtvwJtX/ufJtu.\f}?X}ũJtvwSS ʩ vw3vwJt}gXrVfvw}gr8tfJt[fJtyfJt تJtĪ $mt 8 +vwݪPXD   vwS|D"hvwXvw,mvw"|| ҫ|ëJt ׫|T ,JtT|1||GYvw|R¬¬Ǭ  Ѭ֬Jt<G"+ @@ƭAGBC˭D E( sdF0G78HIXHJXHKXHLXHMX +.8 rev+  7(  GOrb7 ns0X8< r>@ idS` hDpOrcuqx7 8 ops!  h! 1"J$ c% & (( 02 89@: H= ұP@XA `8  ??dirЭ ?  kn}g 5 5@`h x    @  A %iI "1&J6c%O%h"NұZ ױ @X1   0'() gp* +, - 4(1b b **G* r *m*n*o&X*0*1IJ*2 *3 *40 *5 ](*7 0*9 ]8*; @*= H*?մP³r˭IJdzr˭!˭bL+]}g˭5}g˭b}g˭մ}g˭ ** #* Fڴ#˭ F˭G( ` X4 vXK 0tu vw! x*0yD z ^("˭(&&+ƭD+5"^+*/Im }~Ŷwbufն Ŷ+ն+?L+ 5Nq0+!0GI+:Ig+gcSl (ʷ+++++ (0Orcu1q273{\+ HjIjJK LM+Nn ʷt:>o@$ppHGPX$busJ`Wh p x5Nuz ;msi](8@SHSPX `hx \c f;id?X4 &!! # ߼$%'#)+ `, a- b. c/ d9 e< ft :^;<Cϼ  ߼!ϼ"ϼ#ϼ $ϼ(%ϼ0&ϼ8'ϼ@(ϼH)ϼP*ϼX+ϼ`,ϼh-ϼp.ϼx/ϼ0ϼ1ϼ2ϼ3ϼ4ϼ5ϼjϼo"߼oԼPU   PXlE    Hxy X4zX|X}5~0@ :8^2  2 !2 "2 #2 $2 %2 &2 '2 (2 )?X4 9 @ @ A B C D EN;PSIX5   X                XSSSS  %(;qos/0 +,G id-./X4 0 (1<02+X3 <`4 <h5 <p6 <x7 <8+9+:+;+<+ dev=oH> H?  E"%o0 *$opsjϼ ϼ ߼ ߼"ooX MNGOGP! Q! R! T (U'0Vϼ8W ߼@X ߼HY ߼P[ϼX\ϼ`^@h_ϼpaϼxcϼd ߼ pmfEho `aG busbJd%eGg h$j(kH0mϼ8n ߼@oϼHp ߼Pq@Xrϼ`s! ht! p pmvExw ߼ pyR""g>@o^, `23G5! 6! 8'9  ; +(< ߼0>ϼ8@(&@A?HC YP pmEEXO"r"&&?"0"Y"*/D 0XYGZ! ['\ ^ ߼ pm`E(^+  (  BDEFGHI(  7A-K  :@/ N O+P Q * 0. ?fBf ZNBfrGU ('EU'FG mod'G% ops'H!1'I +'J'K x s_ 'L?arg'M ?str'N?arr'O, 'V'WX'X '\' max'^X'_X num'`O  ops'a!1'b'%(0(RS)Rx7c+  +  X T  L+7 `-#. mod/%@0˭H mp1(P2MX # 856IJ7 9 ; <(= 0-G"%G%"%PX>7   R8Ec$modF%NG6RPpqrstXVmtnw7  X  :߁xc4+' > HWZW ka zpg#c@X-  ȧ  @ C id clsC M"*/fXX+PX   PX   8] 0!]p" PX1      PXB  PXO  ckd&e2f4g $lidh k4  S cma  0c1G2 3G4h6X7`8ch9cp:cx>+? @/0 ops1" dev4o56(7 8hh  ,w++L!+L1+@XT    get put  +D + X( q08@HPX`hHpxfT QRX idSXT PfghXit0" +D"01XIqG]GXvG%GGCGGXXCaaMkX ?   C12345  0 len 0! 0 $% 0& $' $ (V% +6,X-X.X HFGX lenH I J K  L $(M 0N 8O@ \]?^? j ecck6m611 c; h;c Jt (@SS? Hw55 HX 8 D D!gg6N q+ "0@XtEK      tNtT tZteK"nnc++t7ttt+\+ tt+/^(u0u$vmau1 u2 `u3 +u4+u5+ $Tu>.u? .u@ 5"  +  +++nnXn1n+++E 6m +JG r @U@U +V% +aX  aX'  aXb*     @ 6 w  ec B 6 6 6  6<*w+@   6 w w w w 6 6   6 6 6 6  $ B( 0 6<w+w+ cpd 6e 6f 6g w h w i *j lk wl p$crcm 6w+aXi       hdrrb7( +Ou ecm| e|@+m +:XJVdevKtL};ubiMXN`OdPhQlRpStTxV|WXYZ[ \]^_a$b(c 0d 8e@g$HhX"iX"jX"kX"lX"mX"nX":,-}Vdev.th/X0!\1h2p3 X4x4|5689:;<>?@AB5DFIJ X4K.8L5O;fmPQ R, S88T8`UV WIXXYZ[\_.8`.8a.8bc.8;pqdef X4g5h8ijklmno p(q0r4u HvPwTxXy\z`{d|h}l~ptx|XX;mtd55\;dbg. x2X2X2X2X2X2X2XXXX XaJt Jt(Jt0Jt8Jt@JtHJtPJtXJt`JthJtp)+++ L+ rb7.R8l$ec 2X2XVu R@  Vrb7 .88qp.8(8HX\`dhlptx |     0q$echuz*eqA'e% GGBdA/GpA //BZuBv f,)8$8f.)8I8A+GpBPqGXlFqAh e"e5BQQBrQBJQf`#BuBA( )8.8A - f5#9A' P)8A bbA .~~lB%f%Gp8A=<)B20`B8Qq`B?m`ef ??cA= 36A= 36BzA&L%GpA3Gpe2qBNq`1z 0ubiz-0aizJQ|z}~5err~ ~5rb1)85rb2)85av5aeb5buf _vout_p_{9n^&GGT&U9ULT_XrX[[^^a&aqp:h[?U T }! 3r *'VFV9VFV*TV   fVsVhVrV6V VV0T QVJWW!W.W;W!HWU T8QR0_YkYwYY_YkYwYY_YCkYwYY_YkYwYY_YkYwYYmU~5!    $ 1 =-J-d3k^ p }*'V h FV9VFV*TV  fVsVT 313 *[ s[[!-*[8>[sU T R*t ( *y***! + + + '+ 3+ @+ M+ Z+-z+6T'T3++3+ +*[[[!-*[8>[U T R3+ +?UsT RWU|UsT Q1UsT Q U|6+ n#+3+ +>UsT QviUsT QvUsT QvR~UsT QvR~0TBTJ JKKK! +KlR-~RRR! RsR R R2T yX3XXWXXXXiY.Y:YFY! RYU|TQ~XhKKbK3qKs rK*[5[[!-*[8>[5U T R+I ,,*, 7,D,+^, c,6YnZZ)Z cT0UvUsQTUv+UvVUsT Q{UsT PU~U T Q2R X1UvU TKS yKKK! K3K0L3L L*[ [[!-*[8>[U T RX~lR~RRR! RsR R R2T *yXXXWXXXXiY .Y:YFY! RYUvTQ~XZUsT4UsTQ|R0%L0U~TZNUsTwUsTQvR0%LU~TQ R X~Y1Y7UsT~QR~X~Y|%L U~TQ R X~B UsT g UsT  UsT QY7 UsT~QR~X~Y| UsT QY7UsT~QX~Y|6VWq] %v6Y} YY Y9Y YYY}) ))w  ) ) )+*  *+]*  b* UsT  UsT4 UsT 6 UsT U U UsT  U U 3  3  +  6U& UtU!XU%mmUs+  +$  )+7  <+J2 O+] Y b+p qNz`m! y ----T}T6U U3& +39 >6VWE%v+KdzPVW%v%v+^ _U8U}UsT ;UsT fUsT Q|UsT UsT UsT UsT UsT DUsT iUsT UsT UsT UsT UsT UsT +nF s+m 3 3 VW%vUsQ~R1UsT Q~AUsT fUsT UsT UsT UsT UsT UsT +C 3 *'VGFV9VFV*TV  fVsVT +z+7 +9^ >+L Q+_ d+r w+ +! +H +o + U~UsT gUvT0 U}%1U~KU~cU}8{U|U~ZUsT|mUvUsT U}"U~%%TU|UsT Q|UsT UsT U}PUUsT LUsT R~mdUvmUv6U#UtUXU%mmU~\#Us@U HUsT bU~%%Uv%m%m%rUsT~VUsT~5UsT~"5UsMUs%%cSx+ h1 Q5G5aiQ&1^ 0ubi^(0ai^EQ_ 5erraa 5rb1b)85rb2b)85avc5aebd_X _h h =s# )s&s$7J]p&S+a'[;U T m.E.Ew/=O# D.)O,/O*[ O[[!-*[8>[OU T /EW8/WW3I 1y4y 4&434! ?4 L4-Y4+`40 a4 n4*'V FV9VFV*TV  fVsVT 1U|TQ0E1U|TQ}m]1U}mu1U}U|T QR 6W3N2W9 XXYX d2X XU9%X1X=XIX6W/:3W9 XXYXp3X XU9%X1X=XIXU|T S3+31 }40ubi/0ai%}4-0ec75erru_&  p^5[U T 5Uv Tsa'UsTvQs({H6aiC}4U T*S "S-S9SES! QS \S fShSzS{HY7:)8g*9=@# D8)@,9@*[ @[[!-*[8>[@U T RXYv;P9S :=a# D:)ak:a*[ a[[!-*[8>[aU T >:UQR|)I;UT|Q}R%L0;UY4%Ls;UTQRvXY4;UT Q~g;UT0PU|HCR=HHHH"= HH6R<RRSSUTQ3R6[<[8>[%U T Q 6[E =[lR">~RRR! RsR R R2T eWe>qW}WW)I>UT|Q}R9>T%c)8{JH[U T RsA=# D;A)A*[ [[!-*[8>[U T RsB=# D-B)B*[ [[!-*[8>[U T RsC=# DC)C*[ [[!-*[8>[U T RsD=# DD)tD*[ [[!-*[8>[U T RsE=# DE)fE*[ [[!-*[8>[U T Rs6PT@FTbToT|TTUQsX|6UFUtUXU%mmU}6T  FT6U+GUtUXU%mmU}GUGU Q| $ &GU\G@U  HUTsQ}R0:HUkHUT QsR~T 1 )I0aiCQ "b5avXx &J# J* J J[U T R|N}# DN`rNW[ [[!-*[~>[U T R|O}# DN`_OW[ [[!-*[~>[U T R|YlR OP~RRR RsR R R2T iyXLQXXWXXXXiY5Q.Y:YFY! RYUvTsQ|XWTX`XlXWXXXXiY.R.Y:YFY! RYU|TvQsXlRKai+QKaebDRKai>2T Q SKaiKQ' ';Qg TKaigGQ'h'h%X'i;uavkupl>>l.)8X+T S>qS>>&}# S`S>U T R|S+T+T1PT&1|T0ubi|=0buf|H} }0len}"X, &J# J* 1e#UeJzX!UX0 z0buf1&41 tV0ubi t<1'V0err%1 %TV ; G`1|.V|D|P`&X1%XV<&)1z0qVzC`zX+1UqVWU!GU4XUGXVlV"4XFq Z;W';1)8';G)8'<>1sWs6W&)u  1jWj8WjVWZ X'/Z%X'7ZTX'2'K&`ZyXKnew4'KZXKnew/'FZXKnew1''&`QjY'jFuretl&>o>pQA_YKnewA@'B'CuretEZ#Y'#5Y`%&`&Q SY' S' -?> ?Q SY' #S' 1?' ?)Z:EZ)TZ)cZ)rZ)Z)&Z)vZ)vZ)vZ)v&)vZ['2G'<'XQ"4[Kkey"J9['"Z(B4[Q,,[&>1 n[>1 [>1 [>1 ![>1 ?&>1 SQ A![Kptr A<Q 4![Kptr 4=Q '#\' '0!U_3U MU ZU@U 3gUK]rlU yU*'VE FV9VFV*TV  fVsVhVrV6V  -]VV0T Q@3U] U U*TVIfVsVU|T UOu_UUUhU UY4`_ZZ)Z6ZEZTZcZrZ+ZF_ZZZZZU?T| cT0mUsS9Pb"S-S9SES QS \S fS3S`zS+SPa S S9'VFV9VFVtTV  fVsVsV V6V  1aVV0T Q@ieWaqW}WW3S5bS3Sb SW[ [[!-*[~>[9U} T~lR9b~RRR RhRrR RFR cTR_RTT"a& **F*R& K& W o& & & & bint W ,& *&2s8c2u8v2s162u16 2s32 )2u322s642u64a m& *  1W 2W Ht Ia X ] ^a _ `K&& % ' <W  8 /     #| k& % & ** 4 = B U  h) l n8 qL } B  L  L  W  W  L H w ` B K0*XX h0hX]ctde*W)  *         9%fH # F  Ϊ "ݪ    (  p$0  >8  @   "H   "H  "H H  "H  "H   "H   "H @ A      P h  F F ͫ    W 4!kp   W( W, 0  8 k@ kA kB WD  H P?mem #@  *  W  4 9  C M  ( m0 W8 m@ WH WL RP WX W` Wh \p  x W W u$ f W u W W $ m W !$ "W % &' 9W : ? A D  F w P  QW( Tz$0 eo f* g h  u  v) w)key xmo   U  V wA  j key k  n key o ;n <=? W @ W$A W(B W+0    L* m  ( k* -@ \3WW m Z7( W,!W0( 4)(8*WH+*P,X5 `6 d8 h: l; p< t=Wx8se?B@!rt@D?dlADBDFG)IJ*KWOGX G] G)`"@@dhWkW l*m n0G o5G(p'0q mXs`ubx dyFhzp{?G*    F ?4()P!mm_h_p3Hx    *W W, W, W, W- W- W- W- W- W- W- W- W- W - W - W - W -"W -**!pid S S* (0@HPHX "I%?(?+ m- L. L3 L4?6?: w(=*0>*8A L@D LHG*PH*XKA=`)N=ThJWhJZhJ^WKk 3maKp3 q4(t*8u*@!fsxkKH{uKP~KXK`&Oh mOp 7x 7 7e;* WXwO >W6; L  L d4 7" F ( 8 O@  mH OP OX O` Ph $Pp *x )P < W  L  L  L 37 >  3P   8  8 "=P ){P    P0  48  WX P\ P` 4h  P      !W "W # $* & L ' L ( L ))0 3P C$ D* LP N* RP S8( T8, Y*0 ] 8 ^ < _ @ ` D )a0H d{<X gP iF< lP w x z* } ~P  L L  $ w w*WPQ QQ W(W,F0?rcu00Z7@ DHv6PRxZ7 m "R R%Rm  L >)0 !"($"().0</R)F@@ @n "pad!*?@ g)@BCDE E(#sE,#dplE-#pE'/F0#avlF4#lF5#dF6#gF%7F+8 * * * * * pte " pmd " %I%%*%/,@' opgd'*'"V@p pudp*p"|*@HI*'pp0 w4*8 @@:(3sp*es ds"$&*(*0838*X*`cr2*h*p*xW3*W8** 28fpu w2@W( _ 'd @@'w@{@o 3 'u_ Iu k(,u0+u8Xuh%vp*xt mv Pvt  !"val w  *! ,!Z!Z!j!*!  w6! !j!*! ! !h!!!*i "FWFWFmFmLL 7"*! " "7" W*U"fmtVFvaW "!,;#fmtFFFWFF$ "j6b# 7 8 8#FFFF(W(W(4Wkey9@#($W=$   8Up$VmodWp$XFYu$ Z ([ ,\#0#Fu$v$w$xWyWb#$*K$* /%1Wset3Zget5s7 !) $T ' p$     ߢ     Ζ(  Ζ0 *8 !C@ " fH # P $ X %` &h 'ϣp (x ) * +8 ,` -e .8 /  0  1  2 3  5 ) 9 V ;  > ? @ĥ "% !G'% + -/  o' !)key ") ?' A* B' C' 'G' =' >mo'*'*  ;D '0!cC(!dF!e!g!i #!l( ( '" w" w#w#w#w$8($9($<($=((%<( %=W %> w%:!)%;((src%A dst%A &)1)m$W&T)  (&)&)val& 8&!8 &"8&#L&$) 8&*) &+&) &,#(*')'' )((*(a( )*&'d*&(_&)1))&.L &1*&2*&3&4 &5*&6* *(&* &%T) &/-* &7d*8&+&*fn& (+*m#+#+*+)U+)Lend)L*;+#cs*=L#sl*?L#wfe*AL*E#,#ss*GL#sti*IL*KL#nmi*ML*PL *SL0*VL8#lm*XL9*]L:*dL<*P,"cs*"csx*L *U+*},"ss*"ssx*L *+*g-r15*m*r14*n*r13*o*r12*p*bp*q* bx*r*(r11*u*0r10*v*8r9*w*@r8*x*Hax*y*Pcx*z*Xdx*{*`si*|*hdi*}*p**xip**#,**sp**P,+ -+ m+ -},p,3.cwd,8swd,8twd,8fip,8 fcs,8foo,8fos,8,3.,8l8C.*,*g.rip,+Lrdp,,L,..fip,/8fcs,08foo,18fos,28 ,).C.g.0,@. ,A. ,B.8.* A,$}/cwd,%swd,&twd,'fop,(.,58,68,9}/ ,</,>.M.8/*8/*?,Qz0cwd,R8swd,S8twd,T8fip,U8 fcs,V8foo,W8fos,X8,Z3.,[l,\m,]n,^orm,_p,`q,az0x,b8-0*L0*@,:0,; L,< L,= 0L0* @@,O%1+,P.,Q0,R%1@414*k@,^1,_-5,`.,a/5,b0@,c11U* @@,f>2,hW,kW,nL,qLxfd,tL,wW,zW,W,W+,41@@,w2, L,W,W lfpu@,2,W,*,2,2,>2 ,>20+,1@@1- 3- L-LK(3*83*H3H3*M3 R3.>3.?*.@*.A8cpu.C8/w$W03     131 3 32 423 :43 w4P4 4"4d4:4 4P45 45! 5"p4 6)46* 6+7"osq6-4 6/(7  57 7 7 83508 8 8 N58$W9 k5 @9'509( 59)  9*5(9+q609,89-99.:9/;N555k55@@:/q6:0:1W:2 _ seq:3v>:45:535 :6!0:7 85(;6; ;*; 6;8 66v66<7<< w<7 7= #7=#7*37* =8 7>Z7> w >?7?+7?,t?-tx@7@7@W`@*hmax@*p*7* A 7sigA#7 A7 BRV BS88 BU% BV88 8NCc8 C  C m C =8C'8C(C)C-8C.C/C0 c8C1C59C6C7C8 c8 C<M9C=C>C?C@CACS~9CT $CUmCVm CY9CZ $C[ C^9C_*C` Ca CJ: CL CQ CWM9 C\~9 Cb9 CE6:CFm9CgZ:Chm_fdCiCm:CnmCoCpW N C%: C*o8 C28"_rtC98 CB9 Cd: Cj6: CqZ::*0D ;;D D D D :0D O;: D;; [;D ;D!D" 7 D%;D'8D(*D.,8D0 7 D3;saD4; E +<E E *lenE *E k(FF<F DG${<G%G'G( 0GD<GM#+<GPk(GWk)8H =HLHLHLHLHL H#L(H,L0I)A=I*LI+35PI8v=I9v=I:WHI;WL==*8ID=0IE0IF4IGW0 J>%>JKJZJpJJJendJ%>K4>4*K!O>K" W K&4>KDv>KDO> KD[>KE>KEO> KE>KT >KY>KZ d4 K[>L >valL L >L ?valL  L >SX?U LV LW7".W[?    0h?iO>jkX?cpulWmLnL oL( @@*k@* 83@@@ L L L 8 8* *(*0W8 @B L L L L L  L( L0 L8 B@ LH LP BX B` Lh Lp Lx  L  L  L  L L L L L L L L L L @C@@+ ! L(" L0# L8%@&P'Q(R)S, LX- L`. Lh/ Lp0 Bx1 L3 L6 7C9C;C=*8avgGk@@B C0KrDLM*N*OW P$Q&SrD(D*]DDkDDD3`F+ah Li L j L(k L0l L8s B@t LHuWPWWWWWWWW+k5X+k5rq%FwDFD*^ FF!FDVrq!FuFW W WW@FmFObuFOs8FFFL G G G*F0G*'' :G3 3H zY } S  0@  wD  wH P *`  *h )p *x   d4  S  mDGWpidpM7HM9 Z7M:WM; d4M<QVinoM=LM?~ M@@MBXSH,rcuMC0`MD~p8HH* NINWNWcHOocJOp uidOq >gidOr ? Os >Ot ?Ou >Ov ?Ow > Ox ?$Oy W(Oz~0O{~8O|~@O}~HO~~POXOWK`OWKhOWKpOWKxO mOO{O`;O' IcJWkeyPWKPZ7P' P semPS(PPP mXA`P _huidP >pgidP ?tPxP|P~P P*P!mJ \K fK pK zK KAXQ^&OQ_Z7Q` wQaQb QcQeXS Qh8Qke;@QnXQq`QsdQthQwpQxWtQzx(QW(QWQWQQ0Qk5Q itQQ QA=QhQ wQHQGttyQQQ >QLQ LQLQLQLQLQ?Q*Q*Q*Q'*Q* Q*(Q"*0Q,*8Q*@Q*HQ"*PQ,*XQ*`Q*hQ<pQQÅQGQ؅Q WQQkQQQ_Q4QS0KB QmOQd4QZ7QXSQ7 +O rO |O O O OXRcPRd Re wRg Rk d4Rm}Rn(Ro0Rqge8O PO; .P 8P S{PS%S SBP PP* P P P*P*= P P7P* P P QhTyQTzkT|WT}l'kTk(Tv60T*XT#l`Q@U4RU5RU6 mU7*U8*U9{ U;W(U=W,U>H0U?o8Q  R R  R *RVwVwVwV!wV%wV'wV,wV/wd4V3wV5wV9wV<wVAwVDwVHwVLwVQwVUwVYwW#XSW$d4W% W' 0S%Xw%Xw%Xw(Y0SY1 Y7 osqY94Y;7"Y<%Yw%Yw%Yw%Yw%YwZ"6TZ#^TZ&^TZ'^TZ' cT6T^T[T[d4[ :[TC[hT[T'T\3T\48len\48\2TT \6L\1UT\8 T\iBU \j \kBUXSX\rtU \s \t6TC\u0\RLV\TW\U>\V6T\WQV\XT \YzY0\[Y8\_"KZ`\`^h\a*p\bmx0\dT U\m\n,d_u\vGU tUtU x {zY | G } ~ >  ? W    !]  ^( 3H0  m8 *@H  ;L  P  _X  _`  _h 8p 8t 8x 8| d4     $ 8 S * *   g       n0 @ H  wP  wT  wX  w\M` qh) DGp 8M@H  P ({X ` h  mpVVY*'@\FZ\L^\L^\o^\^\^ \^(\ ^0\ ^8\ ^@\ _H\_P\_X\_` YFZ @ ^   ;  *    >( !Ý0 !ȝ8 ͝@ "ܝH *P *X *` QVh Sp   w m & #  $ "  T  , t 6   W  () `  m 8 _ _ !8 " /  0  1 4  6W <4  BF@ D"KZH FdP I X L` O d Reh Sp Z{x a} b}?rcu c0 dge f4 k0) nd4@@ oH qd4X r`PZ$W\8^ L^QVW8^e^e^j^LVTQ^^e^WF^Ut^^e^^^QV^^QV^^QVzY^_QV^ ]EI_]FQV]G^]H]IX_X_]__b_^_mnt^ X_^ QV b_I___k__QV_QV^_ __ __ __m `N``W`W`F`F`Fav`aLaL(a`,cta_a&` N``b`bmbmbb ab!b" b$WHb'ab(Fkeyb) b*ab+m b,m(b-m0b. a8extb/a@'`` b3 b8atpb9ab: mb;8b<8a () cWcc8c GcWc  cLcLinoc)L devc* ;(c+ ;,uidc, >0gidc- ?4c. 8c/_@c0_Pc1_`c2_pc3Lc4Lc58c68c7Lc8Lc98c:8c;8d+cd,7"d- e"ce#0nide&e-*e4*e7PeRdeSdeUdeXmeYeZ Wec Z7 edH(,rcuee0HegmXej`idempepteqFxerQVeud*dddccd fdf Z7Yg g"dge gd4 gdgAedgWgmm h ReWebebege heh hhFeXiqeirgeisv6 wqiveHcpuiwP eXxjHfjXjHfjXf(lenj HjhfPjpeXf**hf*mxf*A@kRgkRgkRgk 0kd4@@k eHk!*k"*k#kk$v6k%geok&0 k'g0k(*8Gcpuk*@Gsspk+hH bg*`k6gk7d4k8Xfk:Xf(k;*Hk<gPk=Xk>\bgkehkfWsdakgeikh"kijigBxkDUikEgkFUikH kI4(kJd4HkK4PkL*pkM*xkN*kO*kP*kQ*kR*kS*kTkkU*kV4kWHkY wk\*k]*k^ek_hpgei*xfhlw m3iiii*mim6im7|im8im9nj n0 n0n"3jn#)n$n%n'Wjn(n)n+{jn,n-n!j n&j n*3j n.Wj njiopsnj{j jjn2kn4*n6Wn7W $WT@=k   $WTHfk   TpkTq=kTrTsk kTkTjT*pTk0T0T*:Tlkqk@TlTfkT*T*T* T k(T,Tl0,rcuT08TlHljTlTidTll4*TlTl l(o-mo7"oBoo p mpLp& p)Sldtp*m8p.*@p94Hp:mhp;npp= wxpC|pD~ mq nqmq*altq*q*q* q*(qo0qm8qm@qmHqmPqmXqm`qmhqmpqmxqmq mq!m mn pF-m\o^ m`WXBo"lruYn d eido j * k*(Rooh3HBos* (uoz*pp{o|*}*~  oo*#pp mrpr}refr8rHHr hrWlr*popsr xrmr#p:(QpdooooC0p W  w@ qval**p6MIqN mPW1JfqOlruK"q1WqX mYq6@GqI*IqU3HV * fq([ w0\ w4^*8;@Frq5j6(mrn*o*q wr ws wt wvW ;@lrr5z60}r~** m m m  m(6 3s**;@|Vsrr53Dzs'q'r@'3s** zs3 t  d4  <   + 3H  m  zY( W0 W4 hJ8 b_@hP  p  mx #͛ $  %  'қ's5tctx6t t=t>d@%>(X uYS(\_ub*h*t6w }$6u**;u_u501uszsr u8rb*t usbvsc sh sjsksq ss(st0su8sw1@s{Hs~PsYXsm`shspsx vvt u@d4D*H*P'*X3*`*h!brk*p!*x**%*0*m{}{@{n*hd4p{x{t&{** w wl ge{**  Vww*}{*3l{* { {a { {*{4** W{ps/k|as7k|(pmds9 0puds; 8f@sEHsFPptesL XptlsPR`sT h.W|      @ DDDDD%t6w%t9w%t<w%tGw8rm}r*r1r1r*r* r*(rk0 m}9kw}u,}u- d4u/ 0u0m}0v3 ~v4j~v6v7v8 kxav9}  vB~v v" mv$d4@@v-j~lruv/ ~v0  B~M2~nrM3nsM4~3~*o~~4*w ~valwL w~$Wx ~   ~ y>yy y%zw>?{{{*  P PPl,rcuPm0PnZ7Po kPvPxPy Pu"xP*(PrcPt*PmPrPF ccN P Pm P wm* PÀWKWKhP PkeyPWKPm:PA PCPPc P _ P _(PP*P*PmPrP  (PɁ Pc6 PPP _1 P PwɁ  || Z7|l|*0| 8|@uid| >P| X| w`|$C"hOނO Z7OgidO ނ?4*:O OZrcuO0&A@@:g:h7"cpu:iW:jW:kW :lW:mW:nW:oW:pW:rW:s:t:uW:{  :|5(:} 0:~580:&@@9 H5@7*;G*?8QQ Q! mQ"*Q#LQ#L Q$*(Q$*0Q'؄Q(LQ)LQ0 Q1 Q2 Q3 QC(QD؄QLPQMQNP(8QQQR wQS(QTHU*H*  f7Ӆ* Ӆ ݅}}0~E~~~XS0~0 ` ,rss :08XS@ wX fn !)arg mvˆ* b ˆ  8RS RT RU:RW; RXCRY08RI{qRJiocRKP' R\W0 {;  val  ·val  <in*v8_` abc kd k,rcue0 reff0ڇ v * %$     . 0  4 4A5W6A7jQQ*[ V `ev*0 p qt r  s  t m u  v$(  >  1 ? ·P  W G   _ _( _8 tHЉ(f)*+ ,0-4@. d4`/ wd0^h1p2 x3*4  val f r$W6   BE"uidF >"gidG ? H DċJH      ( 0 _8 _@H`* W(W, 0 8m@ `! p$`@89:;<= >(?0@/8 e^*^*XDݎEFG HI J(K0N 8O=@QVHS/P 4^zY 8zY8$VzYBxYJZ[L\L]L^L _L(`L0aB8cB@dHeLfLPgLXhL`iBhjp8WWWW WWWino  $( $0WJ * WWW WWWWXHk (ʒ08ʒ@HP k^_M^Wp^ Œ^Œ[^*Œϒ^T8 f W S f0 vH!ops! zYv** *1 w }  ԓ ԓmœmٓ  8 V o     ԕ( 0  8  9@  RH  bP  ΖX ` h  #p  Bx [     ..3 QtQVs=o3H.[k3HQt ϕt3HWϕAeQt3HWWQmٕ3H 9Q$kRQ0>bQW{{(+Ζ,-k.k/  g3HQQ~ӖQk#Q =Q==k([3HQGyyt~ `t{1  ^ W;  5 01 + !+  ;';zY01  P ۘ    Whۘp$@ops +HPdev;`Wd  @ ZX [ \ ]# ^A `_  b( d0 e8 f@ hH jP k,X mY` o|h pp r ǧx s u  v5 yX {v }  ڨ  X b l v  (  t  4pid H 3uid  > >  $ h  * W W  W W  1  4  L;  )͛5 *0 +( , -* Pm 0 -     + -HE>*&  U  ;  ;  j   (  ;0  8 @ H ԩP X ԩ` h p  x . . . .  V  ~       CݎH ҝם     ' 1A@            W$W(W,W0 W4#F8$@'"dH*#iP-WX0W\5`6 nh<p=x?@ B6D6FYHYJL NP R6UWY[ \]^_`a b(c0d 8e @jHk PqkXsi`v0xxzm|p$?dev}u~d!dbg-; K*K,*$* 9>kffFLWk   ,pos  *  WtߢtPtFP  W% Ctf/#\t\a HmtW*ktzYtϣtכtԣt.t.3 *`t****=`PtPWjtPPWؤtؤAeݤ m tt$ VttW.ttW[W ĥ WQVzYQVWɥFQVzY#zY AzYk(_QVFzYQVGkdQVzYQVzYQVzYQVFæzYQVG,zYQVG; YzYQVzYQVW1wQVw1^_8WbǧQVzYLL ̧ zY5zYQVtWGXzYtG:vQV]QV{QV ڨQVƨ  mt e *zYߨ .W F   zYU^FjzYZzY.ozY^^"ԩ^ũQV ٩^?.QVV^3~^F[zYm^dĪĪɪ  ӪتQV>Fm "*@@ȫAFBCͫD E(sdF0Gd8(IW(JW(KW(LW(MW  *rev* 9 w wF,rbnso0W8< G>@idL` mhFp,rcu0x9 :ops! h# 3"L$ e% & (( 02 89k@: H= ԯP@XA ` :   A"dirҫ   Aknt m4 4@`h x    k@  kA %vK3(Lm8mePQmmPjm#ԯ\ٯ $W3  0'() |}* +, - !)( 39mo 9o!!F! G!m !n !o&X!0!1ư!2 !3 m!42 !5 _(!7 0!9 _8!; @!= H!?ײP ı GͫưɱGͫ#ͫ 93H-_tͫ7tͫdtͫײtͫ!! %! H ܲ%ͫ HͫF*` d4 wXM0tu v w!x*2yF z `( ͫC(((-ȫoF-7`-UZKB }~ǴGbuf״ Ǵ*״*?KU*6Or 1-" 1FJ-; Jh-heT m(˵***** 0,rcu102d3|4* HkIkJK LM*N{ ˵u ?p@poHFPXbusJ`Wh mp mx4+ty !msi\(8@LHLPX `hx \a ;!id8d4 &!!# $%'#)+ k`, ka- kb. kc/ kd9 ke< kf u:_; <Dк  !к"к#к $к(%к0&к8'к@(кH)кP*кX+к`,кh-кp.кx/к0к1к2к3к4к5к kкppպ.Uu   .WlE    Hxy d4zW|W}4~0@  8_ k  k! k" k# k$ k% k& k' k( k)8d4 H @ k@ kA kB kC kD kE+k5PLgeXS  w wW k k k k k k k  k  k  k  k WLLLL  %(!qos/0+,Fid-./d4 0 (1v602*X3 `4 h5 p6 x7 8*9*:*;*<*dev=p(> k(? k E%p) *opskк к  pkpWMNFOFP!Q!R! T (U'0Vк8W @X HY P[кX\к`^@h_кpaкxcкd pmfEhk p`aFbusbJdp$eFgk h$j(kH0mк8n @oкHp Pq@Xrк`s!ht!ppmvExw pyR ""h?@p_,`23F5!6!8'9  ; +(< 0>к8@((@A?HC YPpmEEX O"G&&o?"0Y"UZD0XYFZ!['\ ^ pm`E( ^*m (m  B D E F G H} Im(  A-K : @N O* P Q  * ) . 8SBS    ZNBf rFU(EUFFmodGp$opsH!1I $JKx s_L"argM m"strN"arrO,VWWX  \'max^W_Wnum`:opsa!1bm '%0(R0)RHc* * W ?  K*7` -# .mod /p$@ 0ͫHmp 1(P 2IX #8 5 6ư 7  9  ;  <( = 0-Fp$Fp$p$.W >7   38 Ecmod Fp$+ G63P p qm rm sk tW8mtn w7    W    3 Hc4*' > Haha ka zp"c$W-  Ȟ  @o  Cidcls C Mv"UZeWW*.W   .W   8\ 0!r}" .W1      .WB  .WO  cjd&e2f4gk lidhk j4 ~ L Vcma 0a1F2 3F4f6X7`8ah9ap:ax>*?m@/0ops1"rdev4p56(78 ff  w *K*K*$WA  mgetput  1  E( ^08@HPX`h5pxSl AmQRWidSWTPfghWi0k o1"E6k^FJFWmcFu$FF0FFWW0NNw:mlXWq  8 m   01w2345  len ! $% & '  ($ +#,W-W.WHFGWlenH I J K  L (M 0N 8O@\]8^8jecck#m# P ( U(PQV(-LL8 Hd44 (WwsKAeTK1K1TT#;|K|^*K$WrE8     rNmrT }rZre 8}r{{p**Yrrrr-+4*r r-+m6(s0avmas1s2 0s3 *s4*s5* 1s>s? s@ ****{{W{{***1"Y*m6Fm^PrP*$*wW  cxd e f g v h v i j ok vl xcrcm v*XZrb  ,uecB+e+:;;*B * XJ8devKuL!ubiMXN`OdPhQlRpStTkxV|WXYZ[ \]^_a$b(c 0d 8em@gHhW"iW"jW"kW"lW"mW"nW" ,-8dev.uh/X0\1h25p3 d4x4|56k89:;<>?@AEB4DFIJ d4KL4O!fmPJQ@ R@, SS8TS`UmV WgeXYZ;[\_`abc!pqdOef d4g4hSij_k;l;mno p(q0rd4u HvPwTxXy\z`{d|h}l~ptx|WW!mtdm44i!dbg  x5WWWWWWWWWW W QV QV(QV0QV8QV@QVHQVPQVXQV`QVhQVpE*_* ;Kt* xyU ozwm[Um*{[FIJ-ubi'-fmt8FIPvaf"w/ !wQ7/;# / KU Rw<R* ;#J-ubi(-fmt9FIPvaf"w/ !wQ7}/;# / KU Rw<R* J-ubi'-fmt8FIPvaf"w/ !wQ7\/;# / KU Qw<\?-buf#o|0TR:=iJo<G-ubio0]UUT }\-ubi\-E^^Ec Ec ]UUT \05-ubi0)R02=buf2m=err3=i3=vol4~%95E9m<^ E>w@<t_U|TvQsR}X0_U}v`@-ubi0-bufAoR =iP 7/;# / K2U T QK<RP* @werr%S2FS<SW,,`>7>o7>7>7>8`>Lp/1++G+XG1Q1] u1 1 1 1 int ] ,1 *1Hs8iHu8|Hs16Hu16&Hs325Hu32Hs64Hu64]% ~ 1 +  1] 2] H I X ] ^ _ `Q11 % ' ) <]  D c    #1 % & 4 = B U h5 l nD qX } N X X ] ] X u     N        C  C C HCQ]+   ]+W5+    : KSUH T G  L "[ ~  %( f#0 8 @ -!H -!H -!H H -!H -!H -!H -!H+@r DBPTh!GGK ]l4,kp ](],0 8@AB]D HFPYmem@ + ]8  (0]8@]H]LP]X`]hp  x]]k#]]]# ]!#"]%&&9]:?AD PF P  Q](Tp#0Te f+g h u v5w5 keyx  U V  j/ keyk nL keyo ; <=$? ] $@ ]$$A ]($B ]++-@ h53]]  37( ],!]0( 4)v(8*]H++P,hX5 `6 d8 h: l; p< t=]xCse?wB@,rt@CYdlAvDBqDFF7IJ+K]OFXF]F7`"@@dh]k] l+m n G oG(pm'0q Xs`ubx dyFhzp{G+    F ?4(7P,mmhp Hx    +] ], ], ], ]- ]- ]- ]- ]- ]- ]- ]- ]- ] - ] - ] - ] -"] -+w*,pid  +h hh(0@HPHX "H%(+ - X. X3 X4>6a?: (=+0>+8A X@D XHG+PH+XK=`7N_=TBJWBJZBJ^1Kk 2m;Kp3 q3(t+8u+@,fsxEKH{OKP~YKXcK`Oh GOp 7x 7 7>;+ ]QO >]6; X  X =4 X! F ( h8 @  H eOP oOX yO` Oh Op +x P < ]  X  X  X  7 v>   P   D  D "P )UP    _P0  l48  ]X dP\ yP` l4h  P      !] "] # $+ & X ' X ( X 7)] 3P C# D+ LP N+ RP SD( TD, Y+0 ] 8 ^ < _ @ ` D 7a]H dT<X gP i< lP w x z+ } ~P  X X  #  +]PPPYQ ](],F0Yrcu]037@ DhHO6PQx37  "Q QQ  X >7] !"($"(7.]< R7Fq@@ B%C&D&$E& $E&(-sE&,-dplE&--pE'&/$F&0-avlF&4-lF&5-dF&6-gF%&7$F+&8+++++ x pte%"a  pmd1"%%%U8%/Z' pgd'I8'"Zp pudp=8p"8*/@HqI+2pp0 4+8+@@3sp+es ds"$&+(+038+X+`cr2+h+p+x03+]D++ 2Cfpu 2@] (  ]'+@@2uw@{@x?$ 2nu u (,u09u8Xuh%vp+x~t v:Pvt*M *q && .val ") "M  q , *   +! "  !!  !mm   X!   =! !!!X!!!! !!]!+,"0"fmt"G"G"G"]"G"G$!#6X"#7 #8/ 8#"#G#G#G#G3#]3#]3#4] key#95"(&]#=" 8#Uf##V mod#Wf##XG#Yk# #Z (#[ ,#\"0TG #u##v##w##x]#y]X""+Q#+ $/$$1] set$3 get$5$7 (#v%f#p   ܤ  ( 08!@" @H# ^P$ ^X%w`&h'p(x)̥*+,:-?./ g0 1 r23 5 9 ԧ; >̥?$@B$]"& &!`&&% &+ &-&/ ' &'!5 key'"5'?&'A+'B&'C& &`& '=&'>&&]3]'     +m'+ ;m' 0(c'(dG(ee(g(i (l l(~' )  )  * * * +84(+9O( +<O(+=O(4(,<v(,=],>  ,:(,;4(T( src,A& dst,A &((&]-((-<)-<) val- D-!D -"D-#X-$<) D-*c)-+&)-,#) .).. c) /)/a/ 5)-')-(-)(A)-.X -1?*-2D*-3-4 -5+-6+ ?*(-w*-%(-/)-7) 8-*-+ fn- *I***w** 0*0X end0X 1;+-cs1=X-sl1?X-wfe1AX 1E+-ss1GX-sti1IX$1KX-nmi1MX$1PX $1SX0$1VX8-lm1XX9$1]X:$1dX<1+.cs1&.csx1X1*1 ,.ss1&.ssx1X1+ 1g- r151m+ r141n+ r131o+ r121p+ bp1q+ bx1r+( r111u+0 r101v+8 r91w+@ r81x+H ax1y+P cx1z+X dx1{+` si1|+h di1}+p1+x ip1++1+ sp1++ 2 ;-2 2 ;- , p3- cwd3D swd3D twd3D fip3D fcs3D foo3D fos3D3-3DlD-+*3*- rip3+X rdp3,X*3.5. fip3/D fcs30D foo31D fos32D 3)I."-"-03@k.3Ak.3Bk.D{.+ [3$ / cwd3%& swd3&& twd3'& fop3(&5.35D36D39 / 3</3>k.nI.D/+D-/+? 3Q 0 cwd3RD swd3SD twd3TD fip3UD fcs3VD foo3WD fos3XD3Z-3[l3\m3]n3^o rm3_p3`q3a 0x3bD-0+X/0+@3:h03; X3< X3= h0Xx0++@@3O093P{.3Q/03R0@0I+@3^1!3_@-J3`{.!3a-/J3bx0@!3c1*1w++@@3f13h]3k]3nX3qXxfd3tX3w]3z]3]3]930@@323 X3]3] fpu@3}23]3+3}23}231 31093*1@@*1 4 24 X4XQ2+ 2 ! " #ʱ2m3+!3!3+&3 +3 5>w35?+5@+5AD cpu5CD 6&]73 838 3 3 9 39 : 4: ;)4;=! ;=44;)4< `4<!!<"I4 =)4=*:=+X! osq=-3 =/ (> 4> > > ? 5@? ? 9 ? '5?&]@ D5@@'5@@(4@) 9 @*5(@+J60@,8@-9@.:@/;'555D55@@A/J6A0A1]A2  seqA3O>A45A5 5 A60A7 985 (B6B B+B 6BD 66O66 C6CC C6 6D 6D6+ 7+D86 E37E E7 F+g7F,F- xG7G7G]`G+h maxG+p+7+ H 7 sigH6H7IR~IS77IUUIV87oJ<8J J J 8J'l8J(J)J-8J.J/J0 <8J1J58J6J7J8 <8 J<&9J=J>J?J@JAJSW9JT #JUJV JY{9JZ #J[ J^9J_+J` Ja JJ9JLJQ JW&9J\W9Jb{9 JE:JF9Jg3:Jh _fdJiJmd:JnJoJp] o J%:J*H8J2l8._rtJ98JB8Jd9Jj:Jq3::+*0K ;K K K K d: 0K (;:K; 4; K f;K!K" 7 K%;K'7K(+K.8K0 7 K3; saK4f; L <L  L + lenL +L  (M<M  N$T<N%*N'N( 0ND<NM#<NP(NW) 8O <OXOXOXOXOX O#X(O,X0 P)=P*XP+ 5 PP8O=P9O=P:]HP;]L<_=+8PD=@PE]PFl4PG]0 Q>=QKQZQpQQQ endQ=Q >I+ R!(>R" ]R& > RDO>RD(>RD4> REv>RE(>RE[>RT >RYv>RZ =4R[>S > valSS >S > valS S >S1?U XV XWX!=][a?0h?i(>jk1?cpul]mXnX oX( @+D@+ D?@@@ X X X D D+ +(+0]8+@wB X X X X X  X( X0 X8 N@ XH XP NX N` Xh Xp Xx  X  X  X  X X X X X X X X X X+@C@9 ! X(" X0# X8%@&P'Q(R)S, XX- X`. Xh/ Xp0 Nx1 X3 X6 7C9C;C=+CavgGD@@wB C0KKDLM+N+O] P$Q&SKD(C8]]DbDqDqDvD?`E9ah Xi X j X(k X0l X8s N@t XHu]P]]]]]]]]9D5X9D5rqEPDEqD8^EEhEqDxrqENF#] #] #]#]ZFFpbNFpsDFFFm FF FF G+y'm' G? HZY[jS ]@ D HP+` +h)p+x ƈ=4jS GypidpT7HT9 37T:]T; =4T<0V inoT=XT?t T@@TB7SH:rcuTC]`TDpHH+ UHU]U7cHVo=JVp: uidVq > gidVr > Vs >Vt >Vu >Vv >Vw > Vx >$Vy ](Vz0V{8V|@V}HV~PVXV1K`V1KhV1KpV1KxV VV{V9;V2DŽH=JykeyW1KW37Wk2W semWjS(WPW X`W _h uidW >p gidW >tWwxW|W~W W+ʃWGJ 6K @K JK TK ^K[XX^OX_37X` XaXb XcXe7S Xhh8Xk>;@XnXXq`XsdXthhXwpXx]tXzdx3X]3X]X]XX@XD5X 9 itXiXX=XyhX XHXgttyXXX >XXX XXXXXXXXXX>X+X+X+X'+X+ X+(X"+0X,+8X+@X+HX"+PX,+XX+`X+hX<pXXX!XX ]XXXXXXl4XjS0hK\ XGOX=4X37X7SX O LO VO `O jO tO XYcOYd:Ye Yg Yk =4Ym[Yn_(Yo0YqGe8~O O(; P P ZUPZZZP ZPtP+ tP ~P P+P+= P Pg7P+ P P Ph[yYQ[zj[|][}il2k[k([O60[+X[#nl`P @\4Q\5Q\6 \7+\8+\9{ \;](\=],\>u0\?8^Q Q Q Q R X!   ! % ' , /=4 3 5 9 < A D H L Q U Y ]#7S]$=4]%]' S)^)^)^ (_0S_1:_7: osq_93_;X!_<)_)_)_)_)_ `"T`#=T `&=T`'=T`' BTT=T*akTa=4a TaT]a"GTaT2kT*b3Tb4D lenb4Db2T"Tb6X b1TTb8Tbi!Ubjbk!U7SzbrSUbsbtT]bu]bR+VbT]bUv>bVTbW0VbXT bYZY0b[_Y8b_"+Z`b`]hba+pbbx@bdTTbmbn:d_ubv&USUSU+x{ZY| {}~ > >] !7 ]( H0 8+@H oL P _X _` _hDpDtDxD|=4 QDjS++A&& 0@H P T X \n`Kh7Gp8nH P(UX_`ih p5VoY+'@b&Zb,^b,^bO^bw^b^ b^(b ^0b ^8b ^@b ^Hbo_Pb_Xb_`oY&Z+@] o+  (!0!8@"H+P+X+`0VhjSp &ş#ޟ$S   ~t  ף] (7` D__!D"/ 0 14 6]<l4 BG@D"+ZHFdPI:XL`O ƈdRehSpZ{xabYrcuc]dGefl4k07n=4@@oHq=4Xr`0Z&]b^,^0V]^E^E^J^+VT1^r^E^]Gr^TT^^E^|^^0V^^0V^^0VZY^ ^0V ^ cE)_cF0VcG]cHcIi8_8_=_^B_ dj_ mntd 8_d 0VB_)___j_t_0V_0V]_e e _e _e f.`f]f]fGfGfG gV`gXgX(g}`:ctg_g&}` .`` h`hhh h `h!Fh" P$h$] Hh'rah(G keyh)/ h*rah+ h,(h-0h. wa8 exth/|a@&``h3 h8a tph9ah: h;Dh<D`/5 i7ciDi {i]i ! iXiX inoi)X devi* o(i+ o, uidi, >0 gidi- >4i. 8i/_@i0_Pi1_`i2_pi3Xi4Xi5Di6Di7Xi8Xi9Di:Di;D j+_cj,X!j- k"ck#] nidk&k-+k4+k7PkR~dkSdkUdkXkYkZ ]kc 37 kdH(:rcuke]HkgXkj` idkmpkptkqGxkr0Vkud+dddc_c~d: ldl 37{m m"dmdm=4md m!edm]mn 2e7eBeBeGe n|en:nn&e XoqeorGeosO6 wqoveH cpuowP e xp(fpp(fp8f( lenp:HpHfPppe8f++Hf+Xf+[@q3gq3gq3gq @q=4@@q eHq!+q"+q#q$O6q%Geq&] q'g0q(+8gcpuq*@gsspq+gH:Cg+ `q6gq7=4q88fq:8f(q;+Hq<gPq=Xq>\Cg qegqf] sdaqgFiqh5!qiKig\xqD6iqEgqF6iqH qIl4(qJ=4HqKl4PqL+pqM+xqN+qO+qP+qQ+qR+qS+qTqU+qVl4qWHqY q\+q]+q^|eq_gpgFi+Xfg rs3iiniii+i s6is7]is8is9tit0t0t"jt#5t$t%t'8jt(t)t+\jt,t-t!jt&it*jt.8j tji opstj\j jj t2jt4+t6]t7] &][@k&][HGk [p|k[qk[r[sk |k*[k[j[+[k@[][+T[k"kk@[il[Gk[+[+[+ [ ([,[il0:rcu[]8[lHkj [l[ id[sllI+ [l[l l (umuX!uNuu v mvXv& v)jS ldtv*m8v.+@v9l4Hv:hv;npv= xvC&|vD~ m w nww+ altw+w+w+ w+(w0w8w@wHwPwXw`whwpwxww w!mnvFm*\n^ `]X%o.lruY"ndeiGoj +k+*(Rwonh H%os+ *(uoz+ pp{o|+}+~: o*o+*pp  xpx~ refxЉ8xHHxhx]lx+p opsx xxxpT(Qp"Go"wo"o"o]]p] Z pval+8pKM,qN P]AJIqplruK"qAWnq!X !YpK@GqI+,qU HV + Iq([ 0\ 4^+8U@Fq"nqJj/K(mdrn+o+q r s t v] U@lr"qJz/K0}r~++     (K s++U@|9s"r"rJ/?D]s2q2dr@2s8+]s? yt ڊ =4 i   H  ZY(]0]4BJ8B_@BP p  x#$ ƈ% ƈ'2gosos5tctx6t t=t>d@=(XtYjS(\Gub+h+t7w }$Knu++Uu"GuJ]Au!js!]s uCrb+t uybvyc ;yh ;yjTykhyq ys6(yt0yu8yw@y{6Hy~6PyXy`y+hyIpybxuvtt%wXcid @@ @w Z uw+ P@@S{2%w@d@+P+X+`+h+ppgd  x) 5 ?S{E+L]S ZX!]:_a=4pjSr+++++ +(+0+8(>@=4D+H+P'+X3+`+h,brk+p!+x++%+0+X{h{@}{n+h=4p{xh{~t&{++  l:Ge{++: @wv+h{+3lx{+ x{ {a { {+{I+8 ]*{py/V|y7V|(pmdy9 0pudy; $ 8 @yE*HyF*PpteyL XptlyP{R`yT h=]| @^^^^^)z6)z9)z<)zG&]{}*}&]{}    &]{~        !"#$%&'()*+,-./0 8xGx+x2x2x+x+ x+(x0 GSQ|,|- =4|/ ]|0[ 0}3}4D}6}7}8  xa}9[ }} }" }$=4@@}-D lru}/}0:  T2o nrT3 nsT4o3+II+~ val~X~&] ـ ـ  )>> af+ aW W!Wl:rcuWm]Wn37Wo *Wv܁Wx&Wy MWu".xW+ (Wr=Wt+܁WGWLWG ==o WwWW |Q+W1K1KBw WW keyW1KWGTWW]WW=W _W _*(WW+W+WGWLW  (WW"=K WʃWW 9A W!WQ"  ł  37l+0:8@ uid >P:X `$d!h VV 37V gidV >DŽI+TVV|rcuV][@@AgAhX! cpuAi]Aj]Ak] $Al]$Am]$An]$Ao]$Ap]Ar]AsAtAu]A{ 9 A|5(A} 90A~58@A@@S9h5@+;!+? 8XX X! X"+X#XX#X X$+(X$+0 X'X(XX)X X0X1 X2 X3  XCXD XL*XMhXN* 8XQdXR XSXTH/y+H+  ?7+   ܇h07S@] ` n:rss ܇087S@ X   fn ( arg |+ b DYSYTYUހTYWYX]YY]8YIU qYJZ iocYKO҈2 Y\]0 U d valn val<ˉˉЉ in+vh8_c`:acbc$c $d :rcue] reffˉ0 v +%m& Ê. ڊ0 4Ê 45]67D+++5 0 :?|Y+^0pNjq~tr s Õt u v&$p( >   > P] {Nj  __(_8 ~tHА(@)*+ ,0-l4@. =4`/ d0]h1̍p2 x3+4 c val @L&]6BE̍.uidF >.gidG >H c DJo Hp      ( 0 _8 _@ H:+ ](], 0 8@ :!f#:@89׏:׏;׏<׏= >(?0@ 8?׏]Ï܏]̍XDEFАG HI J(K׏0N 8O@Q0HS PА]ՐZYZYc0ZYxY$Z[X\X]X^X _X(`X0aN8cN@dHeLfXPgXXhX`iNhjp8]]]] ]]]ino  Q( Q0]$+ y]]] ]]]]X"E׏^^׏ (0”8@H^PyE]_'^]]J|]|c]̍5”]۔]۔ǔv8 @ ] jS @0 PH,ops!` ZYP+p`+p+Aw!}! ÕY0I b | (0 8 @ ,H <P X˘`ߘh p x5b rȕ* +~t+9sI H5b H+Nrrw g~t H]!e+~t H]]+E HE+,+]<+1UYUZ (+,-./ C^ A˘ H++ߘ+И++5 H+!SS~t]X E:r~tgYUwA!d!]U!J]A!!! %ZY AY!P!! ! ] hf#@ ops HP devo`]dY +@Z2[`\]^`ݨ b(d#0e<8f_@hHj<PkXmש`ohp'pr Exsruvy֪{}?XĚ2 < F P Z d(ߜ~t `4pidH3uid >> $ B +]] ]] A g!l4! XU )J*]!+4(!,ߜ!-n8P+0  9h+Wӫ    ( 0 %8׏@>HRP>XR`uhp %x Ԭ  . . %"  ϟʟ ԟٟ     [@ף  ! - ! !  !  !  ! ]$](],]0 ]4#G8$@'" H*#P-]X0]\5`6 h<1p=cx?@BDFHJ&LN&PRUWYN[ ^\|]|^|_`a b(c0d ^8e ^@jHk ^PqXsi`vxxz|f#Ydev}~d,dbguף ܣQ+Q+$8@@GX]Ep pos 8 ]~t}~t *ܤ~tG*Y] ~t@ W6~t6; "^~t]+Ew~tcZY~t|~t̥~t~tѥ~t +:~t++++`gP~t*]D~t*P]l~t!e ~tƦ~t x buf       ( 0l48 opX`hpԧ~t~t]~t~t]٧] B])0V`ZY0V]GG~0VZY~neiZYZYݨ0V ĨiZY0V{#0VZY0V <ZY0V(_iZY0VGAiZY0V{diZY0V{oשiZY0VZY0V]i0V ܩ"i_"D]aE0V ,hZYhXXm JZYwZY0V~t]{֪iZY~t{i0V۪i0V5i0V5: X0V5D mt d +ZY]=]īZYӫ]īZYثZYZY%]>]*R]Ck0Vkp W] z0VԬ] ]G٬ZY.]dBBG 3 QV0V~G`-!+ @@FAGBCKD Es( sdFq0Gd83I]3J]3K]3L]3M] + rev+  qq  qG:rb ns0]8< {>@ idX` hİp:rcu]x  ops! qh} "ʱ$ %  & (( 902 89@: 9H= RP@kXA `}  .dirPv   knq~t l4 l4@`h x    @  A %vɰʱ*ϱ*9 WR6>kWp&] 0' () V* +5,? - ((S++0 S: (l(G( {(m(n.(o&8X(0)(1D(2 (3 (4 (5 ݴ((7 0(9 ݴ8(; @(= 2H(?UP3B)={`K`DG{K=jK=`S Hݴ~tK3  ~tK= 2~tK=U~tK=7(( ( ƵZK` ƵK`G `  =4 X˵ 0tnu vw!x*yĶ z ޶(nKx' FĶ޶/4ɶ\ }5~5EgbufU  E+ U+?Qfw+ ͷfGȷȷҷ (I+++++ 0~:rcu1]2d3~I+ HIJK LM+N{ I+@pHGP=Xbus`h p xl491 ,msi(8@XHXP&X +`h5x ?G o,idD=4 !!# ^$Q%['#`)k+ `, a- b. c/ d9 e< f :ݻ;<»:N  ^!N"N#N $N(%N0&N8'N@(NH)NP*NX+N`,Nh-Np.Nx/N0N1N2N3N4N5NN?^S=U=]lĽHx'y =4z]|]}l4~0,@ '+8kݻ#  # !# "# ## $# %# &# '# (# )D=4 H @ @ A B C D E9D5PXGe7S  ]                ]ccXXXX  (,qos0 +,G id-./=4 0(1O602+X3 9`4 9h5 9p6 9x7 98+9+:+;+<+ dev=3> 3? k Ľ5 $opsN 4N ^ ^M4$M]9 McNGOGP!Q!R! T(U0VN8W ^@X ^HY ^P[NX\N`^h_NpaNxcNd ^ pmfhR|| `aG busbdf#eGg h $j|(k0mN8n ^@oNHp ^PqXrN`s!ht!p pmvxw ^ pyhݻ:c `2w3G5!6!89 ; (< ^0>N8@(@AHC P pmEX {|w/4 0X8YGZ![\ ^ ^ pm`(8R+ zR  BDEFG!HIz  *ACK :^@R"&NO+PQ * 5. DZZ MmGm ($E$FG mod$Gf# ops$H!$I 0$J$K rY m$L%.arg$M .str$NR.arr$O $VM$W]$X %M $\ max$^]$_] num$` ops$a!$bW$0(@)h+   + ? ]  ?L QT+7 `-. mod/f#@0KH mp1P2HX  856D7 +9 N; c <w(= 0!!& TN!&G0cf#GSwf#hf#|=]>?8EmodFf#9G?Pp8qrst]Cmtnw  ]  M ?rh+&8  aga  !&]-0ȥw @0w  id cls  /4A]]+=]k=]8 A0!L"  =]1M=]Bq=]Ocd&e2Mf4qg lidh    X !xcma0 : 01G2 C3G46X7`8h9p:x>+?D @/B0G ops1" dev456(78 L V |++Q+X+Q+&]  get put   ( 0+8N@bHbPvX`hpxv*> QPR] idS]TPB PfgGh]i0GGGPPPPG+PG]NPGk#0GbPSGvPgGPG{GPGPGG]]UPG*P]>G/ D   O 12345 Q - len -! - $% -& !' ! (# +,]-].] HFKG] lenH I J K  L !(M K0N K8OP@ \}]D^D j ecckm}ףU  /RpMףM4kףkW 0V (XXD H l4l4 3]/Q,ף,^ף%!e^6ףhף%ף%ף!ף%!Nף+%+^ףS|ף-cףף&]xE xNxT "xZ6xeY"*{6{'Yp++;{x*xx^x*I+xx*"bK(y0vmay1y2 ]y3 +y4+y5+ Ay>0!y? x!y@ ;0T+@hY+++m{{]{{++++G+PPI+#0*b+N&]v     &]       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuZ,[\]^i_|`a1biA+ @ ? | r ec K ? ? ?  ?<A|+@   ? | | | | ? ?   ? ? ? ?  $ K( 0 ?<|+|+ cd ?e ?f ?g | h | i 3j Ik |l crcm ?|+z|rb :u ec\? e?:OO+\ ++XJCdevKLY,ubiMXN`OdPhQlRpStTxV|WXYZ[ \]^_a$b(c 0d 8e@gHh]"i]"j]"k]"l]"m]"n]"+,-YCdev.h/X0\1h2Np3 =4x4|5689:;<>?@A^Bl4DFIJ =4KLl4O,fmPcQT RT, SjS8TjS`UV WGeXYZO[\_`abc,pqdhef =4gl4hjSijxkOlOmno ph(q0r}4u HvPwTxXy\z`{d|h}l~ptx|]],mtdףl4l4i,dbg xN#]#]#]#]#]#]#]]]] ]M0V 0V(0V00V80V@0VH0VP0VX0V`0Vh0Vp^+x+ OQ+ rb!?84ec #]#]Cu ?@ Crb 892yt 0V _%% _$2 _?%% q*Dq)&q(;I/5DyD` *0 +0+ii/++/H'G]/GGG]`\ cZY~t/q0wQ0xG0vGV``/l~t/p7ZY~t}J/m o~t */o~t/P0VG{0V/  +GV00V/0VG0VWU0;,0=Ci:i<0&]fGV8G/"GV0\ }" GG0+GV032GV`]ף%/\s+~sQubi*>3L]a)")DcBQubi.~N7QubiN-LP+bdQ7R {4nSU|T6Q RvU|9U T RvX rU T RvX U T RvX U T RvX U T RvX VU T RvX U T RvX U T RvX U T RvX 'U T RvX c5 +>51ZYQf5E~t4s74ubi8D7dUUTT# E#.ZYf#B~tbs%berr&c Qs5>>bubi4wlOWL4errj&* k2*'R*U~M *Ak*@*,U~'@*U~M\)h)r)'cT Q"U}'U|T R} es6Uev?Tc2yes7UQv@QposK*4ubic(es8UeposC*T4ubic>,~t>EG>> *W+L0V4ubi4d7L rbuf2rvaloutlL L M}) )))d*t***5%*a*** +'U~TvQ0'U~T}QvD72Us'OU~T0sU~T0QDi/HZ>H+~t>H> >I>I*WK+LL0V4ubiM4dN7rbufO24valPoutM,t #,5%,%,aA- S-]-5%i-Fu-%------R . ..*.9.H.U~T@'fU2T@M,e ,5%,F,MA- S-]-5%i-Fu-%------R . ..*.9.H.U~T@'fU2T@,,,,,R,, --'-5-'fU4T@QAM,j ,5%,F,aA- S-]-5%i-Fu-%------R .e ..*.9.H.U~T@'fU2T@M,o U,5%,F,aA- S-]-5%i-Fu-%------R . ..*.9.H.9U~T@'fU2T@DU~T@Q yUvT|Q}R~7UsU~T@Q "U~T@Q LU~T@Q Di/A) N lK 4err0 _20" _2  jr.0) .'U TsjU./~ e.'U T0X + 0"OW Preq5W nm\ ON|  0  0"     `  0"      0"      0"      0"      0"    l: ))))5) 666 6<6+'+4+A+N+[+h+ j  0"     U  U  U  U  U $ U I U TvDi/,Ql +X| +l OxPaeb.f7N  0"     , 0"     \ 0"      0"      0"      0"     U *U IU hU U dU 4X+ OPav0N $ 0"     T 0"      0"      0"      0"      0"     D 0"     t 0"      0"    U U U  U ?U ^U }U U dU X+ O15Pr95Pidx@sNJ ^ 0"      0"      0"      0"      0"     N 0"     ~ 0"      0"      0"      0"     > 0"    A-)S-]-5%i-%u-%------R . ..*.9.H.U}Tv'fU2TU TTU 3U RU qU U U TvU U T}U dU XJ+:O}$Pvol}1$N9  0"      0"      0"     G 0"     w 0"      0"      0"      0"     7 0"     g 0"      0"      0"      0"     ' 0"     W 0"      0"    A-,S-]-5%i-%u-%------R . ..*.9.H.U|T"vv#,('fU2TKU jU U U U U U $U CU bU U U U U U TU#dU X9+)Od $fd1$N   f0"  f    g0"  g     h0"  h   6  i0"  i   f  j0"  j    k0"  k    l0"  l    m0"  m   &! n0"  n   V! o0"  o   ! p0"  p   ! q0"  q   ! s0"  s   " t0"  t  5"U T"U s"U "U "U "U "U #U -#U L#U k#U #U #U #U 'U T Q2R X1YsOQJ'fQ/J'N t$ S0"  S   $ T0"  T   $ U0"  U   % V0"  V   4% W0"  W   d% X0"  X   % Y0"  Y   % Z0"  Z   % [0"  [  &U 2&U Q&U p&U &U &U &U &U  'U 'U T Q2R X1YsO4!W)Pubi4(f41f4;Plen4Gerr6 7 buf8s9 outHlP();W)s;']U2{(TvQRXs(U|T RX}Y~(U|T QR}X~1)U T Q2R X1YsI)UsDi/V`tz})Bmz7BszFGX+)BtoG-BnA+X<D *G<,D );I )6ND )6RD<6VX&*E5{R]@*E]3{R0'R*R0d*RX*GG*G6usz #e # #a #;G #}{ #/ #*H #?  #ކ # ! #Q4 #]; #@ #L #X #d #`Rp #| #h #s #-= #> #T #_ # # #{ #jz # #r #K" #xu. # $: #8F #sVR #^ #j #;v # # #V # #с # #с # #7 #q # #,+ #}9 #@F #qS #z{ #t #q #D #\I #> #. # #2 #5 # # #U # #. #Z #Y  #t& #\, #2 #8 #Q> #l\D #nJ #X!P #V #p\ #_b #h #p #? # ## #@ #% # #V} #4U #m #!q #v  #} #WP) #7 #eE #S #c a # o #$} # # #q #ȇ # #v #ߚ #; #% #4 #WsC #BR #b #jq #c #I #j #I # #lE #@ #KQ #\ #'h #  #=& #Q5 #QmD #fS #7b #eq # #4 #ק #j #r #d #Y #\ #, #p #ss #gT% #Ri4 #$C #zR #a #p #s# #*( #Ş #{ # [ # #2 #h #Z # #$ #գ4 #kD #T #d #At #n #f #T #ۊ #q; #Ȋ #C # #: # #q$ # 4 #C #sa #7p # # #N #Ip # #u #Ji # #qz #+C #_ #p$ #'3 # B #f_Q #FS` #o #@~ #< #k # #WZ #l! #: #+m #z #t #  #c$ #e3 #{bB #9Q #}` #Fo #~ #D # # #C #p #K # #s( #Q( #I" #4u1 #|@ #ϨO #H.^ #1m #T| #Ʀ # #4 #/ #d #Œ #h #V[ #co # #! #[0 #=? #rN #k] #l #5{ # #9 # # #M& #W #m #` #{ # ` #  #]/ #\> #TM #.\ #\Mk #&z #y #A #: #Vy #Y # #j #n # #V #E #s. #T= #]L #n[ #fj #{y # #} #&X #t # #4 #e #P #h #VU #  #.. #k6= #&L # N[ #@6j #wy #~ #7 #3 #q # #` #g #h. #T #N #T # . # Q= #L #Gz[ #"j #:y #s #== #w #nA #  #: #O #; # #19 #‘ #- #XL #U[ #sj #-gy #Q #IP # # #ug #$ # #? #] #5 # #/ #? #O ##^ #Ym #| #P< #& #! #R #Z # ! #$j4 # 1@ #"L #G Y #h #Uu #D #W #  # #1 #JZ #wh ## # # #D# #P1 #q? #M #[ #}i #Vw #; # #4> #~d #c #> # # #JZ #rp #j # ~! #Fo/ #,= #KK #Y #g # ]u # #n #ty #9 #d #y #g # #Ru  #` #]18 #PG #UMV #5e #St #} # # #f #  #[R #|X # #$ #  #2 #}( # 7 #AF #jU #2d #/\s #؇ # #  #  # # #v #37 #x' #n  # #x ' #s.6 #BE #.T #c #9|r # # #` #] #O #G # # 1 #| #q  #> #@$ #wD #N #!F[ #t # l #Fa #d #B #^ # # # 1 #s( #W  #'- #O: #OH # 1| #' #O # # #? #  #h #bA #M #"[ #"j #8 #!h #p # #$ # #J  #m #o& #F[ #hi # w #_S #r #} # #4 # #L| #K #z #R # ! #/ #OA= #he #Lr #uJ #A #U #e #6B #$ #! #<]! #4; ! #RQ/! #ey=! #K! #c4Y! #4g! #^u! # K! #ڃ! #ȍ! #! #ߏ! #! #! #Ϩ! #(A " #p7" #k8K" #x5`" #sm" #O5" #" #^v" #>&" #t" #]" #4z" #c?" #Q" #`h # # # #e$# #w1# #`O># #$K# #0X# #e# #js# #4 #S4 #Qa4 #!m4 #yz4 #S:4 #=_4 #4 #L4 #w4 #D4 #4 #X4 #64 #5 #75 #5 #3(5 #55 #B5 #uO5 #z\5 #^i5 #v5 #e5 #H5 #O5 #55 #p5 #h5 #P5 #>&5 #Hn5 #]6 #6 #L6 #+6 #5#96 #cE6 #CR6 #`6 #l6 #oy6 #6 ##6 #6 #e6 #D6 #uJ6 #>~6 #t7 #L7 #K7 #$+7 #-U87 #*`F7 #gS7 #P`7 #&m7 #܈{7 #7 # 7 #57 # 7 #bC7 #"(7 #MJ7 #^7 #z7 #| 8 #"(8 #)8 #|68 #jD8 # V8 #k8 #}w8 #8 #SX8 #dY8 #W=8 #;/8 #2)8 #P8 #>&8 #Hn9 #@9 #9 #bf*9 #0R69 #< #< #*< #0D< #NQ< #^< #.k< #-U~< #< #< #P!< #< #< #d< #ߥ< #|< #@z = #= #zI!= #֢.= #e<= # I= #g V= #2)c= #= #M= #Ut= #!i= #}L= #H= #F= #> #y> #X0&> #y#3> #NcJ> #.8W> #Fd> #q> #> #y#> #Nc> #> #y#> #Nc> #h > #> #? #1? #ڄ? #c5? #"B? #F$Y? #m#f? #\s? # ? #{? #? #=? #R? #8j? #? #Q@ #4@ #A+@ #z9@ #F@ #R@ #j@ #Tv@ #P@ #@ # @ #@ #@ #W@ #/@ #'@ #( A #UA #h A #-A #s(;A #@HA #3UA # bA #toA #-@}A #UWA #oA #UA #-UA #rA #A #aA #<B ##s B #sB #'B #K4B #BB #nOB #;\B #0jB # wB #tPB #gB # B #cB #hB #hB #"_B #.B #B #| C #+7C #&C #D3C #@6tC #C #C #<C #FSC #C #eC #tC #C #FC #MC #D # D #kD #(D # R6D #RD #FS`D #nD #@}D #D #+D #RD #D #~}D #D #%lD #T2D #tD #( E #WE #nb'E #">5E #3CE #0cQE #n_E #SImE #U|E #HE #DE #^E #gE #2E #E #kE #eE #u9E #l F #F #%F #53F #XAF #OF #_]F #i=kF #uyF #KYF #F #F #̖F #F # |F #6F #F #`F #1G # G #"G #F91G #md?G #N=NG #l\G #[jG #QRxG #!G #vG #}G #XG #SG #2G #cMG #G #X>G #AH #B.H #[ H #0.H #NI #?LI #>ZI # ehI #'vI #|mI #eI #lI #I #I #<I #8I #iFI #WsI #JJ #kJ #,5.J #:=J #7$YJ #2gJ #'uJ #J #y:J #J #]lJ #`J #J #NK #IK ## K #.K #n>K # cK #qK #qK #XK #BK #RK #|wK #~#K #i%K #QKK #L #1L #ʕL #P~,L #:L #BHL #maVL #[dL #rL # L #EL #HL #L #~L #2)L #,L #eL #$ M #s#M #|&M #}@M #XhM #9uM #eM #EM #@M #sM #M #fM #;4M #-M #JN #N #.MN #P+N #8N # EN #xRN #KD_N #*SlN #yN #N #N #}N #UN ##N #eN #NoN #O #!O #4O #I}[O #AhO #cquO #`O #O #O #OO #O #&O #b1O #O #O #O #x P #P #X#P #:0P #=P #ϐJP #$OWP #A!dP #NqP #cl~P #GP # P #P #P #aP #%P #kUP #_`P #5P #)Q #\xQ #ҥ+Q # 9Q # GQ #FUQ #cQ #qQ #Q #XQ #IQ #FSQ #Q #cQ #@cQ #@Q #Q #< R #WZR #l!'R #65R #CR #zQR #t_R #mR #k{R #&R #R #`R #WR #6lR #QR #WR #@R #R # S #S ##S #}l1S #?S #MS #2[S #iS #xwS #?<S #S #}S #2)S #GS #7S #S #.S #S #S #T #9T #bCT #+T #zJ8T #eET #NRT #/_T #t{lT #T #T #kT #(T #8T #T #kT #[DT #aT #IU #EU #e-U #-7U #ZQU #([U #eU #yoU #H|U #U #0U #2:U #JU #U #ZU #4U #XU #qU #$j V #*`V #%V #62V #h?V #LV #YV #hlV #%vV #V #V #&V #РV #DV #V #ߚV #mV #V #pV #W #W #JZ5W #UBW #?OW #l\W #$iW #W # 9W #eW #uW #W #nwW #W #X #X #,X #9X #DGX #mYTX #haX #AKX #X #HX #HX #RX #0X #{ZX ##Y # v1Y #>Y # KY #ޡXY #efY #dsY #dY #WY #BY # Y #hY #k2Y #MY #Z #` Z #e(Z #!5Z #IBZ #WOZ #\Z #}^iZ #[|Z #ʢZ #=Z #(Z #jZ #͟Z #;Z #,Z #Z # [ #e[ #`[ #z+[ #d8[ #WE[ #R[ #~E_[ #(l[ #3y[ #Bq[ #F[ #? [ #~[ #/[ #=[ #l[ #[ #h[ #h\ # (\ #[kW\ #;d\ #kq\ #q~\ #4\ #8\ #\ #H&\ #x\ #\ #\ #x ] #r] #x0] #r<] #+H] #XU] #S|] #)] #3] #B ] #M] #\] #/K] #:] #] #:] #) ] #u] #] #+|^ #i ^ #^ #^ #,^ #=9^ #=G^ #=Z^ #.?g^ #kC^ #^ #^ #^ #^ #D^ #^ #@^ #^ # W _ #q&_ #E3>_ #t K_ #wt_ #'_ #1_ #1_ # _ #e_ #2)_ #_ #P_ #J_ #r_ #` #%` #e2` #-?` #.L` #Y` #)sf` #Üt` #~` #.` #` #*`` #`` #` #% ` #`` #` #a #y a #:a #!'a #`g4a #Aa #yNa #*e[a #pha #ua #2 a ##a #|a #ϊa #Ka #"Ca #b #s!b #i^4b #3Kb #O^db #@qb #7~b #b #K1b #b #Gb # b #mHb # b #Xc # 1c #c #Z9c #PFc #{c #tc #Oc #|Vc #gVc #|c #ϊd #3+d #6Cd #Wd #i^ed #yd #|Vd #Jd #md #$d #d #d #d #q e #e #7 e #H->e #hWe #ee #se #/e #e #e #>e #=Xe #me #ee #if #(f #v:f #IHf # Vf #ڋdf #arf #f #f #f #f #מf #ikf #_Gf #kf #K`f #g #g # g #z@.g #: Ig #fg #Mpg #~g # g #JZg #Mg #eg #g #g #-g #g #4g #Th #:m%h #w}Ch #\h #~ih # 6h #Rph #h #h #h #[h #(h #h #i #Kmi #4 i #-i #4;i #Ii #ZWi #9cei #JZsi #|\i #pi #U i #@6i #i #i #j #j #؟,j #Oj #]j #9kj #-yj #j # j #j #%1j #(j #>j #ucj #'hj #D k #!k #!k #P/k #P=k #*vKk #qYk #gk #Yuk #k #k #pk #lk # k #%k #3-k #Ok #8k #Au l #LSl #S8)l # 8l #Gl #el #tl #Al #l #-l #l #5l #]l #l #-l #l #/ m #.m #P(m #}7m #CFm #=Um #=dm #_sm #nm #nm #Km #'m # m #Gm #*m #m #>m # n #8>n #PHn #^Rn #5?\n ##&fn #"n # n #2n #n #:n #$o #b!o #<2o # 8o #>>o #"oDo #Jo #|Po #,_Vo #Z\o #'bo #~io #po #Rwo #~o #o #.o #ro #ro #pWo #So #zio #%o #0[o #o #So #o #?o #p #.p #Y p #R.p #Gp #8rp #Q%p #g+p #[1p #V7p #UG=p #FCp #LvIp #Op #aVp #dfp #`lp #Frp #Sxp #~p #z1p #79p #XNp #hp #'p #op #Pp #p #p #_p #bp #Cp # p #E{p #zp #;p #up ##)p #Np #Kp #Q`p #Dxq #=q #Lq #gq #:q # q #Z&&q #P,q #82q #r8q #N>q #cDq #keJq #]Pq #{Vq #\q #7hbq #hq #nq #Jtq #=zq #:q #Gq #vTq #xq #9q #(q #Jhq #q #Rq #.Bq #Wq #0q #Z\q #tFr #:r #Ț"r #M>r #Z]Kr #hXr #fr #"sr #2)r #r #?r # r #r #mr #g s #]Zs #0s #s #&%s #^X+s #̛1s #U=s #*Ys #fs #eKss #}s #`us #qs #zs #es #2)s #5s #At #E8t #gEt #_Xt #JZtt #t #et #Lt #/t #2t #jXt #Kt #t #'t #zFu #Bu #mu #&(u #D5u #FBu #|Ou #*\u #ipu #p }u #u #5u #I~u #yu #Au #Zu #'u #Uv #{v #!v #F/v #&=v #IKv #_v #I[mv #>{v #v #{v #,v #,v #qv #v #v #Bv #v #Slw #7Dw #MU#w #:1w #?w #!aMw #[w #'iw #0 ww ##w #zw #0w #sqw #w #w #zw #_<w #ix #Bx #n!x #m0x #\Fx #$Ux #\ex #Ay{x #Kx #@ex #Tx #+Jx #,lx # x #x #"y #'y #G(y #j*y #7y #Dy #$Qy # z^y #Qky #xNxy #/y #y #`\y #oy #!y #fy #4y #Qxy #Iz #z #dz #*z #U$8z #CmFz #ATz #aFbz #0Npz #o~z #zz #7z #oz #rz #z #<z #z # dz #,z #tM { #:{ #0i&{ #zP4{ #nC{ #|R{ #a{ #*rp{ #no{ #nu{ #^{ #'n{ #!{ #{ #|{ #E{ #1{ #i| #"{| #HC%| #4| #ɂC| #3R| #a| #:p| #| #>| #%| #1| # | #,| #Q| #| #2} #} #x %} #t5} #D} #?8S} #vh} #zQx} #I~} #]T~ #a~ # n~ #U/{~ #x~ #\~ #2~ #jX #a% #6^2 #ߥ? #T]L #Y #f #Gs # #*` #N #1 # #e #\ #) #]e #) #k6 #VC # P #] #Fk #/x #1 #W #C # # <ǀ #Ԁ # #{ #q # #bC #X/ #< #U #^Bb #JZo #0| #7A #'M #{΁ #[܁ #= #y #; # # g$ #6> #eK #X #ke #es #I #k #2 #3n #2' #D# #L) #0 #= #8J #DW #e # #\ #g # #|_ #à #Kyσ #oh #e #G" # #A #:vN #Ea # 1n #V{ #p #N #֓ #P #؄ #+x # #48 #hN #ZZ #yp #5| #ތ #E # z # 1 #Vƅ #p݅ #' #P #(d #F3 #w= #vL #|vY #;f #bs #K #I #ŝ #p #Y #܂φ ##܆ #e #> #@n? #xM #eg #t #c3 #& #< #V # #wLJ #ԇ #"0 # #Q ##  #u #H7" #=V/ #tn #{ #O# #j #}2 #" # #FɈ #c׈ #qX #P! #- #N #FS #& #cM4 #eA #O #\ #&xi #q| #a #X #L ##։ # #X #  #}l # #&x) #Z46 # cC #P #J] #xl #  #` # #/ #: #  # #ݐ( #c4 #`I #-{U #?b # # #5@ #\ҋ #Z? #W #yC #g| #W| ## #+) #/ #? #]M #1Y #%f #Fos #t #7 # #Յь #>fߌ #{ # #h #3 # % #=sC # #K # 'X #]f # qt #V #6 #g #s #R #xΐ #aWܐ #l #> #m #Gw # " #! #X^ # #( #p #Ǒ #4qՑ # #$k # #ʣ #$ #! #C #Ē #S9Ғ #a #~ # #Y #gx #v& ##\4 #ٗB #?YP #(^ #Al #?Zz #M #J # # # #ϓ #pݓ #c #sK #># #\# #u2 #U@ #zN #^m #u{ #: #' #": #V #5 #;ϔ #^wݔ #K # # #? #xt$ #j 2 #H@ #sN #Q\ #]j #_x # #^ #Wl #z # #p #d/ #8 #*Y #< #nJ #@X # f #Ht # #g #r #V #ѓ #-~ȗ #5%֗ # # #R #O #Wa # * #u8 #jF #+T #A4 #H #)GΙ #ۙ #f #ߢ #"P #G̚ ## #r #X8 # E #^ #3k #x #M% # #Ʉ #Yj͛ #tڛ #' #P # #2). # E8 #|G #JU #c #q #R #7 # #5 #3 #Ŝ #uӜ #\ #H #^ # # #Є' #/5 #4C #GQ #]_ #m #{ # #| # # #Sĝ # Ν #&؝ # #CA #I #e # 6 #sD ##S #nva #o #*`} #{ #7N #R #o #͞ #lq #ר #Nr #, #D% #[2 #A #ȊO #] #k # #.I #l& #'% #xɟ #_2ן # #v #M # # # t+ #M9 #ӌG #wU #c #>q #|- #X #{R #t" #qm #0Š #1Ӡ # #LT # # #/ #SH #xW #*a #u #Ak #1 #' # 1 # #*` #Hˡ #kJء #; #h #  #EW #u  #t%, #7: #vH #JZV #d #;r #[ #3 #I #A #Z #KƢ #ecԢ #2 #2 #݀ # #{ #q( #-06 #WD #9R #6` #n #| #v #T% #Cp # #¢ã #cң #{ #W# #1 #Y #?I #a%, #}; #ӉJ #Y #Bh ##w #sl #i # #Pä #] #/# #T #I #N #\L, #0; #;P # Hz #8 #9ǥ #= #|s # # #n[0 #j r #8 #a= #/ #- #uH #;wp #Gt # #n #P@ #?  #v! #Wc #p #JZ} # #N #@> #A # ʮ #-ٮ # # #< # #w- #Q: #IpG #gb #Tl #O3y #y #E #2) # #N #JZ #E # #ߥ #& #F #cP` #m #*`z # #c[ # # #9 #Qΰ #ܰ #5f # # #Q #z" # 0 #G> #wW #8v # # #Y #]- #I #8̱ #ڱ #h #d #V # #v #. #C> #z(N #c4^ #Nkn #sjt #C@z #z # # 1 #2 # #³ #Eϳ #? #b #y! #JZ. #ߥE #JQ #^ # l # z #*` #3 # # #G #zδ #Uܴ #w #G* #8 #X-F #z #@> # #U¶ #'϶ #. #GK # # #  #V# #Tw0 #B #,2 #ͷ #ڷ # #M7 #7D #@zQ #JZ^ #5˸ #{ظ #q # # } #J # #/`4 # A #^ #Tk #jx #:P #M # # #xĹ #:ӹ #' #N #w # 1% #3 #9(A #O #h] #$Yk # }z #U # # # ź #dԺ # #. #{/ # # #;. #J= #3pL #[ # j #y ## #_J #& #wû #rһ # #} #- #i/ # #G- #F= #6{M #B^] #Fm #} #S #( #V #E #_ȼ #7ּ #S #U1 # #[ #] #k* # 8 #.F #H/T #ab #Ip #X'~ #t # #$ #A #aEĽ #Oҽ #E #Cl #~ #4 #tF #q^L #PR #qX #^ #3e #jv #| #Q # o #U #v # #e #bC #; #۾ #S # # #J #.P #&. #<\= #AL #.[ #8Oj #jy #2 #ۛ #Щ #k #./ÿ #eѿ #߿ # #. #Qe #v #bp+ #~; #(K #;[ #Uqj #x #h #] #L #<- #5 #q> #/k #Rn #5 #Z #ɤ #d. #g> #N #~^ #p?n #1~ #P #qC #W #38 # #L #C% #i # # i #= #< #=`I #JZb #o #e| #L #AK # #ˆ #c@ #F #G #J # #4 # #o #|2 #A #V #hz #  #' # #:H # # #rQ #V# #,Q0 #JZ= #}J #W # d #q #{~ #5 #f # #:F # #w #F #U1 # #w #C #GX& #I4R #Jb_ #JZy #P #6 #q #U #N #ߟ #f # #:F # #U1 # #r" # ; #d# #w #JZ #~ # #ɋ # #Uo #{ #Sg #c! #Tw. #B #t #JZ #r #5 # ## #E0 #= #ֆP #:] #j #ֆ #L #: # #vo #'M #> # L #h #2) #)8 #7YD #H2P #] #&i #.u #A #q #4Z #~ #% #\ # #& #H #+> #0 #z #2 #nNC #(P #JZw #A #, # #| #` #Y( #9SB #Ei #0 # #; # #$j #O #B #  #C #ف% #O2 #'L #;e #+s #c} #t6 # #X- #z #ԋ # #0] #%}n #[t #uGz #! #+! #l@ #; #.W #\% #& #e #*` # #'% #3 #A #U # = # #)] # #A #U #֤ # #U #T #JZ # 1+ #fS9 #R #k # #k # #4y #!D # #  #E # # #c) #,w/ #"5 #!< #M #i<S #Y #b_ #*Tf #[zt #^ #E3 #hj # # #K # #J\ # # #7 #X # #e #[ # #/ #M 5 # ; #kDB #eS #eY #w_ #?f #߉t #$ #` #k] #Vz #)j # # #a #q #%# #JZ0 #Vr= #;J # W #td #q #N~ #J # # # #JN #E #^ #E3 # #}( #@7 #fT #v #[ #7 #!^ #Y #iR #% #p #ė #H #ڝ # #%6% #b2 #s? #L # Y #Of #ˡs # #% #FL #- # #D #E #b # #e # # , #9 #[R #Vr #< #JZ& #M3 #]l@ #qX #7] #_j #w #M # #= # #D # #x~ #q #$j #a # #-U( #H5 #.B #\P #&] #Oj #MOw #?' #` #ߥ # #6V # #Ju # #t # #fG #-U, #M: #f'T #0 #f #& #9 #! #> #u8 #K 2 #X? #EOM #mZ #;g #-Ut #*` # # #a0 #9 #~k #{{ #^ #jn #H #bt # #h #N #} #Ѧ) #G6 #{\ #Y #1 #o ##m # #7d #_% #ȧ5 #p; #?A #<G #M #"S #iY #_ #e #k #aq #@w #;} #a$ #x[ #<; #Y ## #W #\ #} #e #q #e #b #6 #^ #h} # #=5 #S #0 #9 # #I # #| # 9 #>$ #H* #0 #36 #d< #LB #?H #3N #T #Z #_` #0f #fl #u3r #A0x #UF~ # #=b #- # #] #=i #t #؎ #)L #Df #- #t #Џ #1 # #8 #s #5 #X~ # #_; #p #5 #q4 #% #A #+< #b& #,, #2 #z8 #> #VD #tJ #kP #m7V #1\ ##b #^h #n #gLt #z #B #L #|x #L #2 #SH #B # #H #2 #@ #4 #_ #i # #] #/ # #YQ #- #p #l #>j #@ # #$; #N #X" #fv( #L'. #..4 #:: #kI@ #JF #wdL #R # nX #^ #Pd #sv #| #" #9 # #/K #0Oi # w #; #Fo #m #- #C: # #$G #/ #\ # #  #vk #/- #6; #0I #0O} #]7 #Z # #  #m # # #JZ # #z|8 #w> #iD #J #PP #_W #0tq #< # #s! # # # #' #:F # #' #gC #ߥW #Uo #&f} #r #q #qS #Y #6 #& #*` # #R1 #tO #^ #km #| #I #u #m # #Z #m # # #h #] #! # 0 #? #JZN #2] #l #T{ #= # #2 # #2 # # #̅ #  #= #- #tJ #QY #h #Dw #@C # #k #h # #$ # # #\ #© # #'+ #D?: #`I # X #Bg #zYv #[ #5 #^ ## #h" #P # #2 # # #8)) #8 #ScG #V #He #nt #d #& # #0 #5C #e] #h #b #~" #v #f' #V6 #yE #CT #Ac #Mr #< #4 #\8 #|z #\ #-d #LG # #e # #tO #%& #/5 #aD #p5S #b # q #cm # #yH #t # #=[ ## #_A #Q #? #E' #lP #J_ #&m #@| #P #w #<2 #^r #G #J #i #t #R #K #l #EO* #8 #=F #a>T #՜b #p #~ #S #3 #. # # #9 #G #U #$Gc #e]r #- #6 #$u # #^ #6 #m # # #  #C:) #g= #FK #@CY #Ig #0u #q #P[ #G # #Ȏ #p # # # #Y  #l #E #+ #B9 #}aG #zYU #zc #q #,4 #^ #}o #8 #YK # #۩? #W #br #J: # # #5 #. #I #,0 #Q #~8m #? # #f #C #33 #R% #^d; #eiM #!_ #G #' #\ # #g #o #0 # #V5 #? #[ #Kd # ${ #2} #DM # # # #PV #> #Nd #$ &13 %7 % F %oJ %[Z %^ %m %qq %_v #"| &H % % % % % % &H %J %: % % % % %K %9Q &~( = &J %N %W a &m %q %z % ~ % &    P & %7 %% & % % % %% 7- A- ^ %b %k %o %x %| % % % % %F  & %& %$ %5 %3 %H %D & %i %g %z %x 1 ; &L %P %V n`      /!JT1}Ya] ;]E ]w & % %Z & % % % % & %' % % %~Z ' %+ %4 %8 %=i V &/c %g % p %3t %+} % % % % %P %L &L &L %q %m % % %q %m % % %q %m % %,AVk  &a( %, %5?\ %` %f  ) ) % % R  &v# %+ ' % 0 %p 4 %d = % A % F &vS % W % ` % d % m %y q %i z % ~ %  %  %      %I  %A  %  %u    % # % , % 0 % 9 % = % F P i % m % v % z %   %  %    %?  %=  %Q  %O   & %i  %_ ! % % % . % 2 % ; % ? % H %N L %F U &b % f % o y & %  %  %  %  %  %  %+ %% %+ %% %\ %V,AZo & % % % % & % %5 %9 %?Pew  % % %/ %% %` %^ %r %p % % 0 %4 %= %A %J_ %c %lv % %  %! % && %= %/ % % % % % % %[ %M777A7Z %^ %g %k %t %x % % % % % % % &6 % % % % !q ?ZXd(($1?P(]s} &P %, % %y %k &P % % % % %* % %q %eHH M w$  &5  %9  %B  %F  %K  &T  %X  %a j     P P '  2 W: U d  w { v ( 0    ]( (2 qM W r | )  #N  # 0  #c   #* D  #=  #  #`  #Z  #   #ţ"  #f5  #B  #qO  ##\  #vi  #(w  #J  #d   #  #$K  #  #  #c `  #* #ţ! #f4 #A #qN ##[ #vh #(v #J #d # #$K # # #c #* #Q #`c #ţp #f # #q ## #v #( #J #d # #$K # #/ #N ## #( #" #5Q #( #r #-q #ţ  #f/ #-qO # [ &kq %u % %; %/ #H % %t #` % % %- % # b %t %j #^ % % # % % #G &Q #=g]8fe{ # & #r %) %'e & %; %7 %j %f &qqq 8'<F &W %[ %d %h %m &v %z % %3 %# %{ %u % % % % % % % % 0 %4 % = %A %J_ %5c %/lv %] %[ %m %k % %{ % % " %& %/ %3 %8Yc &t %*x %$ %R %L % %t & % % & % % %  % %  %2G\u *4Q %.U %,_i &z %A~ %; %g %a % % % % &! &3 % %-^!u &E % % % % %6 %2 %P %L %j %f ) %- %6 %: %C %G %P %T %Y JJ % %JJ % %S[",I %M %V`y %} %lD8 #C & X %-\ %#a #`k %uo %_| % % %p %Z #Z %> %2 # #  #m % %o # # % % % %} % % #JZ$ %( %6x? &QH #4T #9^ %) b %% g XA A' %E + %C 4 %T 8 %R A %l E %j N %} R %{ [ % _ % dU{xx}a &" %  %  %  %  &7 %  %  %'!  %!! %U! %O!#8Mbw i)DhP[  &6 (H  #%bS Pt  %!x  %w!}  #or  %!  %!  %!  %!  &  #-q  %"  %"  &  %*"  %("  %;"  %7"  #9.  %\"  %V"!+! # ! %{"$! %y")! #q3! %"7! %"&L& #cX&a& #*m&w& &k& #& %&& %&& #q& %&& %&& ##& %&& %&& #v& %'& %'& #(& %'& %'&^& #J' #d' #' #$K,' #9' #K'^U'^m' %('q' %&'z' %9'~' %7'' %9'' %7'' %9'' %7'' %9'' %7'' %J'' %H''' &{' %Z'' %X'' &{' %i'' %g'' %z'' %v'( %'( %'((6( %':( %'C( %'G( %'M(p((( &( %'( %'((( %'( %'()()4+) 5) I)Tm)F)())K) #) #?* #Q!* #/* # [* #h* #-U* #*p* #c*@* #** * #+ #+ #-U.+ #8+B+ #cP+Y+ #*g+(+ #{r+ #8+ #^+ #N+ #^+ #9+ #Q , #^*, #ţ7, #fF, #ţS, #fb, #~}, #^, #, #M, #6, #|M, #fO- #&- #*`3- #A- #FS- #*``- #n- #}- #- #*`- #w- #I- #_- #- #h- #J- #a. #. #H#. #;. #HH. # `. #l. #qy. #. #{. #. #q. #b. #*`. #m/ #/ #.&/ #G5/ #`D/ #yS/ #g/ #w/ #/ #֔/ #f/ #/ #/ #/ #+ / #ڕ/ #0 #O 0 # 0 #200 #ܖ<0 #I0 #KBY0 #*`f0 #ms0 #0 #0 #UC0 #D0 #0 #ʙ0 #0 #0 #0 # 1 #31 #K,1 #."81 #O"I1 #$X1 #g1 #7v1 #T1 #m1 #1 #1 #1 #f1 #1 #h1 #*`1 #m2 #2 #)2 #82 #X5G2 #ȘV2 #f2 #v2 #2 #2 #2 #2 #\2 #`2 #m2 # 3 #43 #q%3 #{p83 #F3 #T3 #b3 #p3 #3 #3 #"3 #_3 #Б3 #3 #c3 #I3 #%3 #3 #4 #r4 #k14 #N?C4 #dT4 # f4 #Vx4 #V4 #V4 #V4 #=4 #t4 #R4 #5 #b5 # 5 #5 #5 #D5 #D5 #U!5 #;T.5 45 #g95 $ =5 $e A5 &M5 !T5 #iz5 #5 #(5 #w5 ##C5 #5 #5 #d5 #225 #5 # 5 #5 #~6 #ܸ6 #R6 #'6 #-6 #R6 #6 # 6 #E6 #&6 #6 # 6 #@6 #%6 #k@7 #'7 #7 #0+7 #77 # HJ7 #Q7 #MV7 #Nb7 #wPn7 #Yz7 #*7 #'7 #7 #-7 #417 #7 #s.7 #t7 #O7 #%7 #$7 #8 #=I8 #t,8 #88 #D8 #?P8 #Z\8 #Dh8 #t8 #8 #8 #8 #8 #08 #+8 #18 #+8 #M8 # 9 #9 #c?(9 #59 #'C9 #P9 #]9 #%9 # 9 #9 #9 #T9 #9 #9 #59 #9 #9 #L: #S: # : #8: #: #: #%: #Ƽ+: #1: #77: #RR=: #C: #aI: #O: #U: #Ъ[: #a: # g: #t4m: #[u: #: #RF: #i>: #: #: #pQ: #}': #&: #: #3; #{L; #' ; #/.; #L<; #FJ; #kX; #f; #9t; #)0; #; #*?; #; #1; #P; # ; #/C; #; #)< #4O9< #yH< #W< #g< #v< #< #y< # < #< #< #< #9< #(< # E< #n = #= #+= #:= #iI= #X= #g= #?v= #= #= #VQ= #ܹ= #/= #!= #C= #= #= #1 > #> #Y*> #9> #H> # %W> #f> #JCu> #> #8> #}G> #%> #> #Q> # > #mN> #_N ? #A? #B)? #L9? # I? #4Y? #i? #@y? #? #G? #:? #4? #U? #4? #Y*? #? #n @ #M@ #)@ #9@ #RH@ #f@ #u@ #B@ #@ #@ #[@ #W@ # @ #@ #1@ #$@ #R A #,A #)A #8A #sGA # VA #AeA # tA #A #lA #A #lA #MA #A #A #CA #.A # B #*B # )B #98B # GB #nVB #*eB #tB #HB #QB #RB #B #B #:B #B #4)B # C #_C #'C #F6C #&EC #3RTC #scC #rC #C #%E #4E #CE #RE #*aE #QpE #E ##E #E #-KE #q#E #E #TE #E #E #4F #=F #$F #3F #BF #QF #ֻ`F #oF #~F #.F #'F # F #+F #6F #F #кF #^F #a/G #HG #M$G #<3G #BG #QG # `G #`oG #!~G #(G #JG #G #G #NG # G #G #G #H #JH #$H #H3H #BH #H7QH #i$`H #oH #~H #H #=H #"H #H #H #N.H #~H #H #I #7I #h;#I #)2I #QI #`I #oI #~I #I #!I #y=I #;SI #I #I # MI #I #V/J #J #l9$J #4J #,DJ #[8TJ #@cJ #urJ #/J #4J #J #J #h)J #K #=K #C9K #BEK #rOQK #t^K #mK #zK #K #K #ӰK #JK #K #1K #K #L #rL #,L #!+L #S9L #GL # RUL #NcL #(qL #L #L #qL #KL #L # L #L #L #zL #1L # M #M #0()M #X7M #EM #SM #DaM #RoM #}M #DM #M ##M #M #9M ##M #M #.N #dN # !N #@N #ON #J^N #mN #P|N #)N #Z?N #N #N #XN #TN #cN # N #O #ĭO #!O #>0O #G?O #NO #0]O #PlO #${O #1O #)O #IO #O #bO #SO # !O #IO #P #P # P #/P #>P #?MP #\P #FkP #`&zP #p7P #AP # P #P #fP #:P #KP #P #BQ #&Q #Q #s,Q #9Q #"YQ #cQ #,pQ #DQ #-Q #l Q #BQ #Q #r+Q #<Q #2 R #BR #(R #5R # BR #OR #]R #BR #'R #R #<R #7R #S #mS #3S #K VS #/bS #KpS #KS #S #hS #S #+S #S #kT #T #,T #*;T #SpT #~T #xT #ZT #+T #(T #qT #T #.T #s&T # U #EIU #(U #6U #9DU #vRU #zU #U #{U #U #U #@U #]U # V #3V #1'V #5V #/DV ##RV #M`V #dnV #|V #V #V #-V #7V #)V #9V #gV #ůV #3RW #OW #LW #`W #uW #W #uW #W #p W #LW #W #W #V$W #zX #X #X # ,X #9X #!FX #FSX #`X #mX #kzX #X ##X #X #8X #X #X #0X #PY #1Y # Y #-Y #L:Y #_GY #<TY #cY #*rY #kY #%Y #,Y #Y #Y #Y #Y #Y #<Y #'Y #Z #jZ #+Z #>8Z #EZ #RZ #_Z #Z # Z #kZ #Z #>DZ #SZ #7"Z # ! [ #[ #'[ #25[ #C[ #Q[ #g_[ # m[ #|{[ #I$[ #[ #O[ #U[ #*[ #[ #m[ #[ #>[ #B\ #dI\ #LA#\ #1\ #@?\ #EM\ #w>[\ #i\ #w\ #O\ #g6\ #_\ #\ #\ #>\ #]\ #\ #k\ #N] #?] #g] #] # ] #!&] #?,] #C52] #88] # )>] #D] #J] #P] #"V] #3\] #ܫb] #Jh] #X] #] #] #6] #1] #v] #] #] #] #^ #DZ^ #E"^ #>H(^ #.^ #)>^ #|X^ #ke^ #M r^ #%?^ #^ #^ #^ #]H^ #&^ #J^ #^ #&^ #J_ #|?$_ #B7_ #N_ #0[_ #=h_ #H(u_ #&_ #J_ #_ #/_ #_ # _ #_ #+Q` #` #u6` #8l` #F` #@` #?` #B` #<` #` #x%$a #8Qa #F^a #%b #Db #kdb #qb #I~b #دb #9b # c #5Fc #c #^c # Qd #!d #x.d # ;d #DSHd #&~d #d # d #<e # ; e #qe #3e #@e #Me #e #e #e #e #e #e #Ee #e #*f ##&f #F 3f #_Af #Nf #?\f #T {f #5Qf #P f # f #f #f #hf #3f #g #g #د g #.g #l #Kl #Xl #el #P sl #Ϳl #l #l #2l #Sl #l #l #:l #l #0l #Sm #m #0$m #)&1m #0?m #VPLm #)&Ym #oLgm #1ym #2m #6'm #7m #:m #Km #Wm #fm #Ym #Sn #Ln #`)n #5n #An #Mn #)Yn #Wen #rn #n #3n #Sn #l,n #)n #6n #n #&n #Jn #Gn #ko #o #o #L*o #_8o #1Eo #Ro #%`o #Dyo #o #o #o #o #$-o #o #=o #o #-o #o #^ o #/o #p # p #/Cp #l3'p #S5p # Bp #Pp #^p # kp #)&yp #p #p #p #zp #p #ƾp #Lp #jp #p # p #p #R&q #\3q #@q #WMq #|?gq #tq #5q #Iq #q #?q #Iq #q #Lq #kq #Hr #/Or #Cr #b$-r #7r #rDr #KQr #_r #Hlr #yr #Yr #%?r #r #Vr #hr #ir #s # =s #.'s ##4s #zIs #Vs #r ms #Dzs # s #Hs #|s #s #r s #Hs #s #r s #׳t #t #8't #4t #.At # Xt #et #Y|t #t #|t #2t #%t #Vt #t #t #\t #Bu #{4u #Au #$Nu #$\u #iu #Duu #$u #u #u #u #u #Du #u #$u # v # v #,v #6v #Cv #zPv #^v #kv #xv #2v #yNv #Tv #<v #v #7v #v #v #jI w # w ##w #E0w #=w #5Jw #Ww #oHew #rw #w #Ow #*w #Lw #w #>w # w #w #bw #- x #<x #"x #&/x #A'| #j| #| #| #X| # } #o} #'} #m5} #C} #HQ} #_} #k m} #{} #4} #k } #} #z} #} #b} #} # } #9 ~ #w~ # D~ #*R~ #0a~ #o~ #}~ #G~ #~ #~ #~ #~ #k~ #L~ #~ # #R #y! #P1 #9A #RQ #N-` #J| #" # #] #] # #u #eL #5  #& #4 #B #P #S` #g #T # # # # #! # #w #I #=$ #$K2 #>@ #w(N #\ #j # x # #k # # #5 #[:́ #( #Y # # #. #; # 'H #(b # #n #F #J0˂ #EL؂ #) #BG # #<  # #& #3 #@ #M #MZ #?g #""t #f #% #` #;S #K #'ƒ #σ #7 #F #` #;6 #KC #;SV #p'} # #n #  # #kʄ #)ބ #H #r? # #P #4) #& #"+ #O8 #E #R #i_ #:l #y #q # #{ # #p #DDž #kԅ #  # #g #   #6 #5& #w"4 #"OM #[ #*i #6w #l #L # ? # #ˆ #Aن #  #B #d  # #+ #l- #M; #I #IW #e #.s # #ؼ # # #y # LJ #Շ #N # # #  # N #) #7 #]9E #S #+a #{o #<} #vJ #" ## #R #-FLj #YԈ # #-1 #C; #F #W # #& #3 #@ #7M #Z #g #t # #% #, #Z #A #ĉ #,҉ #z #R #v #  #& #0 #кO #Y #xs #} #= #C # # #H #&̊ #ي #9 # # #w #  #C- #P : #kG #T #a #)n #{ #~* #1 #N # M #ŋ #Iҋ #ߋ #L #/C #  #4 # G! #0 #,@= #1W #d #q #$H~ #I #YE #& #ڌ #  #0 #! # ##4 #OIA #LN #I[ #i #Tv # #9 #I #;Kƍ #Ӎ # # #q #kE #2 S #}1` #Km #Jz # #: # # # #nɎ #؎ # #<2 #40 #ĵ= #J #&LW #Dd #q #'~ # # #K #5ŏ #ҏ # #H # #  # #/& #3 # @ #$M #Z #g #Nt # #l # #M #< # #(ϐ #2ܐ # # #u # #= #'K #z #R #5 # # #đ #ڑ #V #" #M  #!D #"/ #< #"S #_ #8k #x #g. #C # #Ȓ #Ւ # #' # # #{ #~  #O #." #R&( #. #L5 #IB #O #5\ #j #} #E # # #Eԓ # #I # #L #|@ # P" #/ #I #Ua #Ѵn #! # #G) #G) #3ɔ #֔ #Y #z # # #,9! #; #kH #U #b #7o #*| #K #E #* #7 #L #P Օ #  # # #   #O ## #$0 #= #J #W #0d ##q #Q~ # # # #Ŗ #&Җ #4 #> #I #W( #D #W #8Nn #l #D # #Q; #m— #@@ٗ # #8 #j # #l,( #B5 #kB #\ #Si #Q #  # #c #N #&  #4A #8NN #f #kz # #W #c # #֙ # #v3 #g  #; #Ʒ' #"+5 #C #sa #Az #3 #o # #$. # #ٚ #$ #( # #J' ##0K #S] #8k #y #5 # # #~ #* #UH͛ #Gۛ # #d #  #q  #?' #25 #8C #Q #l #g # #- #: #1 #=̜ #ۜ # #h # # #-! #: #RH #'f #` #'( #1 #dȝ #Mҝ # #O # #  #}I #2S& #c4 #aB #kP #^ #:9l #z #]  #1 #q #ӽ #՞ #` #%? # #K3 #zA #HO #Hr #B # # # # #Bԟ #G #<+ # #   #n #̳( #$6 #gD #UNR #` #< n #| #@O #i #!@ #8 #u0Š #Ԡ #۶ # #^ # # #S. #G= #iL #[ #_Ej #{ # #? #{6 #ġ #5ӡ # # #B #6 #k #- #:< #SK #'Z #5i #x #I #04 #ֻ # #>â #Ң # # #fB #1 # #,, #a #k #u #L #1 #$ #h #3ͣ #k #  #5 # D #8U #H[ #va #4g #Em #&s #7 y # #  #( #}J #6 #- #9 # #! #ͤ #W٤ # # # #& #Ь # #W  #. #P$ #* #0 #}6 #< #TB #H #2JN #T #Z #Z` #Z+f #^ l #6r #P2y # #  # #  #4 # #= #A #J # #ť #˥ #Mѥ #+ץ # ݥ #  #W- #U #`% #*G # # #J  #w # #w  #_"% #+ #1 #7 #:= #2C #hI #O #U #2[ #Ca ##g #m #PKs #%y #K #~ #E #} #  # #P) # #h ## # #9 #Ȧ #o6զ # #U # #  #O #]# #1 #CE #a #Wn #88{ #L #w #Y #* # #׷˧ #2 # #70 #S6 #< #_OB #H #EN #zDT #` #|{ #D #Q #' #r # #%ި # #Y # #1 #"Z #ʽg # z #1 #  # #ɩ #4Lթ #F, #Q #% #  # #c# #0 #G= #J #)W #d #&q #{~ # #߳ #Ī #Ӫ #p( ## # #  # #' #/%5 #C #~Q #_ #m #E #? # #^5 #% #Dǫ #ի # # #x #  #S #k) #R7 #?E #~S #La #G o #)} # # # #\3 #ì #~Ѭ #J #J #;6 #C #% #4 #C #O3R #a0h #w #p- #\# # #g #ʭ #1٭ #D #4.  #/ #a% #2 #U? #L ##Y #f #s #B$ # #a # #= #Uή #-ܮ # # # #l" #F" #/0 #ֹ> #1L #hZ #[h #:/v #J # # #s/ #O #ʯ #د #~P # #. #. ## #i, #P*: #wH #RV #e #'t #Y #F # # #% #?ϰ #ް #H #B& #  #E+ #) #=%8 #oG #>?V #,e #t # # # #& # #α #ݱ # #e+ # #) #08 #ͶG #.W #Bf #Uu #  #e # #v # #_ # #" #ѳ # #Q: # G #ST #/Oa #Qn #O{ #ܭ #i #*ִ #P  # # #*  # #?$ #H1 #> #]K #+X #IKe #r #T # #J #$K # #>ε #Hܵ # #8 # #% #- #k* #7 #l,Q #*^ #zw # #1 #1 #^Զ # #Q # #B0 ## #, #z9 #gF #` #m #zz #8 # #~ #8· ## #K/ #@? #.E #IK #-R #=>_ #l #y #L #W # #s #ϸ # ٸ #5 #f# #  #F #s/ #[I< #mc #L p #" #B #m #ۺ # #=̹ #ع #L #F"3 #}Q@ #Z #p #| #!$ #) #6 #" #-$κ #Bۺ #m #ۺ #4 #) #LB #lU #);_ #ܾn # { # #  # # #uFɻ #u0ֻ # #, #7 #F  #= #Xa #"o # # S #s #P # #xͼ #ۼ # #N #D #O # #* #7 #^D #$Q # #E #{ # #Ľ #ѽ #lF޽ #t #  #X # #D! #. #A; # H #XV #c #q #>~ #A" # #  # #ž # #s # #& #0 #C= #A"K #[X #D e #gQr # #" #A #R #¿ #Ͽ #ݿ #) #g85 #:J #V #@ k #H%w # #L #k #\ # #q ## #3 #&9 #~&? #,E #5K #Q #Ka #o #%{ # #X # # #3+ #/ # #M #E #+ #8N9 #LG #_e #Nq #a@ #6 # #< #(5 #% # #  #P #(  #- #, #MG: #H #I1V #Pd #r # #/ #, #j # # # #vK #9 # #F #5  #' #T # a #t #B ## #@ #$R #0  #K # # #d #+ #5 # # #K, #{9 #F #S #L` #+>m #.z # # # #* #$ #A # #" #H #C  #  #( #l!6 #D #6 #u #` # # #H #? #G #H #f=! #L/ # = #6 # #kC #Y # # # #, #": #$EH #V #@d #&r # # #& # #" #5 #k #K #@ # #  #_ #j7 #?E #/T #b #6$p # #-H #S # # #> #qA #> #! #{ #0 #* #8 #yF #T #>1b #?p #~ # #  #B #1- # #k # #: # #L, #* #] #k #y #N # # #- # # #= #T( #C #, #3 #! #/ #} = #6K #Y #g #u #B #  #. #6 ##  #K ## # #J4 #A #Y #f #X5 # #kK #[ ## #. #} # # #S" #z< #YO #'Y #h #v #v #  # # #< # # #+ # # # #@ #v, #BC: #.H #V #d #r #7 #C # #' #? #c #G #F # # # #j #8 #; #W #)e #9*t #  #u #P  #% #  # # #_S #w #;R #j! #r. #F #q)S #@b #4p #~ # # #& #z #5 #kK # #o #  #" #]G0 #C> #L #Z #6h #!v #u9 #F # # #t # # # #w #C #> #I #A #-P #-i #,x #@* #@ #e # # #B #k #P  # #q #@N #2 ## #,1 #ٵ? #M #[ # i #1w #W #G # #< # # # # 6 #  # # #* #H- #FJ; #I #OW #Ae #s # #= # #  #b #U #= #K #%  #% # #  #/ #7> #oM #'\ #3k #\4z # #  # # #=C #S # #[ #  #+3/ #> #HM #\ #q # # # # #& # #3 #^Q #ε #C #: ^ #+ #-N #i #`! #H # #- #ULa #l8 # B # #U9 #1 #I # #W # #: #  #Y  #| #y' #0A #m1N #[ #[h #s # #_ ## # #Y #5 # #1 #" #k #/O: #=CG #<g #; #O #P  # 2 #S #O #* # # #0 #\  # #+' # 5 #C # Q #_ # !x #D #+ #/ # # #8 #C #=C #b  # #% #z3 # A #+O #_ #o #d #r # #j #$ # #B #4 # #Ŭ #JL #9! #Ž5 ###B #1O #/Of #r # # #/ #P  #8N #~ # # # # # !  #K #^;Y #g #49 #W #z # # #< #? #* #^;* #7 #D #y!Q #  #N #I #* #^ #W #d #b$q #1~ # #U # # #0' #, #k: #U T #:a #~ # #B # # #2 #k #2" #y # # #!) #BE #S #Ga #]o #b} #  #0' # #3 #E # # #V #$2 #! #h?0 #6? #N #R] #El #ܮ{ #/ #E: # #e # #! # #* #' #2N #. #9= #M #] #Q%m #_} # #|9 # # # # #"  # # #w #  #. #< #J #X #f #st #; # #f #Q #jS # #C #| #@ #JM #[ # #ET #@f #l #f*r #x #~ # #$ #|7 # # #  ##  # # # #< #R #}  #T #3" #1 #? #<)N #1] #l #{ #  #> #Q #D #'S #P #Y # #I #S  ## #x+ #Ը; #tK #([ #Ek #{ #` #R # # # #g # # #S #j # #. #M> #QN #^ #Jn #)~ # #5 # # #G #I #M # #Q # #L #S. #= #/\ #c i #1 #I # # #9 #R #0 # # # #C/ #S> #-/ #T+ #8 #R #5a #1v #* #u # #u #7 #VS #E #O #C # P #1] #5Hj #/w #B #K # & # # #wE #7 # # # #w # #!  #- #.F #Jr #v  #1 #S #< # # #8 #H # #wE #7 # #w( #5 #B #B[ # #! #1 #8: #B #5 #z  #g #<7' #4 # A #y!N #  # #1 # # #z #*C #P #c] #0p #} #c #0 # # #H # # # # #|+& #Y= #(X #d #jp #E6} #/ #. # # # #) # # #R #) #MN  #B ## #$0 #> #Wc #p #1 # # #k #"'# #+J0 #RH #4b #J #? #\ # #  #- #}$ # #U+ #9 #5FH #{/V #d #Ls #?} #U #(* # # #LO # #=3 # O #Ҳ #z #A # #  #&6 #:! # #3 #$ #15+ #h9 #x$V #Hj #t #+ #+  # # #1 #r # #/ #- #-  # #% #W2 #2? #LR #3_ # # #U #k #' # #: #  #0  #6  #><  #C  #bj  #w  #  #@  #  #F  #n8  #E  #   #  #  #4  #  #J  #  #-  #2:  #IG  #GGT  #a  #y  #   #  #  #gG  #/  #֭  #T  #r  #  #1  #  #u  #  #  #   #u  #$  #ů2  #@  #_>N  #\  #j  #(y  #  #C  #  #2  #  #  #  #Q  #  #  #3 #M% # 2 #/OL #Y #f #s #\ #+ #57 # #k # # #t #* #V7 #D #W #d #q #~ # # #+ # # # #P ! #k/ #< #I #V #>(  #& #7! #' #O- #c3 #: #G #mT #'a #GP # #A #* #$K8 #F #;T #_Fr #[ #%  #GQ #A4 # # #? #Q # # #UC #<  #  # #i #t" #h( # . #5 #2E #K #Q #'W #?] #!Fc #i # o #J+u #{ #' #< #c # # # #® # #C #& # # # #< #R # # # # #hE #P #  # #  # #c #> #O:# #i ) #xS/ #>5 #q,; #A #G #8M #S #Y #_ #e #9k #q #w #} #B # #( #D #C # # # # #) # #  # #K #$ # # # # # #0 #4 #  #5  #S #W # #% #"+ #Q1 #7M7 #P= #7C #I #AO #U #[ #a # g #m #s #y #40 #) #6 # #*: # #b #. #' # # # #x  #Z #Y #  #c # #| #R #8 # # # #N@ #2 #!P9 #G #_=U #*c #q #Ӿ #k #7 #" #1 # #  # #R #= # #=  #C #޽ #' #7- #c? #E #L #sZ #h #*v #s #Ӿ #E #7 #1 #k #& #z #B #g9P #_7] #Qj #wOw #7 #m #z #x #/O # #M # # #l5 #B #O #8] #P k #B # # #_= # #4 # # #˸! #/0 #? #ӾN #j] #l #3{ #-8 #* #s #7 #1 #F. #4 # # #Ԯ #F-  #L0 #@ #rRP #E` #/p #" # #wC # # #7@ # #g #  # #+ #/: #I #X #G9g #Pv #S #  #;- #[ #.  #" # #a #Q1 #  # #* #G #d,V #/e #t #GR # . #_ #e #w  #h4 # # # #8  #a  #(  #\7  #bT  #m0c  # r  #  #   #-  #  ##  #  #  #  #  #! #r! #$&! #¿5! #QD! #QS! #0b! #q! #+! #L! #|R! #! # ! #! #c! #n! #{! #+" #v" #%" #74" #3D" #T" #r" #" # " #G" #" #" #" #O" #G# #!# #^!# #z0# #9?# #O0N# #nM\# #j# #x# #?# ## #+# #/# ## #x# #E# #j5# #W# #XM$ # $ #G $ #n$ #AE{$ #$ #@$ `$ #W$ @$ #8$ $ #H$ $ #$ $ #$ % #S% % #C'% @% #eL% U% #(a%`z% #eP% % #% #% #% #% #Q & #( & #4& #zF& #ʫh& #o& #ι& #& #& #s<& #B& #3& #9& #I' #Y'' #F'' #L' #l' #' #q ' #j' # ' #' #2( #$( #6( #7>( #U( #q( #O( #( #( #!( #( #) #+) #JB) #u^) #) #v) #) #) #NS) #) # * #@* #=L* &b* %(f* %(k* #_=v* %a(z* %W(* %(* %(* #* #** %(* %(* #s* %(* %(* #Ӿ* %")* % )* #7* %1)* %/)* #E* %@)+ %>)+ %S)+ %M)"+ %)&+ %v)++ #16+ %*:+ %*@+ #WM+W+ &g+ %*k+ %*t+ %*x+ %*++ &#+ %++ %*+++ &6+ %#++ %++ %V++ %L++ &R+ %++ %+, %+, %+, %/,, %',,P3,PH,P],Pr,P,P,P,P,P,P,P-%-cD-N-k- %Z,o- %X,t- --- %l,- %j,--- .p.1.A.Y.t.....L.^.//@//F/X/ #`/P-/ %,/ %|,/ %,/ %,/ # 0/ &/ #dD/p/Y-/ #N/ &/ #0Y- 0 &0 %,0 %,$0 %-(0 % --0 &60-F0-P0-c0-t0p00-0-0 # 80+0 %:-0 %*-0 %-1 %-1 % .1 %-1 #_=$1 %Z.(1 %T.81 %~.<1 %x.A1 # 0J1 &S1 #ND_1h1+}1 #N1 &1 #1 %.1 %.1+1 &1 %.1 %.1 %.1 %.1 &1,1,1, 2,2)2X>2v,H2v,e2 %.i2 %.r2 %/v2 %/2 %6/2 %./2v,2v,2 %X/2 %V/2,2-2-3 %g/3 %e/3 %z/3 %t/3!-63)-K3+c3+3T,373\,3g,3o,3,4,*4-A4m4 #2w4*4 %/4 %/4 #4 %/4 %/4 %04 %/4 %<04 %804 & 4 #4 %U04 %S04 &05 %f05 %b05 &V!5 #4;,5 %005 %{055 #.@5 %0D5 %0I5 #T5 %0X5 %0]5 # h5 %0l5 %0q5 #|5 %05 %05 &j5 #5 %15 %15 &5 #55 #l5 %%15 %#15 #5 %715 %315 &5 #45 %O16 %M16$+6 #R6'6 %_1+6 %]116$+B6pW6(l6*v6 &{6 %s16 %o16 %16 %16 %16 %16 %16 %16 %16 %16 %16 %16*6*6 &F6*7*7*<7 %1@7 %1E7*Z7*z7W*7 #7 %27 %179+79+7 %27 %27 %!27 %27 %>27 %6279+89+8 %`2!8 %^2'8l+B8"*`8S*y8 #8%8 #m8 %q28 %m28 #8 %28 %28 %38 %28 %*38 %38 #8 %38 %39 %3 9 %39 %49 %3$9 #d49 #&?9 %)4C9 %4H9 #<S9 %4W9 %x4\9 #_=g9 %4k9 %4p9 # 0y9 #X9M&9 #9)9 &9 #(D99%9 #N9 &9 #9 %A59 %?59%9 & : %S5: %O5: %5: %~5": &+:&;:&E:&X:&i:v::%:%: %5: %5:%:%: %5: %5:% ;%; &&; %5*; %5/;%J;?&T; &d; %5h; %5m;M&;&;&; %5; %5;&;['; &; %5; %5;`'<(<(6< %6:< %6C< %6G< %6P< %66T< %.6]<(g<(< %X6< %V6<T(<](<](< %g6< %e6<g(<(= &= %y6= %w6=(6=(@= &P= %6T= %6Y=(s=%)=)=)= %6= %6=p)= &= %6= %6=u)>) > &> %6> %6$>);>%Y>6&}>W&>&>><'>'? ("?(E?(]?(?(?)?_)?) @@)7@A@)e@ #Jq@ &-|@ #m@ %6@ %6@ #}@ %H7@ %47@ %7@ %7@ %7@ %7@ %8@ %8@ %68@ %*8@ #_=@ %p8A %h8A #A %8A %8A # 0%A.A #*4A*#=A #ICA#LA &CUA #aAjA"A #A &TA #A %8A %8A"A &TA %8A %8A %)9A %%9A &TAK#AK#AK# Bv#B+B CB #= PB@YB #fB8uB #= BB #B0B #B #B %F9B %D9B#B0#B &d C %X9 C %V9C5#+C#5C#RC %j9VC %h9[C#tC#~C#C %|9C %z9C#C#C &tC %9C %9C#C$D$ D %9$D %9)D $BD4$LD4$iD %9mD %9rD<$D[$D[$D %9D %9Dc$D$D$D %9D %9E %9 E %9E %:E %9"E$,E$IE %&:ME %$:SE$rE|EEEE#E#E$FX,F,$KF4$cFT${Fs$F$FF@FFGG@%G6GJG #UG &jG %=:nG %3:}G %:G %o:G %T;G %D;G %;G %;G #_=G %]<G %Q<G %<G %<G #dG #F-G %=G %<G # 0G #*H H #HH #/H!(H #].H-"7H &@H #LJH %V=NH %N=SH #|)]H %=aH %=jHtH &H %=H %=H %=H %=H %>H %>H %>H %>HH &H %*>H %(>H %<>H %:>H &H %T>H %L>HI#I %>'I %>0I %>4I %>:IZI &edI #pIyII #MI &wI #I %>I %>II &wI %>I %>I %>I %>I &wI0!I0!J0!JQ!*J7J`BJ &LJ #XJPaJ-vJ #J &J #J %?J %?J-J &J %?J %?J %E?J %A?J &J^J^J^KKPK0K &9K #4;CK %f?GK %`?LK #.VK %?ZK %?_K #iK %?mK %?rK # |K %J@K %<@K #K %@K %@K & K #K %@K %@K &EK #KK #lK %AK %AK #K %AK %AK &UL #4 L %,AL %*AL!*L #R64L %L!OLpbL@wLL &)L %RAL %LAL %}AL %wAL %AL %AL %AL %AL %AL %AL %BL % BLuLuMuMu/MuDMu]MurMuMuMuMuMMN N #4;'N %@B+N %8B5N ?N XN %tB\N %rBeN %tBiN %rBrN %tBvN %rB}N &N #4;N %BN %BN #.N %BN %BN #N %BN %BN # N %0CN %(CN #N %jCN %bCN &N #N %CO %CO &O #O&O #l1O %C5O %C:O #EO %CIO %COO & XO #4cO %CgO %ClOi"O #R6O %CO %COi"OpOO O &O %DO %CO %1DO %)DP %jDP %bD P %DP %DP %DP %D'P %D+P %D4PcIPc^PcsPcPcPcPcPcPcPc QcQu=Q eQoQQ % EQ % EQ$QQ &Q %&EQ %$EQ %BEQ %@EQ &Q %QEQ %OEQQ &R %wE R %uER %ER %E"R %E&R %E2R:Sg[S %E_S %EhS % FlS % FuS %FyS %FSS &S %-FS %+FSSS &S %?FS %=FSS T "T %QF&T %OF/T %bF3T %^FX %,GBX %"GGX #7UX #'hXrX &qX %XGX %VGX %gGX %eGX %GX %}GXXXXX %GX %GYY.Y %G2Y %G9YNYXYtY %GxY %GYYY %GY %GY?Y7YYMYuZ*ZCZaZHpZ #Z #Z #Z &Z %GZ %GZ #/Z %HZ %HZ %JHZ %@H[ %H[ %|H[ %H[ %H)[ # 03[A[ #N[ &`[ %Hd[ %Ho[ #= {[[ #[@[n[ &[[[[\#\#8\+Q\8[\8x\@\=\ &\L\ \ \o\]!]+]F]P]k]u]]]]]5]]F]@^^K9^ #X^ #_=f^ #^ #q^ #k^ #/^ #4C^ #K^ #/^ #4_ #P _ #k#_ #5_ #P B_ #kQ_ #W`_ #Fr_ #P _ #_ # _ # _ #k_ #~*_ #F_ #_ #_ #_ # ` #` # 1` #z>` #R` #ra` #P n` #{` #8` #Z6` #|` #` #A` #B` #B` #6B` #NBa #`a #oB$a #B4a #;@a #{Qa #;`a #;oa #~a #<a #(<a #A<a #Z<a #s<a #-=a #F=a #a #P b #b #Z6"b #@1b #@@b #~Ob #A^b #Anb #4A~b #b #YAb #Ab #Ab #ιb #+Jb #b #Lc # c #.-c #@c #:Nc #:\c #:jc #\xc #tc #c #c #;c #v;c #;c #?c #c #Fd #ed #)d #%N;d #SMd #S_d #Smd #S|d #UGd #d #d #d #{d #d #d #d #>e # e #&Bep]e %Iae %Hje %)Ine %!Iseee # e #Re #e #e e #we $e $e &( e !>e #4 f #f #CY"f #b0f #5f #!Cf #{Mf #`][f #Y`f #nf #sf #^f #f #`f #f # f #!&g #zq,g #>g #@Lg #tQg #]g #`ig #ug #g #g #g #g #g # g #]g #Cg #g #g #gg #h # h #h #aT$h # 0h #| #ML| #Z| #h| #gv| #{| #| #U| #m| #| #| #| #| #} #$} #$} #3} #>B} #ZQ} #`} #~} #} #} #_} #} #Q} #} # k} #xl} #T]~ #ޙ~ #$~ #c3~ #mB~ #VQ~ #`~ #o~ # ~~ #~ #~ #~ #~ #~ #~ #o~ #W~ #f # ## #2 # vA #LP #g_ #on #y|} #F #g ## #^ # #\Z # #? #] # #b# #Y # # #m #l~ #Ԁ #d # #> #K #ʒ #=1 #cQ #^ #uk #x # #l~ #u #  #b #! #- #m9 #b\ # # #sq #sq #Z΃ #' # #2 #s  #c: #jG #2^ #l~j #Žv #C #n # # #TDŽ #ُԄ # #b #" #-/ #< #I # W #e #l~s #v #< #Iƅ #ԅ #\ #ٚ #ʹ #  #}g #r6 #6D #qR #` #ln #e~ #X # #k #І #A݆ #j # # * #I? #dM #Dsa #'ko #} # # #ۺ #D #(ć #K҇ #( # #8 #  # #& #eC #XP #g #Dt # # #ˈ #_؈ #ف #9j #=$ #t2 #> #K # X #$Xk #s #{ # #6 #= #_ #- #cɉ #=։ #s #*~ #c #)  #l' #f5 #TC #TQ #z_ #HU} # # #!} #C # #sʊ #׊ #& #s #c #" #7( #c. #4 #; #/H #.Tb #zo #| # #(t #3c # #4pȋ #Ջ #t # # #cC #E~V #d #Sr #ڹ #ָ #U #a # #~ƌ #/Ԍ #v #` # #  #> #( #6 #tD #=vR #I` #-n #| # # # # #Y #MЍ #ލ #Ǝ # #D # #F$ #|9 #@dF #S #Y^` #Tm #c{ #~p # #l~ #Ď #oю #a #+ #f #p #t # #Њ# #) #a/ #5 #; #4`A #G #3M #ƓS #Y #~_ # e #k #q # #  #[ #^ #9 #v̏ #ϲُ #v # #  #T' #د4 #YA # # #S #}_ #h| #1đ #5bё #ݛޑ # # #. # # # # #ʒ #ٗ # ~ #)} #^0 #h> #OL #Z #'y #T # #f #zeƓ #;U֓ #% # #g #.  #+ #[: #H #8V #Od #~ #U # #"v # #$XД #ޔ # #( # #$( #6 #[D #oR #` #un # #& #(t # #q[ # #4 #x #Y  #Y #:t5 #cB #CO #\ # ]x # #Z # #  # #|˖ # ؖ # #$ #l~ #p+ #8 #4E #R # _ #m # #s #w #` # #Q #3 #c #Z #- #3: #XG #eT #ka #o #| #C #> # #r #} #] #B #q # #\s #£ #  #- #~; #E #R #Xt` #m # #  # # o #6ș #jqԙ #! #S #t # #x# #0 #f= #lK #vX #Be #r # #' #v # #' #'Ț #^՚ # #p #I #'  #9 #" #Be) #6 #D #fQ #^ #(tk #Ux # #1j #њ #ƛ #eӛ #b #$ #1 #i # ! #4 #A #N #p[ #h #c #V # #j # #wmӜ #j #: #  #|W #$$ #}1 #> #2L #Y #_f #ws # #( #͝ #ޝ # #q #9 #J # ! #}6 #rC #hZ #jg #Vt # #f #r #h #ɞ #r֞ #h #\ #h # #~! #/. #ǨE #rR #si #yrv # #) #ټ #b # #eʟ # # #! #. #+; #I #gV #3b #az # # #,b #RpĠ #Ѡ #7Wޠ #V #s} #Tv  #v #D# #0 #W= #vK #X #e #r # # # # # #ۡ #u #"V #A #j #s #+ #9 #gF #S #ua` #n #{ #j # # #A #Ag #tɢ #ע # #Ԇ # #&^  #N #& #D #Q #]_ #!l #Mz #! #b #ͽ # #c #)Yȣ # #Y #Ar  #lc #ɍ& #Y4 #n@ #M #Y[ #rp #Y} #- # #JѤ #ݤ # # #m #- #5n' #- #Ώ3 #|9 #? #XF #T #Yb #p #U # #m # #ť #ӥ # # # #>  #r #}) #̶7 #[wE #ݞS #ͧa #o #} #J #_ #t #; #ّŦ #|Ӧ #y # # #<  # #' #F5 #C #<Q #c_ #am #<{ #)X #Q #P # #^ #dϧ #Tݧ # #e #/ # #b# #p1 #~? #$`M #Z\ #k #]y #5 # #ӡ #ԙ #Z #hΨ #)ܨ # #~ #  # #d" #0 #> #^|L #RZ #"h #v #a # #N{ #a #Nͩ #X۩ #} #L # #h #! #^k5 #[ #i #vx #e #O #Щ #2v #Ȱ #N̪ #ڪ #c #g #5 #ք #( #ٵ8 #H #X #ȁh #w # s #) #Y #xZ #  #T # # #i# #–= #K #UY #jg #qw #c^ #`g #C #EƬ #iլ # #D #r #5t #%- #; #I #fW #Le #ms #j #. #` #c #] #ǭ #խ #3 #ƿ #w #z #-* #8 #E #oY #gs #M #  #[ #ǰ #԰ #h #U #c # #% #/ #~9 #C #M #m[ #Mh #jXu # # # c #Y #  #pñ #iб #ݱ # #l] # #c #> #bt- #œ< #,I #vV #wc # q # #^ #&^ # #W² #Zв # # # # #m$ #2 #Z@ #N #H\ #j #Fx #p #( #i # # #Yd̳ #ڳ #`u #m # # #  #. #< ##J #X #pf #Ut #w #ʯ #f #Y #C #ȴ #<ִ #K #c # #w #1 #T1 #; #<E #lO #\WY #Ljc #Zp #^} # #o #- #U #} #˵ #޵ #T #w #lw #R #W #+ #4? #pY #fc #xm #cb #{ #b #Pw #fĶ #^Yζ #۶ #U #" #օ  #;h #d# # 0 #TC #P #C] #j #w #c #% # # #m #5˷ #Bշ #߷ # #4u #;[ # #h* #c7 #D #wQ #^ #bp #} #+ #q #Y # # #/l˸ #aظ #ͷ # # #6^  #^ #)+ #@ #!L #(aY #|l #ťy #> #} #w #S #t͹ #۹ # #@o #۪ # # #0o) #-6 #D #P #] #-j #x # #Qs #  # # #cƺ #&Ӻ #C # #s # #v #N# #)< #^ #k #fx #N # #= # #~ # #aK #PYX #Ce #}| #DŽ #X #u #- # # #- #´ #- ## #/ #< #c #"r # #^ # #g # #I #W #+h #z_ #W # #P #5 # # #U #  #. #A #N #gg #lu #T #X # #f # #$ #| #P #C  #3% #\2 #[ #cvh #v # #J\ #- #w #W # #  #F #mn #c  #- #{& #I3 #@ #M #[ #lfe #Ir #N # # #uV #^ # #^ #X #d #W #q # #( #J5 #کB #O #Re\ #]t #r # #h #9 #+ #b # #ʤ #2 #K #qX #We #s #~ # #a # # #-p # #l~ #c #  #S- #b #][x #ŗ # # # #h # # * #c> #ʤL #b` #n #j| #2 #s #p #Nk # #_ # # #{% #׬> #yL #VkZ #}}h #nv #'f #[ #f #I #V # #X #y! #T/ #^= #bK #"nY # #SL #9Z #h #7ev #_ # # #m # #W # #6 #ZUD #PR #{` #Wn #_| # #q~ # # # #- #[ #Lq #[ # #y$ #2 #@ #N #\ #k #lz # #, #^ #t #x{ # #@ #I #ƚ # #^ #. #TL #g[ #5j # y #W #wf #@ #% # #n #c #Rl #p #S # #- #< #/K #Z #wci #x # #cv #^ #K # # #r #" #% #l/ #9 #C #tM #rf #d_} #: #c # #s #r # #D_ #h% #C+ #%1 #7 #W= #C #qvI #gP #W #^ #e #m #z #DŽ #Ҏ #N # #- # #h #C #H  #- #w/ #A #΋_ # #.e # #9 #m #e #3 # # # #W) #Y6 #vC #P #] #Wj #Buw # #$ # #j #g #\ #&j #d #E #* #* #8 #LvF #T #fb #hnp #~ #Vu # #b # #H # #  #e #{ #l #Z #b, #: #H #V #d #r #i #t # #[ #yk #\ #r #V #O~ #' #  #[ #4 #kC #MR #a #αp #I # #4s # # # # #j #  #y+ #~8 #E #qR #v_ #vl #y #se #U #zs # #? #{ #} # #բ #<  #Fq # % #?3 #A #WO #] #ak #y #(s # #{ # #I #Ʋ # # #~ #E # #̇! #k[/ #= #={K #Y #g # u #T #ڱ # #tY #Դ # #v #i #l # q  #l #@) #h8 #G #!iV #te #Qt # #| #f #U #0 #Z #Ј #Ot #~ #_  #z #( #@WG #`V #e #^t #t # #{ # # # #K #WV #d #} #2 #V # #g #t # # #Σ #d #V #ɵ # # # ##* #d7 #D #PQ #^ # k #lx #y #- #|] #oX #V #Λ # # #  #  #, ## #]0 #= #ֳJ #cW #^d #~ # #W #j #9 #} #S #k # #M( #5 #B #@O #\\ #ʞi #E~v #Ϣ # #v # #) #f #i # # #W # #M* #y7 #WD #VQ #-_ #ny #V # #x #u  # #> #h #d& #hG #JT #a #Tio #y #D # #L # #q # #Y #+ ## #l~0 #= #nbK #ϖ_ #l #ϗx #N # # # #n # #u2 #> #-T #a #n #l~{ # #nb # # #7 #  # #f #S #( #5 #B #ߒO #i #v #1Z #S #> # # # #T #-( #5 #QB #P #‡^ #ʝl #Xz #l # #} #U #[ #\ # # #v #/ #[< #[rI #V #c #qp #} # # # #p #^{ # # #m # #g #[ #e #* #C= #>J #W #Id #r #o_ # #^ #ʯ #p # # #: #~ # #e- #nG #T #ka #U}n #| #[ # #g # #  # ## #H`U #cc #r #V # # #ڕ #ԣ #s #N #h` #w  #t- #]c: #_H # #Ӱ #u # #| # #z #T #R #? #a~ #t #g #ֶ #> #H #l #˪z #  # #)n # # # # #  #W  #Y #& #3 #ѼL #Y #g #u #T #B #e # #7 #p # #]f # # #c #f]# #&1 #? #`N #Dq #/} # # # #  #EX # # #l~ #x #[X #" #&/ #Z< #XI #$V #Oc #p #p~ # #@ #x # #@ #` #  # #u # #ij # #h+ #9 #@M #[ #mi #w #Z # #ݰ # #\ #^q #* ##l8 #wF #(iT #`Ub #p #~ # #` # #s #^qC #Q # _ #$m #Bm{ #6i #T # # # # # #R #@b #Z #. ## #2 #6@ #cN #fY\ #j #x #  #; #Jr #P #3 #L # #0 #g #=$ #Lv2 #ƅ@ #DN #\ #)j #&x #W # #pi #- # #o #e #W #G #[ # #! # #Ҟ #c #vd" #UX0 #)} # #= #b #n #Ɗ # #Α #~ #* #$8 #]F #T #)b #sp #]~ # #p # # #o #j # #U # #& #h #Nu #A # # #0Uf #*r #  #  #p # # #92 #t? #efL #Y #g #t #8v #S #W #w # #c # #[ #h  #I #' #5 #.TC #Q #O_ #-m ##e{ #Z #B #m # #% #N} #f #p #V #w #Mn # l# #`1 #~ZJ #T #}^ #:ph #tr #Fi| #_ #T #- #] #G # #E #T  # #% #P3 #A #Z #&g #  #% # #d # #/ #c #a #do #Z #od+ #?9 #(uG #sU #9c #q #j # #Ε # # #g # #" #W # #L  #{ #Ih' #5 #qC #Q #1~_ #dm #h{ # # #Tf #u #W # # #Lg # #^# #Cv1 #l~> #cK #X #đe #`r # #MX #Zp #u #] #@t # # #9 #b #9  #J #&( #Ғ6 #SbD #R #` #n #| # # #9a #g # #} #, #z # # #[ #y$ # t2 #@ #N #] #l #T{ #cr # # #P #-t # # #, #Ќ #r #  #q/ #> #S] #?{ #;r #k #% # # #J~ # #` #̄S #a #~ #Խ  #FfI  #  #.  #]  #1  #զ  #} # # #  # #hh! #gT' # #o #n # #o  #9 #$ #1 #> #ȋW #6^d #|s #U_ #ck # # # #{ #$ # # #= #! #>T. #w; #iH #U #9z # #c # # # #= # # #0" ##0 #> #tL #Z #$h #v #ª #U # #&[ #a #` #> #ָ #q #O #+_) #D3 #L #TY #1f #t #! # # #W # # # #v #( # #Э # #: #yn( #l~5 #B #pO #U\ #i # #)e # #9 # # n #i #-\ #+_ #" #0 #m> #UL #(Z #ah #v #ָ #> # #{ #N5 #B #WO # \ #8vi #8|| # #t # #_ #؝ # #M #UZ #g #_t #Ek # # U # #9 #d #Vq #y~ #fi # # #c #  #6^ #U # # # #a+ #<8 #cE #չ] #)l #8vz # #M #l~ #an #v #c #! #7 # #" #1 #VO #%\^ #{m #nU| #K #@} # # b # #p # #tW #~o #) #;b/ #T> #JuM #l\ #0k #tz # # #.} # # #N # # #. #) #3, #;w9 #G #S #Ba #no #E} #~ #k #o #F # #[ #| # } #W #  #u  #%  #Y3  #sA  #:O  #:]  #3k  #y  #  #l  #i  #X  #Ҥ  #  #  #>j  #j  #}! #! #JT! #,!! #p'! #.! #h' #K' #TfX' #le' #Nr' #~' #k' #ϸ' #' #p' #' #' #9( #S( #z,( #9( #[F( #YS( #`( #m( #z( #( #Tf( #~( #k( #0( #Y\( #pr8) #lE) #9R) #_) #Y\l) #Qy) #e) #v) #) #) #) #) #G* #۶T* #9a* #0n* #{* #e* #t* #* #i* #* #]l* #i+ #+ #;++ #]l7+ #C+ #O+ #[+ #mr+ #Ŕ+ # + #w+ #}w+ #J+ #q+ #+ #`, #*|, #, #C+, ##7, #տC, #UO, #p[, #N`h, #tu, #, #, #<~, # , #, #q, #%m, #9- #- #z*- #c- # - #R- #- #- #7. #}. #X`,. #L. #Y. #f. #Wt. #4. #h. #. #~. #f. #8v. #!d. #) / #Ψ/ #҂#/ #+_0/ #{=/ #NJ/ #\W/ #d/ #E~/ #70 #8 0 #0 #p0 #p 0 #<0 #L0 #^Z0 #(th0 #tv0 #&0 #0 #0 #50 #sj0 #S0 #a0 #'1 #X11 #J1 #Y1 #w1 #[1 #Z1 #1 #`1 #j1 #91 #l~1 #1 #N1 #Y2 #c2 #?62 #F2 #r2 #2 #|2 #;\2 #2 #x\2 #2 #2 #q2 #p2 #h2 #u2 #@2 #2 #2 #ѻ 3 #WT3 #3)3 #ŭ73 #F3 #T3 #b3 #Nq3 #{3 #Fa3 #3 #3 #3 #3 #;3 #73 #3 #Z3 #o3 #=]3 #D3 #3 #3 #ݸ3 #`3 # 4 #r4 #)4 #74 #̻T4 #h4 #bdr4 #a4 #Ʀ4 #H4 #s4 #94 #4 #4 #~o4 #4 # 5 #5 #v#5 #d05 #)=5 #NP5 #c]5 #5 #WT5 #35 #c5 #5 #5 #X5 #\6 #6 #Ѓ6 #$6 #+6 #R6 #e_6 #Vl6 #y6 #6 #6 #6 #6 #6 #O6 #b6 #0_6 #6 #6 # `7 #t7 #͔"7 #c{/7 #<7 #؎I7 #a7 #n7 #c7 #l7 #7 #~o7 #V7 #ޙ9 #9 #ڇ9 #99 #9 #9 #C9 # 9 #9 #T9 # : #X: #_(: #6: #D: #gR: #]a: #an: #: #j: #: #: #đ: #|: #: #mu: #: #*: #u ; #; #4; #eWA; #oN; #ka[; #Rh; #iu; #; #U; #ؐ; #; #; #u; #E~< #t< #{u,< #?< #+qL< #Y< #f< #_< #-< #"< #"< #< #< # = #c= #fm$= #}1= #>= #> #? # ? #? #? #? #l"? #^/? #H #ߣH #H # H #qH #_H #KH #)H #@I #I #$I #3I # BI #QI #`I #oI #f~I #<I #I #I #JdI #I #CI #SI #g}I #YJ #J #V#J #\2J #AJ #WPJ #_J # jnJ #}J #J #AcJ #{J #.J #JJ #1J #6K #ۓ K #u.K # =K #^LK #r[K #ejK #yK #K #vK #K #K #WK #?K #K #"K #TK #yL #"L ##L #!1L #~j?L #uML #Ѐ[L #C|iL #`VL #L #DL # L #d!M #OM #sM #|M #%M #mM #cM #WM #UM #sN #0N #BN #VTN #isN #TN #N #N #@N #-N #N &{ N %nIO %VIO %IO %I'O %kJ+O %UJ0O #w;O %J?O %JOO %dKSO %NKXO #?bOkO & tO #OO7O #O & O #O %KO %KO7O & O %KO %KO %LO %KO & O{8 P{8P{8*P8;PHPh SP & gP %!LkP %LpP & yP #P %=LP %5LP8P8P %LP %~LP %LP %LP %LP %LP8P8Q9S #HS & ^S %NbS %NrS %XNvS %NNS %NS %NS #wS %OS %NS #S %OS %OS #uS %PS %PS %bPS %BPS %PS %PS #S %/QT %QT #?TpT & #T #/T8T4MT #{WT & `T #kT %QoT %~QxT4T & T %QT %QT %QT %QT & T5T5T5T6TTh U &a U #ѪU %Q#U %Q-U #3:UCU ##TPUX^UgU{Ul7UU UpUU #3U@U ##T VPV4!V & 1V %R5V % R>V %RBV %RKV %-ROV %+RYV_5bV & rV %CRvV %?RV %[RV %YRV %jRV %hRV_5V & V %RV %RV %RV %RV %RV %RV & V %RV %RV & V %RV %RW &/ W %[SW %YSWh5&Wh5;W %oS?W %kSHW %SLW %SUW %SYW %S^Wv5W5W26W26W %SW %SW %SW %SW %SW %SW26W26X %SX %S'X %S+X %S4X % T8X % TAX %TEX %TNX &A [X %4T_X %,TiXN6XN6X &Q X %TX %TX %TX %TX %TX %TXS6Xc6YY#Y5OY7sY7Y57YY YpYY #Z 1!Z %U%Z %U4Z %U8Z %jU=Z #GZ %UKZ %UZZ %VV^Z %@VmZ %VqZ %VvZ #XZ %WZ %VZ #?Z & Z %>WZ %8WZ & Z #Z %aWZ %WWZ1Z1[ %W[ %W[ %W[ %W[ %W[ %W%[1I[ & R[ #^[0g[1|[ #B[ & [ #[1[ & [ %W[ %W[ %X[ % X[ & [1[1[1[2\0\ ,\1P\1\ & \ #\ %/X\ %)X\V1\V1\ %cX\ %aX\ %}X\ %{X\ %}X\ %{X\b1]1T] #e]] &h r] %Xv] %X] %Y] %X] %bY] %PY] #?]] #3]] ##T]`] &~ ] #]h^3^ #)^ & (^ #2^ %Y6^ %Y?^3H^ & T^ %YX^ %Ya^ %Ye^ %Yj^ & s^%4^%4^%4^T4^h^( ^3^ #|^ %Z^ %Z^ #:^ %5Z^ %+Z_4_w_w2_w4\_q_ ~___ #s_ & _ %qZ_ %aZ_ %Z_ %Z_ #v_ %'[_ %[_ %[_ %|[` %[` %[` #?!`*` &+ 3` #?`H`92]` #e` &@ n` #x` %[|` %[`92` &@ ` %\` %\` %4\` %0\` &@ `2`2`2`2`a a #3%a.a ##T:ahDa`2Ya #|ca %S\ga %O\la #:va %o\za %k\al2a03a &U a %\a %\a %\a %\a &U a %\a %\a03a &U a %\a %\a %\a %\b %] b %]bGbG1b2Ob2sb3b[3bq3bmb bbrc #A&c &o ;c %*]?c %]Nc %]Rc %w]Wc #vac %]ec %]tc %^xc % ^}c #U|c #?c0c & c #Zcc/c #"wc & c #c %7^c %5^c/d & d %I^d %E^d %x^ d %t^%d & .d0>d0Gd0Zd0kdxdp d #3dd ##Tdpd0d0d %^d %^d %^d %^d %^d %^e e eG08eX0Vei0ne 1{e=e e0eBe #e & e %^e %^f %5_f %+_f %k_f %g_f #U|-f #?7f@f &. If #UfH^f,.sf #q{f &? f #f %_f %_f,.f &? f %_f %_f %_f %_f &? f.f.f.f. gHg)g #35g`>g ##TJgxTg &O ]g #ܘigrgZ.g #vg &_ g #g %_g %_gZ.g &_ g %_g %_g % `g %`g &_ g.g.g.h. h-hH qj #Qj #֜,j #x`8j #>qDj #QRj #vdj #pj #+|j #j #nj #j #j #j #j #j #`j # k #Ok #g"k #c>k #Kk #^k #ډok #k #k #Yk #Yk #Yk #Yk #k #k #Zk #Zk "k # k $.l $l &l !pQl #=l #0Il #Sl #Jal #fl #Ktl #~l #=l #/ol #Ml # Jl #l #tOl #l #6l #Rl #jWm #]m #M'om #F}m #m #7Km #m #/Hm #3,m #am #Q~m #)-m #@#m #mm #m #n #Cn #pn #L*n #6n #07Bn #QgNn #Zn #Yfn #`!rn #1n~n #n #Skn #jn #n #bn #`n #=n #Cn #z0n #[o #W o #R}o #;$o #d0o # #N #^ #Dm #Y #U # #g #3ǁ #rVց #* #T[ #O #n #`! #(0 #? #VN #] #Ll #E{ #\8 # #% #  #QƂ #QՂ #@ # # #qS #nk  # [/ #> #IN #8v] #Hl #]{ #f #x+ #Dž # #Qƃ #Ճ #u( # #o #e # . # = #.L #v[[ #cj #y # #  # # #xĄ #Fӄ # #1 #}s #[n # A #U- #< #K #qZ #!i #Xx # R # # # #Å #O҅ #  #  #)= #_S #2 #Ob, #1F; #f|J #CY #Bh #H:w #j #g2 #  #*` #&† #Lц #_ #N? #F #Q  #T #+ #x: #*I #2ZX #f9g #Cv # #L # #j #d #=Ї #g߇ #s # #  #5 #Ml+ #:: #9I #xX #g #9 v #3 # #^ #$e # #ш #8W #@ #F #N  # #9+ #3: #3:I #хX #5g #Btv #` # # # #p! #V^Љ #%߉ # ##k #4  #1 #d* #j9 #DxH #fW #=v #i: #Z #|M #> #O5 #0yЊ #ߊ #M # #[  ## #Bl* #,9 #vI #Y #hi #Iuy #Z #? # #y  # ŋ #F #e  #@- #f< #"q #N #d #8 #_X #bd #Ō # #k #b ##0  #K #k) #b7 #vE #%S #O{ #1 #~/ #& #4;Ս #~ # ' #  # #C( #]6 #+6E #_S #a #o #} #D #0 #j #rt #]fÎ #vю #: #s # #% #WM #a #v #JZ # # #\Ϗ #} ݏ #[ #Q # # #B #`& ##3 #6A #NM #Z #Kg #]t #i4 #  #4 #/ #P #<Ґ #o #u # #  #( #ǎ4 #*A #N #,[ #Kh #u #px #s7 #e #/ #a͑ #_iӑ #ّ #Sߑ #/ #Q #  #` #ac' #24 # A #VY #|f #'s # \ #  #( #?Gǒ #/ #O #ـ #, #^, #j]: #H #V #od #r # #  # # #` #,Ɠ #{ԓ #R #!g #*  #s0  #K #@-( #;6 #jD #~R #?` #7.n #| #P{ #) #3 # #[s” #!Д #] # #* #6  # #/' #4 #WPX #d #Xp #} #  #?; #o # #}Õ #ɕ #$ϕ #ZՕ #ە #} #Lr #1 #e #R #/ #oB #S_  #p #K # #2B4 #8E #\ #W.b #"h #n #rt #^z #> #j #c #: #u # #K@ # # #A #t #– #6Ȗ #EΖ #UԖ #ږ # #V #  #q #H #s #@ #   #V- #A: #8S #8?` #j{ #R #r #w #I  #? #{ #И #J #d% #92 #I? #ȑL #b #8 #I #wx # x #_6 #57 #D #Q # # #%Q # #*:͚ #ܚ # #h # #* #\7 #()E #R #B/` #yG #t #NF #0E #%Q #ԛ #L #p #  #Y #$ #02 #-@ #fN #7un #^| # #t # #% #7'œ #tל #1 #  #NFD #I ##0S #` #/m #s7z #, #K # #d< #q #ɝ #v)֝ #6d # #W  #@ #N^& #3 #q #H/ #S #a #/3 #  #/Ğ #^Iў #|ޞ # # #= #B% #Y!2 #߇N #J}[ #n # #' #x #d #Y! #߇ǟ #ڟ #D #J # #Y  #jE #͉R #/_ #l #? #n #) #la #TȠ #5۠ # #+ #  #i # #!C  #& #\j #* #G4 #lA # O #l\ #Ws #e #& # #6 #á #TNС #,ݡ #}  #T #2 # #xp, #/: # G #V/T #Da #|mt #zb #  # #zb # #V9Ģ #HҢ # #G #zb #  #Z' # #T% #H3 #@ #KM # Z #g #Et # #8 #x" #U£ #-ϣ #J} #3 #r # #:# #}0 #= #J #KW #/z #1 # #m #` #¤ #~/ #d #S # # #u.  # - #K; #хH #U # b #| #2 #Z #^Oͥ #1٥ #- #x #j #` #% #2 #II #V #c #p #A # #I # #Ŧ #IҦ #ߦ # #u # #k #I4 #2A #}X #e #RBr #n #b #D #5! #7 #kPϧ # #i6 #; #&* #%a8 #E #^Q #i #:u #5 #[ #Y # #rͨ #ڨ #; #R  #  #X; #N #_, # : #5%G #"T #oa #n #$| #< #2V #t #:ʩ #=Yة #. #1 #0 #   #: #NF( #5 ##5B #zO #o] #pj #Hw #/! #mY #,Z # #0 #rƪ #TӪ # #d # #z5 #M #y3 #I@ #NN #TN[ #EEi #xv # # c #p #/ # # # #{ # #( ## #/ #U< #J #_ #l #Kz #7q #c #v̬ # ڬ #\8 # #K # #[ #+" #x( #o. #z5 #QC #Q #6_ #{ #\8 # #% # #­ #c7Э #pޭ #c #W #kR  # #Z& #; 4 #=B #HP #U"^ #<l #eIz #lT #N. #O; #- #)® #DЮ #Mޮ #% # #Q #Yk #$ #R2 #h@ #|N #\ #=j #x ## #! #[ #> # #_̯ #}گ #Ɉ #b # # #F  #(. #!< #:K #Z #Jh #!w #S #@ #!7 # #\ #c˰ #=ٰ #7 #S #n2 # #" #&- #; #WAI #W #3e #|Is #O[ #[ #|I #49 #ʱ #_(ر #%@ #& #\ #v #*$ #|HJ #:gX # g #xu #" #PK #  #S #K #Sɲ #/ײ # #>  #( #3+ #Y' #7 #ZQG #W #if #n #a # # #س # #R # #r #3- #.; #I #W #@g #@ # #W #= #XŴ #6 #] # #  #O0 #Jy+ #C9 #V|G #dU #c #Xq #G #eA #/ # #* #"rŵ #wӵ #Ze #  # #K #5 #B #ZcO #Wdi # # #h #e #]ƶ # #Gm # #e #_! #L. #{; #@H #/U #Sb #F2o #5| #ڊ # #p^ #/) #*8 #ʷ #׷ # #d #X; #t* #7 #UK #e #r # #c #% #WƸ #FӸ # #/ #_  #Dž #@}! #+ #5 #e? #M #"_Z #g #T>t # #? #w #4 # #d¹ #RϹ #,ܹ #I #C #/ #G #  #:. #F; #sH #j U #^c #| # # #s #Q #º #|޺ #J> #. #\8 # #($ #uI2 #%@ #hN # \ #@j #x # # #nk # [ # #Q̻ # ڻ #U #)G # = #|R #5  #)=. #i%< #DJ #X #f #vvt #R #Bh # #{ # # _ȼ #h ܼ # #7 #  #, #*n# #x- #7 #A #K #U #b #@(o #t| #/ #K # #_ #a #=iн #O߽ #> #L  #l #_ #) #?)1 #HK #tU #*_ #~ #0 #;@ #0  # # #-; #ھ # #k #  #  #?" #5 # >B #WO #WP\ #NFi #/v # #O #%f # #f #nǿ #Ћѿ #[ۿ #  # #| #`E # #1+ #jo8 #)E #W #>d #q #j~ #J #k #u #& # #&\ #4a #D # #o # #* #JT7 #qD #=Q #` #~m #@ #?; #^$ #9 # #! #Y #;  #]\ #$ #]7 #C ##H #)HU # #N #?0 #І #Z #- #m7 #5 #4@B #/ #\ #zn #$ #Ç #K #@w #S #{ #}' #J #N #" #9o0 #qk #x #K #x # #{ # #D #A # #s #   #P  #- #H: #G #T #a #Kn #F{ # a #S #{ #m #z* #> # #rW #bx # #Ge  #r #V% #R3 #bA #NO # Ox # #Q # # #W #' # #r #- #& #!< # I #^V #km #z #^ #CX #^ #X #u #y> # #zd #U #{V* #4 #B #{P #A^ #& l #z # #S #} #X # #Sv # #nI #@ #GB # #7 #E #|a #]| # #_ # # #& # # #  # #~6 #D #gR ##` #In #`N| # # #E # #5 #\ #X # #? # ~  # #rm' #%S6 #E #7 T #c #4r #Z #[ #x8 # # #' #p # #[} #us #& #5 #D #CS #b #sq #/ #S #w #, #d #' #+" # #Aq # #7U #|% #a 4 #C #,R #a #np #" #Ji # #5 #D #b  #> #a #r* #/Z #.h #  #H #v #2 #+ #uU #s #Fc #OE #s@ #o  # e # #s #Bj #v #6 #IY #Y* #<6 #8F #OL #IR #@X #^ # 8d #j #R#q #ӎ # #> # #l #X # #L #A #< #M, #g #\ #s #To #J #F #* #7 #q # #p  #G3 #+ #  # #* #5 #m #^ #5 #m #1* #^6 #…B #UN #?2Z #"q # 1 #g #?2 #B #kA #?m #  #]  #> #& #Ns3 #s@ #MM #Z #(5g # #zL #Ҋ #J # #q #T #Y #W0 #6d #[ #W) #faJ #KW # m # #3& #) # #E #@ # #L) #15 #A #hN #=[ # h #-u #  #D+ #' #, #  #( #s+ #c #@ #"P #  #0 #K? #dM # `[ #&i #@w #9  #: #a # #_+ #  #. # #A #"  #gr #\b% #3 #A #WO #[] #Nk #'y #q #R #) #: #P # #lG #f #N #y #B #hp! #Y/ #W= #L #4[ #Dss #  #P #R' #T #[p #^m # #j #_  #0 #pK' #j6 #4/E #rRj # kw #l # #  #  #P # # # #` #6 #g3 #V #y+ #&B: #nUH #{V #Ld #r #^ # #l # #n # #S #&l #++ #3 #V  #sl #k( #U6 # YD #R # ` #n #LJ| #J #2 #f #mO #5 #T #mc # #zX #U  #[ #D, #T; #]J #$Y #bh #*w #g #O #a #3( # } #{i #^ # # #~  #B" # + #: #I #X #gg #{ # #m # #yZ # # #f\ #S6 #.  #C #s #2 #  #_ #B= #W #= # #C #.= #( # #5  #u # #)b) #RW6 #/C #@(P #hj #fw #_ #,' #@ # #% #_ #H #_ #[M! #>; #(LH #_U #%b #Kp #m #% #D #T  #  #(  #& #i- #@7 #zD #Q #)^ # # #B #gM # #E #r #_ #N # # #a! # H #\U #)h #u #; # #3 #gy #4 # #^ #Տ% #O? #NU #?a #k`w #e #s #) #w` # #; # #q #5 #jJ' #M+: #xD #S #\` #m #Hz #0 #. # #rm # #i #t # #)#" #TF #)_T #Kn #{ # # #  #; #_ # #T # #ȍ #6 #l #\ #) #;6 ##[u # # #P # #) #v #U+ #I #= # #k #3 #\8  #- #n2; #iH #V #c #^p #W #G #T> #1 # #l #J> #  #R #" #^0 #= #UIJ #W #/d #:_s #0 # # # #I # #du #w/ #,J; #>FP #a\ ##i #E #/ #$ #B ## #= #2$ #3C1 #&u> #L #Y # f #!gs # # #o #S # # B #v}  #G #W( #j6 #!lE #)NV #@\ # b #Eh # n #=t #.z #y # #W( #b #b #h #r # # #C #y #   #U #Z# #0F #gP #lx #eV #G~ #s #3 #x #1r #b #  #!W #9 #d #j1 #r? #jM #$[ #Fni #w # #+K #l # #C #m= #S #B #  #.v #@' #ƃ- #r3 #P: #g #A]t #P # #p9 # #{ #AI #U #P #8 #J #qg  #r #B'% #I 2 #܈? #$L #$Y #f #*s #z #  #C #@W #; #N #N # #6 #B_ #< #] #1#- #S; #]I #W # #cD # #  #V #, #dW  #΄ #iQ& #y4 #!B #> P # #( # # # #q# #1 #?? #^M #[ #Ai #}w #> #o # #? #2 #%/ #r #/ # #~ #V #3J  #e0. #J #}X #m[g #`;u #` #E #B # #9  #[ #u{ #~ #Z{ #] #0! #m/ #= ##K #ZY #g #;nu #} #6 #D #E #k #i #= #/ # # ## #h0 #>> #q # #$ #I #- # #N #X # #Zy #d #t   #i #q' #75 #4C #GQ #R_ #m #P{ # # #.  #+ #d #X  #_>  #'  #ar@  #M  #z  #   #  #k  #P  #J[  #%   #,  #_  #   #)  #)  #/7  #TE  #S  #7a  #o  #x}  #  #5  #+h  #a[  #u  #-  #~  #R  #  #k  #   #%  #+3  #A  #zO  #]  #k  #}y  #+  #  #   #-  #G   #  #%  #u  #K  #  #e&  #f5  #\C  #jQ  #NF_  #Dbm  #&3{  #6  #U  #  #W  #  #X  #E  #)  #e  #~#  #q1  #1?  #MM  #s  #.  #   #f   #  #  #4  #H]  #2  #r  #  #dZ  #2 #s) #]7 #vE # S #a #.o #K7} # #S #; #J # #9 # # #i #* #*i9 #fC #W #Qa #nk #0 y # #/ #NF #- #t/ #y # #a #< # #  # #/]* #@8 #-F #T #OAb #xp #.~ # #? #s #I # #> #Jg #> #` #+X  # #~& #4 #B #yP #]^ # ]l # z #lV #y # #6I #ra #+{ #L #>? #.. #  #.d #p, #mq; #'J #GY #Rh #,Pw # #, #C #u #x #7p #3 #^1 #T #A7 # -a #  #: #" #'cZ # #ph #!A #Y # #_G$ #h #j #[/ #]W #Zh #en #"t #' # #] #O=J #nvW #@d #q #3~ #s" #-& # #K #R #/ #  #m #l #n #&- #W< #?H #ieT #` #Bl #Ky #Z  # #^" #F #+a # #]3 #jn #6 #rV #gM #9  #- # `; #H # U #rb #3o #@ #) #/ # # #x #i5 #{! #NF. #o< #AJ #{X #!gf #t #o6 #m #qL # #`g # # # #, #j]  #*  #+h6  #C  #?M  #f  #us  #  #  #TN  #J  #<  #_  #"]  #`g  #(  # ! #" #Q"" #P(" #$." #Xa5" #B" #O" #%q\" #i" #v" #" #w" #" #w_" #@" #" ## ## # # #.# #NF<# #qJ# #ZX# #f# #,t# ## #;# #j]# #,$ #:x$ #$ #MvO% #s"\% #_i% # ;v% #% % #|% #E0% #!g% #:x% #% #;% #]% #'g& #t& #& # g& #& #2& #& #`' #@' #' #h' #@' #%' #' #/J( #scW( #Ed( #|( #O8( #*( #( #~( #H) #F) #WP!) #4/) #&<) #I) #(V) #Zhy) #4) #% ) #Q) #) #I) #) #) #) #Mv* #r* #o* #O* #c* #=A* #m,* #* #* #$* #H+ #<+ # #+ #? 1+ #K?+ #NF]+ #k+ #y+ #+ #+ #+ #?!+ #4+ #B, #p, #h2, #:?, #XL, #Y, #cf, #/s, #/, #SF, #, #, #9, #/, #@5, #, #o- #/- #^+- #:- #% H- #3b- #]p- #- #- # - #3- #TN- #>- #c- #*;- #p- #. #,. #J;. #:J. #!oY. #h. #6}w. #:. #. #. #\V. #. #K. #ww. #j. #h/ / # / #^*/ #X9/ #!gH/ #6 #/lK6 #{X6 #le6 #r6 #V6 #6 #r6 #n6 # O6 #K6 #Q 7 #j7 #9-#7 #ڑ17 #?7 #K6M7 #8<7 #67 #@7 #J7 #l7 #.7 #$7 #hb7 #7 #L7 #? 8 #+8 #&8 #38 #+@8 #M8 #Z8 #c]g8 #g(t8 #=8 #8 #nH8 #@8 #,8 #`8 #X9 #^:9 # u!9 #.9 #L;9 #?H9 #+U9 #b9 #o9 #|9 #X9 #.9 #: #^: #@ : #jw-: #.:: #rG: #MT: #Ua: #6tn: #M{: #I: #]: #'; #Z"; #@/; #X<; #I; #MV; #!gz; #%%; #; #; #Mv; #^: < #-< #< #< #@o+< #@9< #G< #8U< #n< #D< #3< #e< #k< #_< #= #= #= #Mvp= #(~= #)g= #= #*= #M= #&j= #]= #= #5= #= # = #w= #@H= #z9= #` > #> #'> #P5> #?D> #{lR> #0`> #o> #By> #K> #f> #7> #8>> #> #K> #Ip> #> #> #> #> #O)> #5L> #/s> #q]> #> #p ? #_? #:r'? #PC5? #`R? #\Pf? #p? #!? #PG? #W? #N ? #@? #X? #7? #K? #7j? #j@ #3@ #/"@ #*/@ #n<@ #T@ #93a@ #*@ #@ #@ #/@ #A #97A #^A #VB #}B #-"B #/B #kuN #cDN #xJN #PN #8VN #"\N # bN #hN #.nN #tN #3czN #FN ##N #-N #xN #N # KN #1N # $N #-N #0N #N #FN #kN #|N #N #N #+N #wN #SHN # N #yN #hN #zOO #<[ O #uO #+1O #LO #"O #[(O #v.O #4O #E:O #@O #8FO #LO #dRO #lXO #^O #VdO # jO #pO ## vO #{%|O #T O #HO #2O #O #aO #O #i;O #ZO #.RO #O #O #qO #EO #rO #i1O #3O #'O #1O #^O ##O #O #R-P #sP # P #~P #P #DP #U$P #E*P #O0P #6P #CP #\P # P #P #OP #f.P #/P #JP #GP #yTP #P #P #RZP #P #6P #xP #NFQ #uQ #FQ #(Q #ɐ5Q #BQ #gOQ #\Q #tiQ #@vQ #J[Q #Q #6Q #HQ #ZQ #/Q #%Q #Q #J[R #sy R #R #yR #$R ##R #.*R #1[R # aR #hR #vR #@R #gR #8R #R #R #tR #@R #/R #b(S #_5S #YS #vgS #lMS #S #;S #bLS #XS #WS #8S #] T #T #u%T #NF3T #uST #X7qT #J[T #xT #T #qT #/T #\T #T #lT #@U #U #%U #F4U #)OCU #uRU #gaU #8pU #tU #@U #kU #qU #9U #!U #U #iU #@U #V #ɐV #(V #l8V # HV #!YV #hV #J[V #6V # ~V #V #+(V #yV #V #NV #lV # W #W #`v*W ##9W #HW #WW #ifW ##uW #,FW #}W #l'W #?W #NnW #!W #DW #W # X #hX #l(X #7X #FX #jUX # dX #sX #IX #yqX #-X #IUX #X #uX #%X #OX # (X #JCY #jm&Y #H5Y #DY #\SY #!MbY #Z<qY #6`Y #(Y #&Y #2Y #) Y #0Y #Y #aY #Y #oJZ #D,Z #m%Z #4Z #ehCZ #o4RZ #ӐaZ #/pZ #HZ #Z #HZ #ZZ #SZ #3hZ #-Z #Z #tZ #@[ #d[ #%5[ #y6D[ #N$S[ #b[ #/S[ #/[ #B [ #t[ #[ #^[ #[ #X[ #v\ #Lm\ #\ #.[-\ #7;\ #e}I\ #SW\ #H4e\ #ks\ #!\ #"\ #c\ #sr\ #\ #\ #K\ #\ #|1] #7>] #K] #:X] #!e] #D9r] #A] #] #@] #6] #] #"] #%] #dC] #]` ^ # ^^&^ #l*2^ K^ #B.W^h^fq^ #}^^ #p^ ^ #G^ ^ #^^ #th^ _. _ #,_  _ #u,_ 5_ #)2A_ `J_ #s|V_ @__ #hk_ t_ #V_ _ #9_ _ #_ _ #Lw_ _ #(?_ _ #K_ `_ #T2_ @` # G$` -` #%,:`@C` #P` Y` #Yf` o` #U|`` #G&`` #` ` #0` ` #>C` a #a V5a #Ca Laa #oa $a #5a a #a a #a #a # a #b #)5b #]Pb #vbb #{b # b #_?b #/Qb #b #M c #'4c #Gc #^c #Npc #)~c #c #c #Ec #ic #{c #+ c #9= d #i#d #]3d #Kd #jcd ##zd #td #Jd #(d #7d #e #X,e #0^Me #_lhe #"e #z7e #`e #e #Ne #e #f #I$f #D;f #tMf #Hkdf #3f #Af #ґf #^f #Uuf # g #c'g #+:g #X$Mg #eg #xg #g #;g #$g # g #5g #'g #h #?1h #&Nh #gkh #$<wh &[ h %]`h %G`h %`h %`h %ah %ah %;ah %5ah %kah %[ah #^Di #Moi #i %ub"i %_b'i #m5i #NIBiKi #Xigi #NIti }i #ii #NIi`i #ii #NIii #ii & j %bj %bj #NI'j0j #=jGjx>ij(tjj8 j &0 j %bj %bj #NIj j #jj>k k#kx 4k &J Hk %cLk %cVk #NIck`lk #ykk>k,k~k k &d k %:ck %6ck #NIl l #l!l>Cl0Nl_l tl<~l &r l %Wcl %Scl %tcl %pcl & l %cl %cl %cl %clSlSlS mS!mS6mSOmSdmSymSmSmSm=mcm#=n & n %cn %cn %c#n %c(n & 1n %d5n %d>n %7dBn %3dKn %XdOn %TdXn#=bn#=n %sdn %qdn %dn %dn+=nnnnoo5oJo_otoooG=oo=o & o %do %dp %dp %d p & p %dp %dp %d#p %d,p %e0p %e9p=Cp & Tp %3eXp %/e]p & fp %Iejp %Getp=ppppppq%q:qOqdqvq=qq=q & q %beq %Xeq & q %eq %eq=rB'r 9rl=Tr^r?krr8 rr rrh r*r +s #Js #qWs #Uds #mns |s #NIs@s #ss #NIss #ss #st %et %et#2t uEGu #lMu2Vu #=\u-eu #wkutu'u #Pu'u #iu #NIu` u #uu #NIu u # vv #NI(v 1v #>vMv #NIZv cv #pv~vvv %_fv %]fv %wfv %ufv %fv %fv %fv %fv %fv %fvvw&w &}3w &}z.Hzm]z gz|zpzzz z-z z2z>zQ{  {]{.){k>{N{q{ #{ #m{{ #{ #NI{{ #| | #NI| #| #0|=| #sCX| #C| #| #a| #(| #q| #||| #a} %h} %h} %*h} %$h} #g[*} %Gh.} %Ch3} #C} #7W}aa}a~} %ph} %nh}]}w}}~~ #_ ~ &G*~ #65~ %h9~ %h>~ #kI~ %hM~ %h]~ %1ia~ %%if~ #mp~ ~~ #NI~` ~ #~~\T~\T~ %ii~ %gi~hT~~T  &] %i %i#T4CTMTj %in %isTT &m %i %iTLULU %i %iZU U*UG %iK %iPUap z PTTҀTT  U.#UIS4U` %l %l #dC %m %gm %-n  %n %n %n. %Bo2 %o7 #m@ #F%OO #UQ^ #UdNRm #=sFR #NI  #0 #NI Ƀ #փ( #NI`  #  #NI$ - #:I #NIV _ #l{ #NI  #G #Ȅ %p̄ %oф #e܄ %ip %UpGG  %p %p %p %p' %p+ %p4 %p8 %pBGLGe %qi %qr %qv %qG %8q %(qGGɅ %qͅ %qօ %qڅ %qG &f  #P4qH7DOqHd #P4qzH+H #P4̆ՆH= &y #P4$H<PITHi #P4vHa & #Ç %qLJ %q̇ #eׇ %qۇ %q$LH &  %r %r %r %r# &0 &=HR &_ %sc %slHv & %s %s %s %s &OOOЈOX &H% &2 %t6 %t?HI &V %tZ %tc %Htg %Dtl &uoOoOoOO։4I &' %it %ct %t %t v %Rv %Pv %gv %evIڋ %vދ %~v %w %w %w %w %(w %"w %Jw %FwI+6J56JR %iwV %gw`JjJ %xw %vw &pJ &Č %wȌ %wьJی & %w %w %w %w &PP!P5PFxSHb &oJ & %w %wJ & %w %w %&xƍ %"xˍ &ԍPPPP@ x/ &<JQ &^ %Cxb %AxkJu & %Ux %Qx %x %x &YPYPYPώP & J &+ %x/ %x8JB &O %xS %x\ %x` %xe &nQ~QQ0Qɏ &֏J & %x %xJ & %y  % y) %@y- %} %.} # ß %}ǟ %}ן %}۟ %} #sY %*~ %"~;  #"<>?<U fa;; T<̠ ֠n<|< #Q. #"; #mE S #Àao #܋z #X #h # #Xɡ #NI֡ ߡ #H #NI@  #@- #NI: C #P8_ #mx{ # #X #@ #' #Xբ #8 # #X #, #7 #XK #98Yg #،r #X #` # #X #b8ϣ(ݣ #, #X #‚  ## #X7 #؂ES #^ #Xn #| #7 #X #(٤ #" #  #d^ #3 # #O #:ť: %~ %~ # %~ %~  %~ %~N:-Z:; #\B Bd %h %~q%B{ &  %% %! &  %A %9KBcBݦvB #/ #m9 C #DK #6W #NId m #zP #  # #X #6 #6t:  %h %b  %$ %) &K 2 #= %A %G:` #7 # #Ĩ #&Ш F #_ % % % %  #6 %} %q! &/5 %9 %C)FM &^ %Àb %g8FxkF &? %݀ %ـwFƩFש #_ &  #_ % % %Z %P* %Ɓ. %3 #m= K #NIX` a #nX|yE &  % %EEʪ &۪ %ߪ %EEE+ %(/ %&4EET^rE(  ͫ #+ի E %D %>)E &  %b# %`(9E9HIER & fpVEIE #, &  #6ì %Ǭ %x׬ %۬ % #m  #NI  #`)D3 & D %H %MD^mDwD %  % DcǭcۭD (  'K #T@Dt %)x %# %M %E #  % %YD %î %ȮkD #]0C %у %Ƀ #cs! %% %3 %27 %*S %bW %X] # f %j %o{CCC¯CCC*D. #647BX %\ %k %o %لt #cs~ %  %B°BB C #d&9= #^G %5K %1P #Z %P^ %Lm %mq %gv9 #  #h #{ӱ #) # #A  #*WL #^Y #h #L #A #[ϲ #~ #[ #y. #; #@I #ci #{ #NF #/ #d+ #NF #/ó #-ҳ # #NF #M #`  #E #/) #f7 #I #@V #NFc # Bp #/} #!l # # #K #J´ #Kд #S #K #NX #{A #0# #)$I #8TV #uc #NFu # # # #5 #N #gѵ # # #I #  #d& #8TE #zT #{c #{r #{ #{ #{ #| #&| #>|Ͷ #۶ # #E #8T #ى7 #C #ekP #Vc #yn #yy #z #+z #Cz #[z #sz #z #zǷ #zѷ #}޷ #u # #w #x- ##/ #K@ #^R #&d #&v #& #& # #X #%ϸ #! #qZ  #_y #u*9Z?u %y % %Ɇ % %ۇ % %ˈ %ň % %@ &~ ѹ %kչ %A޹ %O %% %5 %  &~  %  % @'1@MWAs},AHAɺdAA A1;AWaAy@@ûһF %X %TFF0 %s4 %o9FP #kT #iZ #^ #$d #e)h #e)u .{ # $% $% &' !x #O #ͼ #׼ #Q #m0 # #H #& #  ## #( #˟A #MM #[ #bA` #n #i۽ # # #z #3 # # #* #m6 #B #s.N #iZ #?f #r #؝~ #6 # #: #< #> # #w; #پ #C  #3 # #ř # #! #>- #*9 #E #<V #!7b #s #  #K #, # # #2 #ǿ #ӿ #߿ # #u #  #d #/ #d= #;I #V #c #z,{ # #? #Ӯ # #y # # #˨% #ү= #I #jV #,c #8q #~ #, #8 # # # # # #M #a  #>B #( #@6 #<D #vR #+` #n #z| #f #g # #  #U #I # # # #  #N #& #4 #!2B #~P #^ #F1{ # # # # # # # #  # #z! #T0 #? #N #G?] #l #q,{ #C # # # # #) #± #{ # #, #5  #/ #> #&?M #\ #k #Tz # #ٖ # #A #  #< # # # #߳ #] #z. #= #4L #[ ##j #y # # # #& #* # # % #]40 # L #,Z #Dh #' #0 # # % #]4 # #7 #t #  #h #' #5 #Di #o #  # ## # # #  #'. #x: #H #W #} #+ # #  #& #t # #  #D ##% #2 #? #L #c l #Fv #l #Z1 # #M # # # #7< # #D" #: #-4G #m*T #a #n #?{ # # # #< #[: #( # #9 #3 #t #ʳ #%" #0 #> #7,L #Z #h #>v #%  #y0 # #e #= #  #ج # #$ #3 #B #Q #H` #qp # #c #k #2 #1 # # #  #_ # # #$ #23 #:B #?Q #٢` #o #ՙ~ #1 #j # # #  # #h #8 # ## #0# #Ƕ2 #A #5_ #n #} #$@ #& #>< #% #{ ##0 #: # #  #. #' #7 # 5G #,&W # g #ww #  # #0 #q # # #ĝ #pA #5  ## #^2 #LA #P #d_ #sn # } #` #} #  # # # #ޕ #B #l # #'" #1 #@ #O #;^ # m #| # # #1 #Z  # # #=% #k # # #" #61 #Q@@ #}AO #z^ #{ # #ޮ # # #ʻ # #  # #@ #2 #  #/ #>> #'M # \ #k #%6z #" #* # #k #7 #I # # #f # # #. #c= #L #[ #ij #y #P # #NB #Z # #+ # # #W # # #- #=< #K # 9Z #i #^x # # # #` #' # #  #z #y #ߤ # # , #; # J #Y #h #"w # # # # # # #' #v #/ #O #K #P , #-; #7J #Z #i #<x # # #R # #8 #B #6 #) #X# # # #, #; #CJ #r Y #h #ޞw # # # #^ # #I' #9 # #x #f  #&, #ԫ; #J #N(Y #Ah #nw # #: # # # #% #b # #j$ #Y #.  #/ #V? #ӹN #+ # #| # #4B # #՜ #$ #2 #k@ #N #j #x # #a #)7 #Ŧ #G #% # # #, #$ #: #O^ #.s # #ӷ #d # #: #r # #; # # # #Q" #0 ##> #L #%Z #w #X #@ #| # #y # #   #x3 #PE # X #f #b r # #7 #k # # # # #j # # #5  #  # #& #t3 #A #] #˨k #($y # #H #ד #> #q # # #9 # #u'  # #Y+ #tH #X #S^ #d #j #q #~ # #' #l # # #{ #+ #4 #<   #5 #E #R #ty # #1 #>B #  #  #w # # # #  #һ #' #g5 #C #Q #<_ #*m #G{ #3 # # # # #H7 #'/ # #i #3 #{* #H# #1 #=? #w"M #e[ #p #ɥ} #~ #, # #t # # #D #= # #% #Z$ #˨8 #H #,N #RT #Z #Q ` #f #-l #C!r #9x #~ # #  # #] # # #8 #D # #ʚ # # #r #! #; #  #9 #B # #$# #) #D/ #65 #; #A ##G #@M #8S #Y #_ #ߴe #k #q #w #t } # #" # # # # # #B #6 #x #{  # & #d #42 #> #[ #? #m # #d #A # #v #d #|' #& # #6 # # #џ # #, #: #9Y #eh #2w #Ĩ #K #ʓ #  # #  # #5  #? #1) #7 #E #a #q # #  #.  #k #' #  # #X$ #   #2 #?% #3 #A #O ##d #q #~ #1 ## #a #5 #t # # #9 # #, #`9 #kF #S #?a #n # # #j  # #/ # #G6 #q  #o #ɸ4 #tA #N #2,[ #ѝw # # # #, #8 #, #D #״ #\ #' #) #,6 #8D #W #c #o #| #5  #? #[: #t # #4 # # #, #1E #X #h #n # t #z # #3 #Q #? # #? # # #3 # # #H #& #4 #@ #%M #>BZ #t #V #o #y0 #G # # # # #K # #  #> #& #O:4 #jA #%O #״] #j #x # # # #p #% # #9 # #U #{ #H #% #w2 #? #BL #,f #Gs #! #7 # #- #7 #״ #9 #t #%6 #= #)1 #, #? #] #i #oBv #Ö # # #9 # #6 # #ؼ #2,! #>- # 9 #7J #V #Zh #'u # #  #~ #Ͷ #F #7 # #6 # #Ͷ #F #66 #ͶC #FP #4] #Gj #$ # # # #1 # # #d # #" #M #+ ##7 #&M #U0j # # #_ #8 # #2 #5 #0 # #d  #R2 #Q1? #lL #۔Y #g #[{ # #s # #I # #  # # #J< #~ # #" #&#/ #I #W #d #,r # #& # #1 # #T # # #N7 # # # #y  #J* #7 #f6E #R #_ #=m #z # # #( # # #% #( #' # #+ #4 #t) #6 #K` #m #z{ #Ԥ #C # #c # # # # # #&  #?? #%K #Y #g #'u # # #O6 #a #& # #_ # # #9 #U # #' #% #03 #;A #O #c] #l #?z # # #  # #5 #^ #T # # #! # #j$ #3 #A # O #] #k #@y # # #a # #* #? # # #p #7 #o # ! #/ #7= #+K #W,Y #9g #u # #  # # #) #& #2 #L #T # # #  #&2. #% < #J #X #<f #0t # # # ## #, #i #6 # #? #  ## #?- #H; #I #W #e #s #%  #% # #H #` # #Ƨ # # # #, #: #H #tV #:f #v # # #  #>? # #U # #y # # #, #`W #e #Jt #E: #! #  # # #( #\B #6  #i #0 #8 #جG #.k # u #Ҷ #ĸ # #]( #9 #n+ # #; # #t #w #t #+ #+9 #!G #&U #v #ؼ #H # #˷ #Ƕ #e #` #ߧ #k #( #; #H #3o #| #%: # #55 # #X # # #c # #@ #h;  # # % #2 #c? #uL #AY #q9f # s #s #$ #3 #V #H #q9 #A  #.  #;  #wH  #U  #Ub  #t{  #  #6  #,  #  #->  #  #R  #,  #ܗ  #n  #  #T  #&  #T*  #ȴ7  #D  #PQ  #^  #2k  #1x  #t  #  #  #  #f  ##  #  #   #<  #Ȟ  #  #"(  #;6  #:D  #,`  #dn  #|  #  #'  #/  #(  #  #6  #  #   #  #6  #g  #1$  #Z 2  #@  #~N  #\  #j  #x  #G  ##  #!  #P  #A  #;  #  #q  #{%  #j  #T  #  #7.  #k8<  #J  #E^  #[k  #4x  #ؼ  #  #  #'  #4  #  #  #c  #  #  ##  #  # #Ҕ% #2 #? #1R #a #k #u # #I #UA # # #Ш # # #  #4$ #z. #^8 #ИB #O #U\ #6i #)} # #U # # #& # # #1 #t # # #K #B, #? #I #V<S #:] #ӹg #y #: #C # # #A # #ӣ #0 # #E8 #  #G #R' #4 #A #Y N #G[ #w #7 #˨ #|: #y0 # #  #5 # #4. #  #Z #F# #-60 #7= #3g # s #ت #  #L #  #6 #~ # #> #= #? #k  # # ? #f #1s # # #7 #y #, #6 #V # # #(9 #B # #- #: #G #U #a #=s # #O #  # # #k # #H # # #] #j( #ؼ5 #>BO #\ #Vj #!| #+ #[ #l # # # #9 #] #37 #|: #7  #˨. # ; #H #o #7~ #9 # # # #- #t  #  #I% #2 #8? #M #<&Z #0g #Ʋt # # # # # #  # # #: #N2) #Ʋ6 #XC #P #c #9p #" # # #|6 #% #H # #{ # # # #0 #Ʋ, #<9 #F #S #` #Vm #g'z # #[ # # # #, # # # #Z> #%AK #˜X #e #| # # # #  #: #b1 #  # #  #@# #%/ #< #c #0r # #u # # #v # #; # #f #. #9 # # #: #h7 #U #"  ##. ##A #wN #g #u # #> #h7 #˨ #9 #. #%> # #  #q% #2 #\ [ #jh #v # # # #ؼ #I # #\ #J% #? #t  # #c& #$3 #@ #M #83[ #Ke #$r #|: #1 # #[ #X # #> # #m # #2 #Y #\( #S5 ##B #O ##\ #Xt # # #  #* # #B #K   #q  #<2  #WK  #nX  #e  # 's  #h  #H.  #  #$  #  #-  #  #D  #t! #^ ! #>B-! #@b! #x! #"! #! #! #! # " #<" #+" #t?" #qM" #Ba" #o" #}" #" #&" #Q" #" #W'" #" #" ## #"&# #?# #ZM# #[# #i# #w# ## ## ## ## ## ## #$ #dB"$ #($0$ #R>$ #!L$ #Z$ #h$ #v$ #$ #^6$ #5$ #h$ #$ #$ #R$ #.$ #$ #$% #% #6% #S% #.]% #Hk% # y% #% #'% #% #q% #% #% #'% #I% #_& #'& #0& #CI& #V& #~& #m& #;& #R& #<& #& #a& #a7& #A& #K& # ' #"' #(' #X%6' #D' #!R' #`' #Yn' #|' #' #K' #2,' #' #9' #I ( #6( #6<( #J( #X( #hf( #Ȗt( #̠( #B0( #I( #( #( #m( #1( #( #n) #J) #-<) #*) # 8) #F) #=T) #"b) #).q) #r) #A) #) #ß) #S) # ) #) # ) # ) #* #a* #%* #34* #<R* #(a* #,p* #"* #* #V* #* #* #[0* #"* #t* #¯* #&+ #>B+ # $+ #a3+ #*B+ #6Q+ #0 `+ #ߤo+ #~+ #++ #j+ #+ #+ #/+ #Y+ #+ #>+ #+, #5, #D, #~N, #=g, #P~, #., #t, #, #&, # - #%- #0 - #&- #*,- #Z32- #Q8- #2>- #lD- #xJ- #Q- #r8X- ##"_- #%f- #%n- #{- #- #|- #- #- #{- #- #- #- #X- #x- #Q- # ?- #- #- #<- #. # . #. #'8. #. #K#. #). #/. # 5. #";. #+B. #R. #X. #P^. #Id. # j. #p. ##v. #|. # . #J. #. #. #t;. #m. #. #. #. #. #. #5. #. #y . #ɼ. #. #. #X. # . #. #. #/ #&/ #; / #/ #/ #/ #$/ #0*/ #0/ #d6/ #/99 #9 #9 #9 #9 #: #: #F": #0: #?: #xN: #]: #l: #v{: # : #: #5: #B: #: #: #: #: #; #; #!; #K,0; #o?; #N; #[]; #l; #{; #A; #޸; #; #; #w; #; #u; #< #< #!< # 1< #L0@< #HO< # d< #t< #z< #P= #=]= #j= #w= #= #= #= #> #!> #9;> #UH> #jU> #6c> #p> #$}> #> #4> #6> #t> #> #> #> #I> # ? #? #5%? #[? #h? #%u? #I? #? #? #? #I? #? #? #? # @ #!l@ #Ax@ #@ #n@ #6@ #@ #@ #A*@ #@ #T@ #|:@ #@ #@ #A #A #A #!%A #1A #yKA #3XA #oA #?7|A #A # A #bA #DA #A #A #B #r( B #,B #|:;B # tB # @B #B #B #B #~B #,B #"B #bC #C #DC #)C #@C # \C # jC #&C #C #&C #C # C #C #C # C #3C #P4 D #AD #ʙ$D #2D #$?D #3LD #(~D #ND #3D #D #AD #D #?D #E #E #NE #*E #;7E #HDE #=QE #^E #ݜkE #D xE #QE #E #{ E #3E #E #sE #F #(F #G4F #,F #:F #GF #״TF #bF #oF #|F #'F #F #F #ӛF #_F # F #F #F #nF #@G #9G #[CG #d]G #۟gG #jqG #l~G # G #wG #G #?G #G #DG #{G #JAG #H #H #H #jH #$vH #&H #H #!H #H #H #fH #tI #I #5I #XI #>dI #I #EI #G$I #|:I #I #ؼI #GI #I #I #y2J #>J #OJ #UJ #[J #{=aJ #gJ #mJ #1sJ #J #QJ #J #J #J #J #!J #qJ #v9J #J #'J #K #NK #( K #?K #IK #qK #6}K #i.K #"K #K #'K #(!K #K #K #K #L #L #*L #8L #V5FL #TL #bL #5?pL #<~L #L #L #5L #,L #L #L #L #U9M #3%M # M #4&M #!,M #3M #`M # mM #QM #DM #M #͗M #@M #M #AM #M #M #>M #N #!N #N #&+N #98N #EN #RN #_N #lN #)yN #N #N #$N #!N #N #N #/N #[N #LN # O #1O #0&O #4O # BO #PO #O #`O #O #1O #O #O #HP #5P ##P #"(-P #:;P #IIP #P #*P #0P #?Q #Q #Q #U*Q #8Q # FQ #2TQ #bQ #.pQ #~Q #xQ #Q #Q #Q #cQ #!Q #tQ #ؘQ #.Q # R #R #'R #CR #,QR # `R #{nR #|R #R #66R #(BR #BR #R #*R #/R #*R #  S #S #(S #;6S #DS # RS #ѳ`S # nS #,|S #S #S #S #/0S #T #*T #tT #T #T #U #)U #7U #jU #ݲxU #U #;U #U #<U #U #SU #|U #m(U #U #V #V # V #..V #FBY #IY #ؼ Z #gZ #"Z #0Z #q>Z #<LZ #ZZ #hZ #'vZ #Z #Z #=Z # Z #ϦZ #.Z #.Z #Z #0Z #[ #[ #[ #(,[ #:[ #61H[ #V[ #Pd[ #,r[ #[ #5[ #3[ #:[ #c[ #[ #[ #($[ #[ #\ #\ #.\ # <\ #6J\ #1X\ #Of\ #ft\ #Q\ #\ #B\ #\ #@\ #\ #\ # ] # ] #.] # *] #O8] #hF] # l] #Oz] #ǹ] #q] #J9] #] #] # ] #] #f5] #>1] # ^ #$^ #""^ #) 0^ #%>^ #4L^ #VZ^ #˪h^ #v^ #ѵ^ #^ #^ #^ #^ #^ #7^ #3^ # _ # #_ #2_ #<_ #UP_ #@Z_ #dd_ #9r_ #D_ #t_ #1_ #_ #_ #<_ #_ #Z_ #_ #_ #ϸ` #` #m #` #1` #B?` #5M` #a[` #'i` #&w` #` #` #"` #]` #` # ` #p` #Y` #;8` #sa #Sa #/a #-a #;a #(Ia #zWa #K ea #sa #^a #(a #9a #a #a #a #a #Ha #`a #b #7b #%b #\ 4b #Cb #4Rb #`ab #pb #~0b #>Bb #b #tb #b #b #b #c #c #+c #4Uc #c #c #c #2Nd #%d #\e #3 f #Mf #0f #i # i #Vj # #j # Kj # \j #bj #hj #5:k #k #@ k #g>l #s%Kl #Xl #7el #rl #rl #l # l #l #Al #l #l #sl #m #m #!m #0m #m #m #m #9m #m #dm # n #n #{!n #/n #Œo #<Lo #GZo #ho #vo #So #.o #wo #o #ؚo #o #o #o # o #=2p #=*p #7p #Ap #7Zp #($gp #0tp #~0p #%p #p #<p #Ip #` p #p #;p #p #r #Mr #ar #"r #k)r #K6r #DCr #Pr #]r #|jr #*:wr #&r #զr #r #r #=r #ݱr #os #ss #"s #10s #<>s #Ls #wZs #hs #vs #1s # s #t #-'t #2t #R%Cu #rPu #I]u #;ju #.wu #u #u #Gu #-'u #u #u # u #6[v #Xhv #7uv #2v #v #v #v #v #w #w #ưw #w #w #Hw #t?x #~Lx # 8Yx #CAqx #rx #8x #Cx #vx #%x #4 y #y #$y #h1y #>y #Ky #lny #{y #.y #y #5y #y #y #y #2y #R%y #!z #z #z #z #Oz #z #z #z #z #%z # { #{ #[&{ #4{ #1R{ #6`{ #4n{ #|{ #:{ #{ #{ ##{ #{ #v | #2| #V.8| #J| #^Q| #I_| #m| #Y{| #| #| #| #j| #| #;>| #C| #(} #=} #!} #/} #t=} # $K} #&Y} #} #Z} #} #(} #(} # $} #&} #~ #~ #ؼ-~ #;~ #l,j~ #x~ #V~ #~ #~ #~ #~ #V~ #~ # #E #+ #9 #JX #$e #r #1 # # #t #6 #  #U # #0 #q # #, #t9 # Q #|` #.n # #  #D #3 #΀ #H܀ #% # # #E #p% #3C #QR #{a #p # # #, #C # #4Aʁ #-ف # #i #c& #s# #2 #A #> P #__ #Gn #E} # < # #% # #ʂ #ڂ #J # #%  #-  #V- #<; #G #U #ձc #?q #r #B # # #u #Ń #Ӄ #w # # #Ѻ  #@ # B' #5 #0C #Q #._ #*;m #0{ #  # #.ӄ #yل #߄ #~ #U #֭ # ##  #ђ # # # " #^0 #> #L #mZ #@h #v #B # # #e # #ʅ #م # #` #+ #?@ #1$ #A3 #_?B #DP #^ #7l #kz # #J # #} #>Ȇ #3؆ # #i #A # #! #G/ #= #K #[ #.k #`{ #Ӱ # #; #q@ #zˇ #8ۇ # # #!  # #' #45 #<C #;Q #_ #n #} #m: #" #  #Ɉ #Dֈ # #7 #  #G ## #A0 #= #J #W #Cd #q #W*~ # #B # #ƣ #!Ή #k # #p #G- #6; #yI #AW #r3e #s #T #L #ʊ #>6׊ #S # #9 #s  # #% #&32 #w? #3L #Y #f #rs #B #  # # #fߋ #: # #>B #'  #_- #m: #-$G #6T #a #&3n #w{ #3 #r #B #_ #Ȍ #, #> 9 #F #V&S #` #!m #z #] #L# #L #~ #  #6; #D H #U #_b #o #| #G #m #; #5 #͡Î #ю #ߎ #D # #|: #C- #HG # _ #qo # #| #O #ŏ #:ԏ # #  #  # # # #o #& #! #( #6 #ޒD #qR #V` #4o #9} # #|: #" #f # # #Rǐ #O=͐ #Ӑ #ِ #< # # # # # #6" # ! #( #6 #SD #1!R #V` #} # # #< # Α #ؑ #Y # # #  #i #& #_3 #@ #M #sZ #g #|:z #y #! #ޒ #qȒ #t #E # # #B7 #G #M #)S #Z # # # #- #" #n4“ #$ϓ #0ܓ # #  # # #1 #8* #7 #D #Q #^ #P5k #Zx # # #$ #ɔ #p5֔ #i # # #Ö #Ж #ݖ # #J # # #! #6. #; #XI #zW #c*e #As # #  # # #ŗ #җ #ߗ # # #i@ # #! #. #< #I #=c #p #} # #  #} #E# #qɘ #֘ # # #ߺ  #A #N #*[ #n #M{ #( # # # # # #% #+ #18 #tF #S #` #m #" #y2 #/#8 #x> #=D # J #YQ #^ #k #Qx #> # #/ #BB #9P #^ #l #:4 #5 #ܞ #? #A  # # # , #/@  # # #0 #'" #( #. #4 #: #=@ #BF #~M #K] #`c #i #0o #u #3{ # # # # # #' #f # # # # #ß #ɟ #>ϟ #՟ #۟ # #' #A # #4 # #  #3  #> # # # # #) #g/ #~5 #m&; #-A #BG #(M #S #SY # _ #$e #dk #=q #yw #P } #% # #î # # 0 # # #2 #e # # #Š #?ˠ #SѠ #1נ #uݠ # #t #) #' # #-  # #v  #2 # # #!% #+ #1 #D7 #N= # C #Y@I #;O #U ##[ #Ya #/g #m #Ωs #y # # # # # #j #y # #H& # #, #X #4ǡ #*͡ #ӡ #١ # ߡ #ź #! #  # # #V #  #. # # # - #3 #9 #? #@F #NS #` #(m #1z #<$ #5 # #A #w3 #=Ȣ #բ # $ # #  #~( #h! #(' #0- #3 # : #fH #V #=d #r # #w3 # $ # #t # #I #+ #%9 #o#F #S #=` #wm #z #I # #= #Ф #ޤ #G # # #+ #8 #$F #1T #90t # #  #( #Υ # ݥ #= #O  #  # #( #7 #F #5U #d #<$s #= # # $ # # # ͦ #&ܦ # # #  #: #) #A9 #w3I #Y # i #z #0 #  # #?.ħ #ӧ # #ƛ # # # #- #< #e%K #P?Z #Ai #Gx # # # #n #è #Ҩ # # # # #ŵ+ #: #I #X #@g #v #޼ # #K #h  # #Щ #ߩ #$ #j #  # #P8 #9G #V #۵e # t # # #I #3 #< #Ϊ #ݪ # #j #  # #+( #~7 #F #ӥU #wd #s # A # # # #2 #˜ͫ #qܫ #E # #  ## #( #8 #V #e #6t #6 # #5 #8ɬ #=ج #4 #D  #h # #%# #2 #N;@ # N #\ #,j #x # # # # #J3 #j!̭ #ڭ #8; #( # #FR #?_ #l #2y #X #Uٮ #h #^9 #o8 #=N #!V #v #+ #) #b # # #4Ư # # #D #0 #9 #fU #v # #o7 # #ˢϰ # #4 # #@/ #&K #8g # # #7'ű # #; #( #nX #v$n #  # #uֲ # ##  # #` #N9 #AV #r #+ #I #y #Ƥ̳ #Ɣ # #) #O #mp # #7 #3Ǵ #.޴ # #ɕ #  #! #9 #Q #Bc #`u #v #  #A\ϵ #($ڵ %޵ % %ȍ % %3 %' %~ %b #* %. %3 #< &_ %c %h &q #~,] #> & #@ %7 %5Ƕ,]Ѷ &޶ %I %E %x %t &<^ <^<^+]^<IPT]i #*t %x %} #e4 % % #= % % #X %· %̷1]ַ1] %Տ %Ϗ % %  % %A]:n]Dn]a %e %kk]]]]^ɸ &Ҹ #ݸ %& %  & #3X] #>$ &- #@8 %B< %@E]O &\ %T` %Pi %m %r &{^^^:^Xǹҹ] # % % #7 ] #% %) %0]=^Z^h\^ # & #($ %ڐ %ΐɺ %Oͺ %ݺ %y %I % %I %  %z # %] %U" #- %1 %6 #? &fX &a # npwsj # & #@ %r %psj &λ %һ %ۻ %߻ % &flflfll,p9DkY #*d %Жh %Ζm #e4x %ߖ| %ݖ #= % % #X % %xjƼxj %  %  % % %+ %)j+j5 &F %BJ %:S %tW %l\ &e %i %r %v %lak & %* %$ %T %P &ƽ %qʽ %mӽ %׽ % % %FFF,FAFVFoFFFFþFվikYl*A4lJkbkk &  #( %И %̘ &5 #2ȿ8ѿ|h #b= &G #@ % %|h &G( %, %5 %'9 %#> &GG@lW@la@lual8h # %D %B #7h # %S %Qh h' %j+ %h1hHh`hz &Y # %{ %w &z #2i #V> & #@ % %i & %! %* %ҙ. %Ι3 &<lLlVlj;l{i & % % % % %# %!ii & %5 %1" %O& %K0j:jW %m[ %ke=jo & %| %z % % & % %=j & %Κ %̚ % % % %mmh-hEj\Qjt[j & %# %  & #3h #o> &! #@ % % h &!" %& %/ %ś3 %8 &!AkQk[kolh #: % % # %_ %Ghh % %  %Ҝ  %Мh, %0 %9hCh` %Kd %Im %]q %[wiii %o %k % % % %/i l &3% %) %2 %6 %; &3D %H %bQ %NU %D^ %b %{u %y % % %}*q6m &r % % &r % % %6 %06m & %\ %V  % % & %! %* %ҡ. %7 %3; %/DjYjnjjjjjjjjj,>mM{lYYYYYYYYY-YBYTjmnw & %P %Lnn & %i %g % %x % %آ & %H %< % % % %( %E, %95 %9 %B &O %ͧS %˧\nf &9w %{ %ۧ %> %4 % %x % %x %ʩ % % %.G\q""""""3"H"]"r"""4 &Z % % % % &j %  %p+ %$/ %"5pFx[@moo &z %8 %4 %P %Noo %a %] %y %w % % oo1 %5 %> %B %K %O %X %Ӭ\ %ͬa2oNo &Qo & % %Qo & % % %2 %. &p!p+p?pP]} & %[ %M % %o & % % %  % % % %- %+o & %?  %= %P %N  &) %n- %`6o@o] %a %j %Ǯn %Ůtooo %׮ %ծp & % % % %  %2 %.  & %_ %[  %$ %|-4B4W4l444444446p7Fd qn q %ԯ %үo"q *qqq4 &A %E %O &\ %` %j`qt & % %`q`q % %`q`q % % %0 %,hq~q ~q6 %G: %EC %VG %TPqhq %g %cqq % %}qq % % &   % % %ٰ %װ'r@ %D %N@rg %k %ufrfr %  % %# %! %4 %2zrrr %E %Cr8 %V< %RE %wI %oRr\ru %y % % % % % %б %αrr % % % %r % % rr0 %"4 % = %3A %1Grj st &  %C %A %R %P s &3 %a %_ %p %n % %} s &C % % % % % % &C" %Ӳ& %ϲ+sS3sj8s8s8s % %8s8s % % % %?s XsXs(ws9F0U|s_|s| %" % rss~r %3  %/:n.hnI]Ytptu`qqsssBim$ &S- #%8 %N< %JAiV #a %de %bj #7xi # %s %qi & #% % %k # % % #7k #* %. %5kS(h] &n %ȳr %Ƴx h:hQip #40 #W #` #j0x #( # $ # #: # #' #( # #+  #k #ѧ #%. #; #kJ # X #b"j #a2w #= #@ # # # # # #:  # #w2&4 #6=? #@T #g #z # # # #R #*0_A #($L %P %׳` %d %t %}x %a %  % # % % % % %< %4 # % %d # &  # # %: %4b% &$6 %q: %kC %G %P %T %Ybzwb6cQcocwc &#a- &> %B %K %¸O %X %ظ\ %ָaaaa % % % %b7bMb &R$ #V/ % 3 %8Q`M #X %2\ %.a #7oY` # %J %H &j #1` # &| #@ %a %_` &|  %s %o % %" &|+b;bEbYcjwz`z` % % %ι %̹`)c &, a6 &G %߹K %۹T %X %a %e %ja&a & #V %  %7a # %/ %- #7?a # %> %<Qa0 &9 #VD %UH %SMeab #m %dq %bv #7ma # %s %qa &,_ &? % % %  % % %_<_T&`{ &`c # c #($ %Һ %º %9 % #ؼ %ۻ % #' %ּ+ %¼; %O? %1D #\ %н` %Ľp %t %}d &4 % %} % %۾ %5 % %ۿ %ɿ &4 %7 %/ %b %\ % % % %  % % % %% %X) %<2 %6 %? %jC %XL &QYdn &c{ % %d &c % % % % &c|f|f|ffP !d+ &u< %@ %I %%M %#V %4Z %2d &q %Pu %F~ % %\eKf & % % % %Kf & % %  %(  %$ & %D %@' &4 %h8 %^A &J %(N %&Yece| %: %8 %K %I %Z %Xee(f(f -feXbfrg!gggg*c0d._dSgdrdd(fHgX #& #($ #ؼ$ #0 #T #Vx # #p  #A #` #1P #< #@ #: #( #Q2 YI #($S %pW %hg %k %p #ؼz % ~ % # % % # % % % % %F %< % %v #V % % % % %D %8 #% %) %. #p 8 %Q< %;A #AK %O %T #] &f #i1r{UY #b< & #@ % %UY & % % %0 %, &ZZZ[,9L &U #1ajY #{< & #@ %M %KY & %_ %[ % % &Y[|[|[ [(3 &< #:F %J %O #Y %] %bY}Z & %  % % % %* %(Z & %@ %< %^ %ZZ &7 %x %t$ %( %- &76 %: %C &WP %T %] &wf %Aj %?uZZ %S %Q %b %` %q %o)Z8Z\Z\Z&aZ4ZoZ[[[\ #V( #($2 %6 %; #6E %I %Y %] %b #&l %p %u # % % % % # % %  %, %&4V & %I %EoXZ %^ %cXuXX %  %XYP$2 #/Q #$p ## #V #j #D # #& # #  #" ##/ #= #]O #1\ #tj #| #1 #t #B #4 #1 # # # #t #  #ў' #\> #ϕZ #\r #I # #] # # # #C #t # # # # + #b"; ##H #1T #ؼa #* #E # #1 # #$ #Q #'- #@- #Y-  #r-4 #-D #-T #-d #-p # #. # #. #. #/ #M #4/ #M/ #f/  #/ #' #14 #A #$N #j"[ #h #˨z #5( #N) #g) #) #) #) #) #) #9 #* #(*& # +5 ##+D #<+S #U+c #s #~+ #+ # #+ # # # #* # #*# #*3 #"C #:S #Rc #jo #,} #ˢ # 8 # #g: # #( # # ( #(! #)/ #)= #6)L #[ #Yj #Ny # # # #  #6 #, #($ # #y&  #   #\,  #8  #g,E  #:5R  #^  #1k  #}  #  #;  #DB  #DB  #DB  #DB  #H  #@  #3  #^5/  #;  #`G  #T  #e  #q  #`}  #  #  #  #H  #  #I  #  #  #7  #  #7  #P(  #z,4  #A  #1K  #-d  #q  #w?  #  #c  #z,  #  #  #/  #7  #z,  #  #4  #z,@  #Y  #f  #Iw  #  #  &  %/  %%  %b  %\ ^ ^  %  % ^ _  &  %  %$ _6 @ W a t           #  #  #Q # #  # : #j$ $~/( $W/, &V8 !ɤ? #ze #q #H{ #u # # #n #FM #g # # #N #5 #P # # # #c #߃ #١ #1 # #P #J #R #Q # #H #_  # #L" #5 #< #A #jM #@Y #e #q #B} # #j~ #` #I #y #*Q # #{ #S #LI # #^ ## #e/ #; #"G #_S #Y_ #Dk #w #~_ #VK # #7 # # # #d #ey # # #Tn' #y5 #$]B #O #ʻw #J # #[W #^ # #s #c~ #s  #f #c~% #sD #(sR #G` #n #:W| #4D # #D # # #, #q # #f #| #CT #$ #2 #A #-P #`D^ #Fl #Gz # #u #ƾ #Y #n # # #_ #j # #$ #D3 # {B #7Q #Z` #o #-~ #W #M #r # # #kw # #; # #\$ #;^3 #:MB #Q #f` #So #`~ #sE #t #J #X #( # # #t # #r #a# #F2 #WA #P #_ #xn #h} # #oX #cb #o # #X #a #  # #I #U" #61 #%@ #!O #!S` #l # # #T # #r #Q #U+ #1Z # # #ڊ[ #z #=T # #h #i #o #r #hC #uR #S^ #j #݀v #_ # #h # #c #c #I #2= #J #w\ #afi #=T #]\ #Ԯ #r #t # #a #  #θ #WC #O #1 #٬N #k #@x # #H # # #r #i # # #G #.g # #" #/ #= #BL #Z #bh #v # #L #=T #Nb # #M #m` #y # # # # #, #!}: #fH # #j #H[ #Y #{ #G] # #ҫ #' #|D  #  #l(  #7  #F  #8U  #tbd  #~s  #F  #?  #ܧ  ##y  #E  #W  #zu  #u  #~Q  #I ! #I! #t'! #ם6! #&nE! #@T! #tc! #(r! #P! #sf! #Қ! #Y! # ! #0e! #i! #! #a" # " #&" #6t5" #D" #S" #^b" #q" #" #" #" #]" #d" #" #" #." ## #|# #!# #1# #YA# #{Q# #Ja# #I_q# #L# ## ## #oy# #2U# #TG# #># #j# #GU$ #$ #H&$ #5$ #ZD$ #S$ #Db$ #ɱq$ #E$ #UN$ #ˠ$ #ӓ$ #_$ #$ #}$ #^$ # F$ #T% #Zc% #B%% #4% #C% #ֵR% # Na% #q% #6% #% #a% #;% #% #=% #% # % #G% #& #G$& #/]3& #ܿB& #iQ& #i`& #o& #9~& #_& #R& #o& #r& #A`& #& #& #|v& #q' #' ##' #2' #fA' #vP' #U_' #]n' #n[}' #~' #ȳ' #' #]' #%w' #[' #z' #,C' #V( #g( #w"( #ݭ1( #@( #O( #s^( # m( # |( #( #( #vp( #( #Ah( #( #( #( #&) #) #F!) #0) #o?) #_N) #]) #݆l) #{) #) #מ) #S) #˧) #X) #) #G) #) #^* #* #, # FM, #z\, #k, #Wz, #٘, #Е, #, #T, #}Z, #, #, #Z- #- #- #M- #bw\- #l- #mD|- #- #s- #d- #w- #[- #}- #g- #c). #C. #ǛP. #-_. #. #. #mL. #. #:. #. #KX. #Rv/ #%/ #  / #./ # #> #i!> #1> #sGA> #ŒO> #]> #k> #a> #W> #=> #T> #oa> #߂> #Ƀ> #> #? #f? #Q? #JV? #`? #+m? #=Tz? #3? # ? #? #e? #? #H? # V? #Ѕ? #y? #1x? #@ #L&@ #ո3@ #`e@@ #nq~@ #:@ #@ #pI@ #@ #f@ #=T@ #K@ #t@ #LA #tA #%A #L2A #c~?A #s[A #hA #r{A #>cA #iA #A #޾A #c~A #sA #wA #jA #A #O B #B #JRB #_B #=TlB #bJyB #B #B #ۅB #лB #OB #lB #MB #ӇB #kdC #* C #&fC #C #qC #)C #q7C #AC #NC #g\C #viC #C # C #hC #daC #C #cC #,C #C #gD #6D #D #,D #9D #^GD #iTD #HaD #%nD #D #ּD #iD #1D #ּD #D #ؔD #\|D #>cD #D #ּE #{E #E #U%E #P2E #\|@E #wVME #ZE #fgE #`DtE #ڠE #[E #E #E #AVE #-SE #E #F #*F #F #0F #D=F #*JF #>cWF #dF #=TF #F #F #F #F #_F #pF #F #G #FG #w G #z-G #|:G #HG #GUG #ObG #joG #tG #G #jG #G #SG #9G #H #H #zH #q2H #6e?H #pVH #ycH #EpH #0}H #-WH #6eH #pH #0H #6eH #pH #KH #YH #I #rI #*I #ϤAI #dNI #eeI #*erI #ѝI #.I #sI #DRI #?~I #wI #I #I #J #qv*J #7J #EJ #WRJ #Y^J #PvJ #J #bJ #[RJ #bJ #J #.FJ #DJ #%qJ #Yi K #iK #K #,K #F9K #iGK #TK #?uaK #/nK #{K #K #K #*K #PK #K #K #EK #L #x L #afL #'L #5L #~WBL #OL #:Q\L # jL #wL #/L #9~L #6L #L #WL #L #L #L #|L #+L # NM #M #"M #{@M #MM #[M #,hM #vM #M #RM #|M #xM #=TM #HM #wM #%IM #d N #SN #."N #%I0N #`rS #iS #S #pnS #iS #S #-HS #ԄS #iS #:|T #T #T #\1T #WT #eT #itT #dVT #T # T #iT #jT #T #T #=TT #VT #R}U #=zU #u$U #j4U #DU #TU #vdU #TsU #eU #NsU #IU #JU #{U #CU #!V #V #*V #9V #GV #DUV #[cV #sV #INV #.XV #V #٘V #H[V #V #V #;e W #fW #3)W #7W #EW #SW # aW #_oW #U\}W #ӢW #œW #=TW #MW #W #hW #{W #W #j X #mX #&X #f@X #0eMX #ZX #tX #oVX #%YX #eX #6X #aX #LX #nY #Y #1Y #,Y #9Y #uFY #UoSY #`Y #bImY #zY #Y #2Y #!NY #Y #Y #Y #:XY #ZY #2Y #ZY # Z #4Z #LAZ #aUZ # YoZ #2|Z #ZZ #Z #߂Z #}Z #Z #`DZ #=T[ #[ #=![ #+[ #r5[ #?[ #ܿI[ #_W[ #d[ #Hq[ #™~[ #,|[ #?S[ #[ #[ #/c[ #T[[ #'[ #[ #RM[ #>\ #=T \ #\ #g)\ #,8\ #šE\ #0R\ #qj_\ #@m\ #\ #M\ # N\ #V\ # F\ #I\ #[\ #\ #] #ӓ] #_ ] #~.] #b<] #J] #X] #}f] #Tt] #Zc] #p] #Z] #] #ֵ] #T] #U] #9h] # _] #D^ #n^ #^ #*^ #w8^ #JF^ #T^ #}bb^ #|Dp^ #t~^ #A^ #^ #.I^ #hs^ #^ #^ #|}^ #$T^ #_ #j _ #_ #Y-_ #7_ #zA_ #]K_ #FU_ #[__ #zl_ #y_ #_ #u_ #_ #D_ #Iq_ #H_ #_ #,C_ #N_ #Sj_ #y ` #F` #'` #;` #5U` #`W_` #݆i` #R` #,o` #` #7j` #V` #H` #` #`D` #j` #n{a #fYa #)Ua #,a #.v?a #zLa #Ya #fa #sa #=Ta #Axa #֩a #ia #_a #&a #Ga # a #a #ga #Jb #{b #b #S(b #a5b #Bb #Ob #Rab #nb #Gx{b #b #uxb #b #tb #]b #Qb #ٶb #b #b # c #[Wc #=&c #4c #߮Ac #9Nc #[c #Vjc #{wc #Gc #c #Oc #c #c #Nc #nzc #Yd #!d # U.d #sAd #\Md #Rd #D_d #ld #yd #d #?Ud #Ed #Zd #d #d #Ee #Hse #`"e #/e #f #Sf #_f #Plf #=f #=f #~f #pf #jf #f #gf #6f #*f #ag #g #g #z*g #2{7g #Dg #p~Rg #asg #g #=g #*g #[Wg #Vg #g ##g #Dg #h #ىh #-h #C9h #xFh #=Th #4h #h #-Nh #Wh #h #>h #h # ah #h #^i #i #s&i #q4i #oi #M|i #i #i #i # ai #\i #՟i #i #pi #Mj #jj #$j #1j #\|>j #mKj #zFXj #bej #rj #j #nj #j # aj #|j #j #.[j #%uj #\j #7j #Lk #yk #~pk #sU)k #h7k #7EEk #Sk #ͩ|k # Mk #1k #k #Hk #k #]vk # ek #bl #ىl #z*l #6H@l #gMl #wZl #ql #~l #wl #l #wl #l #l #l #mm #Dm #u!m #N.m #t;m #7Im #Ym #{_m #CGem #VYkm #`Orm #6Gm #m #m #lm #m #m #`Dm #Mm #Sm #Sm #m # n #\^n #C:n #dHGn #Tn #[Wan #nn #{n #n #ϗn #n #tn #Ln #Ǹn #hi o #o #"o #K/o #z #z #z #kz #p { #^{ #+{ #:{ #NI{ #}gX{ #ng{ #Jv{ #ty{ #F{ #{ #y{ #N{ #T{ #MC{ #X{ # | #| #F*| #V9| #6wH| #W| #f| #(u| #=T| #^| #| #| #Z| #n| #Z| #w| #| #S } #} #)} #hi8} #NG} #V} #ue} #t} # } #} #z} #E} #} #g} #d~ #JO~ #_s.~ #=T^~ #C{l~ #af~ #~ # ~ #*O~ #jZ~ #5~ #~ #~ #~ #~ #vi~ #?~ #"~ #b~ # #  #Bp #" #޳. #: #SJ #cP #]V #-\ #Db #h #Wn #qu #h #p # #o #tT #c #R # # #} #l #0 #` #  # # #$ #3 # #( #r #z # # #Hi  #& #4, #>2 #Z8 #%> #D #]J #`P #V #\ # }b #h #jn #/t #z # #( #* # #Ҩ # #T #g # # z #A #i€ #!Ȁ #k΀ #Ԁ #ڀ # #H #_ #?D # #~ # #  #7 #ܹ #z #" #[) #6 #MC #P #I] # #* #w #U` #ƃ #ԃ #P #; #y #e #( #ʻI #V #jl #w~ # #Eń #U҄ #  #G #_  #ئ' #3 #? #?L #TY # Gf #c #n #[ #ӓ  #_ # $ #X1 #kK? #UL # Y #l #y #™ #Í #seƘ #UOИ # #N #A #]  #  #u& #B3 #@ #M #\ #`v # #h] #q #L{ #K # # # $ #9 #E #R #.P #=T # #&š # #e #T  # #P' #=5 #NPB #jO #p\ #Si #Ow # #u˛ #ܛ #Z #q # # h #H #) #*^ #Y* #̄: #;@ #+F #L #;R #CX #7h #6v #fr #9g #Y # #Jy̜ #֜ # #]  #  #, #BI9 #|F #wS #kl #}y # # #, # #^Vŝ #ӝ # #u # #V  # #' #S5 #LMC #Q #_ #0n #) #, #" #X #Y # #G # #9  #r #( #G5 #CB #5O #L\ #i #v #b # #1 #ԃ #]} #]ş #ҟ #ߟ #P #o #a #h #! #*/ #\= #wK #Y #fm #{ # # # #P # #LϠ #Lݠ #c< #J #]X #jf #Zt # D #N #M # # #yȡ #f֡ #cc #q #- #z #9_ #Z #fC #Ţ #KӢ #1 #h #d #)  #oR #I' #<5 #9C #R #` #=Tn #H| # # # #I #dУ #ޣ #0 # #  #U( #6 #D #@iR #^{` #n #0| # #c #e # #Zä #Ѥ #ߤ #Ub #j #  #. #R% #3 #A #7 #Q& #=T4 #TB #GP #p #E #æ #o] #Ka #݁ #  #. #[< #J #X #Mf #$t # #f # #< # #ȧ #֧ #a #\ #g #D #u; # #@3 #dz # #͙ #b #Ū #9uҪ # #f  #V # & #/4 #A #,iN #h #F #j #J #S # #9Kʫ #Yث #[ #y #u #B #Ru #, #*: #UH #"V #d # `r # # #q #Fv # #EƬ #Ԭ #y` #] # #J #i! #:+ #b5 #g? #ZI #W #1e # #M #1 # #ȭ #GC֭ # # #؎ # #' #~4 #L #ZZ #yg #bUt # # #  # #aĮ #8JҮ #T #. #g #f" #0 #s> #1\L #Z #Hh #v # #5 # # # #ʯ #د #n #tY #  #0d #_ #(r, #gU: #.ZH # V #0d #V # #G # #Ȱ #Xܰ # #wN #7i #r  #=T #% #2 #f? #M #G[ #bi #w #M #f #x #ط #G #-S˱ #ٱ # # # #R # #[- #; #sI #+tW #e #Ps # # #q #R #z #xDz #=ղ #BK # #f #d  #Y #h* #*9 #ֻH #W #9sf #u #? #f #q # # #$ϳ #e޳ #7 #Ϫ #  #* #6H #dW #8]f #lu #> #2 #Ar #U| #( #"z  #Oz. #MK #ڵ #V #* #~ #Mٷ #SV #z #Rqq # # #@׻ #\ #Y #B # #*b~ # #ʽ #l׽ #G #* #> #  #$ #N1 #`o@ #;OO #\^ #}m # #O #o # # #Ⱦ #Ծ #C #@ #4P #g # #  #3r- #: #sH #T #a #n #j{ #? #R #t #p #Bȿ #jտ #* #> #G #E! #=T. #M #Z #|z # # # #> #s # #p #{ #  # #5 #D, #: #JH #QV #Od #r # # # #O #Ě #n #1 #S # #, #* #w8 #FF #˷T #b #&r #j #u #$ #I # # #` #r #U #b #D # #4 #UH #U #Gb #y #7` #[ #K #O # # #` #D #܈ #Q #i # #^ #l #nz #K # #F #s #,i #o #)# #p0 #= #OJ #NW #Yd #C #zs #% #P #\* #mj #Cw # #G #w #_$ #GK #߂X #me #=T #Ͻ # # #Ɠ #= #qZ #>Pg #\| # # # # #9Z # # #. #,i  #_T9 #wG #֤Q #w^ #Ok #nx #K # #8 # # #r  #` #i( #3S6 #,D #R #ݽa #}p # # #K # #D #Y #p # #R #} #$ #T3 #FB #aQ #e` #jR} #Z ##h # # #p # # #p # # #߇$ # 4 #D #T #d #z #"j #w # #| #/` # #r #] #ќ #= #L #zK #bp- #p; #"GI #W #he #s # #Tf #\ # # # # #M^ #[ #- #ɟ3 #9 #? #[E #F\L #۪] #c #Bi #o #ڕu #%| #Z # # #\ #  #B #= # # #А # #$ #3 #HB #ďQ #7` #o #8~ #F # #p # #* #%Y #op #Q #P # #g" #2 #-}B #oQ #_ #m #{ #ʍ #n #*w # # #@ #)_ # #x # #% #j5 #E #ʀU #Ke #Ls #Ą # #y #V #H #f # #. #  #W~ ## #0 #GI #*V #c #ʍp ##} # # # #ɇ # #s # #] #I #԰ #R #*( #= #a #KSk #qh #GC #X #u # # #  # #G$ #1 #> #LK #X #ļe #wr # #l #Z #V #F^ #߇ #r #] #  #܄ #1  #u9 #{F #G` #m #wz # #ŕ #6 # # #l #Z #V #r #] #  #L" #!e # #G #X #L # #9V #h #v #x # #Y #C # #G # #w #9V #p #ŕ  # #3 #P #x+ #G9 #rG # U #=n #SI #3S #) # # #_ #x #K #. #VL? #}E #1K #WdQ #cX #EYi #}o #u #[{ # #D #B #t #> # # # #= # # Q # #Qy #! #' #- #~3 #: #oJK #8bQ ##MW #^ #o #uu #{ #kP # #e # #Þ #? # #T #P  #k' #1 #f> #GK #X #K|e #ar # # #> #| #GU #. #= # # #B #t! #=T9 #C # R #_ #K #  #y #y # # #JV # #O # #+ #8 #wE #ƣR # _ #Rl #Oy # #D #O #Eg # #n # #= # #ϣ #S #ߦ2 #? #aL #EY #  #, #0~9 #GF #fS #!` #x #=y} # #GC #f #`G #tO # #$ #X #5 #Dz #  #t\. #; #H #U #pb #p #Fh} #T # #h #0 # #F # #0Q #O #[  #o #|D2 #}? #L #fZ #ht # #pQV #~p #&y #m #= #y #m #I #& #aZ- #ff? #<[ #m # #F #: #  #͈ #uЀ  %  %#?6 #T #Jn #ty~ # % % # % % #/ %@ %8 %g %a % % 1&G #0YSuj #u %y % % %uu % % % %uu % %uHu2 #=@T # I_ %;c %3h #/s %gw %_ % % #. & #B P # & # % %P &  % % % %! &*:CVg tpR & % % % % v #DP  # I %* %  #/+ %r/ %d? %C %S %W %\ #.e &n #,z o # & # % %o & %  % %; %7 &"3 @HU^{ %Z %V %r %n #SP}  # I  %  %  #/+  %/  %?  %C  % S  %;W  %3\  #.e  &dn  #z  o}  #  &t  #  %\  %Z o}  &t  %n  %j  %  %  &t } } }" }3  @ U }^ }{  %  %  %  % }  # ~  # I  %  %  #/  %>  %0  %|  %v  %  %%  %)  %.  #.7  &@  #L H U /~j  #t  &}  #  %  % /~  &  %  %  %  %  & ~ ~ ~ ~ H   ' J~0 J~M  %.Q  %*Z  %F^  %Bd p~ ~  #.  |  # I  %h  %Z  #/  %  %  %  %  %O  %?  %  %/  %3  %8  #C  %G  %L  #.U  &@^  #j  s S|  #  &R  #  %  % S|  &R  %%  %!  %Q  %M  &R | | |}# 0K|T|q %ku %i~ %z %x| #7Fz # I % % #/ % % %4 %( ## %|' %l7 %; %K %O %_ %Ic %Ch #s %nw %h| #. & # { # &. # % %{ &. % % % %  &.{&{/{B{S `:{:{ % % % %{ # # I %  % #/# %E' %;7 %v; %n@ #K %O %_ %c %h #vs %w % %" % %? %7 %l %b # % % #. & #ٓ < # & #& %* %3<< &G %K %T %X %] &fnv Mɂ5N_ #j0 # I %  % #/ %C %9 %t %l # % % % % #v % % %  % %= %5, %j0 %`5 #@ %D %I #.R &[ #gg( pl # %: %[ %U #. &J #` u # &Z # %~ %| u) &Z4 %8 %A %E %J &ZSuculuu` huu % %uvv % %#v8vP'vh/vAv #T #kT % % # %V %F # % % # #  #.) &62 #> G\ #Mf &Fo #z %~ % &F % % % % &F???f |(|E %I %Oxt #d #kT % % # %D %< # %r  %j # % %" #s2 #VB%gjtφ #r & # % % #G %5 %% #  % %y %  %% #/ %3 %B %6F %.U %_Y %Wh %l %q #.z & # yy #E & # % %yy & % % % % & yy#y5zF S@sIz % %nzy & %( %" %P %J & %~ %x % % {"{7{L{a{w{{{{{{y8zAz^ %b %g-zrz &  % %|zz zz z=  # RG pv^  #h  %l  %q  #{  %m  %c  #  %  %  %  %  # I  %  %  %  %  %  %  #.  #4 [w  #d Kw! #U !mx! &j ! #+! 4!yvI! #,R! &}[! #e! %Ri! %Ps!yv|! &}! %d! %`! %! %! &}!v!v!v!v! ! " w!" #t+" %/" %4" #$>" %B" %L" wU" wl" %p" %y" %}" %" w" %" %" w" w" %1" %/" %A" %?""w#w#w+# %U/# %O4#wO#xX#xs# %uw# %s|#x#vx# &# %# %#{x#Gy#Gy# %# %$v$:w'$Ww?$nwZ$p$vw$x$ x$4x$[x$x$'y%&%?y>%GyY% #`%`x% # I% %% %%v%v% %% %% %% %% %% %% #%& #^"&pt9& #C& %G& %V& %/Z& %#i& %em& %]v&t&t& %& %& %& %&t&t& #' #' #/-' #M' #;g' #U|u' #}' #' #' #=T' #-S' #' #' #Y' #& ( #( #=T(( #&6( #vC( #Q( #^( #l( #)~( #؜( #pQ( #( #ͮ( #(( #6v( #) #) #') #5) #C) #Q) #`) #o) #~) #) #1) #I) #)) #) #) #) #) #* #* #'* #6* #TR* #_* #v*t** %* %* %* %* % * %*2*2+ %' + %%+ %7+ %5$+>1+FI+RW+!h+?}+p+ %H+ %D+ %g+ %_+ %+ %+ %+ %+ %+ %+, %, %, # , #-, MF3, #(8, $8<, $8@, &'L, !S, # t, #0, #, #5G, #4x, #H, #O, #t, #h, #I, #F, #, #;K- #- #- #cM!- ##d- #f - #'- #C- #,{- #G- #- #E- #\,- #4\- #u. #M- . #$. #ng%. #1. #3}D. #EAK. #P. #}\. #gh. #؆t. #P6. #ia. #. #U. ##. #g. #. #d. #. #. #^\. #<[/ #/ #_~!/ #U02/ #V>/ #. J/ #tV/ #:b/ #yn/ #z/ #/ #T~/ #/ #/ #:/ #f/ #Ub/ #h/ #Ub/ #W 0 #0 #S'0 #it:0 #G0 #a^U0 #b0 #So0 #[0 #<0 #S0 #0 #S.0 #$0 #K1 #Yl1 #K 1 #1 #1 #1 #R9%1 #n+1 #f11 #>71 #t==1 #C1 #w?I1 #JnO1 ##U1 #!5[1 #?a1 #RPg1 # m1 #fs1 #"Ry1 #2C1 #,k1 #1 #1 #{1 #s1 #\1 # 1 #H1 #^1 #81 #SO 2 #R2 #H*2 #@^82 #`4F2 #̀T2 #S{b2 #cp2 #~2 #p2 #f2 #2 #0t2 #S2 #fh2 #2 #W2 #@x2 #! 3 #4 3 #Q3 #T`3 # o3 #3 #5 #n5 #66 #6 ##6 #k26 #wA6 #Q6 #Ma6 #Bkq6 #N6 #P&6 #oP6 #M|6 #Wp6 #dk6 #!6 #Qk6 #`7 #7 # !!7 #517 #A7 #Q7 #`7 #T~7 #7 #&7 #7 #27 #Q7 #;7 #9V7 #AK7 #Yh8 #C[8 #m(#8 #28 #RA8 #fP8 #_8 #Bn8 #7}8 #8 #&8 #"8 #=M8 #8 #=8 # 8 #8 #N9 #d9 #U"9 #:19 #nFA9 #oP9 #E_9 #on9 #a}9 #+9 #}9 #9 #9 #9 #(9 #9 #: #_: #Q!: #/0: #.?: #eVN: #-]]: #l: #!{: #: #: #>: #q: #: #S: #F}: #m: #h; #>; #Q ; #~/; #i>; #$M; ##\; #Tk; #iMz; #; #; #; #/ ; #; #(; #R; #t;; #N< #~< #y\< #TC.< #s=< #`AL< #O@[< #8j< #y< #1< #< #Z< #&< #"< #Z< #U=< #p< #zL= #P= #U= #r-= #*<= # #4> #e> #9-> #l<> #WrK> #WZ> #i> #O2x> #,> #X> #'_> #$> #> #R> #q> #C> #J? #+? #c8? #;-? #8 B #f -B #KQB #}]B #qiB #vB #*B #9B #B #:B #B #B #)B #=B #{J C #^C #)'C #c5C #D)CC #nQC #S_C #ΆmC #{C #^C #c:C #!C #iC ##C #DGC #FC #$C #PC # D #=D #Q%D #6L3D #^AD #POD #]D #0kD #yyD #fD #@D #xD #hPD #8ZD #Y D #FD #NZD #J E #IeE #V*E #)D9E #XE #&4gE #1vE #E #…E #`E #`tE #QE #E #hE #K6E #!<E #% F #F #C*F #9F #tHF #|WF #&fF #KuF #F #?F #vhF #T`F #fF #<F #7F #ևF #XF # G #vG #O)G #M8G #GG #6VG #a'eG #_tG #{G #\G #mG #)G #1DG #qAG #3G #JpG #;H #}H #B]H #S*H #t7H #%DH #XdH #nH #N+{H #xH #MH #DH #GH #'H #aH #CrI #iI #}$I #Q3I #;@I #MI #3ZI #3hI #}I # I #3I #,I #AnJ #$%J #kJ #J>J #REaJ #fmJ #_ {J #_ J #J #NJJ #5RJ #bJ # K #cK #)K #wOU #DU #o2TU # nU #c{U #EU #+tU #U #U #;U #}U ##U #U #@V ##V #-V #t:V #}MV # dV #:(qV #jr~V #^V ##V #V #qV #AV #pGV #*V #TV #%W #P0W #:W #?=GW #bW #_oW #{W #UW #tW #}W #;rX #!X #\PX #_o}X #{X #.QY #7pY #cY #CMY #Y #Y #6p%Z #BF2Z #l{Z #Z #Z #@[ #M[ #L8Z[ #BFg[ #&t[ #][ #7\ #BF \ #6r-\ #p:\ #v5G\ #4`\ #m\ # z\ #\ #U!\ #L\ #!\ #8\ #2] #6z] #x#] #C] #S] #NW`] #)n] #{] #/] #pD] #] #C] #|B] #L] #] #^ #gj^ #.^ #T>^ #N^ #0\^ #-j^ #`x^ #n^ #^Y^ #sz^ #^ #^ #&^ #'^ #n_ #+1_ #u _ #C^_ #Pc_ #/m_ #Hz_ #c_ #_ #l{_ #)_ #a^_ #_ #S_ #=_ #X ` # ` #`` #_m` #/'` #` #5` #V ` #Y` # ` #B` #` #1` #i a #)a #*a #?<8a #Fa #lTa #ba #dpa #b~a #a #a #Va #y[a #Ba #a #!Ha #-a #3a #b #uRb #HJ b #n-b #CGb #OUb #gb #btb #]1b #Zb #h b #b #)b #Zb #Cb #2Qb #Zb # b #Z c #!Hc #j/c #V/Mc #^Yc #fc #F1tc #o0c # c #8c #Cc #c #&4c #c #yic #c #&c #d #Jd #( d #-d #./:d #QBGd # g_d #\ld #d #Xd #\d #<d #gd #>id #]d #Md #;d #=e #9#e #(e #5e #nOe #C\e #Oje #&|e #e #He # 6e #z*e # e #!He ##e #e #be #`f # 9 f # f ##&f #4f #|Af #cNf #6[f #-hf #Ӏuf #q f #hf #)f #[f #yf #4f #f #+f # f #ycf # f #@g #8' g #cg #&g #zD0g #)f=g # Kg #}1Xg #@xeg #'jrg #}g #7g #!g # g #Dg #\g #&!g #'g #g #Og #!g # h #Ӏh #u #h #P0h #B=h #uJh #-7qh #$~h #Rh #Gh #th #G2h #llh #h #8h # uh #~i # i #Ӏ i #cCi #F}Pi #]i #xji #[xi # i #b.i #i #&Hi #}i #i #i #+tj #>2j #U+j #%K-Zj #orgj #Ldsj #nZj #j # j #$Fj #j #tj #}j #Qj # k #$Fk #}(k # 5k #$FBk #Ok #\k #5osk #k #:ek #Fk #- k #k k # k #@k #hk #V\l #Ll #"l #6)l #K?l #x\l #5l #l #F'l #c[l #l #yl #:l #8l #4l #{l #/ $m #x1m #>m #Km #iYm #mm #ym #9m #Jm #m #Qm # &m #m #im #m #%m #;n #oQn #m!n #8;n #XTIn #~Vn #Dcn #"pn #T}n #6Un #n #y0n #}n #>Pn #!n #vn #:n #}4n #Io #-so #nF,o #J:o #HJGo #BUo #Wrbo #oo #J]|o #o #co #o #,o # p #pp #"!p #7/p #=p #!HLp #]p #p}cp #C+ip #pop #iup #|p #=Mp #Zp #5p #Pp #7p #p #&p #Rxp # q #6q #Cj%q #^4q #Bq #MPq #_q #Umq #{q #Y;q #|Eq ##q #q #Fq #Oq #J.q #9q #-q #) r #Ar #I%r #3r #6Ar #QMOr #d]r # kr #PNyr # br #$r #r #;r #r #A~r #K#r #Vr #<r #s #s #Pt!s #v/s #\=s #Ks #Ys #Cgs #us #Gs #zs #s #0Gs #0#s #bNs #>s #A6s #ys #Wt #]t #(< t #6.t #@v #Nv #+^v #Tnv #~v #Lv #@v #cv #\ v #Ov #v #Ev # w #g-w #M&] #k #y #l #o #N #4b #c #i # #vY #8" #J  #d{ #$ #,1 #gD #qN #|X #b #l #v #/  #( #(n #[/ #!H #Ā #р #+\ހ #b # #v  # #" #0 #> #)R #El #v #* # # # >Á #́ #ׁ #+ #- #P #~ #  #2) #6 #=C #V #5<c #Sp #K} #C #c # #J #K` #7˂ #`ނ #g # #ف # #~" #/ #c< #@xJ #OW #kd #W|q # #Wu #= #9 #o% #N}΃ #ۃ #z # #M* #W7 #D #}XW #Dc #@ #q~ #c #~ # # =Ƅ #Jӄ #0 #~  #0 #-# #60 #J #>W #c #:W #%h #[ #ʅ #!H؅ #gp #G # #'  # #J( #7 #hE #qk # #!H # #y # #oΆ #Bۆ #q? # #l #a" #HL5 #}B #!O #r\ #i #X v #!H #C #W[ #G # #ć #*ч #އ # #R #q # #J_ #, #s: #=NH #V #Jd #J #+ #Mʈ #h׈ # #S # #v #\* #M7 #gYD #[ #xh #gY #S #gY #S #Vo #<ȉ #d #tx #  # #2% #@3 #0C #6!I #O #"U #\ #l #dr #\x #\K~ #Ɂ #~ #P #l ## ##͊ #$ڊ #( #* #$ #1 #~> #K #̀X #ue #r #: #S # # #X # #_ #_  #R #!H& #3 #@ #4W #.d #oq # #c #!H #j #pn #t`̌ #Tٌ #z #  #pn #c  #C% #D2 #6? #L #)DY #؄f #as #Z #D! #  #I #g #Z #G΍ #LRۍ # # #  #$]" #XkJ #sV #d(l #Gx #U #A #͂ #A׎ #% #S #q # #ku) #6 # #n #e #< #3 #(:6 #:M #$][ #Xk #͂ # #cː #Aِ #G #(: #  #wO' # @ #1jN #\ #bqj #x #a # #: #Jˑ #:jّ # #s #pd # #]$* #;8 #NF #JHi #Kx #f # #n #ʒ #Rlؒ # # # #` #} #|, #M: #,H #\M\ #Cj #[x #i #Mo #% # #7ړ #.2 #d #J #= #vr #!H, #: #LH #V #d #Nr #8 #N #^ #|Д #^ݔ # #Q #b# #1 #? #^?M #[ #~i #w #N # # # #o #0˕ #Fٕ #= # @ # #& #,4 #+tP #k # # #} #}Ö #і #% ߖ #o #+ #  # x% #3 #aA #$O #KF] #TJk #y #8  # # #4 #DW #SS͗ #ۗ #= #Lu #b #g #xN% #4 # C #%R #3a #p #rV #"7 #, #/ #z # ٘ # #t # m #I #$ #3 #WAB #"xQ #m` #co #~ #p #n #8^ #P( ##ə #~ؙ #k # #P #s ## #2 #-A #wP #5h_ #t$n #c} #n #4 #DBƚ #$К #(ښ #9  #  #` #cN # \ #  #E #go #g # #P #z #]]ě #Bʛ #E>Л #֛ #_ݛ # #l #c #"p # #dT #0T! #;. #m; #6H #w'U #F;b #Vo #?| #+ #c! #)x #1ǜ #AԜ #n #c # #  #9a ## #1 #Liy #O #5J #= #& #^ # #< #dy #Ɲ #t # #20 #a^  #V #S$ #[E #!HR #h #z #& #E* #Ξ #-C #= #A  #YH$ #810 #< #bI #<V #gc #qp #} #+ #%( # # #L) #+˟ #;]؟ # #K # #^+ #: #^H #xZV #'d #r>r # #E9 #[ # #+ #Ơ #.Ԡ #5 #> #J$ #l #\  #y. #< #:SJ #X #nf #(t # #M #u) #9 # #ȡ #cD֡ #'` # # #  #j #`* #R8 #G #fV #ln #f"} #tK #' #,P # j #fТ # ߢ #c #Z #0 #G$ #3 # /B #Mg #dt #e #u  # #% #QL #£ #Fϣ # ܣ #Z #5 #2 # # s( #?7 #PE #2 S #Ha #o #Ϊ #۪ #- # , #=8 # #y;* #Y(7 #}E #"R #o_ #l #h\y #R #c #( #b #`ǫ # #' #= # #n&= #1K #Y #$?g #f{ #EZ #! # #oI #ɬ #mH֬ # # #!H # #+ #1 #O #< #Q) #.~ #Zc #Msȭ #vխ #7* #c # #g@ #{I+ #e9 #BC #4lO #Z[ #sJu #S{ #  #}~ #Uͮ #TWڮ #E* #} #2: # #2* #r7 #3C #ce ##Y #U #ů #Jۯ #= #Z #  #0m #E*, #Z9 #}F #2:S #j #k #5 # G #+ #pʰ #ٰ #W #! #E #0  #. #{4 #gA #N #Ec\ #eni #S{v #$ #O̱ #Yڱ #!H # # # #"* #=:8 #F #T #a #n #τ{ #5 # #V #4 #9 #V #z #  #L" #/ #$ < #{I #+V #dFd #<q # ~ # #2 #7 # #1 #}γ #ܳ # #Y #S  #D #}<# #N10 # c #m #s< # #N # #Y #ô #Eд #?ݴ #x/ #Y #[ #  #7- #K: # H # #n #p #F #aCֵ #[ #-% #k! #c/ #%> #s@_ #$ #b; #( # ] #\ #wb #}l #M #c̶ #qAڶ #r #  #P #U  #0 #a: #kf^ #Hl #'z #z # #͂ #܀ #Tз #Qܷ #u #im #w  #Qr #k% #N\> #"K #zRY #%8g #^u #Dd # #l| #L% #g #ϸ #ݸ #G #Yf #1 #z #;# #-O1 #}@@ #Uc #oo #> #{ #k #ZL # #W̹ #K߹ #} #7 # # #E! #P. #K; #7H #"GU #ab #slp #'} #-" # #% #U% # #o*˺ #;sغ #* #NA #R #Y: # #"J+ #v? #6M #Y[ # ;i #xw #$ #"O #VX # #J  #A #* #8 #9F #T #Rb #|p #L~ #r # #  #J 5 #(C #]xQ #_ #m #G{ #" #= #RY #Qz #? #@uϽ #<ݽ # # #= #1 #.$ #&l2 #c@ #3N #!v\ #;Rj #Fx #@0 #q  #t #LV #9; #Z۾ #tB #W} #X #$ # 2 #s@ #vN #s\ #mXj #\0y #Bg # #B% #U # #gͿ #tۿ #5 #A # C #w #c #N; #c # ## # { #b #< #> # #% # #- #i #+J #T+ #9 #rG #^U #N c #Ocq #j #6 #3 #D #S #1 #(L # #r #-x #J,[ #`mh #+Iu # #+4 #Y #Q  #S #< # #k # #J% #f 2 #? #)eL #KZ #/Vg #t #n # # #J* # #/ # # #6  #~ #Jr( #6 #D #bR #FV` #n #'-| #u #~ #Jx #0e #D # #&, # #x # #p #t$ #k= #|G #A{Q # [ # e #Wo #z&} #n #!H # #` #` #wW # #C  #n\ #f2& #64 #)QM #AZ #Rr #  #S #b #) #_ #u #Qk #2 # # #%., #u: #@ H #JV #d #r #W #1 #t| #x #\U #$2 #%m #X #o #%| #]  #@ #k6( # 6 #OD #BR #g` #n #8| #~ # #gc #o #b #` # #L  # #$ #}1 #c> #CK #-X #L/e #Ղs #  #7  #: # #  #Y #W #= #G #)} #?  #\r #.) #7 #=E #lS #;Fa #o #+} #ba #^ #b #nS # #v #:  #x # s #  #W #m % #Q3 #'sA #P #E_ #[n # } #: #E= #6. #z  #Y^ #pj #k # ( #  # N #K" #Ex1 #nP #qAn #b } # #i #2 #0 #[ #! #-- #{F #T ##q #Q] #< #j #> # #x| #VD # #d #V #JX #U #p # #" # #W #; #o #=  #~ #2$ #$1 #&J #JW #f #xu # #" #2g #h #5 #Q #{I #W8 # #dZ #! #. #ll; #2H #=m #E*z #c # #Ex #Qr #l4 # #C #h #># #1 #9a? #h M #5[ #gi #Hw #r #xa # # #* # - #X #y #b #N #f=& #v,? #nL #xY #Exg #HJu #aG #t: # #W #xa #) #X # #L # L #. #[ #+ #}( #j5 #B #wO #\ #Bp # #Y #= # # # #5 #N #C #͂# #1 #r? #,M #[ #u9i #Xw # - #*q #J #o( #$5 #B #9O #\ #o # 0| #9a #*q # #K: #cX #,(@ #{M #~Z #ag # # 2 # #[ #= #X #e #GSr #w #] #/ #c #C #J #P #t8 #w #C4 # #h, #c9 #YQ #!` #n #2 #X #} # # #M #HJ #< #] #9 #Pj% #zC #-R #XGa # p #h #! #nt #B #! #w #Q # #L #p ## #@/2 #A #XP #T_ #9an #g^} #ǂ # #o #, #, #\ #A #+ #<  #7  #- #t:; #+G #BU #c #7q # #b #?? #xA #+M # # # #} #z. #V  # #T' # 5 #xC #*Q #u_ #m #M{ # # #u #B #` #yS # # #K #m  # #P #8 #+W" #0 #!H> #(L #Z #†h #X7v #ň #j #/ #74 #_ #? #& # #%3 #t # #sy$ #3 #څB #P #!H^ #~l #z # #G # #Q #8_ # { #! #R #ȇ #J #:A! #U1/ #.= #K #4$[ #Lk #O{ # #x> #k # #I # #_ #% #k  # #(' #>|5 #C #IQ #_ #\ n #hK} #T #K #" #f #C #= #~ #!H  #U1 #0# #ȇ0 #[g= #%J #+W #2,d #eq #ks~ #e #ш #DQ # #ll #Gh #J #y #- #; #]-I #8W #ze #b5s #: #55 #= #_} # f #a #€ #\  # #H% #z2 #g+? #L #Y #,f #s #b #X #; #; #z #XE #= #n #  #ZS- #8: #nG #}T #Ha #zn #g+{ # # #b #T #a # , #X9 #=F #spS #a` #Alm #Jz #P #m #I #\F #cX #,(; #UH #=U #Tb #o #J| #9a #+ # #fg # # #fg #@1 #+ #}7 #"QC #1O #o$f #0u #a # # #< # #l #e # #& #S #=+ #_7 #C #@O #q\ # i #v ## #M #p[ # #2 # #= #& #r #c #] #M # #7 #2 # #{  #!@ #s{M #KZ #3h #O'u # #( #]b #3 # # # } #F  #` #N$ #J1 #o> #LlK #iX #V #] #> #, #   #  #%0 #!@ #:N #u \ #j #Hx #C #} #| # #h # #" #o% #@> #VjM #bk #8{ #x #| # #h #= #} #<7 #c # #M # `* #e: #Yf #_)t #Aa #C #-+ # #c #;X #  #  # #p" #p #EE #7 #-[ # # #K+ #l{: #eH #0V #ce #?o #k #` # #a< #2 #/H #i # # # #Q #) #zH #l #$X # #|j #6  #k #A+ #([H #K\ #f #Az #GD #S #(  #= #S #! #L #c #d #2  #b/ #;% #h2 #cE #y2R #+y # # #c #g^ #& #BI # # #d?3 #h9 #A? #<F #Y6m #kz #R #+u #- #{ #n # #E #DU # #S #2  # #/# # 0 #0= #J #f|W #=*d #*| #E #  #`H #| #L #U #K6 #S #" #= #2 #M #S # #C  # #2' #5 #C #wsQ #$*_ #m #_| #/S #K # #Yi #8 #- #\ # # #3  #K3 #I( # D5 #O #\ #9i #v #{V # #m #l #, #8 #2 #d #V- #^I: #G #b Z # g #$t #N # #; #23 #gO #!  #8 #C$ #c2 #? #L #Y #^ #\ #m$ #P* #0 #U6 #I= #J #2W #s^d #I #, #v #?=. #< #iQJ #NX #{v #G #FC  #i  #t  #8  #2  #N  #:3  #]4  #yu:  # A  #fN  #h[  #  #{n  #'  #T  #Y+  #n+  #  #   #  #P  #  #-  #   #J(  #5  #3S  #Va  #o  #P}  #  #  #   #r  #E,  #  #?  #  #H  #"M  #  # %  #3  #3b  #Ip  #d>~  #/a  #H  #  #z  #\n  #=  #c  #]  #X  #K$  #*  #40  #B  #H  #yN  #XT  #Z  #t`  #N g  #U  #h  #  #   #o  #Q #r #E, #W( #HJ6 #b9N #H\ #Sj #!Sx #G7 #q # #E #C #x #O #E, #o #x6; #/VY #rh #'w #yk #. #V # #!f #d> # #C # #J  #n #/a+ #H: #\nI #=X #dg #kv #8 #n# # #c # #  #P #z #bf #A ### #ix2 #/VO #5^ #bum #| #( # #' #J #!f #  # #o #˅ # #7! #c0 #$? #OCN #K ] #'l #={ #g # #B #  #  #b #zf # # #Vd # . #M= #)FL # k[ #-j #/y # #E #Y #V #w( #A #f #E #  #W #5I, #:; #ZJ #(Y ##'h #2w # " # #5 #N[ # #G #m, #g # #hb  #r3 #Z+ #]: #DI #rX #g #v #N #%b #- #D #3n #> # #& #5 #_% #L, #NU #/b #B]z # # #7| #X # #S #ro #f # #!V  #6 #t) #kN7 #23E #_eS #{#a #$$o #z} #l # #_ #$ #  #!+ #9 #CT #ob #rp #E,~ #A # #  #UV #r #gB # # #  #g #H( # D #{IS #+a #(o #.} #V # #> #, #hb # o #Q #g #Nq #  # #M% #*3 #߆A #'O #D] #=k #i[y #_ #] #bB #g #o #ke #F #]5 #0R #Em #  #5{ #J #bR #& #r #w #E  #1% # 7 #/)X #k #4} #w #i # # #~" #]: #{B #Db^ #~ # # # #a #z: #[ #K5 #G #;mr #"q #%) #6 #9 #B$ # . #x #i #W1 #i%C # VNp %t % %H %< % %| %" % #E %E %? %i %c % % % %  %  %  #f  #l # ,  &&5  #]zB x K `  # j  &&s  #S~  %  %   &&  %  %  %:  %6  &&    !x !0#! &&"! #E30!d 9!*Q!O^!d i! &&}! %[! %U! & '! #R! %|! %x!P! #~! %! %!q! #R! %! %!""1";"X" %\" %f"p"" %" %" %" %"í"í" %" %"ѭ"ȭ" %" %"֭ #ޭ'#1# &'B# %F# %O# %1S# %/]#g# &3'x# %@|# %># %V# %T# %e# %c## &C'# %v# %t# %# %## &S'# %# %# %# %$ %$ %$$7$ %;$ %D$ %H$ %Q$ %U$ %^$ %b$ %g$$$$B$B$ % $ % $ %#%"=%iU%Įj% &c's% #{%@ % % #%% &z'% #S% %% %% % &z'% %.% %*% %]% %Y% &z'%&&.&د?&@ L&$[&Ze&Z& %z& %x& %& %&b&b& %& %&g&g& %& %&p'x'`&' &'7' %;' %D' %H' %Q' &'^' %b' %h''#'հ'#''h#''W(#2( #e=(_( %c( %h( #<s( %w( %|( #@( %4( %0( %e( %K( %( %( #E( %,( %"( %u( %k( #y( %( %( #_( %( %) %+) %'") %K&) %?6) %:) %|I) %M) %R) #l X)a) #fk)pt) &&}) #) #`) %) %)4) &)&) %) %) %/) %)) %Z) %X) %j) %h) &)&) %) %z*_ * &9&* %* %$* %(* %-*dL* &I&U* #b* #`m* %#q* %{* &I&* &I&*p* &I&* %Y* %W* %h* %f*}* &Y&* #+ %| + %x+ #`+ %+ %'+1+ &k&>+ %B+ %K+ %O+ %X+ %/\+ %+e+ %Ki+ %Gn+ &k&|+++ %i+ %g+ %x+ %v++ &{&+ #+ %+ %+ #`+ %+ %, , &&, %, %', %+, %4, %68, %2A, %RE, %NJ, &&X,=b,={, %p, %n, %, %},G,, #R, %, %, #R,@, #R- % - %- #R)- #E7-@@- #N-\-f- &&w- %{- %- %- %-- &&- %- %- %- %-Ы-Ы-̪.ު..&5.8B.SO.Ыl.#|...p...'.1.p/z/M/ #/ #H^/ &$/ % / %/ #'/ %K/ %A/ %/ %/ #bB/ %/ %/ %3/ %/ #r0 % 0 %0 #E,0 %60 %0$0 #?/0 %i30 %Y80 #[C0 %G0 %W0 % [0 %`0 #csk0 %)o0 %0 %|0 %v0 %0 %0 #f0P0 #}0ͤ0 #00 #E00 #01 &$ 1 #Ny1 151 #?1 &$H1 #SS1 %W1 %`1j1 &$w1 %{1 %1 %1 %1 &$1111 1 1p!2 &o% 2 #y2X "272 #A2 &%J2 #SU2 %Y2 %b2l2 &%y2 %)}2 %%2 %X2 %T2 &%22222X 2!2 &K%2 # z 3 3*3 #43 &]%=3 #SH3 %uL3 %sU3_3 &]%l3 %p3 %y3 %}3 %3 &]%33333 3!3 &'%3 #j4 4¤#4 #-4 &9%64 #SA4 %E4 %N4¤X4 &9%e4 %i4 %r4 %v4 %{4 &9%4444ť4 4 "4 &%4 #;z5 5ߥ%5 #E/5 &%85 #SC5 %1G5 %/P5ߥZ5 &%g5 %Ck5 %?t5 %rx5 %n}5 &%5353535X5 5x"5 #E5 6 #66)6 &$:6 %>6 %G6Q6 &$]6 %a6 %j6t6 &$6 %6 %66 &$6 %6 %66 &$6 %6 %66 &$6 %6 %7, 7,*7 %.7 %77 %;7 %E7EO7 &$`7 %d7 %i7\7d7d7 %(7 %&7l7u7 &%7 %@7 %87 %q7 %i8 %8 % 8 &%8 %8 %#8-8J8 %N8 %X8Ob8O8 %8 %8^8w8w8 %&8 %$88 8 9-9E9&d9.|9 9 99999 %89 %69 %G9 %E9 %X: %V : %i: %g: %y: %w":M:W:p::7:7:<:V: &%: %: %: &%:V:V; %; %;g2;<; &%H; %L; %Q;m;]w;];b;;; %; %;;̧; &%< % < %<ѧ(<2< &%C< %G< %P< %T< %]< %+a< %%j< %Tn< %Nw< %z{< %t< &%<Ǩ< &%< %< %< %< %< %< %< %< %< % < %< &%<֨< &&= %# = %=#=֨:=F=c= ====d =d = = >ڤ0>ߥJ>4q>>>x>I>"?1?"D?e? z??P? ? ??P? ? #I"@ #9&@H@ %ML@ %7\@ %`@ %e@ #E,p@ %dt@ %L@ %@ %@ %'@ % @ %@ %@ #)E@ %+@ %)@ #r@ %;@ %9@ #bB@ %T@ %J@ #cs@ %A %~A %A %A #/A(A #f1A &P$:A #8yGA PA0eA #XoA &b$xA #SA %A %A0A &b$A %A %A %A %A &b$AbAbAbAB BH!1B[;B &$LB %PB %ZBrdBrB % B %B %/B %-B %>B %<BBB %MB %KBCC!C>C %\BC %ZKC %oOC %iXCbC~C %C %CCáC &-$C %C %CȡCC &=$C %C % DxDx2D %6D %?D %CD %LDxVDxrD %vD %{DDD &t$D % D % DDD &$D % D % DEE5E %0 9E %. BELEeE %? iE %= nE{EEOErEEc3FNF5XFߢFFFUF #LF &#G %Z G %L "G % &G % +G #E,6G %, :G % JG % NG % ^G % bG % gG #rG %: vG %" G % G % G #)EG %. G %, G #?G %X G %< G #rG % G % G #bBG %Z G %N G #csG % G % G % H % H #fH!H/H #E=HFH #THcH #EqHzH #HH H &#H % H % HH &#H % H % H %H % H %7H %1H &#I %Z I %VI I :I %r>I %pHIˠRIˠoI %sI %yI I8I8I8I %I %I %I %I8J8J %!J %&JLAJhKJ &#WJ %[J %`Jm|JJ &#J %J %J(J(J %J %J %%J %#J(J(K %4K %2K25KI?K &#KK %FOK %DTKNpKpzK &$K %ZK %VKKKK %pK %nKKL %L %} LL4L >L WL4 aL4 vLLLMgM5'MQM* fMsMM/ MZ MMM_ M #h_M &!N % N %N %N %$N #E,/N %3N %CN %GN %LN #8WN %m[N %OkN %#oN %N %N %N #oN %N %N #)EN %-N %+N #rN %EN %;N #bBN %N %zN #csN %N %NyN #fO &Q %/GQ %hKQ %`TQ %XQ %]Q &]!jQtQ &~!Q %Q %Q %Q %Q %Q % Q %,Q %(Q %JQ %FQ &~!QQ &!Q %dQ %`QURR+R 5R JRxgRR R RRRRR %|S %z S8S &!(S %,S %1S &!@S8JS &!WS %[S %`S=ySUS &!S %S %SZSS &!S %S %S %S %SΘSΘT %T %T %!T %*TΘ4TΘPT %TT %YTؘtT~T &!T %T % TTT &!T %#T %TT &!T %;T %7TU$Uq)UyCUMMU &"^U %SbU %OgUUU &"U %{U %iU %U %U %RU %@U %U %U %"U %U %U %U %U %U &"U %U %V %V %V %B#V %.,V6VSV %WV %`V %dV %nV &X"{V %V %VV &"V %TV %@V %V %V %NV %8V %V %V %ZV %FV &"V %W % W %T  W %H W % W % #W %3!'W % !0W %!4W %!BW %Q"FW %M"UWbW &"oW %q"sW %e"|W1W1W %"W %"W %"W %"W %"W %"WRW W X %"X %"X &"/X %"3X %"#Y %#Y %#YǛYxY &N#Y %#Y %#Y %#Y %#Y %$Y % $Y %4$Y %.$Y &N#Y Z &`#Z %X$Z %T$&Z %p$*Z %l$3Z %$7Z %$EZ %$IZ %$NZ &`#WZ/aZ &p#rZ %$vZ %${ZtZ/ZZ}ZZ"["%[ %$)[ %$2[ %$6[ %$?[ %$C[ %$L[ %%P[ %$Y[ %%][ %%b[4[ [ [;[_[![t\0\Śb\ך}\\\1\\] ]9]+k]=]]]]]^(! ^J:^VS^n^^^ܝ^B^~^ _ _)_;_LR_Ea_ۚk_ &#|_ %$%_ % %_ۚ_ &#_ %B%_ %>%_____љ`;`\`` `5`B` `ŝa a>agUa |a #a &a %f%a %\%a #E,a %%a %%a #bBa %%a %%a %J&a %D&a #8a %{&a %m&b %&b %&b %'b %'b #o*b %;'.b %+'3b #?>b %'Bb %'Rb %'Vb %'[b #_{fb %g(jb %_(ob #rzb %(~b %(b #Db #fb &b #xb8bb #&b &b #Sb %(b %(bb & c %( c %(c %)c %)c &(cZ8cZBcZWchc8uc0cc &c %?)c %5)c %y)c %o)c %)c %)c %)c %)c %=*c %3*c &dǍ d &d %q* d %m*)d %*-d %*6d %*:d %*Cd %*Gd %*Pd %*Td %*Yd &bd֍ld &}d %*d %*dd֍dd5d5dΌd)e`7e[HeUegeӋee0eMe f'fOf+hfHf0fiffufg2g0Xg #4qwg #og #rg #E,g #8g #)Eg #bBh #yPh #5h #oBh #E,\h #8vh #bBh #yPh #csh #Eh #rh #?h #Dh #fhi #ai #Ei`(i #6iEi #pTi #pai #dni # {i #Wi #i #i #zGi #i #/i #ki #li #i & j % +j %+%j %4+)j %.+9j %g+=j %Y+Bj #E,Mj %+Qj %+Vj #8aj %+ej %+uj %,yj % ,j #j #G@j %^,j %X,j %~,j %z,j %,j %,j #fjPj #Ej j #kkPk & 4kP>k & UkP_k & skp }kp k|k kkPk #l #-l &Cl %,Gl %,Wl %,[l %,`l #E,kl %8-ol %.-l %q-l %k-l #8l %-l %-l %-l %-l #l %r.l %b.l %.l %.l #ol %/l %/l #Al %/l %/m #r m %0m %0m #bBm %0#m %0(m #cs3m %07m %0Gm %1Km %1Pm #aVm_m #fimrm #yPym #l m@m &q m #>5mmHm #im & m #Sm %.1m %,1mHm & m %@1n %<1 n %o1n %k1n & n-n7nLn]njnn #En n #nn & n #pn %1n %1ngng o %1o %1o %1o %1%o %1)o %1/o|[o &do #qopzoao #o & o #So %1o %1oao & o %1o %1o %-2o %)2o & o2p2 p2pe0pp=pgp #Eup`~p #pp #Epp #pp &< p #p %L2p %H2pqEq\qh qq*{q &q %f2q %b2q %~2q %z2q %2q %2q &q %2q %2q/q/q %2q %2q/rF/r9r &' Jr %2Nr %2Wr %2[r %2dr %%3hr %3qr %O3ur %G3~r %3r %|3r &' rrrrrss$s.s &N ?s %3Cs %3MsWs &^ msws &^ sss@s@s %3s %3s@s@t %3 t %3tMtV7t[At & Rt %3Vt %3[ttt~tt t tV tV t tu>uiu3uuYuu8 uvv v-v' BvOv`v, mva vvvf v #Zv #E,v #ov #qw"w %4&w %46w %F4:w %<4?w #E,Jw %}4Nw %s4^w %4bw %4gw #orw %4vw %4{w #rw %4w %4w #awsw #fw &w #Iww*w #w &w #Sw % 5w % 5x*x &x %5!x %5*x %I5.x %E53x &i} #rv} #E,} #c} &} %;8} %%8} #r} %8} %8} #E,} %8} %8} %@9} %89} #f} ~ #E~ ~ #.~<~F~ &3W~ %i9[~ %e9`~y~ ~ &I~ %9~ %9~ %9~ %9~ %9~ %9~ &Y~ %9~ %9~ &l~ %9~ %9~B~ &| %: %: R'DNc;{go+0 #] #r #E,: #vE &xZ %l:^ %V:c #rm %:q %:v #E, %5; %+; %w; %g; %; %; # %< %; #fˀԀ &݀ # #` %Q< %A<  & %< %<$ %<( %<1 &@Jg %<k %<t %<x %<~1 & #E3d bӁd  & %< %< #2 %(= %= #R2 #E@`I #Weo & %f= %d= %u= %s=ׂ l& &7 %=; %=@qYxcx %= %= %= %= %= %= %= %= & %> %>̃փ %2> %0>"+ #@H #rT #E,y #R # # &zɄ %K>̈́ %?>܄ %> %> # %> %> %> %> %? %? #f&5 #E@J #Udene؅ #/E #P %B?  %>?% #/ %b?3 %Z?B %?F %?a %?e %?rD{ &7 # #` %? %? &7 % @† %@ˆ %@φ %@؆ &7 %+@ %)@ %;@ %9@  &7"? %M@C %K@L %]@P %[@Vӎt &J} # %o@ %k@ #` %@ %@ێ &Z %@ %@ʇ %@· %@ׇ %@ۇ %@ %@ %@ &Z % A" % A+ %-A/ %+A4[Lq #Bxp #E, %AA %=A #ƈ #, #r #~ #  #]_H #5g #ru # #o #8ȉ #f҉܉ #E #  #U8 #oE #8_ #fis #E # #S #ъ #bBߊ #j #bB #q  #5' #bBF #S #`b #o #`~ #_ #bB #pË #qC # #~| #S4 #eF # Y #d3y #} #C #c #Ì #CЌ #c݌ #) #+ #C  #c #G' #{9 #CF #_T # ._ # Cq #c~ #` #/ #2f #4ō #!э #2ݍ #| #4 #!H #:G #!H" #4 #!HB #ST #F?f #"~ #- #@  #it #S #ǎ # #it #S  #)- #/I #-?l #i7 #' #C #pO #.o #l̏ #(ُ # #w #2w  #Jw #bw' #zw; #VK #w[ #wk # w #  #rq #q # #qĐ #qԐ #q #q #r #r #r #J- #C: #pOG #lY #uh # vw #Z #/v #Gv #_v #ő #vՑ #v #w # #nW  #g#* #iUH #6Y #(of #tr #n~ #z #p #Bf #C #7ܒ #S #Y{ #$ #G #1 #tC #tU #tc #tr #m #C #} #4 #CϓЇ %ZA %VA- &< %{A@ %qAI %AM %AV %AZ %Ak &&~ %B % B && %@B %>B %PB %NBƔ &&Ӕ %bBה %`B %rB %pB &&# %B' %B0 %B4 %B:\ &<i %Bm %Bv %Bz %B &L %C %C %C %CɉѕΉە &\ %'C %!C %MC %GC %sC  %mC &q %C  %C)Չ3 &D %CH %CQ %CU %C^ %Cb %CkՖ-BTn % D %Dė %5Dȗ %1Dҗ'ܗ & %KD %ID/ D &'! %ZD% %XD*IDp_ %tDc %jDlv &j %D %D0Θ %DҘ %Dۘ %Dߘ %DG & % E % E OO, %E0 %E5XB`Z #K9^ #8d #hh #u @S{ #8 $B $B &i. ! #p #ș #َҙ #_ # #b #f #A  # #Z ## #< #H #V #f.[ #vi # ֚ #kܚ # # #! #  # #-% #h1 #2= #I #OU #Fa # m #y #"# # #( #) #+ #- #kț #ԛ #4 # #g #  # #  #=( #1+4 #\@ #&L #J] #C$i #z #Z #( # # #A #Bœ #Μ #ߤڜ # # #  # #* #8 #(D #Q #O^ #q #۳~ # # #O #Ν #۝ #O #  #& #, #2 #8 #> #D #'J #/P #V #\ #b #h #n #it #Mz # #- #  # # # #݈ #M #! # #l #՞ #]! # #5 #  #, ## #h0 #> #M #'[ #ii #Lw #' # ! # #̧ # # ˟ #ĥٟ # #D # #7+ #s #- #; #0I #2* #? # #8 #d #ԢΠ #ݠ # #< #׊  # #\) #@8 #G #V #e #t # # # # #C #zΡ #ݡ #, # #  #ҏ #@( #7 #F #U #[d #s #! # # #K # #͢ #ܢ #" #B  #G #-' #6 #k)E #])T #Hc #pr #' # # #  #q£ #ң #!" # # # #" #2 #XB #R #b #r #ߒ #t. #u # #ͤ #ܤ # # #  # #' #v6 #-E #pT #=c #Br # #P # #Q # #̥ #ۥ #P #p # #ʨ #& #5 #2 D #S #b #r #% # # #A # ##̦ #B-ۦ #. # # #% #4 #C #aR #?a #p # #O #- #P # #ʧ #+٧ # #ͻ # #5# #$ #3 #B #/Q #$` #'o #Р~ # # #| #^ #ɨ #5ب # #y # #b ## #2 #W/A #P #V_ #"n # } # #" # #U #ѭȩ #zש # #C& # # #D" #1 #M@ #O #^ #m #| #! # #g # #QǪ # ֪ #N #P #+ # #" #s1 #{@ # O #^ #=m #| #g # # #< #ǫ #]֫ #4% # # #) #" #1 #p@ #O #K%^ # m ##| # #_ # # #Ǭ #֬ # # # # # ! #0 #B? #N #>] #l #]{ #F #C # #ǭ #֭ #> # #. #A #̫! #(0 #? # N #޼] #rm #Ȋ} # #b #8 # #Sʮ #ڮ # #* #D #Q #k^ # #$ #* # #ݖ #ï #ׯ #- # #ț #޸ #t+ #/9 #G #U #^ c #Sq #G/ #O #- #) # #Ű #Ӱ # #u #k #  # #) #7 #tE #S #^a #o #} # # #i #= #vñ # # #0 #  #! #F+ #: # I #4X #0g #a # #N # #Z,² #AѲ # #  #ף #5  #f #+ #: #sI #‹X #ѹg #av #" #  # #9, # #г #x߳ #{ # #Ҝ  #. #* #%9 #uH #W #f #u #{ #p # #! # #vϴ #޴ #8 #4 #h  # #3 #$? #dK #OX #e # r # # #^ #µ #ߵ # #* # #( #s6 #D #$R #aa #n #{ # # #$ʶ #  # #ߘ% #1 #= #XI #=l #K #D  #d #d #޷ # #y #D# #0 #J #W #e #3t #=/ # #hŸ #jӸ # # #Ν # # ' #5 #CC #K$Q #Ga #o #} # # # #ӹ # #  #" #0 #D #$R #` #nn #G} #! #( #F #| #,ú #3Ѻ # ߺ # # #  #& #3 #-J #W # #s #t # #K #" #@ #S #! #g) #1 #> #L #X #e #nr #n #: #ܫ #· # # #fݼ # # # # #M3 #+? #cL #dY #f # 's #T #C # #6 #Ƚ #ؽ #d ޽ #y #l # # # #% #2 #? #qL ##d #Aq #!~ # # #ž #=Ҿ # #ݷ  # #G/) #7 #E #݊S #a #o #s} #M #G # #X #ÿ # ѿ #*߿ # #k #  # #n% #f3 #A #j$O #] #Rk #vy #  # #: # #+ #l # # # #  #I #P  #p- #:: #G #U #|e #2k #Cq #w #} # #G #P # # # # # # # # #& #: # #ِ # #t #V  #- #: #S #H` #xm #v} #W# #n #' # # #5 # # # #[ #v# #`) #&< #XI #`V #&r # #$ # #N # # #` #& # #h  # ## #u0 #,i #v # # #! #1  #+ #$' #OB #P # # #! # # # #V #% # #T #xa #@! #  #' #,o #+| # #x #. #> #A #xN #J[ #h #u # # #l #Ɣ # # # #$ #É3 #B #Q #q #0 # # #R #p #w #, #s #V # #, #< #L #\ #nl #| # # # #P #/ #'  #, # #  # #/ #< #qI #s #$ #C #' # # #@! # # # #O! #y- #: #٪G #" # #> # # #[ # #W # # # #M, #9 #K #X #ɽe #%r # #H  # #s #ŗ # #k # # #n # # # #) #6 #G/C #S] #k #*| # # ## #Y #\ #( ## #K #c ## # ## #n- #0B #` #l #Ry # # # #a #s #= # #M # #x/ #  # #% #3 #@ #M ##Z #) m #z # #+ # #s' #  #w # # #} # ## #C0 #*= #G/W #Sd #r #(~ ## #> #; # # #n #m # #  #< #x  # #`$ #&2 #"? #L #Y #f # 's #T # # # #1 # #ӓ # #ة #  # # #G  #Z  #$ #. #W ; #I #.V #c #`p #Z~ # #Y # # # # # #p #. #Y #6 # ' #q! #. #; #H #bo #| # # # # # #+% #a #[ #$ # # ' #A #5#N #-*[ #ch #v # # #& #s ## # #* # # #G) #: #F #@W #d # p #f} #q # #Z #6 #$ ## # # #Z ##% #2 #Z? #ǑL #oY #p #} #  # # #N # # # #T #  #< #& #< #Y #} #» #U #\ #W #; # # # #" #?  #- #: #5G #ǶU #Юi #u #5 #{ # #a # #ź # #w) #w # # #- #a7 #E #p$R #_ #6l # y # # # ## #o # #* # #i #` #` #( #86 #C #kQ #^ #k #lx # # # #< #, # # #Q+ #9 #nH #Y #_#_ #Se #k #q #x #P ## # # #Q # # # #.( # #|! #B0 #,> #L #X[ #wi #ׯw # # #c #ߺ #< # # #, # # #n #n! #ȹ/ #-= #dK #& Y #g #tu #N #, #q #= # #0$ # #m #u # # # #&+ #9 #G #͘U #c #˸q # #N #S #Z # # #: #\ #n #s # # #* #8 #\F #T #b #'p #J~ # #$ # #S # # #S # #+  # #) #77 #sE #S #[g #l # # ## # # # #C # #  # #'* #O: #J #Z #?j #Q,z # # #  #? # # #9 #} #߉) #8 #i'G #V #p #~ # # #e/ #D # #O #F # # , #O6 #D #~R #o` #n #:&| # # # # # # # #ܓ # #& #j #7 #*D #Q #n^ #x # # # #. # # ! #  #I'" #7/ #M"< #iI #V #c #p #`} #@ # #( # # # #5 # #. #& #a  #5 #E # !R #f # #& #. #  # ## # # # #-( ##2 #< #fF #H+P #Z #h #ou # # #) #  # # # #à #  # #M #  # #+ #: #I #V #c #p #~ # * # # # #p #' #r # # #Q# #1 #J? #LM #[ #Zi #w # #ʨ #$ #j #2  # #{ #G #ɭ # #' # #- #; #I #HW # )e #s #׊ #c #: #x #, # #% #^ #y # #8! #* #+ # > #H #!R #^\ #͌f #5p #} # # # #n #, # #) #B  #y # # # #* #Y.8 #L #f #p #z #s # # #̯ # # #  # #$ #? ## #ܚ0 #H= #P #] #Oj #w #s # #ý # #o # #, #  #) #( # #$ #) #'6 #D #Q #^ #+"k #jz # #t # #? #=# #!% #8  #-  # $ #1 #Ӛ> #AQ #] #U~ #U$ #' #$ # # #8 #_ #$ #Q& # #* #D #Q # # #B #( #% #n #- # # # #u #8" #o1 #? #z # #n #*' # # # # #G #& #  #q #p/ ##< #YI #V #c #]p #n} # #A # # #) # # # # #5 #  # #& #24 #aB #P #8^ # # # #). # #O # #̿  #4# #]0 #O= #(T #a #Ox # #O #w # #' #  # # # # #C, #M< #B #wH #ОN #[U #je #: k #q #=w #'~ #$ # #  #2 #2 #o # # #d #b* #$7 #D #'Q #^ #@+k #Jx #O #7 # # #߮ # # ## #n #*, #9 #P #>] #2j # # #n # # # # #h  # # #' #s #+ #8 #fE #0R #"+_ #9l #y # #  #, #:  # # # # #s # #F #C #O #ge #q # # #6) # #g #, # #O  #" #/ #= #J #d # q #$~ # # #G/ # - # #  #/ #F #FT # #6) # # # # # # # #8 #jF #KT #%b #p #~ # #@ # #s #S #Ѷ #  #U  #" #g0 #> #a #p #  #m/ # #` # # #, #i # #n# #"$ #(2 #@ #oT #b #/p #~ # # # # # #c  # #t # #n$ #C2 # @ #;N #\ #j #* # #; #P # # # #( #U) #*7 #4E #¯S #$a #.o #} # #| #g #@ # #E #t # #e # #<, #H #c #&| # ## ## #_ # # # # # #)+ #9 #G #U #c #q #= #W #S) # #  # #>* # # #? #  # #, # ; #+J #Y #h ##w #W #[ # #>  # #p # # #"  # #+ #: #I #X #g #v # #G/ #a #S #9 #$ #K #g # #/  #߮ #ڔ* #9 #AH #RW #f #O u # # # #v #8 # #E # #F #T #~ # # #% #ٟ # #  # #u # # #F #% #  #@  # #ӵ # # #" #2 #48 #> #jD #J #*P #ǜV #X] # ,m #s #=y #Z #< # #_ #d% # # # # #. # # # # #B # # #~ #D #? # # #R # #( # # & #, # 2 #8 #> #5"D #J #P #V #u\ #b #h #n #t #z #y # #Ù #o # # # #5 #  # #f& #l #%& # #0 # #/ # # # # # # # # #t #+ #8 #E #ݷR #_ #l #z # # # #? #' #I #* #k #M # #\ #Nh #y # # #* # # #  #ƣ #  # #w # #B #O #( #n5 #*K #] #{ #T #\ # #t #  # # #8' #, #9 #@F #:S #` #m #!z #b # #[ # #] # # #ϑ # # # + #p9 #,G #!U #c #q # # # # # # # # #k # #y # #x- #; #I #W #/e #s # # # #' #j #K # #} # #P #  #3 # &* #:9 #HQ #` #|o #~ #] #C #  # #  # #  # #ɡ #b# #H # U #, b #zo #| #5 #y # # #ԫ # # #_ # #7  # #& #74 #oB #pP # ^ #"l #J z # # #] #  #  # # # #  #* #u #" #+0 #> #L #Z #h #mv # # #o #i # #  # #: #P #^  # #( #O7 #F #U #d #s # # # #  #  # # # #P #  # #' #6 #E #d #Ys #n  # # # #G # #~ # #@ # # #] #T #2 #5 # #' # #-* # # #ڋ #/ #  #s- #: #G #[T #\a #n ##{ #; #d # #_& #] # # #' #:& #  #\ ##& #F3 #@ #ƓM #fZ #g #t # #  # # # #t #( # #9, #,: #H # \ #=i #Yv # # # # # #I #n # #I  #m #y #/ #` #$ #  # #̿ #F #' # #& #  #0 ## #/ #; #'U # !b #y #a$ # # #T #$ # #~ #  # #" #'D #} #, #ֻ #I #, # # # #T  # #$% #2 #~I #e #s #4 # # #L #^ # # # # #! #  #Ǐ- # ; #H # !U #/ #  #v #n #. #U #-, # ! #! #r%! #3! #)@! #;M! #+Z! #g! #pt! #! #:! #g! #! # ! #s! #D" #" #" #w!(" #5" #C" #P" #]" #k" #x" #Q" #" #\" #;" #" #" #" #O" #" ## ## #B# #PL# #f# #Дp# #:z# #J# ## #=# #,# #,# ## ## #c# #N.# # $ #$ #'$ #s$ #n$ #$ #$ #c$ #$ #$ #)% #% #% #2>% #a% #m% #}% #+% #% #% #% #ω% #&% #4% #% #ɬ% #% #% #̾& #& #r =& #K& #~(Y& #a g& #u& #6)& #'& #%& #& #& #& #@& #& #5' #L' #*' #8' #F' #3T' # h' #v' #X"' #' #' #H,' #' #' #` ' #' #G' #'( #c( #<( #&B( #N( #_^( #!d( #j( #q( #Í( #( #"( #$( #+( #( #-( #) # ) #) #') #L4) #A) #O) #\) #Zi) #&v) #) #) #) #~) #~) #) #) #) #) #) # * #* #*,* #:* #H* #SV* #7d* #Xr* #* #ђ* #O* #* #g + #+ #%+ #e3+ #A+ #"O+ #]+ #k+ #'y+ #+ #O, #", #0, #`>, #L, #Z, #h, #$v, ##, # , #y, #{, #i, #6, #, #i, #u, #E- #- #- #-- #I;- #I- #W- #e- #b- #- # - #=- #- #9- #F#- #1/- #. #/. #. #-. #;. #1I. #X. #a f. #Lt. #. #j. #ӧ. # . #. #. #P. #. #|. # / #/ #/ #/ #0 #lZ0 #g0 #Tu0 #0 #ͦ0 #0 #)0 #0 #0 #0 # 1 #1 #&1 #41 #JB1 # P1 #^1 #l1 #z1 #1 #h1 #1 #P1 # 1 #$1 #*W2 #V:3 #G3 #T3 #&a3 #n3 #%84 #B4 #o4 # 4 #4 #e4 #4 #&5 #b5 #5 # +5 #95 #F5 #S5 #G/m5 #5 #*5 #Y5 #u5 #5 #f5 #d5 #5 #5 #z6 #6 #غ#6 #a16 #?6 #QM6 #)[6 #i6 #aw6 #6 # 6 #6 #6 #26 #;6 #p6 #Х6 #.6 #7 #?7 #"&7 #!07 #':7 #D7 #"N7 #\7 #j7 #n7 #ӓ7 #77 #7 #P7 #7 #s7 #7 #8 # 8 #I,8 # /98 #,Q8 #-_8 #l8 #!y8 #8 #8 #8 #8 #G8 #w8 #8 #\ 9 #9 #<'9 #&59 #cC9 #Q9 #_9 #m9 #`"{9 #x9 #9 #9 #9 #b9 #{9 #!9 #t9 #9 #: #: #8#: #ɷ1: #&?: #M: #m[: #$i: #: # : #H: #/ : #: #: #: #r: #; #$; #; #s*; #7; #D; #>)R; #`; #Gn; #o|; #; #; #w; #; #t; #; # #; #; #; #< #O< #;$< #2< #q@< #N< #\< #j< #x< #x%< #< #F< #< #< #< #"< #o< #< #i= #= #> = #&/= # >= #M= #{\= #k= #z= #m= #v= #x= #= #w= # = #= #0= #> #> #G//> #4M> #S\> #Ţk> #z> #> #n> #> #R> #/> #ѿ%? #3? #,P? #s? #t@ #@ #A #A #[B #]D #vE #q E #bE #E #9E ##E #:E #Y'F #G #yG # G #[G #tG #$G #H #H #)H #6H #EH #6TH #ycH #rH #Q H #2H #H #H #H #H #AH #\H #I #* I #I #'I #tLI #TYI #fI #-*I #I #I #XI #*I #sI #I #J #*J #kJ #,J #:J #1 HJ #VJ #݊dJ #rJ #J #J #J # J #J #J #aJ # J #K #UK #+K #8K #FK #TK #bK #pK #~K #K #K # K #hK #FL # L #2L #L #L #$L #$M #M # !M #.M #N';M #lM #WM #M #tM #-*M #M #rM #M # M #sM #6)N #iN #݊N #,N #:N #HN #VN # O # O #PO #:P #P #!P #.P #;P #"NP #e[P #khP # uP #ٕP #P #'P #(Q #0,Q #$9Q #VFQ #BbQ #Q #Q #Q #tQ #7R #YDR #QR #B^R #kR #xR #R #xR #R #R #R #QR #/R #R # S #S #0S #?S #MS #gS #XuS #$S #S #'S #S #S #NS #S #S #T # "T #1T #@T #sOT #^T #mT #|T #T #T #8.T #T #T #aT #TT #1U #U # U #w/U #>U #kMU #\U #0)kU #qzU #U #U #U #U #U #U #U #U # V #V #&V #`4V #BV #PV #Y^V # lV #zV #;V #>V #V #V #PV #VV #V #UV #r-V #/W #W #("W #0W #>W #H(LW #ZW #hW #W #W #W #W #W #'W #W #W #W #W #W #MW #X #vX #nX #+X #-9X #-GX #UX #/dX #nX #}X ##X #X #X #X #X #X #NX #0-X #Y #.Y #r,!Y #6/Y #n=Y #$KY #YY #gY #/wY #Y #Y #nY # Y #*Y #Y #.Y #8Y #Z #Z #4Z #*Z #:Z #JZ #ZZ #jZ #'zZ #(Z #b-Z #MZ #%Z #Z #Z #Z #Z #[ #"[ #;"[ #(0[ #ǎ>[ #XM[ #Z\[ #'k[ #z[ #T[ # [ #[ #t[ #$[ #n[ #[ #_\ #.\ #z \ #)\ #6\ #>C\ # P\ #]\ # j\ #/w\ #\ #\ #\ #d\ #\ #\ # ] #] #_(] #/6] # D] #vR] #] #!] #t] #N#] #9 ] #2] #&] #] #] #c^ #V ^ #w^ #+^ #8^ #E^ #YR^ # _^ #l^ #y^ #q^ #,^ #^^ #t^ #G/^ #^ # _ #8_ #%&_ ##3_ #c@_ #V M_ #wZ_ #g_ #Yt_ # _ #_ #2_ # ` #w` #t%` #G2` #2?` #L` #Y` #!f` #Ss` #` #` #'` #(a #'a #t4a #Aa #Na #[a #ka # a #a # a #a #a # a #a # b ##b #B"b #9.b #Eb #Tb #rb #*b #b #ab #Lb #Rb # b #b #b #Ob #^ c #c #"c #L.c #/;c #0Hc #K)Uc #lbc #Էoc #b|c #c #Uc #c #tc #c #c #bd #od #]%|d #G.d #Dd #B%d #6d #9d #Ye #G!,e #9e #bGe #^Te #ae #ne #e #qe #e #e #"e #e #pe # f #Pf #:f #*f #7f #ݷf #f #f #f #ިf #f #g #Yg #X-g #q;g #Ig #gWg #sug ##g #!g #\g #'g #g #Fg #Gh #h #,h #Jh #8Zh #(`h #"fh #|mh #{h #th #$h #qh #'h #Qh #h #/ i #r i #Ei #nSi #sai #oi #,~i #Qi #$ i #i #ĩi #i #i #i #wi #>i #5i #i #*i #7i #' j #@!j # 'j #5j #'Dj #Nj #_j #ej #Ӿkj #qj #|*wj #|}j #1j # *j #j #j #j #j #j #3j #j #fj #j #0j #>j # k #'k #;k #Ek #Yk #Nxk #Tk #$k #tk #8k #Hk #ak #5 k #z k #k #k #l #l #'$l #11l #Xl #*el #7rl #l #l #l #l #Ցm #:m #m #wm #,$m #tKm # Xm #,em #frm #m #!m #um #!m #m #m #˜m #m #m #%m #n #լn #Xn #(n #R"5n #LBn #Zn #gn #n #n #j"n #an #ԋn #fp #8p #-p #tp #p #p #Op #p #p #p #q #q #o!q #/q #3=q #fKq #<Zq #mgq #q #֡q #q #aq #q #q #Z-q #֭q #q #'q #<r #r #-*-r #֌:r #`Gr #CTr #,ar #nr #L{r #׊r #r #ar #r #cr #ݷ s #s #%s #8s #$Es #/Rs #_s #}s #.s #s #s #Ys #as #st #t #Ԥt #z*t #!7t #u #u #6v #6v #*v #Tv #&v #(v #k5v #Bv #+v #v # v # w #:&w #(w #6w #j!Tw #Caw #Hx #,x #\x #x #x #yx # -x #Ix #x #x #x #x #x #x #iy # y #vy #y #*'y #-y #3y #q9y #?y #,!Ey #Ky #Qy #Wy #]y #,cy #Wiy #"oy #uy #{y #y #݌y #y #gy #y #y #$y #y #hy #!.y #y #y #y #кy #G y #+y #5y #y #۠y #gy #Zy #y #^z #Q z #$/z #Dz # z # #z #)z #/z #;5z # ;z #Az #Gz #Mz #Sz #Yz #ۿ_z #Zez #kz #qz #Iwz #}z #z #z #Tz #z #Zz #ez #z #γz #Rz #Mz #z #Fz #z #z #_z #z #z #Az #z #yz #Bz #6{ #%{ #8 { #J-{ #5({ #x{ #%{ #+{ #1{ #7{ #={ #C{ #I{ #fO{ #ڝU{ #[{ # a{ #g{ #Nm{ #s{ #9y{ #{ #{ #Q{ #|{ #^{ #{ #{ #H{ #I{ #?{ ##{ #{ #{ #d{ #q{ #{ #b{ #ˍ{ #{ #{ #| #I| #i| #~!| #إ(| #5| #IB| #O| #h| #u| #| #| #| # | #| #I| #| #C| # } #P} #!} #Q/} #=} #oK} #YY} #g} #5u} #} #} #} # } #O} #} #a} # ~ #C~ # '~ #5~ #tC~ #Q~ #>~ #~ #~ #-~ #~ #=~ #"~ #~ #~ #Ѩ #m) #A #O #~] #_k #| #/ # # #s # # #! #0 #? #N #'] #l #{ #O  # #C # #Yƀ #Հ #4 #a # # #t # / #> #M #\ #k # z #' # #- #  #i ʁ #ځ #  # # #& #5 #"D #S #b #q # #O  #« # #M #c,˂ #.ڂ # #  # #Q #P% #4 #C #R #Ӽa #p # # #  #  #Ƀ #-؃ #  #0 # #_ ## #2 #A #P #_ #n #ݷ} #z # #  #DŽ #ք #j # ## # #! #20 #? #:N #] #dl #8{ #2 #9 #y #  #Zƅ #Յ #N #. # # #l #g/ #^> #*M #i\ #k #z # #w #1 #dž #ֆ #/ ## # #%, #: #*I # "X #}g #@v #@ # #  #l( # #͇ #ۇ # # #  # #! #z / #w= #{K #V(Y #g #-u #݈ # ! # #Ǫ* #F #b #t #R # # #. # #$( #@ #!H #_ #Ch # # #Š #9Պ # # #- # X #c #n #Ty #` #} #. # #П֋ # #. #z" #9 #R #^ @ %?E %3E #m %~E %rE #a %E %E %E %EŌ #݊ %CF %3F %F %F # %F %F #  #& Q/ &*8 #'C %JGG %FGL #*W %iG[ %aG`  p p %G %G   . &; 5V X*` Q{ * c Ž xݎ    8 E ] t * #ˏ #m؏ #a #݊ #$ #1 #q= #'J #*p #~ #Q # #4 #m #  #4 # #8 #,% @G %GK %GP #m[ %G_ %Gd #o %Hs % H %NH %JH #I #  E Eԑ %dHؑ %bHޑ l  ' B R j w Ҵ $ # #m #  # #8 #' #*& #E #mR #l #Iy # #  #m #>œ &5-ۓ %Hߓ %qH #m %H %H #4 %bI %XI # %I %I+ %I/ %I? %IC %IQ %JU %JZ # d Pm &[-v #    #+ &m- #w %KJÔ %IJ̔ ֔ &m- %]J %YJ %J %J &m- > > >0 aA N -d #%q  z #   &K- %J %J ȕ &-ٕ %Jݕ %J %J %J &-  9 %J= %JC pc  m &-~ %J %J %K %K   &-͖ %;Kі %5Kږ  &- %YK %WK  % 2 Z< ZP t  > ԗ @-ޗ  % P 9 #C &)Y %tK] %fKb #mm %Kq %Kv #4 %L %K #w %NL %@L %L %L #f %L %Lј %M՘ %Mژ #I #  %WM %OM # %M %|M %M %M" # , 5 &)> #K T &i #*s &)| #w %M %M & &) %M %M %N %N &)ʙ ƽڙ ƽ ƽ   ), #%9 B #O Y &)b # o x  #V+ & * #w %4N %2N š & *Ϛ %FNӚ %BNܚ %uN %qN & * < < < _- : h)K &>*T # a j  #o+ &N* #w %N %N  &N* %Nś %NΛ %Nқ %Nכ &N*     7 ,  (L &*U #Fb Pk , #+ &.* #w %N %N , &.*œ %OƜ %NϜ %1OӜ %-O؜ &.* o o o  P- )H  R &)c %NOg %LOq  {  _ ם   )4 L ܾg 8)w  V 'Ϟ ^ v   ' %4 E  h #~r  %gO %[O # %O %O #C %O %Oş # П %Pԟ %Pٟ # %Q %Q #Q %R %rR #P %mS %MS #o %T$ %ST) #Y4 %W8 %W= #H %%YL %XQ #5^ #i %|\m %:\y 8  M '  -̠ 8  G  O. T; mV ` ~{    š ϡ   ³  ֳ4 w> Y `c ~   ; &Ģ Ϣ #٢ &, %J` %:` #m %` %` # % a %`+ %\a/ %Za? %maC %kaH # R [ &,d #q 0z 9 #ʹ &, #w %|a %za 9ģ &,ѣ %aգ %aޣ %a %a &,     / 0< ,R #%_ h #u    &, %a %a %a %a %b % b &,ʤ %*bΤ %&bפ %Cbۤ %?b I   %eb %cb" @ I[ k Q V  &, %vb %rb %b¥ %bǥ   &- %b %b ] & -$ %b( %b- vH %R {e *o *  Ԧ  , P % , U: # D & )Z %b^ %bc #mn %&cr %cw # %kc %_c #w %c %c %c %c #f %d§ %dҧ %hd֧ %Xdۧ #I #  %d %d #  p &") #& / iD #)N &7)W #wb %df %do iy &7) %d %d %e %e &7)   Ө ;  8' #% @ #* (4 &L)= #J S h #r &^){ #w %2e %0e  &^) %De %@e %se %oe &^)ɩ ٩   һ  '& &)/ #< E YZ #J*d &)m #wx %e| %e Y &) %e %e %e %e &) {˪ {ժ {    (' &p)0 #= hF [ #c*e &)n #wy %e} %e  &) %f %e %/f %+f &) ̫ ֫   h (#  -  A p  m ,Ӭ h( 4 O$ p'4 kR Ƽm ' μ  ϭ  % p  % #n/ Q %^fU %JfZ #e %fi %fx %f| %f # %:h %*h #^ %Qi %Ei b ^ծ @$ n  v {( D N j $t DZ $ # &( %i %i #m˯ %Cjϯ %1j߯ %j %j %j %j #   #%! * #7 0E V O V c { " ' Bɰ Ӱ | %    #w &'4 %j8 %j= #mH %kL %k\ %_k` %Yke # o } #%  # 8 &' %k± %kDZ &'б #ݱ H U #) &( #w %k %k& U0 &(= %kA %kJ %kN %kS &(\ vl v   H x% OѲ p H%    #  8 %E V # y #  &. %l %k #m %Fl %8l #ܻ %lų %lճ %lٳ %l %m %m #  0 #%  #- @; E &0.V %mZ %mc %mg %ml &0.u %my %m   %m %m Ѵ    1 &B.* % n. %n7 %Cn; %9n@ &B.I %nM %onV %oZ % oc %og %op }  %o %o  ʵ %oε %o׵ % p۵ % p % p % p   % p$ %p- 7 T %ApX %?pa %[pe %Ypn %[pr %Ypx  W \ _Ѷ i  * M !p > j 8. r˷  ( - 0& FA .W No a p.   ظ  r  0 %= 0N r #*| &^* %tp %jp #m %p %p %p %pù #ӹ #޹ %9q %-q #' # #4 #' #- 6 # @ N #%[ d #q H G &t* %q %q %q %q %q %qº &*˺ %rϺ % rغ N &* %7r %1r %_r %Yr %_r %Yr  /  D  Y  n     ƻ  ۻ    %  b;  E  Y  ? ؼ   (*( K  X  m %z   #% #mݽ # #   #% `" #/ P> #M #r #[| &- %r %r #m %r %r %!s %sþ #*ξ %esҾ %[s #  P # h &- # ) 1> #)H &-Q #w\ %s` %si 1s &- %s %s %s %s &-   Ϳ &޿  p- #%   #$ X. & .7 #B %sF %sO hY hr %tv %t %t %t %t %t E E %&t %$t E E %5t %3t O O/ %Dt3 %Bt8 TM W k   -   >  ?# > -N i s   % P  # &* %]t %Qt %t %t #m %t %t #a %5u %#u, %u0 %u? %vC %uH #W #a %tve %rvj # t } &* #a  < # &+ #w %v %v < &+ %v %v %v %v &+  ' : K X +z #% ` #  #%  # x #%  # p #%   #+ h: #%G `P #] `l v &"+ %v %v %w % w &"+ %(w %$w   %@w %>w   * = G &4+X %Qw\ %Mwe %kwi %gwn &4+  &I+ %w %w   &Y+ %w %w  &k+ %w %w" H= HR %wV %w[ Mp Bz &}+ %w %w %x %w %3x %+x %ax %Wx %x %x &}+ %x %x %y %y %4y %*y %hy %`y Q R& RC %yG %yQ &+^ %yb %yk %zo %zt  &+ %Dz %>z %qz %kz %z %z &+ %z %z   , 9  I d H,z     x, ?  7 HE n = \  + ! &+ %z %z %z %z &+ %0{ %&{ %a{ %]{ %{{ %w{ %{! %{* %{. %{7 %{; %{D #Q ![ !x %{| %{ 1 &+ %{ %{ %.| %(| &+ %]| %Q| %| %| 1 %| %| %} %| 1 10 %,}4 %*}= %>}A %<}J %N}N %L}W 1a 1z %`}~ %^} %p} %n} 1 %} %} 1 1 %} %} %} %} G &,# %}' %}0 %&~4 % ~= ZG &.,T %L~X %H~a %d~e %b~j k { &>, %x~ %t~ %~ %~ %~ %~ &[, %~ %~  &p, %~ %~ %  % %  %(  =  R  g  |          , A [ #e &,v %3z %- ( 0 R Z    8 ^ y H+     % %  U U #  -  E  O  f  p   ( w ~ +2 ? qZ d iq  +   K %  P ' { < %I Y  f  { %    %     %  %; #.D &$(Y %\] %Pl %p %u #m % % #a %. %" %r %h % % #* %6 %* #݊ # %} %u #  ! # p &;(# # / (8 M #(V &M(_ #wi %m %v  &M( % % % % &M( O O O x ( % #%# , #8 G #%S \ #h w #%  #  &q( # % %  #% ` #  #%   # "  ,  C  M  ` Ӷ{ & ض  P&  $ %  % %2 !B  O F d %q ! K #%  #  &( #*   #y &( #w %N %L % &(0 %`4 %\= %A %F &(O >_ >i >| _  & 9 &_( % % %Ȃ %Ă &_( % %ނ 9 9 % % = X h | ڷ ڷ %  % ڷ ڷ % %   %' %% - ( 7 ( N X X X o  y     f N % ! S ( ~ = %J !Z  g  | % !   % !  #c # #4 #:* #48 #W #d #4 #' #* #' #* # #4 # #g #2< #,J #$i #,w #Q #, # #, # #, # #`> #$[ #x #$ #, #" # # #@ #<9 #;K #sX #f #x #s # # #! #s #' #C # # #, #\ #) #`7 #I #W #f #hx #s # #_ # #1 #T #W #o # #Ŗ # #, #)9 #T #Йq #w~ #&! # # ##) #M/ #M/ #M/ #M/ & %<* %43 %j7 %b@ %D %M %ȃQ %ăZ %^ %܃g %3k %)t  &( %g %]  &( % % % % % %  &( %ф %τ % % ) 3 &(D %H %Q %U %^ %1b %-g &(p %Ht %F    %W %U   & ĸ< ` "x @ & R  _ d # # # #\ _ #U $K $K &<+ ! 2 #dS #.u_ #5i #w #)| # #Y #{9 #T #^ #ϋ # ; #ѐ #< # # #m #Os #l # #t #0 #= #Y #q # #, #r #i #٬ #-9 #j# #* #g/ #; #G #S #z_ #ۦk #0w # #h #O #6 #, #= #S #ܡ #Ơ #5 # #t #P #P) #(5 #(A #M #oEY #1e #Jq #7} # # #ǧ # #ǧ # #mc #ǘ # #GY #ѣ( #H5 #ǘB #5j #R7w #ǘ #lC #s #i #Z #ϱ #^ #a #g # #X~ #j #Z #S # #@ # #" #8( #y. #?4 # : #^N@ #/F #L #R #}X #2` #Iw # #  #3 #-R #c #p #} # #Y # # #y #O' #5 #=@C #aMQ #_ #m #K{ #θ # #٭ #Y #A #5 #f #Q #T$ #{3 #FB #eER # a #Hp #'s #b #r #1 #Ko #j #y # #ۏ #M #th #gz% #4 #C #+cR #2a #Cp #_ #I #= #6 #6 # #` #4Y #= # #} #ߐ$ #rQ3 #;B #xEQ #G` #1Po #T~ #| #¡ #ރ # #^ #~ #p #$J #߻ ##$ #E4 #D #IT #`kd #(t # # # #f # #< #E #e #<6 #J #9$ #3 #Q #wc` #Ao #3~ #dw # #A # #א #̭ #͠ #8m #1 #ۗ #2# #:2 #8A #{P #J_ #kn #g} # #2 # #rN #/ #q #> # #A: # ## #2 #/LA #vP #~p_ #Rn # } # #4 #m #)4 #H #, #T #T #Cs # ! #0 #? #ZN #X]] #Kl #{ #l #` #[ #} # #y # # #l #"I #F #h/ #ٙ> ##M #MI\ #Kak #IGz #d #C0 #C #R # #_ # # # #_ # #. #}= #&[L #bv[ #NSj #y #k # # # #7 #I #Օ #)K #) #o # #|- #e< #?K #Z #ZDi #x # # #Y # #U` #> #3y #@ # ~ #8 # #a- #fS< # wK #aZ #]i #x # #Z_ #9 # #  # #Z #6} # #} #\ #y- #5< #K #~OZ #4i #Hx #h # #k #&: # #Hx #}f #2 #d # # #< #}K #КZ #i #Fx #x #S #K #E #;Q #R #Hj #' #ra #B #u1 #/ #?? #ON #Z] #gGl #Lg| # S #N #V # #N #z$ #\0 #< #EMI #7=X #~e #lCy # #4 #B #] #  # #KC #G1 # #m #$ #ǘ2 #@ #N #\ #j #fx #C@ #i # # #i #h1 #2 #  # # # #" #Y0 #Hu> #L #BKZ #h #μ #! #П #e #j # #} # #* #e #]+ #x: #[vI #{aX #g #v # #H #I #o9 #z #[ #? #bK #[2 #^ # #1* #k9 #gH #XW #f #u #ƥ #M #k3 #$C # # #b #T #T #D  #vM #Z) #_l8 #&DG #V #Ye #_t #06 #m # #0x # #? #\ # #ǘ #4L  #k #z7 #n0A #oN #g #_ #ĉ #s #l #C # # #\ #T #Ѐ #S  #tx- #zx; #\o #S #x #? # #4j #GK # #w4 #@ # ON # O] #5 #Տ # #r #`Q #=@ #G #:  #h #N #[\ #8j #{x #i # #D #k` # #l #t # #uA #0 #h" #k0 #cX #ue # tx # l #~ #b #}l # Q #8H # #f #y" #0 #> #`L #>`Z #h #tv # #x #ܥ #R #2B #3 # #ok #&* #c> #aS #` #` #6G #  #R # # # #j #>z # #1; # #B$ #x1 #KQ> #\K #=@X #2f #" #lC # #/ #X #1 #+ #n #t[ #q #U #P% #ٶ2 #I{A #PP #=@m #} # #B_ # #Lt #8 #/ #a # #v #Q #F? #~ #M# #0 #^R= #mj #rw #=@ #\ # # # # #1 #= #ͮ #)]" #"`0 #T> #1<L #aZ #h #qv #( # # #AT #t # #r # # #  # #r #, #: #nH #qwV #*d #fr #6h #QZ #k@ #o #t: #/ #=@ #$N # #a #j # #(> #  #N #^< # #0# #ft) #w/ #P5 #; #0A #xG #\^ #+|o #7{ #޲ #  #T # # #%| # #5 #s # #5  #,w #Q7 #=@D #$Q #ɸ^ #&9z #^ # # #g #j #Յ #g #j #  #\ #VN- #m: #G #*T #ga #jo #b #߆ # #1< # #- #n #^0 #ĴK #s #7 # #\ # #@ # #Ĵ0 #= #ms #[|# #=@C #P #t] #3p # #t # #\ #D #  #g> #}  #t #T' #] #5| #t # #J #z #x #r\ #|[, #;_ #5fm #X{ #f #~} #0 #+ #eC #A #0 # #4n  #C- #s; #[ #7j #ˆx #߇ #X #d] #=1 # #&T # #3 #Tu #{r #T* #J #X #hf #7t #L #k #l # #u #Q #ˆ #7 #t #, #=@9 #6F #a #qnn #ѣ| #Qb #ǘ # # #aP #!\ #P #-l3 #LH #>zV #Ob #nu #e # #? #u #r #n #> #y #gb # #b #T" #^0 #bI> #>L #Z #h #fv #L # #lr #x #` #& #Ϗ # #R # # # $ #v0 #a5= #OK #?W #md #a5r #L~ #ږ #a5 #P #a5 # #9 # t #G #1 #u# #u0 #`Q= #}J #ˆX #Ce #xr #= #׮ # #U3 #@a #Q: #km #T #s # #e #" #T. #; #"H #V #i #~ # #Z= #2 #0 #.h #S[ #U # #R  # #.k* #L6 #BB #zN #oZ #8eg #t # h #D #N #| #} #Q #g #j # #=@ #I{ #q #U #P- # : #|nG #IU #n #y # : #p #qO # #%Q # #6l #[ #y\ # # #R #&v! #5! #x! #6J*! #|7! #fE! #VNS! #`! #"n! #e~! #l! #A! #! #f! #B! #U! #Q! #h1! #G! #.G! #{" #i(" #MB5" #?B" # \" #wi" #v" #" #}" #ɹ" #A" #VN" #U" #=@" #}" #O# ## #"# #J,# # s9# #F# #T# #\a# #;n# #U{# #ɸ# #v# #M# ## #u# #q$ #$ #$ #*$ #Y\?$ #7PL$ #Ic$ #cp$ #2}$ #;$ #>C$ #7P$ #I$ #;$ #7P$ #I$ ##8$ #E% #% #M]*% #7% #N% #O[% #Pr% #+P% #Z% #% #ԡ% #G>% #g% #{% #% #& #z*& #`7& #DlD& #S& #C`& #l& #G=& #u}& #y& #^>& #M& #ټ& # 3& #1& #[' #XT' #T#' #~-' #F:' #2G' #TU' #kb' #_o' #|' #' #j' #;' #' #' #}' #' #( #> ( #g( #G'( #4( #CA( #"uN( #\( #i( #fv( #( #A:( #!y( #d( #( #( #( #Ϗ( #( # ) #>) #Ȣ&) #b3) #=@@) #4M) #a) #&) #y) #g) #{) #J) #) #K* # * #o* #@* #* #3&* #4* #a5B* #zP* #h1l* #{z* #J* #k* #G* #y* #,{* #* #* #* #x* #^ + #}+ #_U%+ #3+ #A+ #hO+ #_]+ #+k+ #gy+ #s+ #~+ #[r+ #n+ #+ #r+ #^+ #K+ # + #2, #d, ##, #|1, #??, #=M, #[, #3i, #w, #@h, #c, #, #@, #S0, #, #, #*, #0b, #>- #-- #s]- #N<-- #6<- #dK- #Y- #%hh- ##v- #у- #z- #- #A- #$- #b- #{- #^- #iv- #@. #+i. #l. #Z,. #V:. #H. #dwV. #Bd. #ۛr. #cY. #B. #l|. #i4. #m. #-. #rf. #A. #q/ #oH/ #;/ #ĦI/ #TX/ #Bf/ #ait/ #A/ #6T/ #Д/ #/ ##/ #=@/ #/ #%g/ #`d/ #p0 #{0 #p(0 #{80 #`H0 #W0 #Ps0 #]0 #50 #L60 #e0 #00 #0 #0 #1 #w1 #Cs,1 #1:1 #GH1 #X1 #~:1 #C1 #ǘ1 #1 #F1 #z1 ##1 #426 #?6 #dfL6 #/?Y6 #f6 #ws6 #GN6 #F6 #6 #iq6 #96 #n6 #=@6 #6 #R6 #!~6 #7 #7 #U 7 #ߞ.7 #BG7 #:U7 #A:c7 #q7 #27 #7 #¸7 #7 #Vs7 #{7 #J7 #ϻ7 #;7 #k 8 #8 #g'8 #58 #rNC8 #Q8 #F_8 #>m8 #{8 #@8 #8 #FS8 #nJ8 #\8 #8 #8 #y8 #8 #Nk9 # 9 #M#9 #119 #3?9 #דM9 #[9 #j5i9 #]w9 #9 #9 #;g9 #$@9 #9 #U9 #q9 #H9 #l9 #: #MI : #53: #IG : #d-: #km:: #G: #tT: #a: #1n: #[{: #: #f: #C0: #p: #pU: #c: #2: #: #Kn: #D; #qC ; #o*; #>I; # ZS; #Cm; #TUw; # C; #25; #r; #h1; #; #ze; #E; #@; #߂; #G`< #o < #ǘ< #z'< #ˆ4< #=@A< #abN< #r[< #h< # Ku< #a< #6< #< #R< # S< #< #lC< #< #5< #E= #= #= #B*= #7= # Q= #~^= #jk= #x= #= #y= #d= #-E= #= #@= #> #H > #L.> #;> #H> #AU> #lCc> #9p> #}> #t> #[> #> #lr> #6{> #0> #<? #=@?? #M? #Z? #b:g? #Nt? #? #̵? #? #UL? #l? #QJ? #? #0^? #^? #°*@ #97@ #D@ #uQ@ #׽^@ #ULk@ #,Hx@ #J@ #@ #@ #@ #T@ #@ #@ #f@ #XA #%3A #N A #-A #:A #GA #TA #ULaA #nA #]o{A #FA #t_A #zA #˶A #8A #A #.[A #`AA #A #2B #B #i7B #>9EB #tB #B #$5B #ǘB #v`B #+dB #r4B #RB #B #bC #C #)C #M6C #MC #YC #eC #́rC #C #iC #c_C #:C #vC #C #tC #eC #3C #EC #;D #3D #FD #K"D #(D #B/D #H #6QH #IhH #H #jH #3H #zH #]H #H #=H #H #+rH #MI #N"I #\/I #=@K #Y\K #uK #K #gHK #[K #ҩK #BK #miK #K #VK #ǍL #"L #FL #XL #fL #:tL #ȱL #KL #b?L #XKL #L #L #L #ϒL #?qL #M #M #7"M #0M #>M #jLM #8gM #2BM #vM #dM #Q:M # M # M #M #WGM #.AM #q?N #KN #_N #}5N #CN #aN #7zN # N #aN #N #N #jFN #(N #N #JUO #O #B!O #/O #2M=O #2KO #)`YO #gO #F7uO #4O # O #OO #AO #;O #aO #ɸO #vJP #,.P #2

X #f Y #Y #Q*Y #M39Y #MHY #WY #7tY #sY #0SY #KY #ҙY #Y #_Y #CY #[Y #^Y #vq Z #pZ #+Z #;Z #pKZ #[Z #Q|vZ #tZ #ѣZ #8Z #ǘZ #5Z #Z #UZ #5a[ #k[ #nH[ #AU[ #~h[ # [ #K[ #֍[ #u[ #[ #([ #I[ #3[ #x5[ #T\ #!p\ #m\ #3+\ #(S8\ #mE\ #ypR\ #_\ #Gl\ #E\ #+8\ #G\ #Y@\ #R\ #\ #l\ #\ #PT] #5~] #a#] #K1] #Lp?] #] #l] # ^ #^ #'n%^ #~3^ #FA^ # O^ #]^ #k^ #Hy^ #8^ #P^ #h^ #\^ #^ #r^ #7^ #B^ #[g_ # _ #l"_ #1_ #[@_ #8V_ #Pe_ #u_ #_ #cu_ #a_ #G_ #s_ #_ #_ #g` #"O` #T ` #T-` # :` #AG` #R1T` #CQa` #|n` #Gz{` #Nw` #[` #` #3` #o` #N` #s` #2`` #Ԟa #a #a #=,a #:a #PHa #Va # da #pra #wa #a #Ra #a #4]a #a #%a #ga #`7a #_a #RY b #zvb #3(b #ʐ6b #'yDb #Sb #bb #H5qb #pb #–b #Fb #Նb #tb #Nb #+Jb #;b #~ob #1c #Fc #o&c #^m5c #Dc #Sc #[Cbc #n1qc #ec #6c #hc #Rc #?]c #A;c #Yc #6c #3d #<d #&d #:5d #Ed #Td #ccd #Ɯxd #zd #asd #de #02qe #%A~e #m[e #e #e #n^e #I(f #S5f #Bf #OOf #'\f # Aif #s2vf #kf #f #ˆf #kwf #]f #f #g #Lg #xg #~,g #@J9g #mFg #Sg #9`g #C4mg #p{g #}g #g #g #$mg #5g #gg #g #:g #g #S h #=@h #km%h #N?h #Lh #2eh #lrh # h #'\h #~kh #Fvh #h #jh #i #ݟ i #fi #2'i #4i #bNi #[i #2hi #1ui #i #GLi #1i #^j #j #S-j #n3j #9j #̨@j #طMj #+dZj #ngj #uj #Ej #j #j #EFj #Nj #j #j #j #k #4Ok #*k #\5Qk #^k #nqk #\~k #;k #>k #wk #wk #xk #k #"l #p/l #`Il #+_l #Âkl #[l #`l #l #nl #gl #\l #;l #>l # m #ym #}1m #:pDm #RNm #B]m #,jm #fwm #ъm #:um #sm #m #[m #6m #m #ӳm #m #i,n #Pn #&^n #xn #n #0_n #Ln #gn #\n #4n #In #n #:\n #;n #Yz o #8o #&o #b3o #~@o #o #o # Po #ёo #B^o #Oo #ڿo #Bpo #o #Po #VNp #sYp #wp #{*p #J7p #ivEp #DDRp #5`p # Bmp #zp #ǘp #p #p #up #tPp #;p # q #;q #דq #EI,q #:q #`Gq #Tq #Zaq #,tnq #7}q #Lq #q #Hq #[q #deq # 8r #K$r #+9r #Er #Zr #zfr #=jsr #r<r #=@r #jr #r # js #s #m"s #(s #w.s #4s #:s #0@s #Ps #^s #\js #8Rws #s #s #Rcs #s #s #<s #s # t #Kt #I(t #^6t #aTt #Z`t #"vt #ײt #~5t #t #t #̡t #gt #+t #|t #at # u #zBu #()u #\j7u #dEu #gSu #Bau #$ou #}u # @u #9u #܀u #u #u #u #u #v # v #v #)v #4Cv #Pv #cv #\qv #|~v #/4v #v #v #v ##v #B|v #v #v #v #lw #0gw #w #j(w #ej5w #=Bw #oOw #\w #Siw #ww #Aw #xw #aw #w #xw #zw #?w #Gw #w #i x #x #%x # 93x #Nx #%x #VIx #Ux #Fx #/1x #lx #x #y #@y #y #Q,y #Ny #my #Ry #dy #Jy #'Fy #}0 z #z #)z #F7z #Ez #Sz # az #m>oz #5}z #z #vz #sz #z #=@z #:5z #z #z #)z #t { #O&{ #L4{ #C{ #~Q{ #p_{ #~{ #{ #{ #PT{ #je{ #?{ #2{ #${ #{ #u{ # | #aF| #Rj'| #p5| #hMC| #YQ| #x_| #Ozm| #dž{| #^| #| #o} #}} #=@} #@} #)4} #|[} #. ~ #~ #HM~ #lL[~ #ji~ #w~ #Pr~ #"G~ #~ #ƙ~ #9~ #r~ #6~ #Q~ #~ # #{ #w #Չ- #M; #GI #ݑW #1e #_ #r #q߀ #β # #$ #x #0݁ #O$ #1 #I #MV #co #_| # #Q #B #Ђ #ނ #֛ # #҂ɉ #׉ #m #s^ #^ #Ԧ #k= #+ #59 #E\G #EU #dc #bq # #7 #R #Q # #Ŋ #Ԋ # #O #P #] #{ #r. #Q= #ɣL #[ #ej #ly #P #͓ #O #: #ԋ # #O #H #7 #dw. #u= #\L #fa #q #0dʌ #rd، #h #Ϣ #B # #2A #9 #x #N #[ #r> #XY # #? #PE #0 #Q #=M( #G2 #t #+ #  #A #dw #i #kΕ #Q:ە #?Z #; #tH #g #1 #> #zK #X #s #*}} #_ # #/ #U # #dw̖ #  #n #=@ #O* #:7 #W #yq #(~ #ˆ #$ #' #( #× #eї #"zߗ #m #3 #1 # #)7% #=3 #1<A #qO #h #ƽ # #U; # #.qØ #И #xݘ #: #Ϗ #Ԍ # #2# #g1 #? #mO #T_ #`o # # #s #' #K #\ # #Mƚ #1Ӛ # # #A% #d2 # ? #OV #}Kb #Fo #H8} #U; #ˆ #I #XK #1Û #qћ #=ߛ #{~ # #q; #I #YW #  #i #2Ɲ #~ӝ # #I #@ #;G #G #[ #k #0 #_Ţ #}ˢ #ҜҢ #E # #km #AH #s #|& #5 #? #@tN #x\ #4k #z #k #4 #w # #ţ #hԣ #+ # #F[ # #A #D* #[8 #rH #<X #h #x # #g # # #ä #tѤ #uߤ #Y #Pa #Di # #+ #J; #K #[ ##k #Q{ #a # #!j # #8ɥ #zmץ # #c # #5 #Q #- #< #K #gZ #ǫy #Ո #  #A # #uƦ #tӦ # #Ƭ #j #p #p #! #. #; # H #U #>o #~ # #} #;? #~Sݧ #^0 #r #f # #y# #` #ym # z # #t #t8 #D # #.aȨ #gը # #p #B #I #p #]# #I0 #= #J #&c #` #} #  #é #aЩ #ݩ #} # #$ #g # #p+ #B8 #]E #IR #ҙ_ #t8x #"Pܪ #K #  #ص #t8 # #EB* #7 #)D ##Q #^ #k #m # #  #ҙ #.a #EB, #` #om #Fz #Ѭ #I #F #Ѭì #uϬ #I۬ #M #ʖ #Fv #i #su% #MC #UZ #Uu # # ^ #L # #bZ #k #ǘϭ #ۭ #ۤ #0 #Ʌ #x< #R #^& #h3 #\@ #M #|^[ #Dw #J #  #k #Xή #=@3 #@ #M #e #{ # #5\ï #<Я #f # #z #*x #Ml% #E2 #m? #ϧb #9xo # #eL # Z #\h #{v # #5 ##?³ #oڳ #~ # #n$ #2 #V8@ #oO #8` #%f #ӝl #]Or #Ny #D #eg # #j #| # #0 #_ʹ #۴ # #Z #3u # # #x=0 # 6 #Yc< #B #H #N #IT #-[ #6l #KMr #X9x #z # #- # #< #ͯ #P #<͵ #Q۵ # # #@ #N=* #I #̘S #Q` # m #z #f #M #6 #{ #dw #tȶ #Aն # # #6w #o) #06 #_C #=@[ #_e #$kt # #18 #η # cԷ #ڷ #с #{ #fB #ŗ" #Թ/ #r< #I #RV #ac #p #} #> #Z; #w #; #6< #DR˸ #{uظ #Y # #n #o #$ #?= #ݍP #f] #Mj #m2w #z> #J #gW # d #vq #~ #ǘ #Ec #h #^0 #v» #3л #;޻ # #n #oD #j #$ #z> #GL #Y #}f #Frs #Z # #SS #_x #w #Sü #Hм #O #>3 #~ #= #" #F+ #"8 #1P #Fq] #}j #vx #S #\Ƚ #ێս #aS #e #N #i #d #;p #} #w #* #f #} #ˆ #=@; #Jھ #b\ #~d #  # #  # # #Z #J #: #Zw #ף #g #qt # #n # # #i #Ϳ # #c #|Pp #>} # #\ #7r #P #Q #\ #w #8A #> # #B- #xY; #eI #9W #pe #\s # #4 #5C #ܒ #\ #a #\ #w #b # #. #5C< #BJ #X #ʳf # t #=@ # #i #2 # #Ly #1 #]^ # #_6 #O? #S #e #(# #MK #2X #yN| #= #h~ #$ # #ט # | #8D #Lb # #ˆ& #F #!{d #֛ #9 #G #װ #s # #< # # #B #Y4 #4' #6 #E #T #5Cc #ʳr #  # #߰ #k} #\h #E3 #  #7 #^ #~ # #+ #H;; #hL #^[ #֛x #qz #  #1 #Vm #7 #G #Q # #1Q #L # #, #; #IJ #Y #ih #w #M #l #F #l #ga #` #WP # #2L #qg #=u #9 #p #K #xY #a # #9 # #Bb #B #4 #- #5C; #eW #f #*pt #Vm #us #\ #I # #q #ڧ #| #- # # #7 #:* #o8 #noF #T #lb #p #F~ # ##H #_ # # #2 #lC #9 #p! #`T #Rea #H| #c # f # #? #H #R6+ #cG #ŷ^ #Rj #O # #{ # #6 # #D #3 #VB #P3 #ժT #p #? #[ # #27 #e # # #/ #LH #v_ #Ew #a # #eQ #x # #m #Ri #r #Y( #I # df #n #O #yj #Pf #^ #ݫ #P{ ## &;9 %= %pM %Q % _ %.c %,h #2n jw # ! # `! #/  &< &< %? %; &<  &+< %U %S$ . &+<; %g? %cH %L %Q &+<Z j t   ` 09   % %   &;< %ņ %Æ" 7 X rb r %׆ %Ն z   % %    % % 3 = &K<N %R % W &K<` %+d %%m w &g< %L %H %f %b &g< %~ %| % % % % &y< % %   &< %އ %܇ +, <E %I %S h] hv %z % %  %  % % %- %+ %B %: %b %` h %s %o p &< % % L( &<9 %= %F %ĈJ %S %ވW %ڈ` Lj L % % F F % % % % ^ `0 c >1 &<> kS &<` %#d %!m kw &< %5 %1 %d %` &<    * ` `9 d /  ? {I {f %j %o    % %   &< % %   - rE ] {{   9    . ! 9 #Ծe #o 0!y # ` #X # #f &B1 % % % % # $ #% `$. #/; I S &X1d %h %q %/u %+~ %E %C %T %R &X1 %h %d % %| % % &h1 % %  &{1 %Ί %Ȋ ` &1' %+ %4 %8 %A %E %N `X `u %1y %/  &1 %@ %> %O %M  `0   H H1 O nd .q $ s # # # # #=8 #AE #S #O[ #h #j| #  %b %\ #h1 % % % % % % &; #e % % %$ #`, N %R %W #` &z;i #v   # &; #  &; %D %@ %s %o &;    . ; 9J T &;e %i %n &;w %{ % % % % % # &; % % # # %* %& # # %B %>& %Z* %V/ (H 3R 3h %ql %ou %y %~ 7  % %  % % H &; % % % % g+ g@ %͍D %ɍL d      #QpO #eb #eq #e #< &i: % % %* % %v %d # %Ȏ %Ž #/ % % %] %U" %& %5 %9 %I %M %Џ] %Ua %Oo %s %nx #O~  # " &: #w d   d  #w d  ,  9 d D &:M #[ #jf %j %s } &: % % %. %, %D %> %u %s % % &:   % % % % ( &:1 #e< %@ %F &:O #eZ %Ǒ^ %őd &:m #ex %ؑ| %ԑ &: #e % % + # % % #j %! % < # " #/ % : #eE %CI %AO d #eo %Ts %Py  #e %n %j  # % % #j % %  &"; # @ -* #4 &4;= #H %L %U -_ &4;l %p %y %/} %+ &4;     @ 8 &: #  k # &;) #4 %L8 %JA kK &;X %^\ %Ze %i %n &;w      @8 U #e % %  #e % %" &F;+ #e6 %ȓ: %ƓE #R @"[ #/h r  # %ٓ %Փ   #e % % &V; #   # &h;' #2 % 6 %? I &h;V %Z %c %Jg %Fl &h;u # # # F  8 # " #/   / %g3 %e< Q g 0q 0 %v %t 0 3    & & +0 : S e qo q v   % % % % % %   ; ;- k7 kK g  q       k: S ` > I ( f z  i# 82 M 8W !l .y " & a . " f  . " < #CF  h %l %| %` %N # % % %ٕ %ѕ % % #O  &A7 # #j %6 %. E  : %Y> %WG %hK %fP e    #p &<0 % %u # ! &R0 %Ö %" 7 #eB %F %Q #^ !g #/t   &t0 %  %    % %   %) %' %: %6 , 6 L %QP %OY %`] %^f ~    > . ! C  $ %o( %m1 Y #!c ` % % #h %˗ %ŗ % % # &9 %3 %/  #T^ %I %G  #O` %Z$ %X+ @ #T^M b #O`m %jq %h{    &9 %z %x   & :   + 5 M W &:l &):y %} %  &): % % &):  % 0   % %! 7 A _ x i i %͘ %˘ v v %ܘ %ژ ~  &9: % % 3 = V d q ~   7  {   &I: ## x, A #K &Y:T #_ %c %l v &Y: % % %G %C &Y: = = = Y x 7 i  i% i/ &9B ] 7m  #<{ # #e #^   % %b #= %# % ( #+3 %w7 %kG %ʚK %Y %D] %8k &t #z    &h9 %w %u   &x9 % % % %  58 B &9S %W %\  u K K %ԛ %қ S _ _ % % g { {. %2 %; %? %D e  &9 &9 % % %= %5  % %  % %     4 %Ϝ8 %͜= V 5` &9q %u %ߜz B   % %  0 &9 % %  = - E ]  |   [ u   . O n  #` #F &8 %; %' #9 % % #p %  %/ %e3 %W8 #C %G %L #V P#_ &8h #u ~  #Z &8 # % %  &8 % %  %> %: &8   " >3 @ 07W &9k %io %Y % %  #e % %  #e % % #  # #/  &99 #e" %G& %?0 : W %m[ %k` y   % %}   % %   % % % % %( 02 0H %ŠL %àU %ԠY %Ҡb 4z Y Y % % a z z % %   &X9' % + %0 H a k   r   P  .) P#: H ` u #  %3 %# #= % %{ % % #2 > # &w8 #P  7 #A& &8/ #: %ҡ> %СG 7Q &8^ %b %k %o %t &8} s s s   6 &8 %2 %. ! &8 %J %F f8 *B *_ %`c %^h 2}  ! L  / / %r %p 7  > >1 %5 %: FS Z] Zz %~ % b  &8 % % %Ģ % %ޢ %ڢ   %  % < <? % C % L %P %U Tp `0 Y    %, %*   ]  A "b >o     # &W7 %T  %< #9 %ӣ  %ɣ% #p0 %4 %9 #=D %iH %CM #`X %\ %l %op %e~ % % # p( #2  &n7 #F  ) # &7 # %Υ %̥ ) &7 %# %ܥ, %0 % 5 &7> N X l >}  /  # ' #/  # ' #/  &7 #0 X - #7 &7@ #K %,O %*X b &7o %>s %:| %m %i &7     X x6 &8 #     #) &182 #= %A %J T &18a %e %n %˦r %Ǧw &18       6 # ( #/  #! @(* #/7 E O &7` %d %i    % %   &7 % %   j &7# %)' %%0 %C4 %?= %]A %YJ jT jq %uu %s  &7 % % % %  `0    6 %: %? X b & 8s %w % %Ч %̧ % %   % % + + % % %&  %$ E, `0< JJ #l "v " %8 %6 * 5 5 %G %E = _ &C8 %X %T& %r* %n3 %7 %@ _J _g %k %u O O % % %Ȩ %ƨ i `0 n w  &U8- %ܨ1 %ب6 {O Y &g8j %n %s      ; ; k k   * B Z t f    ) G 5e Q    L   1 .# p(4 6A aV .c p(t f  . p(   . p( ! #ʰ!! #t.! #BH! #R! x&h! #u! ! #! #! #Ǜ! &e2! %! % ! #t! %p! %b! %! %! #=! %! %" #9" %<" %0" #p"" %x&" %n6" %ê:" %?" #J" %SN" %=S" #\" #ob" k" &{2t" #l" " " #]" &2" #" %" %" " &2" %˫" %ǫ" %" %" &2# # # .# ?# L# 01c# &2l# #w# %{# %# ?# ?# %1# %/# N# N# N# %C# %A$ %R$ %P $ q#$ q-$ &2>$ %aB$ %_G$ ~]$ }$ $ $ %s$ %q$ $ $ &2$ %$ %% $% $$% &25% %9% %>% &2K% %O% %٬X% %G\% %;e% %ui% %sr% /% u% &2% %% %% u% u% %% %% u% u% %% %& % & %& })& 3& I& %˭M& %ɭV& %ڭZ& %حc& {& /& /& %& %& 9& 9& %& %& &3& % & %' &!3' p)' &336' %:' %C' pM' &33Z' %+^' %'g' %Zk' %Vp' &33y' ' ' ' E' ' h1' &E3' %y' %u' ' ( %( %( 9( C( `( %d( %i( ( ( ( ( x( x( ( ) ) .") P&8) JB) &U3S) %W) %\) Yt) ) Y) &g3) %ծ) %Ѯ) %) %) |) ) |) &y3 * % * %* +* D* N* k* %'o* %%t* * %* %* %6* %4* 4* \* &3* %J* %F* a+ ++ 5+ R+ %hV+ %f[+ t+ !~+ &3+ %z+ %x+ ++ + + %+ %+ + , !, %%, %*, C, )M, )j, %n, %s, 1, *, H, 1,  , - s4- D- ~b- z- !- - - 1- - - . +. F. 02P. $k. h2u. @. 2. #V}. . %د. %. #@. %X. %H. %. %. %/ %ڰ/ #/ / # / #&/ // N/ %R/ %c/ &1l/ #ew/ %/{/ %+/ "/ / #E/ p/ / #/ / #0 %F0 %D 0 0 00 %V40 %T=0 %nA0 %lJ0 Y0 c0 w0 0 p0 00 ,0 &10 %~0 %|0 %0 %0 %0 %0 %0 %0 &10 %ű0 %1 %1 %ޱ1 %1 %1 ,41 %81 %=1 1W1 &"1`1 %d1 % m1 &0v1 #B~1 81 +1 #1 &01 #1 %,1 %*1 +1 &01 %>1 %:1 %m1 %i1 &02 2 2 02 A2 8N2 00Y2 Bn2 #y2 %}2 %2 #j2 %2 %2 B2 B2 %2 %2 %2 %2 B2 %2 %2 B3 B 3 %/$3 %--3 %@13 %>73 XY3 c3 &0t3 %Rx3 %N}3 3 :3 :3 %n3 %l3 B3 3 4 % 4 %~4 (4 24 O4 %S4 %\4 %`4 %e4 }4 4 4 4 &214 %4 %4 4 {5 #1v(5 &4>5 %׳B5 %ɳR5 %"V5 %[5 #Bf5 %~j5 %Jz5 %~5 %a5 #5 %۶5 %5 #`5 %·5 %5 #:K5 %p5 %P5 #3@5 % 5 %5 #I5 %ʹ5 %5 #5 %`5 %@5 #96 % 6 %6 #p6 %6 %ֻ-6 %16 %@6 % D6 %I6 #T6 %pX6 %d]6 #h6 %l6 %q6 #1|6 %?6 %6 #6 %6 #6 `6 #A6 6 #6 6 #o6 6 #6 $6 #/6 0 7 #7 $!7 #/.7 (87 &!5A7 #N7 W7 l7 #v7 &357 #7 %7 %߾7 7 &357 %7 %7 %7 %7 &357 (7 (7 (7 ` 8 8 2$8 &E5-8 #e88 %A<8 %7A8 X8 &U5a8 ##n8 w8 8 #Z8 &g58 #8 %l8 %j8 8 &g58 %~8 %z8 %8 %8 &g58 E8 E9 E9 f,9 99 @3D9 & 6M9 #0Z9 hc9 x9 #9 &69 #9 %ʿ9 %ȿ9 9 &69 %ܿ9 %ؿ9 % 9 %9 &69 k9 k9 k: : h%: 30: &z49: #eD: %.H: %&M: Gd: &4m: #Rz: 0: : #x: &4: #: %R: %P: : &4: %d: %`: %: %: &4:  ; ; '; 98; 0E; 3P; &6Y; #f; o; ; #; &6; #; %; %; ; &6; %; %; %; %; &6; ; ; < $< 1< 3<< &6E< #|R< [< p< #z< & 7< #< %< %< < & 7< %< %< %F< %B< & 7< < $< $< == =  4(= &61= #2>= G= \= #f= &6o= #z= %`~= %^= = &6= %r= %n= %= %= &6= = = = =  > h4> #&>  %/> #/<>  F> &K6O> #H\> Pe> xz> #> &]6> #> %> %> x> &]6> %> %> %> %> &]6> @> @> @ ? m? P'? H5A? &o6J? #^W? `? u? #Ƈ? &6? #? %? %? ? &6? %.? %*? %]? %Y? &6? ? ? @ @ "@  -@ &y56@ #C@ L@ a@ #yk@ &5t@ #@ %z@ %x@ @ &5@ %@ %@ %@ %@ &5@ @ @ @ 9A A 5(A &61A #/>A GA \A #fA &6oA #zA %~A %A A &6A %A %A %A %A &6A A A A /A  B 5B #&B `%/B #/C %XGC /QC /jC %lnC %jwC %|{C %zC /C /C /C %C %C %C %C ED QD %D %&D %*D %3D X=D XVD %$ZD %"cD %3gD %1lD eD qD &64D %GD %CD %dD %`D %D %}D &P4D %D %D xD &e4E %E % E %E %E %E %'E L KL eL oL &5L %<L %8L %VL %RL %pL %lL L L %L %L L M % M %M %M %M 9M `0KM YM |M M M %M %M M M %M %M  M N  N *N %.N %3N NN WXN &16iN %mN %rN \N N  N &7N % N % N N N  O %O %O %,O %*!O 7:O 7DO 7aO %;eO %9jO ?O O O O O O &/7O xO xO P 0P JP RbP P P P 4P ?P @6 Q 'Q AQ }[Q uQ Q Q aQ Q 1R QR pR R R R @S %S CS 9bS S US S S 5T %T @T 6ST nT 4xT T .T %T T T .T %T T ; U .U %+U @8U MU .ZU %kU xU U .U %U U #2U U %SU %KU %U %yV #9 V %V %V #pV %#V %(V #`3V %!7V %W #pW %W %W #`W %W %W #@W %=W %3W #tX %zX %n X #X &$X #1X &:X #/GX 8QX &0ZX #CgX HpX X #YX &,0X #X %X %X X &,0X %X %X %X %X &,0X X Y Y %Y H2Y @/CY XY #cY % gY %lY #jwY %/{Y %#Y Y Y %`Y %^Y %qY %oY Y %Y %Y Y  Z %Z %Z %Z %!Z CZ #MZ #jZ %nZ %wZ %{Z %Z 3Z >Z FZ Z Z  [  [ .-[ &>[ L[ #ڄv[ #(|[ &/[ %[ %[ %t[ %f[ #[ #[ #[ #[ #/[ @[ \ &/\ %\ %\ 5\ ?\ \\ %`\ %i\ %m\ %v\ \ \ %\ %\ %\ %\ %\ %\ \ \ %"\ % \ %1\ %/\ %@] %> ] %Q] %M] 8] O] Y] v] %hz] %f] ] &/] %] %u] /] K] ] ^ ; ^ "^ ./^ #@^ c^ #^ #U^ #^ #^ P&^ #e^ #e^ #-^ _ #_ ##_ #e2_ #?_  &H_ #/U_ H`_ #Sj_ _ %_ %_ %_ %_ #`_ %H_ %4_ %_ %_ #_ %_ %_ %/_ %_ #_ #O` )` &1` #$` -` B` #L` &1U` #`` %d` %m` w` &1` %` %` %` %` &1` G` G` G` n` ` 0a a # a %$a %)a #j4a %-8a %#Aa Ka &12Xa %X\a %Vea %jia %hra %va %a a &12a %a %a %a %a a &A2a #a a a #b &S2 b #b %b %#b -b &S2:b %>b %Gb %Kb %Pb &S2Yb ib sb b b b 0b b &1b %$b %b %Eb %Ab %ab %]b &1c %c %xc %c %c %c %.c 8c &1Ic %Mc %Wc &2dc %hc %qc %"uc %~c c &!2c %Cc %Ac %Uc %Sc %oc %mc c &!2c %c %c %c %c d /d Id wdd wd d d d d  d  d %d %e e *%e *Be %Fe %Ke 2`e ~e e 1e e 0e #De f % f %f #=f % f %.f %"2f %7f #@f &0If #6Vf (_f |tf #&U~f &0f #f |f &0f %Bf %>f %qf %mf &0f f f f g (g /*g 4g &0Eg %Ig %Rg %Vg %_g ig g %g %g &0g &0g %g %g 4g %g %g @h %#h %!h $h /.h @h MJh Mch %2gh %0ph Mzh Mh %Ah %?h Mh Mh %Ph %Nh %ah %]h Uh `h `i %xi %vi %#i %,i dAi #pki #ui  !i #yi `i #Ui #i #8i #i #ѣi #4 j #ej #e-j #e #jD #J #$P #)5V #0\ #&b #6h #'n #Ot #| #9 #X^ #V # #dž #iԆ #B # #;4 #a7 #Sd #B' #25 #cC #'^Q #_ #m #>T{ #0K #J #~W #7 #L #gχ #k<݇ #Z # #| #f@ #9O #^ #1n #>1} #s #V #1 # #Ɉ #؈ #  #% #\ #*/ #<# #2 #A #3P #-_ #zn #?} #I #> #i # #ȉ #׉ #-[ #$ # #U6 #9" #1 #60@ #OO #j@^ #Dm #Z| # #B #_ #@NJ ##֊ #i #2 # f #e #! #~Z0 #d@ #x2P #O` #p #i  #F5 #q_ #T #O #Ћ #O #IE #Q # # #L0 #@ #.kO #9m #| # #g # #6 #nj #;֌ #.0 #L #? #|  #S! #60 #? ##N #'] #l #{ #  # #*2 #l #"ƍ #DՍ #O #3 #[I #: # #)+0 #S? #2*N #] #El #{ #` #j #;k # # Ԏ # #[ #OD # #i #r. #?;= #AL #pj[ #5j #y # #th #CU # #Rď #[`ӏ #WQ #L ## #5 #b #- #< #K #8Z #V2i #x # # # # #Ð #Ґ #o  #3 #l #&A #( #W, #&; # %J #Y #h #w # #I? #  #"c #>‘ #["ё #% #|1 #4 # #U #+ #:: #I #%X #bg #-v # #H #B #  #F #~QВ # #O #a #NJ #  #+ #U: #JI #0X #2g #v #= #C #:b # #A7“ #{fѓ #k( #. #? #T #Qb #+ #a: #I #QX #?g #jv # # #8 #= #  #Д #$Iߔ #v # # # #hU* #D9 # X #g #9v #V. # #$ #"V #k #.Е #ߕ #d #Q  #CJ # #T+ #; #"GK #R[ #j #1"y #& #S # #| #qD #[# # #0@ #L #\gX #e #t # # # #i #З #6ޗ #" #`/ # # #G$ #'2 #l@ #7N #:j\ #fj #0Cx #g # # #  #, #k+͘ # ܘ # # #" #6 #81" #FC0 #5> #L #Z #6\h #v #% #m[ #?5 #> #&Ι #+ݙ #? #. #I #]; #(( #G #V #e #t #.i #D #W # #` #Κ #$ݚ #2! # # # #( #ZW7 #`F # U #0d #hs #$ #L #D # # #͛ #^kܛ #< # # #y4 #' #+6 #JE #t T #c # _r #A #R # #( #-& #^̜ #mTۜ # # #A #7 #& # 3 #=S #] #?j #[ #2 #>) #+ϝ # ܝ #sF #U #M # #" # / #V< #I #W # #]˞ #ڞ # #bR #=  # #n/- #)P #J\ #j #y # #$/ş #7ҟ #F #= # #~ #_4& #E5 #kj #/x #C # #w8 #%C # #ڠ #I #A # #qa #" #?0 #&T> # L #/t #* #9 #!  #Ρ #Y #  # # #%! #/ #,> #>L #deZ #h #v #' # #H #+R #D #Tʢ # #s #pj #x  #37F #2Z #mo #.:| #D # #@<ȣ #֣ #: #y% #? #  #| #:/ #& #,3 #f=@ #0M #(Z #Hg #t #e1 # # #R #:Ȥ #֤ # #h #E # #' #c4 #A #UN #l] #l # #@ #G # #4 #{ #k1 #J٥ # #%B # # #% #:W2 #s? #;L #FY #  #( # #cΦ #[ܦ #l #= #< # #" #M0 #> #L #qZ #h #;v #? # #f #2 #E #ʧ #2ا #, #Q #  #a #Y #", #,: #p]H #VV #d #r #g #;Q #Z # #iǨ #m7ͨ #,Ԩ # #R #  #: # #& #;X, #&2 # 8 #9> #D #PXJ #5PP #V #;D\ #c2b #h # %n #>t #'Nz #* #c # #J # #Qǩ #"ԩ # #6 #F$ #D #3" #]0 #@ #}`F #SL #R\ #v # #* #yW # #Ū # Ҫ #`ߪ # #b #j% # #b5 #WB #U #(l #Z y #U #^C # #b #d #a&ͫ #1,٫ # #9 #i, #E"9 #T #S #^ #l:ά #4Xܬ # #U # #@B #So #^| #C #zb # #02 #b # #YT #*$ #;^ #ͯ # #gi2 #? #=L #*Y #kf #A #T #* #U #!U, #P9 #R #"_ #l # #: #1 #ɱ # # #\ # #5 #qE #(<R #e` #9m #{ #&) #i # ( #='Ʋ #1Բ # # #N # #90 #@ #N #\ #oEj #R #%> #\ #i #E³ # г # ޳ #?R # # # (P #U #_ #Sdl #y #[ #;^ # #B #ɴ #7 #" #= #> #R #kD_ #B s #& #| # #> # #m'̵ #ڵ # #zM # #s #P!% #3 #bA #O #qI] #^k #y # #; #2@ #& #g #,˶ #ٶ # # #37 #/ #l #4 #4B #gS #1G_ #Ak #x # #? # # # #5Ʒ #Է #d # #, #AO #97 #{CC #hP #*^ #Sk #=x # # ( #$ # #D #Mȸ #7lո # # # #  #: #$ # '1 #KI #QAV #:i #hv #QA #Gd #%L #M #KBŹ #ҹ # ! #" #R # #E #l9 #F #4T #7 ` #wl #-x # #k #P #, #  #ź #vGҺ #D # # # #b #_! #. #l; #H #cU #c #Mp #} #x@ #\ # #ǻ #ͻ #]ӻ #Hٻ #߻ #% #K  #H #) #0) #J #+ #a8 #ZE #NR #` #m #{ #( #) #QA # #  #R #4μ #ܼ #( #c # # #' #* #Q #! ^ #k #x #W #* #P #1b #̽ #dXٽ #a #( #c ## #[`0 #f= #P[J #?X #b #Oo #c| #, #a #{ #E #yW #! #: #0 #( #+: #UG #HS #5?` # u # #* # #  #` #׿ # #* #` # #*" #/ #h< #XSS #` #Im #>+ # # # #$ #%M #A # # # #0 #Z< #Z` #m #Y z #@ #> #(\ # #~ # # # #x[ # #K+ #v9 #M #)Y #c #/p #} # ##  #  #N #f #  # #/6 #Q # #29) #a6 #)C #P #b9] #:j #aw #] #` #5 # #ag # #O #. #tV #)+ #i/ #/' #R'5 #UB #O #A\ # i #v # # #i #7T # # # #,, #>= #`C #4I #UO #MU #z\ #*2j #x # # # # #  #Z #e #\ #N #B #ti" #20 #? #:M #[ #T i #%*w # # #* #4 #7 # # # #g& #. # #j! #>2/ #OI= #K #D3Y #Fg #iu #S #  # #Va #d #; #! # # #W #vc #YA #+ #9 #(G ##U #c #r # #+ #I #V3 ## # #;\ #k< #aB #9! # #< #* #r8 #4 F #+ T #/b #"$p #'a~ # #* #; # #* # # #  #" # #k<) #/T7 #.K #*q #E #: # #j  #v, # #3 #- #V3 # #d #, #. #{> #9N #h^ #1n #3~ #=H # #\ #z # # #  #2 #=d+ #P: #T #rb #p #~ #$l # # #7 #  # # #G= #* #8 #F #1VT #cb # Wp #C~ # #v #e) #0$ # # # # P #T #D #E* #7 #,D #^ #k #Bx #C #  # #'^ #NK #d #D #_" #-/ #k< #I #KV #Ec #sp #} #1e # #= #l # # #k #^c #B # #R+ #'^8 #5L #&f #^cs #k #B #  #7 #( # # #) #` #W" #, #g6 #OD@ #N #N>[ #h #!u #z # #T # # # #2 # #  # \ # #) # #"/ #G(< #QI #0V #>d #f} # # #P #l #zd #kW #! # # # #nZ% #*3 # A #FO #] #"k #Dy #-a #K #[I #: #C #!2 # #  #( #f  #2 #! #o / #W = #eK #MY #g #Su # 3 #F # #v #b #=> #B # #3^ #E # #PL$ #CU. #9_8 #B #L #V #c # p #IR} #> #, #B # #@ #G # #Z # # # #k #|2 #)L #V #` #O # ## # # # # # #'a # # # #"# #6 #F!C #7P #0] # (j #w # #/ #D # #|E #>L #$f #d # #a # #nd #Z* #j47 #OD #{_Q #\` #Xm #" # #  #c` #'b #] # # #; #$ #9=7 #C #d #{aq #nd~ #a # #" #i/ # #b #0c # #f #O* # #7 #u #< #L # #b #, #T #;, # #  # #i/ # #fM% #O` #tm #,z #c #c\ # # #& #b$ #c #P # #J1 #`" #/ #< #I #V #,c #u(p #@} #;, # #f # #~ # #7 #U #g #C # # #13( #6 #i/D #/m #{ #1 #j # #7 # #d # # #.>$ #d; #[H #.>_ #l8l #.> #8 #yS #! #=I #[ # #V # #U% ## #) #[/ #5 #=< #NL #cIR #zAX #^0^ #de #ar # #P # # #  #  # # #G #a #+ #c8 #XE #gR #_ #7y # # #= #  #bD #bD # #, #E # #7 #D #SQ #k #x #, #~ #R #D #h9 #&] # #R #nd # ( #( # #9, #(9 #gF #S #y?` #)m #z #. #K #_? #, #7 #b #F #' #A #O* #V6 #s L #X #9t #& #e #& #  # #QU # #X #e #_S$ #c1 #lK #vGX #e #r #=# #l #i # # #, #- #A; #Or #e # # #& # #, #~ #_4 #= #N. #< #UJ #X #6Ff #t #N #/ #N #& # #H #G #v  #  #3& #-I #/X #*K| #,l #R #3 #P #+ # # # E #` #_ #2 #( #I2< #A(J #X #Mf #pSt #  #b # # #H # #" #U #, # #( #6 #pD #MR #k #3y #B #1 #=C # #6 #de #6 #f #O$- #; #aI #kW #3e #s # # #S # #* #" #$ #6 #i # #yW0 #K #cd #r #` #` # # # # # #Z # #XF! # / #+= #*/K #Y #g #8u #e # #< #98 #f #%" #X # #yK #l3 # #P# #92 #A #P #L;_ #n #} # # ] # # #W #OQ # # # #&" #Z1 #Q@ #O #)^ # Um #l| #B #_  # #4a #\O #b #P5 #(W #  # #! #eZ0 #L? # N #G] #\ # #' #  #{ # #' #m #. #a< #=f #k*u #S # # #5 #H] # B #\' #K# # #C #b #P #iH #ET # #>9 #9 #  #CQ #$ # 1 #A > #cK #$X #e #Hs #Z # #% #R #nd #+ #E #E #0 # #MU #4a #ko #$} #W #( #8 # #"J # / #" #3 #Ig # #! #[ #O #! #/. #; #BI #k;V #7c #d@ #, #E # #  #6 #- #' #"< #H #-c #o # d{ #PG # ! #$ # # # #E  #F # #/ # #A #^$ #08 #E #j #y #C #?? #0  #x# # #R #@ # # # #z #' ##5 #c C #PPQ #3A_ #F\m #{ # 8 #? # #>  #Ul #2 #X # # #d #) #D# #I1 #X? #xM #pN[ #mi #7w #b # #Q #b #v0 #  #5 #cN #eK # #FH. #>E #T #,c #r # #2 # I #uJ # # #_ #S1 # # #  #?( #5 #tB #O #gVg #$v #5 # #- # #> #T_ #J #z #M # #3 #'J #s, #B: #6H #`JV #hgd #r #8 #h # # #+ # # #@E #!0 #U #5 #1B #+ #~8: #5I #y;Y #W&h #4w # # #jA # #aF # #@ #  #W #G # #+ #: #LI #X #g #v # # #fF # #P #K # #K: #Z # #;2 #DB #H #9& #+ #8 #E #3>R #D%y # # ! #) #& #f #% ## #0 #9W #E~ # ( # #V #E #, #X # a #, # #1 #>c #0 #' #5 #.B #c\ #t i #h v #` ## #;S # #A #[7 # #  #vG # E # # , #"9 #F # | #l #Vi #6$ #FK # ? # # #E. # #;- #" #_/ #,= #W #_j #- #4 #v #4 #Ca #G #V #d #! #nd/ #O #8%\ #Q.i #w #' #P #> #I/ #'^ # #a #  #.< #6+ #8 #6E #ZS #h #FVu # #nd #= #i # #z/ #"% #?; #G #sQ] #6j #?w # #6 #Z #O # #+ # #)U #> #V<$ #1 #U*> #uK #X #{^r #yK # #G #R #'^ #  #4  #U> #,2 #jk? #L #hZ #h #Av #W #} #e # #g # #K #; #' # #:9 #]F #S #1` #m #yz #r^ # #+ #'! #( # # # # # # #y #' #=4 #7G #)T #!a #2n #Q #2 #! # # 3 # #= # #* #i #[( #f>7 #Q #k^ #k #Jx #j # #R #U #{+ #( #@ #F - # _ #m # | #D% #  #]  #  #A #A #G #P # #cc #-& #$ # 1 #5> #:K #n #GFx #J #- #)e #] #2 #e #c #|9 #r6 #X0 #Q< #%I #UV #Pc #@| # #87 # #C #H # #_ #e  #lL #h  #} #Y,) #J7 #E #S # a #4o #N%~ #Uc #S ## #_ #P #\1 # #<  #0 #+ #8 #E #ajR #*_ #5l #0y #a #+ #,F #P #  #7 #c #  #n  # #`  #V #d# # &1 #I7? #]M #[ #.i #&Z} # #n> #  #@[ #  # 4 #= # #L #&Z #h #v # # #7 #_ #1 #V #d #` #s #  #Z # #< # # #" #> #\ #$ #X  #! #&) #7 #"E #S #b #qPp #~ # #eY # 7 #+ #$ # #X #&; #  #? #0'8 #l`F #kT #b #pp #V~ #Y #V #)= #@ #K #- #[  #: # #aL  #X #' #I&5 #'C #ZQ # H) #I 7 #E #`S #a # #VG #! # #  # # #e1 #? #M #/[ #8i #jw #AV #jC # #G #O # # #O) # # #*1 # #qL # #F #Q #- #c # #f # #8 #! #S #JP) #6 #Jcc #p #} #I #0 # ; # #l # #E #; #p #c  #G. #]< #J #qX #Uf #Jt # #F # ; #" # # Y # #Z #I #C # #" #7* #][8 #VF #T #'Xb #{ # ` #^ #y #` # #  #R #, # #D #)E #H<, #: # (H #AV #Id #r #5 #k #7 #xj #8 # # #zD #*Y  #O #( #16 #Y\ #j #x # #Jc # #R #< # #_ #e[ #6: # #hQ #Z= # T. #I_< #qJ #X #Df #"t #3 #O # #~ # #a #t #H #,! #{G"! #0E,! #x@! #1J! #ET! #b! #o! #|! # (! #~! #/! #e! #! #! #! #! #! #L" #<" #"!" #/" #>`=" #$K" #UY" #g" #?u" #"" #P" #*" #" #'" #E" #" #xb" #T8" ## #Y# ## #k+# #RV9# #PG# #|<U# #c# #6q# #nV# #c# #*# #~@# ## #G# #K"# ### ## #B$ #N$ #mO$$ #- 3$ #}B$ #3Q$ #0`$ #Zo$ #l$ #-&$ #$ #d$ #?N$ #$ #$ #h% #% #E% #i% #% #% #A>& #fz& #NL' ##' #~=( #[( # )+ #+ #H+ #;, #=;, #t:L, #R, #X, #-d - #- #q<- # .. #S;. #"H. #aU. #b. # o. # . #. #. #. #3. #. #K. #L. #/ #6/ #Q.-/ #H7/ #D/ #+?R/ #Z_/ #El/ #Py/ #/ #"/ #6/ #/ #f/ #Z/ #U0 #>+0 #f80 # (E0 #,MS0 ##a0 #fo0 #E}0 #50 #`0 #K0 #-0 #0 #F0 #0 #0 #0 # 1 #<"1 #R\A1 #FM1 #Z1 #l"d1 #r}1 #R1 #[1 #Z1 #/1 #",1 #x1 #1 #<1 #F1 #  2 #2 #)3 #193 # 1?3 #E3 #V@L3 #Y3 #f3 #Os3 #\3 # 3 #"d3 #eT3 #(3 #>3 #"3 #f4 #4 #S)4 #74 #E4 # (S4 #ea4 #o4 #}4 #4 #4 #4 #<4 #5 #^U6 #^6 #Sf6 # s6 #6 #6 #6 #6 #6 #E6 #^U6 #6 #O6 #=6 #L ~7 #7 #a7 #E7 #7 #8 #V8 #?8 #")8 #}8 #U8 #-88 ##8 #EB8 #j8 #8 #%(8 # 9 #)9 #e69 #uZC9 #P9 #k]9 #8Mj9 #w9 #=9 #9 #9 #9 #P=9 #9 #|9 #Q : #: #/(: #!6: #EBE: #T: #Nc: #]: #: #,: #: #GM: #5: #W: #: #: #j; #i6; #&; #5; #TD; #!a; ##p; #; #o=; #8; #E; #B; #e; ##; #T; #; #< #@< #&(< #8< #!H< #p^< #k< #xy< #< #G'< # < #< #< #< #?$< #4&< #2< #= #= #= #:-= #g;= #I= # jW= #jbe= #0s= # [= #= #X= # e= #2= #= #h= #Y> #&> #dE> #_8#> #)> #g0> #0A> #RG> #fM> #w5S> #Y> #<`> #on> #,|> # > #> #.j> #1> #]l> #N> #o> # > #WD> #$? # ? #&? #5? #GWD? #iS? #\b? #kq? #Fi? #? #,? #a? #? #? #,? #? #6? #C@ #]@ #&@ #75@ #PkC@ #i/Q@ #%_@ #9m@ #B{@ #@ #M @ #1@ #4@ #,@ #~#@ #me@ #j@ #. A #bA #D)A #* 9A #OIA #xWA # eA #b_sA #A #KeA #A #A #j0A #_dA #/A #A #JB #3(B #"-B #a:B #,GB #9TB #aB #PknB #K{B # B #B #.B #0JB #VB #JB #ilB #6B #fB #P C #L!C #/EC #OC #HkC #yC #JC #kC #`]C #3C #~C #C #"D #t`D #J"D #/D #cL #E+HL #SUL #bL #^oL #S|L #PL # NL #c(M #xB9M #$?M #EM #XKM #RM # nM #~M #M #M #XM #,M # (M #aM #_M #/M #sd N # N #YN #,cN #%|N #NN #_GN #N #zeN #_N #sN #mMN #"N #N #O #ndO #66O #PO #DhO #IxO #>O #BO #EO #O #O #,O #MHO #<O #IP #kP #P #lP #T$P #)*P #1P #??P #sMP #[P #1iP #;^xP #hJP #nP #ndP #$P #P #EP #P #r!P #gP #,P #QNP #fP #hP #Q #Q # Q #H-Q #Q$Q #<*Q #]1Q #N?Q #MQ ##P[Q #%iQ #?Q #0Q #LQ #Q #(Q #7Q #pQ #"Q #8R #R #"R #^H/R #H_ #^E_ #YR_ #9__ #5l_ #_ #o_ #_ #/_ #_ #_ #_ #9_ #5` #5` #"` #0` #V>` #AL` #Z` #$h` #>v` #` #2` #` #` #` #` #<` #j# a #Ea #(a #56a #e]Da #}RRa #"`a #na #Aa #=a #0a #Rja #za #~a #]:a #UMb #b #K8b #SFb #^b #u-lb #8zb #7b # b #b #b #Ecb # (b #Zc #Q c # ;>c #VMc #\c #Okc #zc #;c #c #Jc #j#c #5c #c #>c #/c #Rd #Ed #d #}R.d #"=d #ILd #O[d #tjd #yd #d #5Hd #dd #d #jd #e]d #Jd #d #e #Ze # ;4e #Ce #XRe #8ae # pe #le #e #/e #Je #e #\e #Se #7ie #wke #f #*Hf # $f #'3f #Bf # Qf #"`f #tLof #~f #&f #4f #f #nGf #Jf #f #jf #Hg #Kg #"g #*1g #yO@g #Og #b5^g #mg #Ec|g #g #cg # g #%g #qKg #c*g #,g #b<h # .h # h #U?/h #>h #6 Mh #\h #kh #zh ##h #@h #h #+h #ih #Lh #"h #Gh #Di #ji #ji #).i #e=i #cLi #9[i #3ji #Fyi #oi #i #TRi ##i #i # i #ji #x j #kj #v3:j #Ij #9Wj #qgfj #[_uj #u=j #j #8j #Sj #SKj #ej #:j #j #Wj #_3k #k #I"k #0k #= >k #8]Lk #\PZk #:hk #vk #,k #k #k #l #j#l #S1l #V?l #AMl #%\l #kl #l #/;l #Vl ##'l #l #5l #>l #Ll #l #m #Q.,m #:m # Hm #Vm #cdm #krm ##m #m #Gm #+Sm #E6m #Lm #vUm #m #mm #2m # n #Kjn # (n #u)6n #"Dn #"@Rn #`n #\|n #'n #&_n #8n #jn #o #8o #6Oo #uo #*o #.o #x*o #o #To # p # *p #I0=p #*Pp #:qp #;p #p #y6p #Up #Jq ##Fq # 4q #ITq #kq #q #q #kq #q #[ q #ar #Br #^&r #/r #Kr #Nlr #Er # r #r #Br #r #s #ss #k5s #KMs #Jis #SBs #'s #8's #Ss #t #i"t #3t #.:t #lFt #7Yt #kt #7zt #7t #7t #7t #7t #5t #7t #7u #d u #D u #73u #7Fu #7Yu #7lu #7u #7u #7u #7u #7u #7u #7u #7 v #=v &jC,v %0v %{5v #@v %Dv %Tv %Xv %gv %tkv %jpv #"vv Gv #Kv #v "v #v "v & Hv #^v v "v #iv &Hv #8v %v %w "w &Hw % w %)w %-w %2w &H;w 5&Kw 5&Uw 5&iw a&zw w Dw rw &Cw %w %w &Cw %7w %/w &Cw %fw %^w rw &Cx % x %x %x %!x %%x %.x r8x &CEx %Ix %Rx %Vx %_x &Cnx rxx rx %x %x %x %x ~x x &Cx %x %x % x %y %1y %/y %1y %/y %1"y %/'y &C6y -Gy r iy sy &Cy %Ay %?y y y y &Cy %Py %Ny y z z &C*z %_.z %]7z Lz bz lz &C}z %nz %lz z z z &Cz %}z %{z z { ( { Q*{ &D;{ %?{ %H{ %L{ %U{ %?Y{ %7^{ &Dg{ %k{ %gt{ %_x{ %G{ %{ %{ %{ %{ %{ %{ %'{ %#{ +{ { &ID{ %G{ %={ %{ %}{ Q| &YD | %| %| %| %'| %+| %4| Q>| &YDK| %O| %X| %\| %a| V}| &iD| | &~D| %| %| | &~D| %| %| %.| %*| &~D| ~| ~ } ~} .} ;} h>P} Z} &Dk} %eo} %I}} %} %} %}} %a} &D} %} %} %a} %G} %} %} %} %} %w} %G} %F} %*} %} %} %} %~ #~ ~ 8~ %<~ %F~ &DS~ h~ &Du~ %y~ %~ ~ &D~ %&~ %"~ %U~ %Q~ &D~ ~ ~ ~ ~ @ > &E& %t* %p/ 9!J @?Z A!r , > f- ? n-     % % &E% %) %. V I AY )t A + @ ?+π XA n  &4E % %   &SE1 %5 %> %!B %K %:O %8X %O\ %Ia &SEj %sn %ow   &fE % % % % % % &fE % %ˁ   % % % %     &|E- %1 %: %3> %/G  Q &E] %Ma %Ij %en %aw %{ %{   &E % % % % % % &Eʂ %΂ %ӂ   ! &E !2 &E? %C %L !V &Ec %g % p %:t %6y &E v) ) ) ) ΃ A ( &E %X %R %{ %u % %# &E0 %4 %C (\ %` %i (s ( % % %7 %5 %7 %5 )Ȅ ( .) W) g). M*F z0a x?q 0 ? 0 0Ņ  ҅  0 0 (@' \*1 &EG %JK %FT %eX %_] &Ef %j %s & F \* &F % % \* &FƆ %ʆ %ӆ %׆ %܆ &F * * * *$ 1 X@O ^*Y &*Fj %n %w %{ % % % &*F %2 %. ^* %H %FŇ %Xɇ %V· o* * &@F %i %e % %} *% &VF1 %5 %> %B %K %O %X *b &iFr %v % % % % % &iF %3 %/ *ш *  - OK i  #ʉ e( (8 (S >] )x @ * A * , A 1G Q j |   %J %H %[ %Y %j %hʋ ԋ  % % % % % %  &|F0 %4 %= %A %F &|FS %CW %;` %xd %jm %q %z ~1 %0 %.  %H %BČ )(ߌ  :( E-" B, r1G HBQ -f  p J pB ~1    э &Fލ %f %d &F %w %s [ %$ %. 8 U %Y %b l   % %  # M!Ύ %Ҏ %܎ o! % % |! % %* !C %G %Q !j %n %x ! % % ! &F %( %Ǐ %ˏ %}Џ &Fُ %ݏ % %Q %K % %s % % %R %H % %' %+ %4 %8 %A %E %N %bR %F[ %_ %h  -u % % / " &G % %Ő "ϐ " %  %  &6G % % &FG" %C& %'/ /$9 /$R 4$d $ $ &G $ x% k%ґ %֑ %ܑ $ _% %'  1 %L [ V 'q hC l+ HC +  C˒ + = +   ,0 p : -U  _ -z  /  /ē  Γ _0  .1   L1/ B> ,&W %[ %e &~ % % &G % % &G %: %6 &˔ &Gؔ & & +$  7 Z/R  \ o/w  /  /  ˕ /   0   "0,  ; 'T %RX %Pb &Go %es %_| % % , &G % % % % % %ǖ ,і &Gޖ % % % % #, -/ -H %L %V -o %s %} - %5 %3 . %D %B˗ . %S %Q 7. %b %` F.2 %q6 %o@ ^.Y %] %~g m. % % . % % $˘ % C % %% %2 #&L &f &~ w' ' k,Ι , !- C )-# -= -J -W -o . . /  /ښ C %/ -/ E//  9 @0T Cg 1 1 " " %ě %͛ &"כ " % % +" 3" r> Y  c }  ? O ? G"˜ R؜ " " "8 "P "h  #u 1 #F #)ĝ #dѝ #D #2- #% #Se #<l #Kv * #IS #d #D #^ ƞ #hў #8 #7 #7 #7 #71 #7D #7W #7j #7} #7 #7 #K  ؟ %ܟ % %* % #PF % % %P %L& %h* %d/ &S=8 #7C %G %}M &c=V #7a %e %k &=t #7 % % &= #7 % % &= #7 % %Š &=Π #7٠ %ݠ % &= #7 % %  &> #7 % % &<>( #73 %27 %*= &L>F #7Q %UU %S[ &o>d #7o %ds %by &> #7 %y %q &> #7 % % &> #7ɡ %͡ %ӡ &>ܡ #7 % % &> #7 % % S  &s=. %2 %; S E S ] % a %j S t S  % % %* %& X  d ¢ d ڢ %Aޢ %? %P %N h  v  &=' %_+ %]4 %n8 %l=  O  Y &=j %}n %{w     % %    ̣ %У %٣ %ݣ %       % %# %' %0  H  R &=c %g %p %t %y   ?  & > % % ?  ? դ %٤ %  ?  ?  % % %. %* D 0 P : P R %EV %C_ %Tc %Rl T  b  &,> %c %a %r %p q ǥ  ѥ &\> % %     % %  (  D %H %Q %U %Z  l  v   % % % %    ʦ &>ۦ %ߦ % % %   +  &> %" %+ + 5 + M %Q %Z + d +  %! % %2 %. 0  <  < ʧ %IΧ %Gק %Xۧ %V @  N  &> %g %e$ %v( %t- ] ;  I  b  } #;K  % % % % #˨ %Ϩ %ߨ % % #* % %  &= #7 %& %$ ( E %5I %3R %FV %B_ i  %] %[ %l %j %} %y  Ω %ҩ %۩ %ߩ % % % % % $ ; E &"=V %Z %c %g %l  $ #\Ъ #oBݪ #+ #K ( #* ( #?' 6 #7I #*W )` #?n } #7 #* @) #? x֫ # #S #7( #'5 #8'[ #Jh #Vu #rW #K ) #k #^ @ #hǬ #8۬ #/ #A #a #V #o8 #VE #S_ #Ef #Kp )~ #4U #* ) #? ҭ #}ݭ  % % %V %N& %* %|: %> %C # N %R %W #K` &4Ci #7t %Qx %I~ &GC #]   #[h &ZCŮ #8Ю %uԮ %sݮ  &ZC % % % % &ZC # - A R _ =j &Bs #7~ % % &B #7 % % &C #] xů  گ #zT &C #8 % %   &C % %) %- %2 &C; TK TU Ti |z x 8> &$C #7 %7 %1   &Bϰ %VӰ %Rܰ   q &B %x %l$ %( %- &B6 %: %C %G %P ] |v % z %  %F  %@  | &B %c  %a  %w  %s  % ű % α |ر &B %  %  %  %   9 ` x * ! >ɲ Ӳ  %  %    % # % , 6 R % V % _ % c % h    %+  %)  %:  %8  ׳   %I  %G   - %X 1 %V : D ` %g d %e m %x q %t v    %  %  % ´ % ˴ ߴ  ^  #A #Sg #2t #| #d #D # ǵ % ˵ % ڵ % ޵ %  #K &B #]   #Bh* &B3 #8E O &B\ % ` % i %7 m %3 r &B{     Ƕ =Ҷ   # ^ 0C #VR #Ec 9m &dBz %T ~ %R  %c  %a  %r  %p  &dB %  %  %  % Ƿ % ˷ % Է &tB #c  %  %  #V" % & % + #E; f u # &A %1  %'  %z  %f  #S %  % ϸ %( Ӹ % ظ #V %i  %]  #J %  %  %  %  #V % # %( #A3 %G7 %A< #G %pK %jZ %^ %n %r % % % # %" % #K &A #] XŹ ڹ #h &A #8 %h %f  &A %z %v) %- %2 &A; K U i z X < &A #*9 %º %Ǻ &Bк #7ۺ %ߺ % &B #    #)h# &/B, #87 %4; %2D N &/B[ %F_ %Bh %ul %qq &/Bz    G  ƻ =ѻ  ) /K   h= ڼ   &A % % % %( %2, %&5 %}9 %q> &AK %O %b l  % % % % % % ܽ   %/ %-  / = N <[ *q {  %> %<  &AB %Mž %Kξ %^Ҿ %\۾ %m߾ %k &AB % %|  % % % %% A IK &TB\ %` %i %m %v %z %  hƿ ٿ #y] @ %  % % %# #S. %o2 %O7 #VB %F %V %Z %j %n %s #~ %7 %! #J % %} #j %, %" #2 %q %] % % #' % % #  % % #K #VE  #E & &EA/ #[< E Z #d &VAm #8x %| %  &VA % % % % &VA      : &A! #v\. p7 }L #fV &A_ #8j %n %w } &A %1 %- %` %\ &A    3 p ; &@ #\ 8) > #gH &@Q #8\ %}` %{i s &@ % % % % &@      8 ; &fA #+O  0 #: &xAC #8N %R %[ e &xAr %v % % % &xA    >  ; &@ #\  W" #0g, &@5 #8@ %9D %7M WW &@d %Kh %Gq %zu %vz &@ b b b   < &$A #\   #g &5A' #82 %6 %? I &5AV %Z %c %g %l &5Au : : : ]  X<   % % % % % %$ %%( %#1 %45 %2: _ 9i 9 %C %A > > %R %P G O   %a %_ % B %pF %nO Y r %v %}{      9  ; U Yp `; v : # #V #S #V #E #K * #*" *+ #?9 E #zQ s %w %| #V % % %a %W #S % % #5 % % #V #> #  &2= #q % %! w=  G c  m    /  9   ## #S- #VS #K] p)g #[t  #bf #8 #  #S #K ) #[ % #If0 #8A # L m %Cq %+v #S % % #V %H %@ #A % %n % % #/ %S  %;  # %  %  #K &@ # ! 6 #? &@I #8R % V % _ i &@u % y %  %! %! &@ ? K K f  : &+@ #  # #, &=@6 #8? %0!C %.!L V &=@b %B!f %>!o %n!s %j!x &=@ o { {   @: &? #[ P Q #0f &?# #8, %!0 %!9 QC &?O %!S %!\ %!` %!e &?n ~   6 P x: Z Z %! %! %! %! % " %" %+" %!"( Z= %["A %U"J %~"N %z"S kn x &? %" %" %" %"  & @ %" %" %" %" %" %"  &@ %" %" %# %# %# %# &@% %+#) %'#. T k u &O@ %B# %@# %S# %O#  &b@ %i# %g# %x# %v# %# %#  &r@ %# %# %# %# %# %# &r@ %#" %#' M b #E #( #S #d #D  #( #V #E, #H #VT #` #E # #K X* #7 #d #D #f.  #e #8   $ 9K #+] #Vk # #S # #K + #* * #?  #s #'# #KO. #'< #>[ #rh #' #d #D #d #D #*D #' #4U #" #6B #T # (a #o # # ( # # #^ # ( #  # #' # #|E #1" #"/ # (< #$I #V #"Jc #r # #m # # #` # # # #) # # #; #a' #3 #a@ #CL #WX #7e #+o # # #^i # # #W #7 #p #Z #a #W* #78 #AU #Wa #7z #Q/ # #> #W #_ #G # # #F #G # # #/* # (7 #X4D #.QV #5Ye #MYt #M #sY #Y #Y # #Y #5Z #MZ #X #R #: #T #9 #8F #-^Y # k #N,| #e # l # l # l # l # #C: # #RS. &?= %#A %#J %.$N %$$W %`$[ %X$l &? %$ %$   &? %$ %$ %$ %$ %$ %$   &? %$ %$ %$ %$ &?    1 %%5 %%> %!%B %%H - j &.?w %7%{ %/% %h% %`% A  &>? %% %% %% %% I  N  &N? %% %% %% %% %& %%! &c?* %&&. % &7 U A &x?R %L&V %F&_ %r&c %l&l %r&p %l&y        % : O a { h      %& %& %& %& %H' %<' %' %' %' %' %?( %3( %t( %n( &?3  L %(P %(Y %(] %(f  p   %( %( %( %( %) % )     %!) %) %2) %0)   %H) %B)    5 %j)9 %h)B %{)F %y)L  o : y &? %) %) %) %) %) %) &? c  &? %) %) c  &? %) %) %) %) &?"  2  <  P Z p  %* %* %5* %/* %W* %Q* %u* %s* &@ %* %*  %* %* %* %* %' #X+ #3 #7 #D }xI #N $^R $^V &Hb !Ni #  #  #{q #{ # #8 #ޒ #u # # #̾ #w # #x# #|( #6 #t # # #ֿ #x #f #R #` # #, # #] #4u) #< #C #!H #^T #` #9l #x #l # # # #dr # #Ry #K # # #q # #ݪ #I% #1 #"= #I #U #=a #Enm #;y #s #  # # #` # # # # # #n #C+ #@8 #E #m #sz # #~ #" # #֩ # # # # #, #9 #xG #:sc # q ## #d #v~ #m # # #9 # # #e #z #ݳ #' #{5 #ԟC #Q #߾` #`o #m} #ao ## #& # # #. #C #' # # #[ #4 #C #R #Ra #=p # # # #- # # # #% #R # #% #4 #͂C #8R #vua #4p # #{ # #n # # # # # # # #H$ #3 #cB #oQ #O~` #o #~ #e #x # #? # # # #Q # # ## #r2 #A #P #_ # n #z #r #c # # # #Z # m # # #5. #߼K #FX #we #Vr #' #@ #r #S #U # #o # #e # # # #, #: #3H #V #d #*r #{ # # # # # # #8 #Q #1 #  #ʝ #_( #a #p # #3 # #c #  #V # #n # #E #R #F& #=5 #ЇD #RS #b #kq #; #͚ #&o #~ # #K #y #r #tr #d #ܸ #[% #4 #C #R #a #2p #Ŷ #F # # #  #? #p #ʷ # #  #.$ #3 #B #Q #a #q # # # # # # # # # #c #S! #1 #rA #Q # ua #p # # #y| #=p # # #| # # #+ #$ #3 #inB #EQ #o` #vo #i~ # #P # #Z # #So #0 # #l #E #"# #2 #HvA #Q #=` #Žo #~ # #ڦ #q # # #kp #6 #p #K #i" #S1 #1@ #<O #^ #Nm #| #~ #ە #؅ #p # # #c # #& # #! #K0 #q? #ƃN #] #`l #{ # #ڃ #" #  #3 #l #@~ #} # #3 #I #/ #> #lM #\ #k #hz #ٓ #, # # # #l #j # # #= # #{. #Q= #)L # [ #j #ȹy #S{ #* # # # #< #l #M #g #Oz # #. #Dz= #tL #)[ #j #y #Ƭ # #G #  # # # #R #( # # #. #= #SL #{[ #:j #y #f # #Wq #s # #i #g #-v # # #b #fo- #< #K #Z #2y # # # #݀ # #{ # # # #  # #- #I< #L #n\ #l #| # # #* #" # #Lj #" #/ #< #I #.V #4d #r #% #: #z #1 #  # #r: #] #4i #)w #) #Hr #7 #Z # #- #{ #% #3 #B #/w # #t # # #o #3 #} # # # # #|/ #em= #K #6Y # #Ϋ # # #' #& #/ #ڊ #  #w. #~< #YK #yY #g #3u #V # #v # # # # #m} #Ip # #% #S #g #| #$ # # # #n # #S #X #9  #DŽ* #4 #+> #_I #LQ #SY #Πf #t #M #)w #D #, # # #0 #{ #& #w #Y1 #~? #YM #ul[ #3i #m # # #' # # # # #| # #{ #H+ #1 #n7 #= #@D #,Q #lk #mx # #y # #{ # # #y # #G #% #{L #K_ #m #9{ # # #n #y #% # #: #9 #)x # #F ## #~1 #]? #M #[ #֪i #Dw #C # # #Y # # # #' #w #+ #" #  #- #<B #{O #\ #{vi #ulv #{ #I # #r # # #x #2 #~ #7+ #s8 ##E #HR #_ #`l #1 # #r #  #&q #P} # #C # # #( #a# #M0 #”n #ȩ~ # #r # # #{ #. # #-u #ٖ #G # #Ӟ* #U= #=J #ӞW #Us # #r # #ã #< # #Ӟ #U # #B  #P #)x$ #1 #/j #w #m #  # #Y  #s #r( #C #K|Q #@ #  # #f #g #{ # #y #\p #U #qb #8 #  #( #p #!z} # #q # #= #AB #qO #\ #i #tv #p # #/ #w #. #L # #J% #?m4 #[C #~R #0}q #m # #Τ #~ #© #Ǽ #9 #ݻ # #L #+ #m; #K #[ #k #\p{ #3 # #{ # # #l #9 #ن #{  #@ #- #: #G #ݻ #s # # #{ #s #8 #| #v # # #  # # # #J) #7 #ѼA #GN #Ћ\ #i # # #ߢ #Ά # #  #1 #9 #n #L # # , #9 #G #T #yb #p #!} # # #^ #| #f #y #} # # #m #x # #8 #E #}R #z_ #y # # # # #z #F # # #{  # #$ #1 #_? #AR #p #| #j #o # # # #I #{ #w #ێ #4 #@ #oL #] #{i #z #A # # # ## #S #H #o #d #i~ ##$ #S1 #dH ##U #Sb #*to #x| # #Е # # # # # #ָ #| #% #z1 #= #I #_ #| #~ # # # #~ # #y #A # #z #C #P #to] #anj #yx # # #K # #ao #S # # #R #: #` #r& #3 #@ #Z #Oh #~nu #Ϋ # #- # #ݻ #~ # #vy #/ #  #K! #! #!! #.! #~;! #H! #%V! #c! #p! #~! #Hv! #ڮ! #! #! #! #m! #1! #%! #)" #z" #k " #]-" #{:" #aqG" #q" #q~" #߉" #H{" #z" #q" #T" #n" #q" #h" #q" #D # #L-# #(P# #\# #Zj# #x# #P# #D# ## ## ## ## #G# #Pp# ## #q# ## #m $ #$ #P'$ #6$ #D$ #3R$ #l`$ #n$ # }$ #$ #E$ #$ #$ #$ #ʴ$ #$ #Ÿ$ #̗$ #5 % #&% #&% #B5% #D% #-R% #H`% #n% #|% #% #% #% #% #% #% #A% #y% #)% #ap& #& #$& #\2& #H@& #R|N& #m\& #j& #x& #& #ܙ& #z& #H& #& #Fx& #r& #& #v& #' #' ##' #*1' # ?' #1M' #[' #i' #w' #' #3' #5|' #' #Ȣ' #x' #<' #' #' #L( #( #4( #L>( #xL( #pZ( #.h( #6v( #W( #1( #( #( #( #( #( #}) #.) #!) #/) #=) #eK) #Y) #{g) #w) #) #) #) #) #) #o) #Ә) #) #* #/ * #7r.* #r=* #ќg* #[mu* #}* #n* #* #O* #<* #-n* #݁* #W* #v+ #(+ #<+ #2D+ #S+ #ٯw+ # + #(+ #+ #+ #+ #c+ #\+ #+ #V+ #z+ # , #J, #{), #v7, #ZE, #S, #Qa, #?, #ێ, #3, #D, #Ҋ, #, #, #d, #}- #&- #P3- #F- #S- #*z- #- #N- #- # - #- # - #- #- #r- #- #z . #b. #]v#. #w0. #դ=. #ΰJ. #"W. #d. #q. #+~. #K. #C. #*. #6. #. #. #/ #8/ #{E/ #R/ #@_/ #ml/ #{/ #:/ #q/ #/ #/ #b/ #i/ #m/ #/ #p/ #0 #I 0 #z0 #w'0 #40 #pA0 #N0 #[0 #h0 #uu0 #0 #{0 #0 #ڋ0 #ܲ0 #0 #0 #Ǝ0 #0 #1 #$v1 #Hv$1 #21 #So@1 #N1 #j1 #޵x1 #O1 #1 #P1 #1 #E1 #1 #1 #Z1 #01 #2 #2 #[ 2 #".2 #<2 #|J2 #X2 #،f2 #܄t2 #w2 #ܴ2 #V2 #22 #2 #2 #2 #ه2 #n2 #3 #3 #3 #q*3 #I83 #F3 #T3 #h3 #{u3 #03 #ێ3 #ݧ3 #3 #3 #3 #ڃ3 #o3 # 3 #33 #3 #4 #4 #D"4 #Xn/4 #<4 #WI4 #h\4 #lk4 #au4 #4 #04 #ao4 #o4 #4 #Q4 #~4 #)4 #Oz 5 #5 #L.5 #85 #5~B5 #qL5 #Y5 #mf5 #s5 #5 #5 #p|5 #5 #_5 #5 #5 #5 #ݻ5 #{6 #6 #6 #)6 #]66 #I6 #S6 #F]6 # g6 #q6 #]s~6 #6 #@6 #r{6 #6 #6 #B6 #sz6 #6 # 6 #7 #77 #87 #,7 #97 #yF7 #S7 #`7 #m7 #z7 #D7 #7 #@7 #7 # 7 #7 #7 #ێ7 #97 #n 8 #L8 #Ρ$8 # 18 #>8 # K8 #ƥX8 #e8 #Cs8 #;8 #8 #8 #D8 #ێ8 # 8 #9 #*9 #|79 #J9 ##f9 #gr9 #|9 #9 #=9 #*9 #z9 #o9 #q9 #9 #9 #9 #p : #: #&: #զ3: #\@: #bM: #da: #2tn: #: #{: #: #: #͢: #: #: #: #; #+; #Ц ; #Ό.; #D<; #zP; #^; #'l; #?z; #; #; #N; #E; #r; # z; #; #[; #s; #< #< #"< #0< #>< #L< #9Z< #th< #|v< #< #U< #< #]< #s< #< #1< #J< #V= #= # = #6= #E= # U= #Uk= #Bz= #= #= #= #L= #= #= #= #> #' > #> #)}'> #m4> #A> #?N> #[> #h> #u> #> #> #> #> #> #J> #> #> #:> #y ? #Y? #Ɗ(? #]6? #D? #R? #֬`? #n? #|? #? #? #? #? #? #s? # ? #y? #D? #Z@ # @ #$@ #3@ #B@ #qQ@ #`@ #Vo@ #'@ #8@ #3@ #ވ@ #@ # @ #@ #D@ #@ #A #A #$A #3A #~BA #nQA #`A #roA #~A #NjA #•A #9wA #9A #IA #}oA #xA #>B #vB #G%B #4B #YCB #XB #hhB #ZnB #DC #nQC #|^C # kC #xC #C #C #zD #D #!D #Ӟ.D #UM #KM #|YM #gM #nuM #mM #M #EuM #M #?M #qN #N #&N #2N #pHN #xUN #bN #yN #N #N #N #N #N #N #N # O #?O #)O #v6O #CO #(QO #aO #gO #1pmO #sO #wzO #$pO #*O #O #2O #O #O #mO #O #O #O #O #P #YP #l@P #qMP #ZP #~gP #tP #P #ZP #=P #P #>P #uP #SQ #эQ #|Q #|(Q #lt5Q #DBQ #ێOQ #ao\Q #sQ #Q #JQ #0Q #{Q #DQ #Q #NQ # Q #Q #R #"~ R #NR #'R #ݻAR #oNR #n[R #vhR #uR #<R #pR # R #R #ΈR #R # R #R #R #qR #}S #uS #61S #E>S #fS #ArS #ܣS #zS #S #S #S #S #PT #o T #T #.T #ET #yRT #`T #UmT #T #PT #rT #{T #iT #9T # U #s U #\,U #RU #iU #EwU #U #U #U #{U #U #zV #V #$V #BV #-[V #iV #wV #V #wV #!V #ݚV #ɒV #V #V #W #W #W #},W #:EW #RSW #*aW #mW #W #W #_W #YW #vW #W #X #{X #X #%+X # 9X #QGX #UX #}cX #wX #X #sX #8X #1X #X #tX #m}X #X #S Y #XvY ##*Y #H8Y #DGY #UY #|cY #'{qY #Y #Y #pY #TY #Y #sY #Y #bZ #3Z #=Z #FKZ #~YZ #igZ #uZ # Z #Z #eZ #{Z #nZ #AZ #jZ #QsZ #>Z ##[ #˸[ #|[ #w@[ #N[ #j[ #[ #[ #ao[ #F[ #^[ #m[ #)[ #\ #o\ #x!\ #=\ #wK\ #;Y\ #gg\ #zu\ #=\ #t\ #\ #s\ #\ #\ #\ #^\ #\ #~] #] #] #.] # =] #vL] #([] #j] #y] #] #] #] #m] #=v] #] #m] #^ #+^ #^ #o-^ #-~<^ #3K^ #Z^ #i^ #x^ #{^ #^ #^ #9^ #+^ #ȣ^ #^ #^ #V^ #S{_ #_ #y,_ #э;_ #wJ_ #Y_ #h_ #w_ #Q_ #u_ #_ #_ #_ #S_ #` #w` #@1` #{a` #{o` #-` #\` #` #fw` #ʀ` # ` #` #~` #/` #w` #ߍ` #` # ` #` #0a # a #a #['a #'4a #Aa #Na #[a #'ha #ua #Ka #a #a #<a #a #a #a #Pa #a # b #yb #ao#b #0b #+Jb #Wb #aodb #unqb #Db #b #unb # c #?c #>)c #/c #5c #k #Jk #ͻ_k #(kk #xk #Vxk #{k #hk #k #Š l #Ӵl #g3l #@l #xMl #[l #vxhl #ێul #l #9{l #wl #l #l #&m #*m # m #m #m #Kmm #/m #=m #gIm #Vm #.cm #pm #m #2m #bm #m #Zm #m #m #n #&n #3n #?n #Un #lan #qnn ##{n #n #zn #n #n #ٱn #n #n #}n #o #o #$o #2o #~@o #ʿNo #P\o #{jo #uxo #o #o #!o #o #3o #o #o #o #o #}p"p #v/p #Bp #rPp #]p #pjp #wp #p #!p #Up #Np #hp #p #p #Kp #p #p #vq #q #x!q #.q #;q #,Hq #Vq #dq #ӳrq #[q #q #q #q #q #~q #wq #xq #q #r #ur #qr #r #r #kr #r #mr #r #{r #~r #hr #r #C s #s #as #(s #s # s #s #/ms #Ӷs #t #`t #$t #2t #<@t #,zNt #Qr\t #jt #Lxt #t #`t #{t #qt #Kt #`t # t #Ȫt #u #Fu #"u #S0u #3>u #]u #ku ##yu #u #u #Lu #fu #1u #u #u #1u #=u # v #v #"v #0v #]>v #Lv #*Zv #ehv #vv #Mw #[w #{iw #,|ww #pw #/w #0w #'w #z+x #9x #Gx #Ux #zcx #$qx #'x #x #ux #x #x #yx #x #0x #x #zx # y #Py #'y #5y #5nCy #py #Ҩy #@z #cz #Nz #z #z #m{ #ȉ| #| #'| #߇4| #9M| #Z| #| #| #~| #q| #| #| #| #9| #ao } #ێ} #'} #a{6} #(D} #sR} #m`} #n} #Ě|} #} #l} #ŗ} #} #} #|} #} #} #} #~ #x~ #T$~ #q2~ #!@~ #oN~ #\~ #j~ #̓x~ #f~ #r~ #~ #~ #~ #8~ #~ #*~ #Y~ #D  #v% #3 #CB #P #m^ #ݻl #z #ݬ # #e #  # # # #| #8 #! #@0 #> #/L #rZ #%| # # #k # #ƀ #VԀ #} #[ # # #, #( #76 # D #R #` #n #| #T #D # #7 #| #Ё #DZށ #L # ~ # #p7 #UF #JP #d #n #vx # #r #{ #ݻ #p #ǂ #Ղ #p #% #b #u # #) #d7 ##E #zS #a #4o #.} #n #?z # # #jà #Öу #߃ # #&y # # #% #y3 #>A #șO #] #sk #By # # # # # #Є #߄ # # # # #;* #9 #gH #W #f #u #n # #9 #Ѕ #ى߅ #T #` # #p #P* #r? # i # # #ӆ #rb #} #p # #ua #Nމ #, # #a #Q7 #_ #ap #v #l| #^/ # #7 #R #_ ##l #Fy # # # #Xv #*ȏ #ww׏ ## #g #! # #ѯ) #6 #Q # [ #Hh #v #l #ێ # # ##ϐ #ܐ #{ # # ##5 #ɮO #~\ #ݻi #w #  #~ # #a # #ˑ #ّ #n # #Hs #y #)x #- #F #"e #q #Mw~ # #l #Y #N #ɒ #1ג # # #ao #W # #r- #Z= #3M #] #c #i #p #<} #r #: # #"n #S # #| #0 ## #4 #΅@ #cM #Ot[ #Mwi #ݻw # # #n #ԧ #y # ˕ #ٕ # #' #ْ5 #R # #ao # # #[ї #ޗ # # #x #ų # # #[ #A #ɘ # #% #|m2 #_? ##L # #ݢ # # #Ǟ #|) #6 ##O #F\ #Di #ݫv # # #J # # #-ģ #ѣ #ޣ # # # #fz #. #C #g #{q # #m #< # #Ť #`Ӥ # #I ##* #7 #)D #{tQ # ^ #k #x #  # # # ~ #C #ƥ #ӥ # # #n #c #? #L ##f #9s #m #o #~ #^ #M #  #Φ #ۦ # ~ # # #  #{t( # #5 ## #2 #{t #{ͧ #}ڧ #= # # # # # # ## # ¨ #Ϩ #}ܨ # #J #* #U= #J #W #Us #ȫ # #l #^ # #LƩ #Rթ #` #ێ #% #41 #w= #J #V #Mb #p # #  #N #jm #1 #\x #Kɪ #֪ #˟ #B # #̖ #0 #= ##d #{q #3~ #{ # # #] #ݰ/ #V #֔s #fx #y #? # #Ȭ #լ # #S # # #9 #{R #` #j #w #Mw #ْ #R # #[ #KJ #[ #"a #g #m #Zt # #y #K # #0ʮ #=خ #ݻ # # #3 #. #yB #{ #p #d # #9˯ #~ۯ # #a #x # ## #r # & #? #qX #zr # #b #HŰ #Ӱ # #]t #i #t # # #k! #( #9 #;? #^E #K #R #z` #ln #>| # #8 # # #ı #α #3y߱ #2 # #̵ # #R #r # #s #! #_u' #. #? #E #K #xR #` #n #'| # #u # #|Ų # yٲ # #! #S ## #( #h5 #IB #%O #j\ #i # v #| #| # # #P׳ #l #> #{ #I #ġ" #e/ #8t[ #ok #q #Qw #~ #B #} #/ #̴ #ٴ # # #v #Ͻ # #z' #Rw4 #eA #&N #.x[ #h #Zu # # # #3 #ؽ #{ڵ # #) #I #n #4۷ # # ## #y #} #3 #8 #E #mR #y_ #Ipm #w{ # #p # # #: #۸ # # # #p # #+ #8 #E #R #K` #cm # #o #\ #ly #% #qȹ #չ #n # # #y #f/ #Ke #r # #[ # #p # #w # #( #5 #yB #O #ݻ\ #{j #0w # #͛ #F #V #\ #nb #h #|n #xu #v # #U #{ #ŧ #6 #e #cs # #= #b #_ # # #Y #( #6 #D #`~R #}` #n #:| ## #{ #= #ao # # #/ #= #K #,Y #} #c # # #ݻ # #a # #a #- #< #K #Z #xi #?x # #} #p #p # #m # #`~ #: ## # #, #7; #:J #oY #h #x #ޖ #' # #Y #@w #l #4 # #ɯ ## #Nn2 #A #sP #_ #n #?} # # #w # # #f # # # #. #p" #v1 #@ #>O #^ #Cm #8 #H #q # # # # #q #X #s # #/ #t> #M #{\ #Kk #z # # # #N #( #X # # #j #Ӣ #- #< #K #vZ #i #~x #U #c #n #| # #Э #1 #m #: # #Jo #t, #}; #J #aY #́h ##w # #{ #F # #) # # #Z #( #7 #F #;U #kd #s # # #H # # #5 # # # #G # # #K+ #>9 #G #ۗU #fc #n # #o # # #v# #: #? 05` %*d %*s %*w %* #4 # # + #zl  5  5# #( 04I %+M %+\ %5+` %/+s #4 # # + #zl  4 m 4 # ( %Y+, %S+; %~+? %x+R #4` #n #z , #zl  1 _ F #l 3 %+ %+ #Ԗ #ݻ %+ %+( %+, %+2 #7 4X %,\ %,a 5y D #Xy &}H %0, %*, # %], %S, &H # %, %, # %, %, u xD #z 29 %,= %,B #aL %)-P %%-_ %K-c %A-r %-v %s- %- %- %- %- 2 # # % . %. 2 &gH #ݻ %6. %2. -3 -3# 231 3] V3x #U &RH %T. %J. %. %. #y %. %. %./ %(/ # p, # @, #zl ! k* k> S HD` p,o  #­ #h #M #Y #ul #I # # ## #?2 #?A #?L #?Y # ] # j p #u $gy $g} &K !ձ #- #@ #u #W #u #X #" #m #5z #Z #\W #6 #/\B #P #U #^c #u #Y #6 #AT #Ռ #rX #' #U# #w;/ #m; #(G #m<S #O3_ #xk #w #ߎ #oQ #ԓ #& #a # #nF # s # # f #1 #7y #^ #sv #& #2 #l> #O # [ #?l #gx # #T #%J # #  # # # #J #x #s #y #s* #p6 #E,C # dP #3c #!p #o~ # # d #:m # # d #  # #- #>: #RG #sxZ #]ng #u #R #]n #% #M #& #M #[ #c  # #t #o8 #* # d8 #F #-T #0pb #iJp #/~ #g #2 #W #oW #3 #: # #M #b #o] #Fp #a( #D!6 #9@D #R #` #Pn #; #oa #k #. #W #k #Z #v #g #T #&1 #OD@ #AO #K*^ #Ŗm #q| #* #g # #a #iF # L #) # #1 #' #! #0 #5? #\N #] #Ol #y{ #q # # #<  # #ci #+ #0 #` #\  # ##/ #^6> #n M #\ #nk #z # #T #Q #C # #V #B #% #n # d # #4* #5jJ #3T #:a #Ou #^ #U #W #6 #s # #z #% #6 #c #1, #o: #DH #V #d #ar # # #x # # #d #y # #h # #20 # #rS #eb #q #  #u] # #= #] #Z= #V #9 #S4 #`E # #2[' #6 #2E #ET #'c #Zr #, # #  #( #@ # #| #n # #UP #\! #b& #e5 #VHD #J\S #b #Mq #  # #W # #S #m #N #s #' # #Q% #4 #+C #S #^c #|s #` #Z5 #va # #+ #| #/ #| #wr #  #.# #3 #C #S #b #f #O, #5  #  #B #b #J  #~g #B\ #y #l #7% #4 #!cC #R #a #JSp #9G #1 #4 #0 #a^ # #N # # # ` #v #7g$ #33 #-WC #<R #Va #p #r #: # # #ʘ #: #8 #t # #[q #6# #2 #=A #gP #n_ # n #"} #`& # #8 # #l) #>$ # #~ #ay #O #a" #1 #{@ #0O #2^ #Lem #^| # #* # #- # #"  # #zK #_ # #n! #S0 #{? #QN #P] #Hl ##{ #A #o # l #5 # #k #[M #S #] #9a #\ #σ/ #:> #\fM #H\ #UQk #z # Z #  #v #o #K #s #~ #,) # #D #aw #+I/ #> #M #*\ #k #UBz #* #"j #p #ѐ #*( #qc # #QT #Z ## #H #/ #H> #M #0E\ #k #lz # #Q #( #1 #Dj #5 # #Nv #C #V/ # #v-. #%= #qL #Kk #Hz #Cf #uZ #7 #{D # #$ #Z # # #3 #Vw #B*. #> #GN #+t^ #|n #} #1M # #0 #; # #K # #C #D #%9 #y #D #G # #3 # #[ #U #w #R #R' #BM #,[s #6c #s # #a # #` #r #z #[& #4 #RGB #dP #%p^ #8 l #B) #v #n #s? # #  # #́ #5 #[" #2A/ #>B #6X #I| #^ #|6 #d # #Q #/ #gE #k #{ #( #)$ #R2 #c?@ #uN #\ #rj #x #A  # #  #i5 #cc #, #5d #tf* #)Q #c #hv # #?g #P #l #3 #E #k[ #D #X #j #C # #[% #a" #]0 #JL # Z #:h #v #4! # #} #9 #$ #0< #ʒ #" #Q #F # #a7 #mG #tM #(S #y`Y #?` #]m # #f* #4o #A #* # #̆ #* #h # #&84 #TA #ah #%{ #^ # #gj #zi #\ # #z #'& #( # #D #*# #tl1 #+<? #FM # _[ #ri #}w #? #X #< # J #0 # #M #{= # #5 #k9 #B #- #~; #1I #"n #,/t #cz #X # #9 # # #a #t #\ #% # # #6( #I5 # I #Y #_ #*e #4k #.fq #Dw #} #j} #q #Gq #^ #@? #lP #:k #&{ #x # #/P #G # #M #+ #[b #O" #G; #g_H #U #Jb # o #$ | #8 #o #+ # d #M #4 #: # @ #uBP #<j #aw #V # #  #k' #K #3 #t1 # #P #t1 #) #L6 #%I #` #^7m #z #^p #t1 # #* #Q #,c #D #f # #EM- ##H # ~ #p #f # #% #] # #m6 # c #pp #'>7 #GV #av #g^ # #+ #   #W #  #$ #  #& #3 #tH@ #WM #-Z #n #G #W #X #ނ #E, #n #T # #S #R #] #l& # #{ #H # f" #+2 #E@@ #=N #r\ #j| #j # # # #5 #6 # #A #* #S # * ##7 #lOD # dQ #! # #s? #1 #a # #  #y # #; # #$u  #| #Q #56 #u( #%6 #U@ #wM #Z[ #)h #cc #q #,6 # #E #I #&[ # # #a #uA #+ #{8 #F #HS #m/a #o #vU| #]n #. #6 #  #a #m/ #  #ʒ #* #: #YS #w #JG7 #2D #\ Q #b^ #Lx #MB #} #Ȑ #I #ň # # #ʒ #a  #  #m#  #0  #l>  #"Q  #>o  #{p{  #  #v  #)  #=  #  #Y  #  #  #  #3  #DB?  #fK  #\\  #@h  #^<y  #  #v  #k  #$  #]  #V  #~,  #  #  #V   #]#  #V0  #G  #]T  #Va  #on  # {  #݀  #U&  #v  #BW  #  #  #Q  #OP  #z  #m$  #c0  #P1<  #FH  #]^  #]{  #E  #a)  #C6  #l  #   #  #F  #H  #D  #z  #HB  #FO  #\  #i  #T$w  #  #  #I  #[  #  #6  #4  #^(  #{  #  #n4  #K% #pb2 #T? #IY #eg #t #2A #? # #I #S #  #OD # #z #6 #U #J1 #e  #Vf- # : #@G #EU #[ab #/o #} #3 #D #Z #g #-W #[ #&[ #S # #  #n #{+, #a9 #[F #*p #} # # #Y8 # #f #3b # # # #X  #C|, #O #݁[ #0i #9Gw #1 #X #  # #: #Ԃ # { # #a^ # # F #:  #9G #1& #45 #C #Q #F_ #{m #o| # #^ #' #f # #_K #V #2 #x( #V  #` #=% #I4 #<C # 9Q #Q_ #Zm #x'{ #) #u^ #yv #- #_ #s #' # #K #0 # #1# #g1 #L? #M #[ #ki #Uw #en #* #% #qT #{& #a # #- #W #1 #_ #N" #_F0 #> #hL #foZ #'Lh #Fv #' #A # #2 #6 #" #qO # #B #V #yg #!3 #V= #GK #Y #7g #Nu #K/ #h #Ձ # #U #r # #  #2 #X  #X. #P`< #*YJ #_X #af #kv #c0 #4- #: #e # #] #) #Nu #  #& #1- #< #.f #nt #+_ # #} #C #= # #Z # # # ( # d< #KD #S #Fw #i #b #7 #? # # #9 #p #7 # #;U  #O #a) #7 #N:E #@}S #xa #q # #4! #X #\ #W #-o #p #  # & #t3 #qF #S #z #>x # #q #  #Y #( #y" #> # #A #FD  #> #`# #Rj0 #8= #GJ #' W #$d #=q #o~ #I #$ # #a #  #= #$ #o8 #5E #cR #iT_ #:l #a #hk # #B #& #* #[q #N #j # #|L #=/  #t #' #ZC4 #NA ##N #1_[ #;h #yu #t #a #KU #d #@I #-T #4 # #j #` # #3$ #-~2 #@ #^N #j #rLx #= #9G #1 # #V #4 #s #0 #N #  #͏  #  #v.  #7g<  #J  #X^X  #gf  #t  #T  #qK  #^  #(E  #zK  #15  #  #  #V  #z! #Y_! #s! #*! #&8! #\F! #jT! #0h! #Hu! #! #! #<! #0y! #! #! #! #;! #! #-! #7! #" #>" #X"" #/" #x$<" #mI" #t\" #k" #Mu" #" #f," #" #" #8" #U" # " #:" # # #i"# #,N.# #~8# # B# #L# #(=Y# #:f# #s# #e.# #; # #, # #M# #)# #4L# # d# #\# #S# #a$ #!+$ #[$ #q)$ #>6$ #rI$ #yS$ #]$ #g$ #;q$ #p$ #}.$ #!S$ #$ #@$ #z$ #69$ #$ #>L$ #'+$ #6 % #U+% #v$% #'1% #>% #K% #1hX% #me% #xRr% #&% #X% # =% # D% #ϕ% #:t% #UA% ##% #% #& #& #a& #5)& #66& #YC& #>FP& #9]& #?j& #ox& #g& # d& #:m& #X& #& #)& #5' #9/' # <' #SO' #Mk' #Hw' #AY' #A' #' #Yt' #L' #' #' #A' #:' #"7( #( #I( #w8+( #:8( #nE( #R( #\f( #ws( #c( #}( #p( #l( #6( #N( #( #mI( #Xm ) #=) #:%) #]3) #=A) #PU) #Nc) #2q) #}) #Zo) #) #O!) #Ed) #) #m) #7) #K) #!_) #8 * #R* #'* #x5* #TC* #qQ* #_* #%m* #{* #y{* #%* #c* #* #* #a~* #0* #\* #6+ #Ia+ #l{&+ #Ux<+ #K+ #pu[+ #kq+ #T@+ #X+ #&+ #>+ #^+ #4v+ #w+ #d+ #A, # , #] , # -, #0:, #G, #mlT, #Ea, #Bn, #o${, #>, ##P, #a, #%, #Y, # ), #j, #׍, #w- #- #y - #+.- #)`<- #:wJ- #:X- #eBf- #Rbt- #sw- #- #2&- #Ze- #h- #1- #- #W- #!- #A. #nr. #(\. #D*. #Ua9. #@oH. #W. #df. # bu. #P. #Q. #`. #. #. #.. # :. #Xs. #H. #fm / #7/ #_*/ #I#9/ #s H/ #@W/ #.f/ #u/ #l2/ #Q/ #=&/ #T/ #:!/ #xs/ #/ #/ #x 0 #0 #f+0 #T:0 #,I0 #qh^0 #En0 #>t0 #QJ1 #W1 #R d1 ##q1 #j~1 #P1 #U'1 #L2 #"I2 #q'2 #t142 #B2 #mO2 #a\2 #Fi2 #0<v2 #ʒ2 #"2 #y2 #92 #@m2 #2 #D2 #j3 # 3 #R3 #)3 #`63 #}C3 #P3 # _3 #l3 #M3 #I3 #643 #3 #3 #+3 #e-3 #e  4 #hh4 ## #4 #i64 #ZB4 #3G4 #UT4 # Ra4 #mn4 #*Q{4 #B 4 #I4 #e4 #4r4 #S4 #B4 #& 5 #r5 #X$5 #x15 #>5 #XK5 #X5 #]e5 #r5 #5 #5 #;5 #).5 #X5 #15 #eH5 #5 #K5 #l76 #~6 #Z06 #Ȁ+6 #86 #mE6 #cR6 #a_6 #7l6 #t6 #9r6 #6 #66 #M6 #$6 #x5 7 #C7 #7(7 #z=7 #{1I7 #YV7 #Li7 #Sv7 #17 #h7 #7 #R7 #7 # 7 #M7 #[7 #? 8 #/8 #<8 # =I8 #FV8 #p8 #%N}8 #a8 #h8 #y8 #l8 #8 #X8 #; 9 #HX9 #%9 #629 #?9 #[N9 #']9 #?zk9 #|9 #9 #X9 #ܒ9 #܋9 #9 #u9 #SR: #O: #{!: #$~;: #FH: #][: #[h: #m/u: #4!: #+: #f: #X: #[T: #l: #HX: #: #8: #9: #; #D(; #c; #C+; #L8; # qE; ##R; # `; #_n; #|; #[; #[; #0; #+^; #r; # < # d< #M)-< #-9< #O< # \< #ji< #ϓ< #W< #j< #k< #j< #&e< #< #L< #gv= #ˊ#= #3(0= #== #BJ= #PX= #?h= #A_n= #t= #+ z= #= #= #v= #vn= #f\= #= #z= #:= #$~= #N2= #N2= #x3= #7> #5&> #I> #V> #zc> # p> #}> #9> #"> #J> # d> #'> #> #.j ? #? #nq'? #nq1? #>? #XK? #X? #e? #D|? #e>? #I? #B? #a? #X? #-"? #/? #!r? #e? #[ @ # @ #/#@ #R0@ #SJ@ #TW@ #$d@ #q@ #T~@ #@ #@ #;l@ #/@ #@ #Z@ #x@ #!l@ #X@ #McA #  A #%A #p:A #nGA #|oA #O{A #w7A #bA #(fA #?RA #ȔA #%RA #^4 B #B #$B #&7B #NB #[B #iB #<vB ##B #tB #%B #aB #INB #B #jC #)C #(D5C #.J[C #JrC #nC #|C #ȔC #+C #aC #?RC #bD #.JD #-D #`KD #dD #{rD #D #3D #D #5sD #,D #!D #[D #{D # E #^$E #$v'E # 5E #2NE #D\E #_jE #2YE #[E #xE #E #:E #E #}E # F #F #&F #9r4F #+BF #ePF #9^^F #;lF #^F #TF #F #zF #UF #4F #/F #A G #4B G #uG #C)G #M8G #ƃFG #XUG #cG #[ qG #G #*G #(G #HG #`G #oG #G #=pH #[*.H #bBH #{LH #ZH #FhH #OvH #eH #IH #H #1`H #H #H #)H #WH #dH #VI #MI #DPI # ,I #OI #*]I #yI #I #I #I #fI #~I #I #-J #2"J #{$J #2J #JNJ #%\J #OsjJ #$3xJ # WJ #2[J #KJ #+J #J #J #DJ #hJ #^dJ #~K #%MK #!K #|0K #ix?K #_NK #]K #lK #!{K #CK #T,K #gK #?GK #,K #(K #1K #)L # L #] L #~/L #>L # ML #*\L #QkL #czL #,L #aL #L #L #L #oL #c7L #U2L #ԏM #M|M #M #a.M #=M #LM #6[M #8<jM #yM #yM #3M #tM #,M #DM #RM #M #N #.N #&BN #arN #:.N #N #P #DDP #JJP # PP #SVP #}V\P #WubP #hP #mnP #tP #0zP #QhP #P #BP #@P #TP #jP #62P ##AP #ZP #P #;P #P #EP #,P #dP #P #WP #7P #P #mP #͑P #B[P #mQ # Q #V>Q #1Q #wqQ # <"Q #z(Q #Nk.Q #-4Q #:Q #U[AQ #~NQ #F[Q #t6hQ #LKuQ #%Q #PQ #:Q #/Q #jQ #AQ #Q #OQ #6xQ #k R #m/R ##R #dZ0R #I+JR #UYWR #dR #qR #XR #R #R #' S #`S #)S #|8/S #5S #uV #OV #ixV #cV #tV #$V #W #832W #fVUW #kcW #X}W #W #'W #W #1W #CJW #W #W #W #$W #X #EX #X #h+X #+8X #IEX #MgX #X #3X #U]X #1'X #X #FX #:X ##WX #LX #Y #!Y #B"Y #9G/Y #1sZ #!kZ #~Z #Z #9Z #6$Z #C.Z #%[ #)[ #>[ #WJ[ #S_[ #qmk[ #3x[ #[ #a[ #v4[ #P[ #3 \ #hK\ #A3\ #0Q@\ #YM\ #R[\ #h\ #u\ #r\ #\ #\ #z\ #[`\ #7] #n] #n ] #t] #~] #^] #B/] #Q=] #%I] #wV] #ac] #gp] #*,] #Fs] #w] #Y] #6] #T] #] #Ȕ^ #Ӓ^ #e3^ #b?^ #U^ #a^ #n^ #{^ #O}^ #m^ #0^ #hc^ #MH^ #p^ #u^ #y ^ #+_ #3_ #Ly$_ #2_ # @_ #fXN_ #w\_ #5j_ #sx_ #K_ #p`_ #P_ #4_ #2_ #N_ #_ #7}_ #]_ #L"` #Qi/` #3]B` #%P` # H]` #j` #w` #V` #a` #\` #G` #W` #+s` #}` #6` #n0` #h` #4a #3a #!a #9.a #;a #Ha #xQVa #ycda #_Jra #T*a #Za #a #-Fa #)ka #Ka #a #@3a #e`a #ib #b #=qb #.Rb #b #Nb #Ob #b #cb #b #]b #b #b # c #=c #@8c #c #-c #c #]c #Bc #Mc #jd #d #O$d #2d #L@d #Nd #K\d #Mjd #Axd #l>d #}d #ad #d #d #e #R]e #ke #nye #e #U.e #Ze #e #?e #ie #?e #xe #e #3f #ff #"f #Ay0f #>f #ELf #QZf #edhf #7vf #1uMg #TK[g #aig #wg #tg # $g #_tg #Lg #7+h #9h #4Gh #Uh #<ch #(%qh #[h #9eh #h #h #jph #h #th #|h #Fh #LCh #%U i #{i #G'i #a]5i #Ci #(pi #H=i #e;j #~j #1Zj #j #TDj #k #l #el #L'l # 4l #}Ml #X(Zl #)l #l # l #vl #)]l #tgl #ml #l # m #m #9'm #6m #?Dm #Rm # `m #Fnm #+|m #m #m #q(m #sm #gm # m #G<m #Wm #m #n #vn #/$$n #6)2n #2;@n #Nn #+\n #"jn #xn #n #n #n #ތn #0n #n #mn #5n #:n #X o #%o #q3o #WrBo #hPo ##^o #Slo #nzo #lBo ##Fo #bo #Ho #co #o #do #q o #!9p #q!p #x0p #|>p #ZLp #Zp #p #a=p #/p #p #)p #'p #p #Xip #Ap #3p #3 q #fq #*B(q #~6q #iDq #Rq #̍`q # "nq #I |q #Fq #sq #E`q #b%q # q # q #;Hq #q # r #ur #7r #tFr #^rPr # dr #^nr #xr #r #%r #ar #Sr #<r #>r #Дr #lr #Pr #Jr # s #Bs #+)s #?i7s #MEs #bSs #Ɏas #dOos #}s #/>s #s #Ms #2~s #Vs #Z's #'s #ss #js #, t #dt #$%t #ى3t #-At #*Ot #)]t #kt #iyt #"t #bt #Et #st #Vt #Fmt #;t #&t #KMt #r= u #/u #o*u #{9u #y|Hu # 7Wu #fu #O_uu #\u #u #u #Qu #u # u #>{u #B v #@v #%*v #f/?v #M<iv #-v #F-v #H2v #nbw # w #|px #6Oy #ay #ڊ{y #Sy #,y #y #P{y #by #-4y #Xy #o!y #:y #Ȕz #T| #$} #u} #g} #i~ #f~ #w ~ # ~ # ~ # #i #K #r #M # #B* #27 #5P #C] #"l #{ # #0 #x #py #È #bڀ #pZ #H #'  #k #' #4 #}A #BN #Ms #9 #a #m # #ف #D #F #S  # z #+O) #F7 #rE #.S #Ea #{xo #Y} #\ #s #[ # #D #+<т #zi #ˋ  #s #h" #|, #"E #:R #ڊ_ #m #&[{ #X #zJ # #2i #s #Q8у #= #( #^ #C] #4  #,m #N! #%. #1|; #H #aU #b # #  #^k #M #m؅ # # # #h  #S #Ȕ) #7 #\E #<S #a #Io #zi} #+< #ˇ #!ه #Q. #2; #H #IU #mb #"u #? #r # #5 #QJ #iÈ #87F #&S #z` #rm # #Bɉ #։ #l #M #)] #j #Rdw # #To # ? #a #SƊ #Cӊ #: #H #   #lD #$ #z1 #a> #bjV #.e #ms #B #i #% #6ŋ #Ӌ #h #&[ #L #To  #I #{* #H #W #Xf #u #'z #!$ #8 #Y #0 #ό #bތ #n #t #b  #( #>7 #QF #jU #Eed #rs #o #” #$ # #; #;ύ #mߍ #R #: # #G% #Z2 #zJ@ #1:L #RZ #h #Gv # & #t #O #Q #O^ #ʎ #\#؎ ## # #= # #З #S, #: #H #9V #Hd #r #_ #& #Ə #m؏ #GRޏ #r #d # # #\ # # #a #I  #}h' # 5 #XC #7Q #_ #ޗm #uG{ # #{ #? #`D #cq #Oϐ #5ސ #E #nC #ن  # #n) #8 #ݖG ##U #Xc #q #  #i# #X # #b #p͑ #Ɍݑ #>0 #c #Ҙ  #[ #dQ& #MA4 #!B # *P #2` #]p # a # #N # # #ZВ # #7q #3 #)} # #7, #: #,H #bV #cd #s #\ #C #\ #h1 #wΓ # Tۓ #M # #X #MA #?( #Ҙ5 #xB #4O #:\ #M;i #Cwv # #-w #Ǚ #Eb #Ĕ #}Ӕ #y #[  # #2 ##@ #}<N #?\ #j #Ex #J #?E• #Mϕ # ܕ #w # # #Kn #) #Y* #I7 #:D # Q #^ #;k # &x #t #si #8 #K #( #U #M  # #f*% #od2 #H? #?L #mY #Yf #Is #: #  # & #t #Ee #͗ #H1 #j> #MK #UX #e #}r #T  #a #z #Z #W #i #87@ #!gM #MZ #Eeg #)t #T  #r #>:™ #ϙ #x # # #x #,A$ #0 #< #bH #AT # 3k #d@z #s # #ʚ #L֚ #& #~ #w #" #5 # d$ #M0 #,q< #H #PT #a #n #ݔ{ #2 #m% #l #c' #B՛ # #M  #5 #4!# #a #Fo # # #,GԜ # #$ #% #m/E #R #\_ #Cm #L6z #  #28 #t #Cĝ #mޝ # # #IW #* #h) #!6 #QC #}P #!{] #% #to #RO #;  # # #45 #m/E #JS #*a #o #X} #S # # #ş #Wӟ # #Z1  #* #PC #{R #htp #H # #u # #Fz #M #% #YGˠ #R # #h #q/ #v? #vkk #8y #r # #]: # #wu #i #ǡ #Ρ # ߡ #0 # #U #*H #l # #'" #8]0 # ? #{wM #$@[ #Rj # Pt #w #Fr #1, #`L # # Y #Z{ #K #" #Ǣ #J͢ #8Ԣ #bY #L~ #i # #{ # #X}" #AQ0 #lM #\a #k #M #T #d # #M #eΣ #\/ۣ #t #u #u #B #> #J ) #z6 #RI #BV #D:} # #' #a #o #5Ȥ #HZ #}& #O6 #+< #QB #LI #wFp #e } # c #Ј #4= #x # #u*˥ #7Vإ #df # #m #7C  #| #I& #3 #@@ #!M #%Z #}9g #': #@V #$ #HY #=Ŧ #tҦ #Cߦ #iF #e #A1 #M̨ #A٨ #+_ # d #, #pS ## #A* #8 #F #+T #d9b # p #p #*d #\ #3 #z #IΩ #<۩ #?# # # #C #C #+ #T8 #mR #D_ #Il #y #g # #s #V #;Ū #IҪ #A # #%0 #+n= #J # .] #j #83w #, #ث #K #{C #` #m/  #I #S' #a5 #B #%O #Y-\ #Tp #Qn! #]' #"a- #3 #f9 #c@ #M #BZ # pg #Cή #;ۮ # #EM0 #> #jbL #`Z #9x #W #Sʰ #1ڰ #^| #4 #1 # #~ #r\ #T #  # #VU #4 #/" #7( #@O. #/4 #M; #K #KQ #W #o] #Xc #i #Yo #nVu #]s{ #iR #o #e #) #G #I% #. #T #= # #o #R-ñ #-3ɱ #<ϱ #vձ #j۱ #[X #:A #3 #i( #: #n #S #%  #; #( #$ #:# #l) #U/ #a5 #K; #tA #5\G #fgM #S #@Y #Y_ #C"e #-gk #q #K&w #} ##- # # #p # #/ #b #!* #( # #C5 #y0Ų #'V˲ #z!Ѳ #ײ #lݲ #B #I # g #^ #+ #% #"| #R  #} #@ # #F7% #l@+ #j1 #7 #= #<C #AI #O #U #C'[ # a #{)g #ySm #\s #D y #Q #(x #q #nE #N" #G #_ #] #H4 #  #r/ #C #Ldz #hͳ #ӳ #"ٳ #I.߳ #= #8? #W # #` #  #T  #|f #F #߃, #r: #9H # V #ad #r #$ #M # # #a˴ #$ #< #P #[  #$ #fC; #e I #W #ae # s #! #v. #߃ #`; #$ #Oǵ #յ #M  #F^ #$ #o*  #$ #fCO #+] #Nk #ry #M  #  # # #M #aͶ #n # #C #Q #sIi #Yw #-e #d #dG # ķ # +ѷ #߷ #S #A  #F+ #tgI #߃X #=g #|v #F> #'h # #w #N # и #߸ # #[ #N  #r #M * #9 #MH #FvW #|f #Hu #1 #f #Fu # #p'¹ #Cҹ # #w #[ #(2 #' #tgD #ES #b #q #7 # #= #[ #w #˺ #ں #d #Ζ # #Q #;u% #34 #SC #YR #6a #Mp #Ty #7* #YR #} #gɻ #wtػ #w #8' # # v ## #2 #VA #|P #=_ #an #} # #W #% #7 #;Qּ #ax #^V #} #h #;Z! #J0 #l? #I8N # 6] #Bl #N0{ #V) #, #l #  #Wƽ #;ս #x # # t #C #M  #H$/ #U> #)M #\ #k #7`z #s #< #I # #Nƾ #־ #5 #E ##4 #ӎ! #_J #U?Y #g #v #ލ #j #& # e # #Cxп #$޿ #Xg #F #g #_ #{C$ #w2 #2@ #2N #m\ #}j #x # #( #" #  # #63 #A #߃O #`;] #;Ql #!{ #o* #g #߃ #R #+ #  # #x #M   #v.( #pZF #$Rh [ #nh@q #Sz~@ #\? # # #> #, #lM #p## # : #B #J #j #9 #r #E #_R #} #+9 #k, #1M #;d #K #l #>; # # # #ď= #)7O #tj #߇q #2x # #o #A # # #Z #^ # #2 #n/ #[e #} #7 # # #A %_/ %U/  #r %/ %/ #EM* %/. %/7A@ &JM %/Q %/VAe #kPA %/ %/eA #@? %0 % 0 #E %M0 %G0 #m %m0 %i0u?;5K?c?x;@?C@@J@-@#V=@GV@\fv@@{@@@@!@+@@Z@d#Au? #ߐ6 #} %0 %0 %0 %0 %0 %0 %0 %0 668 #7J #}| #O6 %1 %0 #  %Z1 %L1 %1 %1 #zm #v  %1 %1 %1 %17&7C7\47e &Hw<77d7 &H %2 %2 %52 %32u70E6U7) ; #k~Cp6s #~ 6 %O2 %K2 %l2 %f2 %2 %2 #gN5# %2' %2- #687O #:Z %2^ %2c #{>n %2r %2w # %2 %2 #6 %3 %3 #E # %43 %03 %S3 %K3 %|3 %v3 #dI %3 %3! 9* &H3 #b> % 4B %4G # }R %$4V % 4`!8i &Hz %A4~ %=4 %W4 %U4 %f4 %d4!8 & I %w4 %s4 %4 %4 %4 %4 &I %4 %4!8 &4I  %4 %4 %4 %4$ %4( %4-+8O98p8}9M994: ### &GI #: %4  %4 #{> %(5 %5$ #/ %d53 %Z58 #6C %5G %5L #EY #d %5h %5x %&6| %5 %7 %6 %7 %7;L; &]I %08 %,8 &]I %M8 %I8 %r8 %h8L; &I' %8+ %84 %88 %8= &IF %8J %8X %9\ %8ez&;MY;jC< &I %9 %9 &I %;9 %79C< &I %Z9 %V9 %w9 %s9 &I %9 %9 %9 %9 5J_tP<%CXm+N<W &Ih %9l %9q &Iz %9~ %9< &I %: % : %+: %': & J %J: %F: %i: %e: 4Ibw<< &%J %:# %:( &%J1 %:5 %:C<L &%JY %:] %:f %:j %:o &:Jx %&;| % ; %O; %I;.CXm<:L; ;;1C<Q [<{ < < #?%? #j &J #w  &J %q;" %o;, #V9,B #O]HfH %; %~;C8G>> %; %;>1 #z!`B %;F %;Z #wh #Vt -} # #V`- # #V- # #V-  #( #V4 .= #IX #Vd`.m #y &J # #v # #i #o &J #  #*X # #}? #| #~/8P %;T %;] %;a %;j %;n %;w %;{ %; % < % < %< %< #V. #F  *? I^ h} G% #G  %4< %*< #% %g<! %]<& #w4 #V@.I #U0d #Vp /y #( #V`/ #  #V/ # #V/  #$ #V0 09 #EOdFn /A  #?% E %<I %<N #w\ #Vh`0q #}x #V0 #p #V0 #h #V 1 # ` #V(`11 #=XL #VX1a #mP| #V1 #H #V 2 #@ #V`2 #89F&G;EVZdey&t<Rh~5 #4%:Y %<] %<l %<p %<u # %= % = #w #V2 # #V3 # #V@3  #& #V23; #GV #Vb3k #w #V4 # #V@4 # #V4 # #V"4+ #7F #VR5[ #gv #V@5 # %<= %:= %K= %I= &J %Z= %X= %k= %i= %|= %z=&;Pez2GpFX mw.>N\t.8M]r@F| #- %= %= #w #V5 #P #V+54 #@HO #V[ 6d #p@ #V`6 #8 #V6 #0 #V6 #( #V 7$ #0 ? #VK`7T #`o #V{7 # #V7 # #V 8 # #V `8 # / #V;8D #P_ #Vk8t # #V 9 # #V`9 #7 &zJ %=  %= %= %= &J' %=+ %=4 % >8 % >A %>E %>NQcQxQQQQQQQQ$Q6Ftdg.@R d *v?I^h} $;Tk"7BWk|@F #. # %0> %*> #w #V9 # #V:# #/> #VJ@:S #_n #Vz: # #V: # #V; # #V @; #. #V:;C #O^ #Vj;s # #V< #x #V@< #p #V< #h #V*<3 #?`N #VZ=c #oXyE    )  9) 3JH R[g ql}0AT !F+< I o #TIt #_ %U> %O> #w #V@= # #V= #  #V=! #-< #VH>Q #]l #Vx@> # #V> # #V> # #V? #, #V8@?A #MW l v ) <" M: ^P o&f 0E| OdEn   #V = %|> %t> # %> %> #I %> %> %? %>% %?) %?. #\H %5?L %1?Q #\[ %N?_ %J?lq>u &dJ~ # #q %i? %e?=>)>XEE>3ERo>g t y>> # ~ #t #, #" #_3 #>A #$`S #$`a #$`p #){ #X #W #X #d #O #= #\ #9 # #| #~% #)C1 #S= #J #l #N>z #6 #S #` #ր #~ #7 #  # #τ # #Յ ## #1 # ? #2M #IW #bf #Vs # # #{ # # #Ƈ #߇ # # #p #`# #0 ##= ##J #/W #Ge #HEs #v% #H #% #~ # # #` #= #&)  #v #b- #u; #I #W #{e #4t # # #] #u # #N #f #<=- %?1 %~?: %?> %?L %?P %?YO=bC= &TJ %? %?T=2=@ #8 #8 : ; 9 I8  : ;9 I8 I !I : ;9 I8( I~'I  : ; 9  : ; 9 I8 1B < : ; 9 I&II : ; 9 I !I/ 41B : ;9 I kH} : ; 9 I8 : ;9 .?: ;9 '<4: ;9 I I8  1 : ; 9   : ;9 I8 H} '! : ; 9 ": ;9 I# $  : ; 9!%4:!; 9 IB&: ;9 I'4: ;9!I ( : ;9 I)4: ; 9 I* I+ : ;9 I k , : ; 9 I k ->! I: ; 9!. : ; 9 /.: ;9 'I 0  : ;9!1 : ;9 I821RBUX YW 34: ;9 I4 : ; 9 I5 : ; 9 I k 6$ > 7 I 8 8 : ; 9 I k94: ; 9!I : : ;9 I 8;: ;9 I< : ;9 I 8 = : ; 9 I!8 >> !I: ;9!?H}@1RBX YW A UB.?: ; 9 '<C UD4: ;9 IE: ; 9 IF.?: ; 9 '<G  : ;9!H : ; 9 I 8 I : ;9 J.?: ;9 'I<K 1L1RBX YW M : ;9 I 8 N 1UO4:!; 9 IBP:! ; 9!IQ!IR : ;9 I S : ;9 T.?: ; 9 'I<U: ; 9 IV>! !I: ; 9!W.: ; 9 'I X'IY !: ; 9!Z  : ;9![\4I4]1RBX Y W ^ : ;9 I 8_ : ;9 `  : ; 9!a : ; 9!b : ; 9 I!c(d4:!; 9 Ie1RBX!YW f4:!;9 IBg h4: ; 9 Ii : ; 9 I8jI k.?: ;9!'<l.?: ; 9 '<m.: ;9 ' n:!;9 IBo 1p 1Uq 1r:!; 9 IBs !: ;9!t I8u : ; 9 v : ;9 Iw4:!;9 IBx :!;9!y1RBUX!YW z1RBX Y W {:!; 9 IB|1RBUX!Y W }.: ; 9 ' !~.?:!;9 'I !.?<n:!;! : ;9!!I/ !: ; 9 < !: ; 9! !: ; 9! : ; 9 I!41 :!;9!4:!;9!I!:!;!9 IB 1RBUX!Y W % U$ >  &4: ; 9 I?4: ; 9 I? <' : ; 9   : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 4: ;9 I?< I 8(  : ; 9   : ;9  : ;9 I .?: ; 9 n'I<.?: ;9 'I<.?: ; 9 '<.?: ;9 'IU@z41 : ;9 .: ;9 'IU@z4I41.: ; 9 'IU@z : ;9 .?: ; 9 'I@zH}.?: ; 9 'IU@z1RBX Y W .: ;9 'I .?: ; 9 'I  : ; 9 .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8( I~'I  : ; 9  : ; 9 I8 < : ; 9 I 1B&I : ; 9 IH}I!I/  : ;9 I kH} : ; 9 I8 : ;9   I8 4:!;9 IB.?: ;9 '< : ; 9 ' : ; 9  : ;9 I8 1RBX YW  1!  : ; 9!"4: ;9 I # U$ : ;9 I% I&: ;9 I' : ; 9 I k ( : ;9 I k )>! I: ; 9!* + : ; 9 ,4:!; 9 IB-4:!; 9 I.41B/  : ;9!0 : ;9 I814:!;9 IB21RBUX!YW 3 : ; 9 I4 : ; 9 I k 54: ; 9 I6$ > 7 I 8 8 : ; 9 I k94: ; 9!I : ; : ;9 I 8<: ;9 I= : ;9 I 8 > : ; 9 I!8 ?> !I: ;9!@.?: ; 9 '<A.?: ; 9 '<B.?: ;9 'I<C D : ; 9 I 8 E : ;9 F.?: ; 9 'I<G.?: ;9!'<H.: ;9 'I I:! ; 9!IJ  : ;9!K!IL : ;9 I M : ;9 N UOH}P :!;9!Q1RBX Y W R: ; 9 IS>! !I: ; 9!T : ;9 I 8 U1RBUX YW V4:!;9 IW.: ; 9 'I !X'IY !: ; 9!Z  : ;9![\:!;9 IB]:!;9 IB^ 1_1RBX!YW!`1a4:!; 9 IBb: ; 9 Ic : ;9 I 8d : ;9 e  : ; 9!f : ; 9!g : ; 9 I!h(i: ;9 Ij:!; 9 IBk1RBUX Y W l1RBUX!Y W m : ; 9 I8nI o4I4p4:!;9!I!q4: ; 9 Ir !: ;9!s I8t : ; 9 u : ;9 Iv4: ;9 I?<w.?: ; 9 '<x 1y.?:!;9!'I@zz1RBX!Y W {.: ;9 ' !| : ;9!}!I/~ !: ; 9 < !: ; 9! !: ; 9! : ; 9 I!4:!;!9 I4: ;9 IH}4I44:!; 9 I!H}.: ; 9 ' .?:!;9!'I !% U$ >  &4: ; 9 I?4: ; 9 I? <'4: ; 9 I?< : ; 9   : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9  I 8(  : ; 9 > I: ;9 .?: ; 9 n'I<.?: ; 9 '<.: ;9 'IU@z : ;9 .?: ;9 '@z.?: ;9 'IU@z.?: ; 9 'IU@z 1U1RBX YW .: ; 9 'I@z.: ; 9 'IU@z: ; 9 IB.?: ; 9 'I  : ; 9 .1@z.?<n: ; .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8'I : ; 9  : ; 9 I8 ( < I~ : ; 9 I &I : ; 9 II!I/  : ;9 I k1B : ; 9 I8 : ;9  I8  : ; 9 ' : ; 9  : ;9 I8   : ; 9!4: ;9!I  : ;9 I IH} : ; 9 I k U! : ;9 I k " # : ; 9 $H}%  : ;9!& : ;9 I8' : ; 9 I(>! I: ; 9!) : ; 9 I k *4: ; 9 I +H},$ > - I 8 . : ; 9 I k/:!; 9 IB0: ; 9 I1 : ;9 I 82: ;9 I3 : ;9 I 8 4 : ; 9 I!8 5.?: ;9 '<6> !I: ;9!7 U84:!; 9 IB9 : ; 9 I 8 : : ;9 ; <1RB X!Y W =4:!; 9 I>41B?:! ; 9!I@  : ;9!A!IB : ;9 I C : ;9 D 1E : ;9 I 8 F.?: ; 9 '<G.?:!;9!'I<H4:!;9 IBI1RB UX Y W J4: ; 9 IK'IL !: ; 9!M  : ;9!N:!;9 IBO4I4P4:!;9 IQ4:!; 9 I!R.?:!; 9 '<S.: ; 9 'I !T U : ;9 I 8V : ;9 W  : ; 9!X : ; 9!Y : ; 9 I!Z([1RB X!YW \4:!; 9 IB]: ; 9 I^ _ : ; 9 I8`I a.?: ; 9 '<b4:!;9 IBc1RB X Y W d:!; 9 IBe !: ;9!f I8g : ; 9 h : ;9 Ii.?: ; 9 'I<j1RB UX YW!k1RB UX!YW l1RB UX Y W m 1Un:!;9 Io>! !I: ; 9!p : ;9!q!I/r<s !: ; 9!t !: ; 9 u !: ; 9!v : ; 9 I!wx.?:!;9!'IU@zy:!;9 IBz4:!;9!I!{1RB X!YW | 1U}1RB X!Y!W!~H}.?:!; 9!'IU@z.:!; 9! 'IU@z4:!;!9!I.:!; 9 ' !% U$ >  &4: ; 9 I?4: ; 9 I? <' : ; 9   : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9  I 8(  : ; 9 .?: ; 9 '< 141.: ; 9 'I@z4: ; 9 I4I4H}4: ; 9 I.?: ;9 'I  : ; 9 .?<n: ; .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8( I~'I  : ; 9  : ; 9 I8 H} < : ; 9 I&I1BI!I/   : ; 9 I4:!;9 I : ;9 I kH} : ; 9 I8 : ;9 41B I8  1.?: ;9 '< : ; 9 ' : ; 9  : ;9 I8 !H}" #4: ;9 I$  : ; 9!%4: ;9!I &: ;9 I' : ;9 I( 1U) I*4: ;9 I+4:!;9 IB,1RBUX YW - U. : ; 9 I k /.: ;9 'I 0: ;9 I1 : ;9 I k 24:!; 9 I31RBX YW 4>! I: ; 9!51RBX!YW 6 : ; 9 74:!;9 I 8.?: ;9 'I<9.?: ; 9 '<:  : ;9!; : ;9 I8< 1= : ; 9 I>.?: ; 9 'I<?1RBUX YW @ A : ; 9 I k B$ > C I 8 D : ; 9 I kE4: ; 9!I F.?: ;9 '<G:!;9 IBH: ;9 II : ;9 I 8J : ;9 I 8 K : ; 9 I!8 L> !I: ;9!M UN4: ; 9 IO : ; 9 I 8 P : ;9 Q.?:!;!9!'<R4:!;9 IBS:! ; 9!IT  : ;9!U!IV : ;9 I W : ;9 XY:!;9 IBZ :!;9![ : ;9 I 8 \4: ;9 I?<]4I4^ _'I` !: ; 9!a  : ;9!b 1c:!; 9 IBd: ; 9 Ie.: ; 9 'I !f : ;9 I 8g : ;9 h  : ; 9!i : ; 9!j : ; 9 I!k(l41mH}n.: ;9 ' o: ; 9 Ip>! !I: ; 9!q : ; 9 I8rI s41t.:!;9 '@zu.?:!;9 'IU@zv:!; 9 IBw.1@zx !: ;9!y I8z!I/{ : ; 9 | : ;9 I}4G:!; 9 ~.?: ; 9 '<4I4.:!;9 'I@z :!;9! 1.?:!; 9!'I@z4:!; 9 IB : ;9!< !: ; 9! !: ; 9  !: ; 9! : ; 9 I!1RBX YW .?:!;9!' !14:!; 9! IB4:!; 9!I.: ;9 'I !.?:!;9 'I !4:!; 9 I.?<n:!;!% U$ >  &4: ; 9 I?'4: ; 9 I?<4: ; 9 I? < : ; 9   : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9  I 8(  : ; 9 .?: ; 9 '<.?: ; 9 n'I<.?: ;9 'I<.?: ; 9 'I<.: ;9 'IU@z4: ;9 I : ;9 .: ;9 'H}.?: ;9 'I@z.?: ;9 '@z H}4: ; 9 I .: ; 9 'I@z.: ;9 ' .?: ; 9 'I .: ; 9 '  : ; 9 41 .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8( I~'I  : ; 9  1B : ; 9 I8 < : ; 9 I&II : ; 9 I !I/ 41B : ;9 I kH} 1.?: ;9 '<H} : ;9  : ; 9 I8 I8 4:!;9 IB U4: ;9 I: ; 9 I  : ; 9 !'" : ; 9 # : ;9 I8 $ % &  : ; 9!'4: ;9!I ( : ;9 I)H}* I+.?: ;9 'I<, U-: ;9 I. : ; 9 I k / 01RBUX YW 1 : ;9 I k 2>! I: ; 9!34:!; 9 IB4 : ; 9 51RBX YW 6.?: ; 9 '<7.?: ; 9 '<84: ; 9 I9 1:  : ;9!; : ;9 I8<: ; 9 I= : ; 9 I> 1? 1U@.: ;9 'I A : ; 9 I k B4: ; 9 I C.?: ; 9 'I<D:!; 9 IBE$ > F I 8 G : ; 9 I kH4:!;9 IBI: ;9 IJ.: ; 9 ' K: ;9 IL : ;9 I 8M : ;9 I 8 N : ; 9 I!8 O> !I: ;9!P.: ; 9 'I Q1RBUX YW R4:!;9 IS4: ; 9 IT4:!; 9 IBU : ; 9 I 8 V : ;9 W4:!;9 I!X1RBX!YW Y1RBX Y W Z1RBUX Y W [4: ;9 I\1RBX!Y W ]:!; 9!I^  : ;9!_!I` : ;9 I a : ;9 b4:!; 9 Ic : ;9 I 8 d:!;9 IBe4:!;9 If g1RBUX Y W h1i>! !I: ; 9!j'Ik : ;9 l !: ; 9!m  : ;9!n.?: ; 9 '<o:!;9 IBp1RBX YW q : ;9 I 8r  : ; 9!s : ; 9!t : ; 9 I!u(v4: ;9 I?<wx4I4y4I4z4:!; 9 I!{ : ; 9 I8|I } 1U~I~.:!; 9 'I@z.: ;9 ' ! !: ;9! : ;9! I8 : ; 9  : ;9 I4G:!;9!.?: ;9 '<.:!;9 'I@z1RBX!Y W!.?:! ;9 'I !!I/< !: ; 9! !: ; 9  !: ; 9! : ; 9 I! 1:!; 9 IB.:!; 9! 'IU@z.?<n:!;!% U$ >  &4: ; 9 I?'4: ; 9 I?<4: ; 9 I? < : ; 9   : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9  I 8> I: ;9 (  : ; 9 .?: ; 9 '<.?: ; 9 n'I<.?: ;9 'I<.: ;9 'IU@z41 : ;9  : ;9 41H}.: ;9 'I .?: ; 9 'I .: ; 9 '  : ; 9 .1U@z1 .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8( 'I : ; 9  I~ : ; 9 I8 < : ; 9 I &I : ; 9 II!I/  : ;9 I k1B : ; 9 I8 : ;9  I8  : ; 9 ' : ; 9  : ;9 I8 H}:!;9 IBH}  : ; 9!4: ;9!I  : ;9 I I!4:!;9 IB" U# : ; 9 I k $ : ;9 I k %>! I: ; 9!& : ; 9 '4:!;9 I(.?: ;9 'I<)  : ;9!* : ;9 I8+4:!;9 IB, : ; 9 I- : ; 9 I k . / 0$ > 1 I 8 2 : ; 9 I k34: ; 9!I 4: ;9 I5 U6: ;9 I7 : ;9 I 88 : ;9 I 8 9 : ; 9 I!8 :> !I: ;9!;.?: ;9 '<<.?:!;9 'I@z=1RB X YW >4I4? 1@.?: ; 9 '<A4: ; 9 IB : ; 9 I 8 C : ;9 D4:!;9!I!E1RB UX!YW!F1RB X!YW!G 1H:!;9 IBI:! ; 9!IJ  : ;9!K!IL : ;9 I M : ;9 N.?: ; 9 '<O41BPH}Q4:!; 9 IBR : ;9 I 8 S.: ;9 'I T:!; 9 IBU: ; 9 IV W'IX : ; 9!Y !: ; 9!Z  : ;9![H}\: ;9 I]4:!; 9 IB^1_ : ;9 I 8` : ;9 a  : ; 9!b : ; 9 I!c(d e>! !I: ; 9!f : ; 9 I8gI h4:!; 9!Ii.?: ; 9! 'I<j.?: ;9 '<k1RB X!Y W l.1@zm !: ;9!n I8o : ; 9 p : ;9 Iq4: ;9 I?<rs4:!;9 It4: ;9 Iu :!; 9!v.: ;9 ' !w: ; 9 Ix.: ; 9 'I !y : ;9!z!I/{<| !: ; 9!} !: ; 9 ~ !: ; 9! : ; 9 I!1RB UX!YW I~4:!; 9!I!1RB UX!Y W!1RB X!Y W!1RB UX!Y W 41.?:!; 9 'I@z1RB X!Y W :!; 9 IB.?:!; 9!' !4:!; 9 I% U$ >  &4: ; 9 I?'4: ; 9 I?<4: ; 9 I? < : ; 9   : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9  I 8(  : ; 9 4G: 9 .?: ; 9 '<.?: ; 9 n'I<.?: ;9 'I .?: ;9 'I@|1RB X YW .?: ;9 '@zH}H}.?: ; 9 'IU@z 1 1.?: ; 9 '@z: ; 9 I.?: ; 9 'I  : ; 9 .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8I~1B'I  : ; 9  ( : ; 9 I8 H} <: ; 9 IH}&II : ; 9 I!I/  : ;9 I k4:!;9 IB : ; 9 I8 : ;9 1RBUX YW  : ;9 IH}.?: ;9 '< I8  U1RBX YW  41B! : ; 9 "'# : ; 9 $ : ;9 I8 % U&4: ;9 I': ;9 I(4:!;9 IB):!;9 IB*4: ;9 I+  : ; 9!,1RBX YW -1RBUX YW .4: ;9 I / : ;9 I0 I1.: ;9 'I 2 : ;9 I k 3 4 : ; 9 I k 5:!;9 IB6: ; 9 I7 : ; 9 8.?: ; 9 '<91:: ; 9 I; <1RBUX Y W =  : ;9!> : ;9 I8? : ; 9 I@>! I: ; 9!A4: ; 9 I B C : ; 9 I k D 1E.: ; 9 'I F$ > G I 8 H : ; 9 I kI : ; 9 I!8 J4:!;9 I!K4I4L : ;9 I 8M: ;9 IN : ;9 I 8 O> !I: ;9!P.?: ;9 'I<Q 1R41S4: ;9 IT  : ;9!U : ; 9 I 8 V : ;9 W : ;9 I 8 X:!; 9!IY!IZ : ;9 I [ : ;9 \ :!;9!]4: ; 9 I^>! !I: ; 9!_.?: ; 9 'I<`1RBX Y W a 1Ub.: ;9 ' c 1Ud'Ie : ; 9!f !: ; 9!g  : ;9!hi1RBX YW j4:!; 9 IBk.: ; 9 ' !l : ;9 I 8m : ;9 n  : ; 9!o : ; 9 I!p(q.?:!;9 'I@zr4I4s1RBX!Y W t.?:!;9!'IU@zuI~v:!; 9 IBw4:!; 9 IBx : ; 9 I8yI zH}{ :!;9!|:!; 9 IB}41 ~.1@z !: ;9! I8 : ; 9  : ;9 I.?: ; 9 '<1RBUX!Y!W!4: ; 9 I : ;9!4:!5; 9!I?<!I/ !: ; 9 < !: ; 9! !: ; 9! : ; 9 I!.?: ;9!'< :!;9!:!;9 I.:!;9! 'U@zH}.?:!; 9!' !4:!; 9!I.?:!;9!'I !.?<n:!;!% U$ >  &5I4: ; 9 I?4: ; 9 I? <' : ; 9   : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 4: ;9 I?< I 8(  : ; 9   : ;9  : ;9 I .?: ;9 'I<.?: ; 9 '<1UX YW  1.: ;9 'IU@z: ;9 I.: ; 9 'IU@z.?: ; 9 'U@z1RBX Y W .?: ; 9 'I@z4: ; 9 I  : ; 9 .?: ; 9 '@z: ; 9 I: ; 9 I.?: ; 9 'I .: ;9 'I .?: ; 9 '< : ; 9 H}.1U@z1 1 : ; 9 I8  : ;9 I8 I !II~ : ;9 I8( 'I  : ; 9  H} : ; 9 I8 1B <: ; 9 I&II : ; 9 I!I/  : ;9 I k : ; 9 I8 : ;9 H} I8 41BH}  : ; 9 4:!;9 IB' : ; 9  U : ;9 I8 !4:!;9 I"  : ; 9!#: ;9 I$4: ;9!I %4: ;9 I& : ;9 I' U( I).?: ;9 '<* : ; 9 I k +:!;9 IB,4:!;9 IB-.: ;9 'I .: ;9 I/1RBX!YW 01RBUX YW 14:!; 9 I2 : ;9 I k 3 14>! I: ; 9!5 16 : ; 9 71RBUX YW 8  : ;9!9 : ;9 I8: : ; 9 I; < : ; 9 I k =:!;9 IB>1RBX YW ?4: ;9 I@$ > A I 8 B : ; 9 I kC4: ; 9!I D E1RBX!Y W F : ;9 I 8G: ;9 IH : ;9 I 8 I : ; 9 I!8 J> !I: ;9!K4I4L4:!;9 I!M.?: ; 9 '<N : ; 9 I 8 O : ;9 P.: ; 9 'I !Q.?: ;9 'I<R41S4: ; 9 IT:! ; 9!IU  : ;9!V!IW : ;9 I X : ;9 Y: ; 9 IZ : ;9 I 8 [.?:!;9!'IU@z\4:!; 9 IB]'I^ !: ; 9!_  : ;9!`:!; 9 IBa>! !I: ; 9!b : ;9 I 8c : ;9 d  : ; 9!e : ; 9!f : ; 9 I!g(h.?: ; 9 'I<i.?: ; 9 '<jk :!;9!l 1m 1Un o : ; 9 I8pI q :!;9!r1RBX YW s 1t:!; 9 IBu !: ;9!v I8w : ; 9 x : ;9 Iy.?:!; 9 'I<z.:!;9! 'I@z{1X!Y W! |1}4:!; 9 I!~1RBUX!Y W .:!;9!' !: ; 9 I : ;9!!I/ !: ; 9 < !: ; 9! !: ; 9! : ; 9 I!.?: ;9 '<.?: ; 9 '< 1H} :!;9!.:!;9! 'IU@z 1U.?:!; 9!'IU@z4:!; 9!IB1RBUX!Y W!41% U$ >  &4: ; 9 I?4: ; 9 I? <' : ; 9 > I: ;9   : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 4: ;9 I?< I 8(  : ; 9 .?: ; 9 '<.?: ;9 '<.?: ;9 'I@z : ;9 4: ;9 I : ; 9 1RBX Y W 1RBX Y W .?: ;9 'I  : ; 9 .1@z41 .?<n.?<n: ;  : ; 9 I8  : ;9 I8 I~I !I : ;9 I81B'I H} H}  : ; 9  ( : ; 9 I8 <: ; 9 I&I1RBX YW 4:!;9 IBI : ; 9 I!I/ 41B U : ;9 I k1RBUX YW H} : ; 9 I8 : ;9 1RBX!YW    .?: ;9 '<!4:!;9 I" U# I8 $1RBUX YW % : ; 9 &4:!;9 IB' 1( : ;9 I8 )'* : ; 9 +4:!;9 I!,4: ;9 I- .: ;9 I/4: ;9 I 0:!;9 IB1 12  : ; 9!3I~4: ;9 I5 : ;9 I6: ; 9 I7 I8 : ;9 I k 9.: ;9 'I :4: ;9 I;:!;9 IB< : ; 9 I k = : ; 9 >1?.?: ; 9 '<@4I4A: ; 9 IB  : ;9!C : ;9 I8D : ; 9 IE>! I: ; 9!F 1UG : ; 9 I k H :!;9!I1RBX YW J$ > K I 8 L : ; 9 I kM4: ; 9!I N1RBX!Y W!O.: ; 9 ' P : ;9 I 8Q: ;9 IR : ;9 I 8 S : ; 9 I!8 T> !I: ;9!U.?: ;9 'I<V 1W4: ; 9 IX.?: ; 9 'I<Y1RBX Y W Z.: ; 9 'I [  : ;9!\ : ; 9 I 8 ] : ;9 ^ : ;9 I 8 _.: ;9 ' `:!; 9!Ia!Ib : ;9 I c : ;9 d4I4e'If !: ; 9!g  : ;9!hi 1Uj 1k1RBUX Y W l4: ; 9 Im : ;9 I 8n : ;9 o  : ; 9!p : ; 9!q : ; 9 I!r(s.:!;9! 'I@zt u>! !I: ; 9!v : ; 9 I8wI x.?:!;9!'IU@zy.:!;9 'IU@zz.?:!;9!'I@z{H}|4:!; 9 I}.?:!; 9!'<~ !: ;9! I8 : ; 9  : ;9 I.?: ; 9 'I<.?: ;9!'<1UX!YW 41.:!;9! 'U@zH}1RBX Y W .1@z : ;9!!I/ !: ; 9 < !: ; 9!4: ;9 I?< !: ; 9! : ; 9 I!.?:!;9 '<.?: ; 9 '< :!;9!H}1RBUX Y W H}41 4:!; 9 IB.: ; 9 ' !.1U@z% U$ >  &5I4: ; 9 I?4: ; 9 I? <' : ; 9   : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 4: ; 9 I?< I 8(  : ; 9   : ;9  : ;9 I .?: ; 9 '<.?: ;9 'I<.?: ;9 '@z  : ;9 1RBUX YW  1.: ; 9 'U@z: ; 9 IB: ; 9 IB4: ; 9 IB.: ; 9 'I .: ;9 'I .?: ;9 'I  : ; 9 1 .?<n: ; .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8I~1B'I  : ; 9  ( : ; 9 I8 < 41BH}: ; 9 I&II : ; 9 I!I/ 4: ;9 IH} : ;9 I k  : ; 9 I8 : ;9  U4:!;9 IB I8 : ;9 I1RBUX YW  1  : ; 9 ! U"'# : ; 9 $ : ;9 I8 %H}& ': ; 9 I(  : ; 9!).?: ;9 '<*1RBUX YW + 1,4: ;9 I - 1. : ;9 I/ I0: ;9 I1.: ;9 'I 2 : ;9 I k 3 1U4 : ; 9 I k 54: ;9 I61RBX YW 7 : ; 9 81RBX!YW 91RBX Y W :  : ;9!; : ;9 I8<:!;9 IB=4:!;9 I!>4: ; 9 I? : ; 9 I@>! I: ; 9!A.?: ; 9 '<B.?: ;9 'I<C4:!;9 IBD E : ; 9 I k F$ > G I 8 H : ; 9 I kI4: ; 9!I J4: ;9 IK: ; 9 IL : ;9 I 8M: ;9 IN : ;9 I 8 O : ; 9 I!8 P> !I: ;9!Q.: ; 9 'I R  : ;9!S : ; 9 I 8 T : ;9 U:!;9 IBV : ;9 I 8 W1RBUX Y W X4I4Y1RBX Y W Z.: ; 9 ' ![:!; 9!I\!I] : ;9 I ^ : ;9 _ :!;9!`.?: ; 9 '<a>! !I: ; 9!b'Ic !: ; 9!d  : ;9!e.?: ;9 '<f.?: ; 9 'I<g4I4h 1Ui1RBUX Y W j : ;9 I 8k : ;9 l  : ; 9!m : ; 9!n : ; 9 I!o(pq :!;9!r41 s 1t1RBX YW u4: ; 9 Iv w : ; 9 I8xI y1z41{.?:!;9 'I@z|:!; 9 IB}4:!; 9 I!~1RBX!Y W  !: ;9! I8 : ; 9  : ;9 I4:!; 9!IB.1@z : ;9!!I/ !: ; 9 < !: ; 9! !: ; 9! : ; 9 I!.?: ; 9 '<.?:!;9!'IU@z41I~.:!;9! '@zH}:!; 9 IB.:!;9!' !% U$ >  &4: ; 9 I?4: ; 9 I? <' : ; 9 > I: ;9   : ;9   : ;9  : ;9  : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 4: ;9 I?< I 8(  : ; 9   : ;9  : ;9 I .?: ;9 'I<.?: ; 9 '< : ;9  1H}.?: ;9 '@z: ;9 I: ;9 I1 .: ;9 'I@z : ;9 .: ; 9 'I@z: ; 9 I4: ; 9 IB.?: ; 9 ' .?: ; 9 'I .: ;9 'I .?: ;9 'I  : ; 9 .1U@z1.?<n: ; .?<n : ; 9 I8  : ;9 I8  !II : ;9 I8'I : ; 9  : ; 9 I8 < : ; 9 I ( : ; 9 I &II!I/  : ;9 I k : ; 9 I8 : ;9  I8  : ; 9 ' : ; 9  : ;9 I8   : ; 9!4: ;9!I  : ;9 I I : ; 9 I k  : ;9 I k  : ; 9 I~   : ;9!! : ;9 I8" : ; 9 I# : ; 9 I k $>! I: ; 9!%4: ; 9 I &$ > ' I 8 ( : ; 9 I k) : ;9 I 8*: ;9 I+ : ;9 I 8 , : ; 9 I!8 -:!; 9 IB.> !I: ;9!/4:!; 9 I0 : ; 9 I 8 1 : ;9 2:!; 9!I3  : ;9!4!I5 : ;9 I 6 : ;9 7 8 : ;9 I 8 9'I: !: ; 9!;  : ;9!4:!;!19! I? : ;9 I 8@ : ;9 A  : ; 9!B : ; 9!C : ; 9 I!D(E4:!; 9 IBF :!;!I8 G : ; 9 I8HI IJ.?:!; 9!'@zKH}L !: ;9!M I8N : ; 9 O : ;9 IP4:!; 9!IQ4I4R:!; 9 IBS:!; 9 IT : ;9!U!I/V<W !: ; 9!X !: ; 9!Y !: ; 9 Z : ; 9 I![.?: ; 9 'I<\.?:!; 9!'I@z]H}^ U_H}` a% Ub$ > c d&e4: ; 9 I?f'g4: ; 9 I? <hIi : ; j : ; 9 k  : ;9 l  : ;9 m : ;9 n I 8o : ; 9 I 8p  : ; 9 q I r  : ;9 s  : ;9 t  : ;9 u( v : ; 9 w> I: ; 9 x.?: ;9 'I<y.?: ; 9 '<z.?: ;9 'I<{.?: ; 9 '<|: ; 9 I}.?: ; 9 'U@z~ 1RB X Y W .?: ; 9 'IU@z4I41RB X Y W .: ;9 'I : ;9 I.: ;9 'I .: ; 9 ' .: ; 9 'I .?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8( I~'I  : ; 9  : ; 9 I8 4:!; 9 I < : ; 9 IH}&II : ; 9 I!I/  1 : ;9 I k : ; 9 I8 : ;9  I8 1B : ; 9 ' : ; 9  : ;9 I8 .?:!;9!'<  : ; 9! 4: ;9!I ! : ;9 I" I# : ;9 I k $ : ; 9 I k %41B&>! I: ; 9!'H}( )4: ; 9 I * : ; 9 +  : ;9!, : ;9 I8- : ; 9 I k . : ; 9 I/.?: ; 9 'I<0.?: ; 9 '<1$ > 2 I 8 3 : ; 9 I k44:!;9 IB5 U64: ; 9 I7 : ;9 I 88: ;9 I9 : ;9 I 8 : : ; 9 I!8 ;.?: ; 9 '<< => !I: ;9!>:!;9 IB?  : ;9!@ : ; 9 I 8 A : ;9 B: ; 9 IC : ;9 I 8 DH}E: ;9 IF41G: ; 9 IH:! ; 9!II!IJ : ;9 I K : ;9 L4:!;9 IBM1RB UX YW N4I4O.?:!; 9!'@zP:!; 9 IBQ:!;9 IBR 1S'IT !: ; 9!U  : ;9!VW4: ;9 IX.: ; 9 'I !Y : ;9 I 8Z : ;9 [  : ; 9!\ : ; 9!] : ; 9 I!^(_4:!;9 I`.?: ;9 'I<a1RB UX YW b4: ;9 Ic.:!;9 'I@zdH}e:!;9 If:!; 9 IBg : ; 9 I8hI i.?: ; 9 '<j1RB X!YW k1l Um !: ;9!n I8o : ; 9 p : ;9 Iq.?:!; 9 'I<r4:!;9 Is4:!; 9 IBt.: ; 9 ' !u4: ; 9 Iv : ;9!w!I/x<y !: ; 9!z !: ; 9!{ !: ; 9 | : ; 9 I!}.?: ;9 '<~.?:!;9!'I@z.?:!;9!'@zH}: ;9 I :!;9!1RB UX Y W H}4:!; 9 IB.:!;9!' !.?:!;9 'I !% U$ > > I: ; 9  &4: ; 9 I?'4: ; 9 I?< : ; 9 > I: ;9   : ;9   : ;9  : ;9  I 8 : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 (  : ; 9   : ;9  : ;9 I .?: ; 9 '<.?: ; 9 n'I<4: ;9 I.: ;9 'I .: ;9 '@z.: ;9 'IU@z.?: ;9 'IU@z4: ; 9 I4: ; 9 I 1RB X Y W 1RB X Y W  : ; 9 .?: ; 9 'I .1@z.?<n          YzBt X <{$l$tJt qX x Rw=<qXYW:.i..:!f%=#fJf X=J*<XJ"g<  "  tY F I A I>X u&J J!)~J JJ> XXX! vtB:tyQ . tX4Y\<Y\/Y}f~XX %F.~%~  .~  <`{zX <cXKzX yf..}   ,~ <ttf%ue=Y.ny tXy X~2< !. |J< ]<#., U w : v  *G 0$  |z< tK. ytX<. .YIJKJJ* |J}X..J<X ".fottY4u0rt |.   w  H *G X< fX|tX f          X X<#  uff"yX^"y<K\g < |!}XsJ X<JY z  k< X  `xXNh} t}  }< <;Y eX}f   ,} <#|!y XS } <ts/4 tWg$.[ *~ /u!z}(tz } @XX < J< g(t<#<IvJ<$fJ=  tXw %.~%~  }<.gXg=s.gKJX.WhLrJ>:g(g* vtKvL tw<c< otugs1.GvXtJtX           X0uX @<%.~%~ }zw"r g-v<=X*-{/ >-qzt..tuv ~)XJ@X  X8g"t"J<  uX=^ t J Y ^/=X |tl   <|X :YX |<#| u!y} "_ |X /X | <9Z X#fY#| JXt ^Xt<Y  }XW#| !y  tJj X>~X. XX   J  | ,L1 ,z&~  X` ,{ ,{&Xf{f{   !          7v}Y NzfME/ I/ /j"?Agf# X| .X .J{t tx!.t!t<<YY| r9e> t!Xy<!X>){fX 3o7E JYX< X~ KAsN f~:J4!Pq 1!XX J1U!-/X z%.~%~ zIKt~ ~Xt4)wG)?U$tJYX'4W2Ih\7t'tA//J;g A. ~XXpj /t~<JwuX~!sIg>* } u<<^!wfuv,S=#~X ~  ,~ &J Xl ~Xt%J SX t =!~;vrl ~t tgi>F<:tXAX<uXu&usgY~."iq.KKKvrY* }!  | .$.<  y  ,~&}XtX .          Xr#<ft=?+vI# r6XJ<2YXeYX .}XtX .          X ~ ~XJ/=su$<tL }.gtS.f)UX* =X  |X  ,}tXR- AxX'J J.Ym;gYub M .XX:L:gtXurYX XV <4 -=e.Ks1<Gvy  |$J }~;Y!tXurY~X ~~Xu b!X!| XX~Hu=eui~XXu~YX0 fMXfXX \ "@X=J~tt Gtt gsO>~/JsgXK* s~  =.r$tX           X  | .$.< ~$ =u {XYg=N7bK&tquY<<YP  |f J.$.< ~J < .... {X  ,{X....jX> {J ....  {X {<.usY=  {X  ,{J ,I4&  J     ~ ,}&,}&           )X./'t. Ip.  .k  ,,    ,z#  q*:ZYu:/Y YX.XX/'RX, tCtrZ ftu:/Y .Ct ' ,\!")uuA <g<hKXXYB9f<~..<X   ... *kX vX t>}<XX K~. <....pX p  p < p.<.. p.~X  ,~:.u/Nt'f<  K.J..X  ,ttf=M Xt.uf<6X/<v< ..rX / hX-t=~. Jru<hu [/ .~X  ,~/ J   t  < t  . t. XX. ?~~X1,t~f,X~%s=Y-g )XXuK k<<g@t Xo+ Xp #  vt}  ,~t= [<q?+ ^".XXp M Jf XJt*; Wu= H=HX. ^f  e <tY M  =LuGt  t" fXu}};fX !-= ZJus=\J<. u < <..J~X. f X. afX 0, &",Y$&%,&3,,}Xt),}& Yt>,}& Yt {'          wf =tXY#Y%GttXu;z.<%<R Y >Y >Y > u .d-LV LV t X=J %XXv p< l           ft<X.pX <.Xz <X.Z <X.Z <X.\ <X.Z <X.Z <X.\ <X.V <X.\ <X.Z <.\t zY XY$J:f=:-<}0V>:> !J<.X/WJ9=/ X $qJJ[;[ n<t ft y g->Z  .$ J< .   XfJ$J  X3M<yX g3M<tK=DxX .$Xt X$Jf $JX <%.~%~ X< )Yt'tW uuu Xs.> |{X{X t M3<KJ<X0u! }< ~t < t[[ .Ys= <<X<  6.t  Y6wY<u.{.y5 {<JX y-W {<J1{XzXzXzXzX t,u-/-0,. 3 t<3J< ZzXzXzXzX t us <+<,I%t>I)8 uW&zX3t tv tXu = tY = { t <X X5t5<Jv|XYY =$J%u!x= b<zts$$$%*$zsYz=sY |.fw*  ,{+{  ,{+.7Ji dX }X ${xX  ,z tz  ,z-z  ,z-z  ,z-z  ,z*,"~t~X ~}X}X}XN[f FXfXX^zPX=zKsuztzJXyz<tzX  tY]{ /  DtX .z  ut1!v !v =X2 $ E p@YYV.<1X.Yu<.> At?<YZ_#X*  X X]XQXX:Xz    Xl<XXX?AJ>uX  !,~&Y$,}&Y,|&X f"XX~,{&Y.,{&Y.XXrXX~,{&_ X,w&   K$u$<lYu+            "JzJ<ztuxX}&fg\ZKvX}J .uX=eY.t."HL=~XJ#K~X (K (L  <~6fXJ<6fJX=~JX~5JJX  WK e  qX  Mc r h:> / Y1 #<X ^I= s .` v.~  ,~<Xt /X}f}ttX} u XHKu<  }XX<" } tX"tJg;>:KYX~& ." tJ||X  <.<~t>J  }XX< } tXN  <. . <Y  %.~%~ X<~ <u!z= =I Qt   XX+'KJ ~* " XtXz  ,z t < |XtX t          Xp!z=LXXt];= ,&,yXX,`&,_&        X|  J$  J\  J          f/f=f=f=f=f= <= UOX=Zcf/f=f=f=f=f= <<Y /  yX_ T\ #Y[} ~ . < t[ tYX /  S]|=v}. <u}.  ,} Xumu .-nXu3~J. s[WX~  ,ft eJ .%~ X< zftXL0  Xt~ CytY~ = :LY  >:Z XCtf~X~XHt tL XvX&6Xvy >:Y#~ XJt~<~<.["f  =[ zf$tf.~  ,~ttft = s[tt$ JY X't#J tY Kf..JsX =uv|X! J.} 9W!&M -[ I = ... - pXXX ....XlXft|J  ,|tX |=uv{XX! J }+<![ -[ I = ... - qXXX ....X{J  ,{t {$=0z.!f J~ Y = . - S^ ..zX  ,z< z=0{.! J~M  . - wX X ..{X  ,{f zY;/Yf SX=0z.! J~M Y = = -Y - xX X ..zX  ,zf zw%./>z.   XJ = zX  ,zt< $ =tX`t<q#[+/..JjX<< |t[u  Ah.J:e*K 5-  .uX<!J zX X[f=Z usK|XM J ....pX<.|  ,|ttt J  7  /G)=Z usK|XM J ....pX<.|  ,|ttt J  7  /});=ft f=f/ f=tKf=f=f=f=  g I= g= f=f/ f=tKf=f=f=f=  g I=#[U S/ Z9<> /J".q  /M t X=  <LX XzXX X X t}. sX`J }X  ,}J< K#} .0  I/  Y   I:         yY.%~z XXz Xz JtXz  tX = <LX Jt  = 1 h gJ sY^J uX2u <. S=  v / y_ yXX~K kf!~. JX KpXX J< i=<0u  f  %F.~%~ ~. ~Jt ~ X [ ~t.~  ]`t{>KtfXyt  JzY@;E.;tEX<;EX? ~t YZ 1 h /J s z X Kfx_ `  < ..`.X~J._ < ..`.XGY o.otX<oXs ~t YZ 1 h /J s z X Kfx+T, T< ..,.X~J.+T< ..,.XXYudY 8L X=t<x. w#qwZ   K j<x.  ,xt   .Jct ~K t tJcXfZ Yf Y p< uX<Xt_~.x.}t.=iz  ,{7 vJo.IX J'<X  qX-X| |lttZftlz.< =< fJue< ] ){<'J <) 3 v }~  )o  Jtt  <tJ  JtJrtXYYY ..tt jaYK J zY !}Jz<Y$tux. ~2wf  ,x: # <ztxX} t}<Jx<uX}I\Ux.fK9.=>d.= xf=>  x} t}XX}=<K0tXf` PY./ ~t^Y`z !} JX ~ c*} 1 XYr  X=r<X.?  k7K X=uX)X(Z OfY##ZJ,~ ~GZ #.# X<}=}X[ sRxJ~ |Xt=y} tXy<X}\eKT<KIY.KPu##0x ~"}tX } X<}ZqX$twZu #~~X  <}u##X}X_! ~S ~ȬJ_}Y!X~.#eYzf#KK f,<s X #tz <  yY !}Jy<Ywt} t}XX}I^x<<Kw.f.=NT.= wf=>YKK-K>X w} t}XX}=<K0zXf <_!D8RX Xf%X<Jy. !} < q. f.=Xz.zt^? m X=# t< y !}vt} t}JX} I^z<Kw.f.KJK wfKLY;Y0,K[LvX X v} t}JX} =<K0zXt<Y~=X f.JX Y5JM.3 MJ3 M 3< M 3... MJ*Xv   ,v - \tX.t  u t<u#~ vg k ^  K I/ >uX Jf.eM~ 9*xtx<x x !} t<<!XfuX f .Jtt   ,v 0V gfJ.fxXVt) fw uX  ju   ,u 2 =uX ~  {X X{/:YKLu} t}X Ju<uX} L=*t   ,u # u   ,u +x}   ,u */ X{ J Jt<w#twX#<wYX}#}tX  >j L, NXdZX.I2 XX{f}X_ .xxfR> ({  X<v{XJ [fX<'J.J  X< {.J  X  {<mf.t  t=t[({{th.J  ?({{t.J.J   M" f<(e(X.="J(;"=t(} KX} gY<X  <J< ; X <[|J KX|X gY<X <JJ ; X <[ J(wJ#ts,g,s & ]tX<Y #<JX.< JFt   ttX . tJoX ttOv.sumX u ~0.J tJt֐~ ,~Y  ,}&,}&,w x,~Z,w< {,{&,{,{,z&Y,y&,w&x,w&h,w< ,t &w,}&Y,v tX )         YK=> Jlf.z 5XcXJXJY vt.Ky.."xf.YvV=Y= KY;==v>X.X.> <1X(?J"t f X etKt<Yg.<YC=<%X y 5  _t /t<YP.t<YY Ht<Y_.t<Yy.t<Y .t<Y.t<Yz.t<Y6Xt<YzXt<YgXt<YXt<YlXt<YYxy '/<z<Y vJ. . iX.tX!!Y ot ,0 d0tZzv<  /X .tX0t <M /{Jfi{  ,{J.| XJX yx> t>d&J<<J<ZXsgYG<nXtmZ_. .J.~X  ,tfYY wJ,~ JYI<gR~J fX~  ,~#X  X %~.~  . }VYY q.Zt 0 V0{v< fOX .T1t<KfLX .uX tfzzXJ g K g  zX <...yt  ,zttf#XX X". !W= >z. qJX^X K z  ,z# z  ,z&ya X]zt J .z  ,z1 WY XJ# X<LxXJ s.X...t K xX xX  ,xttf XX !I= >]w. rJXxX  ,x# x  ,x&ze  yX<]xtO .w  ,x1 WY X{JX3Sht/ X sX ;=   =;KY$< t{sY/IXfYwiXY ww >!Y~wXJyy yJ}{J" ,yX  ,ytf{ }] .X!Y} tZ.p.# ><LwX< ygY.ZYxJM .+wX  ,wtf ..xXq z ^ .. uXXu.Z.yX}XX"~w=WJKuY>Y0=Y J}t  ,} t</M~ X<g WY cX WY  XXJ[< y{  t ~2Y   g;Xt 6t  LaJ' ~f[  \FY gX YY {t  ~ttY  ~ ~.> ~.m.  ,{< |,&,&,~g,&Q,&,~&X,{< ,z&,x&{,|&  ~,~&,~&  ~J,~XQ,~&,~&,y&,w&y,}&,|t  P         Y.wc?~t f<[t =M u K KJ}..}  ,} IX~fY ;= t5J y= / w JJ wXK!f < <-wX < sJf xZ qf <t  tXq~ t~ttp Mg K<"uuf~/L tTj. ~<.X~ .  tZ ]_ 1MJ mY<OJ oX/nX Y~~Jtt~<<~tX}[t =M u K KJf ~~~ < ~fX~< ~fXJY[{.  .%~  }zX KKK>/ /X<...{X  ,{1 S. X.Yt. t. / ttp Mgt K<"= tJ uf yu t  X..uY#t<K   r qf<t.<YX~p <YMgt K<"| ./ &~XJX"Y r` |X  ,| $Yzz.tz< X f;< wYHG[< yX  U r )fJ<UX zJ vY. |X X Xpf JV <JX <Jy gi tJX viv|   s s  %.~  |  t< |uM4z<= |X <L  |  ,|JZH   s s  <  wt|X J  %x.~  X Yփs|X  ,|.J<K~<gX   K ;=ftYgYs fX>g qXf#Y=KKHYw.> tvX  ,wyt wz~ {~J=|X}p Mg K<"K}tYztJ~ X wX  ,|.yt xXu;y,su{~  tXXyt xXu;y yt fy<<gyX!z Xy  u fu#Ou>v8hY fy <y.X XzXyt xXu;y<yXXPX!/YyuyXy!vA]<y'X t= ELv.  wtYW<v   ,v tY;/Y< {XWt>{.  aYYYZ YJ.J.xf{  ,{<Xt$x.RY Y.X}  %F.~%~   .~t  <`t {sY<| tJ|=}.t(r.f=;<X=   r uzX u|Ju|X     .(~<XZN'zfzyu <' yJ yJu;{Y X<x  ,z   <{}X=;<X=[ JJ<.zXuAX z  ,z.> ? g <LY  @<   f~':xX{     {J{X~ Y g~   r uzX ~{ {J'{X= yX =xX XyX( X]f4X'x.({  ,x. qw {J{X~l ~yX(X4 ~yX(4W'Xx  ,z&z  ,z9~<z  ,zz  ,y"vy  ,y{ J'{X=r=#x<  ,yy  ,x(tx  ,y*}4}'  l~4 ~tXzJJ{ zJu;{4' Z|    YX t YXXX}<YXNt$X JsKJL`  NBXJnX M n stK; J . gtf|v <vX xxFXzv. x<xtXfx&Xx <x.X%uX   ,v v   ,v XX " XK  r zxP  aX Ju  r ztuX !xxX   Ju  r zu hXuX   ,v ) !~x <xXX X z YX t YX t YXzq19CyJ.XrK8Pxu. Ynwx '. .Jut   ,u Ju  r Jz J^"tw Y  rX!}x   vYXz"t ufX  wt<5gd<<<gvp YMgt K<" ufw ww fXfm<<<wJkh{w <nXYX ~y .wt tw6s) w XtXicr Z (y yh.J  r<J' gX.JJtJyJ Qy<<JX= ~X J~JJ Xt ~X< J= <= k7YHLnJJXJ lXJX<J qJ ~X< J= <=qXi<i<J  .JJY ~X$zJt*J M XX9ppXr Y jJ<=rp YMgt K<"=MK2 ;Y hXsYq Jr  <rXX J.JoX  ,}-  z vYXrG<hu HG[<y HG^;< w. X ,} ~,& YX>,~&#,~<t,{&Y),{ttfX,r &,o&s,|&,z&,z& ~  ,x&X/{.Jg{X~X~,yX,x&X/{.Jg{X~X,v &,u &E,v &,v &,t &,q&YJ#,q&,q&,o& 8          Y"L XI= <.-Xn JV <JX <Jy  giYw[J = K K K1 t wXx)Y<zJ {qL XOMU/\hJOe<.]aX 5X X`XtJ׃ kttJtJtJ<Y JJ<wJ<wp YMg K<"KfKtfXyt  JxY 0 ? r YJ 1 pX ;<2%.~%~ tX<z >gLJK!< JYY K.X.J._XJ L $J   ,$X....WX #Y[G[  J  J~XL K /5K KY< ~J<Ji =M  IY :K K /..nX~tJ ~J<J[ =M  IK K Kf~t~  ,~.~  ,~.~  ,~.  XT.BJ?X#t1X[ = /  tXLH> df<!aJ&fr> {$Xt<X$<J K Y|XJOV{|X+_X<h|X>.X .J.EX X=Y KK # JX{|t  ,|&X|  ,|.tfZ|t  ,|(|  ,|(D|. 2|X fJ t<J% <[fZ˂ Yw  ,|.tfXX|  ,|Xb<0 TtY   X   IxJ   ;x.  Jw< {X ~Z ~ Ȟ< !}wX.KtK fXeM IK  <K y= < J{ XJf  g =  N JW= 8=uuIgs M<'...zt  ,{JttfJX ~Z<{  ,{ r,JX ~ Xf !{ < X<Y|J< |K J  ? |J/u "gKtMYzJz<K! <Y X.Z  5X  M 6 { ?J rJ Y< X1J pJX{XJzXz<.K zX  ,zt| 2F |J tJXJJJ <Y f>    %.~   < > <LYM91Y)M K{p Mg K<"y.Kփ)zJJ<yX  ,y*j J{p <YMgt K<"y .JXy  ,y J sY X: z. %|.~%~ tX wJ}t J} JtX tJ JtXJ tJ JtXJ tJ JtXJ tJ Jtt JItX w+ X  |t ~ %}.~  X    w <|Y0 J  zXuX  |su# ~xX 3=mY xf0J <[K v/ v ~  xJ=<Jft<fJ <JX<XIJ / ,X<WJ  |. $f fX Ys/g<x  ,xX}t[ Y7fY =s)   ,u " |Y& J</ ~?G1 ZWf XJc y<~J JK JK t =X= ~JX <K~i Y=  L VK K KJ}Z<JuY t,JJ]JtY t,JJ\JtY t,JJ\ tY#{ u ~} Y'KeKqvKIgsX e/ie/1e/fbtXYzY   < J $<ZruYJJ }XX {<XJfJ   }X HZ <.J- AI%<J*<$  X} :LJ<OJtfYIl } <WJ  }  JX} <K w#<f LH@JZ g  XAJDy.KMJ <.r~<YL~[>< ..lt||.X~< .~&Qw<!Y ~X ~< Px<!Y            t"N $t t."< CyfN X[ tY KJJPX t<6 t<<* t<<Z t<<\ t<<Z"N $'t'<"N $"N $ t4XX p$<u JfzX v  XL YX|2>z<"$v<z F-J <>XY?,X...t$$u!~ J/&' .tw/s <x<=Z v>wwxxyyyxx  / . LXX;t G& J@@rX(fhf E. uX{ {.X yfJ.   J  J  J$  \<  J~ =tY/*<m =tY0*<QJ=tY!!!!!!!!/!Z f'Y3.Xt"< 3<tY  J2(sZz Bz zz.X, 8 f=ZtZXLug s  t .s.X$Y.J",<   J)D#IZ0" W& =tY $J=tXK/ X !W0/} L WYfZX!~" $>& $e* $u. $2 $6 $: $> $B $F $J $#N $9R $MV $da $wf $~k $p $u $z $ $ $ $ $ $ $ $ $ $ $ $  $ $  $4 $> $C $L $Y $e $q $ $ $ $ $ $ $ $  $ $ $ $- $;$ $A) $O. $W3 $b8 $r= $B $G $L $Q $V $[ $` $e $j $o $t $y $~ $ $ $! $) $9 $J $U $e $v $} $ $ $ $ $ $ $ $ $ $ $ $ $  $ $/ $> $L $\  $g $t $} $ $# $( $- $2 $7 $< $A $F $K $P $U $*Z $3_ $=d $Gi $Yn $ks $wx $} $ $ $ $ $ $ $ $ $ $ $ $ $  $ $ $' $/ $6 $= $H $Q $\ $i $x $ $ $ $  $ $ $ $ $" $' $, $1 $6 $; $@ $!E $'J $.O $4T $>Y $G^ $Tc $ch $lm $qr $}w $| $ $ $ $ $ $ $ $ $ $ $ $ $  $  $  $+  $7  $@  $I  $Q  $Z  $  $  $  $  $  $  $1  $F  $]  $l  $  $  $  $  $  $  $  $  $ # $ ( $ - $ 2 $$ 7 $+ < $8 A $A F $I K $T P $_ U $m Z $u _ $} d $ i $ n $ s $ x $ } $  $  $  $  $  $  $  $  $  $&  $2  $B  $T  $d  $t  $  $  $  $  $  $  $  $  $  $  $  $  $  $  $+  $3  $;  $I " $Q ' $] , $n 1 $} 6 $ ; $ @ $ E $ J $ O $ T $ Y $ ^ $ c $ h $m $r $ w $(| $0 $= $F $P $\ $h $t $z $ $ $ $ $ $ $ $ $ $ $ $  $> $S $h $o $~ $ $ $ $ $ $ $ $! $& $+ $0 $5 $: $? $ D $*I $;N $AS $HX $S] $Xb $eg $nl $q $v ${ $ $ $ $ $ $ $ $ $ $ $ $  $ $ $) $8 $G $N $W $g $q $| $ $ $ $ $! $! $ ! $! $! $! $ ! $%! $*! $/! $4! $ 9! $>! $C! $H! $.M! $@R! $IW! $[\! $da! $if! $rk! $|p! $u! $z! $! $! $! $! $! $! $!P< > $(> $O> $_> $v> $> $> $> $> $> $? $ ? $#? $7 ? $N? $a? $g!? $m&? $z+? $0? $5? $:? $?? $D? $I? $N? $S? $X? $]? $b? $g? $l? $ q? $v? $({? $8? $C? $P? $\? $h? $x? $? $? $? $? $? $? $? $? $? $ ? $? $+? $3? $;? $F? $N? $V? $f? $s? $|? $@ $@ $ @ $@ $@ $@ $ @ $%@ $*@ $/@ $4@ $ 9@ $>@ $/C@ $?H@ $NM@ $\R@ $lW@ $}\@ $a@ $f@ $k@ $p@ $u@ $z@ $@ $@ $@ $@ $$@ $9@ $@@ $P@ $_@ $e@ $r@ $y@ $@ $@ $@ $@ $@ $@ $@ $@ $@ $@ $@ $@ $@ $@ $A $A $# A $+A $=A $IA $YA $d$A $k)A $v.A $3A $8A $=A $BA $GA $LA $QA $VA $[A $`A $eA $jA $oA $tA $yA $ ~A $A $$A $3A $:A $HA $OA $YA $dA $sA $A $A $A $A $A $A $A $A $A $A $A $A $A $A $A $A $B $-B $6 B $;B $GB $MB $VB $^#B $d(B $m-B $s2B $7B $R $LR $RR $fR $tR $}R $R $R $R $R $R $R $R $R $R $R $R $R $ R $ R $ R $' S $- S $8 S $I S $X S $f S $t S $ %S $ *S $ /S $ 4S $ 9S $ >S $ CS $ HS $!MS $ !RS $!WS $$!\S $.!aS $=!fS $[!kS $f!pS $v!uS $!zS $!S $!S $!S $!S $!S $!S $!S $!S $!S $!S $"S $"S $"S $*"S $1"S $8"S $@"S $G"S $R"S $_"S $g"S $o"S $"S $"S $"S $"S $"T $"T $" T $"T $"T $"T $"T $"$T $")T $#.T $#3T $#8T $#=T $'#BT $1#GT $:#LT $B#QT $I#VT $T#[T $_#`T $l#eT ${#jT $#oT $#tT $#yT $#~T $#T $#T $#T $#T $#T $#T $#T $$T $$T $$T $%$T $-$T $6$T $=$T $G$T $P$T $V$T $_$T $l$T ${$T $$T $$T $$T $$T $$T $$U $$U $$ U $$U $$U $$U $$U $$#U $ %(U $%-U $ %2U $0%7U $6%);z $G)@z $S)Ez $[)Jz $c)Oz $n)Tz $v)Yz $~)^z $)cz $)hz $)mz $)rz $)wz $)|z $)z $)z $)z $)z $)z $*z $*z $"*z $0*z $>*z $M*z $`*z $p*z $*z $*z $*z $*z $*z $*z $*z $*z $*z $*z $+z $%+z $0+z $@+{ $U+{ $j+ { $q+{ $+{ $+{ $+!{ $+&{ $++{ $+0{ $+5{ $+:{ $+?{ $+D{ $+I{ $+N{ $+S{ $,X{ $ ,]{ $,b{ $,g{ $),l{ $1,q{ $9,v{ $K,{{ $W,{ $g,{ $r,{ $y,{ $,{ $,{ $,{ $,{ $,{ $,{ $,{ $,{ $,{ $,{ $,{ $,{ $,{ $,{ $-{ $ -{ $-{ $-{ $)-{ $6-{ $E-{ $O-{ $V-| $d-| $k- | $u-| $-| $-| $- | $-%| $-*| $-/| $-4| $-9| $->| $-C| $-H| $.M| $.R| $ .W| $.\| $ .a| $&.f| $/.k| $<.p| $K.u| $].z| $f.| $q.| $.| $.| $.| $.| $.| $.| $.| $.| $.| $.| $.| $.| $.| $.| $/| $/| $/| $!/| $4/| $=/| $L/|V+P $/ $/ $/ $/ $/ $0 $"0 $80 $M0 $d0 $0 $0 $0 $0* $0/ $04 $09 $0> $0C $0H $1M $ 1R $1W $"1\ $(1a $31f $>1k $L1p $T1u $\1z $e1 $r1 $w1 $1 $1 $1 $1 $1 $1 $1 $1 $1 $1 $1 $1ť $ 2ʥ $2ϥ $/2ԥ $:2٥ $J2ޥ $_2 $q2 $z2 $2 $2 $2 $2 $2 $2 $2 $2 $2 $2 $2$ $3) $ 3. $33 $38 $(3= $83B $A3G $O3L $[3Q $g3V $s3[ $y3` $3e $3j $3o $3t $3y $3~ $3 $3 $4 $4 $4 $04 $A4 $L4 $Y4 $b4 $p4 $z4 $4 $4Ħ $4ɦ $4Φ $4Ӧ $4ئ $4ݦ $5 $5 $5 $%5 $,5 $25 $;5 $G5 $P5 $Z5 $d5 $v5 $}5 $5# $5( $5- $52 $57 $5< $5A $5F $5K $5P $5U $5Z $6_ $6d $!6i $'6n $.6s $96x $>6} $K6 $T6 $Z6 $`6 $i6 $s6 $}6 $6 $6 $6 $6 $6 $6 $6ç $6ȧ $6ͧ $6ҧ $6ק $6ܧ $7 $7 $ 7 $'7 $07 $@7 $R7 $\7 $g7 $q7 $y7 $7 $7 $7" $7' $7, $71 $76 $7; $7@ $7E $7J $7O $7T $ 8Y $8^ $8c $"8h $48m $=8r $B8w $K8| $U8 $_8 $o8 $}8 $8 $8 $8 $8 $8t{ $8 $"9 $29 $B9 $Y9 $p9 $9¼ $9Ƽ $9ʼ $9μ $9Ҽ $9ּ $ :ڼ $!: $4: $:: $@: $F: $M: $X: $a: $k: $|: $: $: $:! $:& $:+ $:0 $:5 $:: $:? $:D $;I $ ;N $;S $&;X $.;] $6;b $?;g $K;l $_;q $i;v $n;{ $w; $; $; $; $; $; $; $; $; $; $< $< $-< $?< $H<ƽ $X<˽ $f<н $l<ս $t<ڽ $<߽ $< $< $< $< $< $< $< $< $< $< $< $< $= $=% $#=* $*=/ $5=4 $C=9 $K=> $[=C $l=H $w=M $=R $=W $=\ $=a $=f $=k $=p $=u $=z $= $= $> $> $> $&> $9> $I> $X> $f> $v> $> $> $> $>ž $>ʾ $>Ͼ $>Ծ $>پ $?޾ $ ? $? $"? $)? $/? $8? $D? $M? $W? $a? $s? $? $? $?$ $?) $?. $?3 $?8 $?= $?B $?G $?L $?Q $@V $@[ $$@` $-@e $5@j $<@o $C@t $N@y $W@~ $b@ $o@ $~@ $@ $@ $@ $@ $@ $@ $@ $@ $@ $@ $@Ŀ $Aɿ $ Aο $Aӿ $Aؿ $'Aݿ $-A $4A $:A $DA $MA $ZA $iA $rA $wA $A $A $A $A $A# $A( $A- $A2 $A7 $A< $AA $AF $AK $BP $ BU $BZ $B_ $)Bd $1Bi $9Bn $LBs $WBx $`B} $oB $~B $BЇD $B $B $ C $"C $2C $MC $cC $xC $C $C $C $C# $C' $C2 $ D7 $D< $DA $DF $,DK $6DP $?DU $FDZ $LD_ $]Dd $hDi $sDn $Ds $Dx $D} $D $D $D $D $D $D $D $D $D $D $E $"E $-E $9E $IE $[E $kE ${E $E $E $E $E $E $E $E $E $E $F $ F $F $F $'F $2F" $:F' $BF, $PF1 $XF6 $dF; $uF@ $FE $FJ $FO $FT $FY $F^ $Fc $Fh $Fm $Fr $Gw $ G| $G $%G $2G $:G $BG $OG $XG $bG $nG $zG $G $G $G $G $G $G $G $G $G $H $ H $H $#H $2H $PH $eH $zH $H $H $H $H $H $H! $H& $H+ $H0 $H5 $H: $H? $ID $II $ IN $'IS $2IX $ $ KC $KH $KM $"KR $(KW $1K\ $7Ka $FKf $XKk $aKp $sKu $|Kz $K $K $K $K $K $K $K $K  $L  $7L  $GL  $WL  $nL  $L  $L  $L  $L  $L  $L  $ M  $M  $6M  $IM  $NM  $SM  $ZM  $gM  $qM! $zM! $M ! $M! $M! $M! $M!! $M&! $M+! $M0! $M5! $M:! $M?! $MD! $MI! $NN! $ NS! $NX! $)N]! $3Nb! $8Ng! $ANl! $NNq! $ZNv! $fN{! $yN! $N! $N! $N! $N! $N! $N! $N! $N! $ O! $O! $"O! $0O! $6O! $DO! $LO! $WO! $gO! $tO! $}O! $O! $O! $O! $O! $O! $O! $O" $O" $O " $O" $O" $O" $ P " $P%" $#P*" $4P/" $?P4" $OP9" $`P>" $gPC" $vPH" $PM" $PR" $PW" $P\" $Pa" $Pf" $Pk" $Pp" $Pu" $Pz" $P" $P" $ Q" $Q" $(Q" $6Q" $FQ" $QQ" $^Q" $gQ" $uQ" $Q" $Q" $Q" $Q" $Q" $Q" $Q" $Q" $Q" $R" $R" $R" $!R" $+R" $=R" $OR# $[R# $kR # $vR# $}R# $R# $R# $R$# $R)# $R.# $R3# $R8# $R=# $RB# $RG# $RL# $RQ# $SV# $ S[# $S`# $Se# $!Sj# $,So# $5St# $@Sy# $MS~# $\S# $fS# $mS# ${S# $S# $S# $S# $S# $S# $S# $S# $S# $S# $S# $S# $S# $T# $ T# $T# $T# $"T# $+T# $8T# $GT# $LT# $XT$ $^T$ $gT $ $oT$ $uT$ $~T$ $T$ $T#$ $T($ $T-$ $T2$ $T7$ $T<$ $TA$ $TF$ $TK$ $TP$ $UU$ $ UZ$ $U_$ $"Ud$ $-Ui$ $;Un$ $JUs$ $YUx$ $hU$:itq $Uxq $U|q $Uq $Uq $Vq $,Vq $BVq $WVq $nVq $}Vq $Vq $Vq $Vq $Vq $Vq $Vq $Vq $Wq $ Wq $Wq $#Wq $,Wq $9Wq $CWq $IWq $QWq $ZWq $bWq $mWq $xWr $Wr $W r $Wr $Wr $Wr $W!r $W&r $W+r $W0r $W5r $W:r $W?r $XDr $XIr $*XNr $6XSr $FXXr $XX]r $hXbr $xXgr $Xlr $Xqr $Xvr $X{r $Xr $Xr $Xr $Xr $Xr $Xr $ Yr $Yr $Yr $$Yr $/Yr $7Yr $?Yr $MYr $UYr $aYr $rYr $Yr $Yr $Yr $Yr $Yr $Yr $Yr $Yr $Yr $Ys $Zs $Z s $Zs $"Zs $/Zs $7Z s $?Z%s $LZ*s $UZ/s $_Z4s $kZ9s $wZ>s $ZCs $ZHs $ZMs $ZRs $ZWs $Z\s $Zas $Zfs $Zks $Zps $[us $[zs $ [s $/[s $M[s $b[s $w[s $~[s $[s $[s $[s $[s $[s $[s $[s $[s $[s $[s $[s $\s $\s $\s $$\s $/\s $9\s $J\s $P\s $W\s $b\t $g\t $t\ t $\t $\t $\t $\t $\$t $\)t $\.t $\3t $\8t $\=t $\Bt $\Gt $\Lt $]Qt $ ]Vt $][t $ ]`t $*]et $5]jt $D]ot $S]tt $Z]yt $c]~t $s]t $}]t $]t $]t $]t $]t $]t $]t $]t $]t $]t $]t $]t $]t $]t $]t $^t $^t $^t $^t $%^t $+^t $:^t $L^t $U^t $g^u $p^u $u^ u $~^u $^u $^u $^u $^#u $^(u $^2u0p $_t $)_x $9_| $P_ $`_ ${_ $_ $_ $_ $_ $_ $_ $` $(` $;` $B` $I` $S`ê $[`Ȫ $f`ͪ $q`Ҫ $`ת $`ܪ $` $` $` $` $` $` $` $` $`  $a $ a $a $)a $;a" $Ka' $Ta, $_a1 $oa6 $a; $a@ $aE $aJ $aO $aT $aY $a^ $ac $ah $am $br $bw $%b| $.b $6b $?b $Jb $Rb $Zb $hb $sb $b $b $b $b $b $b« $bǫ $b̫ $bѫ $b֫ $ c۫ $c $(c $9c $Jc $Uc $bc $kc $yc $c $c  $c $c $c $c! $c& $c+ $ d0 $d5 $!d: $.d? $5dD $;dI $DdN $PdS $YdX $cd] $mdb $xdg $dl $dq $dv $d{ $d $d $d $d $d $d $d $d $d $d $e $ e $e $,e $8eƬ $Heˬ $SeЬ $Zeլ $eeڬ $oe߬ $e $e $e $e $e $e $e $e $e  $e $e $e $e  $f% $ f* $f/ $$f4 $3f9 $:f> $CfC $SfH $efM $lfR $vfW $f\ $fa $ff $fk $fp $fu $fz $f $f $f $f $f $f $f $f $g $g $g $g $$g $3g $Egŭ $Ngʭ $`gϭ $igԭ $ng٭ $wgޭ $g $g $g $g $g2ΰ` $g $h $#h $3h $Nh  $dh $yh $h $h $h $h# $h' $h+ $i6 $%i; $-i@ $5iE $@iJ $KiO $YiT $ciY $ti^ $zic $ih $im $ir $iw $i| $i $i $i $i $i $i $i $i $j $j $j $/j $?j $Jj² $VjDz $fj̲ $xjѲ $jֲ $j۲ $j $j $j $j $j $j $j $ k $k $k  $&k $.k $:k $Jk! $Wk& $`k+ $hk0 $qk5 $|k: $k? $kD $kI $kN $kS $kX $k] $kb $kg $kl $kq $ lv $l{ $-l $mڳ $Mm߳ $Sm $`m $gm $mm $vm $m $m $m $m  $m $m $m $m  $m% $m* $m/ $m4 $m9 $m> $nC $nH $nM $"nR $-nW $4n\ $Ana $Snf $_nk $onp $znu $nz $n $n $n $n $n $n $n $n $n $n $n $n $ o $o $oŴ $)oʴ $0oϴ $:oԴ $Eoٴ $To޴ $co $jo $so $o $o $o $o $o $o  $o $o $o $o $o$ $o) $o. $o3 $p8 $p= $pB $(pG $.pL $7pQ $?pV $Ep[ $Np` $Tpe $cpj $upo $~pt $py $p~ $p $p $p $p $p $p $p $p $p $p $q $q5Jx \4GBB B(A0D8GP; 8A0A(B BBBE $P\GEB B(D0D8D` 8A0A(B BBBE $ `4&KDD  ABE 0 tKBB B(D0A8D@N 8A0A(B BBBE B8A0A(B BBB\ KBB B(A0A8D` 8C0A(B BBBE $`x LKBE A(D0 (D BBBE $00$JN\9GBB B(D0D8F@U 8A0A(B BBBE $@LXGIB A(A0DH 0D(A BBBE l+KJB B(A0A8G 8D0A(B BBBE wFJA$$tBKBB B(D0C8D@ 8A0A(B BBBE 2 8A0A(B BBBE $`@dKBB B(A0A8G[ 8D0A(B BBBE cZTuKBB E(D0A8DP 8D0A(B BBBE KBB B(A0D8 0D(B BBBE z 0D(B BBBE j0A(B BBB,eJDh AE x D}GBA D(J (C ABBE $0DGBD D(J  (C ABBE $0GBE H(D0D8n 0J(B BBBE x 0C(B BBBE A 0M(E EBBE TXKED D(t  ABBE ~  ABBE $0(DKDD j ABE E DDE 0 \KBB B(A0D8G` 8D0A(B BBBE $`KBE E(D0A8 0D(B BBBE  0A(B BBBE D 0A(E BBBE I 0A(E BBBE $>8x '4uTDA OABDGBA A(J (A ABBE 4FNGAAT7KGE A(A0Gu 0C(A BBBE $ ,VFDCADKJD A(FW (A ABBE \KGE B(A0D8G 8D0A(B BBBE 4EKDC kAB$hJU E 6$6Jg4JJE AE pA6,yJP E U\ KBB B(A0A8DXF 8D0A(B BBBE $QX<TDC c ABE Z0 TKBB B(A0A8D`m8C0A(B BBB$Ewx ,JJAyA<%JA| AE  AE  F0<KBD D(L  ABBE 4GAD s ABE 0  KEB E(A0A8D`8h^`H 8A0A(B BBBE ^ 8C0A(B BBBE ] 8A0A(B BBBE D<KFA F@Q  AABE ,FDoA`\QKBB B(A0A8G 8D0A(B BBBE )KEB B(A0A8Gh 8A0A(B BBBE s 8A0A(B BBBE  8A0A(B BBBE i 8A0A(B BBBE \ KBB B(D0I8Ih 8D0A(B BBBE $kx I,|OSOF,[JA E F<KBA D(  ABBE TKBB B(D0C8FH\ 8D0A(B BBBE tOKBB B(D0D8DHz 8A0A(B BBBE  8A0A(B BBBE $H|:KHB E(D0C8DH 8O0D(B BBBE I 8A0A(B BBBE lPIHtKEB E(D0C8D@z 8L0D(B BBBE I 8A0A(B BBBE TKBA D(  DBBE F  ABBE TKBA D(`  ABBE F  ABBE 4HKDC g ABE TKBA D(U  DEGE F  ABBE ,sJAo AE D]KDM N ABE cAB~dKBB E(D0C8GPz 8D0A(B BBBE kXKPSXSPdKBB E(D0C8GPz 8D0A(B BBBE kXKPSXSPLKJB D(I0G^ 0C(A BBBE DJAG(F AAE \ CAE x \~GJB E(A0A8K@ 8D0A(B BBBE $=@4BKK X ABE   \GIH D(C0D (D BBBE a(A BBB$00\GIH D(C0D (D BBBE a(A BBB$00ldGBE B(D0C8DX`AhP`BXU 8D0A(B BBBE U`bX$0X4EKHA iAB#,JMq AE $(OO4nKDD SAB7 4@KAD hAB#TKBB B(A0A8D@ 8D0A(B BBBE lKBB E(D0D8D` 8C0A(B BBBE ^hBp]hB`bhT`$`|KBE E(D0A8DP]X@PL 8A0A(B BBBE a8A0A(B BBB$4PlKBB B(A0D8D 8A0A(B BBBE ^BTA$`\ZKBE B(A0A8D` 8D0A(B BBBE $``KBB B(A0A8Dh 8A0A(B BBBE M 8A0A(B BBBE D 8L0D(D BBBE d4KBB B(A0A8Gp 8D0A(B BBBE fxPpxKp$p\KBB B(A0A8Dp 8C0A(B BBBE \KEE B(A0A8Dh. 8C0A(B BBBE x ,FGB AE DKGAD  ABE A CBE <PDD [ABL <KAC G(j  AABE 0(lKEE B(D0A8FX`OhQ`AXU`KhZ`AXh 8D0A(B BBBE $.X<GJD A(  CBBE LKAC G(r  AABE y  AABE 0(TKBE E(D0C8D@ 8C0A(B BBBE $0@T{KBE B(D0C8D@T 8C0A(B BBBE $0@DGGD A(J  (A ABBE $?lKBB B(A0A8DP| 8A0A(B BBBE XW`FXFP\X^PtKBE E(D0A8Fhm 8A0A(B BBBE EpTxkORhgprh$hDMKDD  ABE G ABE 0 dCKBA C(  ABBE {  ABBE Z  FBBE $0(TGBE B(A0A8DX 8C0A(B BBBE $0X\KBB B(D0C8G@ 8A0A(B BBBE $0@x TGBA D(e  ABBE I  \BBE $0(<GED A(W  ABBE $8(<GBA A(  CBBE $0(P0\GBI A(D0i (D BBBE P(A BBB$60TGEE E(D0D8D@a 8A0A(B BBBE $0@DGLL H(D0X(A BBB$00,F{ E f E tGIB A(C0y (A BBBE O (A BBBE f (A BBBE 4GDH  ABE 0 ,FDI A\ TRKBB B(D0D8GP 8D0A(B BBBE |UGBB B(A0D8GH 8C0A(B BBBE iPFHD 8A0A(B BBBE $0HDKAD } ABE ABDFF BJGD\ BBBBA E  KBB E(A0A8JpP 8A0A(B BBBE xMp 8A0A(B BBBE pxGpxEKxAp$cpTGEI K(P  DBBE X  ABBE TKBB E(A0A8GP 8C0A(B BBBE $PlKBB L(K0A8~ 0A(B BBBE  0A(B BBBE tKBE B(D0D8DHb 8A0A(B BBBE G8A0A(B BBB$0HTKBB B(A0A8DH~ 8C0A(B BBBE TKIE I(D0I8 0A(B BBBE \KIB B(K0A8GX 8C0A(B BBBE $XT@KBB B(D0A8D@ 8A0A(B BBBE dKIJ H(D0 (A BBBE  (A BBBE $00x LGBE D(A0D8M 0D(A BBBa 4MDG(AAJ(TGBB B(A0D8g 0A(B BBBN 4BKK X ABE   9GEE B(D0A8 0D(B BBBE W 0A(B EBBE h 0A(B BBBE TGLE E(D0D8D@ 8A0A(B BBBE ,9JHaAtJKEB B(A0A8DP  8A0A(B BBBE T 8A0A(B BBBE tKBB B(D0A8DxpFx{ 8D0A(B BBBE dBEWxwVx$(x$HMq E H,^JDe AE T&KFB B(A0A8GP 8D0A(B BBBE KLB B(A0A8D\ 8C0A(B BBBE  E p P Hb^ E  P [ P iVUB$Sx 4qKAD WAD; dKGA A(D0U (A ABBE r8T0@ (A ABBE ?$JF  3),JC  E <,JC  E x (2,+JDWAtKBB D(A0\ (C BBBE J (A BBBE c(A BBB\KBB E(A0A8DX` 8D0A(B BBBE \KBB B(D0D8DX\ 8A0A(B BBBE $`X4TKDK Q ABE l!KHB E(D0A8DPkX\PkXU`FXAP\ 8A0A(B BBBE ,JU FAA, JU FAADKAA d DIE mABT1KBA A(  HBBE  ABB$J4xJC^ AE AA4JFG8AA$>Jo4KTA  ABE ,s[Z H Y E Q " | " "` ", "0d "h  "P "0 \ "`P "P "  "p< "@ "P " "` "c ""$ "(L "P% "*  "+ "P- "-$ "(L "P`/ " " 1D "H02 "G "3 " w, "0 4 "  " 7\ "` 1 " 9 " 9 " : "  : " :d " h  " < " o " ?4 " 8 BL " P  B| " B " 0C$ " ( @D\ " ` D " c "  E " pE " $ " ( FT " XFl " pF " G "   " 0TL " P l " p "  "V4 "8pVt "xP "W "`X  ", "0 Y "@\ "\$ "(^T "Xt "x0_ "c "g ", "0tD "Hptt "xu "pu "pv< "@py "{ "z\ "` | "P}, "0~ "~ "P "@D "HЀ\ "` "p "$ "(0 "` " "  "l "PpЇ "P "P  "PD "PHd "Ph0 "P "PL "PPt "Px "P5  "PD "PHp\ "P` "Pp "P "Pe  "P0D "PH\ "P` "P$ "P(L "PP "Pp  "Pd "Ph  "P  "P  ! "P!! "P!" "P"d <" "P@"" "P"# ""#D# ""H## ""#@# ""# $ ""$ ,$ ""0$$ ""$( $ ""$% ""%T% ""X%V t% ""x%`% ""% % ""%L& ""P& t& ""x&& ""& & ""&@T' ""X'' ""'% ' ""'0<( ""@(*\( ""`(( ""(Z( ""(D) ""H)l) ""p)) "") * ")*d* ")h** ")*`* ")** ")* + ")+@L+ ")P+Rt+ ")x+@+ ")++ ")+, "),,, ")0,`, "),, "),`, "),- ") -L- ")P-- ")-- ").H. ") .L. ")P.. ").$/ ")(/xL/ ")P/`/ ")// ")/t0 ")x00 ")0 0 ")0 L1 ")P1 t1 ")x11 ")1\2 ")`22 ")22 ")2`43 ")833 ")33 ")34 ")4,4 ")04@4 ")44 "44$5 "4(5\5 "4`5 5 "45 5 "45 6 "46 6 "466 "467 "4 747 "487@7 "47$8 "4(8L8 "4P8t8 "4x808 "488 "489 "49@9 "49: "9:2<: "9@:`\: "9`:2: "9:3: "9:; "9;3; "9 ;L4; "98;04d; "9h;4|; "9;05; ";;5; ";; 6; ";;p6 < ";<6<< ";@<6< ";<7= ";=P:t= ";x== ";=== ";==D> ";H>t> ";x>> ";>> ";>D? ";H? l? ";p?? ";?`? ";?>@ ";@0$@ ";(@?<@ ";@@@?t@ ";x@PA@ ";@Aubi_io_read_data___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrZSWPOUTcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_stateUBI_IO_BITFLIPSsubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsNUMA_INTERLEAVE_HITneed_qsswap_deactivateblkcnt_tvol_counticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountdfs_emulate_failuresextable_basenoinstr_text_sizenargsattributesMTHP_STAT_SWPOUT_FALLBACKvfreeset_child_tidNUMA_HINT_FAULTS_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_stateleb_sizetick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugretlenPGSCAN_SKIP_DMA32upd_bufof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_state__compiletime_assert_15__compiletime_assert_16__compiletime_assert_17UTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_count__compiletime_assert_103qsize_t__compiletime_assert_104DIRECT_MAP_LEVEL3_SPLIToobsizefilesdqb_bhardlimitliveatomic_write_unit_maxusable_leb_sizerun_listixolsym_vvar_pagemodule_sect_attrsused_ebsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesfm_workinit_volumesdescseqcountoom_score_adjd_seqia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sum__compiletime_assert_127freeze_ucounti_ctime_nsecs_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteubi_add_to_avcallback_heads_vopperf_eventf_securityi_sb_listfutex_statevm_rcupgtables_bytesget_link_lock_user_prot_regfmode_tvolumes_lockcputime_atomicvols_foundrestoredelayed_call__compiletime_assert_134max_nr_cid__compiletime_assert_137_statusd_sibkernel_ulong_tubi_io_write_datadma_opsTHP_COLLAPSE_ALLOC_FAILEDbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stateleb_startgsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countPGPGOUTfm_pool_rsv_cntreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tcreate_vtblclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasewritesize_shiftscan_objectspid_typewb_errcputimertrace_recursionstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerhighest_vol_iddev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinschanging_lebattrget_next_child_nodeFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDmtd_ecc_statsget_wunitfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_node__ret_condpercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSmetaonlysyscore__s64dqi_bgrace__kernel_pid_t__compiletime_assert_88static_call_mod_timerdma_map_opsma_external_lock_panic_writedevice_physical_location_paneluid_toobretlenflush_requiredsum_block_runtimepgmapmin_perf_statestrnlendq_oprcu_tasks_nvcswwritetypetabcrc32_leclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_poolsubi_remove_av_addr_lsb__compiletime_assert_97i_generation_sigpollmxcsrdevtd_rt_spc_hardlimitmagicnumeraseregionsNR_ZONE_ACTIVE_FILEnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qosmap_typef_opnor_flashpids_active_resetconfirm_switchcheck_attaching_infoseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportubi_update_layout_volpercpu_sizedq_sbNR_FILE_THPSarch_static_branchsighand_structerroneousflagsi_lock_keykmem_cacheinodedrivers_dirNR_ZONE_ACTIVE_ANONbug_entrygood_peb_count___GFP_NOWARN_BITcmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanubi_vid_hdrf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenget_policy__list_add_validHRTIMER_RESTARTsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtime__ret_do_oncenumbers_softexpiresvol_typekey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messageNUMA_OTHERnum_trace_eventsdata_pad_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contextflash_sizetlbflush_unmap_batchsoft__sifieldsDIRECT_MAP_LEVEL2_SPLITrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6THP_DEFERRED_SPLIT_PAGEkprobes_text_sizestatic_call_sitesTHP_FILE_FALLBACK_CHARGEubi_fm_poolthread_group_cputimernuma_scan_period_maxbadblocksstart_stackTHP_SWPOUT_FALLBACKwatcherskmalloc_caches__compiletime_assert_218completionsw_reserved__builtin_memcmpdevice_removableubi_read_volume_tableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataWORKINGSET_REFAULT_ANONget_dquotsnum_orcsclass_task_lock_is_conditionalubi_warnFAULT_FLAG_MKWRITEoom_reaper_timermemcmps_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printkvm_operations_structcnivcswbin_attrs_newdatbufruntime_idle__builtin_memcpyiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersPGSCAN_DIRECTvid_hdr_aloffsetexp_hintd_childrendirty_foliois_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabPGSCAN_SKIP_MOVABLEdfs_emulate_io_failureswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infofail_addrref_counterror_remove_folioold_time32_tcore_kallsymsec_countmemcpysrcu_parentdetachedclock_op_might_sleepnew_name_lenenvp_idx_head_1_head_2backstate_add_uevent_sentOOM_KILLi_hashubi_dbg_power_cuthlist_nodeio_uringotp_user_nvmemcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setkzalloc_noprofrcuwaitCOMPACTFAILbio_listwrite_dquotclass_read_lock_irq_is_conditionalNUMA_MISSioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrseraseonlineruntime_resumedup_xol_workKCOMPACTD_WAKEautoresize_vol_idMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumeUBI_VTBL_SKIP_CRC_CHECK_FLGd_spc_softlimitreported_split_lockmtd_mastergfp_tseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexNR_PAGETABLEcrcsUNEVICTABLE_PGMLOCKEDpgdval_tsetattrf_mappingnoinstr_text_startpreparelayout_volbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclcreate_empty_lvolUBI_COMPAT_REJECTpids_activedriveri_opldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEcredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstateubi_msgavail_pebswait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysoobavail__list_adddevice_mutexsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDshared_pendingexpires___GFP_HARDWALL_BITnivcswubi_wl_entryMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_minmtd_pairing_schemes_devcpus_allowed_lockget_next_idrwlock_tpgprotfalseout_freed_weak_revalidate__compiletime_assert_100removed__compiletime_assert_101fm_disabledshow_pathmove_mutexUBI_STATIC_VOLUME__compiletime_assert_18DL_DEV_DRIVER_BOUNDPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datavm_event_itemmce_countswap_info_structnvmemsequencert_spc_warnlimitac_flag_block_isbadcoredump_datatasks_pidaddress_spacemm_context_talc_mutex__q_size__call_single_nodestartupubi_ec_hdrseqcount_spinlock_tleb_corruptedi_wbreboot_notifieruint8_tpanelclass_id__read_overflow2_fieldinactive_timer_pkeyfilenames_export_opMTHP_STAT_SPLIT_DEFERREDdata_offseti_flctxstashedvm_page_prottimespec64PIDTYPE_SIDrsvd_pebsbpf_ctxd_pruneprintedresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipe_writevbase_resumehostuaddrerasesize_masks_wb_errshm_clistis_child_subreapercall_depthunicode_mapgraph_get_remote_endpointnum_descsTHP_MIGRATION_SPLITexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeUBI_VTBL_AUTORESIZE_FLGuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidmtd_req_statspairrseq_sigubi_debug_infodev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modemax_bitflipsSWAP_RA_HITpoweroff_latemtd_ooblayout_opsftrace_callsitesd_hashis_confidentialdl_bw__real_strnlenkobjfsyncmtd_infoi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_map__compiletime_assert_520alloc_dquotpm_messagemay_split__q_size_fieldmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountfm_sizeGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuCOMPACTSTALLhlist_heads_encoding_flagsrunnable_weightincrcopy_flaggraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowkernfs_open_fileunsigned charumount_beginvdsommap_legacy_basePAGEOUTRUNTHP_SCAN_EXCEED_SHARED_PTEpipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsdfs_power_cut_maxSWPIN_ZEROvtbl_recslicesas_ss_spNR_ZONE_INACTIVE_ANONnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BITNR_FREE_PAGESnumblocks___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listsrcu_barrier_completionshrink_controldriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidmin_io_size_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1padding2padding3llistdebugfs_entryelemnr_retries_get_fact_prot_infoPGSCAN_DIRECT_THROTTLEsigval_tpartitions_lockalimitundo_listKMALLOC_RANDOM_STARTubi_dump_vtbl_recordALLOCSTALL_DEVICEmissedquota_readst_shndxfreeparti_wb_frn_avg_timePGSCAN_KSWAPDfile_ref_tCMA_ALLOC_SUCCESStypemembarrier_stateFORTIFY_FUNC_UNKNOWNpage_poolsuspendinitfiles_structwrite_iterNR_ACTIVE_FILEs_dio_done_wqDROP_SLAB_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type_block_markbadmtimeserver_has_tasksvm_faultoom_score_adj_minkobj_uevent_envdisable_bgtfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memfm_eba_semTHP_FILE_FALLBACKpath_unpointst_sizermtpcheckedwait_sumnum_tracepoints_readupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalubi_early_get_pebconsumerskernfs_elem_symlinkclock_was_set_seqPGSCAN_KHUGEPAGEDDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerPGREUSEunlinkperiod_contribdfs_power_cut_minrcu_node_entrystart_scan_seqaeb_slab_cachefsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollTHP_MIGRATION_FAILpagesizes_blocksizevm_pgoffauprobe__retnuma_workupdate_timeptrace_dr7prioritybgt_thread_call_addrloginuidcheckTHP_FILE_MAPPEDexpiryoptimistic_spin_queuedl_defer_runningALLOCSTALL_NORMAL__lstate__compiletime_assert_84ro_modearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvTHP_MIGRATION_SUCCESSltree_lockmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_namesqnumproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfd_read_user_prot_regnr_wakeups_remoteleb_countpebsllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextubi_vtbl_recordHTLB_BUDDY_PGALLOC_FAILwritesize_maskDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincountnvmem_devicetablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codethread_enabledqspinlockget_info__kmalloc_large_noproflru_genNR_VMSCAN_WRITEinsnfilldir_tubi_dump_vol_infoNUMA_PTE_UPDATESubi_get_vid_hdrdl_non_contendingdir_contextPGFREEchrdev_locktracepoint_ptr_tutaskNR_UNEVICTABLEsched_entityd_spc_hardlimitlong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baseio_context_get_user_prot_infogpl_symsgroupseq_showubi_alloc_vid_bufPGSCAN_SKIP_DMAswait_queue_headcow_pageblockSWPOUT_ZEROi_spc_timelimitreturn_instancescompatrb_firstclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namemasternodeBALLOON_INFLATEvm_lockMTHP_STAT_NR_ANON_PARTIALLY_MAPPEDPGMIGRATE_SUCCESSno_cgroup_migrationMTHP_STAT_SPLIT_FAILEDnextevts_writers_key__countxcomp_bvcma_areaWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeworks_countshrinkerdl_yieldeddqi_formatCOMPACTFREE_SCANNEDexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keysMTHP_STAT_ANON_FAULT_FALLBACK_CHARGEpropertywchar_addr_bndkernel_symbolsubsys_datatv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineIS_ERRupd_receivedNR_SWAPCACHEdfs_chk_iouser_cpus_ptrpi_top_taskdirect_writesNR_WRITEBACK_TEMPactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedfs_chk_fastmapdisable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidPGACTIVATEngroupsfree_file_info__kernel_time64_tNR_VM_NUMA_EVENT_ITEMSautaskuser_namespacevtbl_sizeget_currentvfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsPGREFILLMTHP_STAT_ANON_FAULT_FALLBACKbuf_mutexkfreestatic_call_trampTHP_SWPOUTbtrace_seq_pp_mapping_padsa_maskrequest_queueKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenMTHP_STAT_SPLITcodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimeCOMPACTMIGRATE_SCANNEDsched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedmax_write_sizetracing_graph_pausepermcompat_robust_listktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidmove_to_putspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmUBI_VID_STATICfortify_memcpy_chkdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTmax_ecsp_offsetsrcu_cblist_invokingoops_panic_writei_lockd_nameget_ownershipUNEVICTABLE_PGMUNLOCKEDufdsexe_filenr_scannedpcp_listpid_linksfree_countvolumess_sysfs_nameq_size_fieldrefcountvaddrrequestrw_hinttimeoutdma_configurelast_switch_timenum_classesorc_unwind_ipqc_dqblkmove_tommappedseqcount_raw_spinlockubi_io_write_vid_hdrkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_endforce_full_scans_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyUBI_COMPAT_ROremoveUBI_COMPAT_PRESERVEPGSCAN_ANONs_magicdl_overrunallocd_parentubi_attach_infopayloadac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openstart_prevent_timelnumreadahead_control__kernel_gid32_tpeb_sizeNR_BOUNCEf_credmtd_oob_regionMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesfastmapread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areaTHP_FAULT_FALLBACK_CHARGEdev_pagemapvid_hdr_offsetPGDEACTIVATEerasesizewritepagessched_statisticsheadfm_anchorcopy__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclamp__compiletime_assert_326super_operations_suspendsplice_eofutil_avg___GFP_DMA_BITKSM_SWPIN_COPYrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockPGSCAN_SKIP_NORMALD_REAL_DATApt_regscorrecc_strengthpipe_bufswritersNR_IOMMU_PAGESctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colordevres_lockwritesizebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESCOW_KSMFORTIFY_FUNC_memscanubi_eba_table_cond_reschedvm_private_dataio_bitmap__ret_onceuprobe_task_statetimerkobj_typei_pagesubi_dump_avhlist_bl_headino_warnlimitfasyncu_chari_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGESchardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecUNEVICTABLE_PGCLEAREDKSWAPD_LOW_WMARK_HIT_QUICKLYgraph_get_port_parentpartitionsUNEVICTABLE_PGRESCUED__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_aliasNR_SHMEM__iovcpumaskPGLAZYFREEDdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivenew_aeb__read_overflow2taintsclosidsum_exec_runtimes_rootsubi_dbg_chk_gend_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrworksfreeze_fsuserfaultfd_ctxsigset_tubi_fastmap_init_checkmaprunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountpage_freeNR_FILE_MAPPEDparentatimeprocess_lvolcopy_file_rangetask_cputime_atomicBALLOON_DEFLATEuser_definedkey_typeget_named_child_nodelaunder_foliocurr_targethdr_crcis_suspendeddfs_dircorrected_bitflipsburstmtd_is_eccerrerroneous_peb_countetypeei_funcsmodule_kobjectactive_memcgdef_flagsuncorrectable_errorsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsWORKINGSET_NODESUBI_IO_BAD_HDR_EBADMSGlinux_binfmtpage_table_lock_sigfaultcountersname_linkNR_ANON_THPScmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_type__UNIQUE_ID_ddebug519policysharedTHP_SCAN_EXCEED_SWAP_PTEdismissd_real_typelookahead_bandseq_startpeb_bufgfp_flagsraw_lockd_dnameget_dqblkvol_id2idxmax_hang_timecpus_maskubi_numsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnameubi_volumerun_delaytailslineno__dynamic_pr_debugbase_pfnERR_PTRget_inode_aclpower_cut_max_addr_pkeymigrate_foliocustom_sliceNR_ACTIVE_ANONNUMA_LOCALthread_keyringkparam_arrayutimestart_codeis_hardfsbasecompatiblemax_wl_pool_sizeclock_listattrsnuma_stat_itemALLOCSTALL_MOVABLEcpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpuPGDEMOTE_KSWAPDmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainupd_bytes_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclmemset___GFP_ZERO_BITubi_fastmap_layoutwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsqc_stateKCOMPACTD_MIGRATE_SCANNEDubi_eba_atomic_leb_changeooblensoftirq_next_timerdump_stackcheck_flagsswp_entry_tuint64_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventNR_MLOCKset_performance_statephys_addr_tlookuptblclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryerasesize_shiftk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanPGPGINfs_parameter_specdesc_structdq_offmtd_debug_infoexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkBALLOON_MIGRATEpushDEV_DMA_COHERENTNR_ZONE_LRU_BASElinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotma_flagsdelayed_workmean_echiwater_rsskretprobe_instancesrange_max_bad_blocksfutex_exit_mutex__MTHP_STAT_COUNTkernfs_iattrs___GFP_WRITE_BITd_spacegraveyard_linkeraseregionsxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERconst_pcpu_hotreserved_pebsi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typeNUMA_FOREIGNbad_allowedi_rdevalienself_exec_idkernfs_opsfile_lockMTHP_STAT_NR_ANONMODULE_STATE_LIVEpairingnr_migrationsa_opsxa_flagsfreezebin_sizeNR_ZONE_WRITE_PENDINGclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITdata_sized_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkpercpu_refscrubhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqTHP_UNDERUSED_SPLIT_PAGErefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploltreePGALLOC_DEVICEclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_filevidbhighest_lnums_stateUNEVICTABLE_PGCULLEDuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkotp_infoTHP_SPLIT_PAGEkmalloc_typeqstrWORKINGSET_REFAULT_FILE___GFP_ZEROTAGS_BITPGSTEAL_KHUGEPAGEDorig_pmdvtblacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posNR_FILE_DIRTYnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsNR_LRU_BASEmtd_oob_opsalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexmax_sqnumcore_stateMTHP_STAT_SHMEM_FALLBACK_CHARGEtimerqueue_headlist_is_headhdrs_min_io_sizercharfutex_pi_statekstat__kernel_uid32_ttriesDEVICE_FIXEDpte_tubi_vtbl_rename_volumesPGSTEAL_ANONdevice_driverdl_server_has_tasks_frunnable_sumreal_credCOMPACTISOLATEDget_namefwnode_endpointepoll_watcheswl_lockprealloc_ptePGALLOC_NORMALWORKINGSET_ACTIVATE_BASErb_next_is_lockeddqb_curspace_entrygp_statebitsetload_avgaccesscstimecfs_rq_uidfm_work_scheduled_pointst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimitNR_WRITTENs_encodinggpl_crcsorc_entrykeyspeb_countorig_ptedqb_curinodesself_vtbl_checkvzalloc_noprofload__s8ZSWPINinvalidate_lock_keydma_maskprealloc_mutexnanosleep__already_donenode_stat_itemsrcu_gp_seq_neededpscr_ret__PGMAJFAULTdq_dqb_lock__kernel_ulong_tPSWPOUTdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignNR_THROTTLED_WRITTENbtime__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTPGALLOC_DMA32runtime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionto_be_torturedseq_stopkiocbKSWAPD_HIGH_WMARK_HIT_QUICKLYclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typewl_scheduledclass_device_is_conditionalmtd_pairing_infoshrinker_idrootubi_volume_descoom_reaper_list__UNIQUE_ID_ddebug517shutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countNR_SHMEM_THPSsig_ok__SCT__cond_rescheddelaysqf_ownerreadaheadkmalloc_cache_typeNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypefortify_memset_chksigpendingimage_seqfsindexshstksrcu_ssppage_orderwake_irqlast_eb_bytes__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32PGINODESTEALptracedtrc_reader_specialubi_free_all_volumesNUMA_HITHPROBE_GONEMTHP_STAT_SWPOUTactive_timeTHP_SPLIT_PAGE_FAILEDi_sequencedqb_ihardlimitUBI_IO_FF_BITFLIPSd_lockrefsubpage_sftrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfTHP_ZERO_PAGE_ALLOC_FAILEDi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tf_iocb_flagsdata_crcpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmoveHTLB_BUDDY_PGALLOCsched_contributes_to_loadstatic_key_trueis_emptyweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeecc_statstty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinedfs_dir_namepinned_vmwl_reboot_notifierTHP_ZERO_PAGE_ALLOC_head_2apsi_flagsaddressstart_boottimevm_starts_flagsfaultmigration_pendingec_hdr_alsizeshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusemtd_partp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgZSWPWBs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execveretrytlb_flush_pendingfm_do_produce_anchorRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqempty_vtbl_recordprev_posNR_ISOLATED_FILEseqcount_spinlocks_securitystrncmpexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchalien_peb_countrcu_tasks_exit_listarchdataia_uid_syncchildrenrb_subtree_lastno_pm_callbacksbuild_id__p_lenPGMIGRATE_FAILdevice_get_match_datavfork_done___GFP_ACCOUNT_BITpud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_struct__mptrrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memmax_pool_sizeerase_infoi_mtime_nsecperformancemmlistsuppress_bind_attrs_write_oobRPM_RESUMINGreg_offsetgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesNR_ZONE_INACTIVE_FILEf_llistphandleemulate_bitflipsrename_listubi_ro_modei_nlinkbranchused_blockswrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_serverUBI_COMPAT_DELETEtrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedNR_VM_EVENT_ITEMSfreeze_superPTR_ERRs_inode_list_lockubi_vid_io_bufsweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabKCOMPACTD_FREE_SCANNEDdevice_typePGROTATEDmaj_fltarch_rwlock_tclock_basepower_cut_minSLABS_SCANNEDcdevmy_qgroup_leadermkdirnextentsubi_ainf_volumereal_blockedarg_lockooboffsnum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerexclusiveclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyNR_FREE_CMA_PAGESqrwlockSWAP_RAfile_ra_stateuser_structwork_semon_rq__p_size_fieldfs_context_erase_user_prot_regprealloc_bufbitflip_thresholdprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasschk_fastmaplast_mm_cidUBI_IO_FFcookieubi_change_vtbl_recordtargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuUNEVICTABLE_PGSTRANDEDilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrPGDEMOTE_DIRECTattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listmove_fromsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockdev_links_infoloff_tthread_pidbgt_namesrcu_gp_seqCOMPACTSUCCESS_archec_sumst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevtrc_blkd_nodecalls_block_isreservedi_default_acls_uuid_lenioc_nodeof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tPGSCAN_SKIP_DEVICEFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmodule_state__write_overflow_fieldlast_used_athardirq_stack_ptrALLOCSTALL_DMAvm_endlast_queuednuma_migrate_retryuser_ns__statePSWPIN_rebootfirstiommu_groupmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrssuspendedhas_timeoutinvalidate_folionodemask_ti_modenr_thpsNUMA_HINT_FAULTS_LOCALia_ctimebbtblocksFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendubi_init_vid_bufFORTIFY_FUNC_memcpynsproxycan_wakeupxol_areaPGPROMOTE_SUCCESSrlockpcpu_hotfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtTHP_SCAN_EXCEED_NONE_PTEvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpctimealignmentreleasemax_segment_sizeubi_free_aebsched_dl_entity_write__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_idPGALLOC_MOVABLENR_ZSPAGESs_dentry_lrubp_offsetfolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkvid_hdr_alsizeoom_flag_origincounterorc_unwindcorr_peb_countWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapfm_pooldonePGSCAN_ZONE_RECLAIM_FAILEDfscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotavtbl_slotseba_tbldl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intfm_bufnuma_preferred_nid_hugetlb_cgroupdentry_operationsupd_ebsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requesteddfs_chk_gen__list_add_valid_or_reportcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opis_deadsysv_shmdq_countupdatingutf8data_tablefm_wl_poolset_latency_tolerance__func__resource_size_tfoliowake_entryTHP_SPLIT_PMDxa_headsuidemulate_power_cuti_readcountpq_headlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tbad_peb_countlast_data_sizeclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeglobal_sqnumparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_counters_flagsnotify_nextmax_perf_statebus_dma_limitbuffershort intmynodeof_device_idNR_VM_ZONE_STAT_ITEMSclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitmtd_erase_region_inforead_iterwritablef_ownerubi_io_writebp_regVTIME_USERsa_flagstest__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invotp_factory_nvmemDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guest_get_devicedevice_physical_locationpm_domain_datapoll_table_structdirect_IOCMA_ALLOC_FAILcurrent_may_mountseqlock_tubi_free_vid_bufnuma_scan_offsetMTHP_STAT_ANON_FAULT_ALLOC_put_devicefast_attach___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskreadersch_lnumNR_INACTIVE_FILE__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTAi_private_listia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secdfs_emulate_bitflipsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITUNEVICTABLE_PGSCANNED__read_overflowactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpids_eraseFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_start__flagsp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidNR_UNACCEPTEDattribute_groupcontextposix_timersTHP_COLLAPSE_ALLOCselectorMEMORY_DEVICE_PRIVATEoobbufdev_releasedefault_timer_slack_nsubi_rename_entrysource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refvid_hdr_shiftpmdval_t___GFP_NOFAIL_BITname_lengroup_infovdso_imageUBI_VID_DYNAMICfileof_match_tableused_bytespercpu_count_ptr__user_state_sizemce_kill_meuuid_tproperty_read_int_array___GFP_UNUSED_BITempty_peb_countKSWAPD_INODESTEALcount_objectserrorq_size_stimezone_device_dataf_wb_erruseddefparamfred_csfault_flagemulate_io_failureskprojid_tptracer_credtlb_genstorepage_mkwritebeb_rsvd_pebskobjectaudit_ttypnummce_ripvstatfsdma_skip_syncDROP_PAGECACHEnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistTHP_SPLIT_PUDclass_groupsnuma_nodePGSCAN_FILEoffsetsi_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_t__compiletime_assert_12__compiletime_assert_13__compiletime_assert_14ioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchanged__compiletime_assert_19watch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opswrite_errorsequential_io__compiletime_assert_20__compiletime_assert_21maybe_bad_peb_count_large_mapcount__compiletime_assert_102check_avsda_is_static__compiletime_assert_105__compiletime_assert_106__compiletime_assert_107__compiletime_assert_108__compiletime_assert_109formatftopenclaveALLOCSTALL_DMA32PGLAZYFREEsp_regcreateiattrMTHP_STAT_SHMEM_FALLBACKrseqecc_step_sizenfdssigvalvma_lockperf_event_list__compiletime_assert_110__compiletime_assert_111vol_idget_reserved_spacestack_refcountinvalidate_lockbmapkey_payload_write_user_prot_regd_real_lockPGSCAN_ZONE_RECLAIM_SUCCESSexpiry_active__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126dqi_max_spc_limit__compiletime_assert_128__compiletime_assert_129exception_table_entryvid_hdrevent_countcorrectedpreempt_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimit__compiletime_assert_130__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135__compiletime_assert_136mems_allowed__compiletime_assert_138__compiletime_assert_139tlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderMTHP_STAT_ZSWPOUTtimewakee_flip_decay_tss_max_linksnr_wakeups_sync__compiletime_assert_140__compiletime_assert_141kallsymsprevdma_parmsfs_structclockiduint32_targ_startemulate_failuresblocks__might_reschedset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_listdevice_dma_supportedd_ino_warnshiwater_vmtracepointubi_namecompound_headUBI_DYNAMIC_VOLUMEia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writers__compiletime_assert_82__compiletime_assert_83ino_timelimit__compiletime_assert_85__compiletime_assert_86__compiletime_assert_87splice_write__compiletime_assert_89i_rt_spc_timelimitTHP_FILE_ALLOC_read_fact_prot_regcss_setqf_nextranges__compiletime_assert_90__compiletime_assert_91__compiletime_assert_92__compiletime_assert_93__compiletime_assert_94__compiletime_assert_95__compiletime_assert_96iommu_mm__compiletime_assert_98__compiletime_assert_99cutimeem_tableNUMA_HUGE_PTE_UPDATESpersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infoMTHP_STAT_SHMEM_ALLOCd_fieldmaskubi_deviceuprobe_xol_opsseq_filefreeze_noirqNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tNUMA_PAGE_MIGRATEsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataPGSTEAL_KSWAPDsync_stateki_posexecute_only_pkeydfs_disable_bgtFAULT_FLAG_RETRY_NOWAITsyncupd_markersetleasepinspacct_structmust_resumelen1len2long intubi_find_avfile_lock_contextusagel_yesPGALLOC_DMAsiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimeuidhash_nodefred_ssproperty_present__kmalloc_index__write_overflowUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typechk_ioruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirtynum_srcu_structsbdi_writebackkobj_completionooblayoutckvol_mutex__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobe__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenNR_ZONE_UNEVICTABLE_read_oobclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvolNR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_id_unlocksrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infop_lensuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkskip_checkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountTHP_FAULT_FALLBACKrestore_noirqdfs_emulate_power_cutpower_cut_counterki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGY__compiletime_assert_518rlimread_folionr_events__vpp_verifyiommuprivatewritebufsizest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipe__be16s_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsnew_nametqheads_activechk_genMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cached__be32s_copPGSTEAL_DIRECTdd_key_truezone_stat_itemhres_activebpf_raw_eventsdq_dirtydl_deferbug_listbeb_rsvd_leveldirect_completexa_locklist_addfxregs_stateload_weightkuid_tarch_datafpstateblock_maxmthp_stat_itemrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateMTHP_STAT_SWPINis_late_suspendedsysvsemTHP_FAULT_ALLOClockmapignore_childrenrestore_earlyclock_mutexfs_supersvtbl_check__be64min_ecUBI_IO_BAD_HDRdqb_bsoftlimitpendingf_task_workfm_protect___GFP_NORETRY_BITiowait_countubi_ainf_pebcorruptedmax_erroneousPGFAULTnotifier_blockdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesbad_peb_limitearly_initubi_io_readmprotectsecurityxmm_spaceubi_erractivatef_pos_locksuspend_noirqPGSTEAL_FILEi_fieldmasktls_arrayownerpfo_val__acct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITi_bytesdomain_datarelax_countdevice_attribute___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrZSWPOUTcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seubi_eba_unmap_lebFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsNUMA_INTERLEAVE_HITneed_qsvol_releaseswap_deactivateblkcnt_tvol_counticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountdfs_emulate_failuresextable_baseUBI_VOLUME_REMOVEDnoinstr_text_sizenargsattributesMTHP_STAT_SWPOUT_FALLBACKset_child_tidNUMA_HINT_FAULTS_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_stateleb_sizetick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugretlenPGSCAN_SKIP_DMA32upd_bufof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_state__compiletime_assert_15__compiletime_assert_16__compiletime_assert_17UTASK_SSTEPreal_parentcdev_dellockedVTIME_GUESTregsslice_maxlast_switch_countqsize_t__compiletime_assert_104DIRECT_MAP_LEVEL3_SPLIToobsizefilesdqb_bhardlimitliveatomic_write_unit_maxusable_leb_sizerun_listixolsym_vvar_pagemodule_sect_attrsused_ebsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesfm_workdescseqcountoom_score_adjd_seqia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sum__UNIQUE_ID_ddebug521freeze_ucounti_ctime_nsecs_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listfutex_statevm_rcupgtables_bytesget_link_lock_user_prot_regfmode_tvolumes_lockcputime_atomicrestoredelayed_callmax_nr_cid_statusd_sibkernel_ulong_tdma_opsTHP_COLLAPSE_ALLOC_FAILEDbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stateleb_startgsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countPGPGOUTfm_pool_rsv_cntreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tvol_attribute_showclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasewritesize_shiftscan_objectspid_typewb_errcputimertrace_recursionstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinschanging_lebattrget_next_child_nodeFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDmtd_ecc_statsget_wunitfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_node__ret_condpercpu_ref_datadividenddestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSmetaonlysyscore__s64dqi_bgrace__kernel_pid_t__compiletime_assert_88static_call_mod_timerdma_map_opsma_external_lock_panic_writedevice_physical_location_paneluid_tubi_update_reservedoobretlenflush_requiredsum_block_runtimepgmapmin_perf_statestrnlendq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_poolsattr_vol_reserved_ebs_addr_lsb__compiletime_assert_97i_generation_sigpollmxcsrdevtd_rt_spc_hardlimitnumeraseregionsNR_ZONE_ACTIVE_FILEnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qosmap_typef_opnor_flashpids_active_resetubi_create_volumeconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizedq_sbNR_FILE_THPSarch_static_branchsighand_structerroneousflagsi_lock_keykmem_cacheinodedrivers_dirNR_ZONE_ACTIVE_ANONbug_entrygood_peb_count___GFP_NOWARN_BITcmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirubi_fastmap_destroy_checkmapsockhash_lenget_policyUBI_VOLUME_SHUTDOWNHRTIMER_RESTARTsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtime__ret_do_oncenumbers_softexpiresvol_typekey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messageNUMA_OTHERnum_trace_eventsdata_pad_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contextflash_sizetlbflush_unmap_batchsoftubi_eba_copy_table__sifieldsDIRECT_MAP_LEVEL2_SPLITrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6no_vtblTHP_DEFERRED_SPLIT_PAGEkprobes_text_sizestatic_call_sitesTHP_FILE_FALLBACK_CHARGEubi_fm_poolthread_group_cputimernuma_scan_period_maxbadblocksstart_stackTHP_SWPOUT_FALLBACKwatcherskmalloc_cachescompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataWORKINGSET_REFAULT_ANONget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printkvm_operations_structcnivcswbin_attrs_newdatbufubi_rename_volumesruntime_idle__builtin_memcpyiov_basesrcu_size_jiffiesi_statesched_classmultiprocessubi_wl_flushpi_waitersPGSCAN_DIRECTvid_hdr_aloffsetexp_hintd_childrendirty_foliois_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabPGSCAN_SKIP_MOVABLEdfs_emulate_io_failureswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infofail_addrubi_free_volumeref_countfwnode_property_read_stringerror_remove_folioold_time32_tcore_kallsymsmemcpysrcu_parentdetachedclock_op_might_sleepnew_name_lenenvp_idx_head_1_head_2backstate_add_uevent_sentOOM_KILLi_hashhlist_nodesprintfio_uringotp_user_nvmemcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setkzalloc_noprofrcuwaitCOMPACTFAILbio_listwrite_dquotclass_read_lock_irq_is_conditionalNUMA_MISSioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlineruntime_resumedup_xol_workKCOMPACTD_WAKEautoresize_vol_idMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumeUBI_VTBL_SKIP_CRC_CHECK_FLGd_spc_softlimitreported_split_lockmtd_mastergfp_tseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexNR_PAGETABLEcrcsUNEVICTABLE_PGMLOCKEDpgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEcredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstateavail_pebswait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpacctUBI_EXCLUSIVEi_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysoobavaildevice_mutexsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDshared_pendingexpires___GFP_HARDWALL_BITnivcswubi_wl_entryMODULE_STATE_GOINGdev_set_nameDL_DEV_UNBINDINGthreadsym_timens_pages_time_minmtd_pairing_schemedivisors_devcpus_allowed_lockget_next_idrwlock_tpgprotfalseout_freed_weak_revalidateremoved__compiletime_assert_101fm_disabledshow_pathmove_mutexUBI_STATIC_VOLUME__compiletime_assert_18DL_DEV_DRIVER_BOUNDPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datavm_event_itemmce_countswap_info_structnvmemsequencert_spc_warnlimitac_flag_block_isbadcoredump_datatasks_pidaddress_spacemm_context_talc_mutex__q_size__call_single_nodestartupseqcount_spinlock_ti_wbreboot_notifieruint8_tpanelclass_id__read_overflow2_fieldinactive_timer_pkeyfilenames_export_opMTHP_STAT_SPLIT_DEFERRED__mptri_flctxstashedvm_page_prottimespec64PIDTYPE_SIDrsvd_pebsbpf_ctxd_pruneprintedresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipe_writevbase_resumehostuaddrerasesize_masks_wb_errshm_clistis_child_subreapercall_depthunicode_mapgraph_get_remote_endpointnum_descsTHP_MIGRATION_SPLITexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeUBI_VTBL_AUTORESIZE_FLGuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidmtd_req_statspairrseq_sigubi_debug_infodev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modemax_bitflipsSWAP_RA_HITpoweroff_latemtd_ooblayout_opsftrace_callsitesd_hashis_confidentialdl_bw__real_strnlenkobjfsyncmtd_infoi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_map__compiletime_assert_520alloc_dquot__compiletime_assert_522pm_messagemay_split__q_size_fieldmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountfm_sizeGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuCOMPACTSTALLUBI_READWRITEhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowkernfs_open_fileunsigned charumount_beginvdsommap_legacy_basePAGEOUTRUNTHP_SCAN_EXCEED_SHARED_PTEpipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsdfs_power_cut_maxSWPIN_ZEROvtbl_recslicesas_ss_spNR_ZONE_INACTIVE_ANONnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BITNR_FREE_PAGESnumblocks___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listsrcu_barrier_completionshrink_controldriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidmin_io_size_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1padding2llistdebugfs_entryelemnr_retries_get_fact_prot_infoPGSCAN_DIRECT_THROTTLEsigval_tpartitions_lockalimitundo_listKMALLOC_RANDOM_STARTubi_dump_vtbl_recordALLOCSTALL_DEVICEmissedquota_readst_shndxfreeparti_wb_frn_avg_timePGSCAN_KSWAPDfile_ref_tCMA_ALLOC_SUCCESStypemembarrier_stateFORTIFY_FUNC_UNKNOWNpage_poolsuspendinitfiles_structwrite_iterNR_ACTIVE_FILEs_dio_done_wqDROP_SLAB_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type_block_markbadmtimeserver_has_tasksvm_faultoom_score_adj_minkobj_uevent_envdisable_bgtfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memfm_eba_semTHP_FILE_FALLBACKpath_unpointst_sizermtpcheckedwait_sumnum_tracepoints_readupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqPGSCAN_KHUGEPAGEDDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerPGREUSEunlinkperiod_contribdfs_power_cut_minrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsfwnode_property_read_u32iopollTHP_MIGRATION_FAILpagesizes_blocksizevm_pgoffauprobe__retnuma_workupdate_timeptrace_dr7prioritybgt_thread_call_addrloginuidcheckTHP_FILE_MAPPEDexpiryoptimistic_spin_queuespin_unlockdl_defer_runningALLOCSTALL_NORMAL__lstate__compiletime_assert_84ro_modearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvTHP_MIGRATION_SUCCESSltree_lockmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfd_read_user_prot_regnr_wakeups_remotepebsllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextubi_vtbl_recordHTLB_BUDDY_PGALLOC_FAILwritesize_maskDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincountnvmem_devicetablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codethread_enabledqspinlockget_info__kmalloc_large_noproflru_genNR_VMSCAN_WRITEinsnfilldir_tubi_dump_vol_infoNUMA_PTE_UPDATESdl_non_contendingdir_contextPGFREEchrdev_locktracepoint_ptr_tutaskNR_UNEVICTABLEsched_entityd_spc_hardlimitlong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baseio_context_get_user_prot_infogpl_symsgroupseq_showPGSCAN_SKIP_DMAswait_queue_headcow_pageblockSWPOUT_ZEROi_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namemasternodeBALLOON_INFLATEvm_lockMTHP_STAT_NR_ANON_PARTIALLY_MAPPEDPGMIGRATE_SUCCESSno_cgroup_migrationMTHP_STAT_SPLIT_FAILEDnextevts_writers_key__countxcomp_bvcma_areaWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeworks_countshrinkerdl_yieldeddqi_formatCOMPACTFREE_SCANNEDexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentdevice_unregisteria_sizein_hrtirqs_master_keysMTHP_STAT_ANON_FAULT_FALLBACK_CHARGEubi_classpropertywchar_addr_bndkernel_symbolsubsys_datatv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineIS_ERRupd_receivedNR_SWAPCACHEstrcmpdfs_chk_iouser_cpus_ptrdevice_registerpi_top_taskdirect_writesNR_WRITEBACK_TEMPactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedfs_chk_fastmapdisable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidPGACTIVATEngroupsfree_file_info__kernel_time64_tNR_VM_NUMA_EVENT_ITEMSautaskuser_namespacevtbl_sizeget_currentvfsuid_traw_spinlocktimer_autosuspendscdev_device_delpudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsPGREFILLMTHP_STAT_ANON_FAULT_FALLBACKbuf_mutexkfreestatic_call_trampTHP_SWPOUTbtrace_seq_pp_mapping_padsa_maskrequest_queueKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenMTHP_STAT_SPLITcodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimeCOMPACTMIGRATE_SCANNEDsched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedmax_write_sizetracing_graph_pausepermcompat_robust_listktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidmove_to_putspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmUBI_VID_STATICfortify_memcpy_chkdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTmax_ecsp_offsetsrcu_cblist_invokingoops_panic_writei_lockd_nameget_ownershipUNEVICTABLE_PGMUNLOCKEDufdsexe_filenr_scannedpcp_listpid_linksfree_countvolumess_sysfs_nameq_size_fieldrefcountcdev_addvaddrrequestrw_hinttimeoutdma_configurelast_switch_timenum_classesorc_unwind_ipqc_dqblkmove_tommappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyremovePGSCAN_ANONs_magicdl_overrunallocd_parentpayloadac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openstart_prevent_timefwnode_property_read_u32_arraydevice_initializereadahead_control__kernel_gid32_tpeb_sizeNR_BOUNCEf_credmtd_oob_regionMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areaTHP_FAULT_FALLBACK_CHARGEdev_pagemapvid_hdr_offsetPGDEACTIVATEerasesizewritepagessched_statisticsheadfm_anchor__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclamp__compiletime_assert_326super_operations_suspendsplice_eofutil_avg___GFP_DMA_BITKSM_SWPIN_COPYrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockPGSCAN_SKIP_NORMALD_REAL_DATAUBI_VOLUME_UPDATEDpt_regsecc_strengthpipe_bufswritersNR_IOMMU_PAGESctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colordevres_lockwritesizebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESCOW_KSMFORTIFY_FUNC_memscanubi_eba_tablevm_private_dataio_bitmap__ret_onceuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasyncu_chari_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGESchardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecUNEVICTABLE_PGCLEAREDKSWAPD_LOW_WMARK_HIT_QUICKLYgraph_get_port_parentpartitionsUNEVICTABLE_PGRESCUED__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_aliasNR_SHMEM__iovcpumaskPGLAZYFREEDdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivevolume_dev_group__read_overflow2taintsclosidsum_exec_runtimes_rootsubi_dbg_chk_gend_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrworks__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountpage_freeNR_FILE_MAPPEDparentatimecopy_file_rangetask_cputime_atomicBALLOON_DEFLATEuser_definedkey_typeget_named_child_nodelaunder_foliocurr_targetis_suspendedubi_volume_notifydfs_dircorrected_bitflipsbursterroneous_peb_countetypeei_funcsmodule_kobjectactive_memcgdef_flagsuncorrectable_errorsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsdevice_get_named_child_nodeWORKINGSET_NODESlinux_binfmtpage_table_lock_sigfaultcountersname_linkNR_ANON_THPScmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_type__UNIQUE_ID_ddebug519policysharedTHP_SCAN_EXCEED_SWAP_PTEdismissattr_vol_typed_real_typelookahead_bandseq_startpeb_bufraw_lockd_dnameget_dqblkvol_id2idxremaindermax_hang_timecpus_maskubi_numsubdirstask_groupstarttimeubi_mkvol_reqmmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnameubi_volumerun_delaytailslineno__dynamic_pr_debugbase_pfnget_inode_aclpower_cut_max_addr_pkeycdev_initmigrate_foliocustom_sliceNR_ACTIVE_ANONNUMA_LOCALthread_keyringkparam_arrayutimestart_codeis_hardfsbasecompatiblemax_wl_pool_sizeclock_listattrsnuma_stat_itemALLOCSTALL_MOVABLEcpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axcompletesched_rt_entityout_acctimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpuPGDEMOTE_KSWAPDmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainupd_bytes_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_ti_blocksnuma_faults_localityout_sysfshas_child_subreaperdiv_u64_remi_acl___GFP_ZERO_BITubi_fastmap_layoutwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsqc_stateKCOMPACTD_MIGRATE_SCANNEDooblensoftirq_next_timerdump_stackcheck_flagsswp_entry_tuint64_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventNR_MLOCKset_performance_statephys_addr_tlookuptblclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryerasesize_shiftk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanPGPGINfs_parameter_specdesc_structdq_offmtd_debug_infoexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkBALLOON_MIGRATEpushDEV_DMA_COHERENTNR_ZONE_LRU_BASElinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotma_flagsdelayed_workmean_echiwater_rsskretprobe_instancesrange_max_bad_blocksfutex_exit_mutex__MTHP_STAT_COUNTkernfs_iattrs___GFP_WRITE_BITd_spacegraveyard_linkeraseregionsxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsIS_ERR_OR_NULLnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERconst_pcpu_hotreserved_pebsi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typeNUMA_FOREIGNbad_allowedi_rdevself_exec_idkernfs_opsfile_lockMTHP_STAT_NR_ANONMODULE_STATE_LIVEpairingnr_migrationsa_opsxa_flagsfreeze_raw_spin_lockbin_sizeNR_ZONE_WRITE_PENDINGclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXout_errnlinkpercpu_refscrubhorizontal_positionfw_volsattr_vol_usable_eb_sizepref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqTHP_UNDERUSED_SPLIT_PAGErefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploltreePGALLOC_DEVICEclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateUNEVICTABLE_PGCULLEDuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalfwnode_get_next_child_nodeworker_privateis_relassoc_array_ptrset_dqblkotp_infoTHP_SPLIT_PAGEkmalloc_typeqstrWORKINGSET_REFAULT_FILE___GFP_ZEROTAGS_BITPGSTEAL_KHUGEPAGEDorig_pmdvtblacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posNR_FILE_DIRTYnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsNR_LRU_BASEmtd_oob_opsalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_stateMTHP_STAT_SHMEM_FALLBACK_CHARGEtimerqueue_headlist_is_headhdrs_min_io_sizercharfutex_pi_statekstat__kernel_uid32_tubi_eba_destroy_tableDEVICE_FIXEDpte_tubi_vtbl_rename_volumesPGSTEAL_ANONdevice_driverdl_server_has_tasks_frunnable_sumreal_credCOMPACTISOLATEDget_namefwnode_endpointepoll_watcheswl_lockprealloc_ptePGALLOC_NORMALWORKINGSET_ACTIVATE_BASE_is_lockeddqb_curspace_entrygp_statebitsetload_avgaccesscstimecfs_rq_uidfm_work_scheduled_pointst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimitNR_WRITTENs_encodinggpl_crcsorc_entrykeyspeb_countorig_ptedqb_curinodesload__s8ZSWPINspin_lockinvalidate_lock_keydma_maskprealloc_mutexcdev_device_addnanosleep__already_donenode_stat_itemsrcu_gp_seq_neededpscr_ret__PGMAJFAULTdq_dqb_lock__kernel_ulong_tvolnamePSWPOUTdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignNR_THROTTLED_WRITTENbtime__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTPGALLOC_DMA32runtime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionto_be_torturedseq_stopvolume_dev_attrsdevice_set_nodeself_check_volumeskiocbKSWAPD_HIGH_WMARK_HIT_QUICKLYclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typewl_scheduledclass_device_is_conditionalmtd_pairing_infoshrinker_idrootubi_volume_descoom_reaper_list__UNIQUE_ID_ddebug517shutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countNR_SHMEM_THPSsig_okdelaysqf_ownerreadaheadkmalloc_cache_typeNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypefortify_memset_chksigpendingimage_seqfsindexshstksrcu_ssppage_orderwake_irqlast_eb_bytes__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32PGINODESTEALptracedtrc_reader_specialNUMA_HITHPROBE_GONEMTHP_STAT_SWPOUTactive_timeTHP_SPLIT_PAGE_FAILEDi_sequencedqb_ihardlimitd_lockrefsubpage_sftrpm_requestnum_bpf_raw_eventsaddrdevice_privatefail_perfTHP_ZERO_PAGE_ALLOC_FAILEDi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tf_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmoveHTLB_BUDDY_PGALLOCsched_contributes_to_loadvolidstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeecc_statstty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinedfs_dir_namepinned_vmwl_reboot_notifierTHP_ZERO_PAGE_ALLOC_head_2apsi_flagsaddressstart_boottimevm_starts_flagsfaultmigration_pendingec_hdr_alsizeshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusemtd_partp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgZSWPWBs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingfm_do_produce_anchorRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releaseubi_eba_create_tablealloc_locks_dquotfolioqUBI_READONLYprev_posNR_ISOLATED_FILEseqcount_spinlocks_securitystrncmpexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uid_syncchildrenrb_subtree_lastno_pm_callbacksbuild_id__p_lenPGMIGRATE_FAILdevice_get_match_datavfork_done___GFP_ACCOUNT_BITpud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memmax_pool_sizeerase_infoi_mtime_nsecperformancemmlistsuppress_bind_attrs_write_oobRPM_RESUMINGreg_offset_raw_spin_unlockgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesNR_ZONE_INACTIVE_FILEf_llistphandleemulate_bitflipsrename_listubi_resize_volumei_nlinkbranchused_blockswrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedNR_VM_EVENT_ITEMSfreeze_superPTR_ERRs_inode_list_locksweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabKCOMPACTD_FREE_SCANNEDdevice_typePGROTATEDmaj_fltarch_rwlock_tclock_basepower_cut_minSLABS_SCANNEDcdevmy_qgroup_leadermkdirattr_vol_alignmentnextentsattr_vol_namereal_blockedarg_lockooboffsnum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerexclusiveclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyNR_FREE_CMA_PAGESqrwlockSWAP_RAfile_ra_stateuser_structwork_semon_rq__p_size_fieldfs_context_erase_user_prot_regprealloc_bufbitflip_thresholdprojiddrop_inodenum_trace_evalsnum_vfllseekfind_volume_fwnodeDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasschk_fastmaplast_mm_cidcookieubi_change_vtbl_recordtargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuUNEVICTABLE_PGSTRANDEDilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrPGDEMOTE_DIRECTattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsfw_volrobust_listmove_fromsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockdev_links_infoloff_tthread_pidbgt_namesrcu_gp_seqCOMPACTSUCCESS_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevtrc_blkd_nodecalls_block_isreservedi_default_acls_uuid_lenioc_nodeof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secmatchnew_eba_tblmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tPGSCAN_SKIP_DEVICEFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmodule_state__write_overflow_fieldlast_used_athardirq_stack_ptrALLOCSTALL_DMAvm_endlast_queuednuma_migrate_retryuser_ns__statePSWPIN_rebootfirstiommu_groupmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrssuspendedhas_timeoutinvalidate_folionodemask_ti_modenr_thpsNUMA_HINT_FAULTS_LOCALia_ctimebbtblocksFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupxol_areaPGPROMOTE_SUCCESSrlockpcpu_hotfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtTHP_SCAN_EXCEED_NONE_PTEvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpout_unlockctimealignmentreleasemax_segment_sizesched_dl_entity_write__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_idPGALLOC_MOVABLENR_ZSPAGESs_dentry_lrubp_offsetfolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkvid_hdr_alsizeoom_flag_origincounterorc_unwindcorr_peb_countWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapfm_pooldonePGSCAN_ZONE_RECLAIM_FAILEDfscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotavtbl_slotseba_tbldl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intfm_bufnuma_preferred_nid_hugetlb_cgroupdentry_operationsupd_ebsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requesteddfs_chk_gencompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opis_deadsysv_shmdq_countupdatingutf8data_tableout_mappingfm_wl_poolset_latency_tolerance__func__resource_size_tfoliowake_entryTHP_SPLIT_PMDxa_headsuidemulate_power_cuti_readcountpq_headlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tbad_peb_countclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeglobal_sqnumparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_counters_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_idNR_VM_ZONE_STAT_ITEMSclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitmtd_erase_region_inforead_iterwritablef_ownerbp_regVTIME_USERsa_flagstest__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invotp_factory_nvmemDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guest_get_devicedevice_physical_locationpm_domain_datapoll_table_structdirect_IOCMA_ALLOC_FAILcurrent_may_mountseqlock_tnuma_scan_offsetMTHP_STAT_ANON_FAULT_ALLOC_put_devicefast_attach___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskreadersch_lnumNR_INACTIVE_FILE__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTAi_private_listia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secdfs_emulate_bitflipsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITUNEVICTABLE_PGSCANNEDactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpids_eraseFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_start__flagsp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidNR_UNACCEPTEDattribute_groupcontextposix_timersTHP_COLLAPSE_ALLOCselectorMEMORY_DEVICE_PRIVATEoobbufdev_releasedefault_timer_slack_nsubi_rename_entrysource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refvid_hdr_shiftpmdval_t___GFP_NOFAIL_BITname_lengroup_infovdso_imageUBI_VID_DYNAMICubi_add_volumefileof_match_tableused_bytespercpu_count_ptr__user_state_sizemce_kill_meuuid_tproperty_read_int_array___GFP_UNUSED_BITKSWAPD_INODESTEALcount_objectsq_size_stimezone_device_dataf_wb_erruseddefparamfred_csfault_flagemulate_io_failureskprojid_tptracer_credtlb_genstorepage_mkwritebeb_rsvd_pebskobjectaudit_ttypnummce_ripvstatfsdma_skip_syncDROP_PAGECACHEnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistTHP_SPLIT_PUDclass_groupsnuma_nodePGSCAN_FILEi_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_t__compiletime_assert_12__compiletime_assert_13__compiletime_assert_14ioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchanged__compiletime_assert_19watch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opssequential_io__compiletime_assert_20__compiletime_assert_21__compiletime_assert_100_large_mapcount__compiletime_assert_102__compiletime_assert_103sda_is_static__compiletime_assert_105__compiletime_assert_106__compiletime_assert_107__compiletime_assert_108__compiletime_assert_109formatold_eba_tblftopenclaveALLOCSTALL_DMA32PGLAZYFREEsp_regcreateiattrMTHP_STAT_SHMEM_FALLBACKrseqecc_step_sizenfdssigvalvma_lockperf_event_list__compiletime_assert_110__compiletime_assert_111vol_idget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadUBI_VOLUME_ADDED_write_user_prot_regself_check_volumed_real_lockUBI_VOLUME_RESIZEDPGSCAN_ZONE_RECLAIM_SUCCESSexpiry_activedqi_max_spc_limitexception_table_entryevent_countcorrectedpreempt_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderMTHP_STAT_ZSWPOUTtimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startemulate_failuresblocksset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_listdevice_dma_supportedd_ino_warnshiwater_vmtracepointubi_namecompound_headUBI_DYNAMIC_VOLUMEia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writers__compiletime_assert_82__compiletime_assert_83ino_timelimit__compiletime_assert_85__compiletime_assert_86__compiletime_assert_87splice_write__compiletime_assert_89i_rt_spc_timelimitTHP_FILE_ALLOC_read_fact_prot_regcss_setqf_nextranges__compiletime_assert_90__compiletime_assert_91__compiletime_assert_92__compiletime_assert_93__compiletime_assert_94__compiletime_assert_95__compiletime_assert_96iommu_mm__compiletime_assert_98__compiletime_assert_99cutimeem_tableNUMA_HUGE_PTE_UPDATESpersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtirq_domainattr_vol_upd_markersigned charpriopropnameprivgetattrsched_infoMTHP_STAT_SHMEM_ALLOCd_fieldmaskubi_deviceuprobe_xol_opsseq_filefreeze_noirqUBI_VOLUME_RENAMEDNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixups__UNIQUE_ID_ddebug523file_operations__UNIQUE_ID_ddebug525__UNIQUE_ID_ddebug527KMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tNUMA_PAGE_MIGRATEsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampubi_vol_cdev_operationsfuncsend_dataPGSTEAL_KSWAPDsync_stateki_posexecute_only_pkeydfs_disable_bgtFAULT_FLAG_RETRY_NOWAITsyncupd_markersetleasepinspacct_structmust_resumelong intfile_lock_contextusagel_yesPGALLOC_DMAsiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimeuidhash_nodefred_ssproperty_present__kmalloc_index__write_overflowUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typechk_ioruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegidiomapdq_hashdiv_u64put_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirtynum_srcu_structsbdi_writebackkobj_completionooblayoutckvol_mutex__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytesattr_vol_corruptedsrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobe__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenNR_ZONE_UNEVICTABLE_read_oobclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEubi_remove_volumeget_reference_argssrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyubi_eba_replace_tableNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvolNR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_id_unlockfwnode_handle_putsrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infop_lensuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkskip_checkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountTHP_FAULT_FALLBACKrestore_noirqdfs_emulate_power_cutpower_cut_counterki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGY__compiletime_assert_518rlimread_folionr_events__vpp_verifyiommuprivatewritebufsizest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctx__compiletime_assert_524__compiletime_assert_526__compiletime_assert_528splice_pipe__be16s_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodsnew_nametqheads_activechk_genMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangeput_devicenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_taskUBI_VOL_SKIP_CRC_CHECK_FLGtask_worksmemory_failurerb_root_cachedvolume_dev_groups__be32s_copPGSTEAL_DIRECTdd_key_truezone_stat_itemhres_activebpf_raw_eventsdq_dirtydl_deferbug_listbeb_rsvd_leveldirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxmthp_stat_itemrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateMTHP_STAT_SWPINis_late_suspendedsysvsemTHP_FAULT_ALLOClockmapignore_childrenrestore_earlyclock_mutexfs_supersUBI_METAONLYdqb_bsoftlimitpendingf_task_workfm_protect___GFP_NORETRY_BITiowait_countcorruptedmax_erroneousPGFAULTnotifier_blockdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesbad_peb_limitearly_initmprotectsecurityxmm_spaceubi_erractivatef_pos_locksuspend_noirqPGSTEAL_FILEi_fieldmaskattr_vol_data_bytestls_arrayownerpfo_val__acct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITi_bytesdomain_datarelax_countline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seubi_eba_unmap_lebElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_tvol_counticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchmap_pagesreschedule_countvfsmountdfs_emulate_failuresextable_basenoinstr_text_sizenargsattributesvfreecopy_from_userset_child_tid_overruntmpfilercu_read_lock_nestingem_perf_stateleb_sizetick_dep_masklist_copy_from_userthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugretlenupd_bufof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_toobsizefilesdqb_bhardlimitliveatomic_write_unit_maxusable_leb_sizerun_listixolsym_vvar_pagemodule_sect_attrsused_ebsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesfm_workdescseqcountoom_score_adjd_seqia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sum__UNIQUE_ID_ddebug521freeze_ucounti_ctime_nsecs_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_link_lock_user_prot_regfmode_tvolumes_lockcputime_atomicrestoredelayed_callmax_nr_cid_statusd_sibkernel_ulong_tdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stateleb_startgsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countfm_pool_rsv_cntreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasewritesize_shiftscan_objectspid_typewb_errcputimertrace_recursionstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinschanging_lebattrget_next_child_nodeFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDmtd_ecc_statsget_wunitfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_nodepercpu_ref_datadividenddestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSmetaonlysyscore__s64dqi_bgrace__kernel_pid_t__compiletime_assert_88static_call_mod_timerdma_map_opsma_external_lock_panic_writedevice_physical_location_paneluid_toobretlenflush_requiredsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_pools_addr_lsbi_generation_sigpollmxcsrdevtd_rt_spc_hardlimitnumeraseregionsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_head__bad_copy_fromdev_pm_qosmap_typef_opnor_flashpids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizedq_sbarch_static_branchsighand_structerroneousflagsi_lock_keykmem_cacheinodedrivers_dirubi_leb_change_reqbug_entrygood_peb_countcmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenget_policyHRTIMER_RESTARTsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbers_softexpiresvol_typekey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsdata_pad_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contextflash_sizetlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesubi_fm_poolthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherscompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structcnivcswbin_attrs_newdatbufruntime_idleiov_basesrcu_size_jiffiesi_statesched_classmultiprocessubi_wl_flushpi_waitersvid_hdr_aloffsetexp_hintd_childrenis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabdfs_emulate_io_failureswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infofail_addrref_counterror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringotp_user_nvmemcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointersect_attrsonlineruntime_resumedup_xol_workautoresize_vol_idMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmtd_mastergfp_tseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexcrcspgdval_tsetattr__bad_copy_tof_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstateavail_pebswait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysoobavaildevice_mutexsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDshared_pendingexpiresrcuwaitnivcswubi_wl_entryMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_minmtd_pairing_schemedivisors_devcpus_allowed_lockget_next_idrwlock_tpgprotfalsed_weak_revalidateremovedfm_disabledshow_pathmove_mutexUBI_STATIC_VOLUMEDL_DEV_DRIVER_BOUNDPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structnvmemsequencert_spc_warnlimitac_flag_block_isbadcoredump_datatasks_pidaddress_spacemm_context_talc_mutex__call_single_nodestartupseqcount_spinlock_ti_wbreboot_notifieruint8_tpanelclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDrsvd_pebsbpf_ctxd_pruneprintedresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_folioubi_start_updatelast_busyi_pipe_writevbase_resumehostuaddrerasesize_masks_wb_errshm_clistis_child_subreapercall_depthunicode_mapgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfodfs_emulate_power_cutalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidmtd_req_statspairrseq_sigubi_debug_infodev_pm_domainlimit0limit1dqi_max_ino_limitis_sourcemigrate_modemax_bitflipspoweroff_latemtd_ooblayout_opsftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_map__compiletime_assert_520alloc_dquot__compiletime_assert_522pm_messagemay_splitmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountfm_sizeGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_base__compiletime_assert_530pipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsdfs_power_cut_maxvtbl_recslicesas_ss_spnr_dirtiednum_kprobe_blacklistnumblockss_vfs_rename_mutexsuspend_latewakeup__check_object_sizecg_listsrcu_barrier_completiondriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidmin_io_size_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retries_get_fact_prot_infosigval_tpartitions_lockalimitundo_listdirty_foliomissedquota_readst_shndxfreeparti_wb_frn_avg_timefile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type_block_markbadmtimeserver_has_tasksvm_faultoom_score_adj_minkobj_uevent_envdisable_bgtfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memfm_eba_sempath_unpointst_sizermtpcheckedwait_sumnum_tracepoints_readupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribdfs_power_cut_minrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollpagesizes_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7prioritybgt_thread_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstate__compiletime_assert_84ro_modearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvltree_lockmce_addrnum_bugsqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfd_read_user_prot_regnr_wakeups_remotepebsllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextubi_vtbl_recordwritesize_maskDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincountnvmem_devicetablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfromend_codethread_enabledqspinlockget_infolru_geninsnfilldir_tdl_non_contendingdir_contextchrdev_locktracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextubi_start_leb_change_get_user_prot_infogpl_symsgroupseq_showswait_queue_headcow_pageblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namemasternodevm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areastatic_priomay_skip_resumeworks_countshrinkerdl_yieldeddqi_formatexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyspropertywchar_addr_bndkernel_symbolsubsys_datatv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineupd_receiveddfs_chk_iouser_cpus_ptrpi_top_taskdirect_writesactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedfs_chk_fastmapdisable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevtbl_sizeget_currentvfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsbuf_mutexstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlencodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimesched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedmax_write_sizeubi_calc_data_lentracing_graph_pausepermcompat_robust_listktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidmove_to_putspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTmax_ecsp_offsetsrcu_cblist_invokingoops_panic_writei_lockd_nameget_ownershipufdsexe_filenr_scannedubi_more_update_datapcp_listpid_linksfree_countvolumess_sysfs_namerefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipqc_dqblkmove_tommappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentpayloadac_minflti_sbd_sbcommcan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openstart_prevent_timelnumreadahead_control__kernel_gid32_tpeb_sizekernfs_open_filef_credmtd_oob_regionMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapvid_hdr_offseterasesizewritepagessched_statisticsheadfm_anchor__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclampsuper_operations_suspendsplice_eofcheck_copy_sizeutil_avgrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATApt_regsecc_strengthpipe_bufswritersto_userKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colordevres_lockwritesizebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESFORTIFY_FUNC_memscanubi_eba_tablevm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasyncu_chari_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecgraph_get_port_parentpartitions__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrworksfreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freeparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typecopy_overflowget_named_child_nodelaunder_foliocurr_targetis_suspendeddfs_dircorrected_bitflipsbursterroneous_peb_countetypeei_funcsmodule_kobjectactive_memcgdef_flagsuncorrectable_errorsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetmutex_lockarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkcmaxrsstimer_slack_ns__UNIQUE_ID_ddebug517bus_type__UNIQUE_ID_ddebug519policyshareddismissd_real_typelookahead_bandseq_startpeb_bufraw_lockd_dnameget_dqblkremaindermax_hang_timecpus_maskubi_numsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnameubi_volumerun_delaytailslineno__dynamic_pr_debugbase_pfnget_inode_aclpower_cut_max_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimeubi_more_leb_change_datastart_codeis_hardfsbasecompatiblemax_wl_pool_sizeclock_listattrscpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainupd_bytes_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_ti_blocksnuma_faults_localityhas_child_subreaperdiv_u64_remi_aclmemsetubi_fastmap_layoutwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsqc_stateubi_eba_atomic_leb_changeooblensoftirq_next_timerdump_stackcheck_flagsswp_entry_tuint64_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventset_performance_statephys_addr_tlookuptblclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryerasesize_shiftk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offmtd_debug_infoexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treedentryto_writecpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workmean_echiwater_rsskretprobe_instancesrange_max_bad_blocksfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkeraseregionsxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsnvcswwatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERconst_pcpu_hotreserved_pebsi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typebad_allowedi_rdevself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEpairingnr_migrationsa_opsxa_flagsfreezebin_sizeclosedev_dma_attrgrphid_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkpercpu_refscrubhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploltreeclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrotp_infoqstrma_flagsfutex_stateorig_pmdvtblacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsmtd_oob_opsalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headhdrs_min_io_sizercharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointepoll_watcheswl_locknon_rcu_is_lockeddqb_curspace_entrygp_statebitsetload_avgaccesscstimecfs_rq_uidfm_work_scheduled_pointst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeyspeb_countorig_ptedqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutexFORTIFY_FUNC_kmemduppscr_ret__dq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtime__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionto_be_torturedseq_stopkiocbflush_lenclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typewl_scheduledclass_device_is_conditionalmtd_pairing_infoshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadmutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypefortify_memset_chksigpendingimage_seqfsindexshstksrcu_ssppage_orderwake_irqlast_eb_bytes__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequencedqb_ihardlimitd_lockrefsubpage_sftrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_requbi_eba_write_leb_stchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tf_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeecc_statstty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinedfs_dir_namepinned_vmwl_reboot_notifier_head_2apsi_flagsaddressstart_boottimevm_startsrcu_gp_seq_neededs_flagsfaultmigration_pendingec_hdr_alsizeshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusemtd_partp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendingfm_do_produce_anchorRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uid_syncchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_donenanosleeppud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memmax_pool_sizeerase_infoi_mtime_nsecperformancemmlistset_dqblksuppress_bind_attrs_write_oobRPM_RESUMINGreg_offsetgsbases_quota_typesf_llistdtypephandleemulate_bitflipsi_nlinkbranchused_blockswrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basepower_cut_mincdevmy_qgroup_leadermkdirnextentsreal_blockedarg_lockooboffsnum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerexclusiveclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structwork_semon_rqfs_context_erase_user_prot_regprealloc_bufbitflip_thresholdprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasschk_fastmaplast_mm_cidcookieubi_change_vtbl_recordtargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrattributerestrict_linkdev_archdatai_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listmove_fromsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockdev_links_infoloff_tthread_pidbgt_namesrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcalls_block_isreservedi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmodule_state__write_overflow_fieldlast_used_athardirq_stack_ptrvm_endlast_queuednuma_migrate_retryuser_ns__state_rebootfirstiommu_groupmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrssuspendedhas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimebbtblocksFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexubi_eba_write_lebi_private_dataElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupxol_arearlockpcpu_hotfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtset_update_markervm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpctimealignmentreleasemax_segment_sizesched_dl_entity_write__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkvid_hdr_alsizeoom_flag_origincounterorc_unwindcorr_peb_countWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapfm_pooldonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotavtbl_slotseba_tbldl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intfm_bufnuma_preferred_nid_hugetlb_cgroupdentry_operationsupd_ebsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requesteddfs_chk_gencompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opis_deadsysv_shmdq_countupdatingutf8data_tablefm_wl_poolset_latency_tolerance__func__resource_size_tfoliowake_entryxa_headsuidemulate_power_cuti_readcountpq_headlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tbad_peb_countclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeglobal_sqnumparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_counters_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_idclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitmtd_erase_region_inforead_iterwritablef_ownerbp_regVTIME_USERsa_flagstestFORTIFY_FUNC_memchr_invotp_factory_nvmemDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guest_get_devicedevice_physical_locationpm_domain_datapoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offset_put_devicefast_attachkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskreadersch_lnum__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTAi_private_listia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secdfs_emulate_bitflipsqc_type_statekey_serial_tdev_ueventsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpids_eraseFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_start__flagsp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectorMEMORY_DEVICE_PRIVATEoobbufdev_releasedefault_timer_slack_nssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refvid_hdr_shiftpmdval_t__copy_overflowname_lengroup_infovdso_imagefileof_match_tableused_bytespercpu_count_ptr__user_state_sizemce_kill_mevmalloc_noprofuuid_tproperty_read_int_arraycount_objects_stimezone_device_dataf_wb_errdefparamfred_csfault_flagemulate_io_failureskprojid_tptracer_credtlb_genstorepage_mkwritebeb_rsvd_pebskobjectaudit_ttypnummce_ripvstatfsnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavesp_regcreateiattrrseqecc_step_sizenfdssigvalvma_lockperf_event_listvol_idget_reserved_spacestack_refcountinvalidate_lockbmapkey_payload_write_user_prot_regd_real_lockexpiry_activedqi_max_spc_limitexception_table_entryevent_countcorrectedpreempt_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimitcheck_object_sizei_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startemulate_failuresblocksset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_listdevice_dma_supportedd_ino_warnshiwater_vmtracepointubi_namecompound_headUBI_DYNAMIC_VOLUMEia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writers__compiletime_assert_82__compiletime_assert_83ino_timelimit__compiletime_assert_85__compiletime_assert_86__compiletime_assert_87splice_write__compiletime_assert_89i_rt_spc_timelimit_read_fact_prot_regqf_nextranges__compiletime_assert_90__compiletime_assert_91iommu_mmcutimeem_tablepersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmaskubi_deviceuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixups__UNIQUE_ID_ddebug523file_operations__UNIQUE_ID_ddebug525__UNIQUE_ID_ddebug527__UNIQUE_ID_ddebug529no_pmgroup_stop_countalloc_tag_killktime_tclear_update_markersymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbs__UNIQUE_ID_ddebug531max_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeydfs_disable_bgtFAULT_FLAG_RETRY_NOWAITsyncupd_markersetleasepinspacct_structmust_resumelong intfile_lock_contextusagel_yessiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimeuidhash_nodefred_ssproperty_present__write_overflowUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typechk_ioruntime_statusin_iowaitunregfuncegidiomapdq_hashdiv_u64put_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirtynum_srcu_structsbdi_writebackkobj_completionooblayout__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobe__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirq_read_oobclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpygfp_maskpi_state_listrcu_segcblistsubvolusedfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_id_unlocksrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTwrite_lebbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkskip_checkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqpower_cut_counterki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGY__compiletime_assert_518rlimread_folionr_events__vpp_verifyiommuprivatewritebufsizest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctx__compiletime_assert_524__compiletime_assert_526__compiletime_assert_528splice_pipe__be16s_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seq__compiletime_assert_532DEVICE_PANEL_RIGHTmodstqheads_activechk_genMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cached__be32s_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listbeb_rsvd_leveldirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemlockmapignore_childrenrestore_earlyclock_mutexfs_supersdqb_bsoftlimitpendingf_task_workfm_protectiowait_countcorruptedmax_erroneousnotifier_blockdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesbad_peb_limitearly_initmprotectsecurityxmm_spaceactivatef_pos_lockckvol_mutexi_fieldmasktls_arrayownerpfo_val__acct_rss_mem1need_mbvm_flags_trefcount_structi_bytesdomain_datarelax_countdevice_attribute___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrZSWPOUTcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimit__UNIQUE_ID_description552xregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocdev_reserved_for_badparametersNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsNUMA_INTERLEAVE_HITneed_qsswap_deactivateblkcnt_tvol_counticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountdfs_emulate_failuresextable_baseUBI_VOLUME_REMOVEDnoinstr_text_sizenargsattributesMTHP_STAT_SWPOUT_FALLBACKvfreeset_child_tidNUMA_HINT_FAULTS_overruntmpfilercu_read_lock_nestingem_perf_stateleb_sizetick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugretlenPGSCAN_SKIP_DMA32upd_bufof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateubi_debugfs_init_devUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tDIRECT_MAP_LEVEL3_SPLIToobsizefilesmtd_devsdqb_bhardlimitliveatomic_write_unit_maxusable_leb_sizerun_listixolsym_vvar_pagemodule_sect_attrsused_ebsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesfm_workdescseqcounttokenoom_score_adjd_seqia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEanywayclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seubi_init_attach__init_rwsemget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsec__UNIQUE_ID_ddebug524s_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_link_lock_user_prot_regfmode_tvolumes_lockcputime_atomicrestoredelayed_callmax_nr_cid_statusd_sibkernel_ulong_tdma_opsTHP_COLLAPSE_ALLOC_FAILEDbin_attributemin_align_maskpercpu_counterubiblock_exitdev_groupsnuma_pages_migrateddl_dev_stateleb_startgsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countPGPGOUTfm_pool_rsv_cntreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasewritesize_shiftscan_objectspid_typewb_errcputimertrace_recursionstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerubi_devices_lockdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinschanging_lebattrget_next_child_nodeFAULT_FLAG_WRITEubi_notify_addstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDmtd_ecc_statsget_wunitfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_sym__UNIQUE_ID___addressable_init_module548latch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSmetaonlysyscore__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lock_panic_writedevice_physical_location_paneluid_toobretlenflush_requiredsum_block_runtimepgmapmin_perf_statestrnlendq_opmtd_can_have_bbrcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatget_bad_peb_limitdma_pools_addr_lsbi_generation_sigpollmxcsrdevtd_rt_spc_hardlimitnumeraseregionsNR_ZONE_ACTIVE_FILEnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qosmap_typef_opnor_flashpids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizedq_sbNR_FILE_THPSarch_static_branchsighand_structerroneousflagsi_lock_keykmem_cacheinodedrivers_dirubi_notify_allNR_ZONE_ACTIVE_ANONbug_entrygood_peb_count___GFP_NOWARN_BITcmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirubi_fastmap_destroy_checkmapsockhash_lenget_policyUBI_VOLUME_SHUTDOWNHRTIMER_RESTARTsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbers_softexpiresvol_typekey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messageNUMA_OTHERnum_trace_eventsdata_pad_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contextflash_sizetlbflush_unmap_batchsoft__sifieldsDIRECT_MAP_LEVEL2_SPLIT__get_mtd_devicercu_read_unlock_specialread_bytes__compiletime_assert_200__compiletime_assert_201__compiletime_assert_202__compiletime_assert_203__compiletime_assert_204__compiletime_assert_205__compiletime_assert_206fsverity_operations__compiletime_assert_208wake_q_noderequest_key_authvirtual_dr6THP_DEFERRED_SPLIT_PAGEkprobes_text_sizestatic_call_sitesTHP_FILE_FALLBACK_CHARGEubi_fm_poolthread_group_cputimerdev_max_vol_countnuma_scan_period_maxbadblocksstart_stackTHP_SWPOUT_FALLBACKwatcherskmalloc_cachescompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constant__baseFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeubi_volume_infopm_subsys_dataWORKINGSET_REFAULT_ANONget_dquotsnum_orcsclass_task_lock_is_conditionalubi_warnFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotversion_showd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structubi_free_internal_volumescnivcswmtd_dev_parambin_attrs_newdatbufuif_initruntime_idle__builtin_memcpyiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersPGSCAN_DIRECTvid_hdr_aloffsetexp_hintd_childrendirty_foliois_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabPGSCAN_SKIP_MOVABLEdfs_emulate_io_failureswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infofail_addr__UNIQUE_ID_version551ubi_free_volumeref_counterror_remove_folioold_time32_tcore_kallsymsmemcpysrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2backstate_add_uevent_sentOOM_KILLi_hashresulthlist_nodesprintfio_uringotp_user_nvmemcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setkzalloc_noprofrcuwaitCOMPACTFAILbio_listwrite_dquotclass_read_lock_irq_is_conditionalNUMA_MISSioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESubi_debugfs_exitsect_attrsonlineruntime_resumedup_xol_workKCOMPACTD_WAKE___GFP_WRITE_BITautoresize_vol_idMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumeUBI_VTBL_SKIP_CRC_CHECK_FLGd_spc_softlimitreported_split_lockmtd_mastergfp_tseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexNR_PAGETABLEcrcsUNEVICTABLE_PGMLOCKEDpgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_complete__UNIQUE_ID_mtd550vtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEcredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operations__put_mtd_devicespinlock_t__kmem_cache_create__task_fpstateubi_msgavail_pebswait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultubi_enumerate_volumeskstatfssitesubi_class_groupDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connectorunregister_mtd_user_sigsysoobavailuse_freeptr_offsetdevice_mutexsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDkmem_argsshared_pendingexpires___GFP_HARDWALL_BITnivcswubi_wl_entryMODULE_STATE_GOINGdev_set_nameDL_DEV_UNBINDINGthreadsym_timens_pages_time_minmtd_pairing_schemes_devcpus_allowed_lockget_next_idrwlock_tpgprotfalseout_freed_weak_revalidateremovedfm_disabledshow_pathmove_mutexDL_DEV_DRIVER_BOUNDPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datavm_event_itemmce_countswap_info_structnvmemsequencert_spc_warnlimitac_flagsched_rt_mutexblocking_notifier_headcoredump_datatasks_pidaddress_spacemm_context_talc_mutex__call_single_nodestartupseqcount_spinlock_tubi_notificationi_wbreboot_notifieruint8_tpanelclass_idinactive_timer_pkeyfilenames_export_opMTHP_STAT_SPLIT_DEFERRED__mptri_flctxstashedvm_page_prottimespec64PIDTYPE_SIDrsvd_pebsbpf_ctxd_pruneprintedresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipe_writevbase_resumehostuaddrerasesize_masks_wb_errshm_clistis_child_subreapercall_depthunicode_mapgraph_get_remote_endpointnum_descsTHP_MIGRATION_SPLITexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeUBI_VTBL_AUTORESIZE_FLGuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidmtd_req_statspairmisc_registerrseq_sigubi_debug_infodev_pm_domainubi_detach_mtd_devlimit0limit1dqi_max_ino_limitmigrate_modemax_bitflipsSWAP_RA_HITpoweroff_latemtd_ooblayout_opsftrace_callsiteskern_pathd_hashis_confidentialdl_bwlimit__real_strnlenkobjfsyncmtd_infoi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountfm_sizeGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuCOMPACTSTALLhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowkernfs_open_fileunsigned charumount_beginvdsommap_legacy_basePAGEOUTRUN__compiletime_assert_531THP_SCAN_EXCEED_SHARED_PTEpipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsdfs_power_cut_maxSWPIN_ZEROvtbl_recslicesas_ss_spNR_ZONE_INACTIVE_ANONnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BITNR_FREE_PAGESnumblocks___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listsrcu_barrier_completionshrink_control__compiletime_assert_58driver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidenable_fmmin_io_size_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retries_get_fact_prot_infoopen_mtd_devicePGSCAN_DIRECT_THROTTLEsigval_tpartitions_lockalimitundo_listKMALLOC_RANDOM_STARTALLOCSTALL_DEVICEmissedquota_readst_shndxfreeparti_wb_frn_avg_timePGSCAN_KSWAPDfile_ref_tCMA_ALLOC_SUCCESStypemembarrier_statepage_poolsuspendinitfiles_structwrite_iterNR_ACTIVE_FILEs_dio_done_wqDROP_SLAB_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type_block_markbadmtimeserver_has_tasksvm_faultoom_score_adj_minkobj_uevent_envdisable_bgtfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memfm_eba_semTHP_FILE_FALLBACKpath_unpointst_sizermtpcheckedwait_sumnum_tracepoints_readupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqPGSCAN_KHUGEPAGEDDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerPGREUSEunlinkperiod_contribdfs_power_cut_minrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollTHP_MIGRATION_FAILpagesizeubi_device_infos_blocksizevm_pgoff__remauprobe__retnuma_workupdate_timeptrace_dr7prioritybgt_thread_call_addrloginuidcheckTHP_FILE_MAPPEDexpiryoptimistic_spin_queuespin_unlockdl_defer_runningALLOCSTALL_NORMAL__lstatero_modearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvTHP_MIGRATION_SUCCESSltree_lockmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfd_read_user_prot_regnr_wakeups_remotepebsout_detachllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextbytes_str_to_intubi_vtbl_recordHTLB_BUDDY_PGALLOC_FAILwritesize_maskDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincountnvmem_devicetablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfromend_codethread_enabledqspinlockget_info__kmalloc_large_noproflru_genNR_VMSCAN_WRITEinsnfilldir_tNUMA_PTE_UPDATESdl_non_contendingdir_contextPGFREEchrdev_locktracepoint_ptr_tutaskNR_UNEVICTABLEsched_entityd_spc_hardlimitlong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baseio_context_get_user_prot_infogpl_symsgroupseq_showPGSCAN_SKIP_DMAswait_queue_headcow_pageubi_wl_entry_slabblockSWPOUT_ZEROi_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namemasternodeBALLOON_INFLATEvm_lockMTHP_STAT_NR_ANON_PARTIALLY_MAPPEDPGMIGRATE_SUCCESSno_cgroup_migrationMTHP_STAT_SPLIT_FAILEDnextevts_writers_key__countxcomp_bvcma_areaWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeworks_countshrinkerdl_yieldeddqi_formatCOMPACTFREE_SCANNEDexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keysMTHP_STAT_ANON_FAULT_FALLBACK_CHARGEubi_classpropertywchar_addr_bndkernel_symbolsubsys_datatv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineIS_ERRupd_receivedNR_SWAPCACHEdfs_chk_iouser_cpus_ptrpi_top_taskdirect_writesNR_WRITEBACK_TEMPactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedfs_chk_fastmapdisable_depthmax_beb_per1024i_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidPGACTIVATEngroupsfree_file_info__kernel_time64_tNR_VM_NUMA_EVENT_ITEMSput_mtd_deviceautaskuser_namespacevtbl_sizeget_currentvfsuid_traw_spinlocktimer_autosuspendscdev_device_delpudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flags_printkPGREFILLstrcpyMTHP_STAT_ANON_FAULT_FALLBACKbuf_mutexkfreestatic_call_trampTHP_SWPOUTbtrace_seq_pp_mapping_padsa_maskrequest_queueKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenMTHP_STAT_SPLITcodegtimeclass_attributesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimeCOMPACTMIGRATE_SCANNED__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedmax_write_sizetracing_graph_pausepermcompat_robust_listubi_do_get_device_infoktypelockrefin_dpm_list__UNIQUE_ID___addressable_cleanup_module549srcu_struct_ptrsmm_structvlagi_uidubi_major2nummove_to_putpfo_val__spinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mm__kmem_cache_create_argsdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTmax_ecsp_offsetsrcu_cblist_invokingoops_panic_writei_lockd_nameget_ownershipUNEVICTABLE_PGMUNLOCKEDufdsexe_fileblocking_notifier_call_chainnr_scannedpcp_listpid_linksfree_countvolumess_sysfs_namerefcountvaddrrequestrw_hinttimeoutdma_configurelast_switch_timenum_classesorc_unwind_ipqc_dqblkmove_tommappedseqcount_raw_spinlockmtd_numkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersubi_update_fastmapi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startkstrtointf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifiersubi_ctrl_cdevsrcu_last_gp_ends_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyremovePGSCAN_ANONs_magicdl_overrunallocd_parentpayloadac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openubi_put_devicestart_prevent_timedevice_initializereadahead_controldev_eraseblock_sizeubi_dev_group__kernel_gid32_tpeb_sizeNR_BOUNCEf_credmtd_oob_regionMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesubi_get_deviceread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areaTHP_FAULT_FALLBACK_CHARGEdev_pagemapis_power_of_2vid_hdr_offsetPGDEACTIVATEerasesizewritepagessched_statisticsheadfm_anchor__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclampsuper_operations_suspendsplice_eofubi_devicesutil_avg___GFP_DMA_BITKSM_SWPIN_COPYrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockPGSCAN_SKIP_NORMALD_REAL_DATAUBI_VOLUME_UPDATEDpt_regsecc_strengthpipe_bufswritersNR_IOMMU_PAGESctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colordevres_lockwritesizebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESCOW_KSMFORTIFY_FUNC_memscanubi_eba_table_cond_reschedvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasyncu_chari_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGESchardomainunix_inflightholders_dirfpu_state_perm__param_str_mtdi_fsnotify_maskbio_vecUNEVICTABLE_PGCLEAREDKSWAPD_LOW_WMARK_HIT_QUICKLYgraph_get_port_parentpartitionsUNEVICTABLE_PGRESCUED__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_aliasNR_SHMEM__iovcpumaskPGLAZYFREEDdumperwakeirqclass_mutex_intr_is_conditionalplist_nodedev_total_eraseblocksxarraycap_effectivedev_ro_modetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrworks__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountpage_freeNR_FILE_MAPPEDparentatimecopy_file_rangetask_cputime_atomicBALLOON_DEFLATEuser_definedkey_typekthread_create_on_nodeget_named_child_nodelaunder_foliocurr_targetis_suspendedubi_volume_notifydfs_dir__keycorrected_bitflipsbursterroneous_peb_countetypeei_funcsmodule_kobjectactive_memcgdef_flagsuncorrectable_errorsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetmutex_lockarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsWORKINGSET_NODESlinux_binfmtpage_table_lock_sigfaultcountersname_linkNR_ANON_THPScmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_typepolicysharedTHP_SCAN_EXCEED_SWAP_PTEdismissd_real_typelookahead_bandseq_startpeb_bufraw_lockd_dnameget_dqblkout_volumesmax_hang_timecpus_maskubi_numsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnameubi_volumerun_delaytailslineno__dynamic_pr_debugbase_pfnstatdev_attribute_showget_inode_aclpower_cut_max_addr_pkeycdev_initmigrate_foliocustom_sliceNR_ACTIVE_ANONNUMA_LOCAL__UNIQUE_ID_ddebug530thread_keyring__UNIQUE_ID_ddebug534kparam_arrayutime__UNIQUE_ID_ddebug538start_codeis_hardfsbasecompatiblemax_wl_pool_sizeclock_listattrsnuma_stat_itemALLOCSTALL_MOVABLEcpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axdev_bad_peb_countcompletesched_rt_entityubi_devices_mutextimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpuPGDEMOTE_KSWAPDmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainupd_bytes_sigchldubi_free_volumes_fromfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_ti_blocksnuma_faults_localityhas_child_subreaperubi_cdev_operationsi_acl___GFP_ZERO_BITubi_fastmap_layoutwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsqc_stateKCOMPACTD_MIGRATE_SCANNEDooblensoftirq_next_timerdump_stackcheck_flagsswp_entry_tuint64_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventNR_MLOCKubi_mtd_param_parseset_performance_statephys_addr_tlookuptblclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryerasesize_shiftk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanclass_registerPGPGINfs_parameter_specdesc_structdq_offmtd_debug_infoexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aout_debugfsdma_cleanupmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkBALLOON_MIGRATEpushDEV_DMA_COHERENTNR_ZONE_LRU_BASElinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotdisable_fmcss_setdelayed_workmean_echiwater_rsskretprobe_instancesdev_bgt_enabledrange_max_bad_blocksfutex_exit_mutexget_mtd_device__MTHP_STAT_COUNTkernfs_iattrstrc_blkd_noded_spacegraveyard_linkeraseregionsxol_vaddrsplice_readElf64_Addrubi_do_get_volume_infod_rt_spacenameu_flagsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERconst_pcpu_hotreserved_pebsi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typeNUMA_FOREIGNbad_allowedi_rdevself_exec_idkernfs_opsfile_lockMTHP_STAT_NR_ANONMODULE_STATE_LIVEpairingnr_migrationsa_opsxa_flagsfreeze_raw_spin_lockbin_sizeNR_ZONE_WRITE_PENDINGclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITubi_notifiersd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpercpu_ref__param_mtdscrubhorizontal_positionneed_resv_poolubi_notify_removepref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqTHP_UNDERUSED_SPLIT_PAGErefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicpbufdquot_operationsmappingRPM_INVALIDgrplowake_up_processltreePGALLOC_DEVICEclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightout_unregvm_file___GFP_COMP_BITs_stateUNEVICTABLE_PGCULLEDuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkotp_infoTHP_SPLIT_PAGEkmalloc_typeqstrWORKINGSET_REFAULT_FILEma_flagsfutex_statePGSTEAL_KHUGEPAGEDorig_pmdvtblacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posNR_FILE_DIRTYnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsNR_LRU_BASEmtd_oob_opsalt_lenusersizeubi_dev_attrsubi_class_attrscinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_stateMTHP_STAT_SHMEM_FALLBACK_CHARGEtimerqueue_headhdrs_min_io_sizercharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_tPGSTEAL_ANONout_dev_unregdevice_driverdl_server_has_tasks_frunnable_sumreal_credCOMPACTISOLATEDget_namefwnode_endpointepoll_watcheswl_lockprealloc_ptePGALLOC_NORMALWORKINGSET_ACTIVATE_BASE__compiletime_assert_207_is_lockeddqb_curspace_entrygp_statebitsetload_avgaccesscstimecfs_rq_uidfm_work_scheduledubi_wl_close_pointst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimitNR_WRITTENs_encodinggpl_crcsorc_entrykeyspeb_countorig_ptedqb_curinodesload__s8ZSWPINspin_lockinvalidate_lock_keydma_maskprealloc_mutexcdev_device_addnanosleepnode_stat_itemFORTIFY_FUNC_kmemduppscr_ret__PGMAJFAULTdq_dqb_lock__kernel_ulong_tPSWPOUTdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignNR_THROTTLED_WRITTENbtime__u8is_roxlockrlim_maxdev_mtd_numDEVICE_PANEL_FRONTPGALLOC_DMA32runtime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionto_be_torturedseq_stopkiocbKSWAPD_HIGH_WMARK_HIT_QUICKLYclass_rwsem_read_intr_is_conditionalprobefsuidmtd_max_bad_blockss_blocksize_bitsnuma_scan_periodmigration_disablediter_typewl_scheduledclass_device_is_conditionalmtd_pairing_infoshrinker_idrootubi_volume_descoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countNR_SHMEM_THPSsig_ok__SCT__cond_rescheddelaysqf_ownerreadaheadkmalloc_cache_typeNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingimage_seq__kmalloc_cache_noproffsindexshstksrcu_ssppage_orderwake_irqlast_eb_bytes__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32PGINODESTEALptracedtrc_reader_specialubi_free_all_volumesNUMA_HITHPROBE_GONEubi_initMTHP_STAT_SWPOUTactive_timeTHP_SPLIT_PAGE_FAILEDi_sequencedqb_ihardlimitd_lockrefsubpage_sftrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfTHP_ZERO_PAGE_ALLOC_FAILEDi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesget_mtd_device_nmuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tmiscdevicef_iocb_flagspoweroffcmaj_fltvtimeio_initmath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmoveHTLB_BUDDY_PGALLOCsched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeecc_statstty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinedfs_dir_namepinned_vmwl_reboot_notifierTHP_ZERO_PAGE_ALLOC_head_2apsi_flagsaddressstart_boottimevm_startsrcu_gp_seq_neededs_flagsfaultmigration_pendingec_hdr_alsizeshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusemtd_partp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgZSWPWBs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingfm_do_produce_anchorRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqprev_posNR_ISOLATED_FILEseqcount_spinlocks_securityexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uid_syncchildrenrb_subtree_lastno_pm_callbacksbuild_id__p_lenPGMIGRATE_FAILdevice_get_match_datavfork_done___GFP_ACCOUNT_BITpud_trt_spc_timelimitsym_int80_landing_padtailia_atimemtd_div_by_ebtlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memmax_pool_sizeerase_infofreeptr_offseti_mtime_nsecperformancemmlistsuppress_bind_attrs_write_oobRPM_RESUMINGreg_offset_raw_spin_unlockgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesNR_ZONE_INACTIVE_FILEf_llistphandleemulate_bitflipsubi_resize_volumei_nlinkbranchused_blockswrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrold_reserved_pebspkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tubi_mtd_notifiershareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedNR_VM_EVENT_ITEMSfreeze_superPTR_ERRs_inode_list_locksweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabKCOMPACTD_FREE_SCANNEDdevice_typePGROTATEDmaj_fltarch_rwlock_tclock_basepower_cut_minSLABS_SCANNEDcdevmy_qgroup_leadermkdirminornextentsreal_blockedarg_lockooboffsnum_exentrieshlist_bl_nodes_writersmtd_get_masterint32_toffset_ctxmtd_get_of_nodenr_failed_migrations_runningclassesnext_timerexclusiveclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyNR_FREE_CMA_PAGESqrwlockSWAP_RAfile_ra_stateuser_structuif_closework_semon_rqfs_context_erase_user_prot_regprealloc_bufbitflip_thresholdprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasschk_fastmaplast_mm_cidubi_attachcookieubi_change_vtbl_recordtargeta_flagstrace_overrundevice_pebssession_keyringcpusfop_flagstaskkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuUNEVICTABLE_PGSTRANDEDilenmnt_flagscred_guard_mutexmajorsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrPGDEMOTE_DIRECTattributerestrict_linkdev_archdatai_deviceskey_perm_tubi_get_by_majorpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listmove_fromsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stack__compiletime_assert_451dockdev_links_infoloff_tthread_pidbgt_namesrcu_gp_seqCOMPACTSUCCESS_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcalls_block_isreservedi_default_acls_uuid_lenioc_nodemtd_devof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tPGSCAN_SKIP_DEVICEFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmodule_statedev_of_nodelast_used_at__mutex_inithardirq_stack_ptrALLOCSTALL_DMAvm_endlast_queuednuma_migrate_retryuser_ns__statePSWPIN_rebootfirstiommu_groupmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrssuspendedhas_timeoutinvalidate_folionodemask_ti_modenr_thpsNUMA_HINT_FAULTS_LOCALia_ctime__fortify_strlenbbtblocksFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupxol_areaPGPROMOTE_SUCCESSrlockpcpu_hotfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtTHP_SCAN_EXCEED_NONE_PTEvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpctimealignmentreleasemax_segment_sizesched_dl_entity_write__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_idPGALLOC_MOVABLENR_ZSPAGESs_dentry_lrubp_offsetfolio_queuelast_task_numa_placementpgtable_tblock_startcgtimedev_max_ecnodenamesymlinkvid_hdr_alsizeoom_flag_origincounterorc_unwindcorr_peb_countubi_class_groupsWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqubiblock_inittrace_eval_mapfm_pooldonePGSCAN_ZONE_RECLAIM_FAILEDregister_mtd_userfscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotavtbl_slots__builtin_strleneba_tbldl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namemtd_notifierfileattrdeadpropslong long unsigned intanon_nameunregister_chrdev_regionia_filesival_intfm_bufnuma_preferred_nid_hugetlb_cgroupdentry_operationsupd_ebsmemcg_nr_pages_over_higharch_uprobeubi_thread_Boolsleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatestrleni_linklistxattr_lowertrap_nrasync_probe_requesteddfs_chk_gencompat_long_tactive_countctors_iflagsprevent_sleep_timemce_kflagstotal_numa_faultsmtd_get_device_sizes_countdev_msi_infod_revalidatebus_groupspmd_ts_opis_deadsysv_shmdq_countupdatingout_slabutf8data_tablefm_wl_poolset_latency_tolerance__func__resource_size_tfoliowake_entryTHP_SPLIT_PMDxa_headsuidemulate_power_cuti_readcountpq_headlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tbad_peb_countclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeglobal_sqnumparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_counters_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_idtokensNR_VM_ZONE_STAT_ITEMSclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitmtd_erase_region_inforead_iterwritablef_ownerbp_regVTIME_USERsa_flagstestclass_attr_versionthis_deviceFORTIFY_FUNC_memchr_invotp_factory_nvmemDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guest_get_devicedevice_physical_locationpm_domain_datapoll_table_structdirect_IOendpCMA_ALLOC_FAILcurrent_may_mountseqlock_tnuma_scan_offsetMTHP_STAT_ANON_FAULT_ALLOC_put_devicefast_attach___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskreadersch_lnumNR_INACTIVE_FILEregfuncindex_keymemalloc_noioGRPQUOTArwsemi_private_listia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secdfs_emulate_bitflipsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITUNEVICTABLE_PGSCANNEDactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpids_eraseFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisentypevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidNR_UNACCEPTEDattribute_groupcontextposix_timersTHP_COLLAPSE_ALLOCselectorMEMORY_DEVICE_PRIVATEoobbufdev_releasedefault_timer_slack_nssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refubi_debugfs_exit_devvid_hdr_shiftpmdval_t___GFP_NOFAIL_BITname_lengroup_infovdso_imageubi_add_volumefileof_match_tableused_bytespercpu_count_ptr__user_state_sizemce_kill_mevmalloc_noprofuuid_tproperty_read_int_array___GFP_UNUSED_BITKSWAPD_INODESTEALcount_objectserrorq_size_stimezone_device_dataf_wb_erruseddefparamdev_avail_eraseblocksfred_csfault_flagemulate_io_failureskprojid_tptracer_credtlb_genstorepage_mkwritebeb_rsvd_pebskobjectaudit_ttypnummce_ripvstatfsdma_skip_syncDROP_PAGECACHEnumab_stateremovablefeatureson_listpath_putkgid_ton_cpuFAULT_FLAG_VMA_LOCKNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistdev_min_io_sizeTHP_SPLIT_PUDclass_groupsnuma_nodePGSCAN_FILEoffsetsi_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexitout_mtd_notifiererrseq_tioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclaveALLOCSTALL_DMA32PGLAZYFREEcreateiattrMTHP_STAT_SHMEM_FALLBACKrseqecc_step_sizenfdssigvalvma_lockperf_event_listvol_id__compiletime_assert_39get_reserved_spacestack_refcountautoresizeinvalidate_lockbmapERR_PTRkey_payloadUBI_VOLUME_ADDED_write_user_prot_regd_real_lockUBI_VOLUME_RESIZEDPGSCAN_ZONE_RECLAIM_SUCCESSexpiry_activeof_device_is_compatible__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_44__compiletime_assert_45__compiletime_assert_46__compiletime_assert_47__compiletime_assert_48__compiletime_assert_49dqi_max_spc_limitexception_table_entryvfs_getattrevent_count_block_isbadcorrectedpreempt_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimitubi_debugfs_init__compiletime_assert_50__compiletime_assert_51__compiletime_assert_52__compiletime_assert_53__compiletime_assert_54__compiletime_assert_55__compiletime_assert_56__compiletime_assert_57i_mmap_writablemems_alloweddev_volumes_countopen_mtd_by_chdevtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderMTHP_STAT_ZSWPOUTtimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startemulate_failuresuseroffsetblocks__might_reschedset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_listdevice_dma_supportedd_ino_warnshiwater_vmtracepointubi_namemisc_deregistercompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitTHP_FILE_ALLOC_read_fact_prot_regmtd_get_master_ofsqf_nextrangesiommu_mmcutimeem_tableNUMA_HUGE_PTE_UPDATESclass_unregisterpersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infoMTHP_STAT_SHMEM_ALLOCd_fieldmaskubi_deviceuprobe_xol_opsseq_filefreeze_noirqUBI_VOLUME_RENAMEDNR_DIRTIEDrcu_tasks_idle_cpuout_uifwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabled__UNIQUE_ID_ddebug520fixups__UNIQUE_ID_ddebug522file_operations__compiletime_assert_199__UNIQUE_ID_ddebug526__UNIQUE_ID_ddebug528KMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tNUMA_PAGE_MIGRATEsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbs__UNIQUE_ID_ddebug532max_allowed_capacityi387__UNIQUE_ID_ddebug536d_ino_timeravx512_timestampfuncsend_dataPGSTEAL_KSWAPDsync_stateki_posexecute_only_pkeydfs_disable_bgtFAULT_FLAG_RETRY_NOWAITsyncupd_markersetleasepinspacct_structmust_resume__UNIQUE_ID_ddebug540__UNIQUE_ID_ddebug542__UNIQUE_ID_ddebug544long intfile_lock_contextusagel_yesPGALLOC_DMAsiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimeuidhash_nodefred_ssproperty_present__kmalloc_index__write_overflowUSRQUOTAprintk_index_sizesymtabkmem_cache_destroyrt_mutex_waiterremount_fss_typechk_ioruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirtynum_srcu_structsbdi_writebackkobj_completionooblayoutckvol_mutex__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inodecancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalubi_exitbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldkill_volumesssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobe__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestuballoc_chrdev_regionget_timemm_cid_activeelemsizedirty_paused_whenmaxlenNR_ZONE_UNEVICTABLE_read_oobclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyubi_eba_replace_table__UNIQUE_ID_license554NR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvolNR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tubi_attach_mtd_devuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idubi_dev_groups_unlocksrcu_structrlim_curnofaultmm_countdrv_groupsstack__UNIQUE_ID_author553functionki_flagskthread_stop___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infop_lensuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkskip_checkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountTHP_FAULT_FALLBACKrestore_noirqdfs_emulate_power_cutpower_cut_counterki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_events__vpp_verifyiommuprivatewritebufsizest_infomap_countsp_regexit_signalsa_restorer__compiletime_assert_521bpf_run_ctx__compiletime_assert_523__compiletime_assert_525__compiletime_assert_527__compiletime_assert_529splice_pipe__be16spinlock_checks_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seq__compiletime_assert_533__compiletime_assert_535DEVICE_PANEL_RIGHT__compiletime_assert_537simple_strtoul__compiletime_assert_539KMALLOC_RANDOM_ENDmodsstrseptqheads_activechk_genMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangeput_devicenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_task__compiletime_assert_541__compiletime_assert_543__compiletime_assert_545__compiletime_assert_546__compiletime_assert_547task_worksmemory_failurerb_root_cached__be32s_copPGSTEAL_DIRECTdd_key_truezone_stat_itemhres_activebpf_raw_eventsget_devicedq_dirtydl_deferbug_listbeb_rsvd_leveldirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxmthp_stat_itemrcu_blocked_nodegp_countubi_ctrl_cdev_operationstop_of_stackkey_restrictionnr_rangeexit_stateMTHP_STAT_SWPINis_late_suspendedsysvsemTHP_FAULT_ALLOCdevice_sizelockmapignore_childrenrestore_earlyclock_mutexfs_supersdqb_bsoftlimitpendingf_task_workfm_protect___GFP_NORETRY_BITiowait_countcorruptedmax_erroneousPGFAULTnotifier_blockdma_io_tlb_memstringread_count__param_ops_mtdfutex_offsetlong long intatomic_flagssysvshmslab_flags_ttimer_expirestrace_evalsactive_basesbad_peb_limitkmem_cache_argsearly_initmprotectsecurityxmm_spaceubi_erractivatevid_hdr_offsf_pos_locksuspend_noirqPGSTEAL_FILEi_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITi_bytesdomain_datarelax_count___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrZSWPOUTcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seubi_eba_unmap_lebElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersubiblock_createNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsNUMA_INTERLEAVE_HITneed_qsswap_deactivateblkcnt_tvol_countubi_leb_mapicq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountdfs_emulate_failuresextable_baseUBI_VOLUME_REMOVEDnoinstr_text_sizenargsattributesMTHP_STAT_SWPOUT_FALLBACK__list_del_entryvfreecopy_from_userset_child_tidNUMA_HINT_FAULTS_overruntmpfilercu_read_lock_nestingem_perf_stateleb_sizetick_dep_masklist_copy_from_userthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugretlenPGSCAN_SKIP_DMA32upd_bufof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tDIRECT_MAP_LEVEL3_SPLIToobsizefilesubi_dump_mkvol_reqdqb_bhardlimitliveatomic_write_unit_maxusable_leb_sizerun_listixolsym_vvar_pagemodule_sect_attrsused_ebsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesfm_workdescseqcountoom_score_adjd_seqia_vfsgidvol_cdev_direct_writesize_tacpi_device_idverify_mkvol_reqcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sum__compiletime_assert_127__UNIQUE_ID_ddebug521freeze_ucounti_ctime_nsecs_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytes__compiletime_assert_45get_link_lock_user_prot_reg__compiletime_assert_47__compiletime_assert_48fmode_tvolumes_lockcputime_atomicrestoredelayed_call__compiletime_assert_134max_nr_cid__compiletime_assert_137_statusd_sibkernel_ulong_tdma_opsTHP_COLLAPSE_ALLOC_FAILEDbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stateleb_startgsindexexpires_nexti_io_listf_ep__compiletime_assert_51srcu_barrier_seq__compiletime_assert_54__compiletime_assert_55__compiletime_assert_56__compiletime_assert_57links_countPGPGOUTfm_pool_rsv_cntreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasewritesize_shiftscan_objectspid_typewb_errcputimercopy_to_usertrace_recursionstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depth__compiletime_assert_158data_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinschanging_lebattrget_next_child_nodeFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDmtd_ecc_statsget_wunitfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpoint__compiletime_assert_160nr_wakeups_idleFORTIFY_FUNC_memset__compiletime_assert_164io_cqelf64_symlatch_tree_node__ret_condpercpu_ref_datadividenddestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSmetaonlysyscore__s64dqi_bgrace__kernel_pid_tubi_cdev_ioctlstatic_call_mod_timerdma_map_opsma_external_lock_panic_writedevice_physical_location_paneluid_toobretlenflush_requiredsum_block_runtimepgmapmin_perf_statestrnlendq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatubi_open_volumedma_pools_addr_lsbi_generation_sigpollmxcsrdevtd_rt_spc_hardlimitnumeraseregionsNR_ZONE_ACTIVE_FILEnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infomight_faultindexdriver_datathread_head__bad_copy_fromdev_pm_qosmap_typef_opnor_flashpids_active_resetubi_create_volumeconfirm_switchubi_leb_unmapseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizedq_sbNR_FILE_THPSarch_static_branchsighand_structerroneousflagsi_lock_keykmem_cacheinodedrivers_dirubi_leb_change_reqNR_ZONE_ACTIVE_ANONbug_entrygood_peb_count___GFP_NOWARN_BITcmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingvol_cdev_releasemnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenget_policy__list_add_validUBI_VOLUME_SHUTDOWNHRTIMER_RESTARTsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtime__ret_do_oncenumbers_softexpiresvol_typekey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messageNUMA_OTHERnum_trace_eventsdata_pad_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contextoriginflash_sizetlbflush_unmap_batchsoft__sifieldsDIRECT_MAP_LEVEL2_SPLITrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6THP_DEFERRED_SPLIT_PAGEkprobes_text_sizestatic_call_sitesTHP_FILE_FALLBACK_CHARGEubi_fm_poolthread_group_cputimernuma_scan_period_maxbadblocksstart_stackTHP_SWPOUT_FALLBACKwatcherskmalloc_cachesdown_writecompletionubi_syncsw_reserved__builtin_memcmpdevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeubi_volume_infopm_subsys_dataWORKINGSET_REFAULT_ANONget_dquotsnum_orcsclass_task_lock_is_conditionalubi_warnFAULT_FLAG_MKWRITEoom_reaper_timermemcmps_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printkvm_operations_structcnivcswbin_attrs_newdatbufubi_rename_volumesruntime_idle__builtin_memcpyiov_basesrcu_size_jiffiesi_statesched_classmultiprocessubi_wl_flushpi_waitersPGSCAN_DIRECTvid_hdr_aloffsetexp_hintd_childrendirty_foliois_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabPGSCAN_SKIP_MOVABLEdfs_emulate_io_failureswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infofail_addrlist_emptyref_counterror_remove_folioold_time32_tcore_kallsymsmemcpysrcu_parentdetachedclock_op_might_sleepnew_name_lenenvp_idx_head_1_head_2backstate_add_uevent_sentOOM_KILLi_hashhlist_nodeio_uringotp_user_nvmemcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setkzalloc_noprofrcuwaitCOMPACTFAILbio_listwrite_dquotclass_read_lock_irq_is_conditionalNUMA_MISSioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlineruntime_resumedup_xol_workKCOMPACTD_WAKE___GFP_WRITE_BITautoresize_vol_idMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmtd_mastergfp_tseccomp_filterstimelist_add_taili_mmapphys_addrd_lrusignal_structperf_event_mutexNR_PAGETABLEcrcsUNEVICTABLE_PGMLOCKEDpgdval_tsetattr__bad_copy_tof_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEcredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstateavail_pebswait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpacctUBI_EXCLUSIVEi_dentrygrab_current_nsiminoraltmapdescsfsnotify_mark_connector_sigsysoobavail__list_adddevice_mutexsrcu_cb_mutexrsvd_bytesstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDshared_pendingexpires___GFP_HARDWALL_BITnivcswubi_wl_entryMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_minmtd_pairing_schemedivisors_devcpus_allowed_lockget_next_idrwlock_tpgprotfalseout_freed_weak_revalidateremovedfm_disabledshow_pathmove_mutexUBI_STATIC_VOLUMEDL_DEV_DRIVER_BOUNDPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datavm_event_itemmce_countswap_info_structnvmemsequencert_spc_warnlimitac_flagsched_rt_mutex_block_isbadcoredump_datatasks_pidaddress_spacemm_context_talc_mutex__q_size__call_single_nodestartupseqcount_spinlock_ti_wbreboot_notifierimajoruint8_tpanelclass_id__read_overflow2_fieldinactive_timer_pkeyfilenames_export_opMTHP_STAT_SPLIT_DEFERRED__mptri_flctxstashedvm_page_prottimespec64PIDTYPE_SIDrsvd_pebsbpf_ctxd_pruneprintedresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_folioubi_start_updatelast_busyi_pipe_writevbase_resumehostuaddrerasesize_masks_wb_errshm_clistis_child_subreapercall_depthunicode_mapgraph_get_remote_endpointnum_descsTHP_MIGRATION_SPLITexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidmtd_req_statspairrseq_sigubi_debug_infodev_pm_domainubi_detach_mtd_devlimit0limit1__compiletime_assert_518dqi_max_ino_limitis_sourcemigrate_modemax_bitflipsSWAP_RA_HITpoweroff_latemtd_ooblayout_opsftrace_callsitesd_hashis_confidentialdl_bw__real_strnlenkobjfsyncmtd_infoi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_map__compiletime_assert_520alloc_dquot__compiletime_assert_522pm_messagemay_split__q_size_fieldmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountfm_size__compiletime_assert_44GNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__compiletime_assert_46__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuCOMPACTSTALLUBI_READWRITEhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowkernfs_open_fileunsigned charumount_beginvdsommap_legacy_basePAGEOUTRUNTHP_SCAN_EXCEED_SHARED_PTEpipe_inode_info__compiletime_assert_536securebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsdfs_power_cut_maxSWPIN_ZEROslicesas_ss_spNR_ZONE_INACTIVE_ANONnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BITNR_FREE_PAGESnumblocks___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeup__check_object_sizecg_listsrcu_barrier_completionshrink_control__compiletime_assert_58driver_flags__compiletime_assert_149rw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidmin_io_size_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1padding2llistdebugfs_entryelemnr_retries_get_fact_prot_infoPGSCAN_DIRECT_THROTTLEsigval_tpartitions_lockalimitundo_listKMALLOC_RANDOM_STARTALLOCSTALL_DEVICEmissedubi_open_volume_nmquota_readst_shndxfreeparti_wb_frn_avg_timePGSCAN_KSWAPDfile_ref_tCMA_ALLOC_SUCCESStypemembarrier_stateubi_rsvol_reqpage_poolsuspendinitfiles_structwrite_iterNR_ACTIVE_FILEs_dio_done_wqDROP_SLAB_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type_block_markbadmtimeserver_has_tasksvm_faultoom_score_adj_minubi_attach_reqkobj_uevent_envdisable_bgtfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memfm_eba_semTHP_FILE_FALLBACKpath_unpointst_sizermtpcheckedwait_sumnum_tracepoints_readubi_bitflip_checkupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqPGSCAN_KHUGEPAGEDDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerPGREUSEunlinkperiod_contribdfs_power_cut_minrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollTHP_MIGRATION_FAILpagesizes_blocksizevm_pgoffauprobe__retnuma_workupdate_timeptrace_dr7prioritybgt_thread_call_addrloginuidcheckTHP_FILE_MAPPEDexpiryoptimistic_spin_queuespin_unlockdl_defer_runningALLOCSTALL_NORMAL__lstatero_modearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvTHP_MIGRATION_SUCCESSltree_lockmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfd_read_user_prot_regnr_wakeups_remotepebsto_copyllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextubi_vtbl_recordHTLB_BUDDY_PGALLOC_FAILwritesize_maskDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincountnvmem_devicetablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfromend_codethread_enabledqspinlockget_info__kmalloc_large_noproflru_genNR_VMSCAN_WRITEinsnfilldir_tNUMA_PTE_UPDATESdl_non_contendingdir_contextPGFREEchrdev_locktracepoint_ptr_tutaskNR_UNEVICTABLEsched_entityd_spc_hardlimitlong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baseio_contextubi_start_leb_change_get_user_prot_infogpl_symsgroupseq_showPGSCAN_SKIP_DMAint64_tswait_queue_headcow_pageblockSWPOUT_ZEROi_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGubi_close_volumesym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namemasterget_exclusivenodeBALLOON_INFLATEvm_lockMTHP_STAT_NR_ANON_PARTIALLY_MAPPEDPGMIGRATE_SUCCESSno_cgroup_migrationMTHP_STAT_SPLIT_FAILEDnextevts_writers_key__countxcomp_bvcma_areaWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeworks_countshrinkerdl_yieldeddqi_formatCOMPACTFREE_SCANNEDexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keysMTHP_STAT_ANON_FAULT_FALLBACK_CHARGEpropertywchar_addr_bndkernel_symbolsubsys_datatv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineIS_ERRupd_receivedNR_SWAPCACHEstrcmpdfs_chk_iouser_cpus_ptrpi_top_taskubi_get_volume_infodirect_writesNR_WRITEBACK_TEMPubi_check_volumeactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedfs_chk_fastmapdisable_depthmax_beb_per1024i_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidPGACTIVATEngroupsfree_file_info__kernel_time64_tNR_VM_NUMA_EVENT_ITEMSput_mtd_deviceautaskuser_namespacevtbl_sizeget_currentvfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flags_printkPGREFILLMTHP_STAT_ANON_FAULT_FALLBACKbuf_mutexkfreestatic_call_trampTHP_SWPOUTbtrace_seq_pp_mapping_padsa_maskrequest_queueKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenMTHP_STAT_SPLITcodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimeCOMPACTMIGRATE_SCANNED__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedmax_write_sizetracing_graph_pausepermcompat_robust_listktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidubi_major2nummove_to_putspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmfortify_memcpy_chkdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTmax_ecsp_offsetsrcu_cblist_invokingoops_panic_writei_lockd_nameget_ownershipUNEVICTABLE_PGMUNLOCKEDufdsexe_filenr_scannedubi_more_update_datapcp_listpid_linksfree_countvolumess_sysfs_nameq_size_fieldrefcountvaddrrequestrw_hinttimeoutdma_configurelast_switch_timenum_classesorc_unwind_ipqc_dqblkmove_tommappedseqcount_raw_spinlockmtd_numkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyremovePGSCAN_ANONs_magicdl_overrunallocd_parenttbuf_sizepayloadac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openubi_put_devicestart_prevent_timelnumreadahead_control__kernel_gid32_tpeb_sizeNR_BOUNCEf_credmtd_oob_regionMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_infoubi_set_vol_prop_req__sigrestore_t__kernel_loff_tdetachget_unmapped_areaTHP_FAULT_FALLBACK_CHARGEdev_pagemapvid_hdr_offsetPGDEACTIVATEerasesizewritepagessched_statisticsheadfm_anchor__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclampsuper_operations_suspendsplice_eofcheck_copy_sizeutil_avg___GFP_DMA_BITKSM_SWPIN_COPYrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockPGSCAN_SKIP_NORMALD_REAL_DATAUBI_VOLUME_UPDATEDpt_regsecc_strengthpipe_bufswritersto_userNR_IOMMU_PAGESctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colordevres_lockwritesizebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESCOW_KSMFORTIFY_FUNC_memscanubi_eba_table_cond_reschedvm_private_dataio_bitmap__ret_onceuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasyncu_chari_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGESchardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecUNEVICTABLE_PGCLEAREDKSWAPD_LOW_WMARK_HIT_QUICKLYgraph_get_port_parentpartitions__compiletime_assert_49UNEVICTABLE_PGRESCUED__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_aliasNR_SHMEM__iovcpumaskPGLAZYFREEDdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrworks__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountpage_freeNR_FILE_MAPPEDparentatimecopy_file_rangetask_cputime_atomicBALLOON_DEFLATEuser_definedkey_typecopy_overflowget_named_child_nodelaunder_foliocurr_targetis_suspendedubi_volume_notifydfs_dircorrected_bitflipsbursterroneous_peb_countetypeei_funcsmodule_kobjectactive_memcgdef_flagsuncorrectable_errorsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetmutex_lockarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsWORKINGSET_NODESlinux_binfmtpage_table_lock_sigfaultcountersname_linkNR_ANON_THPScmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_type__UNIQUE_ID_ddebug519policysharedTHP_SCAN_EXCEED_SWAP_PTEdismisslist_deld_real_typelookahead_bandseq_startoffppeb_bufraw_lockd_dnameget_dqblkremaindermax_hang_timecpus_maskubi_numsubdirsinode_locktask_groupstarttimeubi_mkvol_reqmmap_missquota_format_opsclass_rwsem_write_is_conditionalargpmin_sliceargs__poll_tfwnode_operationsshow_devnameubi_volumerun_delaytailslineno__dynamic_pr_debugbase_pfnget_inode_aclpower_cut_max_addr_pkeymigrate_foliocustom_sliceNR_ACTIVE_ANONNUMA_LOCALthread_keyringkparam_arrayutimeubi_more_leb_change_datastart_codeis_hardfsbasecompatiblemax_wl_pool_sizeclock_listattrsnuma_stat_itemALLOCSTALL_MOVABLEcpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axcompletesched_rt_entityubi_devices_mutextimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__UNIQUE_ID_ddebug543nr_cached_objectsia_mtimetrc_ipi_to_cpuPGDEMOTE_KSWAPDmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainupd_bytes_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_ti_blocksnuma_faults_localityhas_child_subreaperubi_cdev_operationsdiv_u64_remi_acl___GFP_ZERO_BITubi_fastmap_layoutwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsqc_stateubi_map_reqKCOMPACTD_MIGRATE_SCANNEDooblensoftirq_next_timerdump_stackcheck_flagsswp_entry_tuint64_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventup_writeNR_MLOCKset_performance_statefile_inodephys_addr_tlookuptblclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryerasesize_shiftk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanPGPGINfs_parameter_specubi_is_mappeddesc_structdq_offmtd_debug_infoexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkBALLOON_MIGRATEpushDEV_DMA_COHERENTNR_ZONE_LRU_BASElinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotdisable_fmcss_setdelayed_workmean_echiwater_rsskretprobe_instancesrange_max_bad_blocks__ptrfutex_exit_mutexget_mtd_device__MTHP_STAT_COUNTkernfs_iattrstrc_blkd_noded_spacegraveyard_linkeraseregionsxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERconst_pcpu_hotreserved_pebsi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typeNUMA_FOREIGNbad_allowedi_rdev__compiletime_assert_530self_exec_idkernfs_opsfile_lockMTHP_STAT_NR_ANONMODULE_STATE_LIVEpairingnr_migrationsa_opsxa_flagsubi_rnvol_reqfreeze_raw_spin_lockbin_sizeNR_ZONE_WRITE_PENDINGclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpercpu_refscrubhorizontal_positionneed_resv_poolpref_node_fork_copy_to_userwait_queue__int128dqi_privrss_statmems_allowed_seqTHP_UNDERUSED_SPLIT_PAGErefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploltreePGALLOC_DEVICEclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_file___GFP_COMP_BITs_stateUNEVICTABLE_PGCULLEDuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkotp_infoTHP_SPLIT_PAGEkmalloc_typeqstrWORKINGSET_REFAULT_FILEma_flagsfutex_statePGSTEAL_KHUGEPAGEDorig_pmdvtblacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posNR_FILE_DIRTYnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsNR_LRU_BASEmtd_oob_opsalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_stateMTHP_STAT_SHMEM_FALLBACK_CHARGEtimerqueue_headlist_is_headhdrs_min_io_sizercharfutex_pi_statekstat__kernel_uid32_tcompat_ptr_ioctlDEVICE_FIXEDpte_tPGSTEAL_ANONdevice_driverdl_server_has_tasks_frunnable_sumreal_credCOMPACTISOLATEDget_namefwnode_endpointepoll_watcheswl_lockprealloc_ptePGALLOC_NORMALWORKINGSET_ACTIVATE_BASE_is_lockeddqb_curspace_entrygp_statebitsetload_avgaccesscstimeubiblock_removecfs_rq_uidfm_work_scheduled_pointst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimit__tmpNR_WRITTENs_encodinggpl_crcsorc_entrykeyspeb_countorig_ptedqb_curinodesload__s8ZSWPINspin_lockinvalidate_lock_keydma_maskprealloc_mutexnanosleep__already_donenode_stat_itemvol_cdev_openFORTIFY_FUNC_kmemduppscr_ret__PGMAJFAULTdq_dqb_lock__kernel_ulong_tPSWPOUTdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignNR_THROTTLED_WRITTENbtime__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTPGALLOC_DMA32runtime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionto_be_torturedseq_stopkiocbKSWAPD_HIGH_WMARK_HIT_QUICKLYclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typewl_scheduledclass_device_is_conditionalmtd_pairing_infoshrinker_idrootubi_volume_descoom_reaper_list__UNIQUE_ID_ddebug517shutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countverify_rsvol_reqNR_SHMEM_THPSsig_ok__SCT__cond_rescheddelaysqf_ownerreadaheadkmalloc_cache_typeNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagINIT_LIST_HEADfs_flagsworkpgprotval_tkeytypesigpendingvol_cdev_llseekimage_seqfsindexshstksrcu_ssppage_orderwake_irqlast_eb_bytes__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32PGINODESTEALptracedtrc_reader_specialNUMA_HITHPROBE_GONEMTHP_STAT_SWPOUTactive_timeTHP_SPLIT_PAGE_FAILEDi_sequencedqb_ihardlimitd_lockrefsubpage_sftrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfTHP_ZERO_PAGE_ALLOC_FAILEDi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqno_remove_neededchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tf_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmoveHTLB_BUDDY_PGALLOCsched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeecc_statstty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinedfs_dir_namepinned_vmwl_reboot_notifierTHP_ZERO_PAGE_ALLOC_head_2apsi_flagsaddressstart_boottimevm_startsrcu_gp_seq_neededs_flagsfaultvol_cdev_readmigration_pendingec_hdr_alsizeshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusemtd_partp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgZSWPWBs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingfm_do_produce_anchorRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqUBI_READONLYprev_posNR_ISOLATED_FILEseqcount_spinlocks_securityexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchvol_cdev_writercu_tasks_exit_listarchdataia_uid__list_del_entry_valid_or_report_syncchildrenrb_subtree_lastno_pm_callbacksbuild_id__p_lenPGMIGRATE_FAILdevice_get_match_datavfork_done___GFP_ACCOUNT_BITpud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memmax_pool_sizeerase_infoi_mtime_nsecperformancemmlist__compiletime_assert_0__compiletime_assert_1__compiletime_assert_2__compiletime_assert_3__compiletime_assert_4suppress_bind_attrs_write_oobRPM_RESUMINGreg_offset_raw_spin_unlockgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesNR_ZONE_INACTIVE_FILEf_llistdtypephandleemulate_bitflipsinode_unlockrename_listubi_resize_volumei_nlinkbranchused_blockswrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscr__ret_gupkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedNR_VM_EVENT_ITEMSfreeze_superPTR_ERRs_inode_list_locksweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabKCOMPACTD_FREE_SCANNEDdevice_typePGROTATEDmaj_fltarch_rwlock_tcount_saveclock_basepower_cut_minSLABS_SCANNEDcdevmy_qgroup_leadermkdirnextentsreal_blockedarg_lockooboffsnum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerexclusiveclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyNR_FREE_CMA_PAGESqrwlockSWAP_RAfile_ra_stateuser_structwork_semon_rq__p_size_fieldusersfs_context_erase_user_prot_regprealloc_bufbitflip_thresholdprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasschk_fastmaplast_mm_cidcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuUNEVICTABLE_PGSTRANDEDilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrPGDEMOTE_DIRECTattributerestrict_linkdev_archdatai_deviceskey_perm_tubi_get_by_majorpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptr__ret_pui_opflagsrobust_listmove_fromsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stack__compiletime_assert_451dockdev_links_infoloff_tthread_pidbgt_namesrcu_gp_seqCOMPACTSUCCESS_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcalls_block_isreservedi_default_acls_uuid_lenioc_nodeof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tPGSCAN_SKIP_DEVICEFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmodule_state__write_overflow_fieldlast_used_athardirq_stack_ptrALLOCSTALL_DMAvm_endlast_queuednuma_migrate_retryuser_ns__statePSWPIN_rebootfirstiommu_groupmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrssuspendedhas_timeoutinvalidate_folionodemask_ti_modenr_thpsNUMA_HINT_FAULTS_LOCALia_ctime__fortify_strlenbbtblocksFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexubi_eba_write_lebi_private_dataElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupxol_areaPGPROMOTE_SUCCESSrlockpcpu_hotfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtTHP_SCAN_EXCEED_NONE_PTEvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpctimealignmentreleasemax_segment_sizesched_dl_entity_write__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_idPGALLOC_MOVABLENR_ZSPAGESs_dentry_lrubp_offsetfolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkvid_hdr_alsizeoom_flag_origincounterorc_unwindcorr_peb_countWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapfm_pooldonePGSCAN_ZONE_RECLAIM_FAILEDkmsan_copy_to_userfscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotavtbl_slotseba_tbldl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intfm_bufnuma_preferred_nid_hugetlb_cgroupdentry_operationsupd_ebsmemcg_nr_pages_over_higharch_uproberevoke_exclusive_Boolsleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requesteddfs_chk_gen__list_add_valid_or_reportcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupsUBI_VOL_PROP_DIRECT_WRITEpmd_ts_opis_deadsysv_shmdq_countupdatingutf8data_tablefm_wl_poolset_latency_tolerance__func__resource_size_tfoliowake_entryTHP_SPLIT_PMDxa_headsuidemulate_power_cuti_readcountpq_headlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tbad_peb_countclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeglobal_sqnumparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryvol_cdev_fsyncrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_counters_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_idNR_VM_ZONE_STAT_ITEMSclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitmtd_erase_region_inforead_iterwritablef_ownerbp_regVTIME_USERsa_flagstest__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invotp_factory_nvmemDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callvol_cdev_ioctlis_guest_get_devicedevice_physical_locationpm_domain_datapoll_table_structdirect_IOCMA_ALLOC_FAILcurrent_may_mount__UNIQUE_ID_ddebug535seqlock_tnuma_scan_offsetMTHP_STAT_ANON_FAULT_ALLOC_put_devicefast_attach___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskreadersch_lnumNR_INACTIVE_FILE__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTAi_private_listia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secdfs_emulate_bitflipsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITUNEVICTABLE_PGSCANNED__read_overflowactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpids_eraseFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_start__flagsp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidNR_UNACCEPTEDattribute_groupcontextposix_timersTHP_COLLAPSE_ALLOCselectorMEMORY_DEVICE_PRIVATEoobbufdev_releasedefault_timer_slack_nsubi_rename_entrysource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refvid_hdr_shiftpmdval_t___GFP_NOFAIL_BITubi_leb_valid__copy_overflowname_lengroup_infovdso_imagefileof_match_tableused_bytespercpu_count_ptr__user_state_sizemce_kill_mevmalloc_noprofuuid_tproperty_read_int_array___GFP_UNUSED_BITKSWAPD_INODESTEALcount_objectsq_size_stimezone_device_dataf_wb_erruseddefparamfred_csfault_flagemulate_io_failureskprojid_tptracer_credtlb_genstorepage_mkwritebeb_rsvd_pebskobjectaudit_ttypnummce_ripvstatfsdma_skip_syncDROP_PAGECACHEnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistTHP_SPLIT_PUDclass_groupsnuma_nodePGSCAN_FILEoffsetsi_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchangedwatch_listdatasync__fortify_sizeaudit_contextpp_ref_countsysfs_opsfixed_size_llseeksequential_io_large_mapcountsda_is_staticformatftopenclaveALLOCSTALL_DMA32PGLAZYFREEcreateiattrMTHP_STAT_SHMEM_FALLBACKrseqecc_step_sizenfdssigvalvma_lockperf_event_listvol_id__compiletime_assert_39get_reserved_space__compiletime_assert_119stack_refcountinvalidate_lockbmapkey_payloadUBI_VOLUME_ADDED_write_user_prot_regd_real_lockUBI_VOLUME_RESIZEDPGSCAN_ZONE_RECLAIM_SUCCESSexpiry_active__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126dqi_max_spc_limit__compiletime_assert_128__compiletime_assert_129exception_table_entryevent_countcorrectedpreempt_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimit__compiletime_assert_50check_object_size__compiletime_assert_52__compiletime_assert_53__compiletime_assert_130__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135__compiletime_assert_136mems_allowed__compiletime_assert_138tlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderMTHP_STAT_ZSWPOUTtimewakee_flip_decay_tss_max_linksnr_wakeups_syncleftentskallsymsprevdma_parmsfs_structclockiduint32_targ_startemulate_failuresblocks__might_reschedset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_list__compiletime_assert_150__compiletime_assert_151__compiletime_assert_152__compiletime_assert_153__compiletime_assert_154__compiletime_assert_155__compiletime_assert_156__compiletime_assert_157device_dma_supported__compiletime_assert_159d_ino_warnshiwater_vmtracepointubi_namecompound_headUBI_DYNAMIC_VOLUMEia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimit__compiletime_assert_161__compiletime_assert_162__compiletime_assert_163splice_write__compiletime_assert_165__compiletime_assert_166__compiletime_assert_167__compiletime_assert_168i_rt_spc_timelimitTHP_FILE_ALLOC_read_fact_prot_reg__list_del_entry_validqf_nextrangesiommu_mmcutimeem_tableNUMA_HUGE_PTE_UPDATESpersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infoMTHP_STAT_SHMEM_ALLOCd_fieldmaskubi_deviceuprobe_xol_opsseq_filefreeze_noirqUBI_VOLUME_RENAMEDNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixups__UNIQUE_ID_ddebug523file_operations__UNIQUE_ID_ddebug525__UNIQUE_ID_ddebug527__UNIQUE_ID_ddebug529KMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tNUMA_PAGE_MIGRATEsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbs__UNIQUE_ID_ddebug531__UNIQUE_ID_ddebug533max_allowed_capacityi387__UNIQUE_ID_ddebug537d_ino_timer__UNIQUE_ID_ddebug539avx512_timestampubi_vol_cdev_operationsfuncsend_dataPGSTEAL_KSWAPDsync_stateki_posexecute_only_pkeydfs_disable_bgtFAULT_FLAG_RETRY_NOWAITsyncupd_markersetleasepinspacct_structmust_resume__UNIQUE_ID_ddebug541__UNIQUE_ID_ddebug545long intfile_lock_contextusagel_yesPGALLOC_DMAsiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimeuidhash_nodefred_ss__ptr_puproperty_present__kmalloc_index__write_overflowUSRQUOTArename_volumesprintk_index_sizesymtabrt_mutex_waiterremount_fss_typechk_ioruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegidkmsan_unpoison_memoryiomapdq_hashdiv_u64put_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirtynum_srcu_structsbdi_writebackkobj_completionooblayoutckvol_mutex__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inodecancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobe__fortify_panictracepoint_funcargv__val_guentryfree_cached_objectsworkqueue_structpi_lockcapable___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenNR_ZONE_UNEVICTABLE_read_oobclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEubi_remove_volumeget_reference_argssrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvolNR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tubi_attach_mtd_devuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_id_unlocksrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infop_lensuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkskip_checkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountTHP_FAULT_FALLBACKrestore_noirqdfs_emulate_power_cutpower_cut_counterki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYubi_eba_read_lebrlimread_folionr_events__vpp_verifyiommuprivatewritebufsizest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctx__compiletime_assert_524__compiletime_assert_526__compiletime_assert_528splice_pipe__be16s_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seq__compiletime_assert_532__compiletime_assert_534DEVICE_PANEL_RIGHT__compiletime_assert_538KMALLOC_RANDOM_ENDmods__val_punew_nametqheads_activechk_genMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_taskUBI_VOL_SKIP_CRC_CHECK_FLG__compiletime_assert_540__compiletime_assert_542__compiletime_assert_544__compiletime_assert_546task_worksmemory_failurerb_root_cached__be32s_copPGSTEAL_DIRECTdd_key_truezone_stat_itemhres_activebpf_raw_eventsdq_dirtydl_deferbug_listbeb_rsvd_leveldirect_completexa_locklist_addfxregs_stateload_weightkuid_tarch_datafpstateblock_maxmthp_stat_itemrcu_blocked_nodegp_countubi_ctrl_cdev_operationstop_of_stackkey_restrictionnr_rangeexit_stateMTHP_STAT_SWPINis_late_suspendedsysvsemTHP_FAULT_ALLOClockmapignore_childrenrestore_earlyclock_mutexfs_supersUBI_METAONLYdqb_bsoftlimitpendingf_task_workfm_protect___GFP_NORETRY_BITiowait_countcorruptedmax_erroneoustbufPGFAULTnotifier_blockdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesbad_peb_limitearly_initmprotectsecurityxmm_spaceubi_errctrl_cdev_ioctlactivatef_pos_locksuspend_noirqPGSTEAL_FILEi_fieldmasktls_arrayownerpfo_val__acct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITi_bytesdomain_datarelax_count___GFP_THISNODE_BITlinelinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrZSWPOUTcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGdma_flagsuclamp_seubi_eba_unmap_lebElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsNUMA_INTERLEAVE_HITneed_qsswap_deactivateblkcnt_tvol_countubi_leb_mapicq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountdfs_emulate_failuresextable_basenoinstr_text_sizenargsattributesMTHP_STAT_SWPOUT_FALLBACKset_child_tidNUMA_HINT_FAULTS_overruntmpfilercu_read_lock_nestingem_perf_stateleb_sizetick_dep_masklistthrottle_disksi_errnoubi_leb_writes_inode_lru__UNIQUE_ID___addressable_ubi_leb_map555srcu_size_stateblk_plugretlenPGSCAN_SKIP_DMA32upd_bufof_noderefsmmap_compat_basetrace_eventsenv_starttry_module_getdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_max__UNIQUE_ID___addressable_ubi_get_volume_info522last_switch_countqsize_tDIRECT_MAP_LEVEL3_SPLIToobsizefilesdqb_bhardlimitliveatomic_write_unit_maxusable_leb_sizerun_listixolsym_vvar_pagemodule_sect_attrsused_ebsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesfm_workdescseqcountoom_score_adjd_seqia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventignore_existingf_securityi_sb_listvm_rcupgtables_bytesget_link_lock_user_prot_regfmode_tvolumes_lockcputime_atomicrestoredelayed_callmax_nr_cid_statusd_sibkernel_ulong_tdma_opsTHP_COLLAPSE_ALLOC_FAILEDbin_attributemin_align_maskpercpu_counterdev_groups__UNIQUE_ID___addressable_ubi_open_volume_path531numa_pages_migrateddl_dev_stateleb_startgsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countPGPGOUTfm_pool_rsv_cntreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasewritesize_shiftscan_objectspid_typewb_errcputimertrace_recursionstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinschanging_lebattrget_next_child_nodeFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDmtd_ecc_statsget_wunitfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSmetaonlysyscore__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lock_panic_writedevice_physical_location_paneluid_toobretlenflush_requiredsum_block_runtimepgmapmin_perf_statestrnlendq_oprcu_tasks_nvcswwritetypetab__UNIQUE_ID___addressable_ubi_get_device_info521class_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatubi_open_volumedma_poolsblocking_notifier_chain_register_addr_lsbi_generation_sigpollmxcsrdevtd_rt_spc_hardlimitnumeraseregionsNR_ZONE_ACTIVE_FILEnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qosmap_typef_opnor_flashpids_active_resetconfirm_switchubi_leb_unmapseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizedq_sbNR_FILE_THPSarch_static_branchsighand_structerroneousflagsi_lock_keykmem_cacheinodedrivers_dirpathnameNR_ZONE_ACTIVE_ANONbug_entrygood_peb_countubi_open_volume_path___GFP_NOWARN_BITcmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenget_policyHRTIMER_RESTARTsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbers_softexpiresvol_typekey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messageNUMA_OTHERnum_trace_eventsdata_pad_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contextflash_sizetlbflush_unmap_batchsoft__sifieldsDIRECT_MAP_LEVEL2_SPLITrcu_read_unlock_specialread_bytes__UNIQUE_ID___addressable_ubi_unregister_volume_notifier562fsverity_operationswake_q_noderequest_key_authvirtual_dr6THP_DEFERRED_SPLIT_PAGEkprobes_text_sizestatic_call_sitesTHP_FILE_FALLBACK_CHARGEubi_fm_poolthread_group_cputimernuma_scan_period_maxbadblocksstart_stackTHP_SWPOUT_FALLBACKwatcherskmalloc_cachescompletionubi_syncsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeubi_volume_infopm_subsys_dataWORKINGSET_REFAULT_ANONget_dquotsnum_orcsclass_task_lock_is_conditionalubi_warnFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structcnivcswbin_attrs_newdatbufruntime_idleiov_basesrcu_size_jiffiesi_statesched_classmultiprocessubi_wl_flushpi_waitersPGSCAN_DIRECTvid_hdr_aloffsetexp_hintd_childrendirty_foliois_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabPGSCAN_SKIP_MOVABLEdfs_emulate_io_failureswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infofail_addrref_counterror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2backstate_add_uevent_sentOOM_KILLi_hashhlist_nodeio_uringotp_user_nvmemcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setrcuwaitCOMPACTFAILbio_listwrite_dquotclass_read_lock_irq_is_conditionalNUMA_MISSioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlineruntime_resumedup_xol_workKCOMPACTD_WAKE___GFP_WRITE_BITautoresize_vol_idMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workubi_get_device_infooublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmtd_masterleb_read_sanity_checkgfp_tseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexNR_PAGETABLEcrcsUNEVICTABLE_PGMLOCKEDpgdval_tpage_linksetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEcredjump_entrylist_lru_nodesrcu_gp_seq_needed_expubi_eba_read_leb_sgaddress_space_operationsspinlock_t__task_fpstateavail_pebswait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultubi_enumerate_volumeskstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpacctUBI_EXCLUSIVEi_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysoobavaildevice_mutexsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDshared_pendingexpires___GFP_HARDWALL_BITnivcswubi_wl_entryMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_minmtd_pairing_schemes_devcpus_allowed_lockget_next_idrwlock_tpgprotfalseout_freed_weak_revalidateremovedfm_disabledshow_pathmove_mutexUBI_STATIC_VOLUMEDL_DEV_DRIVER_BOUNDPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datavm_event_itemmce_countswap_info_structnvmemsequencert_spc_warnlimitac_flagsched_rt_mutexblocking_notifier_headcoredump_datatasks_pidaddress_spacemm_context_talc_mutex__call_single_nodestartupseqcount_spinlock_ti_wbreboot_notifieruint8_tpanelclass_idinactive_timer_pkeyfilenames_export_opMTHP_STAT_SPLIT_DEFERREDi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDrsvd_pebsbpf_ctxd_pruneprintedresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipe_writevbase_resumehostuaddrerasesize_masks_wb_errshm_clistis_child_subreapercall_depthunicode_mapgraph_get_remote_endpointnum_descsTHP_MIGRATION_SPLITexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidmtd_req_statspairrseq_sigubi_debug_infodev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modemax_bitflipsSWAP_RA_HITpoweroff_latemtd_ooblayout_opsftrace_callsiteskern_pathd_hashis_confidentialdl_bw__real_strnlenkobjfsyncmtd_infoi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountfm_sizeGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuCOMPACTSTALLUBI_READWRITEhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowkernfs_open_fileunsigned charumount_beginvdsommap_legacy_basePAGEOUTRUNTHP_SCAN_EXCEED_SHARED_PTEpipe_inode_info__compiletime_assert_536securebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsdfs_power_cut_maxSWPIN_ZEROslicesas_ss_spNR_ZONE_INACTIVE_ANONnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BITNR_FREE_PAGESnumblocks___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listsrcu_barrier_completionshrink_controldriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidmin_io_size_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retries_get_fact_prot_infoPGSCAN_DIRECT_THROTTLEsigval_tpartitions_lockalimitundo_listKMALLOC_RANDOM_STARTALLOCSTALL_DEVICEmissedubi_open_volume_nmquota_readst_shndxfreeparti_wb_frn_avg_timePGSCAN_KSWAPDfile_ref_tCMA_ALLOC_SUCCESStypemembarrier_statepage_poolsuspendinitfiles_structwrite_iterNR_ACTIVE_FILEs_dio_done_wqDROP_SLAB_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type_block_markbadmtimeserver_has_tasksvm_faultoom_score_adj_minkobj_uevent_envdisable_bgtfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memfm_eba_semTHP_FILE_FALLBACKpath_unpointst_sizermtpcheckedwait_sumnum_tracepoints_readupidexit_code__UNIQUE_ID___addressable_ubi_sync559exec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkubi_flushclock_was_set_seqPGSCAN_KHUGEPAGEDDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerPGREUSEunlinkperiod_contribdfs_power_cut_minrcu_node_entrystart_scan_sequbi_unregister_volume_notifierfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollTHP_MIGRATION_FAILpagesizeubi_device_infos_blocksizevm_pgoffauprobe__retnuma_workupdate_timeptrace_dr7prioritybgt_thread_call_addrloginuidcheckTHP_FILE_MAPPEDexpiryoptimistic_spin_queuespin_unlockdl_defer_runningALLOCSTALL_NORMAL__lstatero_modearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvTHP_MIGRATION_SUCCESSltree_lockmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfd_read_user_prot_regnr_wakeups_remotepebsllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextubi_vtbl_recordHTLB_BUDDY_PGALLOC_FAILwritesize_maskDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincountnvmem_devicetablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codethread_enabledqspinlockget_info__kmalloc_large_noproflru_genNR_VMSCAN_WRITEinsnfilldir_tNUMA_PTE_UPDATESdl_non_contendingdir_contextPGFREEchrdev_locktracepoint_ptr_tutaskNR_UNEVICTABLEsched_entityd_spc_hardlimitlong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baseio_context_get_user_prot_infogpl_symsgroupseq_showPGSCAN_SKIP_DMAswait_queue_headcow_pageblockSWPOUT_ZEROi_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGubi_close_volumesym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namemasternodeBALLOON_INFLATEvm_lockMTHP_STAT_NR_ANON_PARTIALLY_MAPPEDPGMIGRATE_SUCCESSno_cgroup_migrationMTHP_STAT_SPLIT_FAILEDnextevts_writers_key__countxcomp_bvcma_areaWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeworks_countshrinkerdl_yieldeddqi_formatCOMPACTFREE_SCANNEDexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keysMTHP_STAT_ANON_FAULT_FALLBACK_CHARGEpropertywchar_addr_bndkernel_symbolsubsys_datatv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineupd_receivedNR_SWAPCACHEstrcmpdfs_chk_iouser_cpus_ptrpi_top_taskubi_get_volume_infodirect_writesNR_WRITEBACK_TEMPubi_check_volumeactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedfs_chk_fastmapdisable_depthi_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidPGACTIVATEngroupsfree_file_info__kernel_time64_tNR_VM_NUMA_EVENT_ITEMSautaskuser_namespacevtbl_sizeget_currentvfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsPGREFILLMTHP_STAT_ANON_FAULT_FALLBACKbuf_mutexkfreestatic_call_trampTHP_SWPOUTbtrace_seq_pp_mapping_padsa_maskrequest_queueKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenMTHP_STAT_SPLITcodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimeCOMPACTMIGRATE_SCANNED__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedmax_write_sizetracing_graph_pausepermcompat_robust_listubi_do_get_device_infoktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidubi_major2nummove_to_putspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTmax_ecsp_offsetsrcu_cblist_invokingoops_panic_writei_lockd_nameget_ownershipUNEVICTABLE_PGMUNLOCKEDufdsexe_filenr_scannedpcp_listpid_linksfree_countvolumess_sysfs_namerefcountvaddrrequestrw_hinttimeoutdma_configurelast_switch_timenum_classesorc_unwind_ipqc_dqblkmove_tommappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyremovePGSCAN_ANONs_magicdl_overrunallocd_parentpayloadac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openubi_put_devicestart_prevent_timelnumout_put_ubireadahead_control__kernel_gid32_tpeb_sizeNR_BOUNCEf_credmtd_oob_regionMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesubi_get_deviceread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areaTHP_FAULT_FALLBACK_CHARGEdev_pagemapvid_hdr_offsetPGDEACTIVATEerasesizewritepagessched_statisticsheadfm_anchor__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclampsuper_operations_suspendsplice_eofutil_avg___GFP_DMA_BITKSM_SWPIN_COPYrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockPGSCAN_SKIP_NORMALD_REAL_DATApt_regsecc_strengthpipe_bufswritersNR_IOMMU_PAGESctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colordevres_lockwritesizebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESCOW_KSMFORTIFY_FUNC_memscanubi_eba_tablevm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasyncu_chari_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGESchardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecUNEVICTABLE_PGCLEAREDKSWAPD_LOW_WMARK_HIT_QUICKLYgraph_get_port_parentpartitionsUNEVICTABLE_PGRESCUED__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_aliasNR_SHMEM__iovcpumaskPGLAZYFREEDdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrworks__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountpage_freeNR_FILE_MAPPEDparentatimecopy_file_rangetask_cputime_atomicBALLOON_DEFLATEuser_definedkey_typeget_named_child_nodelaunder_foliocurr_targetis_suspendeddfs_dirdma_lengthcorrected_bitflipsburstmtd_is_eccerrerroneous_peb_countetypeei_funcsmodule_kobjectactive_memcgdef_flagsuncorrectable_errorsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetmutex_lockarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsWORKINGSET_NODESlinux_binfmtpage_table_lock_sigfaultcountersname_linkNR_ANON_THPScmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_typepolicysharedTHP_SCAN_EXCEED_SWAP_PTEdismissd_real_typelookahead_bandseq_startpeb_bufraw_lockd_dnameget_dqblkmax_hang_timecpus_mask__UNIQUE_ID___addressable_ubi_open_volume_nm528ubi_numsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnameubi_volumerun_delaytailslineno__dynamic_pr_debugbase_pfnstatget_inode_aclpower_cut_max_addr_pkeymigrate_foliocustom_sliceNR_ACTIVE_ANONNUMA_LOCALthread_keyringkparam_arrayutime__UNIQUE_ID_ddebug538start_codeis_hardfsbasecompatibleubi_register_volume_notifiermax_wl_pool_sizeclock_listattrsnuma_stat_itemALLOCSTALL_MOVABLEcpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axcompletesched_rt_entityubi_devices_mutextimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpuPGDEMOTE_KSWAPDmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainupd_bytes_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_ti_blocksnuma_faults_localityhas_child_subreaperi_acl___GFP_ZERO_BITubi_fastmap_layoutwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsqc_stateKCOMPACTD_MIGRATE_SCANNEDubi_eba_atomic_leb_changeooblensoftirq_next_timercheck_flagsswp_entry_tuint64_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventNR_MLOCKset_performance_statephys_addr_tlookuptblclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryerasesize_shiftk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanPGPGINfs_parameter_specubi_is_mappeddesc_structdq_offmtd_debug_infoexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2a__UNIQUE_ID___addressable_ubi_open_volume525dma_cleanupmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkBALLOON_MIGRATEpushDEV_DMA_COHERENTNR_ZONE_LRU_BASElinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workmean_echiwater_rsskretprobe_instancesrange_max_bad_blocksfutex_exit_mutex__MTHP_STAT_COUNTkernfs_iattrstrc_blkd_noded_spacegraveyard_linkeraseregionsxol_vaddrsplice_readElf64_Addrubi_do_get_volume_infod_rt_spacenameu_flagsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERconst_pcpu_hotreserved_pebsi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typeNUMA_FOREIGNbad_allowedi_rdev__compiletime_assert_530self_exec_idkernfs_opsfile_lockMTHP_STAT_NR_ANONMODULE_STATE_LIVEpairingnr_migrationsa_opsxa_flagsfreeze_raw_spin_lockbin_sizeNR_ZONE_WRITE_PENDINGclosedev_dma_attrgrphiubi_leb_read_sg___GFP_RETRY_MAYFAIL_BITubi_eba_is_mappedubi_notifiersd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpercpu_refscrubhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqTHP_UNDERUSED_SPLIT_PAGErefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploltreePGALLOC_DEVICEclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightubi_leb_changevm_file___GFP_COMP_BITs_stateUNEVICTABLE_PGCULLEDuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkotp_infoTHP_SPLIT_PAGEkmalloc_typeqstrWORKINGSET_REFAULT_FILEma_flagsfutex_statePGSTEAL_KHUGEPAGEDorig_pmdvtblacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posNR_FILE_DIRTYnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsNR_LRU_BASEmtd_oob_opsalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_stateMTHP_STAT_SHMEM_FALLBACK_CHARGEtimerqueue_headhdrs_min_io_sizercharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_tPGSTEAL_ANONdevice_driverdl_server_has_tasks_frunnable_sumreal_credCOMPACTISOLATEDget_namefwnode_endpointepoll_watcheswl_lockprealloc_ptePGALLOC_NORMALWORKINGSET_ACTIVATE_BASE_is_lockeddqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidfm_work_scheduled_pointst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimitNR_WRITTENs_encodinggpl_crcsorc_entrykeyspeb_countorig_ptedqb_curinodesload__s8ZSWPINspin_lockinvalidate_lock_keydma_maskprealloc_mutexnanosleepnode_stat_itemFORTIFY_FUNC_kmemduppscr_ret__PGMAJFAULTdq_dqb_lock__kernel_ulong_tPSWPOUTdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignNR_THROTTLED_WRITTENbtime__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTPGALLOC_DMA32runtime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionto_be_torturedseq_stopkiocbKSWAPD_HIGH_WMARK_HIT_QUICKLY__UNIQUE_ID___addressable_ubi_flush560class_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typewl_scheduledclass_device_is_conditionalmtd_pairing_infoshrinker_idrootubi_volume_descoom_reaper_listubi_get_num_by_pathshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countNR_SHMEM_THPSsig_okdelaysqf_ownerreadaheadkmalloc_cache_typeNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingimage_seqfsindexshstksrcu_ssppage_orderwake_irqlast_eb_bytes__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32PGINODESTEALptracedtrc_reader_specialNUMA_HITHPROBE_GONEMTHP_STAT_SWPOUTactive_timeTHP_SPLIT_PAGE_FAILEDi_sequencedqb_ihardlimitd_lockrefsubpage_sftrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfTHP_ZERO_PAGE_ALLOC_FAILEDi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tf_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmoveHTLB_BUDDY_PGALLOCsched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeecc_statstty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinedfs_dir_namepinned_vmwl_reboot_notifierTHP_ZERO_PAGE_ALLOC_head_2apsi_flagsaddressstart_boottimedma_addressvm_startsrcu_gp_seq_neededmodule_puts_flagsfaultmigration_pendingec_hdr_alsizeshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusemtd_partp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgZSWPWBs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdi__UNIQUE_ID___addressable_ubi_leb_unmap552posix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingfm_do_produce_anchorRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqUBI_READONLYprev_posNR_ISOLATED_FILEseqcount_spinlocks_securityexpire_count__UNIQUE_ID___addressable_ubi_is_mapped558s_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uid_syncchildrenrb_subtree_lastno_pm_callbacksbuild_id__p_lenPGMIGRATE_FAILdevice_get_match_datavfork_done___GFP_ACCOUNT_BITpud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memmax_pool_sizeerase_infoi_mtime_nsecperformancemmlistsuppress_bind_attrs_write_oobRPM_RESUMINGreg_offset_raw_spin_unlockgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesNR_ZONE_INACTIVE_FILEf_llistphandleemulate_bitflipsi_nlinkbranchused_blockswrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_t__UNIQUE_ID___addressable_ubi_leb_write543shareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedNR_VM_EVENT_ITEMSfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabKCOMPACTD_FREE_SCANNEDdevice_typePGROTATEDmaj_fltarch_rwlock_tclock_basepower_cut_minSLABS_SCANNEDcdevmy_qgroup_leadermkdirnextentsreal_blockedarg_lockooboffsnum_exentrieshlist_bl_nodes_writersmtd_get_masterint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerexclusiveclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyNR_FREE_CMA_PAGESqrwlockSWAP_RAfile_ra_stateuser_structwork_semon_rqfs_context_erase_user_prot_regprealloc_bufbitflip_thresholdprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasschk_fastmaplast_mm_cidcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuUNEVICTABLE_PGSTRANDEDilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrPGDEMOTE_DIRECTattributerestrict_linkdev_archdatai_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listmove_fromsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stack__compiletime_assert_451dockdev_links_infoloff_tthread_pidbgt_namesrcu_gp_seqCOMPACTSUCCESS_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcalls_block_isreservedi_default_acls_uuid_lenioc_nodeof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tPGSCAN_SKIP_DEVICEFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmodule_statelast_used_athardirq_stack_ptrALLOCSTALL_DMAvm_endlast_queuednuma_migrate_retryuser_ns__statePSWPIN_rebootfirstiommu_groupmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrssuspendedhas_timeoutinvalidate_folionodemask_ti_modenr_thpsNUMA_HINT_FAULTS_LOCALia_ctimebbtblocksFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexubi_eba_write_lebi_private_dataElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupxol_areaPGPROMOTE_SUCCESSrlockpcpu_hotfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtTHP_SCAN_EXCEED_NONE_PTEvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpout_unlockctimealignmentreleasemax_segment_sizesched_dl_entity_write__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_users__UNIQUE_ID___addressable_ubi_close_volume534s_idPGALLOC_MOVABLENR_ZSPAGESs_dentry_lrubp_offsetfolio_queuelast_task_numa_placementpgtable_tblock_startcgtimeblocking_notifier_chain_unregistersymlinkvid_hdr_alsizeoom_flag_origincounterorc_unwindcorr_peb_countWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapfm_pooldonePGSCAN_ZONE_RECLAIM_FAILEDfscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexubi_leb_readratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotavtbl_slotseba_tbldl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intfm_bufnuma_preferred_nid_hugetlb_cgroupdentry_operationsupd_ebsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditional__UNIQUE_ID___addressable_ubi_leb_read537driver_privatei_linklistxattr_lowertrap_nrasync_probe_requesteddfs_chk_gencompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opis_deadsysv_shmdq_countupdatingutf8data_tablefm_wl_poolset_latency_tolerance__func__resource_size_tfoliowake_entryTHP_SPLIT_PMDxa_headsuidemulate_power_cuti_readcountpq_headubi_sgllocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tbad_peb_countclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeglobal_sqnumparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_counters_flagslist_posnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_idscatterlistNR_VM_ZONE_STAT_ITEMSclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitmtd_erase_region_inforead_iterwritablef_ownerbp_regVTIME_USERsa_flagstest__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invotp_factory_nvmemDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guest_get_devicedevice_physical_locationpm_domain_datapoll_table_structdirect_IOCMA_ALLOC_FAILcurrent_may_mount__UNIQUE_ID_ddebug535seqlock_tnuma_scan_offsetMTHP_STAT_ANON_FAULT_ALLOC_put_devicefast_attach___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskreadersch_lnumNR_INACTIVE_FILEregfuncindex_keymemalloc_noioGRPQUOTArwsemi_private_listia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secdfs_emulate_bitflipsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITUNEVICTABLE_PGSCANNEDactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpids_eraseFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidNR_UNACCEPTEDattribute_groupcontextposix_timersTHP_COLLAPSE_ALLOCselectorMEMORY_DEVICE_PRIVATEoobbufdev_releasedefault_timer_slack_nssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refvid_hdr_shiftpmdval_t___GFP_NOFAIL_BITubi_leb_validname_lengroup_infovdso_imagefileof_match_tableused_bytespercpu_count_ptr__user_state_sizemce_kill_meuuid_tproperty_read_int_array___GFP_UNUSED_BITKSWAPD_INODESTEALcount_objectserror_stimezone_device_dataf_wb_erruseddefparamfred_csfault_flagemulate_io_failureskprojid_tptracer_credtlb_genstorepage_mkwritebeb_rsvd_pebskobjectaudit_ttypnummce_ripvstatfsdma_skip_syncDROP_PAGECACHEnumab_stateremovablefeatureson_listpath_putkgid_ton_cpuFAULT_FLAG_VMA_LOCKNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistTHP_SPLIT_PUDclass_groupsnuma_nodePGSCAN_FILEi_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclaveALLOCSTALL_DMA32PGLAZYFREEcreateiattrMTHP_STAT_SHMEM_FALLBACKrseqecc_step_sizenfdssigvalvma_lockperf_event_listvol_id__compiletime_assert_39get_reserved_spacestack_refcountinvalidate_lockbmapERR_PTRkey_payload_write_user_prot_regd_real_lockPGSCAN_ZONE_RECLAIM_SUCCESSexpiry_active__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_44__compiletime_assert_45__compiletime_assert_46__compiletime_assert_47__compiletime_assert_48dqi_max_spc_limitexception_table_entryvfs_getattrevent_count_block_isbadcorrectedpreempt_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderMTHP_STAT_ZSWPOUTtimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startemulate_failuresblocksset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_listdevice_dma_supportedd_ino_warnshiwater_vmtracepointubi_namecompound_headUBI_DYNAMIC_VOLUMEia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitTHP_FILE_ALLOC_read_fact_prot_regqf_nextrangesiommu_mmcutimeem_tableNUMA_HUGE_PTE_UPDATESpersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infoMTHP_STAT_SHMEM_ALLOCd_fieldmaskubi_deviceuprobe_xol_opsseq_filefreeze_noirqNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixups__UNIQUE_ID_ddebug523file_operations__UNIQUE_ID_ddebug526__UNIQUE_ID_ddebug529KMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tNUMA_PAGE_MIGRATE__UNIQUE_ID___addressable_ubi_register_volume_notifier561ubi_leb_erasesymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbs__UNIQUE_ID_ddebug532max_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataPGSTEAL_KSWAPDsync_stateki_posexecute_only_pkeydfs_disable_bgtFAULT_FLAG_RETRY_NOWAITsyncupd_markersetleasepinspacct_structmust_resume__UNIQUE_ID_ddebug541__UNIQUE_ID_ddebug544__UNIQUE_ID_ddebug547long intfile_lock_contextusage__UNIQUE_ID___addressable_ubi_do_get_device_info520l_yesPGALLOC_DMAsiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimeuidhash_nodefred_ssproperty_present__kmalloc_index__UNIQUE_ID_ddebug550__UNIQUE_ID_ddebug553__UNIQUE_ID_ddebug556USRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typechk_ioruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirtynum_srcu_structsbdi_writebackkobj_completionooblayoutckvol_mutex__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inodecancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_colddma_addr_tssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobe__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock__UNIQUE_ID___addressable_ubi_leb_erase549___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenNR_ZONE_UNEVICTABLE_read_oobclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEmtd_syncget_reference_argssrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvol__UNIQUE_ID___addressable_ubi_leb_read_sg540NR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_id_unlocksrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infop_lensuspended_timedatastrtabtty_old_pgrpdl_throttledpage_posi_rwsem_oldget_projidsched_reset_on_forkskip_checkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountTHP_FAULT_FALLBACKrestore_noirqdfs_emulate_power_cutpower_cut_counterki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYubi_eba_read_lebrlimread_folionr_events__vpp_verifyiommuprivatewritebufsizest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctx__compiletime_assert_524__compiletime_assert_527splice_pipe__be16s_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seq__compiletime_assert_533DEVICE_PANEL_RIGHT__compiletime_assert_539KMALLOC_RANDOM_ENDmodstqheads_activechk_genMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangeput_devicenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_task__compiletime_assert_542__compiletime_assert_545__compiletime_assert_548task_worksmemory_failurerb_root_cached__be32s_copPGSTEAL_DIRECTdd_key_truezone_stat_itemhres_activebpf_raw_eventsget_devicedq_dirtydl_defer__compiletime_assert_551__compiletime_assert_554__compiletime_assert_557bug_listbeb_rsvd_leveldirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxmthp_stat_itemrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateMTHP_STAT_SWPINis_late_suspendedsysvsemTHP_FAULT_ALLOClockmapignore_childrenrestore_earlyclock_mutexfs_supersUBI_METAONLYdqb_bsoftlimitpendingf_task_workfm_protect___GFP_NORETRY_BITiowait_countcorruptedmax_erroneousPGFAULTnotifier_blockdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesbad_peb_limitearly_initmprotectsecurityxmm_spaceubi_erractivatef_pos_locksuspend_noirqPGSTEAL_FILEi_fieldmasktls_arrayownerpfo_val__acct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BIT__UNIQUE_ID___addressable_ubi_leb_change546i_bytesdomain_datarelax_countubi_io_read_data___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateleb_write_lockWRITE_LIFE_LONGdma_flagsuclamp_seubi_eba_unmap_lebFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_stateUBI_IO_BITFLIPSsubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersleb_write_trylockd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_tvol_counticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountdfs_emulate_failuresextable_basenoinstr_text_sizenargsattributesset_child_tid_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_stateleb_sizetick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugretlenupd_bufof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_t__compiletime_assert_104oobsizefilesdqb_bhardlimitliveatomic_write_unit_maxusable_leb_sizerun_listixolsym_vvar_pagemodule_sect_attrsused_ebsreturn_instancesoftirq_activatedout_unlock_bufclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesfm_workdescseqcountoom_score_adjd_seqia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_se__init_rwsemMOVE_TARGET_RD_ERRget_offset_ctxcore_forceidle_sum__UNIQUE_ID_ddebug521freeze_ucounti_ctime_nsecs_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocubi_io_read_vid_hdrpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listfutex_statevm_rcupgtables_bytesget_link_lock_user_prot_regfmode_tvolumes_lockcputime_atomicvols_foundrestoredelayed_callmax_nr_cid_statusd_sibkernel_ulong_tubi_io_write_datadma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stateleb_startgsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countfm_pool_rsv_cntreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalnum_volumesDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasewritesize_shiftscan_objectspid_typewb_errcputimertrace_recursionstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerhighest_vol_iddev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinschanging_lebattrget_next_child_nodeFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDmtd_ecc_statsget_wunitfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_node__ret_condpercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSmetaonlysyscore__s64dqi_bgrace__kernel_pid_t__compiletime_assert_88static_call_mod_timerdma_map_opsma_external_lock_panic_writedevice_physical_location_paneluid_toobretlenflush_requiredsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritenentriestypetabcrc32_leclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_pools_addr_lsb__compiletime_assert_97i_generation_sigpollmxcsrdevtd_rt_spc_hardlimitmagicle_freenumeraseregionsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexdriver_datathread_headlowmem_page_addressdev_pm_qosmap_typeMOVE_TARGET_WR_ERRf_opnor_flashpids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizedq_sbarch_static_branchsighand_structerroneousflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrygood_peb_count___GFP_NOWARN_BITcmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanubi_vid_hdrf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenget_policy__list_add_validHRTIMER_RESTARTsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_baserb_insert_colordevice_is_availabledquotdl_runtime__ret_do_oncenumbers_softexpiresvol_typekey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsdata_pad_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contextflash_sizetlbflush_unmap_batchsoftubi_eba_copy_tableprint_rsvd_warning__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesubi_fm_poolthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherskmalloc_cachesdown_write__compiletime_assert_218completionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalubi_warnFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printkvm_operations_structcnivcswbin_attrs_newdatbufruntime_idle__builtin_memcpyiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersfm_do_produce_anchorvid_hdr_aloffsetexp_hintd_childrendirty_foliois_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabdfs_emulate_io_failureswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infofail_addrref_counterror_remove_folioold_time32_tcore_kallsymsec_countmemcpysrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2backvmemmap_basestate_add_uevent_senti_hashubi_dbg_power_cuthlist_nodeio_uringotp_user_nvmemcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setkzalloc_noprofrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrseraseonlineruntime_resumedup_xol_workautoresize_vol_idMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmtd_mastercrc1gfp_tseccomp_filterstimelist_add_taili_mmapphys_addrd_lrusignal_structperf_event_mutexcrcspgdval_tpage_linksetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclUBI_COMPAT_REJECTpids_activedriveri_opldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expubi_eba_read_leb_sgaddress_space_operationsspinlock_t__task_fpstateubi_msgavail_pebswait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startubi_next_sqnumhuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysoobavail__list_adddevice_mutexsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDshared_pendingexpires___GFP_HARDWALL_BITnivcswubi_wl_entryMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_minmtd_pairing_schemes_devcpus_allowed_lockget_next_idrwlock_tpgprotfalseout_freed_weak_revalidate__compiletime_assert_100removed__compiletime_assert_101fm_disabledshow_pathmove_mutexUBI_STATIC_VOLUMEDL_DEV_DRIVER_BOUNDPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structnvmemsequencert_spc_warnlimitac_flag_block_isbadcoredump_datatasks_pidaddress_spacemm_context_talc_mutex__q_size__call_single_nodestartupubi_ec_hdrseqcount_spinlock_ti_wbreboot_notifieruint8_tpanelclass_id__read_overflow2_fieldinactive_timer_pkeyfilenames_export_opdata_offseti_flctxstashedvm_page_prottimespec64PIDTYPE_SIDrsvd_pebsbpf_ctxd_pruneprintedresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipe_writevbase_resumehostuaddrerasesize_masks_wb_errshm_clistis_child_subreapercall_depthunicode_mapgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfodfs_emulate_power_cutalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidmtd_req_statspairrseq_sigubi_debug_infodev_pm_domainlimit0limit1__compiletime_assert_518dqi_max_ino_limitmigrate_modemax_bitflipspoweroff_latemtd_ooblayout_opsftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_map__compiletime_assert_520alloc_dquot__compiletime_assert_522pm_messagemay_split__q_size_fieldmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountfm_sizeGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cputry_write_vid_and_datahlist_heads_encoding_flagsrunnable_weightincrcopy_flaggraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_base__compiletime_assert_530pipe_inode_info__compiletime_assert_536securebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsdfs_power_cut_maxslicesas_ss_spnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BITnumblocks___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listsrcu_barrier_completiondriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapraw_atomic_long_readfiemapwaiterssessionidmin_io_size_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1padding2padding3llistdebugfs_entryelemnr_retries_get_fact_prot_infosigval_tpartitions_lockalimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreeparti_wb_frn_avg_timefile_ref_ttypemembarrier_stateFORTIFY_FUNC_UNKNOWNpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type_block_markbadmtimeserver_has_tasksvm_faultoom_score_adj_minkobj_uevent_envdisable_bgtfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memfm_eba_semMOVE_CANCEL_RACEpath_unpointst_sizermtpcheckedwait_sumnum_tracepoints_readupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerldescunlinkperiod_contribdfs_power_cut_minrcu_node_entrynew_pnumstart_scan_seqaeb_slab_cachefsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollpagesizes_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7prioritybgt_thread_call_addrloginuidcheckexpiryoptimistic_spin_queuespin_unlockdl_defer_running__lstate__compiletime_assert_84ro_modearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvltree_lockmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_namesqnumproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfd_read_user_prot_regnr_wakeups_remoteleb_countpebsllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextubi_vtbl_recordwritesize_maskDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincountnvmem_devicetablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfromend_codethread_enabledqspinlockget_info__kmalloc_large_noproflru_geninsnfilldir_tubi_get_vid_hdr__must_check_overflowdl_non_contendingdir_contextchrdev_locktracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_context_get_user_prot_infoMOVE_RETRYgpl_symsgroupseq_showubi_alloc_vid_bufswait_queue_headcow_pageblocki_spc_timelimitreturn_instancescompatrb_firstclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namemasternodevm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areastatic_priomay_skip_resumeworks_countshrinkerdl_yieldeddqi_formatexec_update_lockis_error_sanel1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyspropertywchar_addr_bndkernel_symbolsubsys_datatv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineIS_ERRupd_receiveddfs_chk_iouser_cpus_ptrpi_top_taskdirect_writesactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedfs_chk_fastmapdisable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevtbl_sizeget_currentvfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsbuf_mutexkfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlencodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimesched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedmax_write_sizeubi_calc_data_lentracing_graph_pausepermcompat_robust_listktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidmove_to_putspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmUBI_VID_STATICfortify_memcpy_chkdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTmax_ecsp_offsetsrcu_cblist_invokingoops_panic_writei_lockd_nameget_ownershipufdsleb_write_unlockexe_filenr_scannedpcp_listpid_linksfree_countvolumess_sysfs_nameq_size_fieldrefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipqc_dqblkmove_tommappedseqcount_raw_spinlockdown_readubi_io_write_vid_hdrkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWERllist_headbyteswait_startatomic_long_readf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_endforce_full_scans_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyUBI_COMPAT_ROremoveUBI_COMPAT_PRESERVEs_magicdl_overrunallocd_parentubi_attach_infopayloadac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openstart_prevent_timelnumreadahead_control__kernel_gid32_tpeb_sizekernfs_open_filef_credmtd_oob_regionMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesubi_get_compatfastmapread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapvid_hdr_offseterasesizewritepagessched_statisticsheadfm_anchor__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclamp__compiletime_assert_326super_operations_suspendsplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATApt_regscorrecc_strengthpipe_bufswritersKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsout_mutexi_verity_infoxsavetimespec_type__rb_parent_colordevres_lockwritesizebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESFORTIFY_FUNC_memscanubi_eba_table_cond_reschedvm_private_dataio_bitmap__ret_onceuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasyncu_chari_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecgraph_get_port_parentpartitions__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrworksfreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freeparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeget_named_child_nodelaunder_foliocurr_targethdr_crcis_suspendeddfs_dirdma_length__keycorrected_bitflipsburstmtd_is_eccerrerroneous_peb_countetypeei_funcsmodule_kobjectactive_memcgdef_flagsuncorrectable_errorsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetmutex_lockarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsrb_link_nodeUBI_IO_BAD_HDR_EBADMSGlinux_binfmtpage_table_lock_sigfaultcounterskasan_check_readname_linkcmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_type__UNIQUE_ID_ddebug519policyshareddismissd_real_typelookahead_bandseq_startpeb_bufgfp_flagsraw_lockd_dnameget_dqblkvol_id2idxmax_hang_timecpus_maskubi_numsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnameubi_volumerun_delaytailslineno__dynamic_pr_debugbase_pfnERR_PTRget_inode_aclpower_cut_max_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbasecompatiblemax_wl_pool_sizeclock_listattrsarch_atomic64_readcpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainupd_bytes_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclmemset___GFP_ZERO_BITubi_fastmap_layoutwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsqc_stateubi_eba_atomic_leb_changeooblensoftirq_next_timerdump_stackcheck_flagsswp_entry_tuint64_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventup_writeset_performance_statephys_addr_tlookuptblclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryerasesize_shiftk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offmtd_debug_infoexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushDEV_DMA_COHERENTdma_skip_synclinksai_fastmapdio_completenr_segsd_spc_warnsnr_failed_migrations_hotma_flagsdelayed_workmean_echiwater_rsskretprobe_instancesrange_max_bad_blocksfutex_exit_mutexkernfs_iattrs___GFP_WRITE_BITd_spacegraveyard_linkeraseregionsxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERconst_pcpu_hotreserved_pebsi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typebad_allowedi_rdevalienself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEpairingnr_migrationsa_opsxa_flagsraw_atomic64_readfreeze_raw_spin_lockbin_sizeclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITubi_eba_is_mappeddata_sizeopnumd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpto_readcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsltree_lookupmodule_notes_attrsvm_lock_seqai_scanPIDTYPE_MAXnlinkpercpu_refscrubhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploltreeclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_filevidbhighest_lnums_stateuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrubi_eba_get_ldescset_dqblkotp_infokmalloc_typeqstr___GFP_ZEROTAGS_BITorig_pmdvtblacct_timexpd__rcu_icq_cacheubi_move_aeb_to_listsizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsmtd_oob_opsalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexmax_sqnumcore_statetimerqueue_headout_puthdrs_min_io_sizercharfutex_pi_statekstat__kernel_uid32_ttriesubi_eba_destroy_tableDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointepoll_watcheswl_lockprealloc_pterb_next_is_lockeddqb_curspace_entrygp_statebitsetload_avgaccesscstimecfs_rq_uidfm_work_scheduled_pointst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodeubi_calculate_reservedspc_warnlimits_encodinggpl_crcsorc_entrykeyspeb_countorig_ptedqb_curinodesload__s8spin_lockinvalidate_lock_keydma_maskprealloc_mutexnanosleep__already_donesrcu_gp_seq_neededpscr_ret__dq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtime__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionto_be_torturedseq_stopkiocbclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typewl_scheduledclass_device_is_conditionalmtd_pairing_infoshrinker_idrootoom_reaper_list__UNIQUE_ID_ddebug517shutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countsig_ok__SCT__cond_rescheddelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypefortify_memset_chksigpendingimage_seqfsindexshstksrcu_ssppage_orderwake_irqlast_eb_bytes__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequencedqb_ihardlimitUBI_IO_FF_BITFLIPSd_lockrefsubpage_sftrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_requbi_eba_write_leb_stchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tf_iocb_flagsdata_crcpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_trueis_emptyweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeecc_statstty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinedfs_dir_namepinned_vmwl_reboot_notifier_head_2apsi_flagsaddressstart_boottimedma_addressvm_starts_flagsfaultmigration_pendingec_hdr_alsizeshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusemtd_partp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_granubi_eba_leb_desckernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execveretrytlb_flush_pendingpage_offset_baseRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releaseubi_eba_create_tablealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchalien_peb_countrcu_tasks_exit_listarchdataia_uid_syncchildrenrb_subtree_lastubi_ltree_entryno_pm_callbacksbuild_iddevice_get_match_datavfork_done___GFP_ACCOUNT_BITpud_trt_spc_timelimitsym_int80_landing_paddown_write_trylocktailia_atimetlb_ubcquota_format_typeseekstask_struct__mptrrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memmax_pool_sizeerase_infoi_mtime_nsecperformancemmlistsuppress_bind_attrs_write_oobRPM_RESUMINGreg_offset_raw_spin_unlockgsbases_quota_typessg_pagef_llistphandleemulate_bitflipsubi_ro_modei_nlinkbranchused_blockswrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_serverUBI_COMPAT_DELETEtrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superPTR_ERRs_inode_list_lockubi_vid_io_bufsweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tubi_eba_initclock_basepower_cut_mincdevmy_qgroup_leadermkdirnextentsubi_ainf_volumereal_blockedarg_lockooboffsnum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerexclusiveclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockoverflowfile_ra_stateuser_structwork_semon_rq__p_size_fieldusersfs_context_erase_user_prot_regprealloc_bufbitflip_thresholdprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasschk_fastmaplast_mm_cidUBI_IO_FFcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagscheck_mappingrobust_listmove_fromsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockdev_links_infoloff_tthread_pidbgt_namesrcu_gp_seq_archec_sumst_valueclass_write_lock_irq_is_conditionalaldata_sizeKOBJ_NS_TYPESpprevtrc_blkd_nodecalls_block_isreservedi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_lockleb_read_locksched_delayedmodule_state__write_overflow_fieldlast_used_at__mutex_inithardirq_stack_ptrvm_endlast_queuednuma_migrate_retryuser_ns__stateubi_eba_copy_leb_rebootfirstiommu_groupmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrssuspendedhas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimebbtblocksFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexidx2vol_idubi_eba_write_lebi_private_dataElf64_Halfuse_autosuspendubi_init_vid_bufFORTIFY_FUNC_memcpynsproxycan_wakeupxol_arearlockpcpu_hotfl_owner_tfm_eba_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpout_unlockctimealignmentreleasemax_segment_sizesched_dl_entity_write__kernel_dev_tatomic_write_lenrb_erasedqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkvid_hdr_alsizeoom_flag_originubi_wl_scrub_pebcounterorc_unwindcorr_peb_countWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapfm_pooldonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotavtbl_slotseba_tbldl_timerleb_read_unlocki_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intfm_bufnuma_preferred_nid_hugetlb_cgroupdentry_operationsupd_ebsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requesteddfs_chk_gen__list_add_valid_or_reportcompat_long_tself_check_ebaactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opis_deadsysv_shmrwsem_is_lockedinstrument_atomic_readdq_countupdatingutf8data_tablefm_wl_poolset_latency_tolerance__func__resource_size_tfoliowake_entryxa_headsuidemulate_power_cuti_readcountpq_headubi_sgllocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tubi_eba_entrybad_peb_countlast_data_sizeclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeglobal_sqnumparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_counters_flagslist_posnotify_nextmax_perf_statebus_dma_limitbuffershort intmynodeof_device_idscatterlistclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitmtd_erase_region_inforead_iterwritablef_ownerubi_io_writebp_regVTIME_USERsa_flagstest__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invotp_factory_nvmemDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guest_get_devicedevice_physical_locationpm_domain_datapoll_table_structdirect_IOcurrent_may_mount__UNIQUE_ID_ddebug535seqlock_tubi_free_vid_bufnuma_scan_offset_put_devicefast_attach___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskreadersch_lnum__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTAi_private_listia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secdfs_emulate_bitflipsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpids_eraseFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_start__flagsp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atubi_wl_put_peblast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectorMEMORY_DEVICE_PRIVATEoobbufdev_releasedefault_timer_slack_nskcsan_check_accesssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refvid_hdr_shiftpmdval_t___GFP_NOFAIL_BITname_lengroup_infovdso_imageUBI_VID_DYNAMICfileof_match_tableused_bytespercpu_count_ptr__user_state_sizemce_kill_meuuid_tproperty_read_int_array___GFP_UNUSED_BITempty_peb_countcount_objectserrorq_size_stimezone_device_dataf_wb_errdefparamfred_csfault_flagemulate_io_failureskprojid_tptracer_credtlb_genstorepage_mkwritebeb_rsvd_pebskobjectaudit_ttypnummce_ripvstatfsnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodeoffsetsi_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_list__fortify_sizeaudit_contextpp_ref_countup_readsysfs_opsrecover_pebsequential_iomaybe_bad_peb_count_large_mapcount__compiletime_assert_102__compiletime_assert_103sda_is_static__compiletime_assert_105__compiletime_assert_106__compiletime_assert_107__compiletime_assert_108__compiletime_assert_109formatftopenclavesp_regcreateiattrrseqecc_step_sizenfdssigvalvma_lockperf_event_list__compiletime_assert_110__compiletime_assert_111vol_idget_reserved_spacestack_refcountinvalidate_lockbmapkey_payload_write_user_prot_regd_real_lockexpiry_activedqi_max_spc_limitexception_table_entryvid_hdrevent_countcorrectedpreempt_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startemulate_failuresblocksMOVE_TARGET_BITFLIPS__might_reschedset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_listdevice_dma_supportedd_ino_warnshiwater_vmtracepointubi_namecompound_headUBI_DYNAMIC_VOLUMEia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writers__compiletime_assert_82__compiletime_assert_83ino_timelimit__compiletime_assert_85__compiletime_assert_86__compiletime_assert_87splice_write__compiletime_assert_89i_rt_spc_timelimitltree_add_entry_read_fact_prot_regcss_setqf_nextranges__compiletime_assert_90__compiletime_assert_91__compiletime_assert_92__compiletime_assert_93__compiletime_assert_94__compiletime_assert_95__compiletime_assert_96iommu_mm__compiletime_assert_98__compiletime_assert_99ubi_wl_get_pebcutimeem_tablepersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmaskubi_deviceuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixups__UNIQUE_ID_ddebug523file_operations__UNIQUE_ID_ddebug525__UNIQUE_ID_ddebug527__UNIQUE_ID_ddebug529KMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tMOVE_SOURCE_RD_ERRsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbs__UNIQUE_ID_ddebug531__UNIQUE_ID_ddebug533max_allowed_capacityi387__UNIQUE_ID_ddebug537d_ino_timer__UNIQUE_ID_ddebug539avx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeydfs_disable_bgtFAULT_FLAG_RETRY_NOWAITsyncupd_markersetleasepinspacct_structmust_resume__UNIQUE_ID_ddebug541long intubi_find_avfile_lock_contextusagel_yeserr2siglockstatuserror_injection_entrycurrent_taskreal_addressac_stimeuidhash_nodefred_ssproperty_present__kmalloc_index__write_overflowUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typechk_ioruntime_statusin_iowaitunregfuncegidiomapdq_hashput_supersg_virtfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirtyrb_linknum_srcu_structsbdi_writebackkobj_completionout_unlock_lebooblayout__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_colddma_addr_tssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobe__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirq_read_oobclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyubi_eba_replace_tablegfp_maskpi_state_listrcu_segcblistsubvolusedfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_id_unlocksrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledpage_posi_rwsem_oldget_projidsched_reset_on_forkskip_checkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqpower_cut_counterki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYubi_eba_read_lebrlimread_folionr_events__vpp_verifyiommuprivatewritebufsizest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctx__compiletime_assert_524__compiletime_assert_526__compiletime_assert_528splice_pipe__be16spinlock_checks_lock_keytry_recover_pebsrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seq__compiletime_assert_532__compiletime_assert_534DEVICE_PANEL_RIGHT__compiletime_assert_538KMALLOC_RANDOM_ENDmodstqheads_activechk_genMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_task__compiletime_assert_540__compiletime_assert_542task_worksmemory_failurerb_root_cached__be32s_copdd_key_truekmalloc_array_noprofhres_activebpf_raw_eventsdq_dirtydl_deferbug_listbeb_rsvd_leveldirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_statescan_ebais_late_suspendedsysvsemlockmapignore_childrenrestore_earlyclock_mutexfs_supers__be64min_ecUBI_IO_BAD_HDRdqb_bsoftlimitpendingf_task_workfm_protect___GFP_NORETRY_BITiowait_countubi_ainf_pebcorruptedmax_erroneousnotifier_blockdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesbad_peb_limitearly_initubi_io_readmprotectsecurityxmm_spaceubi_erractivatef_pos_lockckvol_mutexi_fieldmasktls_arrayownerpfo_val__acct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITi_bytesdomain_datarelax_count___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEubi_check_patterndup_xol_addrZSWPOUTcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_stateUBI_IO_BITFLIPSsubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsNUMA_INTERLEAVE_HITneed_qsswap_deactivateblkcnt_tvol_counticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountdfs_emulate_failuresextable_basenoinstr_text_sizenargsattributesMTHP_STAT_SWPOUT_FALLBACKvfreeset_child_tidNUMA_HINT_FAULTS_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_stateleb_sizetick_dep_maskvalidate_vid_hdrlistthrottle_disksi_errnoyields_inode_lrusrcu_size_stateblk_plugretlenPGSCAN_SKIP_DMA32upd_bufof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tDIRECT_MAP_LEVEL3_SPLIToobsizefilesdqb_bhardlimitliveatomic_write_unit_maxusable_leb_sizerun_listixolsym_vvar_pagemodule_sect_attrsused_ebsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesfm_workdescseqcountoom_score_adjd_seqia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listself_check_peb_ec_hdrpasid_activatedubi_dbg_is_power_cutpi_seget_offset_ctxcore_forceidle_sum__UNIQUE_ID_ddebug521freeze_ucounti_ctime_nsecs_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocubi_io_read_vid_hdrpfn_mkwritecallback_heads_vopperf_eventf_securityi_sb_listfutex_statevm_rcupgtables_bytesget_link_lock_user_prot_regfmode_tvolumes_lockcputime_atomicrestoredelayed_callmax_nr_cid_statusd_sibkernel_ulong_tdma_opsTHP_COLLAPSE_ALLOC_FAILEDbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stateleb_startgsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countPGPGOUTfm_pool_rsv_cntreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasewritesize_shiftscan_objectspid_typewb_errcputimertrace_recursionstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinschanging_lebattrget_next_child_nodeFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDmtd_ecc_statsget_wunitfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSmetaonlysyscore__s64dqi_bgrace__kernel_pid_t__compiletime_assert_88static_call_mod_timerdma_map_opsma_external_lock_panic_writedevice_physical_location_paneluid_toobretlenflush_requiredget_random_u32_belowsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabcrc32_leclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_pools_addr_lsbi_generation_sigpollmxcsrdevtd_rt_spc_hardlimitmagicnumeraseregionsNR_ZONE_ACTIVE_FILEnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qosmap_typef_opnor_flashpids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizedq_sbNR_FILE_THPSarch_static_branchsighand_structerroneousflagsi_lock_keykmem_cacheinodedrivers_dirnor_erase_prepareNR_ZONE_ACTIVE_ANONbug_entrygood_peb_count___GFP_NOWARN_BITcmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanubi_vid_hdrf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenget_policyHRTIMER_RESTARTsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbers_softexpiresvol_typekey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messageNUMA_OTHERnum_trace_eventsdata_pad_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contextflash_sizetlbflush_unmap_batchsoft__sifieldsDIRECT_MAP_LEVEL2_SPLITrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6THP_DEFERRED_SPLIT_PAGEkprobes_text_sizestatic_call_sitesTHP_FILE_FALLBACK_CHARGEubi_fm_poolthread_group_cputimernuma_scan_period_maxbadblocksstart_stackTHP_SWPOUT_FALLBACKwatcherskmalloc_cachescompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsubi_dump_flashbpf_raw_event_maperrstrFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataWORKINGSET_REFAULT_ANONget_dquotsnum_orcsclass_task_lock_is_conditionalubi_warnFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structcnivcswbin_attrs_newdatbufruntime_idleiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersPGSCAN_DIRECTvid_hdr_aloffsetexp_hintd_childrendirty_foliois_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabPGSCAN_SKIP_MOVABLEdfs_emulate_io_failureswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infofail_addrref_counterror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2back__compiletime_assert_276state_add_uevent_sentOOM_KILLi_hashubi_dbg_power_cuthlist_nodeio_uringotp_user_nvmemcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setkzalloc_noprofrcuwaitCOMPACTFAILbio_listwrite_dquotclass_read_lock_irq_is_conditionalNUMA_MISSioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlineruntime_resumedup_xol_workKCOMPACTD_WAKEautoresize_vol_idMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmtd_mastergfp_tseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexNR_PAGETABLEcrcsUNEVICTABLE_PGMLOCKEDpgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclUBI_COMPAT_REJECTpids_activedriveri_opldt_usr_semubi_dbg_write_failurekobj_ns_type_operationsmtd_is_bitflipseqcount_raw_spinlock_tpercpu_rw_semaphoreverboseWORKINGSET_ACTIVATE_FILEcredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstateubi_msgavail_pebswait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesmtd_eraseDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysoobavaildevice_mutexsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDshared_pendingexpires___GFP_HARDWALL_BITnivcswubi_wl_entryMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_minmtd_pairing_schemes_devcpus_allowed_lockget_next_idrwlock_tpgprotfalseout_freed_weak_revalidateremovedfm_disabledshow_pathmove_mutexget_random_u32DL_DEV_DRIVER_BOUNDPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyubi_io_read_ec_hdriommu_mm_datavm_event_itemmce_countswap_info_structnvmemsequencert_spc_warnlimitac_flag_block_isbadcoredump_datatasks_pidaddress_spacemm_context_talc_mutexmtd_block_markbad__call_single_nodestartupubi_ec_hdrseqcount_spinlock_ti_wbreboot_notifieruint8_tpanelclass_idinactive_timer_pkeyfilenames_export_opMTHP_STAT_SPLIT_DEFERREDdata_offseti_flctxstashedvm_page_prottimespec64PIDTYPE_SIDrsvd_pebsbpf_ctxd_pruneprintedresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipe_writevbase_resumehostuaddrerasesize_masks_wb_errshm_clistis_child_subreapercall_depthunicode_mapgraph_get_remote_endpointnum_descsTHP_MIGRATION_SPLITexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidmtd_req_statspairrseq_sigubi_debug_infodev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modemax_bitflipsSWAP_RA_HITpoweroff_latemtd_ooblayout_opsftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_map__compiletime_assert_520alloc_dquot__compiletime_assert_522pm_messagemay_splitmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountfm_sizeGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuCOMPACTSTALLhlist_heads_encoding_flagsrunnable_weightincrcopy_flaggraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowkernfs_open_fileunsigned charumount_beginvdsommap_legacy_basePAGEOUTRUNTHP_SCAN_EXCEED_SHARED_PTEpipe_inode_info__compiletime_assert_536securebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsdfs_power_cut_maxSWPIN_ZEROslicesas_ss_spNR_ZONE_INACTIVE_ANONnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BITNR_FREE_PAGESnumblocks___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listsrcu_barrier_completionshrink_controldriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidself_check_writemin_io_size_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1padding2padding3llistdebugfs_entryelemnr_retries_get_fact_prot_infoPGSCAN_DIRECT_THROTTLEsigval_tpartitions_lockalimitundo_listKMALLOC_RANDOM_STARTALLOCSTALL_DEVICEmissedquota_readst_shndxfreeparti_wb_frn_avg_timePGSCAN_KSWAPDfile_ref_tCMA_ALLOC_SUCCESStypemembarrier_stateFORTIFY_FUNC_UNKNOWNpage_poolsuspendinitfiles_structwrite_iterNR_ACTIVE_FILEs_dio_done_wqDROP_SLAB_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type_block_markbadmtimeserver_has_tasksvm_faultoom_score_adj_minkobj_uevent_envdisable_bgtfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memfm_eba_semTHP_FILE_FALLBACKpath_unpointst_sizermtpcheckedwait_sumnum_tracepoints_readupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqPGSCAN_KHUGEPAGEDDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerPGREUSEunlinkperiod_contribdfs_power_cut_minrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollTHP_MIGRATION_FAILpagesizes_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7prioritybgt_thread_call_addrloginuidchecktortureTHP_FILE_MAPPEDexpiryoptimistic_spin_queuedl_defer_runningALLOCSTALL_NORMALself_check_peb_vid_hdr__lstate__compiletime_assert_84ro_modearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvTHP_MIGRATION_SUCCESSltree_lockmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_namesqnumproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfd_read_user_prot_regnr_wakeups_remotepebsllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextubi_vtbl_recordHTLB_BUDDY_PGALLOC_FAILwritesize_maskDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincountnvmem_devicetablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_sequbi_self_check_all_ffcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codethread_enabledqspinlock__get_random_u32_belowget_info__kmalloc_large_noproflru_genNR_VMSCAN_WRITEinsnfilldir_tNUMA_PTE_UPDATESubi_get_vid_hdrdl_non_contendingdir_contextPGFREEchrdev_locktracepoint_ptr_tutaskNR_UNEVICTABLEsched_entityd_spc_hardlimitlong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baseio_context_get_user_prot_infogpl_symsgroupseq_showubi_alloc_vid_bufPGSCAN_SKIP_DMAswait_queue_headcow_pageblockSWPOUT_ZEROi_spc_timelimitreturn_instancescompatclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddeviceubi_dump_vid_hdrs_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessibleubi_io_write_ec_hdrDUMP_PREFIX_NONEquick_threadstime_sliceobjcgfull_namemasternodeBALLOON_INFLATEvm_lockMTHP_STAT_NR_ANON_PARTIALLY_MAPPEDPGMIGRATE_SUCCESSno_cgroup_migrationMTHP_STAT_SPLIT_FAILEDnextevts_writers_key__countxcomp_bvcma_areaWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeworks_countshrinkerdl_yieldeddqi_formatCOMPACTFREE_SCANNEDexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keysMTHP_STAT_ANON_FAULT_FALLBACK_CHARGEpropertywchar_addr_bndkernel_symbolsubsys_datatv_secpid_ttask_listubi_io_is_badftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineupd_receivedNR_SWAPCACHEdfs_chk_iouser_cpus_ptrpi_top_taskdirect_writesNR_WRITEBACK_TEMPactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedfs_chk_fastmapdisable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidPGACTIVATEngroupsfree_file_info__kernel_time64_tNR_VM_NUMA_EVENT_ITEMSautaskuser_namespacevtbl_sizeget_currentvfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagspatternsPGREFILLMTHP_STAT_ANON_FAULT_FALLBACKbuf_mutexkfreestatic_call_trampTHP_SWPOUTbtrace_seq_pp_mapping_padsa_maskrequest_queueKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenMTHP_STAT_SPLITubi_dbg_is_ffcodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimeCOMPACTMIGRATE_SCANNEDsched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedmax_write_sizetracing_graph_pausepermcompat_robust_listktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidmove_to_putspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmUBI_VID_STATICdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTmax_ecsp_offsetsrcu_cblist_invokingoops_panic_writei_lockd_nameget_ownershipUNEVICTABLE_PGMUNLOCKEDufdsexe_filenr_scannedpcp_listpid_linksfree_countvolumess_sysfs_namerefcountNR_THROTTLED_WRITTENvaddrrequestrw_hinttimeoutdma_configurelast_switch_timenum_classesorc_unwind_ipqc_dqblkmove_tommappedseqcount_raw_spinlockubi_io_write_vid_hdrkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyUBI_COMPAT_ROremoveUBI_COMPAT_PRESERVEPGSCAN_ANONs_magicdl_overrunallocd_parentpayloadac_minflti_sbkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openstart_prevent_timelnumreadahead_control__kernel_gid32_tpeb_sizeNR_BOUNCEf_credmtd_oob_regionMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areaTHP_FAULT_FALLBACK_CHARGEdev_pagemapis_power_of_2vid_hdr_offsetPGDEACTIVATEerasesizewritepagessched_statisticsheadfm_anchor__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclamp__compiletime_assert_326super_operations_suspendsplice_eofutil_avg___GFP_DMA_BITKSM_SWPIN_COPYrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockPGSCAN_SKIP_NORMALD_REAL_DATApt_regsecc_strengthpipe_bufswritersNR_IOMMU_PAGESctx_idd_rt_spc_warnsget_random_u8i_verity_infoxsavetimespec_type__rb_parent_colordevres_lockwritesizebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESCOW_KSMFORTIFY_FUNC_memscanubi_eba_tablevm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasyncu_chari_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGESchardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecUNEVICTABLE_PGCLEAREDKSWAPD_LOW_WMARK_HIT_QUICKLYgraph_get_port_parentpartitionsUNEVICTABLE_PGRESCUED__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_aliasNR_SHMEM__iovcpumaskPGLAZYFREEDdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrworksfreeze_fsuserfaultfd_ctxsigset_trunningubi_dbg_is_read_failurerseq_event_masks_rootra_pagesTT_COMPATfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountpage_freeNR_FILE_MAPPEDparentatimecopy_file_rangetask_cputime_atomicBALLOON_DEFLATEuser_definedkey_typeget_named_child_nodelaunder_foliocurr_targethdr_crcis_suspendeddfs_dircorrected_bitflipsburstmtd_is_eccerrerroneous_peb_countetypeei_funcsmodule_kobjectactive_memcgdef_flagsuncorrectable_errorsbase0base1base2wait_queue_head_tpage_typercu_data0no_updateubi_dbg_bitflipcap_bsetmutex_lockarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsWORKINGSET_NODESUBI_IO_BAD_HDR_EBADMSGlinux_binfmtpage_table_lock_sigfaultcountersname_linkNR_ANON_THPScmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_type__UNIQUE_ID_ddebug519policysharedTHP_SCAN_EXCEED_SWAP_PTEubi_dbg_chk_iodismissd_real_typelookahead_bandseq_startself_check_ec_hdrpeb_bufgfp_flagsraw_lockd_dnameget_dqblkmax_hang_timecpus_maskubi_numsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnameubi_volumewrittenrun_delaytailslineno__dynamic_pr_debugbase_pfnget_inode_aclpower_cut_max_addr_pkeymigrate_foliocustom_sliceNR_ACTIVE_ANONNUMA_LOCALthread_keyringkparam_arrayutimestart_codeis_hardfsbasecompatiblemax_wl_pool_sizeclock_listattrsnuma_stat_itemALLOCSTALL_MOVABLEcpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__UNIQUE_ID_ddebug543__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpuPGDEMOTE_KSWAPDmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainupd_bytes_sigchldreservedubi_dbg_is_bitfliplatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_ti_blocksnuma_faults_localityhas_child_subreaperubi_dump_ec_hdri_aclmemset___GFP_ZERO_BITubi_fastmap_layoutwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsqc_stateKCOMPACTD_MIGRATE_SCANNEDooblensoftirq_next_timerdump_stackcheck_flagsswp_entry_tuint64_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventNR_MLOCKset_performance_statephys_addr_tlookuptblclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryerasesize_shiftk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanPGPGINfs_parameter_specdesc_structdq_offmtd_debug_infoexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkBALLOON_MIGRATEpushDEV_DMA_COHERENTNR_ZONE_LRU_BASElinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotma_flagsdelayed_workmean_echiwater_rsskretprobe_instancesrange_max_bad_blocksfutex_exit_mutex__MTHP_STAT_COUNTkernfs_iattrs___GFP_WRITE_BITd_spacegraveyard_linkeraseregionsxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERubi_io_mark_badconst_pcpu_hotreserved_pebsi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typeNUMA_FOREIGNbad_allowedi_rdev__compiletime_assert_530self_exec_idkernfs_opsfile_lockMTHP_STAT_NR_ANONMODULE_STATE_LIVEpairingnr_migrationsa_opsxa_flagsfreezebin_sizeNR_ZONE_WRITE_PENDINGclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITread_errdata_sized_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkpercpu_refscrubhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqTHP_UNDERUSED_SPLIT_PAGErefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploltreePGALLOC_DEVICEclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_filevidbs_stateUNEVICTABLE_PGCULLEDuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkotp_infoTHP_SPLIT_PAGEkmalloc_typeqstrWORKINGSET_REFAULT_FILE___GFP_ZEROTAGS_BITPGSTEAL_KHUGEPAGEDorig_pmdvtblacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posNR_FILE_DIRTYnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsNR_LRU_BASEmtd_oob_opsalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_stateMTHP_STAT_SHMEM_FALLBACK_CHARGEtimerqueue_headhdrs_min_io_sizercharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_tPGSTEAL_ANONdevice_driverdl_server_has_tasks_frunnable_sumreal_credCOMPACTISOLATEDget_namefwnode_endpointepoll_watcheswl_lockprealloc_ptePGALLOC_NORMALWORKINGSET_ACTIVATE_BASE_is_lockeddqb_curspace_entrygp_statebitsetload_avgaccesscstimecfs_rq_uidfm_work_scheduled_pointst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimitNR_WRITTENs_encodinggpl_crcsorc_entrykeyspeb_countorig_ptedqb_curinodesload__s8ZSWPINinvalidate_lock_keydma_maskprealloc_mutexnanosleepnode_stat_itemsrcu_gp_seq_neededpscr_ret__PGMAJFAULTdq_dqb_lock__kernel_ulong_tPSWPOUTdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignDUMP_PREFIX_OFFSETbtime__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTPGALLOC_DMA32runtime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionto_be_torturedseq_stopkiocbKSWAPD_HIGH_WMARK_HIT_QUICKLYclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typewl_scheduledclass_device_is_conditionalmtd_pairing_infoshrinker_idrootoom_reaper_list__UNIQUE_ID_ddebug517shutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countNR_SHMEM_THPSsig_okdelaysqf_ownerreadaheadkmalloc_cache_typeNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypeubi_dbg_is_ff_bitflipsfortify_memset_chksigpendingimage_seqfsindexshstksrcu_ssppage_orderwake_irqlast_eb_bytes__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32PGINODESTEALptracedtrc_reader_specialNUMA_HITHPROBE_GONEMTHP_STAT_SWPOUTactive_timeTHP_SPLIT_PAGE_FAILEDi_sequencedqb_ihardlimitUBI_IO_FF_BITFLIPSd_lockrefsubpage_sftrpm_requestnum_bpf_raw_eventsaddrdevice_privatefail_perfTHP_ZERO_PAGE_ALLOC_FAILEDi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tf_iocb_flagsdata_crcpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmoveHTLB_BUDDY_PGALLOCsched_contributes_to_loadstatic_key_trueweighti_privatemaxrssec_hdrflushruntime_suspendi_blkbitsvaluegroup_exit_codeecc_statstty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimeceildeadlinedfs_dir_namepinned_vmwl_reboot_notifierTHP_ZERO_PAGE_ALLOC_head_2apsi_flagsaddressstart_boottimevm_startmults_flagsfaultmigration_pendingec_hdr_alsizeshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusemtd_partp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgbuf1ZSWPWBs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execveretrytlb_flush_pendingfm_do_produce_anchorRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqprev_posNR_ISOLATED_FILEseqcount_spinlocks_securityexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uid_syncchildrenrb_subtree_lastno_pm_callbacksbuild_idPGMIGRATE_FAILdevice_get_match_datavfork_done___GFP_ACCOUNT_BITubi_dbg_is_erase_failurepud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structDUMP_PREFIX_ADDRESSrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memmax_pool_sizeerase_infoi_mtime_nsecperformancemmlistsuppress_bind_attrs_write_oobRPM_RESUMINGreg_offsetgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesNR_ZONE_INACTIVE_FILE__vmalloc_noproff_llistsize_is_constantphandleemulate_bitflips__UNIQUE_ID_x_547ubi_ro_modei_nlinkbranchused_blockswrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_serverUBI_COMPAT_DELETEtrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixubi_dbg_is_eccerrwlockedNR_VM_EVENT_ITEMSfreeze_supers_inode_list_lockubi_vid_io_bufsweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabKCOMPACTD_FREE_SCANNEDdevice_typePGROTATEDmaj_fltarch_rwlock_tclock_basepower_cut_minSLABS_SCANNEDcdevmy_qgroup_leadermkdirnextentsreal_blockedarg_lockooboffsnum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerexclusiveclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyNR_FREE_CMA_PAGESqrwlockSWAP_RAfile_ra_stateuser_structwork_semon_rqfs_context_erase_user_prot_regprealloc_bufbitflip_thresholdprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasschk_fastmaplast_mm_cidUBI_IO_FFcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuUNEVICTABLE_PGSTRANDEDilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrPGDEMOTE_DIRECTattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listmove_fromsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockdev_links_infoloff_tthread_pidbgt_namesrcu_gp_seqCOMPACTSUCCESS_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevtrc_blkd_nodecalls_block_isreservedi_default_acls_uuid_lenioc_nodeof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secget_random_u16matchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tPGSCAN_SKIP_DEVICEFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmodule_state__write_overflow_fieldlast_used_athardirq_stack_ptrALLOCSTALL_DMAvm_endlast_queuednuma_migrate_retryuser_ns__statePSWPIN_rebootfirstiommu_groupmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrssuspendedhas_timeoutinvalidate_folionodemask_ti_modenr_thpsNUMA_HINT_FAULTS_LOCALia_ctimebbtblocksFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendubi_init_vid_bufFORTIFY_FUNC_memcpynsproxycan_wakeupxol_areaPGPROMOTE_SUCCESSrlockpcpu_hotfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtTHP_SCAN_EXCEED_NONE_PTEvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpctimealignmentreleasemax_segment_sizesched_dl_entity_write__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_idPGALLOC_MOVABLENR_ZSPAGESs_dentry_lrubp_offsetfolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkvid_hdr_alsizeoom_flag_origincounterorc_unwindcorr_peb_countWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapfm_pooldonePGSCAN_ZONE_RECLAIM_FAILEDfscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliomtd_writeMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotavtbl_slotseba_tbldl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intfm_bufnuma_preferred_nid_hugetlb_cgroupdentry_operationsupd_ebsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requesteddfs_chk_gencompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opis_deadsysv_shmdq_countupdatingutf8data_tablefm_wl_poolset_latency_toleranceubi_io_sync_erase__func__resource_size_tfoliowake_entryTHP_SPLIT_PMDxa_headsuidemulate_power_cuti_readcountpq_headlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tbad_peb_countclass_rcu_is_conditionalself_check_not_badbpf_local_storageactionclockid_tquota_syncdq_freeglobal_sqnumparent_exec_idretrieskernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_counters_flagsnotify_nextmax_perf_statebus_dma_limitbuffershort intmynodeof_device_idNR_VM_ZONE_STAT_ITEMSubi_dbg_is_bad_hdr_ebadmsgclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitmtd_erase_region_inforead_iterwritablef_ownerubi_io_writebp_regVTIME_USERsa_flagstest__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invotp_factory_nvmemDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guest_get_devicedevice_physical_locationpm_domain_datapoll_table_structdirect_IOCMA_ALLOC_FAILcurrent_may_mount__UNIQUE_ID_ddebug535seqlock_tubi_free_vid_bufnuma_scan_offsetMTHP_STAT_ANON_FAULT_ALLOC_put_devicefast_attach___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskreadersch_lnumNR_INACTIVE_FILEregfuncindex_keymemalloc_noioGRPQUOTAi_private_listia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secdfs_emulate_bitflipsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITUNEVICTABLE_PGSCANNEDactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpids_eraseFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidNR_UNACCEPTEDattribute_groupcontextposix_timersTHP_COLLAPSE_ALLOC__UNIQUE_ID_y_548selectorMEMORY_DEVICE_PRIVATEoobbufdev_releasedefault_timer_slack_nssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refvid_hdr_shiftpmdval_t___GFP_NOFAIL_BITname_lengroup_infovdso_imageUBI_VID_DYNAMICfilemtd_block_isbadof_match_tableused_bytespercpu_count_ptr__user_state_sizemce_kill_meuuid_tproperty_read_int_array___GFP_UNUSED_BITKSWAPD_INODESTEALcount_objectserror_stimezone_device_dataf_wb_erruseddefparamfred_csfault_flagemulate_io_failureskprojid_tptracer_credtlb_genstorepage_mkwritebeb_rsvd_pebskobjectaudit_ttypnummce_ripvstatfsdma_skip_syncDROP_PAGECACHEnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKdump_lenNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistTHP_SPLIT_PUDclass_groupsnuma_nodePGSCAN_FILEi_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchangedwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclaveALLOCSTALL_DMA32PGLAZYFREEsp_regcreateiattrMTHP_STAT_SHMEM_FALLBACKrseqecc_step_sizenfdssigvalvma_lockperf_event_listvol_idget_reserved_spacestack_refcountinvalidate_lockbmapkey_payload_write_user_prot_regd_real_lockPGSCAN_ZONE_RECLAIM_SUCCESSexpiry_activevalidate_ec_hdrdqi_max_spc_limitpatt_countexception_table_entryvid_hdrevent_countcorrectedpreempt_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderMTHP_STAT_ZSWPOUTtimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startemulate_failuresblocksset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_listdevice_dma_supportedd_ino_warnshiwater_vmtracepointubi_namecompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writers__compiletime_assert_82__compiletime_assert_83ino_timelimit__compiletime_assert_85__compiletime_assert_86__compiletime_assert_87splice_write__compiletime_assert_89i_rt_spc_timelimitTHP_FILE_ALLOC_read_fact_prot_regcss_setqf_nextranges__compiletime_assert_90__compiletime_assert_91iommu_mmcutimeem_tableNUMA_HUGE_PTE_UPDATESpersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infoMTHP_STAT_SHMEM_ALLOCd_fieldmaskubi_deviceuprobe_xol_opsseq_filefreeze_noirqNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixups__UNIQUE_ID_ddebug523file_operations__UNIQUE_ID_ddebug525__UNIQUE_ID_ddebug527__UNIQUE_ID_ddebug529KMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tNUMA_PAGE_MIGRATEdo_sync_erasesymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbs__UNIQUE_ID_ddebug531__UNIQUE_ID_ddebug533max_allowed_capacityi387__UNIQUE_ID_ddebug537d_ino_timer__UNIQUE_ID_ddebug539avx512_timestampfuncsend_dataPGSTEAL_KSWAPDsync_stateki_posexecute_only_pkeydfs_disable_bgtFAULT_FLAG_RETRY_NOWAITsyncupd_markersetleasepinspacct_structmust_resume__UNIQUE_ID_ddebug541__UNIQUE_ID_ddebug545long intfile_lock_contextusagel_yesPGALLOC_DMAsiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimeuidhash_nodefred_ssproperty_present__kmalloc_index__write_overflowUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typechk_ioruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirtyubi_dbg_erase_failurenum_srcu_structsbdi_writebackkobj_completionooblayoutckvol_mutex__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobe__fortify_panictracepoint_funcargvubi_dbg_is_bad_hdrentryfree_cached_objectsworkqueue_structpi_lockubi_dbg_is_write_failure___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenNR_ZONE_UNEVICTABLE_read_oobclass_spinlock_irq_try_is_conditionaloom_mmtorture_pebFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvolNR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_id_unlocksrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkskip_checkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountTHP_FAULT_FALLBACKrestore_noirqdfs_emulate_power_cutpower_cut_counterki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGY__compiletime_assert_518rlimread_folionr_events__vpp_verifyiommuprivatewritebufsizest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctx__compiletime_assert_524__compiletime_assert_526__compiletime_assert_528splice_pipe__be16s_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seq__compiletime_assert_532__compiletime_assert_534DEVICE_PANEL_RIGHT__compiletime_assert_538KMALLOC_RANDOM_ENDmodstqheads_activechk_genMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_task__compiletime_assert_540__compiletime_assert_542__compiletime_assert_544__compiletime_assert_546task_worksmemory_failurerb_root_cached__be32s_copPGSTEAL_DIRECTdd_key_truezone_stat_itemself_check_vid_hdrhres_activebpf_raw_eventsdq_dirtydl_deferbug_listbeb_rsvd_leveldirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxmthp_stat_itemrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateMTHP_STAT_SWPINis_late_suspendedsysvsemTHP_FAULT_ALLOClockmapignore_childrenrestore_earlyclock_mutexfs_supers__be64UBI_IO_BAD_HDRdqb_bsoftlimitpendingf_task_workfm_protect___GFP_NORETRY_BITiowait_countcorruptedmax_erroneousprint_hex_dumpPGFAULTnotifier_blockdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesbad_peb_limitearly_initmtd_readubi_io_readmprotectsecurityxmm_spaceubi_erractivatef_pos_locksuspend_noirqPGSTEAL_FILEi_fieldmasktls_arrayownerpfo_val__acct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITi_bytesdomain_datarelax_count___GFP_THISNODE_BITlinefound_pebs_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_stateUBI_IO_BITFLIPSsubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasewl_tree_addstates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_tvol_counticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountdfs_emulate_failuresextable_basenoinstr_text_sizenargsattributes__list_del_entryset_child_tid_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_stateleb_sizetick_dep_masklistthrottle_disksi_errnoyields_inode_lrusrcu_size_stateblk_plugretlenupd_bufof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_toobsizefilesdqb_bhardlimitliveatomic_write_unit_maxusable_leb_sizerun_listixolsym_vvar_pagemodule_sect_attrsused_ebsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesfm_workdescseqcountoom_score_adjd_seqia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_se__init_rwsemMOVE_TARGET_RD_ERRget_offset_ctxcore_forceidle_sum__UNIQUE_ID_ddebug521freeze_ucounti_ctime_nsecschedule_erases_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocubi_io_read_vid_hdrpfn_mkwritecallback_heads_vop__compiletime_assert_220perf_eventf_securityi_sb_listfutex_statevm_rcupgtables_bytesget_link_lock_user_prot_regfmode_tvolumes_lockdevtvols_foundrestoredelayed_callmax_nr_cid_statusd_sibkernel_ulong_tdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stateleb_startgsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countfm_pool_rsv_cntreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasewritesize_shiftscan_objectspid_typewb_errcputimertrace_recursionstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerhighest_vol_iddev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinschanging_lebattrget_next_child_nodeFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDmtd_ecc_statsget_wunitfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_nodepercpu_ref_dataubi_wl_initdestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSdiffmetaonlysyscore__s64dqi_bgrace__kernel_pid_t__compiletime_assert_88static_call_mod_timerdma_map_opsma_external_lock_panic_writedevice_physical_location_paneluid_toobretlenflush_requiredsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_pools_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitmagicnumeraseregionsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qosmap_typeMOVE_TARGET_WR_ERRf_opnor_flashpids_active_resetconfirm_switchseqcount_tkmem_cache_alloc_noprofnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizedq_sbarch_static_branchsighand_structerroneousflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrygood_peb_count___GFP_NOWARN_BITcmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingread_ecmnt_rootnext_scanubi_vid_hdrf_rain_wl_treequota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenget_policy__list_add_validHRTIMER_RESTARTout_not_movedsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_baserb_insert_colordevice_is_availabledquotdl_runtimenumbers_softexpiresvol_typekey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsdata_pad_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contextflash_sizetlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesubi_fm_poolthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherskmalloc_cachesdown_write__compiletime_assert_217__compiletime_assert_218completionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalubi_warnFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structcnivcswbin_attrs_newdatbufruntime_idleiov_basesrcu_size_jiffiesi_statesched_classmultiprocessubi_wl_flushpi_waitersvid_hdr_aloffsetexp_hintd_childrendirty_foliois_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabdfs_emulate_io_failureswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infofail_addrlist_emptyref_counterror_remove_folioold_time32_tcore_kallsymsec_countsrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodesprintfio_uringotp_user_nvmemcore_occupationmay_reserve_for_fmftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setkzalloc_noprofrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrseraseonlineruntime_resumedup_xol_workautoresize_vol_idMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workubi_find_fm_blockoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimittry_to_freezereported_split_lockmtd_mastergfp_tseccomp_filterstimelist_add_taili_mmapphys_addrd_lrusignal_structperf_event_mutexprotectcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrydo_worklist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstateubi_msgavail_pebswait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysoobavailrb_link__list_adddevice_mutexsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDshared_pendingexpires___GFP_HARDWALL_BITnivcswubi_wl_entryMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_minmtd_pairing_schemes_devcpus_allowed_lockget_next_idrwlock_tpgprotfalseout_freed_weak_revalidateremovedfm_disabledshow_pathmove_mutexDL_DEV_DRIVER_BOUNDPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyubi_io_read_ec_hdriommu_mm_datamce_countswap_info_structnvmemsequencert_spc_warnlimit__refrigeratorac_flag_block_isbadcoredump_datatasks_pidaddress_spacemm_context_talc_mutex__call_single_nodestartupubi_ec_hdrseqcount_spinlock_ti_wbreboot_notifieruint8_tpanelclass_idinactive_timer_pkeyfilenames_export_opdata_offseti_flctxstashedvm_page_prottimespec64PIDTYPE_SIDrsvd_pebsbpf_ctxd_pruneprintedresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipe_writevbase_resumehostuaddrerasesize_masks_wb_errshm_clistis_child_subreapercall_depthunicode_mapgraph_get_remote_endpointnum_descspick_maxexec_vmrw_copyfscrypt_inode_infost_name__SCT__might_reschedmmu_notifier_subscriptionswait_lockoffslast_siginfodfs_emulate_power_cutalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidmtd_req_statspairrseq_sigubi_debug_infodev_pm_domainlimit0limit1__compiletime_assert_518dqi_max_ino_limitmigrate_modemax_bitflipsubi_sync_erasepoweroff_latemtd_ooblayout_opsftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_map__compiletime_assert_520alloc_dquot__compiletime_assert_522pm_messagemay_splitmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountfm_sizeGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrcopy_flaggraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_base__compiletime_assert_530pipe_inode_info__compiletime_assert_536securebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsdfs_power_cut_maxslicesas_ss_spnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BITnumblocks___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listsrcu_barrier_completiondriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidmin_io_size_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1padding2padding3llistdebugfs_entryelemnr_retries_get_fact_prot_infosigval_tpartitions_lockalimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreeparti_wb_frn_avg_timefile_ref_ttypemembarrier_stateFORTIFY_FUNC_UNKNOWNpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type_block_markbadmtimeserver_has_tasksvm_fault__compiletime_assert_560oom_score_adj_minkobj_uevent_envdisable_bgtfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memfm_eba_sem__ai_ptrMOVE_CANCEL_RACEpath_unpointst_sizermtpcheckedwait_sumnum_tracepoints_readubi_bitflip_checkupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handleriommu_groupperiod_contribdfs_power_cut_minrcu_node_entrystart_scan_seqaeb_slab_cachefsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollpagesizes_blocksizevm_pgoffauprobe__retnuma_workupdate_timeptrace_dr7prioritybgt_thread_call_addrloginuidchecktortureexpiryoptimistic_spin_queuespin_unlockdl_defer_runningscrub_possible__lstate__compiletime_assert_84ro_modearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvltree_lockmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_namesqnumproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfd_read_user_prot_regnr_wakeups_remoteleb_countpebsllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextubi_vtbl_recordwritesize_maskDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincountnvmem_devicetablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_sequbi_self_check_all_ffcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codethread_enabledqspinlockget_info__kmalloc_large_noproflru_geninsnfilldir_tubi_get_vid_hdr__must_check_overflowdl_non_contendingdir_contextchrdev_locktracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_context_get_user_prot_infoMOVE_RETRYgpl_symsgroupseq_showubi_alloc_vid_bufswait_queue_headcow_pageubi_wl_entry_slabblocki_spc_timelimitreturn_instancescompatrb_firstclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restartUTASK_RUNNINGregister_reboot_notifiersym_hvclock_pagexstate_headerinaccessibleubi_io_write_ec_hdrquick_threadstime_sliceobjcgfull_namemasternodeget_peb_for_wlvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areastatic_priomay_skip_resumeworks_countshrinkerdl_yieldeddqi_formatexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyspropertywchar_addr_bndkernel_symbolsubsys_datatv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineupd_receiveddfs_chk_iouser_cpus_ptrpi_top_taskunlinkdirect_writesactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writefailuresutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedfs_chk_fastmapdisable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevtbl_sizeget_currentvfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsbuf_mutexkfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlencodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimesched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedmax_write_sizetracing_graph_pausepermcompat_robust_listktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidmove_to_putspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTmax_ecsp_offsetsrcu_cblist_invokingoops_panic_writei_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linksexecutedfree_countvolumess_sysfs_namerefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipqc_dqblkmove_tommappedseqcount_raw_spinlockdown_readkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingargv__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_endforce_full_scans_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEout_rostatic_keyremoves_magicdl_overrunallocd_parentubi_attach_infopayloadac_minflti_sbprotection_queue_destroykmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openshutdown_workstart_prevent_timelnumwl_get_wlereadahead_control__kernel_gid32_tpeb_sizekernfs_open_filef_credmtd_oob_regionMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesfastmapread_newsignalfd_wqhmmapmodnametask_pid_nrasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapvid_hdr_offseterasesizewritepagessched_statisticsheadfm_anchor__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclampfreezing__compiletime_assert_326super_operations_suspendsplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATApt_regscorrecc_strengthpipe_bufswritersKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colordevres_lockwritesizebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESFORTIFY_FUNC_memscanubi_eba_table_cond_reschedvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasyncu_chari_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecgraph_get_port_parentpartitions__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodewear_leveling_workerxarraycap_effectivetaintsclosidsum_exec_runtimes_rootsubi_dbg_chk_gend_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrworksfreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freeparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeget_named_child_nodelaunder_foliocurr_targethdr_crcis_suspendeddfs_dir__keycorrected_bitflipsbursterroneous_peb_countetypeei_funcsmodule_kobjectactive_memcgdef_flagsuncorrectable_errorsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetmutex_lockarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsrb_link_nodeUBI_IO_BAD_HDR_EBADMSGlinux_binfmtpage_table_lock_sigfaultcountersname_linkcmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_type__UNIQUE_ID_ddebug519policyshareddismisslist_deld_real_typelookahead_bandseq_startpeb_bufgfp_flagsraw_lockd_dnameget_dqblkmax_hang_timecpus_maskubi_numubi_dbg_is_bgt_disabledsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnameubi_volumerun_delaytailstree_destroylineno__dynamic_pr_debugbase_pfnget_inode_aclpower_cut_max_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbasecompatiblekthread_should_stopmax_wl_pool_sizeclock_listattrscpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axcompletesched_rt_entitymight_reschedtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__UNIQUE_ID_ddebug543__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainensure_wear_levelingupd_bytes_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingpq_tailtime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclmemset__UNIQUE_ID_ddebug557___GFP_ZERO_BITubi_fastmap_layoutwrite_newlist_lockpm_domaininstrument_atomic_read_writecpu_bitmapstatic_call_keyutil_estucountsqc_stateooblensoftirq_next_timerdump_stackcheck_flagsswp_entry_tuint64_t_mapcountdomain_tag__UNIQUE_ID_ddebug563hang_detectedchild_ns_typeqf_fmt_id__UNIQUE_ID_ddebug567s_vfs_rename_keyeventup_writeset_performance_statephys_addr_tlookuptblclass_preempt_is_conditionalconsumers_cntmodule_memorykeeppi_entryerasesize_shiftk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offmtd_debug_infoexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotma_flagsdelayed_workmean_echiwater_rsskretprobe_instancesrangewl_wrk_max_bad_blocksfutex_exit_mutexkernfs_iattrs___GFP_WRITE_BITd_spacegraveyard_linkeraseregionsxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERubi_io_mark_badconst_pcpu_hotreserved_pebsi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typebad_allowedi_rdevalienself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEpairingnr_migrationsa_opsxa_flagsfreezeDEVICE_VERT_POS_LOWER_raw_spin_lockbin_sizeclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITschedule_ubi_workdata_sized_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkpercpu_reffind_mean_wl_entryscrubhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrplowake_up_processltreeclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_filevidbhighest_lnums_state__compiletime_assert_550user_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkotp_infokmalloc_typeqstr___GFP_ZEROTAGS_BITorig_pmdvtblacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsmtd_oob_opsalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexmax_sqnumcore_statetimerqueue_headlist_is_headhdrs_min_io_sizercharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointepoll_watcheswl_lockprealloc_pterb_next_is_lockeddqb_curspace_entrygp_statebitsetload_avgaccesscstimecfs_rq_uidfm_work_scheduledubi_wl_close_pointst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodeubi_calculate_reserved__compiletime_assert_216spc_warnlimitfreezer_active__compiletime_assert_219s_encodinggpl_crcsorc_entrykeyspeb_countorig_ptedqb_curinodesload__s8spin_lockinvalidate_lock_keydma_maskprealloc_mutexnanosleep__compiletime_assert_582srcu_gp_seq_neededpscr_ret__dq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtime__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionto_be_torturedseq_stopkiocbclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typewl_scheduledclass_device_is_conditionalmtd_pairing_infoshrinker_idrootoom_reaper_list__UNIQUE_ID_ddebug517shutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countsig_okout_error__SCT__cond_rescheddelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagINIT_LIST_HEADfs_flagsworkpgprotval_tkeytypefortify_memset_chksigpendingimage_seqfsindexshstksrcu_ssppage_orderwake_irqlast_eb_bytes__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequenceset_freezabledqb_ihardlimitUBI_IO_FF_BITFLIPSd_lockrefsubpage_sftrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfwl_entry_destroyi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjdebug_check_no_locks_heldcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tf_iocb_flagsdata_crcpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_trueis_emptyweighti_privatemaxrssec_hdrflushruntime_suspendi_blkbitsvaluegroup_exit_codeecc_statstty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinedfs_dir_namepinned_vmwl_reboot_notifier_head_2apsi_flagsaddressstart_boottimevm_starts_flagsfaultmigration_pendingec_hdr_alsizefind_wl_entryshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusemtd_partp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_granrepeatkernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execveretrytlb_flush_pendingfm_do_produce_anchorRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchalien_peb_countrcu_tasks_exit_listarchdataia_uid__list_del_entry_valid_or_report_syncout_resumechildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_done___GFP_ACCOUNT_BITpud_trt_spc_timelimitsym_int80_landing_padtailia_atimelasttlb_ubcquota_format_typeseekstask_struct__mptrrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memmax_pool_sizeerase_infoi_mtime_nsecperformancemmlistsuppress_bind_attrsubi_fastmap_init_write_oobRPM_RESUMINGreg_offset_raw_spin_unlockgsbases_quota_typesf_llistphandleemulate_bitflipsubi_ro_modei_nlinkbranchused_blockswrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_supers_inode_list_lockubi_vid_io_bufsweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basepower_cut_min__erase_workercdevmy_qgroup_leadermkdirnextentsubi_ainf_volumereal_blockedarg_lockooboffsnum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerexclusiveclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockoverflowfile_ra_stateuser_structwork_semon_rqfs_context_erase_user_prot_regprealloc_bufbitflip_thresholdprojiddrop_inodenum_trace_evalsnum_vfllseekfoundDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasschk_fastmaplast_mm_cidUBI_IO_FFcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listmove_fromsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockdev_links_infoloff_tthread_pidbgt_namesrcu_gp_seq_archec_sumst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevtrc_blkd_nodecalls_block_isreservedi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedmodule_state__write_overflow_fieldlast_used_at__mutex_inithardirq_stack_ptrvm_endlast_queuednuma_migrate_retryuser_ns__stateubi_eba_copy_leb_rebootfirstmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrssuspendedhas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimebbtblocksFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendubi_init_vid_bufFORTIFY_FUNC_memcpyserve_prot_queuensproxycan_wakeupxol_arearb_lastrlockpcpu_hotfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgself_check_ecnr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpout_unlockctimealignmentreleasemax_segment_sizesched_dl_entity_write__kernel_dev_tatomic_write_lenrb_erasedqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkvid_hdr_alsizeoom_flag_originubi_wl_scrub_pebcounterorc_unwindcorr_peb_countWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapfm_pooldonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotavtbl_slotseba_tbldl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intfm_bufnuma_preferred_nid_hugetlb_cgroupdentry_operationsupd_ebsmemcg_nr_pages_over_higharch_uprobeubi_thread_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatein_pqi_linklistxattr_lowertrap_nrasync_probe_requesteddfs_chk_gen__list_add_valid_or_reportcompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagsdo_sync_erasetotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opis_deadsysv_shmdq_countupdatingutf8data_tablefm_wl_poolset_latency_toleranceubi_io_sync_erase__func__resource_size_tfoliowake_entryxa_headsuidemulate_power_cuti_readcountprot_queue_delpq_headlocked_vmrb_leftseq_nextkmem_cache_freesym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tself_check_in_wl_treebad_peb_countlast_data_sizeclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeglobal_sqnumparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_counters_flagsnotify_nextmax_perf_statebus_dma_limitbuffershort intmynodeof_device_idclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitmtd_erase_region_inforead_iterwritablef_ownerbp_regVTIME_USERsa_flagstest__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invotp_factory_nvmemDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guest_get_devicedevice_physical_locationpm_domain_datapoll_table_structdirect_IOcurrent_may_mount__UNIQUE_ID_ddebug535seqlock_tubi_free_vid_bufnuma_scan_offset_put_devicefast_attach___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskerase_workerreadersch_lnumregfuncindex_keymemalloc_noioGRPQUOTAi_private_listia_valid__schedule_ubi_workvertical_positionFORTIFY_FUNC_strncati_rcuubi_fastmap_closei_atime_secdfs_emulate_bitflipsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpids_eraseFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atubi_wl_put_peblast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectorMEMORY_DEVICE_PRIVATEoobbufdev_releasedefault_timer_slack_nskcsan_check_accesssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refvid_hdr_shiftpmdval_t___GFP_NOFAIL_BITname_lengroup_infovdso_imagefileof_match_tableused_bytespercpu_count_ptr__user_state_sizeforcedst_leb_cleanmce_kill_meuuid_tproperty_read_int_array___GFP_UNUSED_BITempty_peb_countcount_objects_stimezone_device_dataf_wb_errdefparamfred_csfault_flagemulate_io_failureskprojid_tptracer_credtlb_genstorepage_mkwritebeb_rsvd_pebskobjectaudit_ttypnummce_ripvstatfsnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodeoffsetsi_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_list__fortify_sizeaudit_contextpp_ref_countup_readsysfs_opssequential_iomaybe_bad_peb_count_large_mapcountsda_is_staticformatftopenclavesp_regcreateiattrrseqecc_step_sizenfdssigvalvma_lockperf_event_listvol_idget_reserved_spacestack_refcountinvalidate_lockbmapkey_payload_write_user_prot_regd_real_lockexpiry_activedqi_max_spc_limitfreezing_slow_pathexception_table_entryvid_hdrevent_countcorrectedpreempt_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedavailable_consumedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startemulate_failuresblocksMOVE_TARGET_BITFLIPS__might_reschedset_infofileattr_getvectorout_cancelFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_listdevice_dma_supportedd_ino_warnshiwater_vmtracepointubi_namecompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writers__compiletime_assert_82__compiletime_assert_83ino_timelimit__compiletime_assert_85__compiletime_assert_86__compiletime_assert_87splice_write__compiletime_assert_89i_rt_spc_timelimit_read_fact_prot_reg__list_del_entry_validcss_setqf_nextranges__compiletime_assert_90__compiletime_assert_91iommu_mmubi_wl_get_pebcutimeem_tablepersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmaskubi_deviceuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixups__UNIQUE_ID_ddebug523file_operations__UNIQUE_ID_ddebug525__UNIQUE_ID_ddebug527__UNIQUE_ID_ddebug529KMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tMOVE_SOURCE_RD_ERRsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbs__UNIQUE_ID_ddebug531__UNIQUE_ID_ddebug533max_allowed_capacityi387__UNIQUE_ID_ddebug537d_ino_timer__UNIQUE_ID_ddebug539avx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeydfs_disable_bgtFAULT_FLAG_RETRY_NOWAITproduce_free_pebsyncupd_markersetleasepinspacct_structmust_resume__UNIQUE_ID_ddebug541__UNIQUE_ID_ddebug545__UNIQUE_ID_ddebug547__UNIQUE_ID_ddebug549long intfile_lock_contextusagel_yessiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimeuidhash_nodefred_ssproperty_present__kmalloc_index__UNIQUE_ID_ddebug551__UNIQUE_ID_ddebug553__UNIQUE_ID_ddebug555__write_overflow__UNIQUE_ID_ddebug559USRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typechk_ioruntime_statusin_iowaitunregfuncegidiomap__UNIQUE_ID_ddebug561ubi_wl_reboot_notifierdq_hash__UNIQUE_ID_ddebug565put_super__UNIQUE_ID_ddebug569fwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirty__UNIQUE_ID_ddebug571__UNIQUE_ID_ddebug573__UNIQUE_ID_ddebug575__UNIQUE_ID_ddebug577__UNIQUE_ID_ddebug579num_srcu_structsbdi_writebackkobj_completionooblayout__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONE__UNIQUE_ID_ddebug581__UNIQUE_ID_ddebug583VTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalerase_aebbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaphprobe__fortify_panictracepoint_funccoherent_dma_maskentryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubself_check_in_pqget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirq_read_oobscheduleclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpygfp_maskpi_state_listrcu_segcblistsubvolusedfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_id_unlocksrcu_structrlim_curnofaultmm_countcputime_atomicdrv_groupsstackfunctionki_flags___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkskip_checkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqpower_cut_counterki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYerr1rlimread_folionr_eventsprot_queue_add__vpp_verifyiommuprivatewritebufsizest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctx__compiletime_assert_524__compiletime_assert_526__compiletime_assert_528splice_pipe__be16spinlock_checks_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seq__compiletime_assert_532__compiletime_assert_534DEVICE_PANEL_RIGHT__compiletime_assert_538KMALLOC_RANDOM_ENDmodstqheads_activechk_genMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_task__compiletime_assert_540__compiletime_assert_542__compiletime_assert_544__compiletime_assert_546__compiletime_assert_548task_worksmemory_failurerb_root_cached__be32s_copdd_key_truekmalloc_array_noprofhres_activebpf_raw_eventsdq_dirtydl_defer__compiletime_assert_552__compiletime_assert_554__compiletime_assert_556__compiletime_assert_558bug_listbeb_rsvd_leveldirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_state__compiletime_assert_562__compiletime_assert_564__compiletime_assert_566__compiletime_assert_568is_late_suspendedsysvsemlockmapubi_workignore_childrenrestore_early__compiletime_assert_570__compiletime_assert_572clock_mutex__compiletime_assert_574fs_supers__compiletime_assert_576__compiletime_assert_578__be64min_ecUBI_IO_BAD_HDRdqb_bsoftlimitpendingf_task_workfm_protect__compiletime_assert_580___GFP_NORETRY_BITiowait_count__compiletime_assert_584ubi_ainf_pebcorruptedmax_erroneousnotifier_blockdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesbad_peb_limitearly_initubi_io_readmprotectsecurityxmm_spaceubi_erractivatef_pos_lockckvol_mutexi_fieldmasktls_arrayownerpfo_val__acct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITscrubbingi_bytesdomain_datarelax_countubi_io_read_data___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEubi_check_patterndup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_stateUBI_IO_BITFLIPSsubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_tvol_counticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountdfs_emulate_failuresextable_basenoinstr_text_sizenargsattributes__list_del_entryvfreeset_child_tid_overrunrestrict_linktmpfilercu_read_lock_nestingem_perf_stateleb_sizetick_dep_maskvalidate_vid_hdrlistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugretlenupd_bufof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsscan_pebslice_maxlast_switch_countqsize_tsecond_is_neweroobsizefilesdqb_bhardlimitliveatomic_write_unit_maxusable_leb_sizerun_listixolsym_vvar_pagemodule_sect_attrsused_ebsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesfm_workdescseqcountoom_score_adjd_seqia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sum__UNIQUE_ID_ddebug521freeze_ucounti_ctime_nsecs_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocubi_io_read_vid_hdrpfn_mkwriteubi_add_to_avcallback_heads_vop__compiletime_assert_220perf_eventf_securityi_sb_listfutex_statevm_rcupgtables_bytesget_link_lock_user_prot_regfmode_tvolumes_lockcputime_atomicvols_foundrestoredelayed_callmax_nr_cid_statusd_sibkernel_ulong_tdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsout_vtblnuma_pages_migrateddl_dev_stateleb_startgsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countfm_pool_rsv_cntreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasewritesize_shiftscan_objectspid_typewb_errcputimertrace_recursionstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerhighest_vol_iddev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinschanging_lebattrget_next_child_nodeFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDmtd_ecc_statsget_wunitfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_nodepercpu_ref_dataubi_wl_initdividenddestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSmetaonlysyscore__s64dqi_bgrace__kernel_pid_t__compiletime_assert_88static_call_mod_timerdma_map_opsma_external_lock_panic_writedevice_physical_location_paneluid_toobretlenflush_requiredsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabcrc32_leclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_poolsubi_remove_av_addr_lsbi_generation_sigpollmxcsrdevtd_rt_spc_hardlimitmagicnumeraseregionsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexbad_avdriver_datathread_headdev_pm_qosmap_typef_opnor_flashpids_active_resetconfirm_switchseqcount_tkmem_cache_alloc_noprofnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizedq_sbarch_static_branchsighand_structerroneousflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrygood_peb_count___GFP_NOWARN_BITcmin_fltdev_pin_inforw_semdqio_semlast_aebprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanubi_vid_hdrf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenget_policy__list_add_validHRTIMER_RESTARTsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_baserb_insert_colordevice_is_availabledquotdl_runtimenumbers_softexpiresvol_typekey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsdata_pad_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contextflash_sizetlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesbad_vid_hdrfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesubi_fm_poolthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherskmalloc_caches__compiletime_assert_216__compiletime_assert_217__compiletime_assert_218completionout_wlsw_reserveddevice_removableubi_read_volume_tableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalubi_warnFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structcnivcswbin_attrs_newdatbufruntime_idleiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersvid_hdr_aloffsetexp_hintd_childrendirty_foliois_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabdfs_emulate_io_failureswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infofail_addrlist_emptyref_counterror_remove_folioold_time32_tcore_kallsymsec_countsrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringotp_user_nvmemcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setkzalloc_noprofrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrseraseav_vol_typeonlineruntime_resumedup_xol_workautoresize_vol_idMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmtd_masteradjust_mean_ecgfp_tseccomp_filterstimelist_add_taili_mmapphys_addrd_lrusignal_structperf_event_mutexcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclUBI_COMPAT_REJECTpids_activedriveri_opldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__kmem_cache_create__task_fpstateubi_msgavail_pebswait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrcreatedpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysoobavail__list_adduse_freeptr_offsetdevice_mutexsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDkmem_argsshared_pendingexpires___GFP_HARDWALL_BITnivcswubi_wl_entryMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_minmtd_pairing_schemedivisors_devcpus_allowed_lockget_next_idrwlock_tpgprotfalseout_freed_weak_revalidateremovedfm_disabledshow_pathmove_mutexUBI_STATIC_VOLUMEDL_DEV_DRIVER_BOUNDPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyubi_io_read_ec_hdriommu_mm_datamce_countswap_info_structnvmemsequencert_spc_warnlimitac_flag_block_isbadcoredump_datatasks_pidaddress_spacemm_context_talc_mutex__call_single_nodestartupubi_ec_hdrseqcount_spinlock_ti_wbreboot_notifieruint8_tpanelclass_idinactive_timer_pkeyfilenames_export_opdata_offseti_flctxstashedvm_page_prottimespec64PIDTYPE_SIDrsvd_pebsbpf_ctxd_pruneprintedresume_noirqpagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipe_writevbase_resumeforce_scanhostuaddrerasesize_masks_wb_errshm_clistis_child_subreapercall_depthunicode_mapgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfodfs_emulate_power_cutalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidmtd_req_statspairrseq_sigubi_debug_infodev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modemax_bitflipspoweroff_latemtd_ooblayout_opsftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_map__compiletime_assert_520alloc_dquot__compiletime_assert_522pm_messagemay_splitmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountfm_sizeGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrcopy_flaggraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_base__compiletime_assert_530pipe_inode_info__compiletime_assert_536securebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsdfs_power_cut_maxslicesas_ss_spnr_dirtiednum_kprobe_blacklist___GFP_DMA32_BITnumblocks___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listsrcu_barrier_completiondriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidlate_analysismin_io_size_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1padding2padding3llistdebugfs_entryelemnr_retries_get_fact_prot_infosigval_tpartitions_lockalimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreeparti_wb_frn_avg_timefile_ref_ttypemembarrier_stateFORTIFY_FUNC_UNKNOWNpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type_block_markbadmtimeserver_has_tasksvm_faultoom_score_adj_minkobj_uevent_envdisable_bgtfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memfm_eba_sempath_unpointst_sizermtpcheckedwait_sumnum_tracepoints_readupidexit_codeexec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalubi_early_get_pebconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribdfs_power_cut_minrcu_node_entrystart_scan_seqaeb_slab_cachefsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollpagesizes_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7prioritybgt_thread_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstate__compiletime_assert_84ro_modearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvltree_lockmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_namesqnumproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfd_read_user_prot_regnr_wakeups_remoteleb_countpebsllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextubi_vtbl_recordwritesize_maskDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincountnvmem_devicetablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codethread_enabledqspinlockget_info__kmalloc_large_noproflru_geninsnfilldir_tubi_get_vid_hdrdl_non_contendingdir_contextchrdev_locktracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_context_get_user_prot_infogpl_symsgroupseq_showubi_alloc_vid_bufswait_queue_headcow_pageblocki_spc_timelimitreturn_instancescompatrb_firstclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddeviceubi_dump_vid_hdrs_shrinkhrtimer_restartUTASK_RUNNINGout_aisym_hvclock_pagexstate_headerinaccessibleubi_io_write_ec_hdrDUMP_PREFIX_NONEquick_threadstime_sliceobjcgfull_namemasternodevm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areastatic_priomay_skip_resumeworks_countshrinkerdl_yieldeddqi_formatexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyspropertywchar_addr_bndfind_or_add_avkernel_symbolsubsys_datatv_secpid_ttask_listubi_io_is_badftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineIS_ERRupd_receiveddfs_chk_iouser_cpus_ptrpi_top_taskdirect_writesactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedfs_chk_fastmapdisable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevtbl_sizeget_currentvfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsbuf_mutexkfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlencodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimesched_rt_mutexlocked_pendingadd_to_listnr_deferredfown_structfeatures_lockedmax_write_sizetracing_graph_pausepermcompat_robust_listktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidmove_to_putspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmUBI_VID_STATIC__kmem_cache_create_argsdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTsqnum2max_ecsp_offsetsrcu_cblist_invokingoops_panic_writei_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linksfree_countvolumess_sysfs_namerefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipqc_dqblkmove_tommappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixupirq_getubi_alloc_aebhashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_endforce_full_scans_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyUBI_COMPAT_ROremoveUBI_COMPAT_PRESERVEs_magicdl_overrunallocd_parentubi_attach_infopayloadac_minflti_sbkmalloc_noprofd_sbcommadd_volumecan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openstart_prevent_timelnumreadahead_control__kernel_gid32_tpeb_sizekernfs_open_filef_credmtd_oob_regionMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesfastmapread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapvid_hdr_offseterasesizewritepagessched_statisticsheadfm_anchor__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclamp__compiletime_assert_326super_operations_suspendsplice_eofutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATApt_regscorrecc_strengthpipe_bufswritersKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colordevres_lockwritesizebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESFORTIFY_FUNC_memscanubi_eba_table_cond_reschedvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pagesubi_dump_avhlist_bl_headino_warnlimitfasyncu_chari_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecgraph_get_port_parentpartitions__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsubi_dbg_chk_gend_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrworksfreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freeparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeget_named_child_nodelaunder_foliocurr_targethdr_crcis_suspendeddfs_dircorrected_bitflipsburstmtd_is_eccerrerroneous_peb_countetypeei_funcsmodule_kobjectactive_memcgdef_flagsuncorrectable_errorsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetmutex_lockarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsrb_link_nodeUBI_IO_BAD_HDR_EBADMSGlinux_binfmtpage_table_lock_sigfaultcountersname_linkearly_erase_pebcmaxrsstimer_slack_ns___GFP_MEMALLOC_BITbus_type__UNIQUE_ID_ddebug519policyshareddismisslist_deld_real_typelookahead_bandseq_startpeb_bufgfp_flagsraw_lockd_dnameget_dqblkremaindermax_hang_timecpus_maskubi_numsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnameubi_volumerun_delaytailslineno__dynamic_pr_debugbase_pfnERR_PTRget_inode_aclpower_cut_max_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbasecompatiblemax_wl_pool_sizeclock_listout_echattrscpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axcompletesched_rt_entityubi_dump_aebtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__UNIQUE_ID_ddebug543__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainupd_bytes_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_ti_blocksnuma_faults_localityhas_child_subreaperubi_dump_ec_hdrdiv_u64_remi_aclmemset___GFP_ZERO_BITcheck_corruptionubi_fastmap_layoutwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsqc_stateooblensoftirq_next_timerdump_stackcheck_flagsswp_entry_tuint64_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventset_performance_statephys_addr_tlookuptblclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryerasesize_shiftk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specadd_corrupteddesc_structdq_offmtd_debug_infoexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2atmp_aebdma_cleanupmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotma_flagsdelayed_workmean_echiwater_rsskretprobe_instancesrange_max_bad_blocksfutex_exit_mutexkernfs_iattrs___GFP_WRITE_BITd_spacegraveyard_linkeraseregionsxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERconst_pcpu_hotreserved_pebsi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typebad_allowedi_rdevalienself_exec_idkernfs_opsfile_lockadd_fastmapMODULE_STATE_LIVEpairingnr_migrationsa_opsxa_flagsfreezebin_sizeclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITdata_sized_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_block___GFP_COMP_BITset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkpercpu_refscrubhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploltreeclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_filevidbhighest_lnums_statevidhuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrset_dqblkotp_infokmalloc_typeqstr___GFP_ZEROTAGS_BITorig_pmdvtblacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsmtd_oob_opsubi_find_or_add_avalt_lenusersizecinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexmax_sqnumcore_statetimerqueue_headlist_is_headhdrs_min_io_sizeslab_namercharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointepoll_watcheswl_lockprealloc_pterb_next_is_lockeddqb_curspace_entrygp_statebitsetload_avgaccesscstimethiscfs_rq_uidfm_work_scheduledubi_wl_close_pointst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimit__compiletime_assert_219s_encodinggpl_crcsorc_entrykeyspeb_countorig_ptedqb_curinodesloadubi_is_fm_vol__s8invalidate_lock_keydma_maskprealloc_mutexnanosleepsrcu_gp_seq_neededpscr_ret__dq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignDUMP_PREFIX_OFFSETbtime__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodescan_alllist_lru_onedevice_physical_location_horizontal_positionto_be_torturedseq_stopkiocbclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typebad_aebwl_scheduledclass_device_is_conditionalmtd_pairing_infoshrinker_idrootoom_reaper_list__UNIQUE_ID_ddebug517shutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countsig_ok__SCT__cond_rescheddelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagINIT_LIST_HEADfs_flagsworkpgprotval_tkeytypefortify_memset_chksigpendingimage_seqfsindexshstksrcu_sspto_headpage_orderwake_irqlast_eb_bytes__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialubi_free_all_volumesHPROBE_GONEactive_timei_sequencedqb_ihardlimitUBI_IO_FF_BITFLIPSd_lockrefsubpage_sftrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tf_iocb_flagsdata_crcpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_trueis_emptyweighti_privatemaxrssec_hdrflushruntime_suspendi_blkbitsvaluegroup_exit_codeecc_statstty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinedfs_dir_namepinned_vmwl_reboot_notifier_head_2apsi_flagsaddressstart_boottimevm_starts_flagsfaultmigration_pendingec_hdr_alsizeshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusemtd_partp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingfm_do_produce_anchorRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchalien_peb_countrcu_tasks_exit_listarchdataia_uid__list_del_entry_valid_or_report_syncchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_done___GFP_ACCOUNT_BITpud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structDUMP_PREFIX_ADDRESS__mptrrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenfastf_pipei_wb_frn_historylast_wakeenextio_tlb_memmax_pool_sizeerase_infofreeptr_offseti_mtime_nsecperformancemmlistsuppress_bind_attrs_write_oobRPM_RESUMINGreg_offsetgsbases_quota_typesf_llistphandleemulate_bitflipsi_nlinkbranchused_blockswrite_begingroupsget_random_bytespi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalcmp_reson_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_serverUBI_COMPAT_DELETEtrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superPTR_ERRs_inode_list_lockubi_vid_io_bufsweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tubi_eba_initclock_basepower_cut_mincdevmy_qgroup_leadermkdirnextentsubi_ainf_volumereal_blockedarg_lockooboffsnum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerexclusiveclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structwork_semon_rqfs_context_erase_user_prot_regprealloc_bufbitflip_thresholdprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasschk_fastmaplast_mm_cidubi_attachUBI_IO_FFcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listmove_fromsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockdev_links_infoloff_tthread_pidbgt_namesrcu_gp_seq_archec_sumst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevtrc_blkd_nodecalls_block_isreservedi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_lockself_check_aisched_delayedmax_corrmodule_state__write_overflow_fieldlast_used_athardirq_stack_ptrvm_endlast_queuednuma_migrate_retryuser_ns__state_rebootfirstiommu_groupmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrssuspendedhas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimebbtblocksFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendubi_init_vid_bufFORTIFY_FUNC_memcpynsproxycan_wakeupxol_arearlockpcpu_hotfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayout_free_vidhRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpout_unlockctimealignmentreleasemax_segment_sizeubi_free_aebsched_dl_entity_write__kernel_dev_tatomic_write_lenrb_erasedqb_btime_nr_pages_mappedutf8dataaeb_tmpmm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkvid_hdr_alsizeoom_flag_originalloc_aicounterorc_unwindcorr_peb_countWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapfm_pooldonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotavtbl_slotseba_tbldl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intfm_bufnuma_preferred_nid_hugetlb_cgroupdentry_operationsupd_ebsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requesteddfs_chk_gen__list_add_valid_or_reportcompat_long_tactive_countctors_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opis_deadsysv_shmdq_countupdatingbitflipsutf8data_tablefm_wl_poolset_latency_toleranceubi_io_sync_erasedestroy_ai__func__resource_size_tfoliowake_entrydestroy_avxa_headsuidemulate_power_cuti_readcountpq_headlocked_vmrb_leftseq_nextkmem_cache_freesym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tbad_peb_countlast_data_sizeclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeglobal_sqnumparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_counters_flagsnotify_nextmax_perf_statebus_dma_limitbuffershort intmynodeof_device_idclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitmtd_erase_region_inforead_iterwritablef_ownerbp_regVTIME_USERsa_flagstest__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invotp_factory_nvmemDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guest_get_devicedevice_physical_locationpm_domain_datapoll_table_structdirect_IOcurrent_may_mount__UNIQUE_ID_ddebug535seqlock_tubi_free_vid_bufnuma_scan_offset_put_devicefast_attach___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmaskreadersch_lnumregfuncindex_keymemalloc_noioGRPQUOTAi_private_listia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secdfs_emulate_bitflipsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BITactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpids_eraseFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectorMEMORY_DEVICE_PRIVATEoobbufdev_releasedefault_timer_slack_nssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refvid_hdr_shiftpmdval_t___GFP_NOFAIL_BITname_lengroup_infovdso_imageUBI_VID_DYNAMICfileof_match_tableused_bytespercpu_count_ptr__user_state_sizemce_kill_meuuid_tproperty_read_int_array___GFP_UNUSED_BITempty_peb_countcount_objectsout_vidherror_stimezone_device_dataf_wb_errdefparamfred_csfault_flagemulate_io_failureskprojid_tptracer_credtlb_genstorepage_mkwritebeb_rsvd_pebskobjectaudit_ttypnummce_ripvstatfsnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcs__compiletime_assert_550restore_sigmasksrcu_cblistclass_groupsnuma_nodeoffsetsi_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opssequential_iomaybe_bad_peb_count_large_mapcountsda_is_staticformatftopenclavesp_regcreateiattrrseqecc_step_sizenfdssigvalvma_lockperf_event_listvol_idget_reserved_spacestack_refcountinvalidate_lockbmapkey_payload_write_user_prot_regd_real_lockexpiry_activedqi_max_spc_limitexception_table_entryvid_hdrevent_countcorrectedpreempt_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderec_errtimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startemulate_failuresuseroffsetblocks__might_reschedset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_listdevice_dma_supportedd_ino_warnshiwater_vmtracepointubi_namecompound_headUBI_DYNAMIC_VOLUMEia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writers__compiletime_assert_82__compiletime_assert_83ino_timelimit__compiletime_assert_85__compiletime_assert_86__compiletime_assert_87splice_write__compiletime_assert_89i_rt_spc_timelimit_read_fact_prot_reg__list_del_entry_validcss_setqf_nextranges__compiletime_assert_90__compiletime_assert_91iommu_mmcutimeem_tablepersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmaskubi_deviceuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixups__UNIQUE_ID_ddebug523file_operations__UNIQUE_ID_ddebug525__UNIQUE_ID_ddebug527__UNIQUE_ID_ddebug529KMALLOC_CGROUPno_pmgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbs__UNIQUE_ID_ddebug531__UNIQUE_ID_ddebug533max_allowed_capacityi387__UNIQUE_ID_ddebug537d_ino_timer__UNIQUE_ID_ddebug539avx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeydfs_disable_bgtFAULT_FLAG_RETRY_NOWAITsyncupd_markersetleaseubi_compare_lebspinspacct_structmust_resume__UNIQUE_ID_ddebug541__UNIQUE_ID_ddebug545__UNIQUE_ID_ddebug547__UNIQUE_ID_ddebug549long intubi_find_avfile_lock_contextusagel_yessiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimeuidhash_nodefred_ssproperty_present__kmalloc_index__UNIQUE_ID_ddebug551__UNIQUE_ID_ddebug553__UNIQUE_ID_ddebug555__write_overflowUSRQUOTAprintk_index_sizesymtabkmem_cache_destroyrt_mutex_waiterremount_fss_typechk_ioruntime_statusin_iowaitunregfuncegidiomapdq_hashdiv_u64put_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirtyrb_linknum_srcu_structsbdi_writebackkobj_completionooblayout__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldssize_tiopl_emulwork_structdesc_lenflockvol_ignoredtask_io_accountingmremaphprobe__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirq_read_oobclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpygfp_maskpi_state_listrcu_segcblistsubvolusedfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_id_unlocksrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flags___GFP_IO_BITubi_add_avsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkskip_checkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqpower_cut_counterki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGY__compiletime_assert_518rlimread_folionr_events__vpp_verifyiommuprivatewritebufsizest_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctx__compiletime_assert_524__compiletime_assert_526__compiletime_assert_528splice_pipe__be16s_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seq__compiletime_assert_532__compiletime_assert_534DEVICE_PANEL_RIGHT__compiletime_assert_538KMALLOC_RANDOM_ENDmodstqheads_activechk_genMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_task__compiletime_assert_540__compiletime_assert_542__compiletime_assert_544__compiletime_assert_546__compiletime_assert_548task_worksmemory_failurerb_root_cached__be32s_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_defer__compiletime_assert_552__compiletime_assert_554__compiletime_assert_556bug_listbeb_rsvd_leveldirect_completexa_locklist_addfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemlockmapignore_childrenrestore_earlyclock_mutexfs_supers__be64min_ecUBI_IO_BAD_HDRdqb_bsoftlimitpendingf_task_workfm_protect___GFP_NORETRY_BITiowait_countubi_ainf_pebcorruptedmax_erroneousprint_hex_dumpnotifier_blockdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmslab_flags_ttimer_expirestrace_evalsactive_basesbad_peb_limitkmem_cache_argsearly_initubi_io_readmprotectsecurityxmm_spaceubi_erractivatef_pos_lockckvol_mutexi_fieldmasktls_arrayownerpfo_val__acct_rss_mem1need_mbvm_flags_trefcount_struct___GFP_FS_BITi_bytesdomain_datarelax_countline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEubi_check_patterndup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_sepkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_tvol_counticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchmap_pagesreschedule_countvfsmountdfs_emulate_failuresextable_basenoinstr_text_sizenargsattributesvfreeset_child_tid_overruntmpfilercu_read_lock_nestingem_perf_stateleb_sizetick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugretlenupd_bufof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_toobsizefilesdqb_bhardlimitliveatomic_write_unit_maxusable_leb_sizerun_listixolsym_vvar_pagemodule_sect_attrsused_ebsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesfm_workdescseqcountoom_score_adjd_seqia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_link_lock_user_prot_regfmode_tvolumes_lockcputime_atomicrestoredelayed_callmax_nr_cid_statusd_sibkernel_ulong_tdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stateleb_startgsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countfm_pool_rsv_cntreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasewritesize_shiftscan_objectspid_typewb_errcputimertrace_recursionstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinschanging_lebattrget_next_child_nodeFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDmtd_ecc_statsget_wunitfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleio_cqelf64_symlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSmetaonlysyscore__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lock_panic_writedevice_physical_location_paneluid_tubi_update_reservedoobretlenflush_requiredsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditionaldma_pools_addr_lsbi_generation_sigpollmxcsrdevtd_rt_spc_hardlimitnumeraseregionsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_headdev_pm_qosmap_typef_opnor_flashpids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizedq_sbsighand_structerroneousflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrygood_peb_countcmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenget_policyHRTIMER_RESTARTsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbers_softexpiresvol_typekey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_eventsdata_pad_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contextflash_sizetlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6kprobes_text_sizestatic_call_sitesubi_fm_poolthread_group_cputimernuma_scan_period_maxbadblocksstart_stackwatcherscompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallreg_save_areapermission_utimepm_subsys_dataget_dquotsnum_orcsclass_task_lock_is_conditionalubi_warnFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structcnivcswbin_attrs_newdatbufruntime_idleiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersvid_hdr_aloffsetexp_hintd_childrenis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabdfs_emulate_io_failureswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infofail_addrref_counterror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringotp_user_nvmemcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointersect_attrsonlineruntime_resumedup_xol_workautoresize_vol_idMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligngp_offsetdelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmtd_mastergfp_tseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexhprobecrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstateubi_msgavail_pebswait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysoobavaildevice_mutexsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDshared_pendingexpiresrcuwaitnivcswubi_wl_entryMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_minmtd_pairing_schemes_devcpus_allowed_lockget_next_idrwlock_tpgprotremovedfm_disabledshow_pathmove_mutexUBI_STATIC_VOLUMEDL_DEV_DRIVER_BOUNDPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structnvmemsequencert_spc_warnlimitac_flag_block_isbadcoredump_datatasks_pidaddress_spacemm_context_talc_mutex__call_single_nodestartupseqcount_spinlock_ti_wbreboot_notifieruint8_tpanelclass_idinactive_timer_pkeyfilenames_export_opstashedvm_page_prottimespec64PIDTYPE_SIDrsvd_pebsbpf_ctxd_pruneprintedresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipe_writevbase_resumehostuaddrerasesize_masks_wb_errshm_clistis_child_subreapercall_depthunicode_mapgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfodfs_emulate_power_cutalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidmtd_req_statspairrseq_sigubi_debug_infodev_pm_domainlimit0limit1dqi_max_ino_limitmigrate_modemax_bitflipspoweroff_latemtd_ooblayout_opsftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountfm_sizeGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsdfs_power_cut_maxslicesas_ss_spnr_dirtiednum_kprobe_blacklistnumblockss_vfs_rename_mutexsuspend_latewakeupcg_listsrcu_barrier_completiondriver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidmin_io_size_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retries_get_fact_prot_infosigval_tpartitions_lockalimitundo_listdirty_foliomissedquota_readst_shndxfreeparti_wb_frn_avg_timefile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type_block_markbadmtimeserver_has_tasksvm_faultoom_score_adj_minkobj_uevent_envdisable_bgtfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memfm_eba_sempath_unpointst_sizepattrmtpcheckedwait_sumnum_tracepoints_readupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribdfs_power_cut_minrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollpagesizes_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7prioritybgt_thread_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstatero_modearch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvltree_lockmce_addrnum_bugsqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidunlocked_ioctlrseq_lenmodule_attributepollfd_read_user_prot_regnr_wakeups_remotepebsllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextubi_vtbl_recordwritesize_maskDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincountnvmem_devicetablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockend_codethread_enabledqspinlockget_infolru_geninsnfilldir_tdl_non_contendingdir_contextchrdev_locktracepoint_ptr_tutasksched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_context_get_user_prot_infogpl_symsgroupseq_showswait_queue_headcow_pageblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevices_shrinkhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namemasternodevm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areastatic_priomay_skip_resumeworks_countshrinkerdl_yieldeddqi_formatexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyspropertywchar_addr_bndkernel_symbolsubsys_datatv_secma_lockpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineupd_receiveddfs_chk_iouser_cpus_ptrpi_top_taskdirect_writesubi_check_volumeactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedfs_chk_fastmapdisable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevtbl_sizeget_currentvfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsbuf_mutexstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimesched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedmax_write_sizeubi_calc_data_lentracing_graph_pausepermcompat_robust_listktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagi_uidmove_to_putspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmdebugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTmax_ecsp_offsetsrcu_cblist_invokingoops_panic_writei_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linksfree_countvolumess_sysfs_namerefcountvaddrrequestrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipqc_dqblkmove_tommappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentpayloadac_minflti_sbd_sbcommcan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openstart_prevent_timereadahead_control__kernel_gid32_tpeb_sizekernfs_open_filef_credmtd_oob_regionMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapvid_hdr_offseterasesizewritepagessched_statisticsheadfm_anchor__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclampsuper_operations_suspendsplice_eofutil_avgrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATApt_regsecc_strengthpipe_bufswritersKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colordevres_lockwritesizebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESubi_eba_table_cond_reschedvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasyncu_chari_rt_spc_warnlimitpage_fragwrite_byteschardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecgraph_get_port_parentpartitions__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrworksfreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountpage_freeparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeget_named_child_nodelaunder_foliocurr_targetis_suspendeddfs_dircorrected_bitflipsburstmtd_is_eccerrerroneous_peb_countetypeei_funcsmodule_kobjectactive_memcgdef_flagsuncorrectable_errorsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatecap_bsetarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkcmaxrsstimer_slack_nsbus_typepolicyshareddismissd_real_typelookahead_bandseq_startpeb_bufraw_lockd_dnameget_dqblkmax_hang_timecpus_maskubi_numsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnameubi_volumerun_delaytailslinenobase_pfnget_inode_aclpower_cut_max_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbasecompatiblemax_wl_pool_sizeclock_listattrscpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEfp_offsetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainupd_bytes_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_tnuma_faults_localityhas_child_subreaperi_aclubi_fastmap_layoutwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsqc_stateooblensoftirq_next_timerdump_stackcheck_flagsswp_entry_tuint64_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventset_performance_statephys_addr_tlookuptblclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryerasesize_shiftk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offmtd_debug_infoexec_maxkmap_ctrlnode_stampcompat_rmtpva_listi_bytesdma_cleanupmaple_treedentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workmean_echiwater_rsskretprobe_instancesrange_max_bad_blocksfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkeraseregionsxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsnvcswwatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERconst_pcpu_hotreserved_pebsi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typebad_allowedi_rdevself_exec_idkernfs_opsfile_lockMODULE_STATE_LIVEpairingnr_migrationsa_opsxa_flagsfreezebin_sizeclosedev_dma_attrgrphid_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpercpu_refscrubhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploltreeclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_filei_blockss_stateuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrotp_infoqstrma_flagsfutex_stateorig_pmdvtblacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsmtd_oob_opsalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headf_wb_errhdrs_min_io_sizercharfutex_pi_statekstat__kernel_uid32_tva_formatDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointepoll_watcheswl_locknon_rcu_is_lockeddqb_curspace_entrygp_statebitsetload_avgaccesscstimecfs_rq_uidfm_work_scheduled_pointst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodeubi_calculate_reservedspc_warnlimitneeds_encodingoverflow_arg_areagpl_crcsorc_entrykeyspeb_countorig_ptedqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutexsrcu_gp_seq_neededpscr_ret__dq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtime__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionto_be_torturedseq_stopkiocbclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typewl_scheduledclass_device_is_conditionalshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countsig_ok__SCT__cond_rescheddelaysqf_ownerreadaheadmutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingimage_seqfsindexshstksrcu_ssppage_orderwake_irqlast_eb_bytes__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timei_sequencedqb_ihardlimitd_lockrefsubpage_sftrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tf_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGecc_statstty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinedfs_dir_namepinned_vmwl_reboot_notifier_head_2apsi_flagsaddressstart_boottimevm_starts_flagsfaultmigration_pendingec_hdr_alsizeshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusemtd_partmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendingfm_do_produce_anchorRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uid_sync__UNIQUE_ID_x_517childrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_donenanosleeppud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memmax_pool_sizeerase_infoi_mtime_nsecperformancemmlistset_dqblksuppress_bind_attrs_write_oobRPM_RESUMINGd_weak_revalidategsbases_quota_typesf_llistphandleemulate_bitflipsi_nlinkbranchused_blockswrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_super__va_list_tags_inode_list_locksweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_tclock_basepower_cut_mincdevmy_qgroup_leadermkdirnextentsreal_blockedarg_lockooboffsnum_exentrieshlist_bl_nodeint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerexclusiveclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structwork_semon_rqfs_context_erase_user_prot_regprealloc_bufbitflip_thresholdprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasschk_fastmaplast_mm_cidcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_fileattributerestrict_linkdev_archdatai_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offseti_opflagsrobust_listmove_fromsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockdev_links_infoloff_tthread_pidbgt_namesrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcalls_block_isreservedi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1mtd_pairing_infomatchmemory_typerb_rootnr_wakeups_localHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secsched_delayedmodule_statelast_used_athardirq_stack_ptrvm_endlast_queuednuma_migrate_retryuser_ns__state_rebootfirstiommu_groupmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrssuspendedhas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimebbtblocksFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendnsproxycan_wakeupxol_arearlockpcpu_hotfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpctimealignmentreleasemax_segment_sizesched_dl_entity_write__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkvid_hdr_alsizeoom_flag_origincounterorc_unwindcorr_peb_countWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapfm_pooldonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotavtbl_slotseba_tbldl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intfm_bufnuma_preferred_nid_hugetlb_cgroupdentry_operationsupd_ebsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requesteddfs_chk_gencompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opis_deadsysv_shmdq_countupdatingutf8data_tablefm_wl_poolset_latency_tolerance__func__resource_size_tfoliowake_entryxa_headsuidemulate_power_cuti_readcountpq_headlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tbad_peb_countclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeglobal_sqnumparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_counters_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_idclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitmtd_erase_region_inforead_iterwritablef_ownerbp_regVTIME_USERsa_flagstestotp_factory_nvmemDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guest_get_devicedevice_physical_locationpm_domain_datapoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offset_put_devicefast_attachkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskreadersch_lnumregfunc__UNIQUE_ID_y_518index_keymemalloc_noioGRPQUOTAi_private_listia_validvertical_positioni_rcui_atime_secdfs_emulate_bitflipsqc_type_statekey_serial_tdev_ueventsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpids_eraseFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectorMEMORY_DEVICE_PRIVATEoobbufdev_releasedefault_timer_slack_nssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refvid_hdr_shiftpmdval_tname_lengroup_infovdso_imagefileof_match_tableused_bytespercpu_count_ptr__user_state_sizemce_kill_mevmalloc_noprofuuid_tproperty_read_int_arraycount_objects_stimezone_device_datai_flctxdefparamfred_csfault_flagemulate_io_failureskprojid_tptracer_credtlb_genstore__builtin_va_listpage_mkwritebeb_rsvd_pebskobjectaudit_ttypnummce_ripvstatfsnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodeoffsetsi_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqecc_step_sizenfdssigvalvma_lockperf_event_listvol_idget_reserved_spacestack_refcountinvalidate_lockbmapkey_payload_write_user_prot_regd_real_lockexpiry_activedqi_max_spc_limitexception_table_entryevent_countcorrectedpreempt_countfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startemulate_failuresblocks__might_reschedset_infofileattr_getvectortimer_listdevice_dma_supportedd_ino_warnshiwater_vmtracepointubi_namecompound_headUBI_DYNAMIC_VOLUMEia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimit_read_fact_prot_regqf_nextrangesiommu_mmcutimeem_tablepersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmaskubi_deviceuprobe_xol_opsseq_filefreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsno_pmgroup_stop_countalloc_tag_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeydfs_disable_bgtFAULT_FLAG_RETRY_NOWAITsyncupd_markersetleasepinspacct_structmust_resumelong intfile_lock_contextusagesiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimeuidhash_nodefred_ssproperty_presentUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typechk_ioruntime_statusin_iowaitunregfuncegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirtynum_srcu_structsbdi_writebackkobj_completionooblayout__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaps_writerstracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlensuspend_noirq_read_oobclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolusedfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_id_unlocksrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkskip_checkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountrestore_noirqpower_cut_counterki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYubi_eba_read_lebrlimread_folionr_events__vpp_verifyiommuprivatewritebufsizest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipe__be16s_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmodstqheads_activechk_genMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cached__be32s_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listbeb_rsvd_leveldirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_counttop_of_stackkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemlockmapignore_childrenrestore_earlyclock_mutexfs_supersdqb_bsoftlimitpendingf_task_workfm_protectiowait_countcorruptedmax_erroneousnotifier_blockdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesbad_peb_limitearly_initmprotectsecurityxmm_spaceubi_erractivatef_pos_lockckvol_mutexi_fieldmasktls_arrayownerpfo_val__acct_rss_mem1need_mbvm_flags_trefcount_structdomain_datarelax_countline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEdup_xol_addrZSWPOUTcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsNUMA_INTERLEAVE_HITneed_qsswap_deactivateblkcnt_tvol_counticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchmap_pagesreschedule_countvfsmountdfs_emulate_failuresextable_basenoinstr_text_sizenargsattributesMTHP_STAT_SWPOUT_FALLBACKvfreecopy_from_userset_child_tidNUMA_HINT_FAULTS_overruntmpfilercu_read_lock_nestingem_perf_stateleb_sizetick_dep_maskdentlist_copy_from_userthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugretlenseq_openPGSCAN_SKIP_DMA32upd_bufof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateubi_debugfs_init_devUTASK_SSTEPreal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tDIRECT_MAP_LEVEL3_SPLIToobsizefilesubi_dump_mkvol_reqdqb_bhardlimitliveatomic_write_unit_maxusable_leb_sizerun_listixolsym_vvar_pagemodule_sect_attrsused_ebsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalis_preparedret_stacknode_idautosuspend_delayunsigned intnotifier_callgendiskspc_timelimits_instancesfm_workdescseqcountoom_score_adjd_seqia_vfsgidsize_tacpi_device_idcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sum__compiletime_assert_127freeze_ucounti_ctime_nsecs_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_link_lock_user_prot_regfmode_tvolumes_lockcputime_atomicrestoredelayed_call__compiletime_assert_134max_nr_cid__compiletime_assert_137_statusd_sibkernel_ulong_tdma_opsTHP_COLLAPSE_ALLOC_FAILEDbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stateleb_startgsindexexpires_nexti_io_listf_ep__compiletime_assert_51srcu_barrier_seq__compiletime_assert_54__compiletime_assert_55__compiletime_assert_56__compiletime_assert_57links_countPGPGOUTfm_pool_rsv_cntreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tdfs_rootdirclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasewritesize_shiftscan_objectspid_typewb_errcputimertrace_recursionstart_dataposix_cputimerskref__compiletime_assert_64jit_keyringsrcu_unlock_count__compiletime_assert_66file_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinschanging_lebattrget_next_child_nodeFAULT_FLAG_WRITEstate_in_sysfsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDmtd_ecc_statsget_wunitfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointnr_wakeups_idleFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_node__ret_condpercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSseq_lseekmetaonlysyscore__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lock_panic_writedevice_physical_location_paneluid_toobretlenflush_requiredget_random_u32_belowsum_block_runtimepgmapmin_perf_statestrnlendq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_pools_addr_lsbi_generation_sigpollmxcsrdevtd_rt_spc_hardlimitmagicnumeraseregionsNR_ZONE_ACTIVE_FILEnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinewait_page_queuepteval_ti_inodyndbg_infoindexdriver_datathread_head__bad_copy_fromdev_pm_qosmap_typef_opnor_flashpids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizedq_sbNR_FILE_THPSsighand_structerroneousflagsi_lock_keykmem_cacheinodedrivers_dirNR_ZONE_ACTIVE_ANONbug_entrygood_peb_countcmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsseq_operationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanubi_vid_hdrf_raerase_countquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenget_policyHRTIMER_RESTARTsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtime__ret_do_oncenumbers_softexpiresvol_typekey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messageNUMA_OTHERnum_trace_eventsdata_pad_sys_privateinit_fs_contexts_subtypeheaderfuncperf_event_contextflash_sizetlbflush_unmap_batchsoft__sifieldsDIRECT_MAP_LEVEL2_SPLITrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6THP_DEFERRED_SPLIT_PAGEkprobes_text_sizestatic_call_sitesTHP_FILE_FALLBACK_CHARGEubi_fm_poolthread_group_cputimernuma_scan_period_maxbadblocksstart_stackTHP_SWPOUT_FALLBACKwatcherscompletionsw_reserveddevice_removableUTASK_SSTEP_ACKactive_uprobeshow_optionsubi_dump_flashbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataWORKINGSET_REFAULT_ANONget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printkvm_operations_structNR_ACTIVE_FILEbin_attrs_newdatbufruntime_idleiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersPGSCAN_DIRECTvid_hdr_aloffsetexp_hintd_childrendfs_fopsis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabPGSCAN_SKIP_MOVABLEdfs_emulate_io_failureswrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_infofail_addrref_counterror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idx_head_1_head_2backstate_add_uevent_sentOOM_KILLi_hashubi_dbg_power_cuthlist_nodeio_uringotp_user_nvmemcore_occupationftrace_timestampwriterclass_local_lock_is_conditionalsched_remote_wakeupresumewake_qfileattr_setCOMPACTFAILbio_listwrite_dquotclass_read_lock_irq_is_conditionalNUMA_MISSioctx_lockkveccurrent_stack_pointerubi_debugfs_exitsect_attrsonlineruntime_resumedup_xol_workKCOMPACTD_WAKEautoresize_vol_idMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmtd_mastergfp_tseccomp_filterstimei_mmapphys_addrd_lrusignal_structperf_event_mutexNR_PAGETABLEhprobecrcsUNEVICTABLE_PGMLOCKEDpgdval_tsetattr__bad_copy_tof_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activedriveri_opldt_usr_semkobj_ns_type_operationsseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEcredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstateubi_msgavail_pebswait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssitesDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysoobavaildevice_mutexsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswubi_wl_entryMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_minmtd_pairing_schemes_devcpus_allowed_lockget_next_idrwlock_tpgprotfalseremovedfm_disabledshow_pathmove_mutexget_random_u32DL_DEV_DRIVER_BOUNDPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datavm_event_itemmce_countswap_info_structnvmemsequencert_spc_warnlimitac_flag_block_isbadcoredump_datatasks_pidaddress_spacemm_context_talc_mutex__q_size__call_single_nodestartupubi_ec_hdrseqcount_spinlock_ti_wbreboot_notifieruint8_tpanelclass_id__read_overflow2_fieldinactive_timer_pkeyfilenames_export_opMTHP_STAT_SPLIT_DEFERREDdata_offsetstashedvm_page_prottimespec64PIDTYPE_SIDrsvd_pebsbpf_ctxd_pruneprintedresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipe_writevbase_resumehostuaddrerasesize_masks_wb_errshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descsTHP_MIGRATION_SPLITexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmiddebugfs_create_dirmtd_req_statspairrseq_sigubi_debug_infodev_pm_domainlimit0limit1dqi_max_ino_limitis_sourcemigrate_modemax_bitflipsSWAP_RA_HITpoweroff_latemtd_ooblayout_opsftrace_callsitesd_hashis_confidentialdl_bw__real_strnlenkobjkstrtouintfsyncmtd_infoi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotpm_messagemay_split__q_size_fieldmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountfm_sizeGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventCOMPACTSTALLhlist_heads_encoding_flagsrunnable_weightincrcopy_flaggraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowkernfs_open_fileunsigned charumount_beginvdsommap_legacy_basePAGEOUTRUNTHP_SCAN_EXCEED_SHARED_PTEpipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsdfs_power_cut_maxSWPIN_ZEROslicesas_ss_spNR_ZONE_INACTIVE_ANONnr_dirtiednum_kprobe_blacklistdfs_file_readNR_FREE_PAGESnumblockss_vfs_rename_mutexsuspend_latewakeup__check_object_sizecg_listsrcu_barrier_completion__compiletime_assert_58__compiletime_assert_59driver_flagsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapwaiterssessionidmin_io_size_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1padding2padding3llistdebugfs_entryelemnr_retries_get_fact_prot_infoPGSCAN_DIRECT_THROTTLEsigval_tpartitions_lockalimitundo_listdirty_folioubi_dump_vtbl_recordALLOCSTALL_DEVICEmissedquota_readst_shndx__compiletime_assert_63free__compiletime_assert_65parti_wb_frn_avg_timePGSCAN_KSWAPDfile_ref_tCMA_ALLOC_SUCCESStypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wqDROP_SLAB_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_type_block_markbadmtimeserver_has_tasksvm_faultoom_score_adj_minkobj_uevent_envdisable_bgtfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memfm_eba_semTHP_FILE_FALLBACKpath_unpointst_sizermtpcheckedwait_sumnum_tracepoints_readupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqPGSCAN_KHUGEPAGEDDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerPGREUSEunlinkperiod_contribdfs_power_cut_minrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opsiopollTHP_MIGRATION_FAILpagesizes_blocksizevm_pgoffauprobe__retnuma_workupdate_timeptrace_dr7prioritybgt_thread_call_addrloginuidcheckTHP_FILE_MAPPEDexpiryoptimistic_spin_queuespin_unlockdl_defer_runningALLOCSTALL_NORMAL__lstatero_modeueventlock_countrefcount_tplugchild_countsaved_auxvTHP_MIGRATION_SUCCESSltree_lockmce_addrnum_bugsqf_ops__vm_flagsmod_namesqnumproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenmodule_attributepollfd_read_user_prot_regnr_wakeups_remoteleb_countpebsllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextubi_vtbl_recordHTLB_BUDDY_PGALLOC_FAILwritesize_maskDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincountnvmem_devicetablesDEVICE_PANEL_BOTTOMlist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfromend_codethread_enabledqspinlock__get_random_u32_belowget_infolru_genNR_VMSCAN_WRITEinsnfilldir_tubi_dump_vol_infoNUMA_PTE_UPDATESdl_non_contendingdir_contextPGFREEchrdev_locktracepoint_ptr_tutaskNR_UNEVICTABLEsched_entityd_spc_hardlimitlong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baseio_context_get_user_prot_infogpl_symsgroupseq_showPGSCAN_SKIP_DMAswait_queue_headcow_pageblockSWPOUT_ZEROi_spc_timelimitreturn_instancescompatclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddeviceubi_dump_vid_hdrs_shrinkhrtimer_restarts_fsnotify_masksym_hvclock_pagexstate_headerinaccessibleDUMP_PREFIX_NONEquick_threadstime_sliceobjcgfull_namemasternodeBALLOON_INFLATEvm_lockMTHP_STAT_NR_ANON_PARTIALLY_MAPPEDPGMIGRATE_SUCCESSno_cgroup_migrationMTHP_STAT_SPLIT_FAILEDnextevts_writers_key__countxcomp_bvcma_areaWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeworks_countshrinkerdl_yieldeddqi_formatCOMPACTFREE_SCANNEDexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keysMTHP_STAT_ANON_FAULT_FALLBACK_CHARGEpropertywchar_addr_bndkernel_symbolsubsys_datatv_secma_lockpid_ttask_listubi_io_is_badftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineupd_receivedNR_SWAPCACHEdfs_chk_iouser_cpus_ptrpi_top_taskdirect_writesNR_WRITEBACK_TEMPactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedfs_chk_fastmapdisable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidPGACTIVATEngroupsfree_file_info__kernel_time64_tNR_VM_NUMA_EVENT_ITEMSautaskuser_namespacevtbl_sizevfsuid_traw_spinlocktimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusedqi_flagsPGREFILLMTHP_STAT_ANON_FAULT_FALLBACKbuf_mutexread_posstatic_call_trampTHP_SWPOUTbtrace_seq_pp_mapping_padsa_maskrequest_queueKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenMTHP_STAT_SPLITcodegtimesigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimeCOMPACTMIGRATE_SCANNEDsched_rt_mutexlocked_pendingnr_deferredfown_structfeatures_lockedmax_write_sizetracing_graph_pausepermcompat_robust_listktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagpposi_uidmove_to_putspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmfortify_memcpy_chkdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTmax_ecsp_offsetsrcu_cblist_invokingdfs_file_writeoops_panic_writei_lockd_namedebugfs_removeget_ownershipUNEVICTABLE_PGMUNLOCKEDufdsexe_filenr_scannedpcp_listpid_linksfree_countvolumess_sysfs_nameq_size_fieldrefcountNR_THROTTLED_WRITTENvaddrrequestrw_hinteraseblk_count_opentimeoutdma_configurelast_switch_timenum_classesorc_unwind_ipqc_dqblkmove_tommappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startkstrtointf_freeptr__seq_putsclass_raw_spinlock_irqsave_try_is_conditionalfailedshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyremovePGSCAN_ANONs_magicdl_overrunallocd_parentpayloadac_minflti_sbd_sbcommcan_matchlast_timePIDTYPE_PIDofflineatomic_write_segments_maxatomic_openubi_put_devicestart_prevent_timelnumreadahead_control__kernel_gid32_tpeb_sizeNR_BOUNCEf_credmtd_oob_regionMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesubi_get_deviceread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areaTHP_FAULT_FALLBACK_CHARGEdev_pagemapis_power_of_2vid_hdr_offsetPGDEACTIVATEerasesizewritepagessched_statisticsheadfm_anchor__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclampsuper_operations_suspendsplice_eofcheck_copy_sizeutil_avgKSM_SWPIN_COPYrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockPGSCAN_SKIP_NORMALD_REAL_DATA__compiletime_assert_337pt_regsecc_strengthpipe_bufswritersto_userNR_IOMMU_PAGESctx_idd_rt_spc_warnsuser_bufget_random_u8i_verity_infoxsavetimespec_type__rb_parent_colordevres_lockwritesizebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESCOW_KSMFORTIFY_FUNC_memscanubi_eba_tablevm_private_dataio_bitmap__ret_onceuprobe_task_statetimerkobj_typei_pagesubi_dump_avhlist_bl_headino_warnlimitfasyncu_chari_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGESchardomainunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vecUNEVICTABLE_PGCLEAREDKSWAPD_LOW_WMARK_HIT_QUICKLYgraph_get_port_parentpartitionsUNEVICTABLE_PGRESCUED__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_aliasNR_SHMEM__iovcpumaskPGLAZYFREEDdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrworks__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountpage_freeNR_FILE_MAPPEDparentatimecopy_file_rangetask_cputime_atomicBALLOON_DEFLATEuser_definedkey_typecopy_overflowget_named_child_nodelaunder_foliocurr_targethdr_crcis_suspendeddfs_dircorrected_bitflipsbursterroneous_peb_countetypeei_funcsmodule_kobjectactive_memcgdef_flagsuncorrectable_errorsbase0base1base2wait_queue_head_t_flags_2apage_typercu_data0no_updatecap_bsetarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsWORKINGSET_NODESlinux_binfmtpage_table_lock_sigfaultcountersname_linksimple_openNR_ANON_THPScmaxrsstimer_slack_nsbus_type__compiletime_assert_62policysharedTHP_SCAN_EXCEED_SWAP_PTEdismissd_real_typelookahead_bandseq_startpeb_bufraw_lockd_dnameget_dqblkmax_hang_timecpus_maskubi_numsubdirstask_groupstarttimeubi_mkvol_reqmmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnameubi_volumerun_delaytailslinenobase_pfnget_inode_aclpower_cut_max_addr_pkeymigrate_foliocustom_sliceNR_ACTIVE_ANONNUMA_LOCALthread_keyringkparam_arrayutimestart_codeis_hardfsbasecompatiblemax_wl_pool_sizeclock_listattrsnuma_stat_itemALLOCSTALL_MOVABLEcpumask_tswregs_statedqb_isoftlimitdma_iommuorig_axcompletesched_rt_entityubi_dump_aebtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainupd_bytes_sigchldreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettime64_tnuma_faults_localityhas_child_subreaperubi_dump_ec_hdrbuf_sizei_aclubi_fastmap_layoutwrite_newlist_lockpm_domaincpu_bitmapstatic_call_keyutil_estucountsqc_stateKCOMPACTD_MIGRATE_SCANNEDooblensoftirq_next_timercheck_flagsswp_entry_tuint64_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventNR_MLOCKset_performance_statephys_addr_tlookuptblclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryerasesize_shiftk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanPGPGINfs_parameter_specdesc_structdq_offmtd_debug_infoexec_maxkmap_ctrlnode_stampcompat_rmtpi_bytesdma_cleanupmaple_treedentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkBALLOON_MIGRATEpushDEV_DMA_COHERENTNR_ZONE_LRU_BASElinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workmean_echiwater_rsskretprobe_instancesrange_max_bad_blocksfutex_exit_mutexsimple_read_from_buffer__MTHP_STAT_COUNTtrc_blkd_noded_spacegraveyard_linkeraseregionsxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsIS_ERR_OR_NULLnvcswwatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USEReraseblk_count_seq_startshared_pendingreserved_pebsi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typeNUMA_FOREIGNbad_allowedi_rdeveraseblk_count_seq_showself_exec_idkernfs_opsfile_lockMTHP_STAT_NR_ANONMODULE_STATE_LIVEpairingstopnr_migrationsa_opsxa_flagsfreeze_raw_spin_lockbin_sizeNR_ZONE_WRITE_PENDINGclosedev_dma_attrgrphidata_sized_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorassoc_arraymnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpercpu_refscrubhorizontal_positionpref_node_forkwait_queue__int128dqi_privrss_statmems_allowed_seqTHP_UNDERUSED_SPLIT_PAGErefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploltreeseq_writePGALLOC_DEVICEclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_filehighest_lnumi_blockss_stateUNEVICTABLE_PGCULLEDuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrotp_infoTHP_SPLIT_PAGEqstrWORKINGSET_REFAULT_FILEma_flagsfutex_statePGSTEAL_KHUGEPAGEDorig_pmdvtblacct_timexpd__rcu_icq_cachesizeem_perf_tablewakeup_sourcef_posNR_FILE_DIRTYnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsNR_LRU_BASEmtd_oob_opsalt_lencinblockextableexitkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_stateMTHP_STAT_SHMEM_FALLBACK_CHARGEtimerqueue_headf_wb_errhdrs_min_io_sizercharfutex_pi_statekstat__kernel_uid32_tDEVICE_FIXEDpte_tPGSTEAL_ANONdevice_driverdl_server_has_tasks_frunnable_sumreal_credCOMPACTISOLATEDget_namefwnode_endpointepoll_watcheswl_locknon_rcuPGALLOC_NORMALWORKINGSET_ACTIVATE_BASE_is_lockeddqb_curspace_entrygp_statebitsetload_avgaccesscstimecfs_rq_uidfm_work_scheduled_pointst_spacemm_cid_next_scanns_typeac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimitNR_WRITTENs_encodinggpl_crcsorc_entrykeyspeb_countorig_ptedqb_curinodesload__s8ZSWPINspin_lockinvalidate_lock_keydma_maskprealloc_mutex__already_donenode_stat_itemsrcu_gp_seq_neededPGMAJFAULTdq_dqb_lock__kernel_ulong_tPSWPOUTdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignDUMP_PREFIX_OFFSETbtime__u8is_roxlockrlim_maxDEVICE_PANEL_FRONTPGALLOC_DMA32runtime_deferred_listd_waitlocal_fwnodelist_lru_onedevice_physical_location_horizontal_positionto_be_torturedseq_stopkiocbKSWAPD_HIGH_WMARK_HIT_QUICKLYclass_rwsem_read_intr_is_conditionalprobefsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typewl_scheduledclass_device_is_conditionalshrinker_idrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageno_callbacks__u16timers_activewait_countNR_SHMEM_THPSsig_okdelaysqf_ownerreadaheadNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingimage_seqfsindexshstksrcu_ssppage_orderwake_irqlast_eb_bytes__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32PGINODESTEALptracedtrc_reader_specialNUMA_HITHPROBE_GONEMTHP_STAT_SWPOUTactive_timeTHP_SPLIT_PAGE_FAILEDi_sequencedqb_ihardlimitd_lockrefsubpage_sftrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfTHP_ZERO_PAGE_ALLOC_FAILEDi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tf_iocb_flagsdata_crcpoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmoveHTLB_BUDDY_PGALLOCsched_contributes_to_loadstatic_key_trueweighti_privatemaxrssec_hdrflushruntime_suspendi_blkbitsvaluegroup_exit_codeUTASK_RUNNINGecc_statstty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimeceildeadlinedfs_dir_namepinned_vmwl_reboot_notifierTHP_ZERO_PAGE_ALLOC_head_2apsi_flagsaddressstart_boottimevm_startmults_flagsfaultec_hdr_alsizeshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmtd_partp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgZSWPWBs_time_grankernel_cap_twait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendingfm_do_produce_anchorRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotfolioqprev_posNR_ISOLATED_FILEseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uid_sync__UNIQUE_ID_x_517childrenrb_subtree_lastno_pm_callbacksbuild_id__p_lenPGMIGRATE_FAILdevice_get_match_datavfork_donenanosleeppud_trt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structDUMP_PREFIX_ADDRESSrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memmax_pool_sizeerase_infoarch_spinlock_ti_mtime_nsecperformancemmlistset_dqblksuppress_bind_attrs_write_oobRPM_RESUMINGd_weak_revalidate_raw_spin_unlockgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesNR_ZONE_INACTIVE_FILEf_llistphandleemulate_bitflipsi_nlinkbranchused_blockswrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedNR_VM_EVENT_ITEMSfreeze_superPTR_ERRs_inode_list_locksweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabKCOMPACTD_FREE_SCANNEDdevice_typePGROTATEDmaj_fltarch_rwlock_tclock_basepower_cut_minSLABS_SCANNEDcdevmy_qgroup_leadermkdirnextentsubi_ainf_volumereal_blockedarg_lockooboffsnum_exentrieshlist_bl_nodeint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerexclusiveclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyNR_FREE_CMA_PAGESqrwlockSWAP_RAfile_ra_stateuser_structwork_semon_rq__p_size_fieldfs_context_erase_user_prot_regprealloc_bufbitflip_thresholdprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasschk_fastmaplast_mm_cidcookietargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuUNEVICTABLE_PGSTRANDEDilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_baseseq_printfcb_headcheck_quota_fileFORTIFY_FUNC_memchrPGDEMOTE_DIRECTattributerestrict_linkdev_archdatai_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptrreg_offseti_opflagsrobust_listmove_fromsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockseq_releasedev_links_infoloff_tthread_pidbgt_namesrcu_gp_seqCOMPACTSUCCESS_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcalls_block_isreservedi_default_acls_uuid_lenioc_nodeblock_numberof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1mtd_pairing_infoget_random_u16matchmemory_typerb_rootnr_wakeups_localHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tPGSCAN_SKIP_DEVICEFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpoweri_mtime_secsched_delayedmodule_state__write_overflow_fieldlast_used_atALLOCSTALL_DMAvm_endlast_queuednuma_migrate_retryuser_ns__statePSWPIN_rebootfirstiommu_groupmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrssuspendedhas_timeoutinvalidate_folionodemask_ti_modenr_thpsNUMA_HINT_FAULTS_LOCALia_ctime__fortify_strlenbbtblocksFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progresssrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupxol_areaPGPROMOTE_SUCCESSrlockfl_owner_t_rescls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgnr_pagesnum_trace_bprintk_fmtTHP_SCAN_EXCEED_NONE_PTEvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpctimealignmentreleasemax_segment_sizesched_dl_entity_write__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_idPGALLOC_MOVABLENR_ZSPAGESs_dentry_lrubp_offsetfolio_queuelast_task_numa_placementpgtable_tblock_startcgtimesymlinkvid_hdr_alsizeoom_flag_origincounterorc_unwindcorr_peb_countWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapfm_pooldonePGSCAN_ZONE_RECLAIM_FAILEDfscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotavtbl_slotseba_tbldl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameia_filesival_intfm_bufnuma_preferred_nid_hugetlb_cgroupdentry_operationsupd_ebsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatei_linklistxattr_lowertrap_nrasync_probe_requesteddfs_chk_gencompat_long_tactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupspmd_ts_opis_deadsysv_shmdq_countupdatingutf8data_tablefm_wl_poolset_latency_tolerance__func__resource_size_tfoliowake_entryTHP_SPLIT_PMDxa_headsuidemulate_power_cuti_readcountpq_headlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tbad_peb_countlast_data_sizeclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeglobal_sqnumparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_talloc_tag_counters_flagsnotify_nextmax_perf_statebus_dma_limitshort intmynodeof_device_ideraseblk_count_seq_opsNR_VM_ZONE_STAT_ITEMSclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitmtd_erase_region_inforead_iterwritablef_ownerbp_regPGDEMOTE_KSWAPDVTIME_USERsa_flagstestFORTIFY_FUNC_memchr_invotp_factory_nvmempad_untilDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivalem_pdtrace_event_callis_guest_get_devicedevice_physical_locationpm_domain_datapoll_table_structdirect_IOCMA_ALLOC_FAILcurrent_may_mountseqlock_tnuma_scan_offsetMTHP_STAT_ANON_FAULT_ALLOC_put_devicefast_attachkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskreadersch_lnumNR_INACTIVE_FILE__ret_warn_onregfunc__UNIQUE_ID_y_518index_keymemalloc_noioGRPQUOTAi_private_listia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secdfs_emulate_bitflipsqc_type_statekey_serial_tdev_ueventsetupf_lockUNEVICTABLE_PGSCANNEDseq_putcactivedqb_itimeseq_putsWRITE_LIFE_MEDIUMsrcu_idxpids_eraseFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listeraseblk_count_seq_stopxarray_start__flagsp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidNR_UNACCEPTEDattribute_groupcontextposix_timersTHP_COLLAPSE_ALLOCselectorMEMORY_DEVICE_PRIVATEoobbufdev_releasedefault_timer_slack_nssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refubi_debugfs_exit_devvid_hdr_shiftpmdval_t__copy_overflowname_lengroup_infovdso_imagefileof_match_tableused_bytespercpu_count_ptr__user_state_sizemce_kill_mevmalloc_noprofuuid_tproperty_read_int_arrayKSWAPD_INODESTEALcount_objectsq_size_stimezone_device_datai_flctxuseddefparamfred_csfault_flagemulate_io_failureskprojid_tptracer_credtlb_genstorepage_mkwritebeb_rsvd_pebskobjectaudit_ttypnummce_ripvstatfsdma_skip_syncDROP_PAGECACHEnumab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistTHP_SPLIT_PUDclass_groupsnuma_nodePGSCAN_FILEi_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchangedwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclaveALLOCSTALL_DMA32PGLAZYFREEcreateiattrMTHP_STAT_SHMEM_FALLBACKrseqecc_step_sizenfdssigvalvma_lockperf_event_listvol_idget_reserved_spacestack_refcountinvalidate_lockbmapkey_payload_write_user_prot_regd_real_lockPGSCAN_ZONE_RECLAIM_SUCCESSexpiry_active__compiletime_assert_47__compiletime_assert_48__compiletime_assert_49dqi_max_spc_limit__compiletime_assert_128__compiletime_assert_129exception_table_entryvid_hdrevent_countcorrectedfallocatei_spc_warnlimitbuddy_listi_ino_timelimitubi_debugfs_init__compiletime_assert_50check_object_size__compiletime_assert_52__compiletime_assert_53__compiletime_assert_130__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135__compiletime_assert_136mems_allowed__compiletime_assert_138__compiletime_assert_139tlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderMTHP_STAT_ZSWPOUTtimewakee_flip_decay_ts__compiletime_assert_60__compiletime_assert_61s_max_linksnr_wakeups_sync__compiletime_assert_140__compiletime_assert_141__compiletime_assert_142__compiletime_assert_143__compiletime_assert_144__compiletime_assert_145__compiletime_assert_146kallsymsprevdma_parmsfs_structclockiduint32_targ_startemulate_failuresblocksset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcattimer_listdevice_dma_supportedd_ino_warnshiwater_vmtracepointubi_namecompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitTHP_FILE_ALLOCdebugfs_create_file_full_read_fact_prot_regqf_nextrangesiommu_mmcutimeem_tableNUMA_HUGE_PTE_UPDATESpersonalityget_statemax_sizetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infoMTHP_STAT_SHMEM_ALLOCd_fieldmaskubi_deviceuprobe_xol_opsseq_filefreeze_noirqNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsno_pmgroup_stop_countalloc_tag_killktime_tNUMA_PAGE_MIGRATEsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387iterd_ino_timeravx512_timestampfuncsend_dataPGSTEAL_KSWAPDsync_stateki_posexecute_only_pkeydfs_disable_bgtFAULT_FLAG_RETRY_NOWAITsyncupd_markersetleasepinspacct_structseq_readmust_resumelong intfile_lock_contextusagePGALLOC_DMAsiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodeeraseblk_count_fopsfred_ssproperty_present__write_overflowUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typechk_ioruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmark_dirtynum_srcu_structsbdi_writebackkobj_completionooblayoutckvol_mutex__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEf_inode__kernel_timespeccancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthsnprintfcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldssize_tiopl_emulwork_structdesc_lenflocktask_io_accountingmremaps_writers__fortify_panictracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeeraseblk_count_releaseelemsizedirty_paused_whenmaxlenNR_ZONE_UNEVICTABLE_read_oobclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lruFORTIFY_FUNC_strcpyNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvolNR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_id_unlocksrcu_structrlim_curnofaultmm_countdrv_groupsstackeraseblk_count_seq_nextfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infop_lensuspended_timedatastrtabtty_old_pgrpdl_throttledi_rwsem_oldget_projidsched_reset_on_forkskip_checkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountTHP_FAULT_FALLBACKrestore_noirqdfs_emulate_power_cutpower_cut_counterki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_eventsiommuprivatewritebufsizest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipe__be16s_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmodstqheads_activechk_genMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cached__be32s_copPGSTEAL_DIRECTdd_key_truezone_stat_itemhres_activebpf_raw_eventsdq_dirtydl_deferbug_listbeb_rsvd_leveldirect_completexa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxmthp_stat_itemrcu_blocked_nodegp_countkey_restrictionnr_rangeexit_stateMTHP_STAT_SWPINis_late_suspendedsysvsemTHP_FAULT_ALLOClockmapignore_childrenrestore_earlyclock_mutexfs_supers__be64dqb_bsoftlimitpendingf_task_workfm_protectiowait_countubi_ainf_pebcorruptedmax_erroneousprint_hex_dumpPGFAULTnotifier_blockdma_io_tlb_memstringread_countfutex_offsetlong long intatomic_flagssysvshmtimer_expirestrace_evalsactive_basesbad_peb_limitearly_initmtd_readmprotectsecurityxmm_spaceubi_erractivatef_pos_locksuspend_noirqPGSTEAL_FILEi_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structdomain_datarelax_count/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi/vtbl.c/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi./include/linux./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/mtd./include/linux/device./include/uapi/mtdvtbl.cvtbl.cfortify-string.hsched.hjump_label.hubi.hslab.herr.hlist.hcurrent.hdebug.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hstddef.hgfp_types.hstatic_call_types.hpreempt.hfs.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hwait.hosq_lock.hmutex_types.hmutex.hseqlock_types.hnodemask_types.htlbbatch.hmm_types_task.hrefcount_types.hkref.hrbtree_types.hrcupdate.hmaple_tree.hrwsem.hswait.hcompletion.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hmmzone.hpercpu-refcount.hasm.hlist_bl.hlockref.hdcache.hmount.hpath.hstat.hshrinker.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hcdev.hmtd.hkobject.hkernfs.hkobject_ns.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hdevice.hof.hfwnode.hmtd-abi.hhuge_mm.hvm_event_item.hubi-user.hubi-media.hrbtree.hstring.hcrc32.hkernel.h/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi/vmt.c/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi./include/linux./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/mtd./include/linux/device./include/uapi/mtdvmt.cvmt.cspinlock.hcurrent.hubi.hfortify-string.hproperty.herr.hslab.hjump_label.hmath64.hdebug.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hstddef.hgfp_types.hsched.hstatic_call_types.hpreempt.hfs.hmodule.hasm.hinit.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hwait.hosq_lock.hmutex_types.hmutex.hseqlock_types.hnodemask_types.htlbbatch.hmm_types_task.hrefcount_types.hkref.hrbtree_types.hrcupdate.hmaple_tree.hrwsem.hswait.hcompletion.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hmmzone.hpercpu-refcount.hlist_bl.hlockref.hdcache.hmount.hpath.hstat.hshrinker.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hcdev.hmtd.hkobject.hkernfs.hkobject_ns.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hdevice.hof.hfwnode.hmtd-abi.hhuge_mm.hvm_event_item.hubi-user.hubi.hubi-media.hstring.hsprintf.hspinlock_api_smp.hlist.h/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi/upd.c/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi./arch/x86/include/asm./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/mtd./include/linux/device./include/uapi/mtdupd.cupd.cjump_label.hcurrent.hmath64.hfortify-string.hthread_info.huaccess.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hsched.hfs.hmodule.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hrange.hirqflags.htypes.hshstk.hrestart_block.htime_types.htime32.hthread_info.hpreempt.hllist.hsmp_types.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.hspinlock.hkref.hrcupdate.hmaple_tree.hrwsem.hwait.hswait.htime64.hcodetag.halloc_tag.htracepoint-defs.hmutex.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hextable.hlist_bl.hlockref.hdcache.hmount.hpath.hstat.hshrinker.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hcdev.hmtd.hkobject.hkernfs.hkobject_ns.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hdevice.hof.hfwnode.hmtd-abi.hstddef.hubi-user.hubi-media.hubi.hasm.h/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi/build.c/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi./include/linux./arch/x86/include/asm./include/linux/mtd./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/uapi/mtdbuild.cbuild.cerr.hfortify-string.hspinlock.hcurrent.hslab.hjump_label.hmtd.hlog2.hsched.hint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hmmzone.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcdev.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.hmod_devicetable.hdevice.hof.hfwnode.hmiscdevice.hmtd-abi.hhuge_mm.hvm_event_item.hubi.hubi-media.hubi.hkstrtox.hstring.hnamei.hdebug.hkthread.hpartitions.hsprintf.hspinlock_api_smp.hkernel.h/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi/cdev.c/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi./include/linux./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/mtd./include/uapi/mtd./include/linux/devicecdev.ccdev.cfs.hjump_label.hcurrent.herr.hspinlock.hmath64.hthread_info.huaccess.hsched.hubi.hslab.hfortify-string.hlist.hint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hmmzone.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcdev.hmtd.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hubi-user.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.hmod_devicetable.hdevice.hof.hfwnode.hmtd-abi.hhuge_mm.hvm_event_item.hubi.hubi-media.hstring.hdebug.hspinlock_api_smp.hkernel.hkmsan-checks.h/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi/kapi.c/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi./include/linux/mtd./arch/x86/include/asm./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/uapi/mtdkapi.ckapi.cmtd.hjump_label.hspinlock.hcurrent.hslab.herr.hfortify-string.hubi.hint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hmmzone.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hcdev.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.hmod_devicetable.hdevice.hof.hfwnode.hmtd-abi.hhuge_mm.hvm_event_item.hscatterlist.hubi-user.hubi.hubi-media.hnamei.hstring.hspinlock_api_smp.h/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi/eba.c/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi./include/linux./arch/x86/include/asm./include/linux/atomic./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/mtd./include/linux/device./include/uapi/mtdeba.cubi.heba.cslab.hspinlock.hrbtree.hcurrent.hfortify-string.hjump_label.herr.hscatterlist.hmm.hatomic64_64.hrwsem.hatomic-instrumented.hatomic-long.hatomic-arch-fallback.hsched.hlist.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hstddef.hgfp_types.hstatic_call_types.hpreempt.hfs.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hasm.hpage_64.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hwait.hosq_lock.hmutex_types.hmutex.hseqlock_types.hnodemask_types.htlbbatch.hmm_types_task.hrefcount_types.hkref.hrbtree_types.hrcupdate.hmaple_tree.hswait.hcompletion.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hpercpu-refcount.hlist_bl.hlockref.hdcache.hmount.hpath.hstat.hshrinker.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hcdev.hmtd.hkobject.hkernfs.hkobject_ns.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hdevice.hof.hfwnode.hmtd-abi.hubi-user.hubi.hubi-media.hdebug.hcrc32.hspinlock_api_smp.hoverflow.hkernel.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi/io.c/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi./arch/x86/include/asm./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/mtd./include/linux/device./include/uapi/mtdio.cio.cdebug.hjump_label.hcurrent.hrandom.hslab.hubi.hfortify-string.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hstddef.hgfp_types.hsched.hstatic_call_types.hpreempt.hfs.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hwait.hosq_lock.hmutex_types.hmutex.hseqlock_types.hnodemask_types.htlbbatch.hmm_types_task.hrefcount_types.hkref.hrbtree_types.hrcupdate.hmaple_tree.hrwsem.hswait.hcompletion.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hmmzone.hpercpu-refcount.hasm.hlist_bl.hlockref.hdcache.hmount.hpath.hstat.hshrinker.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hcdev.hmtd.hkobject.hkernfs.hkobject_ns.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hdevice.hof.hfwnode.hmtd-abi.hhuge_mm.hvm_event_item.hubi-media.hcrc32.hlog2.h/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi/wl.c/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi./include/linux./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/mtd./include/linux/device./include/uapi/mtdwl.cwl.clist.hjump_label.hcurrent.hrbtree.hubi.hsched.hspinlock.hdebug.hslab.hfortify-string.hpid.hfreezer.hkernel.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hstddef.hgfp_types.hstatic_call_types.hpreempt.hfs.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hwait.hosq_lock.hmutex_types.hmutex.hseqlock_types.hnodemask_types.htlbbatch.hmm_types_task.hrefcount_types.hkref.hrbtree_types.hrcupdate.hmaple_tree.hrwsem.hswait.hcompletion.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hpercpu-refcount.hasm.hdevice.hlist_bl.hlockref.hdcache.hmount.hpath.hstat.hshrinker.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hcdev.hmtd.hkobject.hkernfs.hkobject_ns.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hdevice.hof.hfwnode.hmtd-abi.hubi-media.hreboot.hsprintf.hkthread.hwl.hspinlock_api_smp.hoverflow.hdebug_locks.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi/attach.c/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi./include/linux./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/mtd./include/linux/device./include/uapi/mtdattach.cattach.clist.hubi.hslab.hfortify-string.hrbtree.hjump_label.hcurrent.herr.hsched.hmath64.hdebug.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hstddef.hgfp_types.hstatic_call_types.hpreempt.hfs.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hspinlock.hwait.hosq_lock.hmutex_types.hmutex.hseqlock_types.hnodemask_types.htlbbatch.hmm_types_task.hrefcount_types.hkref.hrbtree_types.hrcupdate.hmaple_tree.hrwsem.hswait.hcompletion.htime64.hcodetag.halloc_tag.hpid_types.hsem_types.hshm.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htask_io_accounting.hposix-timers_types.hrseq.huidgid_types.hpid.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hpercpu-refcount.hasm.hlist_bl.hlockref.hdcache.hmount.hpath.hstat.hshrinker.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hcdev.hmtd.hkobject.hkernfs.hkobject_ns.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hdevice.hof.hfwnode.hmtd-abi.hubi-user.hubi-media.hrandom.hcrc32.hkernel.h/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi/misc.c/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi./arch/x86/include/asm./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/mtd./include/linux/device./include/uapi/mtdmisc.cmisc.ccurrent.hsched.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hrbtree_types.hatomic-long.hfs.hmodule.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hstdarg.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hsysfs.hirqflags.hpreempt.hllist.hsmp_types.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hrcupdate.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.hspinlock.hwait.hmutex.hrwsem.hlist_bl.hlockref.hdcache.hmount.hpath.htime64.hcodetag.halloc_tag.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hcdev.hmtd.hkobject.hkernfs.hkobject_ns.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hdevice.hof.hfwnode.hmtd-abi.hubi-media.hubi.hasm.hkernel.hubi-user.hdrivers/mtd/ubi/debug.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingdrivers/mtd/ubi./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux/atomic./arch/x86/include/asm./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/mtd./include/linux/device./include/uapi/mtddebug.cdebug.cspinlock.hseq_file.hthread_info.huaccess.hfortify-string.herr.hrandom.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hrbtree_types.hatomic-long.hfs.hmodule.hasm.hinit.hjump_label.horc_types.hsched.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hstddef.hbug.hstatic_call_types.hsysfs.hirqflags.hpreempt.hllist.hsmp_types.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hrcupdate.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.hwait.hmutex.hrwsem.hlist_bl.hlockref.hdcache.hmount.hpath.htime64.hcodetag.halloc_tag.htracepoint-defs.hstat.hswait.hshrinker.hkref.hmaple_tree.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hmmzone.hxarray.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.huio.hcdev.hmtd.hkobject.hkernfs.hkobject_ns.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hdevice.hof.hfwnode.hmtd-abi.hhuge_mm.hvm_event_item.hubi-user.hubi-media.hubi.hkstrtox.hdebugfs.hsprintf.hspinlock_api_smp.hlog2.h'cUc]U]U]]NTN\T\TT\T\\0 0 V00  0 000,P,8SPSPPSPS]]]]\\\\P#SPSP"m P  P PPPdSdiPi0SPS0Sv UVU0VVs`0V11P11P111P1111&1    00P[S[v S v Sv Sv 0 000P*TT0]Tv}^ } $ &Q    V ] ]]\ \\0G p++Gu p~++z01 p++PV VV0 00PV VV_T(psp#s#*(pR-p~sp~#s#*(p#TRT(psp#s#*(pR-p~sp~#s#*(p#TR  TT 88P#P P   $ &V] ] ] ] ]]\ \ \ \ \\}}0_0 _J_W000 0 0 0 0 0000^^0Q ^ QJ^FPPWSPSPS S S P SSW0{0 0J0WSPS SJS  X  X W;{; ;J;  X 1TT T QW JW    J W JW JE1TT T Q   888E1000E11 0000000z0PSSSGS  X  X ;;;;;0;z;  X 1>>>>>0>z>G>>>>>0>z>G>>>>>0>z>>8]]PP]]]]]]0]\\\\\\0\  0 9V9DvDVVVV0VDS^jPjSPSS0SD^^^^^^0^_^^_SSQ&U&\UU\ \&T&VTTV V&Q&_QQ_Q_Q_ _&R&@R@ @$PFzPPP 0000 0]]0]SSSP___)1&  &00     \\\ \P]] ],P,ASAE}PSP P S00 0Pf]]] ]  @  @  44 4@1000 0,P,ASAE}PSP P S^ <\\ \<]] ]#P#8S8<}P P SQQ Q QQ Q ^^ ^P&000&\\\Q&X&\\RITARATAQARTQ1AP]]]]1U1SUSS1T1VTVTVTVTVV101^0@^^^@^^ s$1rQP\\ s$1r-s$1|H0H%$!0)(8/QQ/s$|H0H%$!0)(8/Q]]]]]]]| ]| | | | | | | | ]| | | | | | | R~69P]|PP.|.7|~]||||||p P\  |||___*   PPP2U2\UU\U2T2VTVTp~]]PP}z}gSSS== == = 8R__R  N  NN>1>1.0.>11   __     88 p $ &Q p $ & 3p $ &##+(p $ & PT\T^U^_U\U,S,9Tx}S 0 :1x01PpP \  )U)VUVUU0V)T)STS0S)Q)\\QQ Q 0\ P S "P"8SP     8NV.\0.1!P!$S$$PV  V U8VVC!@U@V~qUVVKTK\T\\$SZTZ^(@<H0H%$!0)(8/9R9X(@8H0H%$!0)(8/PZXYX[SSSv$1t $ &W q $ &W| u $ &|v$x $ &PPs $ &rs $ &s $ &Pv$1t $ &s $ &rP u $ & q $ &P u $ &v$x $ & q $ &Pa@@0U0Tuv____R@@@@         PPPPvvU7V7<U]$T$STSTSTSTS>S $Q$^QQ^Q^Q^Q>Q$R$\R\VR\P\\\>\ P%0yP^P0\P\0>041    003_37P  $ &v Q S  $ &v  $ &v  $ &v U%_U%^^%VVU_UVV00  7v#+v#+    U _ V 0+U+U+T+STSS+Q+VQVQVVV+R+U_~_RU___L([(\[\\\/L\2____L_0PP0P0P_P_PP_0>_]7]tT] cqUqU81    00 XjjX3X3LRUU&&V& } $ &U } $ &0 #} $ &#+7#} $ &#+#} $ &#+    U  } $ &0 U 1@1V1] U !@!]!0! }#+}#+}#+L}#+U@]0UZ]ZbUbcUc]U]UU]8T8VVVbTbcTcoToVTVTTV3Q3\^\bQbcQc|Q|^Q^QQ^ARAX\XbRbcRcR\R\RR\AXALSLcXcXSPPPAYA^_^bYbcYcYY-_2N_Sx_ s $ & Q " s $ &23 s $ &Sx s $ & s $ &    00 qs $ &vs $ & Q qs $ & #U#\U\UU\UU0\#T#}S}TSTTS0S#Q#~V~QVQVQ Q 0V/1    00200PsT#inPnpsUVUUVUV0VT]TT]T]0]Q\QQ\}T#\0\ 0 ,S P SP*0PPSPSPS/1    00f00PPp $ &}"1Pp $ &}"1p p $ &}"1P8U8V|pUV|pV0VdTdSTS0SdQd\QQ\Q\0\P'V'0PV,1    00P s R s5U5VUV}pUV0V^T^STS0SP V,1    00#1    00K-@U@]U<Us>iSPS%P%+S+YPYqSqyPy0_S/ / /0PVNRPR_\|\0BSBEsEGS| $ &T"| $ &T"| $ &T"PV*P*VL^ P VPPT,2TPP1U1LXLUP#P#gS t   ~  p $ &UVUVUV0VT|\|T\TT0TPSPSS0S    S U\U\U\U\0\09U9\U\U\NTNSSSsSTSSSNQN ] Q]Q]Q]Q]Q]Q]Q0Q0D]DIQI]GRGVRDR $0.(VRDR $0.(VRDR $0.(VRDR $0.(VRDR $0.(0RDR $0.(0VX  XXX0X0=X=IIYXYXXXYYYY0Y0=Y=IYIYYYYYYYYYY Q p3$"9p3$"P^^^^P^0^0=p3$"_^p3$"^0)P)-p-HP PP% %@P@D]DuPu]0P] ]  ] P ] P ] ]0     0000000_00P^^^^P^0^_^^      =====0=_==   10 00000PP^ ^ ^^^^^^^^^|^^VRDR $0.( V VVRDR $0.(RDR $0.(RDR $0.(RDR $0.(VRDR $0.(RDR $0.(RDR $0.(|VV+1    00+1    00P P uU Uupu prurUQU PQ|^ ^|V V!RWTPT PPTP PU U upu pr tr^T^V^ Wt  W t !R!(lttt $0-(:&vtO&F%t" tO&F%v#tO&F%t" tO&F%vtO&F%t" tO&F%v $0-(:&"( (VP X rv Q  rvPP(1    00-1    00-1    00-1    00-1    00*1    00-1    00-1    00-1    0011    00^ ^ ^ ^^0^ 0 -V-1v1:VV P ^]^P]P P ] ] P ]]0]41    006^ 0 $$)#PVV ^PUSUSMTMVTVTTVT t $ &#n3$u" 4v $ &#n3$u"t $ &#n3$s"T $ &#n3$s"PP~P~ t $ &#n3$u"# 4v $ &#n3$u"#t $ &#n3$s"#T $ &#n3$s"#Uk\kpUpuUTpTpuTThSpuTUNVNVUU7V0+S+/s/7S U uU u UUh U uUUKSK_U_eSeyU0"p3%"&p3%#&>p3%#GXp3%K KZSZ_P_e etStyP4Q=NQ  & UZVZ_U_VUV6V0"p3%"&p3%#&;p3%#FLp3%&S&1pxV>EPU=U=S ~ S@T@^T^JQJVQV0%_%))e_eh0-0-\03U3{\{U\6T6}]}T]@Q@xSxQS U 'UT'TQU'QUUUUUUUUUUUUUUUUUUUUUUUUUTTTTTTTTTTTTTTTTTTTTTTTTTQPQPQPQPQPQPQPQPQPQPQPQPQPQP!P uUhuUhuUhuUhuUhuUhuUhuUhuUhuUhuUhuUhuUUUUUUUUUUUUUUUUUUUUUTTTTTTTTTTTTTTTTTTTTTQPQPQPQPQPQPQPQPQPQPQPP$PsxPPPPPPPPUUUU.FUU-T-QSQrTrSTSTSTST-Q-QVrVVVV(0I{0{QP\R0PPS0P0\QBVBIQIVPhSS&1    00R V \V@U@VHPQ"SxQ#1    00PzP q U]V] U V UkU?T?STSTSTSTSTSTST S T S T S T S TSTSTkT?Q?\\\\Q\\ \ Q \ Q \ Q\QQ\Q\Q6Q6I\IkQp0pPS0P 0PP0P0P0SR0PP0 P } 0 } 0 }}P0"}DPDVPVPVPVPVPVPVPVP V V P VVkVP%\P\Q\Q\Q\Q \ Q \ Q \ Q\Q\Q\Q6Q6I\IkQ&1    00R \ ~\^\VVVV^^^^ v$1qIv$1~YfP v$1~    U~~SSl  PPQT&1    00P q PPS&1    00~U~\<$V V$~ ~Pp $ &q"1Pp $ &~"1p p $ &q"1PP,_ _ _ ____P_6_Ik_&1    00E0 0 0 000060Ik0P,_ _ _ ____P_6_Ik_  E= = = ====6=Ik=   1P_\ VVVV V V V6VIkV____ _ _ _6_Ik_S0}1SQp}1}0}P}}1}} }}6}IkSPdhP}P}PSP^ S]P]]]Q}^Q]R}R } } R } ]6] ^ P }^}PSSP]SP]U}""}"\"\$PmqPPU}"}"\\\\ 5 ~         6 Ik  PP~\3}S }S}SS }}$6S}P}}}} }6} s0$0& }0$0& s0$0& }0$0& }0$0& }0$0&x $}x-~ ~#*(~-~ ~#*(~-~ ~#*(~-~ ~#*(~ }}$-~ ~#*(~x $&}##-(xN~ ~#*(~##-(N~ ~#*(~##-(N~ ~#*(~##-(N~ ~#*(~##-( &}##-(&}##-($N~ ~#*(~##-(@1 }0$0& }0$0& }0$0& }0$0&% $}%-~ ~#*(~-~ ~#*(~-~ ~#*(~ }}$-~ ~#*(~% $&}##-(%N~ ~#*(~##-(N~ ~#*(~##-(N~ ~#*(~##-( &}##-(&}##-($N~ ~#*(~##-(%888 8$8@1/0/@11  R2}2\R2}2S2\R}S\17PP@1  0000000 060]P]]]] ]6]   22222 262  1P!U U p"}}" s0$0& s0$0&"  }"-~ ~#*(~}PPR9]%]]1PPT}c}}\P!P!A^AZpP^^l0)| P p T  P005P5]P]   22  1-^-\-^-\ Q -} ^ \ Q } 1 ;P=1 0PPrQ TP q  Q TP q vzUzUUUUUUUUUUUUUUUUUTTTTTTTTTTTTTTTTTTQSQQSQSQQQSQSSr0rP0PP0 ڟ0PP0PP0PP0P ^P^0PPP^P^VV]]\|p\\FQFSQSQQSQQSQSQSQSQSQSQ} $ &} $ &,PP~U~S8_TS@]P8Q8RSQS:PP q 01    00]Q U  T S 8QP q QP q  U  S @LULUUUUUUURTR^Q^STQSTSTSTSTSOQO^Z^qq p $ & | $ &ZZQQQZ | $ & p $ & | $ & p $ &Q | $ &QQQGRGRRRR[RRRX0XP\P0P\P0P\P0P0]T]]]]P-}-U}}}UUUUUUUUSSSSSQkQkZZ^QZ^Q^QZQZRRR[RRRR]]]]Y\T_T\0\___($z#u#-((\&~##-(\\&~##-(\$z#u#-(&z##-(U tz"1t #$z"1#$ 0PP0V 0PP00P0QkQkZQZQQQZPGQGQPQ@1    00RT00000PGQGQPSSVVVV00  v#+v#+#| $ &#+v#+v#+$  V0:U:UUU:T:T:Q:QZ^~v^QZZQ^0^Q:R:]RR]R]R] u \\\\PP|  PZ~PV 0PPPQS0SSS$z#r#-(KVKT&~##-(TV&~##-(V || pz"1p#$z"1#$RQ^Q^xZxQZZQQ!P!___P_>1  00!1    00000!P!___P_ } | VVVV11  :v#+v#+v#+  _V1'U'JU+T+JT+Q+JQ+R+JR u Vu( s~P V Pu(s~Us~$U$%U%,U,DU$T$%T%3T3DT$Q$%Q%7Q7DQ$u %,u ,7U# P'P U MUMfUfU0U T MTM_T_T0T9V>VV0V4S:SS0S91    00J1    00UU!T!d\dkTk\P! v 1!(v(EVSV]+^] PIuPu|\    00UUPUVUV0V QMkQnnQ Q %ss"s"s"!\!&PEG pSxS0Ss#Us#UUzVzUV`VlSrrS`Ss#Uu U-UTUUHUT1V1ATAFVFHTQ<\U?J]O].1    00\,1\S,1S!U!sVs|U|VUUV!T!rSr{Q{|T|STS`\gp\w\X]X\U]h]m]P11    00\BG\SBGS8U8\U\UU\8T8VQTVTTV8Q8QQZ@Q8R8]XR]RR]STSS_U__^^^01    00SV;U;\U\UU\;T;VQTVTTV;Q;QQ[@Q;R;_XR_RR_;X;]YX]XX]STSS ZZ^^^%1    00 S VAUAnUnU@UATAaVanTnTVAQAnnvQv1R1c\cnRn\AXA`S`nXnSAYAe]enYnyYy]D_I_R22?R?PYxPxy@yPP+^2^&1  2G  02G0AUAnUnU@UATAaVanTnTVAQAnnvQv1R1c\cnRn\AXA`S`nXnSAYAe]enYnyYy]D_I_R22?R?PYxPxy@yPP+^2^&1  2G  02G0USVSmUmVUVSS\}q\61    00|]|3U3YSY_U_SUS3T3ZVZ_T_tTtVQTVP)1    00 p $ &ZUZdXdU#T#VTVFQF\Q\P1BPBESELPLSS"U"[\[fUfU\U\\"T"YVYfTf~T~VTVV"Q"ffQQ0Ss\S S   PQXPX]]P_@ x_P,1"  "00T s3$"#VVV    PPPP@ :D U 6S6LULSUSUS T ?V?LTLcTcV Q 6\6LQLpQp\Q\Q\ $(X(--?XY  P\ XD P\P\P6^b^P0P0_P_]] p3$"#v $ &3$"#]v $ &3$"#]+1   00O0{0P6^b^P@ O4{4@1P ]TPRQTPUgUgqUq|UTbSbgTgqTqwSw|T P DUW\P\bUP;U;SU T -\-2U2X\X]UT#V#]TP0S08P 0 \:Q:~QUVP[oPtyPrXUApFZp_dp~QP6V"U"^UU^U"T"_T_T_0'S'4s7SsS0 vU p3%vU p3%#vU x3%#0PMS ]DD P pH8V!VV!\!]&P&JSJWPWSP&1"  "00%P%3PP%Sp $ &2$v"PSP.VP' \\US>8>]>-\-)\)^)\^1PP#1    00*\*0]]w_wUptP=FPKUKHTHSQS 0 2S2MsTSsSsSS\S\S0)1,6P6GpGPP0VvVzSz##S#0 0V0PG^G^,P,@@P]@PZkP-^<^^^^^ P UZePelUPUPZjPjqUuzPPG^G^3  s $ &P3 s $ &383 <]S S S0S>~ ~ ~0~>] ] ]0]>~ ~ ~0~>~ ~ ~0~~~]]~~~~SSSSP"SP__SR&S$V ss]Yf]]Yf]S SSSSSSS S S0S]]  0~~~~~~ ~ ~0~\\\\\\ \ \0\~~~~~~ ~ ~0~~X~~~~~ ~ ~0~~YYYYY~ Y Y0Y~_13_0_P~~~~~~ ~ ~0~/P/~~~~~P~ ~0~%S%~001101011000~~~~~~~~~0~~~~~~~~~~0~~X~~~~~~~~0~YYYYYYYYY0Y0VVVVVVVVV0V]]]]]0] P ^P^^^R^^^^^0^)P)2 _P_PPP_0P_PP_  _0_P~~~~~~~~~0~ P _ ~     8.VP U U.VVV.___.^^^.000_LT_^LT^0LT0VLTV V=EVVv%0~~~~~0U0^U^0^BTBVTV0VBQBQQQ0BRB@0@BXBXX0BYB\Y\0\SS0SP]]P]]]0]PggoPo 2$~"0PU0P]PP0P PPPPPPP091    00>SSSS0S>@@@@0@>]]]]0]>TT0>\\\\0\@#+@]#+]#+\#+\S#+S SS6U646T646Q6\Q\Q\4\6R6D4D6X6^^^4^6Y69]9<}v<]]]4] VZVVPP| $ &5$|"#>U>VUVV-T-]T]]>Q>\Q\\>R>>X>>Y>YYYYY0Y10A0kPPS0PSP0P 0PPPPSP Ps  00^^^0S10S10S0S1SS0S0`0`SP@@#P#VP P__t_0_71    00  $ &Q  $ &  $ & ?1    00 PPUVP@Q\PP*VV0V*0*^^0^*TT0*0P Y  Y V4FV=U=SUSU4T4\T\T=Q=VQVQ`0`m]0P[_q_^^1  l  0l0USS^^QVVPPPPUk]km~pmqupqrUr]~pupU]0]#T#gVgrTrVTV0V#Q#i\irQr\Q\0\S0KSWWS0Su$}]GM]VGMV\GM\SSGMSSBFS } ^ UU#-6}68^8<U<=U#Uk]km~pmqupqrUr]~pupU]0]#T#gVgrTrVTV0V#Q#i\irQr\Q\0\S0KSWWS0Su$}]GM]VGMV\GM\SSGMSSBFS } ^ UU#-6}68^8<U<=U#,U,]xp~pU~p]}p]~p=~p!T!STSTS=SQ_Q_=_0P0VVSVPV=V0 '\'?\\\=\d0dxS000=00P0VVSVPV=V1P1 @ P 1X]]]]]=] 0 \':\\0\=\ V ]}2]]2SST2__ \ 2PPP PP^8U8gVgnUnnUU7V8T8fSfnTnnS7S8Q8i\inQnnQ Q 7\v0$p2%$(p2%#(-p|2%#UUTSTS P aVkyV 0 1!,p|2%#,0p|2%#05px2%# P aVkyV#8# #8# 8 1Y0cq0P#vHN0  s $ &P s $ &4  U s $ &2$  T#qUUUqVqxUxV VPOS[cSggS SP?FPKKP PPOS[cSggS S@ @ @ @ @ 1;0GO0SS0 0P?FPKKP P\ @ .VFFV V.SFFS SPFFP PQ??Q Q Q??Q Q \??\ \U=S=@|p@EU V P\sUS"U"#U#(UU S UU#U#8S8@U'T'9V9@U#\\9@9U9bUbuUu_U_9T9bTbzTz\T\9Q9bQbQVQV9R9bRbRSRSP'PF\P PP P W]\jPj] t $ &u$ $ &q $ &"2Et $ &u$ $ &q $ &"EJt $ &$ $ &q $ &"JV| $ &$ $ &q $ &"u0z0 P W]\jPj]U+U+3S3;U;BUBS'T'6\6;T;BTBz\zT\+Q+4V4;Q;BQBzVzQVP'PU U SUUSUSUS0S T VQTTVTVTV0V Q QQQ0Q\\\\0\PksPP P]T]]]0](1    00Q SS VV SSS22 S U!ASS+U+}^}U^U^0^+T+wVwTVTV0V+Q+QQQ0Q+R+y\yR\R\0\PezPP#APA`SPSPSSSSP_T_P_P__YYDYY]b]0];SSS0S(1    00#1    0011    00&1    00"Q.U.VUVUV+T+STSTSzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{%#rH0H%$!0)(8/%RRRRRR#rH0H%$!0)(8/RRRRRRRR&#yH0H%$!0)(8/&YYYYYY#yH0H%$!0)(8/YYYYYYYYl|lsss T#sss|sssssss#tH0H%$!0)(8/TT%sH0H%$!0)(8/T%sH0H%$!0)(8/T%sH0H%$!0)(8/T%sH0H%$!0)(8/T%sH0H%$!0)(8/#tH0H%$!0)(8/%sH0H%$!0)(8/T%sH0H%$!0)(8/T%sH0H%$!0)(8/T%sH0H%$!0)(8/T%sH0H%$!0)(8/T%sH0H%$!0)(8/T%sH0H%$!0)(8/T%sH0H%$!0)(8/T%sH0H%$!0)(8/"#pH0H%$!0)(8/"PPPp(T#H0H%$!0)(8/pP%sH0H%$!0)(8/P#pH0H%$!0)(8/PPPPPPPP!#uH0H%$!0)(8/!UU%sH0H%$!0)(8/U%sH0H%$!0)(8/U%sH0H%$!0)(8/U%sH0H%$!0)(8/U%sH0H%$!0)(8/#uH0H%$!0)(8/%sH0H%$!0)(8/U%sH0H%$!0)(8/U%sH0H%$!0)(8/U%sH0H%$!0)(8/U%sH0H%$!0)(8/U%sH0H%$!0)(8/U%sH0H%$!0)(8/U%sH0H%$!0)(8/U%sH0H%$!0)(8/&xuH0H%$!0)(8/xuxu(xsH0H%$!0)(8/xu v$u U#$uxu(xsH0H%$!0)(8/xu(xsH0H%$!0)(8/ v$u+v$sH0H%$!0)(8/xu(xsH0H%$!0)(8/&xuH0H%$!0)(8/(xsH0H%$!0)(8/xu(xsH0H%$!0)(8/xu(xsH0H%$!0)(8/xu(xsH0H%$!0)(8/xu(xsH0H%$!0)(8/xu(xsH0H%$!0)(8/xu(xsH0H%$!0)(8/xu(xsH0H%$!0)(8/xu(xsH0H%$!0)(8/USUUSUS0ST\QTT\T\0\QVTQQVQV0V P(1    00SS\\VVPP #IBU #IBUSSS11S>^SS'U']UU]0]'T'VTTV0V'Q'\QQ\0\'R'^RR^0^PezP P MSPSSPSSSP_m_P_P__YYDY(1 '   '00#1    0011    00&1    00KUKUUUmUmhUhUhUhTPSPUTUS/%r808%$!0)(8//:RDH%r808%$!0)(8/H\&s808%$!0)(8/R%r808%$!0)(8/&s808%$!0)(8/%r808%$!0)(8/&s808%$!0)(8/#qH0H%$!0)(8/#Q#7%sH0H%$!0)(8/AJ#qH0H%$!0)(8/JY%sH0H%$!0)(8/~%sH0H%$!0)(8/%sH0H%$!0)(8/Q"#pH0H%$!0)(8/"4P>V#pH0H%$!0)(8/{PP#pH0H%$!0)(8/1U1ISIQUQSUS0S1T1JVJQTQVTVTT0VP,\/\4q\v\0\1U1ASAIUIS0S1T1BVBITIVTT0V'\,\0\ P '\'MPMT\1  !/  0!/03U3SUS0S3T3VTVTT0V3Q3\Q\Q\Q Q 0\P^fP03\|00P0 0 0 000 SS VVP1DSSSSSSVVVVV!P"@PAcP~PPP3PDPP P D 0 ||# | | | | |33 s$ $ & Q s$ $ &  s$ $ &Q s$ $ & MUMSUS?ST\T\?\*P+MP|PPPPP]]s% $ &}"T]?]/SSS/~~~*V*/~VVQQQ QQQ @@@FUF^UU^0^FTF\TT\0\ P (S(;P;ASPSPSQ000000)1    00qHH H,^#^ PAUA^UU ^^ATA]TT ]]AQA\QQ \\ARASQvs"R S R SSAXAVrqP V X X VVP`zPP0  P  0   P~$ $ &p".1    00^^\\P-^^^\\^^^^^P^^^ ^]]] ]\\\ \SSSR SVVVXX VP P0+_+/z_P:X:Pr $ &"r $ &" $ &" $ &"^000P:X:P}"}"1[x}"{"P[xPV^^^^ ^\\\\ \4P^bPbk !PPXXp__0_YP ^ @  @   @ ^^ ^ P ____ _ PP P0000 0 P v__ _ @ @ @ @  @ 4444 4@10000 0 PP PR @ E^ ^E_ _P PQ QQ QR R  ___AUA_UU__ATA^TT^^AQASQQSSARA\RR\\AXAVXVVPBZLQPQ}Z}PZP)Z)8 }0000`00Ph.1    00  0 #1    00__SSP9_5_,_PU\U\T]T] P ZVgV VPCSP"R>NR|R%s<H0H%$!0)(8/!P!SSPS!P!SSPS" @  u% $ &" @  u% $ &" @ %\x\%]x]%SxSP\Y*U*V~_UVUv[|\~_UVv[0v[ SPS/SP S1    00v#v#v#v#v#_VV-SSS+VV+]]SPSSPPSSPSR0R]R 7PPSS)2S>TPSP,P,.S VV SS ]]VV]-1    00v#V vU\U\0\)S)1P1_S0S^0U^\^V^ UGPPS p GTPSP"S"2P \1_\ S1_S V1_V\\VUu%UTTQQuZUU Uu%UU\@ U\    00|\ 0 _ SU@_@STT___lU S P TST\PU%_U_U_1PPQ _ S\TPJRP"U"\U \\jTjS @ S @@ PSPSPSP  q1110VVvV V V 0 VVPPP~S~PSUuHUS%^%<SS__^_^^^p^p_^$P$<^ P RSP]SP]P]P]S@SpSP!|# 0$8$  |$ $ &P# |$ $ &$8$  U  PUPqPf000 P RS0S P P  P So002P2[]P]P]P]&1    00#1    00P P P 0 " ~ ) P(1    00PP3\\3QQ0 p|3% p|3%#"p|83%#"* p|3%UtVt}U}VUVTl\l}T}\T\T\T$Q$x]xQPJSXSPP%7P7A\AGPGp\pwPPJSXSP"V"S-U-V|[UV0VBS[[S0SBS[[S0S-SSS 1PPQv$CUCS|\}[USI0__CUCS|\}[USP_ v10s#1 00s$Ss# S3=S1  00HUHS|\US|\S|\S@ S|\US|\LTL|V|_TV_V_T_LQLQ|0 S0PS 0PVP  ]F]V]VVs#S=bS]=b]s# \s#s#VSVVPPP qs 4% qs 4%qs 4%#qs 4%# P qqqp Ps#s# \s#s# \%U%V}[  UV}[  V0V%T%^TT^T^0^%Q%\QQ\Q\0\0P0PD000>1>010100021 %   %00_%DPDJUUPPPUP%GQPQQQ_Nv$Uv$PKv$Pv$"QQPQv#UUU1PPQv#v#v#U]v#5U5S|\USUUST%]%^T>VQfVsVV1    00P/@P S=GSs#s#s#s#SSVVs!s!SSs!s#/U/Sv\  `Sv\Sv\Sv\SS/T/@T@@/Q/DQDD/R/]R]R]R]R]R]R]R]0]0`R`]/X/XXPShoPoSP_Ai_n__`_&1 /   /001    00)1    00s#s#s# V SS __ \\SS\s# SS __ s!s!SSs!VV SS __ s!s!SSs! SSs# V,U,SUS@  S0S,T,<V<TTV T0Tx\\\\\ \k]]]]] ]k^^^^^^{____ _PYVPVVVVPVV P V P V  k00010 0 1 0 V 00041  00PPs##S#\ s#s#s#SSSSS0S]\e]e\]]]]]0]\Td\d~T\\>04]]] 1PPQ s#]\.1    00TUoT s# s#s#s##SS#\\s#s#Sssss ssssUS~\US~\USv\~\US T VTVTVTV0\P0 P)]KYPYv]P]P]P]&1   0T0TSTs!T :Q:<PdQdkQUV3U>YUYkVT3S>kS/\:g\-1    00V%U%\TL9U9SU,S,,U,-SSST-TST~Q~0PPP~Q~ 0YU~~0**~51    00  PY~~PY~~          10 0800PPPPP0 0 00*0*+0S0SU S SS*S*+SSSYU~~**~ U ZZ0Q~Q~  0  0    ~!! !! "" **    0 __ _ _____ _!!_')_PJVJYPP P U!&PU uHMOUPP 00*0*+0S0P)*P  U  U "1    000 00 0 0000000 0!!0'(0^ ^^ ^ ^^^^^^^ ^!!^'(^_ __ _ _______ _!!_'(_\.\\\\ \ \\ \!!\V.VVV V VVVVVV V!!V~6EPE~~P~~ ~ ~~~~~~~~~~ ~!!~'(~4P~P~ ~~~~~~~P~#%~PF_PcPPPPPP P P PPPPP00PP~0 P((1((P060000\ 0\0\\\ \((\ 6   Vv    V   V V  V V  !! '( ((v060000 00V1  00QQ V/RRR~R~VvV^^__@~R~~IVVC^C_RC~PxVV 00P/VU'\T'U'\T'Q'~U\TQ~1P%1   00|SSS|~~~|___(P190P~1 s$ $ &Q s$ $ & n_s_3V3n~sVP,\.1    00@^@_1V1@p4P4]\q0,PU,VT,U,VT,Q,~ U V T  Q ~  1 PyPyp yPOSSS''S((SJS<Y''Y''~((~(~]TT]]J]1V1>8| $ & gfff#&|O&8| $ & gfff#&|O& $0.(VV''V((VSV9\\\''\((\J\~#} ] } PPUP&S SQ QQ QQ QSSS SSSSSSSSYY~~~ PP  pp0\ | L\\0\|\ 0 \P P ~ P P ~ P010 00~~0P~~~PPP~P~ P~~~~~P~~~P\P\P~~~~~~~P|]|P]]00P\P00 ] ] \ ]]]PUP00\\0 ] _]__]__]_]__]_PP]_]__VV0VV00 VVPUP00VVVP0V0VV00V0 VVVVVP_VV VP SP0\|\\0\\\000\0 P ] PPP\v  \v \\PP Pn00 0PRVV V U U P UP\ Q Q Q Q Q Q Q QyyUV}UUVu`ZSZ^T_rSSTSTSTSTS u  #\#&P&f\fkP\P\P\P\P\P\P\P\P$T'1TS]S*U*uu5?s ?CPCHu*U Pu5?s ?CPCHu*U Pu5?s ?CPCHu*U Pu5?s ?CPCHu*U Pu5?s ?CPCHu+P.8PUUU1PPQVTUUU1PPQVTUUU1PPQVTUUU1PPQVTUUU1PPQVTU-]-4U4]T+\+3U34T4\QQ~v` ScS~V3VQ3H/V/^Q/HV^QH1/P ] v`UUU\U\UU\UTUSTSU0VV0 __^_`_`__^^P^^5_5: :\_\l 21    0#]P}*1    00 ~  P*tt"PR^R8VVPPVpwP P {]]]000 P >]]  |% $ &U  |% $ &U 3  1 PPQ/___ 1PPQU3S39U9^ST4V49T9QTQ^V    00HUHTHp` qPp`$qX)-p`-2PU&Q1?Q 0)U)HU)T)HTeUeU(eTeTTTT(eQeQ(eReR(eXe\XX\(\eYeY(!P*7PP P P(VV(V^^(^]Ps`"%p`%)s`Q X+YXY 0 +S++qp+.P.SSS0S91    00#P#__P_"S""qp"%P%SSSS01     00Qg(Tg(Pg(Xg\\\\(\P]]P]  RPP<<_<PQ0P$QUSYNUN_UU_UU_U_U_U_U_NTNTT\TT\TT\TTTTT\TT\NQNSQSQQSQSQSQSQQSNRNiYiRRRRRRRRRYRRRR{\\\\\CPPP@PD~#v#-V~#v#-~#v#-V~#v#-V~#v#-~#v#-~#v#-~#v#-N0ND00DD00D\ @p!D0D001000YZYYYPPPPN0N]0P]0]0]0]0P]VVVVVV(1    00*1    00+1    00(1    00(1    00(1    000_%S\]]] ] ]SUS^U^vUvXUXUXUXSTSYVY^T^jTjVTVTVTV5Q5XSX^Q^vQvSSRS^R^vRvdRdRdRd t^ct PsPVUVUPUP@P@P@UPVTV\pTT\pTT\T\T\TQ_Q_VRV^RR^R^R^R^RVXVVpXVpXVVYV]YY]Y]Y]Y]Y%P%@@ZsPs@$1  7C  07C0$1    00$1    00P \\ VV4P4O@iP@Ps0z00PP#V T #S#V T #S#\ V T S \ 1 #P%\ Q %S%\%V Q %S \ V Q S 1 %PUqVqxUxV VPOS[cSggS SP?FPKKP PPOS[cSggS S @ @ @ 1;0GO0SS0 0P?FPKKP P\ .VFFV V.SFFS SPFFP PQ??Q Q Q??Q Q \??\ \^U^^UU^UU^hTh\TT\TT\UQUQQQQQlRl_RR_RR_s`*s`KP]s`S]PP%U-6VJVVUV%06600^0009P9E]]PP @ @ ^666 @ 1USV61    00U9UT4V49TQ3S39QPPUUTT~cUcU\T\}r}TcUcU\T\}r}T&U&ZUPTPwTU?U5Q5?Q0 uU $ uU#$5uU;U;<U3U(U()UPP ur uu(PP ur$ uu T u)U)8U8BUB\U\)T)TPz]]P]}0}P0PTP00USvSVVVPz]]P]Y>@Y#U#qUqqUU;\#T#hVhqTqqTT;V#Q#&S&asaf qr"rfj qrrjqPqqQQ;SsSNQ=U=VSV[U[lSlsUUTU[T[aTalTlsTupUupUUU-U-S|YUSRVVPPU&V&*U*+UT%S%*T*+T t  t #p!U!5\5>U>\UU\UT0S0>T>STSTPQXP !G Gp]w PV!P!^V^iPVPU\  T 2TQ-P-2QR(u!U!UPTP]T]PQP\\PRPR__)P)SSPp&s&s&V"|?|#,("|?|#,(\\?? U ^]V U ^ V 0 @ U ^ V 0$U$U`UKTKVTV`VKQK\\\`\KRK]R]`]__`_PSPSPSPSPSPSPSPSPSPSPS`S|p&|s&p&s&p&s&p&s&p&s&p&s&p&s&p&s&p&s&p&s&s&`s&PpPikPxzPPPP!^^!@@PPPPP^^@@@@ PP%^^%@@%^^%@@%@@PP%^^%@@%^^%@@%@@PP%^66^^%@66@@%^66^^%@66@@%@66@@P&&PPSPPPP/U/SU @ A    8UkSkqUqrSrxUTlVlqTqsVsxTUSUUSUSU'T'TfVfh| ovVvv,])V)C PUS|xtxUSU0\-V-L PUSUUSU-U-\U\YTY]T]YQY^Q^YRY'P+CP&P&SVV&P&SU.\.3U3T\T(V(3T3?V?TTPP.SV0 NPp0 PRPr    KF   L   ( (   8   - - - - - ' 6 I j {   hZ Z (u gl Z l  4   @Q _r     ) , R W q R  R R  f \ Pz R  q f 4 J f h  f        f 0 @  R  j   f  f  f 8 O f q  S  S   S   S, :SH] jSwSSP0RasP">7nP77P7?\7P7777-_PzPP+YPrPww`#<`h``.lu`*q<`G`Qq\`k`xq4b| 6N^n+@Sh  /Bh!7QkJJ.SvNq?AAAxAA * F AU A` m A~ A A a  a  a!(!aA!V!ik!!P!P!m"m+"<"]"|"+"+"+"+"+"+"+"+##=#[#y########$$1$?$R$_$q$$$$$%hH%g%%%h%h%% &=& X&& &&T&^&^&^'^'^)'^:'^K'^['j'{''''''(K(Pb((P(((#)2)A)T)j)P)O***+$+@+PW+{+P++P+,P0,L,P[,m,,P-,P-,P-,,---P---;-+-+ .,[.+.+.,.+..,..+.,.v,/,7/v,Y/v,h/-{/-/*/*0%*=0?*V01*g0*0*0*0*0*0*1*&1*81*P1+`1$+t1*1*1*1*1*1*1*1*1*2^*29+"2C+?29+a29+r2%2%3&+3&3%30%4D%*4e%4e%4w%B5&T5%_5i5&t55%5&5%5%5%5?&5&5[' 6(6)(76(Y6(h6](z6(6(6)6p)6)6"(7I7"77"77"88#780#q8"88"88K#8"9@9K#9@*9"79K#G9 #Y90#k9#}9#9#9$94$9[$9$9$:$':$>:`c:c:`2;cU;L;2C<u^<<c<<c=A=uW=w=c==c==>>+>=>U>u>c>>>0!>>>0!>>>0!?^?-"?x,?^7?xF?-S?^g?|?u??c?.@cK@@c@@c@V!AV!AV!-A!=A!SA_AV!kAu~AAV!AuAAV!AuAAV!AuBBV!+BuAB dBcuB B BcB BcB Cc1C TCckC CcC:"C:"C:"Cd"Ci"D Dc2D TDckD DcD DcD DcE'ECERExEEEE QE:EEE<Eg FgFg.F@FRF cF F F F!F!FG7-GPYGhGsGGGGGGGPG HP4H KHPpH HoHPH HIp*IpoI7I1I7IJ1lJ7J1J7BK1eKD8K1K{8K7KK{8KL7L{8"L8>L8L8L8L8L8L8M8$M8>M8ZM8xM8Mv9M)8M)8N)8N4?NYN4~NN4NO4OO4OP46PcP4PP(50Q4oQQ5Q4Q Q5Q Q4Q5Q<7QR4R4.R49R SDR_5\R_5kR_5R_5R_5R_5R_5R(5\S6pSh5Sh5Sh5S26S26S26S26S26T26T265T26TTN6TN6TN6U 1U 1U 1WV 1V 1W 1?W1bW1W1W1W1WXW1XXX1X10XV1dXV1~XV1X3Xw Y3DYwcY3YwY%4Y3YY%4YY3Z%4Z36Z4rZ02ZGZ02 [G([02p[G[2[2[2\02\\2&\5\02B\2T\`2p\l2\03\03\03\03\03 ]03] a+]`/k]]`/]]`/^^d08^0J^/U^_^0j^y^/^0^0^0^0^-_6_-[_l_>/_._,._p_._p_,._._._Z._8`.`8!`Z..`.^`<|`o`<`oaV=bb>cc>*co;c>GcXc<dcSuc<cSc<cSc=cSc#=cc#=dd#=%d8d#=FdYd/=edtd#=d#=d=dd=dd=dd=ee=#e4e=Je=ce=e/e=e/e#fY`fkfxfff^ffg,gHgdgxgFgg)ggFgOh+h]Hhqhah0Th h0Ti 2iST[i ji\TuiiTiiTiiTiiLUiUi jGVjjGjkGkkGllG mmGm.nVGDnVnnnnnGGnCoLpG7pjpGppGpGpGpGqGqG9qGiqqGqGqLqq$LrHsr.rHs.sOsHssOssHsOtoOtH%t/toO:tItHVtoOjt4It4It{kLi{{M{L| |Q2|L=|HG|QR|Ha|Ln|Q~|UQ|UQ|M|N|N|Q|2R}:?}:};}a;+~;~:~:~: B& BB Bi::: F8F':Od~ FBFĀ FπހkFpED[EpǁEpEE)E4E Ec EnDcD؂cDD*@DN@Dcv@D\D҃0C0C30CcCsCBBB69Q9n9?ʆ?܇?̈@?l@P@6@ @YFtF\ɍ\4\\\n]8<^J,]U_<^jy,]<^]]]Ï]֏1]1]1]n]']C^U]`j^u]^]]ېgPg:zg+hlY=hI^hhRsflsjflsjflіkkkkxjxj,xjCj`FujFkjF+akAFUakaFrakFakFikFјh@l|h`@l`(|h5@lEhThkh|Ljli(lę(әilii$i6iPinj}=j=j=jϚ=j=j=j $iokhkƛhӛkh2`ihӜhh4Lh^hpiiillOl/OPm qnqCq6mY6m$Y7GmJY]6muj6mj6mjӡ6m4>m@jQnjoonĢn.In£nnFnznFΧpn?njn7n˩n$n۫ppp%p9oQobozoooooԬopQop$3Qo@p\nno oo.o@oQoonoȮoخop4p 43pG4`pn4pį4կ q/q9q`q`q `q1`qH~qW~qhMqqqrڰrrGr fr$fr5frFrWrxrrrrѱrrrr#r4rD sS sb sq s s s s sԲ s?s8s8s#|s4rOieitikkkɳ(h0_0_~0_!^_^_b_=i_i_;brbbbaøaٸaaa [`3Y`K[`bbt`@b@`bz`Ϲz` a a a!Aa0?a?AaVoaematoa___Ӻc:cܻc׼cPcѽccdd6dܿd8dcdee~e7eYddk_e|fdx|fxd|fd&d5d@ QSe_eeee)eEeie)Xf;eLe[eq Y Y  Y Y YHYGUY8ZZZEZYRUYYZUY Z"1UY>ZN|[`Ym}YYY ZZ+Z6 AZ_ZyZZZZBZTZcZrZVVVVV4V4V-LVJ4Vd4VsLV@\@\@\ @\0P\NpVrPpVPVPVP"V4V?X IVTX cVpVKWV KW VKWWW$W9WhWWW X WXWW W!`XF]XuXoXoX X0^Pc^v^_Ѐ~~A~h~uuu/uu<@h@PP  PRR+PsPeo o "- <oI[sP}P}e}<o}]}oo}z8 }8 o}}}}~?~}%~/~p~~/~p ~p /~~/J~GJ~i | | |P |E|L|S||&S|3 C RS|l|{|zz5z}zzzJzo{{{  {:{:{ Fw#%@<mP<<  < 0D0u0000!U>lkllP P l pu?u\uuu u uuuvWx? ? ?| Es'py{6pym{py{-zpy {7y` zzypy y pyyQz)y>{Qyj{y{y{zrz pvnpvpv.w%wvwSvepvp0 zv0 pvv w%w w w w2 wB wVwvxvxGy`vvvpt0ptfttt %(282Iphp|pIY#BFYjw/"  !, ;H\}+Pqíѭ 2AWfwB/ :h DOh ^ k{ZZbg``5fT-4vg,̪Lg404[4k4I__$Zpip}0LjyG7Sq==@ 4d Lbd d d 4d $d 7Md j(d (d E*j }dd 7  *5 ?J YfvH H ¤  ¤"23DߥO Y3d sߥ3,,E)dAu] ru u  O'w9HYjzVV̧ ,U{ǨǨǨǨ Ǩ$֨Ne(,5<UReb0 b 0b[!r0r?N]pááxx  1 @ [     - h      ;   8  / Y   Þ0  [       8[ s ˠ8h 8h(&I5(GI[pq   A n $ G U .Fl ̗^(̗( ^̗-*N*s*//` `! 8`T i` ` -Ke}88UΘΘ$<TM| 2 S  #s  s ך̙  C֙ 63 U * O 7 [i vVu vV vV vV vV vV vV vV vV  vV)<  U   >! 4!w! !6?" R"r"1"1"1" ""##*#;#K#b#›##›#x#x$x5$xY$ q$ $ $ $/$"$"$"%"%"%%ۚC%ۚg%%5%%5%6&5K&`&5|&&5&&5 ''5<'֋s'5''5'S(5h(M(΋(5(Z((`)Z )`)()Z@)c)5z))5))5)*5>*a*5r*Ǎ*Ǎ*Ǎ*Ǎ*Ǎ*֍ + +p 5+K+p h++p ++p +,p ,L,p _,,,,,,!-9-^-r-----S.s...F//W//g00*0006 011/1A1HL1V1a1p1H}11g1g1g121a 2222.2a;22M2g2*2*2*2/2/2223&3;3P3g33333@3@3[4G4~444%4 55*,5;5J5*g555555͑ 60a6|6066067x(7970W7[o7[7[7[7`7<88888,9A9(Y9j99 9 9 9 9:Bm:::;6;[;x;1;;;<4<R<1<<<<<<=)=X=g=v==l=x=x=x=x>3>L>l>e>>e>>e>?C?c??ӎ??ӎ @@,@<@N@^@p@ێ@@ێ@ێ@ێ@ێA.ABAp[AЇ|AAAAAɉAB2BABQBcBsBBBBBBɉBCC(CΉ;CNCΉaCtCΉCCՉCCՉCCՉCD6DDLD'[DDuDpDD0D0 EGEO@E@E@E@E@DFFFpKGjGGpG@G@H@OHleH@HHZHLIZcIIZIIZIIJ=JZLJ>^JiJ@sJ>~J@JJ>JJJJJ KK (Kalv>>9ɂ99 ڷڷ(=kȸɃ4h҄2IX@/p@Vhs}Ɔ؆r,CMgC&+‡&߇+Ch hh.Csc|tsLňL߈LLFF$6kAKVekr{H`H0FUiϊ)```2`APcEPZet#+#C#[#r33HH΍ +VwɎH^n;Vr?/Evcȑnّ+k"?5kDUo- h!h0-=M_kj0t0kUɓdړ #'1#<KX#hw0” a  ڕE7EZi`Ėז *;Rap`̗``4J[k{Θiݘv=$.=9HU=x˚Ex՛K_{{>М 50<Kf%0?LjHn    Ơ0ՠ0Yz 4ӡs7s7!s3K!a*s/>ZŢߢ <<-U  ԣ   5 j   V p ϥ  -?JT_n{HH̦٦*jDj^jvjѧ +'+9"H5Y_s___OɨOݨVxqx =yĪ,Tx̫׫((}2?DNSNbqt$ͬxR/xH^v/uuuṷۭ/R ^,p7AL[phzmJ֮YY |(7%K\i{!)ٯY[,0,GWbo,,,,ƱA1A1H-?+J`T_`n+{B[BBB0BABSo:س#:9xܶ÷9q!˹)a׺M UWq@Ⱦ(( (BmEEE˿kݿk k/MSepXzX   $(8Gas~@xx@xx @/:@DO@^k{ ';/Vl/HhH*9/K/[/m/}///Qh%X4XHqTeqqqxxx"^<^V^r^M +<TjfuS\XaX#a=WqW  -<7T"QcYp8~8Y``+M`y``'>`Z{pp 0ar##Zu#2ARiI!0GGG.Yk%FbAr#DVp *#C|NPXcPr|77$C3MBMQMbMy``/Pf v=`q`w`@W~t@R .CRRidqzR.@If@y@O(#>SAbA```<]www{{+{8Jc@@?uQ5&"5&"5&rr %r 8~g~rrrrrrr r !2BQ`o~QQ+@QQ9J`! (.HQpVQQQQQ~ 0~ 0/<~f~bxG'2h<GhVcu & n  " ; P t        4 N f      )!,;!Y(|((.)((8(K\*f\***\*@*@\**^* ^*^*3r*I^*Yr*j********4*K\k  -D1Wy"1~1Igx&[Q!s!!!!!)!!"R"3,&S"$$$$$c$-," "$D/$k%,&&&;&S'f,-,,,,,,- -6-E.T#.c;.rJ.b.q.."&" +& - Q it & & P     1 3< V e z   (  S  S S +S Bd Qd `v ov ~        ? ? ? /? FP UP db sb         + + "+ 3+ J< Y< hN wN c 'c6G^m~W?CRv2?T T $T8*Wyqq |G d |x | | | |    , ; J Y h y        ) 8 E U 0d 0s 0~  Q F 0 0  2 X {    ) O j      3H^qg#i{5GRH\gHv3c~0?N_nIII @@p@@8p@-@r @e 2}=GRa}n~``((*:bLWWabl{Wb:::&5D9S>bqb1DIT  z K   !!1!{C!P!`!o!!!Q!x!x!Q!Z!Z "Z,"k\"Z"k""""""##,#C#T#j#y####### $/$- L$a$I y$$- $$ $ $ $ % % "% 8%A S%i%I %%A %A %N %%N %&N &'&U :&M&U `&s&U && & I' ' ' @( u( ( ( ( ( ) ") 3) I) k) |) ): ): ): ) )c ) ) ) )c * *6*X*v*****05*05+046+04Z+++3+3+3,41,3=,L^,3j,L,L,L,2*-2L-2-2-2-2 .27.3U.2p.`.2.`.2/`//32`/A/A/A/A/PA0@?N0p?n0u?06060606 16[161+71616 2d762d7A20EP2 6m2 62062527272737537T38}383!8 48%48B4!8X4!8g4!8x4!84!84!84!84!84!84!84P:5)5P:N5e5P:55P:55:5'6:67:77y;18L;=8N8L;[8s8f;88L;88L;88L;89\;99C<+9<9C<I9[9C<g9x9C<99C<99S<99<99<9:<:,:<9:K:<X:j:<v::<::<::<::<;';<<;P;<c;r;5;H;>;0;`;;; <<5<h<< <<===L=[=l=}===4=7=7 >7>F1>V>}>=>=>=?=?>6?=O?=j?=?=?=?4=?O=X !!Y\sx 05< $   6I0  F< 8gz /   '.  !1LZ_   ^^     /5c 3    &K %%)0#8"330_&`0-6lw + 7N$   =HV #*) + #*) `ppp     IS   NQY ,_III -4$+E 3\ 334/0]]][~[[0ByINXe4Y44  0!0bbb  ?0" ;L>% \ $$E (-Y]aeg2h6 6  @F &]b%  |      |                 0  0 8o 0:s:: *0+^++0$(--#F#7#'36^;^;;`!&WZ\ 257""$)}    < - k O  $  Q   6Ik  6Ik"  69$%$%$ (/"3 > LT"  /9Kl F :  "  ""';*7m77CnCC  ]]] :DO}OOmmmmmm0\002qGG2qGG.W..'S =  , ''d=   .    0 GMGMBH -08=0 GMGMBH -08=0ggg>0#+   cc  n7"l+*0$mmm 4F4'*.2=  !`nnn>  0.1=  &RYYf  ?    0  0 >> 0  &+  #8 5:=LT =E`  #&+^l pz N`   -4  !$0 6#+  3 3  ##)) # ! _ll  03>"-)H]w!PYR0j!N//0```/R//  %x00X~XX"S""0CiCC"S""?/0?0? 0? (       # [%'.1 ep{ "&1;E    0  TT >^ 0  vv !A 00 ?0 /  16; 8#Ru8 0 P0'3F06 $ ',0bbb0  &o0  -JVZ0iR[5Y55  QTT 0^   1_    0"   0 e  #  3>k:g::DsSSkrv )04     0  4L8     #(=  !&!& xaa   $     AC}<<:g =G00U]=b    %h!)k~fnff 3==[== SSXd$ $#*.    ::  9SZ^ *0BvTV44 _+  ,  l < ^f !%*/4=Ok 58< #)EHL  #)EHL  #)EHL  #)EHL    .    <`<< 1* 4,7gCC \\\iii(g(""".2!+3:<16?" 0U 00 ^JtJJ5>\` )-= -S ' '3 o      ****+S  49    !!'(EH !!%)-9@C.3:a"I"'  |nssss&(158@ J D !O''JJS   ||     Voq;!,,,Ihu3)_HP  *   `!'  !04GL<<)!> #a-8aGRl`wee|4!FVa l^|hY"h20 =PI        Z %0 BM Wb w6 Z   S`'7AQuPwP nP= P$7HPSgPr^`c--,/uu*;uFV!Vc!fx c c c:"G"!."9D"U"e*#u#%%%?&C'((d))!-*11*G1*W*k*|***++Y-Y-@   -$ / ,.@ ,.P Z.` Z.p `/{  / / A1 A1 1 1 M1 02! G, 92A 92V 3i 3t w 3 3 4  4 4 4 F5 F5 F50 h5B 26R ;6b <7l | 7 1 7 7 8 8 8 )8 8 8) -4 L :\ <g os <} S < S #=  =  = = / d>! 1 >; K >U oe >o  @ %B D c D )E IE pE  yEE )F0?F@kFPG[gHzHH.HHHH(-I=VIMI_IqJJJJJJJJJJ%@K7@KIEK[EKmJKJKOKOKKKLkLL$L6MH0TS ^TnT~9oVGVpVPV!V1VBPMV_WrWW`XUYUYYYYYY8YXYxZ],],]]]]^^-_@_SQ`k`}````7aeaaa^b%b5dRdddvdFeeeeeg(h!|h6|hH|hZh{iiii=jhh"h4Bics6m}Y6mj6mjnnnn/:nP[pkp{oQoQosop4*q/q`q r!r4rDrTig`jFsjsjjFVkFVk Fk(V3PKu[ukyv~yvmxpy{yyyyy{y{ rz{/{AS|SS|eo}uo}/~/~ooPPR<<l'l7GWtb{yDV'=M]ΉgrΉ|Չ05[[`)4J Z m}B55Ǎ֍(68Kێ[ێk{eG**a a( 2 = O _ r H H g [   p 4 4 P!! (!*=!^N!^^!`t! !!!!!D!j!ߘ! "M"[N" Y"ߙ" "ߙ" "ߙ"] #j#/#?#O#ia# q#/#ۚ## # # #S##9$p$ $[.$>$Q$0c$0u$$$$d $ڣ$$$$E%u% (%¤:%¤L%^%p%%%ߥ%ߥ%V%n%%֧%Ǩ&֨&4*&4:&SJ&pZ&l&|&&&&&&& &1'!'+4'D'T'd' {' '`'m'''' '9' 'U ( (U%(0(( <(N(`(9r(( (((((()V )`) #)i8)iM)_)q)))Y)Y)) ) )&)&) **,/*,?*O*_*j* u*G* *G* *N* ***% *<+<#+5+J+Z+l+~+B++ ++!+ +1, ,S/,Z?,{Q, \,{f, q,, ,,0,*,9,9,,--*!-]+-*6-A-ZL-\-n--- --Z--Z---1-1 .h.&.1.C.1j.u. .......`../'/7/@B/RM/E]/Um/}/@//J//////0`00-0=0`H0S0ge0u0g0040|0|00+0+11,#1`31C1N1HY1i1|1@1`1H11H11122"222B2T2f2q2x|222c2q222x23R"3p43pF3V3Jh3Yz3|3S3!3w3{3{3Y3Y4 44/,474qF4Q4q[4f4xp4{434^4444444E5U5"5(45(F5V5h5z555:5D5X5a56 6264L6x^6xp6666666667 707B7%X7 c7 o7)7)77777j7 78 8 828D8_V8h8x887888!88889*9:9Y9i9y99995909i99 ::*:::J:Z:j:u:::::@:g:|::;k#;-5;-G;[W;i;{;;;;;=;;@;<T<T,<<<L<]<h<z<< <<L<k<k<<<=c#=3=T= d=& t=: =o = = = = = = =  > >* ->[ =>q M> ]> p> > > > > > >G >] > ? ?? /?2 ??9 O?N Y?d?N n?y?U ?? ?: ?c ?c ?Q?Q? @@,@>@P@c@s@@@@@@@W@WA}A}%A6AFAWAgAyAAAAAAAABB0BBBUBIeB9uBVBBB B+B2BqB|C C %C*5C~HC[CkC@vCCKCKCCCCCCDA?DJDAZDHjDDDDDEyE 5En TE gE }E E E E!E!E(E\* F\*F\*+F^*AF*WF*jF*}FFFF&F!G G"7G$GG/$G$G&G&G&G,G, H"H"0H;HSH2]H`hH3~H3HLHLH2H`H47Hd7H 8H8 I8I85I8HIP:SI^IL;yIIL;IIL;IIC<IIC<IIC<II<J J<J&J<0J;J<JJUJC=eJ={J(J(JJJJ>J0J0JAK5K    "$&(*,./023578:<=>@4.%5`A 88Z k 0  8P 0  ,  `, , ,% 0 ( ; @,D pO  [ ,es ( FP` @     0 H \ p 00 p9PX P8 8&c$= 8V`m x 8 8 p8    @, , , 0e0s8 `0 H)@7 !=C-}U H8n 80 `/ 80D 0= 1 08  8"G08 D h8]w00 w 8m p 81>  ,   , @, ,; , `, ,sHPX`hpx -59D9'Q:u):g:r<7.` . o?   ` @ -  8 M _ q  ` @ B BV..c6 6 $.-<.E.N.W.` 8y 8 x8 @8 8 8 8  `8(  (8A  8Z  8s  8  8 Q     0     P  ! *  7  @,B  ,M  Z  ,e  ,p  `,{  ,  ,  ,  `,  ,    ,  ,  P  ` ,  ,  ,  ,  ` ,  ,  ,!  @ ,+  ,5  A  ,K  ,U  ` ,_  ,i  ,s  ,}  ` ,  ,    $( L V (     / < I V c p }     & (  " es0 > L ) (0Z 8h @v H P  @0 h X `   0   VJ$pV%5 0 8N 8gP08 }W h 8`X0D P Y  8 8@\D\% 8> X8W^t`0 0_Q 8c) P8g  88 8' 8@ p8Y 8r 8k  0 @ P ` , ,; ,O ` p ,hpxZ   > b0@P`p(Fe; j ` 8   8 8{ 8 8  8 H 8 81 8Jp~g 8@ ( 8 8 0 @  P ` pm % 0   D O  ***6*\* *(*0*8*@2*H]*P*X*`*h*pD*xq*** Ї ~0.d 9=N Zx 00 00 d 88/50K We7o { 8 p8 8  p 4  P 82 `I U ` o 8 8 8 8 X 8 8d  Pm  p x 84.d < @ 8   @, , ,U ,D p ,[ ,8 0^ `,h ,r ~ , , , , `, , , `,  ,  *8FTbp~K@ H8 0  (84 8M( .N ! ^{V 0D  8 8 h8 8 00 p  8% 8> P8W 8p 0  ?K  8%    08*0m  84Z0 PN\ 8u08 P !0 0 ,  , , @,; , , ,^ `,I  h , , `, , , , `, , , , ` , , ,Z   ( 08 @( H6 PX*`8hD pFxR bp~` e t  8 0 P$ ` 8  #  @ R0  " @P !0!! p' -!A!6 #Z!`i! H8"`!0! &!`!0% !!! (8!" 88" /" p8H"W"H0k" $w"" 8" 8"U" 8" 8"x0o P&# 8N,# 8E# 08^# 8w# 8# 8# h8# P8# 8# 8 $ 8&$ 8?$ 8X$cr$ %~$ $ 8$ X8$ 8$ $ p($ 8 % 8%%0K P# 7% x8P%.d Y%.d b% @8{% 8%% 8%O " % 8% `8& `8!&0 ! !  0!  `!, !  !,U ",; @",5& ",>& ",I " h #,r `#~ #, #,H& $ $, `$, $, $, %, `%,T& %, % &,^& h&j& x& v& &,& && ',& @',& ',& ',& (,& @(,& (( *D &Tp&&& '' ('(6'0D'8R'@`'Hn'P}'X'`'h'p''' Z x ' 9' 8( ( P8%( 8>( 8W( 88p( 8( p8( 8( 8( 8( X8) 8)(2) * >) 8W) x8p) 8) 8) @8) 8) 8) 8*S (* (,  ), @), p) m )% )U ), ) D * O *  * 8*8 H*  X** *,K * *, +  0+)*x 7* E =*D*`;0 p,[*L) `+* +, +  +, + ,, @,,    t*|*5(* 62*p6*6+*6*7+P:+`$+=T8+ @ O+.h [+0q+ @z+ ? ,* ,, , -, `-, -, -,U .,; `.,5& .,O . [ ., /,>& `/,^ /,* /,h 0,K P0  `0,~ 0, 0, 1, `1, 1, 1, 2, `2,k" 2 2, 3, @3, 3,T& 3,+ 4,+ @4, 4,+ 4,+ 5,+ @5,+ p5+ 5,+ 5,& 6,& `6,+ 6,& 6,& 7,& `7,& 7,+ 7,+ 8,+ `8,, 8,, 8,, 9,&, `9,0, 9<, 9,F, :,P, @:,Z, :,d, :,n, ;,x, @;,, ;,, ;,  <,, @<,}  <,, <,, =,, 0=, @=,, =,s  =,i  >,_  @>,U  >,K  >,A  ?,, @?,,,,--$-2-@-N-('6'\- j-(D'0R'8`'@x-H-P-X-`-h-pn'x}''''---- ..*.9.H.W.f.u...... .(.0.8.@ /H/P)/X8/`G/hV/pe/xt////////// 00(070F0U0d0s0??P?@?`??h@-@P/@1A9+A9>A:ZA:lA:}A<A?AAABBVB`VCW#CPX7CYKC0\aC\wC^C _CcCg4E`EFF?F VFЊlFH+HбBH0HpHiIIIPII0I0J!JP6JPJJ_JzJJJJPJJKKKK L L AL VL M5M6M`6N6-N6KN7`N@:tN=OOP55 1533E5T5m5@J~55545C<5E5556?6@7$6=604F6N6x[6h6w666F6@?6pu66677P}7'73<7 E6K7PA`7n77*u7707727707+7u~9*pt|788#8B58D8L8`8r8]{8 848z:8878V |8889Z9%929B9U9pyOe9 tIPw9 99pE999999:^:@:$:=:G:Z:&q:{::>>:=!::2q:::::;As;.;`A;N;KЀq;w;;;;;H;;%;;<<.<=<K<0T^<rpvi<C~<<P-e<<<<<@==~H)=:=C=nV="Bh=0Ht={=1=Dh==G ==@==>>.>6> N>]>g>F|>>>>> Fy>>`>0C>0M0p#0.)?F?@d? 00 04<?P?" @$$@)=@+R@@-00{1@ 2@3@4@71%191F1V1q10@10511ABA CB0D!BD6BEKB`EbBFvBFBFBFB T111P11R22$2`+62P2^2CtC`tDtD`u6D`vLD`yeDzyD|D@}D~D~D@D0DEj2WEmE EPEEEІs2 22222FF`FF`FG "Gp:GRGiGGЖGGGGHЬ2#2`2&[HoH2@HHPH3 `I0!I4I NI30 }I@s.3@39N3]3l3z3733333Jp333@DE4u[%K:KQKpdKp|KPKKK0=4+474I43?[4hL|LL0LLL LL M0M22M2IM3aM3{M 4M4M 5j4p(4444402X44Np=N>N?N0?N@AOpAO-OCOZOrOOOOP4N`O5Pvtbl.cvtbl_checkempty_vtbl_recordvtbl_check.coldcreate_vtbl__UNIQUE_ID_ddebug517.20create_vtbl.coldubi_change_vtbl_record.cold__func__.12__already_done.21__UNIQUE_ID_ddebug519.19__already_done.17ubi_read_volume_table.cold__func__.1__func__.4_entry.0_entry.2_entry.3_entry.5__func__.6__func__.7_entry.8__func__.9__func__.10_entry.11_entry_ptr.13_entry_ptr.14_entry_ptr.16_entry_ptr.24_entry_ptr.25_entry_ptr.26.LC12vmt.cvol_attribute_showattr_vol_reserved_ebsattr_vol_typeattr_vol_nameattr_vol_corruptedattr_vol_alignmentattr_vol_usable_eb_sizeattr_vol_data_bytesattr_vol_upd_markervol_attribute_show.coldvol_releaseself_check_volumeself_check_volume.coldfind_volume_fwnodevolume_dev_groups__UNIQUE_ID_ddebug519.18__UNIQUE_ID_ddebug517.19__already_done.16ubi_create_volume.cold__UNIQUE_ID_ddebug521.15ubi_remove_volume.cold__func__.5__UNIQUE_ID_ddebug523.12__already_done.11__UNIQUE_ID_ddebug525.10__UNIQUE_ID_ddebug527.9__func__.0__func__.2_entry.4_entry.6__func__.8volume_dev_groupvolume_dev_attrs_entry_ptr.20.LC38upd.cset_update_marker__UNIQUE_ID_ddebug517.28__UNIQUE_ID_ddebug519.26set_update_marker.cold__func__.11clear_update_marker__UNIQUE_ID_ddebug521.25clear_update_marker.cold__UNIQUE_ID_ddebug527.19__UNIQUE_ID_ddebug523.23ubi_start_update.cold__func__.13__UNIQUE_ID_ddebug525.20ubi_start_leb_change.cold__UNIQUE_ID_ddebug529.18ubi_more_update_data.cold__UNIQUE_ID_ddebug531.15ubi_more_leb_change_data.cold_entry.10_entry.12_entry_ptr.17_entry_ptr.21_entry_ptr.22_entry_ptr.27build.cubi_notify_addversion_showubi_free_volumes_fromautoresizeopen_mtd_by_chdevubi_mtd_param_parsemtd_devsmtd_dev_paramubi_mtd_param_parse.colddev_attribute_showdev_eraseblock_sizedev_avail_eraseblocksdev_total_eraseblocksdev_volumes_countdev_max_ecdev_reserved_for_baddev_bad_peb_countdev_max_vol_countdev_min_io_sizedev_bgt_enableddev_mtd_numdev_ro_modeubi_notify_removeuif_closeubi_devicesubi_devices_lockubi_get_device.cold__func__.65ubi_get_by_major.cold__func__.67__key.69ubi_dev_groups__key.70__key.71__key.72__key.73__UNIQUE_ID_ddebug522.37__UNIQUE_ID_ddebug524.36__UNIQUE_ID_ddebug526.32__UNIQUE_ID_ddebug528.31__UNIQUE_ID_ddebug530.30__UNIQUE_ID_ddebug532.29__UNIQUE_ID_ddebug534.28__UNIQUE_ID_ddebug536.27__UNIQUE_ID_ddebug538.26__UNIQUE_ID_ddebug540.25__UNIQUE_ID_ddebug542.24__UNIQUE_ID_ddebug544.23__UNIQUE_ID_ddebug520.38ubi_attach_mtd_dev.cold__func__.85__func__.81ubi_detach_mtd_dev.cold__func__.87ubi_initubi_ctrl_cdevubi_mtd_notifierubi_exit__func__.108_entry.107_entry.106__func__.105_entry.104_entry.103_entry.102_entry.101_entry.100_entry.99_entry.98_entry.97__func__.96_entry.95_entry.94__func__.93_entry.92_entry.91_entry.90_entry.89_entry.88_entry.86_entry.84_entry.83_entry.82__func__.80_entry.79_entry.78_entry.77_entry.76_entry.75_entry.74_entry.68_entry.66__UNIQUE_ID_license554__UNIQUE_ID_author553__UNIQUE_ID_description552__UNIQUE_ID_version551__UNIQUE_ID_mtd550__param_mtd__param_str_mtd__param_ops_mtd_entry_ptr.0_entry_ptr.1_entry_ptr.2_entry_ptr.3_entry_ptr.4_entry_ptr.5_entry_ptr.6_entry_ptr.7_entry_ptr.8_entry_ptr.9__UNIQUE_ID___addressable_cleanup_module549__UNIQUE_ID___addressable_init_module548_entry_ptr.10_entry_ptr.11_entry_ptr.12_entry_ptr.15_entry_ptr.18_entry_ptr.19_entry_ptr.33_entry_ptr.34_entry_ptr.35_entry_ptr.39ubi_dev_groupubi_dev_attrs_entry_ptr.40_entry_ptr.41ubi_class_groupsubi_class_groupubi_class_attrsclass_attr_versioncdev.cvol_cdev_fsyncvol_cdev_release__UNIQUE_ID_ddebug519.29__UNIQUE_ID_ddebug521.27vol_cdev_release.coldvol_cdev_open__UNIQUE_ID_ddebug517.30get_exclusiveget_exclusive.coldvol_cdev_read__UNIQUE_ID_ddebug523.26__UNIQUE_ID_ddebug525.25vol_cdev_llseekctrl_cdev_ioctl__UNIQUE_ID_ddebug543.15__UNIQUE_ID_ddebug545.14revoke_exclusive.constprop.0revoke_exclusive.constprop.0.coldvol_cdev_ioctl__UNIQUE_ID_ddebug529.23vol_cdev_write__UNIQUE_ID_ddebug527.24ubi_cdev_ioctl__UNIQUE_ID_ddebug537.18__UNIQUE_ID_ddebug541.16__UNIQUE_ID_ddebug539.17__UNIQUE_ID_ddebug535.19__UNIQUE_ID_ddebug531.21__already_done.22__UNIQUE_ID_ddebug533.20ubi_cdev_ioctl.cold__func__.3_entry_ptr.28_entry_ptr.31_entry_ptr.32.LC32kapi.c__export_symbol_ubi_do_get_device_info__export_symbol_ubi_get_device_info__export_symbol_ubi_get_volume_info__export_symbol_ubi_open_volume__export_symbol_ubi_open_volume_nm__export_symbol_ubi_open_volume_path__export_symbol_ubi_close_volume__export_symbol_ubi_leb_read__export_symbol_ubi_leb_read_sg__export_symbol_ubi_leb_write__export_symbol_ubi_leb_change__export_symbol_ubi_leb_erase__export_symbol_ubi_leb_unmap__export_symbol_ubi_leb_map__export_symbol_ubi_is_mapped__export_symbol_ubi_sync__export_symbol_ubi_flush__export_symbol_ubi_register_volume_notifier__export_symbol_ubi_unregister_volume_notifier__UNIQUE_ID_ddebug532.20__UNIQUE_ID_ddebug526.22ubi_open_volume_nm.cold__UNIQUE_ID_ddebug541.17__UNIQUE_ID_ddebug544.16__UNIQUE_ID_ddebug550.14__UNIQUE_ID_ddebug547.15__UNIQUE_ID_ddebug553.13__UNIQUE_ID_ddebug556.12leb_read_sanity_check.isra.0__UNIQUE_ID_ddebug538.18__UNIQUE_ID_ddebug529.21__UNIQUE_ID___addressable_ubi_unregister_volume_notifier562__UNIQUE_ID___addressable_ubi_register_volume_notifier561__UNIQUE_ID___addressable_ubi_flush560__UNIQUE_ID___addressable_ubi_sync559__UNIQUE_ID___addressable_ubi_is_mapped558__UNIQUE_ID___addressable_ubi_leb_map555__UNIQUE_ID___addressable_ubi_leb_unmap552__UNIQUE_ID___addressable_ubi_leb_erase549__UNIQUE_ID___addressable_ubi_leb_change546__UNIQUE_ID___addressable_ubi_leb_write543__UNIQUE_ID___addressable_ubi_leb_read_sg540__UNIQUE_ID___addressable_ubi_leb_read537__UNIQUE_ID___addressable_ubi_close_volume534__UNIQUE_ID___addressable_ubi_open_volume_path531__UNIQUE_ID___addressable_ubi_open_volume_nm528__UNIQUE_ID___addressable_ubi_open_volume525__UNIQUE_ID___addressable_ubi_get_volume_info522__UNIQUE_ID___addressable_ubi_get_device_info521__UNIQUE_ID___addressable_ubi_do_get_device_info520eba.cubi_ro_mode.part.0ltree_add_entry__key.33ltree_add_entry.cold__func__.32ubi_alloc_vid_buf.constprop.0ubi_alloc_vid_buf.constprop.0.coldleb_write_unlockleb_write_unlock.cold__func__.30leb_read_unlockleb_read_unlock.cold__func__.22try_write_vid_and_data__UNIQUE_ID_ddebug523.51try_write_vid_and_data.cold__func__.17ubi_eba_copy_table.cold__func__.36__UNIQUE_ID_ddebug517.60__UNIQUE_ID_ddebug521.57__UNIQUE_ID_ddebug519.59ubi_eba_read_leb.cold__func__.24__func__.28ubi_eba_read_leb_sg.cold__func__.20__UNIQUE_ID_ddebug525.50ubi_eba_write_leb.cold__func__.15ubi_eba_write_leb_st.cold__UNIQUE_ID_ddebug527.47__UNIQUE_ID_ddebug529.45__UNIQUE_ID_ddebug535.42__UNIQUE_ID_ddebug533.43__UNIQUE_ID_ddebug531.44__UNIQUE_ID_ddebug537.41ubi_eba_copy_leb.cold__UNIQUE_ID_ddebug539.38__key.1__UNIQUE_ID_ddebug541.37_entry.7_entry.14_entry.16__func__.18_entry.19_entry.21_entry.23_entry.25_entry.26_entry.27_entry.29_entry.31__func__.34_entry.35_entry_ptr.46_entry_ptr.48_entry_ptr.49_entry_ptr.53_entry_ptr.54_entry_ptr.55_entry_ptr.56_entry_ptr.58_entry_ptr.61_entry_ptr.62_entry_ptr.63_entry_ptr.64_entry_ptr.65_entry_ptr.66_entry_ptr.67io.cvalidate_ec_hdrvalidate_vid_hdrself_check_vid_hdr__UNIQUE_ID_ddebug525.48ubi_io_is_bad.cold__UNIQUE_ID_ddebug517.68__UNIQUE_ID_ddebug519.61ubi_io_read.coldself_check_peb_ec_hdr.part.0ubi_io_mark_bad.cold__UNIQUE_ID_ddebug527.46__UNIQUE_ID_ddebug529.44__UNIQUE_ID_ddebug533.42__UNIQUE_ID_ddebug531.43ubi_io_read_ec_hdr.cold__UNIQUE_ID_ddebug537.39__UNIQUE_ID_ddebug539.37__UNIQUE_ID_ddebug543.35__UNIQUE_ID_ddebug541.36ubi_io_read_vid_hdr.coldnor_erase_preparenor_erase_prepare.cold__UNIQUE_ID_ddebug521.60ubi_io_write.cold__func__.25__UNIQUE_ID_ddebug535.41ubi_io_write_ec_hdr.cold__UNIQUE_ID_ddebug545.34ubi_io_write_vid_hdr.colddo_sync_erase__UNIQUE_ID_ddebug523.54do_sync_erase.coldpatternsubi_io_sync_erase.cold__func__.19_entry.18_entry.20_entry.22_entry.24_entry.28_entry.30_entry_ptr.38_entry_ptr.45_entry_ptr.47_entry_ptr.50_entry_ptr.51_entry_ptr.52_entry_ptr.57_entry_ptr.59wl.cprot_queue_add__UNIQUE_ID_ddebug517.103prot_queue_add.coldwl_tree_addwl_tree_add.colddo_work.constprop.0do_work.constprop.0.cold__func__.14in_wl_tree.isra.0in_wl_tree.isra.0.cold__func__.44__schedule_ubi_work__schedule_ubi_work.coldschedule_erase__UNIQUE_ID_ddebug529.94schedule_erase.cold__func__.40shutdown_workshutdown_work.coldprot_queue_del__UNIQUE_ID_ddebug521.101ensure_wear_leveling__UNIQUE_ID_ddebug557.75wear_leveling_worker__UNIQUE_ID_ddebug555.76get_peb_for_wlget_peb_for_wl.cold__func__.27tree_destroy.isra.0__UNIQUE_ID_ddebug523.100__UNIQUE_ID_ddebug525.99__erase_worker__UNIQUE_ID_ddebug559.74__UNIQUE_ID_ddebug527.98__erase_worker.cold__UNIQUE_ID_ddebug561.73__UNIQUE_ID_ddebug531.93__UNIQUE_ID_ddebug539.87__UNIQUE_ID_ddebug533.90__UNIQUE_ID_ddebug535.89__UNIQUE_ID_ddebug551.80__UNIQUE_ID_ddebug537.88__UNIQUE_ID_ddebug547.82__UNIQUE_ID_ddebug549.81__UNIQUE_ID_ddebug545.84__UNIQUE_ID_ddebug553.79__UNIQUE_ID_ddebug541.86__UNIQUE_ID_ddebug543.85wear_leveling_worker.cold__func__.33erase_aeb__UNIQUE_ID_ddebug563.72__UNIQUE_ID_ddebug565.69__UNIQUE_ID_ddebug567.68ubi_wl_put_peb.cold__func__.49__UNIQUE_ID_ddebug569.65__UNIQUE_ID_ddebug571.64ubi_wl_flush.cold__UNIQUE_ID_ddebug573.62__key.12__key.11__UNIQUE_ID_ddebug575.59__UNIQUE_ID_ddebug579.56ubi_wl_reboot_notifier__UNIQUE_ID_ddebug577.58ubi_wl_init.cold__UNIQUE_ID_ddebug581.54__UNIQUE_ID_ddebug583.52__UNIQUE_ID_ddebug519.102ubi_wl_get_peb.cold_entry.9_entry.13__func__.23_entry.32__func__.37__func__.38_entry.39__func__.41_entry.42_entry.43_entry.45_entry.46_entry.47_entry.48__func__.50_entry_ptr.60_entry_ptr.70_entry_ptr.71_entry_ptr.77_entry_ptr.78_entry_ptr.83_entry_ptr.91_entry_ptr.92_entry_ptr.95_entry_ptr.96_entry_ptr.97_entry_ptr.104_entry_ptr.105_entry_ptr.106_entry_ptr.107_entry_ptr.108attach.cdestroy_avdestroy_aifind_or_add_av__UNIQUE_ID_ddebug517.45add_to_list__UNIQUE_ID_ddebug523.42__UNIQUE_ID_ddebug521.43__UNIQUE_ID_ddebug519.44__UNIQUE_ID_ddebug533.36__UNIQUE_ID_ddebug537.34__UNIQUE_ID_ddebug531.37__UNIQUE_ID_ddebug539.33__UNIQUE_ID_ddebug529.38__UNIQUE_ID_ddebug535.35__UNIQUE_ID_ddebug541.32__UNIQUE_ID_ddebug543.31ubi_add_to_av.cold__func__.16__UNIQUE_ID_ddebug545.30__UNIQUE_ID_ddebug549.28__UNIQUE_ID_ddebug547.29__UNIQUE_ID_ddebug553.22__UNIQUE_ID_ddebug551.26__UNIQUE_ID_ddebug527.40__UNIQUE_ID_ddebug555.21__UNIQUE_ID_ddebug525.41ubi_attach.cold_entry.1_entry.15_entry_ptr.23.LC10misc.cubi_calc_data_len.coldubi_update_reserved.colddebug.ceraseblk_count_seq_starteraseblk_count_seq_nexteraseblk_count_seq_stoperaseblk_count_releaseeraseblk_count_seq_showdfs_file_writedfs_file_readdfs_file_read.colderaseblk_count_openeraseblk_count_seq_opsdfs_rootdirubi_debugfs_init.colddfs_fopseraseblk_count_fops_entry.33_entry.34_entry.36_entry.37_entry.38__func__.39_entry.40_entry.41_entry.44_entry.49_entry.50_entry.51_entry.52_entry.53_entry.54_entry.55__func__.56_entry.57_entry.58_entry.59_entry.60_entry.61_entry.62_entry.63_entry.64_entry.65_entry.67_entry.69_entry.70__func__.71_entry.72_entry.73_entry.80_entry_ptr.81_entry_ptr.82_entry_ptr.84_entry_ptr.85_entry_ptr.86_entry_ptr.87_entry_ptr.88_entry_ptr.89_entry_ptr.90_entry_ptr.93_entry_ptr.94_entry_ptr.98_entry_ptr.99_entry_ptr.100_entry_ptr.101_entry_ptr.102_entry_ptr.103_entry_ptr.109_entry_ptr.110_entry_ptr.111_entry_ptr.112_entry_ptr.113_entry_ptr.114_entry_ptr.115_entry_ptr.116_entry_ptr.117_entry_ptr.118_entry_ptr.119_entry_ptr.120_entry_ptr.121_entry_ptr.122_entry_ptr.123_entry_ptr.124_entry_ptr.125_entry_ptr.126_entry_ptr.127_entry_ptr.128_entry_ptr.129_entry_ptr.130_entry_ptr.131_entry_ptr.132_entry_ptr.133_entry_ptr.134_entry_ptr.135_entry_ptr.136_entry_ptr.137_entry_ptr.138_entry_ptr.139_entry_ptr.140_entry_ptr.141_entry_ptr.142_entry_ptr.143_entry_ptr.144_entry_ptr.145_entry_ptr.146_entry_ptr.147_entry_ptr.148_entry_ptr.149_entry_ptr.150_entry_ptr.151_entry_ptr.152_entry_ptr.153_entry_ptr.154ubi_eba_get_ldescubi_wl_entry_slabubi_bitflip_checkubi_ctrl_cdev_operationsubi_calculate_reservedyieldubi_io_read_vid_hdrtry_module_getalloc_chrdev_region__check_object_size__init_rwsemmisc_deregister__list_add_valid_or_reportubi_eba_replace_tableubi_err__get_random_u32_below_copy_from_uservfs_getattrubi_eba_create_tableubi_vtbl_rename_volumesrb_lastubi_sync_erase__kmalloc_noprofdev_set_nameubi_create_volumeubi_eba_atomic_leb_change__this_moduleseq_releasesnprintfubi_dump_avcdev_device_deldevice_unregisterrb_nextubi_free_aebubi_eba_unmap_lebubi_eba_is_mappedubi_dump_mkvol_requbi_early_get_pebubi_wl_get_pebubi_classubi_read_volume_tabledevice_initializeubi_alloc_aebcleanup_moduleself_check_ebaset_freezableubi_more_leb_change_datamemcpykstrtouintkfreeubi_io_sync_eraseget_random_u16seq_lseekfwnode_get_next_child_nodeubi_enumerate_volumeskthread_should_stoprb_insert_colorubi_io_readget_mtd_device_nmubi_check_pattern_raw_spin_lockubi_eba_destroy_tablepath_putubi_dump_vol_infoblocking_notifier_chain_registerubi_add_to_avubi_start_update__fentry__get_mtd_deviceinit_modulewake_up_processubi_wl_initubi_cdev_operationsubi_update_reserved__refrigerator__x86_indirect_thunk_raxubi_compare_lebsdevice_set_nodefreezer_activeubi_more_update_datadump_stackubi_next_sqnumcdev_device_addscheduleblocking_notifier_call_chainubi_debugfs_exit__stack_chk_failregister_reboot_notifierubi_warnstrnlenubi_dump_aeb__put_user_4const_pcpu_hotubi_msgfwnode_property_read_u32_arrayubi_free_internal_volumesubi_debugfs_init_devcapablemodule_putprint_hex_dumppage_offset_basecompat_ptr_ioctlcdev_addubi_io_writeubi_start_leb_changeubi_put_deviceubi_debugfs_exit_devubi_io_is_badmtd_block_markbadubi_rename_volumesdown_writeubi_notifiersup_writeubi_check_volumesimple_openkstrtointubi_add_volumeunregister_mtd_usercrc32_lemutex_lockkmem_cache_freeubi_volume_notifydebugfs_removestrncmpubi_get_num_by_pathfixed_size_llseekrb_eraseubi_wl_put_pebubi_eba_copy_leb__list_del_entry_valid_or_reportput_mtd_deviceclass_unregistermemcmpmtd_readubi_do_get_volume_infoubi_eba_write_leb_stkthread_stop__mutex_init__fortify_panicfreezing_slow_pathdevice_registerubi_devices_mutexubi_dump_vid_hdrmemsetubi_get_by_majorkern_path__vmalloc_noprofmisc_register__x86_return_thunkkmem_cache_alloc_noprof_copy_to_userubi_remove_avubi_attachrb_first__kmem_cache_create_argsmtd_erasedown_write_trylockubi_change_vtbl_recorddown_readstrcmpubi_debugfs_initubi_dump_flashkthread_create_on_nodeubi_calc_data_lenseq_readsprintfmtd_writevmemmap_baseubi_eba_initubi_dbg_power_cutfwnode_property_read_stringubi_io_read_ec_hdrubi_wl_flushblocking_notifier_chain_unregistervfreeunregister_chrdev_regionstrsepmutex_unlockdevice_get_named_child_nodeubi_add_avubi_dump_ec_hdrubi_resize_volumeseq_write__get_user_4__dynamic_pr_debug__kmalloc_cache_noprofvzalloc_noprof__warn_printkubi_detach_mtd_devseq_printfubi_io_write_vid_hdrsimple_strtoulubi_free_volumeubi_eba_read_lebdebugfs_create_file_fullmtd_get_device_sizeubi_eba_read_leb_sgubi_self_check_all_ffubi_io_mark_bad__SCT__cond_reschedget_random_bytesseq_openubi_eba_copy_tableubi_remove_volumeubi_find_avstrlenubi_dump_vtbl_recordubi_get_deviceubi_wl_scrub_pebubi_attach_mtd_devdebugfs_create_dirubi_wl_close_raw_spin_unlockubi_eba_write_lebmtd_block_isbadsimple_read_from_bufferup_readubi_vol_cdev_operationsclass_registercdev_initubi_free_all_volumes__SCT__might_reschedkmalloc_cachescdev_delget_random_u8ubi_major2numkmem_cache_destroyubi_threadubi_notify_allubi_io_write_ec_hdr__pfx_vtbl_check__pfx_create_vtbl__pfx_ubi_change_vtbl_record__pfx_ubi_vtbl_rename_volumes__pfx_ubi_read_volume_table__pfx_vol_attribute_show__pfx_vol_release__pfx_self_check_volume__pfx_find_volume_fwnode__pfx_ubi_create_volume__pfx_ubi_remove_volume__pfx_ubi_resize_volume__pfx_ubi_rename_volumes__pfx_ubi_add_volume__pfx_ubi_free_volume__pfx_set_update_marker__pfx_clear_update_marker__pfx_write_leb__pfx_ubi_start_update__pfx_ubi_start_leb_change__pfx_ubi_more_update_data__pfx_ubi_more_leb_change_data__pfx_ubi_notify_add__pfx_version_show__pfx_ubi_free_volumes_from__pfx_dev_release__pfx_autoresize__pfx_ubi_mtd_param_parse__pfx_dev_attribute_show__pfx_ubi_notify_remove__pfx_uif_close__pfx_ubi_volume_notify__pfx_ubi_notify_all__pfx_ubi_enumerate_volumes__pfx_ubi_get_device__pfx_ubi_put_device__pfx_ubi_get_by_major__pfx_ubi_major2num__pfx_ubi_free_all_volumes__pfx_ubi_free_internal_volumes__pfx_ubi_attach_mtd_dev__pfx_ubi_detach_mtd_dev__pfx_vol_cdev_fsync__pfx_vol_cdev_release__pfx_vol_cdev_open__pfx_get_exclusive__pfx_vol_cdev_read__pfx_vol_cdev_llseek__pfx_ctrl_cdev_ioctl__pfx_revoke_exclusive.constprop.0__pfx_vol_cdev_ioctl__pfx_vol_cdev_write__pfx_ubi_cdev_ioctl__pfx_ubi_do_get_device_info__pfx_ubi_get_device_info__pfx_ubi_sync__pfx_ubi_close_volume__pfx_ubi_open_volume__pfx_ubi_open_volume_nm__pfx_ubi_leb_write__pfx_ubi_leb_change__pfx_ubi_leb_unmap__pfx_ubi_leb_erase__pfx_ubi_flush__pfx_ubi_leb_map__pfx_ubi_is_mapped__pfx_ubi_unregister_volume_notifier__pfx_ubi_register_volume_notifier__pfx_leb_read_sanity_check.isra.0__pfx_ubi_leb_read_sg__pfx_ubi_leb_read__pfx_ubi_get_volume_info__pfx_ubi_do_get_volume_info__pfx_ubi_get_num_by_path__pfx_ubi_open_volume_path__pfx_ubi_ro_mode.part.0__pfx_ltree_add_entry__pfx_ubi_alloc_vid_buf.constprop.0__pfx_leb_write_unlock__pfx_leb_read_unlock__pfx_try_write_vid_and_data__pfx_ubi_next_sqnum__pfx_ubi_eba_get_ldesc__pfx_ubi_eba_create_table__pfx_ubi_eba_destroy_table__pfx_ubi_eba_copy_table__pfx_ubi_eba_replace_table__pfx_ubi_eba_is_mapped__pfx_ubi_eba_unmap_leb__pfx_ubi_eba_read_leb__pfx_ubi_eba_read_leb_sg__pfx_ubi_eba_write_leb__pfx_ubi_eba_write_leb_st__pfx_ubi_eba_atomic_leb_change__pfx_ubi_eba_copy_leb__pfx_self_check_eba__pfx_ubi_eba_init__pfx_validate_ec_hdr__pfx_validate_vid_hdr__pfx_self_check_vid_hdr__pfx_ubi_io_is_bad__pfx_ubi_io_read__pfx_self_check_peb_ec_hdr.part.0__pfx_ubi_io_mark_bad__pfx_ubi_io_read_ec_hdr__pfx_ubi_io_read_vid_hdr__pfx_nor_erase_prepare__pfx_ubi_self_check_all_ff__pfx_ubi_io_write__pfx_ubi_io_write_ec_hdr__pfx_ubi_io_write_vid_hdr__pfx_do_sync_erase__pfx_ubi_io_sync_erase__pfx_prot_queue_add__pfx_wl_tree_add__pfx_ubi_ro_mode.part.0__pfx_do_work.constprop.0__pfx_in_wl_tree.isra.0__pfx___schedule_ubi_work__pfx_schedule_erase__pfx_shutdown_work__pfx_prot_queue_del__pfx_ensure_wear_leveling__pfx_get_peb_for_wl__pfx_tree_destroy.isra.0__pfx_ubi_sync_erase__pfx___erase_worker__pfx_erase_worker__pfx_do_sync_erase__pfx_wear_leveling_worker__pfx_erase_aeb__pfx_ubi_wl_put_peb__pfx_ubi_wl_scrub_peb__pfx_ubi_wl_flush__pfx_ubi_bitflip_check__pfx_ubi_thread__pfx_ubi_wl_init__pfx_ubi_wl_close__pfx_ubi_wl_reboot_notifier__pfx_ubi_wl_get_peb__pfx_destroy_av__pfx_validate_vid_hdr__pfx_destroy_ai__pfx_ubi_alloc_vid_buf.constprop.0__pfx_find_or_add_av__pfx_add_to_list__pfx_ubi_alloc_aeb__pfx_ubi_free_aeb__pfx_ubi_compare_lebs__pfx_ubi_add_to_av__pfx_ubi_add_av__pfx_ubi_find_av__pfx_ubi_remove_av__pfx_ubi_early_get_peb__pfx_ubi_attach__pfx_ubi_calc_data_len__pfx_ubi_check_volume__pfx_ubi_check_pattern__pfx_ubi_update_reserved__pfx_ubi_warn__pfx_ubi_calculate_reserved__pfx_ubi_err__pfx_eraseblk_count_seq_start__pfx_eraseblk_count_seq_next__pfx_eraseblk_count_seq_stop__pfx_eraseblk_count_release__pfx_eraseblk_count_seq_show__pfx_dfs_file_write__pfx_dfs_file_read__pfx_eraseblk_count_open__pfx_ubi_dump_flash__pfx_ubi_debugfs_init__pfx_ubi_debugfs_exit__pfx_ubi_debugfs_init_dev__pfx_ubi_debugfs_exit_dev__pfx_ubi_dbg_power_cut__pfx_ubi_msg__pfx_ubi_dump_ec_hdr__pfx_ubi_dump_vid_hdr__pfx_ubi_dump_vol_info__pfx_ubi_dump_vtbl_record__pfx_ubi_dump_av__pfx_ubi_dump_aeb__pfx_ubi_dump_mkvol_req__pfx_open_mtd_by_chdev__pfx_ubi_init__pfx_init_module__pfx_ubi_exit__pfx_cleanup_module.symtab.strtab.shstrtab.note.gnu.property.rela.text.rela.text.unlikely.rela.init.text.rela.exit.text.rela.rodata.rodata.str1.8.rodata.str1.1.rela__mcount_loc.modinfo.rela__param.rela.export_symbol.rela.data.rela__patchable_function_entries.rela__jump_table.rela__bug_table.rela.printk_index.data..once.rela__dyndbg.rela.exit.data.rela.init.data.rela.discard.addressable.bss.comment.rela.discard.reachable.note.GNU-stack.rela.debug_aranges.rela.debug_info.debug_abbrev.rela.debug_line.rela.debug_frame.debug_str.debug_line_str.rela.debug_loclists.rela.debug_rnglists.static_call_sites.rela.static_call_sites.retpoline_sites.rela.retpoline_sites.return_sites.rela.return_sites.call_sites.rela.call_sites.ibt_endbr_seal.rela.ibt_endbr_seal.orc_unwind.orc_unwind_ip.rela.orc_unwind_ipx H\Z (f$(,0748]<@DHLP\TX\`dhlptx&|q/$$s%&-3:C ;umnl  H K M$F#($,&0*4,8,<6-@.D0H1L2PI3T 4X6\v8`\9dq9h9l9p9t{:x:|;/?@@@@A.AJAfAAAAAA B C DDDEFzFFjOUUUVVFWXXZT[[\  ]_`|dd wf$f(|i,Tt0t4t8t<Ku@VuDvHyLzP{T|X}\~`,dh{l-pXtƁx߁|iS:3P9k-ÖǗ-A7@Ʋv}4J* . $(2,~048<@DxHLPTX\`dhlpBtx|*#n b!' Y^ r   oAjsy|22 d333 44 4$5(5,60M64y68 7<_7@7D79H;L>=P>T>X)A\A`AdAhGlptCx+|P dKV $(,04!8`<@DH LgPTX\`?dNhVlptx|O#T4    A [        d   l    "-R $(,,0T4\8<@DHLPTX\`Xdlhlptx| $T{&;j0GtGY 2Hp  $C(d,048<@:DHLPTX\ `dhl p4tNx|     "!L!!!!!!#"3"d"{""#0#q######$$'$/$7$O$^$n$$ $%%%% 1&$H&(R&,&0&4&87'<['@'D(H(LO(Pb(T~(X(\(`(d(h )l )pZ)tp)x)|)))**N*****+g++++O,W,b,j,,,,,--$-T-}---../-/>/H/ `/B0S0d00 1$ 1(]1,1014 2842<g2@2D2H2L3PV3Tl3X3\ 4`O4d4hq5l5p5t6xN6|^66707g77.8<88889J9999:I:U:::\;;<:<O<i<w<<=&=B=g==== s>>>>? ?$@(@,@0@4 A8'A<CA@_AD{AHALAPATBX B\FB`^BdBhBlBpBtCx4C|vCCCCC%DDDfDDDDD$E4EDEtEEEEE$F3FrFFFFGGGlHHHHHHI L<K<< <$<(<,<0=4-=8O=<=@=D=H$>L@>Pj>Tt>X>\>`>d?hD?lp?p?t?x?|?(@Q@z@@@@ATAAAAFqvAF^p 8= hm $(,R0W4y8<@DHLPTX%\=`^dhlptx|$OTAFqv/ATev&+V [ $(" ,' 0\ 4a 8 < @ D H L P% T* XU \Z ` d h l p t x | I N y ~       A F w |        F K v {        K P {       $ ( ;, @0 s4 x8 < @ D H  L P 9T >X i\ n` d h l p t x | 6 ; \ f n        , 1 \ a        ! \ a       ! !(!E !!!!,!A !$!(!,!0!4!8!x"|"X"r"|""""A"R"h"z"""""!"2">"^"l""""""""("-"9"L"X"f"{##5#M #Y#g#s#P0 `"%*+ P-$02(3,4074B80C<@D@DD EHpEL FPFTFXG\0T`dhlpptpx|0`@0 @@0 @223 3$04(4,050=4>8?<@?@PADAHLPTX\ `d` (08P80( P (08`80( `   (08@80( @80(  (08`80( ` (0( 0 (08@80( @ (0H0( H (0880(  (08@80( @80( @ (0880(   (08P80( P (080( 80( 80(  ((  ((  (080( 80( 80( 8 ( ( (    (08`80( ` (080( 80( 80( 80( 8  ((  (00(  ((  (0880(   (08X80( X    ( (   (08`h`80( `80( `80( ` @ @ (0880(  (08h80( h80( h80( h80( h (08 80(    ( ( (08H80( H (08H80( HH80( H (08H80( H80( HPH (08@80( @80( @ ( ( ( ( ( (   ( ( (   (08P80( PXPXP (08P80( PXPXP (00( ((( (08@@80( @   (0( 0(  (0( 0(  (08X`h`X80( X`X    (08@80( @ (08`80( `hph`h` (08PXP80( P80(  (0880(  (08`80( ` (08h80( h80( h80( h (08p80( pxpxp (08ppp80( p (08hh80( h      ( ( (08X`h`X`h`X80( X ( ( ( ( ( (08@80( @ (08@80( @ ((  (08P80( PX`XPXP (08h80( hpxhph    ( ( ( ( (08X80( X (08@80( @ ( ( ( (( ( ( ( (0( 0(  (08@80( @ (0(  (0( 0( 0( 00    (08P80( P (08H80( HPH80( H   (08p80( pxp80( pxpxxp ( ( ( (08P80( P (080( 80( 8 (08H80( H80(  (08H80( HH (080( 8 (08X80( X (08@80( @ (0( 0( 0 (080( 8(( (080( 8   (080( 80( 80( 8 (08@80( @ (08P80( P80( P (08xx80( xxx (08P80( P (0880(    (0( 080( 0 (0( 0( 0(  (08X80( X (08X80( X   (08PXPX`XP80( P  P` `0@@( `8X   H@ 0X `P`p(X(@h (X@(0@0 HpPHX0 x X     ( ( 8 (08`80(  ") d$e(f,h0j4l8n<s@DDPHgLlPnTpXt\x`|dbhcldpfthxj|lq#6@[]_aefj         ; = ? A B $C (G ,< 0? 4@ 8B <D @F DH HM L)P@T[X]\b`cdghAlEpGtIxK|PQ`z HPku w$y(z,{04h8<@@DDEHGLIPKTMXR\`dhlpt"x"|"""""""<#=#>#@#B#D#F#K#}$~$$$$$$$$$ % %%%%%%u&y&z&|& ~&&&&& &$)(), *0 *4*8*<*@*D*H*L*P*T*X*\*`*d*hu+l+p+t+x+|+++,,,,,,,,,,,,,---.-0-2-4-6-;-@-Z-^---------- -|.... .$.(M/,P/0g/4i/8m/<q/@{/D0H0L0P0T0X0\ 1`1d'1h)1l.1p61t:1x>1|l1v1x1z1|1~11111111111111112 2;2@2D2H222222D3E3G3I3 N33333 3$4(4, 40%44j48n4<r4@w4D~4H4L4P4T4X4\4`4d4h6l6p6t6x6|66677777777j8n8p8r8t8v8{8S9T9V9X9Z9\9a9e9f9k9m9o9q9v99999 99999 9$9(9,:0$:4(:8):<x:@y:D{:H:L:P:T:X:\:`:d:h:l;p;t;x;|;;|<<<<<<<<%?(?)?+?-?/?4???AABB&B*BmBnBvBBBBBBBCC  C C CCC  C$;C(BC,GC0IC4JC8NC<UC@DDDHDLDPDTDX D\%D`*Dd0DhKDlODpRDt}Dx~D|DDDDDEEE*EQEVE`EzEEEEEEFFF*FzFFFFFFF G GGGGGG ]OaObOdOfO hO$jO(oO,T0 T4DT8HT<KT@UDUHULUPUTUXV\V`VdTVhUVlZVp`VtzVx{V|VVVEWFWKWWWWWWWWWXXXXXNXPXgXhXlXXXXXYY+Y0Y2Y 7Y 8Y 9Y =Y uZ Z Z Z Z$ Z( Z, Z0 Z4 Z8 H[< K[@ L[D N[H P[L R[P T[T Y[X [\ [` [d [h [l [p [t [x *\| 0\ \ \ \ \ \ \  ]  ]  ]  ] ] ^ ^ ^ ^ _ _ _  _ ;_ =_ ?_ A_ B_ C_ J_ ` ` ` ` ` ` ` ` c c c c c c c$ c( c, rd0 sd4 td8 vd< xd@ zdD |dH dL dP dT dX d\ d` dd dh dl mfp nft ofx qf| sf uf wf |f f f f f f f f f g g g g g g g g h oi si ti vi xi zi |i i ;r @r s t Yt `t t t t t t t  u$ Ku( Pu, Vu0 [u4 `u8 {u< }u@ ~uD uH 7vL 8vP :vT | B| | | | | | | | | | | | | | | | | 3} @} [} ]} ^} b} } } } } } } } } } } } ~$ ~( ~, ~0 "~4 ~8 ~< ~@ ~D ~H ~L ~P ~T ~X ~\ ~` ~d ~h ~l p )t *x ,| 1 8 @ [ ] ^ b           " 0 J K z {         * +-2U VX]` $ ( ,048<"@\D`HaLcPeTgXi\n`dhlʂpt x;|=?DHKRɃԃAP˅ՅׅۅILMOQS XφІ $8(9,:0?48<@DHLPTX\`dhl%ptx&|*+-/138~ 7@HLOÊĊƊȊʊϊЊ  C$G(I,K0M4R8s<t@vDxHzLPTX\`dhlp{t|x| ,#$MNPU`ǎ89>U` Ï  $;(<,@0h4i8k<@DːH͐LϐPѐTҐXӐ\א`dhlptx|ڑ !$%')+-2PRoqӔ˕͕ҕוەܕ=}  $(,048<@ÖDȖHЖLPTX\`dhlptx×|ŗǗ̗     # $$%(',)0+4-82<6@BDFHJLLPNTPXU\`ˣdͣhϣlѣpңtӣxڣ|ޤ&ƥ!"#'k589;=?AF¬Ь  $w(,+0.4/81<3@5D7H<LװPTX\?`@dEhͱlбptx|òIJƲ˲ +0PTXstvԴ01249˵еյ׵۵ܵ ȶٶڶ $(,0=4A8B<D@FDHHJLOPfTpX\`dh#l&p(t*x/|*+,.3IPkmrw{~      $s(v,w0y4{8}<@D{HLPTX\`dhlptx%|0KMOQRSW  "  "$1(C,j048 <;@?DCHLPTX/\0`2d7h}lptx|4579>yz|~  $(,048<@D|HLPTX\`dhl pt2x4|6;IPglpq~+0GIJK(0 $&(*/ ?$@(B,D0F4K8P<g@lDqHvLzP~TX\`dhlptxO|Pgs>@  $(,0H4`8<@DHL)P@TX\`dhlptx|op59:<>@BG    $(,04E8P<k@lDpHLPTX\`dhlptx| !"$&(*/4A!#(*/:; ' ,5@ $(,048<@DH+L-P/T4X5\6`=dhlptx|efhjlns hp    X$Y(Z,\0^4`8b<g@pDHLPTX\`dhlptx!|&BPkty$&(34;  $(,048<@DHLP,T0XK\T`^dfhjlptx | $@ WXYc       "   $ ( , 0 4 8 < @ D H L P( T X \ ` d h l p t x |  f j l n p r w                 !%)         $ ( , 0 4 8 < %@ 0D KH PL RP TT UX V\ Z` ed fh gl ip kt mx o| t                  * 0             v!!! !!!!!  !x$!(!,!0!4!8!=$C= $d=$$p=($=,$=0$=4$=8$=<$=@$=D$>H$*>L$U>P$j>T$p>X$q>\$>`$>d$>h$>l$>p$>t$>x$>|$>$>$>$>$>$?$%?$0?$K?$_?$`?$&A$'A$)A$.A$5A$@A$eA$pA$A$A$A$A$A$A$A$$$ $P$ $P$c%%%G %w%%1%o%c %$%(% ,%P0%4%8%<%{@%D%H%L%5P%eT%X%p \% `% d%d h% l%( p%V t% x% |%% %*%Z%%%%%%%%H%x%% %%%%%%%S%`%%%%%G%u%%%%%&&& &&&&& &$&(&,& 0& 4& 8&q<&u@&~D&H&L&P&T&X&\&`&d&h&l&cp&kt&mx&o|&t&&&&&&&*&&&&&&;&<&A&B&C&H&P&j&p&w&)&*&+&0&L&&&$&+&''' '' ' '' '$'(','0'4'8'<'@'D'H'L'P'T'X'@@3A@.@xB((B>jL9@8IBR0M@BbP]@BrA m@H9B z2XvG2~@@BP?(@HB0@0B @B@ B@P'Bh$@$@B)8'$@H-0B7x?H?0C@]3B p@0B"@B$VБQ@ؑB&fa@B(vq@B*p@@B,p 0PЖ(@B00@B3@ȖB5`7**@Ȏ,B8 Hk-@@-/B:0-ә"0su5 q75@2@&8`B>L9KG@ ":jB@:C ;(P`;@\ d;o@d;BEi;@i;BG`j;@m;BI;#@ ;BKx<h@0z<pBM< ;<\',@<(BP