ELF>P!@@CBSH_xf1[HsHH1[SH_xf1[HsHH1[SHH`Ht*Ct%[['H{`@UHSHHVH?UH;qH[]@SHH>eH%(H\$HHT$& D$D$@ fDAWAAVAUIATAUHcSHi@BHeL4%(Lt$ED$HLI}HT$DËD$D!D9tH9}1HD$eH+%(uH[]A\A]A^A_fATHIqUHSH?H}IT$ÅH}qÅA# HᄡÅt%A$H}q[]A\H}DÅ[]A\ff.@ATUSHeH,%(Hl$HHH$ÅtHD$eH+%(u~H[]A\H}ÅE1HÅuHHH}HHcrfATUSHeH%(H\$HHH$u)H;HHAHEAEHT$eH+%(u H[]A\SH_xf1[HsHH1[SH_xf1[HsHH1[SHH>eH%(H\$HHT$$ HD$D$ KD$Qw ‰p0 ЉD$ D$Ā@ D$ DAUATLUSHLt1L[]A\A]Cxt[u'LLŅu8LŅH;jE1E1@@XtLkLŅxGLLŅtH{LŅtLLAtPAtUHSHHPtH1[]H;j@E1E11ɾCxZt-uHHHH1[]H{HHHH1[] H1[]fDSHH{H{PH{PCxveH{HھHHھHHھ!HHH{`Ht1{Hs 1[Hff.USHeH%(H\$H_xfCH;"HT$ D$ ŅD$ SH;1ҾŅH;0HsHHCH;lHT$ D$ Ņ1D$ @H{PH;H;H{P1HD$eH+%(H[]ZHT$ D$ ŅD$ \H;H;H{PxwH;H{PfCXH{`Ht1{Hs #HsHHH;tjE1E1YŅ//H;jE1E1XH;jE1E1_MH;jE1E1ZŅH;jE1E1^ŅzfDATUHSLgxDA|$XtDA|$It$ ÅI|$PÅA|$XI<$1AD$A# LÅIl$H It$HH/It$HHA$LÅLÅI<$Å[]A\A# LÅ'Il$HDA# LÅOIl$HI<$I|$P[]A\LA$AD$XFI<$j1E1E1YÅI<$ I\$HA$I<$jE1E11ɺXI<$ I\$HA$thI<$jE1E11ɾZÅLÅ+I<$ I\$HI|$POOÅy@AWHHAVAUATUSHLgeH%(H\$H$I|$xHǸD$HCHppHt3HH{hHK`HH)HS`H(H)΁0HHHHHH=H{HHH=H;SBHC HC8CH{jE1E1ɹHAXŅsLk LLŅH{HHCPH=H{`{LŅH{PŅHH;1H;1HIŅ$IctccH{`{A# H߾ŅH; HkL1HH;ŅH;HSŅQ_QSH;HT$D$4H;1ҾŅH{`Ht1H{PH{PŅH H{HHC`H=-H=H{PLHD$eH+%(u[H[]A\A]A^A_H{`KH;11Ņf.ffAVAAUIATMUHSHHHt y IDy []A\A]A^MIHڹ [1]A\A]A^ff.HG0HeH%(HD$1HT$D$H1HtD$HT$eH+%(u Hff.fHvHHf.SHw 1ɉHHߺ1ߺ11[ff.fATIUSHHHt yHy []A\[L]A\ff.fATAUSHHHt yHy []A\[D]A\ff.fAUATUSHLneH%(H\$H$LHLd$=Ht#H;HQ $H;H@ $uvt&C|tHtHk HH{HT$eH+%(H[]A\A]HLD$1Ht|$YHC|QHL1D$1Ht|$AtHAuH{H1/AVAUATUSHpGeH%(H\$hHƇIIƃH;1Ҿ@Dc|E@AH;j1E1E1 YŅDc|A H|$1 HD$HH|$D$HD$HD$8H\$@HH=HHMt=11ƅH;LM1ɺ ŅH1ƅH;LM1ɺ ŅIcI1IHŅIH-HHŅuWHD$heH+%(@Hp[]A\A]A^IE1A dIH'HHtH9H{HHH@D ALr%C|A IINDc|h{IwII%IIHH{HAHff.ATUSHeH%(H\$H HHt-H-Hl$HD$HHDd$DHDH1HD$Htkl$HHHHD$eH+%(upH1[]A\Hމ;1E1c11HHt'yH'Hމf.@XvL#++}vsHeHtXaH`oF9wHHuh *? x ? ([O?Cw<HmX(GH H.pH??H  Hwow]V  %  vH?H]Iw⍆@5H33 ?H&HwwwHZ?UDp'O?3H?H (HHor_HHv=_G5!H &H `HHHHFH:%!\ aHHC>H$HHHHHPwh;|f@? M9'%ff.f wj SQz  #Nw<U wk vH'Ht3wVH?HtwujtL=_uG wLwk$d H둸wff.@GuH?!HH?H/vvqvcvUvGv9/v+vvJ=_vyvctUvG`*v9v+_vvJff.@GH?t+tu3nHHWHHff.@H8  .whp`6F:HHtzZ?KX6@XH HuHBxxwgfdQ=  -8  bHHt  #x d? HH9(&H `HV  B;  H?HCw`qw΁@ 033HvCw^HwwwwHC#H?7HnHeHJ6H"3{pH%HHmuAH-HH??H8HH@8EHHsHFHRHH.;HHHH:%== O<?oH?7HKH' H'??H~H<HHH{Yi7!kZKP!o }ip]D0HCwUwAY  wVU w~ #  vMʁCCH?7H„uH@xxwny)HH„<북)uqCuN>H'H„sv`W>-qQdH„7f.fwg&;qA%HFHjh wh? pt)<@EHV  $ HH1ҁ F Oaq9H??HM:y% w?18HHP"CHa7HHH33?H1҃6C wPHH H1 (wHHHvЁI>Ho_@wwHH~ H HH `H<HH@ HHHPwO;X?Rff.vRU    tsw# w?F= tFw&$x H1H?! HDGt1H?HDkwdaH` 8HHXwH1ҁF(  " (Hx>H1ҁFSH??H1ҁpF^aTAV w| % qH?H w*0 8HHHwaw!` HPR;w$w  bH@B~HH33?Hv/HCHp H1ҁFHHHHHHHaH1I>HHH wHHH HfQ@@/&ff.fw<wnvh  U wt  wE wNv  H' HH@H?H  w}Kpu$`JV9HH„='vawZp?GXIHH(w[- =_L@  mx wc? 8NHH‰  -H- HɁ HH FH??-qH{CG:HH FLwwH#-%wkHF-H33-Hh;w4HH„D|~-@H)1"O?N8H„Cw'H?7-H0v8wA7‰/(-)=?‰-9=?‰H-@ H3@8HH„ C9 H?H CHH?- HHaHH?7-Hx[- H1 -v~-v|% Wv\--oyc- N=ff.H?H{wsmOCvkF''wR _w^3gH?7Ht@   v]H?7H3v08wl7tL% 9?/ ()?H? H 1H~HH{HD$D$H{HD$D$H{H1HT$eH+%(uH[H{HH{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HD$I}tDHL$D⻒HH}HH}HH}HH}HH}HH}HHHH{H1HT$eH+%(u4H[H{HH{HH{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HH{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HD$H{HH{HH{HH{HH{HH{HD$l$H{HD$l$H{HxI|$HI|$HI|$HI|$HA|$XA|$It$ HHI|$HI|$HI|$HI|$HI|$HH{H1H{`HLH{`Ht1H{P(H{HH{H봉HLHLH{HHHE1LH{HHHE1LLsHIH{ HLHLHLHL{LHLHL~H{HH{H$ctKw4ccw&IcRwQQH{H5StH{HCAIHHCHLHAHtEHŅtH{HwCw~1틔tH; HHu݋SxCxjH;JE1E11H^HcHHuH{1H{HH{ŅCxHuHŅ H{HLSt7tRH{HAIHC1WAIHH7AIHHStt7H{HCAIHHAIHHStH{HCcAIHHpStt`H{HCAIHH,HŅyH{HAIHH"qH{HrujH;E1E11YSDŽ -dD$Hct̀L$tL$tL$tL$jH;E1E1ZdH{Iؾ!HHHIؾHHHIؾHHHH{E1E1jDLXH{HHH{cfH~HH{HH{H1HH{HH{H'H{HH1HH{HH{HHHLLHHL1L?H{HH{D$HHھ-Hl$DH{HrH{HCH{HH{H1҉wm5102_clear_write_sequencerarizona_clkgen_erroarizona_overclockedarizona_underclocked}arizona_dev_init '3<IX_fpYarizona_suspendarizona_resumearizona_suspend_noirqarizona_resume_noirqarizona_isolate_dcvddarizona_is_jack_det_activearizona_runtime_suspendarizona_connect_dcvddarizona_disable_freerun_sysclk}arizona_poll_reg arizona_enable_freerun_sysclkIPYfowm5102_apply_hardware_patcharizona_runtime_resume#<C\ez3{3A33 arizona_irq_threadixarizona_boot_donearizona_ctrlif_err[arizona_irq_init2>FNV^eoz    !"#$012@AabcdfghijkpIJRSTUVaqrst}uvy}D 777,"  "    !"$%& "` !"#()*+@-./0123567@B ?CPX i @@     @ ABCDE@F@GHIJQRYZ @@@ABCDEFGHIJKLMNO`abcdefghijklmno      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO                           @ A B C D E F G H I J K L M N O P X ` h p x  ( @ H ` h        ! " # $ %         A S T V cc6 7    !"c#@$u &c'c()*+,6- ./071 2 345 678c9@:u <c=c>?@AB6C DEF7G H IJK LMNcO@Pu RcScTUVWX6Y Z[\7] ^ _`a bcdce@fu 3 @  K@ @ @ @@Q S Q @@K @"` (B ?CfX q^  ! qqacPe Hg@@i@9k3m-o(qsPu w y0 {}   @ G H     Jt Jt     !"#$012@ABabcdfghijkpIJRSTUVqrst}uvy }  (777,"  "     !"$%&( )*,-. " !"#$%&' ()*+@,-./0123456789:;<=>?@?PXii444 @@     @ ABCDE@F@GHIJKLMNQRSTUVYZ @@@ABCDEFGHIJKLMNO`abcdefghijklmno      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmno                           @ A B C D E F G H I J K L M N O P X ` h p x             ( 0 8    ( 0 8 @ H P X ` h p x        ! " # $ % 0 1 2 3 4 5 6 7 8 9 : ;          S T V cc6 7    !"c#@$u &c'c()*+,6- ./071 2 345 678c9@:u <c=c>?@AB6C DEF7G H IJK LMNcO@Pu RcScTUVWX6Y Z[\7] ^ _`a bcdce@fu 3 3 @      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghiprstuvwxyz{|}~  K @@ @  @@ @   K @@ @ @ @ Q S Q @@K @K8L='''''&!lndop[3AY 'nprtvxm(o(q(s(u(w( D E@F`GHQR3SSTsUV0 >>1 >2 >>3 >>4 >>5 >>6 >>7 >>8 >>9 >>: >>; >>< >A`@ abA c HdA e@@fAg@9hAi0 jBklmPno pq rs0 tBu`vFwxyz{0|}~ #$ $ $ $ $ $ ```>XZD E@F`GHQR3SSTsUuV$$$$$$$$$$$$```0 >>0 >>1 >2 >>2 >>3 >>3 >>4 >>4 >>5 >>5 >>6 >>6 >>7 >>7 >>8 >>8 >>0 >>0 >>9 >>9 >>: >>: >>; >>; >>< >A` ab cPd e Hf f g@@h h i@9j j j k3llm-nno(ppqrrsPtttu vvvw xxy0 zz{||}~~ #  * 1v  !"#$012@AabcdhijkpIJRSTUVaqrst}uvw}D  "   " !"#()*+@0123567PXi @@     @ ABCDE@F@GHIJQRYZ@ABCDEFGHIJKLMNO`abcdefghijklmno      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNO                            ( @ H ` h        ! " # $        S T V cc6 7    !"c#@$u &c'c()*+,6- ./071 2 345 678c9@:u <c=c>?@AB6C DEF7G H IJK LMNcO@Pu RcScTUVWX6Y Z[\7] ^ _`a bcdce@fu 3   K@ @  @@Q S Q K X"q 1x   !"#$012@AabcdfghijkIJRSTUVaqrst}uvy}D777,"  "    "    !#()+@,-/013457@/AYB*C\HPQXi @     @ ABCDF@GHIJKLMNQRSTUVYZ @ @ABCDEFGHIJKLMNO      !"#$%&'()*+,-./@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmno                               ( 0 8 @ H ` h        ! " # $ %         S T V cc6 7    !"c#@$u &c'c()*+,6- ./071 2 345 678c9@:u <c=c>?@AB6C DEF7G H IJK LMNcO@Pu RcScTUVWX6Y Z[\7] ^ _`a bcdce@fu 3 @@ @ @ @ @   AYB*C\ndop    ~H ?;T !"#$012AabcdpIJRSTUVqrst}uvy }   "    ")*+@PX4 @@     @ ABCDE@F@GHIJKLMNQRSTUVYZ @@@ABCDEFGHIJKLMNO      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmno                              ( 0 8 @ H P X ` h p x     ! " # $ % 0 2 3 4 5 6 7 9            cc6 7    !"c#@$u &c'c()*+,6- ./071 2 345 678c9@:u 3 3 @  K @@@ @@ |!pCLKGEN error Late suspend, reenabling IRQ Resume, reenabling IRQ AIF3 underclocked AIF2 underclocked AIF1 underclocked ISRC3 underclocked ISRC2 underclocked ISRC1 underclocked FX underclocked ASRC underclocked DAC underclocked ADC underclocked Mixer dropped sample Failed polling reg 0x%x: %d Failed to start SYSCLK: %d Early resume, disabling IRQ Suspend, disabling IRQ PWM overclocked FX core overclocked DAC SYS overclocked DAC WARP overclocked ADC overclocked Mixer overclocked AIF3 overclocked AIF2 overclocked AIF1 overclocked Pad control overclocked Slimbus async overclocked Slimbus sync overclocked ASRC async WARP overclocked ASRC sync system overclocked ASRC sync WARP overclocked DSP1 overclocked ISRC3 overclocked ISRC2 overclocked ISRC1 overclocked SPDIF overclocked drivers/mfd/arizona-core.cEntering AoD mode Failed to isolate DCVDD: %d Fully powering off Leaving AoD mode Re-enabling core supplies Failed to enable DCVDD: %d Failed to connect DCVDD: %d Failed to apply patch: %d WM5102WM1814WM8997WM1831WM8280WM8998WM5110CS47L24&arizona->clk_lockmclk1Failed to get %s: %ld mclk2AVDDDBVDD1Unknown device type %d DCVDDFailed to request DCVDD: %d resetUnknown device ID: %x Failed to reset device: %d WM5102 registered as %d WM5110 registered as %d CS47L24 registered as %d WM8997 registered as %d WM8998 registered as %d Unknown device ID %x %s revision %c CLKGEN errorOverclockedUnderclockedFailed to add subdevices: %d 3%s %s: 64arizona-micsupparizona-gpioarizona-hapticsarizona-pwmwm8998-codecwm8997-codecMICVDDDBVDD2CPVDDSPKVDDcs47l24-codecwm5110-codecwm5102-codecDBVDD3SPKVDDLSPKVDDRarizona-ldo1arizonaControl interface error Boot done Failed to resume device: %d Failed to read AOD IRQ1 %d Invalid IRQ: %d Failed to map AOD IRQs Failed to add AOD IRQs: %d Failed to map main IRQs Failed to add main IRQs: %d IRQ %d is not GPIO %d (%d) arizona IRQarizonaBoot doneControl interface errordrivers/mfd/arizona-irq.c3%s %s: 4wm5102 IRQwm5102 AODwm5110 IRQwm5110 AODwm8997 IRQwm8997 AODwm8998 IRQwm8998 AODcs47l24 IRQFailed to re-apply old SYSCLK settings: %d Failed to re-apply old FLL settings: %d Failed to read underclock status: %d Polling reg 0x%x timed out: %x Failed to cache FLL settings: %d Failed to cache SYSCLK settings: %d Failed to start FLL in freerunning mode: %d Failed to start write sequencer: %d Failed to read overclock status: %d Slimbus subsystem overclocked ASRC async system overclocked Failed to check jack det status: %d Failed to set suspend voltage: %d Failed to clear write sequencer: %d Failed to enable core supplies: %d Failed to apply hardware patch: %d Failed to set resume voltage: %d Failed to re-apply sleep patch: %d Failed to restore register cache Failed to add early children: %d Failed to request core supplies: %d Reset GPIO missing/malformed: %d Failed to read ID register: %d Failed to check write sequencer state: %d Failed to clear write sequencer state: %d Failed to re-enable DCVDD: %d Device failed initial boot: %d Failed to read revision register: %d Failed to apply sleep patch: %d Invalid 32kHz clock source: %d No kernel support for device ID %x Failed to read main IRQ status: %d Couldn't set IRQ polarity: %d Failed to add core IRQ domain Failed to request IRQ GPIO %d:: %d Failed to request primary IRQ %d: %d Failed to request boot done %d: %d Failed to request CTRLIF_ERR %d: %d license=GPL v2description=Wolfson Arizona core driversrcversion=5B5144927DB95F0BCF082ACdepends=intree=Yname=arizonaretpoline=Yvermagic=6.13.0-rc1-MANJARO+ SMP preempt mod_unload    (08H80( H   0 0 0 0( ( (0( 008080808080   ( ( (  (08HPH80( H (0( 0(      (8( 8 (00(  0 0   H 0((0 HPHPHPHPH80GNUGNUe,sd_+2RyLinuxLinuxarizona_clk32k_enablearizona_clk32k_disablearizona_pm_opsarizona_dev_initarizona_dev_exitarizona_request_irqarizona_free_irqarizona_set_irq_wakewm5102_spi_regmapwm5102_i2c_regmapwm5110_patchwm5110_aodwm5110_irqwm5110_revd_irqwm5110_spi_regmapwm5110_i2c_regmapwm8997_patchwm8997_aodwm8997_irqwm8997_i2c_regmapwm8998_i2c_regmapcs47l24_patchcs47l24_irqcs47l24_spi_regmap]2X;,[%$R GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910  KQ S Q @@K NarizonaL #LB #,X ,t,[, , C+ +G +XGCQC]uCCCCint],C*CVs8iVu8|fVs16Vu160f0Vs32DVu32fSVs64Vu64lflp]z C+1]2]HIX]^_`QCC<] SZ /#C%&*+4=BhDlm0nS} b+ l l ] ] ll" " b???D? QY + Yf+WDbH  G  9 "H k  (  0 8 @  H  H  H pH  H  H  H  H2@ v4PhSGG ]A67kp ](],0 8@AB]D HPqmem@<+ ]j ;(0]8@]H]LP]X`]h p Z x]] ]&]]L ]!L"]%&9]:0?AD F P : Q](T00 03 00S =val ' ' g 3 ,S 0    +  's    g  ||  g      ]+, fmtGGG]GG$ e% f+gZ hd uZ vDwD keyx% _ U V  j keyki n keyoi 6 7 8 8c GGGG#]#]#4] key9 ( ]= 8U V modW XGY Z ([ ,\c 0GuBvBwGx]y]  +] Qf + /1] set3  get5$7 %fW  ; ^  5( 508!@" H# P$ X%`&+h'Dp(+x)g*+,-./ 0 *1 2\3 5 9 ; >g?@/ !D key"D?A+BC=>@/ x/ Q@+2-@   5 ] ]    ;( ], !]0 ( 4 )%8 *]H ++P , X 5 ` 6 d 8 h : l ; p < t =]xcse ?G@7rt @Iqdl AI BI F)L3 I&9 J+ K] O3L X8L ]8L3 `" F@ d h] k]  l+ m  nHL  oML( p@"0 q X s` ub x d yKh zp {WL +             K     E  8(3 &9P7mm %.h %.p KMx         + ]  ],  ],  ],  ]-  ]-  ]-  ]-  ]-  ]-  ]-  ]-  ]-  ] -  ] -  ] -  ] - "] - + '7pid  ~  ~ +        ( 0 @ MP MX  "N %. (. +  - l . l 3 l 44D 6D : ( =+0 >+8 A l@ D lH G+P H+X KVB`3 NB TO WO ZO ^rP k (5 m|P p8  q8( t+8 u+@7fs xPH {PP ~PX "Q` Th  Up  <x  <  < z@ +   ]  U  D ] g; @  l   l  ,!     K  {9(   8  U@   H  JUP  TUX  U`  Uh  Vp  +x   V  A  ]   l   l   l  ;  C    \W     S   S  "fW  )W    W0  A68  ]X  W\  W`  A6h    W          !]  "]  #  $+  & l  ' l  ( l 3 )Y  3W  CL  D+  LW  N+  RW  SS(  TS,  Y+0  ] 8  ^ <  _ @  ` D 3 aYH  dAX  gW  i[A  lX  w  x  z+  }  ~ X   l  l     L       + ] Y Z 'Z Z  ]( ], L0qrcu Y0 ;@  D  H ;P Zx ;   "Z Z Z     l    >3 Y   !"E% $"E%3 .Y <Z3 F,@@@!!! !,!!!!"" O!" ""8! #!!#% #+ #-#/ ] 3"     ($ 0"$ 0" +@" +$ ;"@"% b"2@A@&$8&2@&$C!&&5&: ,!5&<+5&=+5&>+5&@6&AV^6&BV^ 6&ES86&G 6&H+6&KA66&M 6&N6&Ob6&Q6&T6&Ub6&VV^6&W 7&X7&^+7&d+7&e+ 73&i@@7&t@7&y]`7&{+h7&}]p7&]t7&+x7&~7&+=&J~=&x>3&@?&$c?&h?&}A&݄A0'c@%'dG'e'gԏ'i 'l ($(8`%(9{%(<{%(={%`%)<%)=])> ):%);`%% src)A0 dst)A 0%%(*(*(* ]+8&"(+&+& val+ S+!S +"S+#l+$& S+*&++&&+,# ',&, , &- '-9\- D&"+'H'+(+)&&+.l" +1'+2'+3+4 +5++6+'(+'+%8&+/'+7H'8+'++ fn+ (' ((''.9(.l end.l/;o(>cs/=l>sl/?l>wfe/Al/E)>ss/Gl>sti/Il)/Kl>nmi/Ml)/Pl )/Sl0)/Vl8>lm/Xl9)/]l:)/dl</4)=cs/0=csx/l/9(/a)=ss/0=ssx/l/o(/gg* r15/m+ r14/n+ r13/o+ r12/p+ bp/q+ bx/r+( r11/u+0 r10/v+8 r9/w+@ r8/x+H ax/y+P cx/z+X dx/{+` si/|+h di/}+p/+x ip/+)/+ sp/+4)0B+0C00D0)0E0 )0E0(>s0E0,>dpl0E0->p0E'0/)0F00>avl0F04>l0F05>d0F06>g0F%07)0F+081+1+1+1+1+"1 r+ pte1+1"[+"1 + pmd1++1"~+2%+2%%O+E2%/+g2' +pgd2'C+E2'"+g2p ,pud2p7+E2p"+E2$,),@3Hk,3I+9.lXl03 43+84;,4<&4=&)4? ] )4@ ]$)4A ]()4B ]+2@@5.55sp5+es5 ds5"5$5&5+(5+05585+X5+`cr25+h5+p5+x555+5]5S5+5+5 5cfpu5 4@ . .*.2@@3Q.9s@3lx@+r++e.X3p/9 q3%.3 +'q 3(3,3uq083Lq83X3qh3%xrp3+x3p3 3}r3Q"3W3r3p ,6 /6 6 /a)(7 (7 p8?0 cwd8S swd8S twd8S fip8S fcs8S foo8S fos8S8?08Sl SO0 +08*s0 rip8+l rdp8,l08.0 fip8/S fcs80S foo81S fos82S 8)0'O0's008@08A08B0 S0 + ?8$1 cwd8%0 swd8&0 twd8'0 fop8(0085S86S891 8<1 8>0}0 S1 + S1 +?8Q2 cwd8RS swd8SS twd8TS fip8US fcs8VS foo8WS fos8XS8Z?08[l8\m8]n8^o rm8_p8`q8a2x8bSu/ 2 + l2 +@8:28; l8< l8= 2 l2 +2@@8O2388P08Q28R23@ A3D+@8^3$8_/Y8`0$8a1Y8b2@$8c3 3~+2@@8fM48h]8k]8nl8qlxfd8tl8w]8z]8]8]88A3@@848 l8]8] fpu@848]8+84848M4 8M40883@@39 (59 l9l Q85 + QH5 +? :5: :! L:" 7:#H5 l5 + Q5~+ g*5 + 55 +55;>&6;?+;@+;AS cpu;CS< A6<  =)6=*Q"=+  osq=-&6 =/:>A6:>:>(?(?(?(?!(?%(?'(?,(?/,!(?3(?5(?9(?<(?A(?D(?H(?L(?Q(?U(?Y(@07@1Q"@7Q" osq@9&6@; @<:@:@:@:@:@(ABB |8B H8B ]C8D8D 88E 8E(F &9F F FG[9G+G[9G[9&9G {9G [9G9G`9G[9 H9+H &9H +H 9H{9 ]I :@I'|:+I(9I) + I*:(I+ ;0I,8I-9I.:I/; 9:::|:@@J/ ;J0cJ1]J2  seqJ3CJ4:J59 J6c0J7 +8:(KR;K K+K b;KS ];];;R;L;LL L;;"M ;M; +; +M8;N;N N;O+(<O,O-xPj<Pj<P]`P+h maxP+p +z< + Q<Q lQ lQ"R < sigR;R<SRSS<<SUSV=<T2=T T T  ="T'b=T(T)"T-=T.#T/T0 2=T1"T5=T6T7T8 2=" T<>T=T>T?T@TA"TSM>TT VTUTV" TYq>TZ VT[ "T^>T_+T` Ta TJ>TLTQ TW>T\M>Tbq>" TE?TF>"Tg)?Th _fdTi"TmZ?TnToTp]  T%?T*>=T2b==_rtT9=TB=Td>Tj?Tq)?00U ?U U U U Z?0U @?U?Vuu@Vv nsVwSx uidVx DVy Vz' V{@@U @U!U" < U%@U'<U(+U.<U0 < U3@ saU4@ W @AW ;W + lenW +W (X[AX "Y$AY%$,Y'Y( 0YDAYM#@AYP(YW)8Z .BZlZlZlZlZl Z#l(Z,l0[)VB[*l[+9P[8B[9B[:]H[;]L .BB +8[DB+[EY[FA6[G]0 \>:C\K\Z\p\\\ end\:C QICD+]!dC]" ]]&IC]DC]DdC]DpC]EC]EdC]EC"]T C]YC]Z ,!][C"^ D val^^ C"^ (D val^ ^ D SmD U l V l W @] [D0 hE idC j kmDcpu l] ml nl  ol( UE +    E +  SX@@  F  l  l  l  S  S +  +( +0 ]82@ G  l  l  l  l  l   l(  l0  l8  b@  lH  lP  bX  b`  lh  lp  lx  l  l  l  l  l  l  l  l  l  l  l  l  l2@  I UE8 &9 ! l( " l0 # l8 %@ &P 'Q (R )S , lX - l` . lh / lp 0 bx 1 l 3 l 6  7 I 9I ;I =+cavg GE@GI0 KI L M+ N+ O]  P$ Q& SI(IE ]II IIIX `K8 a&9 h l i l  j l( k l0 l l8 s b@ t lH u]P ] ] ] ] ] ] ] ]8 :X8 :rq 83hAY@VaW iWiiikWW W +WWW +W +BWX (<X +?@jY6cssj idjAtj@@ j j j,!  jf\( j+H jP jX j j j j jH j j j j+ j  jZ( jZ0 j8j(HjPj`jj xj{xj7X0jZj jYj 9 Y"ZhkyZkzfk|]k}h9jgkg(k;0k+Xk#h`,ZZZZZZ LZ +Z Zl,[llll b[l!l" )l$]Hl'[l(G keyl) l*[l+ l,(l-0l. [8 extl/[@Z,[l3 l84\ tpl94\l: l;Sl<Sb[-Dm Q\V\a\a\f\ m\mQ"mmE\Xnq\nrf\ns; wqnv\H cpunwP\8nz]n{f\6rcun|Y wqn\0xo|]oo|]o]( lenoQ"Ho]Pop ]] + +] + ] +p !](p]p]p p]p p^ ^ )^)^]]p#V^p$,!p%p' .^q+^q, q-?@rd_rd_rd_r +r,!@@r  ]Hr!+r"+r#r$; r%f\tr&Y  r'_0 r(+8Lcpur*@Lsspr+$`H Q"t_ +`r6_r7,!r8]r:](r;+Hr<_Pr=Xr>\t_re$`rf] sdargwarh ri|a_JxrDgarE_rFgarH rIA6(rJ,!HrKA6PrL+prM+xrN+rO+rP+rQ+rR+rS+rTrU+rVA6rWM rY  r\+ r]+ r^\ r_$`p _wa +^)`(st3aa aa+at6at7at8at90tAbtB7tCa(rclkb:jd6b ]u/qb  ]v bvqb?@@JgcJh cpuJi]Jj]Jk] )Jl])Jm])Jn])Jo])Jp]Jr]JsJtJu]J{ + J|:(J} +0J~:8+Jc@@bb+ch:@c +wcw ; xdxx xyhd!d b5d:y ]Rd +]y,d  {d{d{d{d{#ddd| |"d|%e|,!|d|See|]|}ze}2}2"}"e}#D}$}%"}'e}(})"}+e},}-}!!f}&ze}*e}.e }HfXe ops}RfeHfMf}2f}4+}6]}7] ]k@f ]kHfkpgkqfkrksgg0kCgkWfk+kjg+kYk+Mkg'gCg@khkfk+k+k+ k (k,kh06rcukY8k4hHg!fk4hk idk hChD+k^hkch^h(~h~ ~b~~ " Cil& )7 ldt*Hi8.+@9A6H:h;Wjp= xC0|D&~Ci Rj+ alt+++ +(08@HPX`hpx !MiRjFh03\j3^ 3`]3Xj=lru3Y'hj3d3e3ij3j +3k+0(3Rkj3hKMj3s+ 0(3u[k3z+ pp3{`k3|+3}+3~Q" [k03|k3+03k3)l3 )l ref 8MHh]l+p ops xkM(3QXl'j'k'ek'|k^3Y3zl3]3 g3 lval3+E3zlZ3Ml3N 3P]G3Jlslru3K'lG3W m$3X $3YlZ@3Gtm3I+l3UKM3V + l(3[ 03\ 43^+8d@3Fm' mY3j),Z(3mm3n+3o+3q 3r 3s 3t 3v] d@3ln'mY3z),Z03}|n3~+3+3 3 3  3 (Z 3n3+3+3d@3|n'n'|nY3),X3Dn9tm9m@9nE3+nX p  ,! `  pKM  (]0]4O8ҳ@.P p  x#$ % '9S o o35;pctx36@p;p3=pp3>c3@:C(3Xp3Y7(3\p3b+3h+3t73w 3}$Z3 q3+3+d3'q'pY3YG3Lq$3o$3n 3uqcrb3&93+ppzqbsrc h jkq s(t0u$8w8@{H~P`Xt`hpxqsrEpp3r3lcid33 @@3 r3 g 3s33+3 Y@@3v9r@3%e@3+P3+X3+`3+h3+ppgd3  Q.x3) 35 3?v3E+3L]3S 3Z 3]Q"3_3a,!3p73r33+3+3+3+33+ 3+(3+03+83dC@3,!D3+H3+P3'+X33+`3+h7brk3+p3!+x3+3+3%+30+3v3w@3w3\j3+h3,!p3"wx3 3Sx3p3&]x3+3+33 3 3Ch3Q"3f\3gx3+3+3Q"3 rr +w +3 hhw +ww?hVJSxVKVL@VMVNSxVOVP DVQ (D nsVRVS+VV  V^ V_rP V`7 VerP@ Vgf\HsetVih VjФ Vlu@ Vm& Vn]@ Vq;`'wXxbx +{xD+3+x3-3/ ,!E3 ]xp/Cyh7Cy(pmd9 [.0pud; p/8m@E$,HF$,PpteL V.XptlP7`T ,h@]3y @iiiii:6:9:<:GyQ" Lz +yh&u4z&v4z&w+` Dz + ]&}z ]&z    ]&6|        !"#$%&'()*+,-./0@]&l|W@&I}&+&7&]&I}8&e}&}&}8&}x&}&}&(7gen&)7seg&*&d0 e} + + + } + + + +} + + +} + + + Q"} + + +H&$~seq&+&&&$~&4~( L4~ + +J~ + +&~&useq&+&+&z&&&&W &eu&f&h,!P&n+X&o+`&qQ"h&s7p&u+&xl|&{}&]"&y~  + + +  +&&seq&(+&*W&, &. ,! d + +  +2@&& ,!&&& &&&&&&& ΀ + @&&&  &  + +' +1&R& &R b +/@]&2@&7&;]&<+ &>+(&?+0&J8&M`&O]"h&P! p&Q$x&V&W&X&c+&Q"&+&+&+&+&G&+& C&3&@&&x&+&,!3&@&+&+&7&+&+&]&]&& & 3&@&'&7`  +΀ z' + Q"7 + Q"G +&r&r&W && G + &݄& ,!&&+(&2&+&+& +& +& + h@C + wS + V^c +' Q"x +/x8+22++ +(0 ] +b,H- ,!/ T0034c678  xa9 idrц]] +`9 rev+8  G6rb&9 ns0]8< r>@ idl` hGp6rcuYx8 ; ops! hҊ "$ % 7 & L(( o02 89@: oH= P@XA ɋ`;  B=dirцBQx: buf:;: : : :  : (: 0:A68 op:X:`: h:p knpL A6 A6@`h ;x    @  A %xr ͊͊͊׊ L L 7LLL< o͊;Q N͊t ͊`. ɋ͊ ]0'N(΋) * X+v, - %(bS llq]b{؍S r]  ll ino)l dev* f(+ f, uid, D0 gid- (D4. 8/T8@0T8P1T8`2T8p3l4l5S6S7l8l9S:S;S''G' r'm"'nŽ'o&̎X'0'1؍'2 '3 '4 '5 .('7 [0'9 .8'; [@'= H'?P"ǎ"֎ю r@@AGBCD^ Eđ( sdF0Gc8#I]#J]#K]#L]#M]؍ێ rԏю юُbKM .pǎ; [pю;3 pю` pю`.'֐' '  ;ې G`^ ,! PX0tu ԑvّw!ޑx*y z 9(cԑɑ֐@% N //4D(DJ }~ Lbuf  ; + ; +? Q~+(K  G## AA>-F ]e +(+++++ 06rcu1Y2c3 eD+ HUIUJK LM+Nlx _2*Z@p(HGP/Xbus` h p xA68"-2< 7msi(K8P@lHlP_X d`hnx x f7idS,! !!ޑ# P$%'#)+ `, a- b. c/ d9 e< f_@x endxG++ (0&8//:ϗ;<,@  P!@"@#@ $@(%@0&@8'@@(@H)@P*@X+@`,@h-@p.@x/@0@1@2@3@4@5@ۗ @Z1PZE@U@]lHxy ,!z]|]}A6~0@28]ϗA  A !A "A #A $A %A &A 'A (A )S,! M r@ @ A B C D E8:Plf\V^|  ]                ]UUllll  (7qos0+r,G id-./,! 0|(1;02+X3 +`4 +h5 +p6 +x7 +8+9+:+;+<+ dev=Z#> #? ]wZDopsۗ@ &@ P P?&Z ?Z]+MUNGOGP!ޑQ!ޑR!ޑ Tz(U0V@8W P@X PHY PP[@X\@`^h_@pa@xc@d P pmfhD nZnu`uaG busbd eGg h?$j(k0m@8n P@o@Hp PPqXr@`s!ޑht!ޑp pmvxw P pysZ A* Zϗ,U`2i3G5!ޑ6!ޑ89 ; (< P0>@8@(@AHC ʢP pmEX ;rni ʢ/40X*YGZ!ޑ[\ <^ P pm`(Ϣ* D +@ U xxD8G r % (0} s t uV^I S+&9ФXФ9 Nx ( setå08@H9PS0 x M9'դurcuYp]Rʕ+h 8pQxRhå 6dirȥ`+S`9Xȥ* å å8Ф/4# QФx=~V BDEFFGUHHI~A $,!]"]  AKP0AwK :@V'ZNO+PQ (+,-./ w 0pwqpr s t u v0$/("#Ĩ&Ĩ'Ĩ' ɨĨ0,! M ^'Ψ"903F4S len4S2a'"6l1F8aijkV^rߩst^uYRT]UCVWXa Y0[8_"``ha+pbx+d mn6d_uvߩߩ2x{| r}~ D (D] !L (KM0 8+@H fL P H8X H8` H8hSpStSxS|,! HS7++-00 %0@H P T X \}K`7h3\Lp8}H P(AXK`Uh pª +'@߲ /( ?0 ?8 T@ rHPX6`2@ f+  (!0!8@"H+P+X+`h7p &#$  ) p r |] (3` SH8H8!S"/ 0 14 6]<A6 BG@D"HFPIQ"XL`O dR\hSpZSxxaMbMqrcucYdf\fA6k03n,!@@oHq,!Xr` ] ] ղղڲa ղ]G ղ / ?4TD ;r;Y EFGHI ȳȳͳwҳ mnt ȳ ҳ  6"JddLmap; Q"t +?6rcuY D+; " #T nid&-+4+7YR޵SUXYZ ]c ; dM(6rcueYHgXj` idmpptqGxru + ޵Q" ; " $,!@@-c lru/0Q" ;_2 nr_3 ns_48  + hD+" ɶ vall ] 2@@h8hh+hhhhhhhhh7knhhh@hi xh0Xh0Zh0\h0^h$h`hy h; hh hhh$@ h 3h@@h@hxHhxph4Dh"h#A6h&V^h)f\7psih,7bpfh/ h2" h5#Zh9E :+bbbl6rcubmYbn;bo 0bv6bx0by IbuO'=xb+(brbt+6bbbG ܹ bѺbb ֺ  +b rPrPѺbTb keybrPbMbvb^b&9bb H8b H80(bb+b+bbb ; (bbO'Z b%bb G bB$b'BL޼ ;hh+0Q"8@ uid DPQ"X `$& haa ;a gida  (D"D+MaBaurcuaY[޼ @\ +?8dŽd d! d"+d#ld#l d$+(d$+0d'd(ld)ld0"d1 d2 d3 dC=dDdLedM dNe=8dQdR dS=dTMj Ž + Mľ +ľξ < +?)/06|7| +IJQ R(U0V8^@fHkP+l|pn~q+oxq|rsu+vxyz{       ( 0 8 @ H P X ` h ptx       0WV^+Y ` 6rss Q08V^@ X  fn % arg  | +" b SgS-gTgUMgWOgX^gYY8gI qgJ iocgKU 9- g\]0O" val" val< i2n+v8_`Q"ab)c )d 6rcueY reff02" v +%  ". 0 4 4W5]6W7 gg +qlv{ D  (D PB] r  T8T8(T88 pHGЯ()*+ ,0-A6@. ,!`/ d0h1p2 x3+4" ! val  ]6QBE=uidF D=gidG (DH !D]J-H/ Q Q Q Q Q  Q( Q0 H88 H8@H+ ](], Q0 Q8@ ! @8}9:;<= >(?0@8  B XDvEFG HI J(K0N 8O@QHSP B{B Q ! xYZ[l\l]l^l _l(`l0ab8cb@dHeLflPglXhl`ibhjp8~]]]] ]]]ino  H( H0] + 8]]] ]]]]X @(c08c@HP8  ] ;;" ^^E ^h ~}W8  ] 7 0 H7ops!   + / + / +GwT$}$ 83456]T wy  \ (0 8 @ H P 5XX`lh p x  $,J+y-/6 7 9 #; ] #< ]!#= ]"#> ]##? ]$#@ ]%#A ]&#I ]'P(S0VI8 W +8 X@Lwb[-H \P _X `\ a` b h c p d x pn~ KM KM8D\EpFKMraG<I +J] K]$L(M+0 pKM]Sea pKM]] <KM<  T 5w|! XKMն: l] q KM pWf#f$ f%+f&f'8 f(uHmaxf)]Lf*Pf+LXf,`f-hf.xf/f1(f3f4]f5]f6]f7]f8]f9]f:Qf;"f<`9f=) f>p(f?M0f@ ,!PfM ,!TfQf\XfRf\xfSfT<p w|G%$d$]dK$YYGp$!p$ uG$W$$ ;$ ]2@ZG[M\p]^` b(d0e)8fL@hoHj)PkXm`ohppr 2xs_uxvy{},EG?i- bdijrl+m+op(q8rHs ,!Xu \vw` x+ y+ z+ {+ |+  +( +0 p8 h l ,!p x \ \ 8  H pX c c    EQ2<FP(p O!pidM|8uid DD $ . +]] ]] G S$A6$ ld )Y*Y$+`%$,$-ZEP20  8hW +    ( 0 8@+H?P+X?`bhp x      v"?))* <+ <,'Z-. /+(0 09 f4:KM8< @=,!D> H? P@XAA6`BCE FA6HIK +Q_?`r idl+&9 +0+8c@]D]H]L]PQ"X+`6wbQh ` p A6 7 V^LdevZ 85 Z( ;0 X.w Q + Q +$E Gl] pos E ] ;p" ^p;@ pGc w] p Np p]+ p`. +p Dp0 gpI pl p +p++++Z Wp] *pW] MpMSeRW/ paLp pp] pp] ]  /] M]4 GkkR u  ; r  ) LG. orQ rft ]  S] 2; UUllZ7 xd p]r} pr   ""' E"1 tmt %e + Jt@]    + ?0 XX]D .;g L ; G B  //4 >C kGM +bio־)  +e  4B8 @LHPlXV` `hpr  t ex5:* D. Sii # G(EFG modG  opsH!I :J K)  $;LW=argM =strN=arrOVW]X;W \ max^]_] num`Q opsa!b0(+)h&9 + <+q ] . qk, Q +7`-. mod/ @0H mp1P2NX85:6؍7 ]9 ; <(= 0 SSX;: SXGb G   @]>X8EmodF 8GXPpjqrst]cmtnw  ];;Nch +[!j[$`[+!5  ]-cȺ @c  id clss ;</4z]]+@]@]8 z0@!"E@@]1@]B@]Oc#d&Je2f4g lidh #7AFlUZArcmais01G2 H3G46X7`8h9p:x>+?}@/{0 ops1"$ dev4Z56(78(?@^G id 6dev_ l A S   !#( &G0 )8 ,@ _`a^pBCG idDE G H K  L (O$10Rt8XG@_lHbPhTiXl `r awdxyh efGg hiP# 8,9G adr:,oGt6oL | ++ Q + Q + X + ] get put   ( 088[@oHoPX`hpx7KQ]R] idS]T]{Pfgh]i2  ] ] ] ]G 8]G] []G = Go]` ]t ] ]G ]GG]]b ])  7]]# K< ]l$m$n$o$psstrq  + 0 + S + l + G# +GjH$k$r S ; T ` rega] defb]c]p]5p P  ops #Z ] ;PU_isrnet}0nsSxu@ \W( VVSVSVS0@V5V5VS< E +0ViViVi@V''E@Vn ]V*    ]V>& 6 + 6 Q"P + ]   ] + @      %&J79 @0 A-` D G J  Mf\  +% - +% = +% ]m ]) ]9 ]N @Tg6seqX dC@[Bd^Sagdl8+iw@@ Sw + S + +JƢƣƤƧA6ƪ!0ƭ58ƮlpƯlxƲ\Ƶƶ ƹ Lavgƺx ƽ  ƾ;( ƿV^P h l A6p   S l 5 l l  S  + l + + +5 + + ]h+     8h knhh+h;hh ssh^h h h0h@ idhPh]ThlXh `hf\h+h\hchh^h  h# h 3 h 3 h 3  h 3 (h H 0ha 8ha @h Hh Ph Xh `h hh ph .xh .h .h 3 hhhidhhGhGh; h hh h h] cx + (hDhEz<hHlhJl ha" hfhgxhmx(huxPh{xxhh hi hhhh y  +  + 2@hA; hBhE]hH hKcrcuhLY 8hS@@hVhY h\]h_5hb85  T D+hl hr85hs+@hy Hh|]Ph]Tssh^Xh`h phҊxh h h hh h 7h Lh h h oh h ; l c T   b c   c l  c b  c c  # c 3 c( H c8  a LcM  u u z f  u    \W   \W  ]       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu?@ Q"+@@+@Q"HQ"P+XQ"`Q"h+p+x++"@$ min%+ low&+'+ max(+)x ++++ ,! (A68f\X ]E>NsT Ze>$,x xx )l++0 (D+('sZ(0hvma1`.2 T3 +4+5+ G>$? r+$@ +`. `.+ `. `.+++ xx] x$x++  +8`.) ``.+= Gt`.e `.Wy W`.+L $,`.+ ]v;     0phh ](" dC,0,.hh0](1 , ] ],?E cnt@ AM ef\urcuYMN <P]R] T]`l]B ]GQ[ Wen5eoep]eu#ew ex `ez e{ e~]8e,!<eU@ef\Pe\pexj ID+J nr i   + ]!x! ,!;;8+`+h+p- ATM]H ,! Se (V^0!A] ]j-A jCh idjD refjE ;jNjOYjQ ?@jWjYYj\'j](j^-+jl@@jp~@tjq@ jr2 js!hH#t +H + +(jjlj atjljMjjurcujY@j^j@^j@ Q" + H + D+@]jC<J~ff ,!f0fff(ffF  +  8D+"ύ1ώGϏ6ϐ retϓ1T uVUVWX] YZ _` errabЭЯGвг еийкм п&(0]4]8<;@;X;p]]]]]]]]# ]# ]# ]# ]# ]# ]# ]# ]# ]# ]# ]# ].GGWG $. $ $:  mV;)<] )=]!)>]")?]# BO  srcC]D]EHw  maxI keyJO J0Mp"N1bQTWZ]] `p"$gU8jDmEpFsGvHyL|]PTӂ]XӅ\ӈ]`Ӌ]dӎ]hӑ]lӔpӗ#"xӘӛ"ӜӟӢ"Ӫӭ"Ӱ" ӳ Ӷ ӹ]$ Ӽ( ӿ], ]" +w   " + " + ]" + p]" ]#Jpw$x$ devyZ{" rev|]~$ Ԁ6PԁXԃ| `#ԅ] Lirqԇ Ԉ ԉ Ԋ Ԍ ԍ] ԏA6 Ԑ Ԓ$ Ԕ Ԗ$ Ԙ$ ԙ$  ԛ  Ԝ  ԝA6  ԟ a@$ $ + b$ +$ $ + , L$ +$N$L i <b%fll=]>] r% +b%"r% $   % +%Q% Uz  & +%^& j& vZ  _& +O&|_&  L& +z&& & & x   X ' +'&K '  X9' +)'K9' .Ԯq'q'#.Q 'Z.V 'Z1N 'Z].=']% W 8'% U. ;(. =.(:Y q*6Gq* .y *].y *]v*$ lO*$*I+O +$]QO,+$]].?H+++].u_+1b1u+6O+$1+61Բ+q'v+$.y +]1,)1,6.24,Gj1O,).l,BGjv~,bO,$]]]ve,bO,bO3,b1H -Z1J )-Z.> ;-6.> M-6z.Pz&q'4}-v'T14i .iH+T0v*_+t(b(U'l.UsTMQsU'.UsTNQsU'.UsT!Qs(.Us+.Ts yyUsFP&q'_$FdevZ,Greg]val],F, *,FretFiB+F`t`r`o`l`a`_&0 U*UsT Q Q31,,,,,_K1___k1_H_auɅ1%I&3*2 0F !qS2!|2&*2T &*2T *2T Q *T Q &l3P3 0F ,T &43 0F )3T Q R1X0Y0,U|T Qv54 0F g4 0F 4   0F 4 0F 4 0F /5' '0F a53 30F 5< <0F 5I I0F 5X X0F )6_ _0F [6f f0F &66p p0F ])T & 76 0F ])T &`7D7 0F ])T &77 0F ])T &87 0F ])T @8 0F r8 0F 8 0F 8 0F 9 0F :9 0F &Y9 +Tv9 0F 9Y Y0F !94r(:4q]:!iV3;i/-i!5:AwM**i;UsTNQ # R X  +T  Q !`M b<`/-`4i ;iH+T0 +;TIQ0_+';UD,h<Us,?<T Qv,T Qv4q<4 <4ق@/=,+U T Q24i mw=iH+T04 =!M">_ly~,T Q3XvYv4ȁ Cj>ځ'T04 b>v'T1!M-?_ly~,T Q3R2XvYv4M!:?_ly~,TvQ X0Y04L?'T1+@T1),@U|Q})K@T 4,c@T},h@Us+@T0*@T0Q~*@T0Q~*@T1Qs*ATIQu)8AT Q3t(b(]AU| +yAT0Q0,AT ,AU|T Qv_+,AT ,'BU|T Qv,RBU|T Qv,wBT Qv,BU|T ,BU|T Qv,BU|T Qv+ CT},5CU|T Qv,`CU|T Qv,CT *CU|T vCUs,CT Qv{CUs((DUsyy6DUsaNDUs,sDT QvibDUs,DT Qv,DT (DTd(%EUsT!Q R Xs(bEUsTNQ R Xs(EUsTMQ R Xs)ET Q~RX0Y0,ET Qv(Us Fq'F X+F +F 5KUF;K=q'kMGedev*Z,q'B9'&qGK   QF% &HG, [  )/\5O,U Q !G˂++kMIedev0Z,q'B%I&HK  QFH%&H,[  )/\5O,U Q !H˂v*v* X%I +IkMJedev1Z,q'BJ&FJK  QI%&J,[  )/\5O,U Q !oJ˂++ XJ +JkMKedev+Z,q'B&KK  Q0K%&K,[  )/\5O,U Q !K˂v*v*lTedev3Z,q',FretBT&7MK  QL%&M,[ )/\5O,U Q iM 0F M 0F &eNK  QM%&fI I0F pfP P0F fY Y0F ff f0F go o0F *%gT qQ|*DgT Q| +bgT qQ3igUvTQ # R1X1 +gT q +gT Q D,gT Qs,hT Qs,9hT Qs,^hT Qs,T  Xh +zh* \iP*3q'!ق8i,+U T Q2!ق1ri,+U T 'Q2H+T1m$i;$9q'5 i;2q'Rret mlS-q'S yreg%]S]S(]n +val]zretB+Fj 0F j   0F {EkU`!ml k}l]قk,+U T LQ2]m k}***lT|Q,KlT Q|Rs,T Q|TlU3+bItyirq,S7nq'valU\zretBYt2m 0F bm 0F m 0F m 0F m 0F "n 0F Rn 0F n 0F n 0F n 0F o 0F Bo 0F ro 0F o 0F o 0F p 0F 2p 0F bp 0F p 0F p 0F p 0F "q 0F Rq 0F <(vqT $ Q\R3,qT ,qT ,qT ,qT ,rT ,=rT ,\rT ,{rT ,rT ,rT ,rT ,rT ,sT ,5sT ,TsT ,ssT ,sT ,sT ,sT ,sT ,tT ,-tT ,T  XYt +Ittbxyirqt-St8nvq'valw]dzretxB%Iu} }0F 6u 0F fu 0F u 0F u 0F u 0F &v 0F Vv 0F v 0F v 0F v 0F w 0F *5wT & Qd,TwT ,swT ,wT ,wT ,wT ,wT ,xT ,:xT ,YxT ,xxT ,xT ,T kb#dyyirqk+Sk6nmq'BtyHyo o0F ,T  Xty +dyN{SN,q'&ynR/R ]MWcz_ly~,T Q@R0X0Y0]`z l,zUs,Us]\{,T4]]g{ l,R{Us,Us;-{Uv)-{Uv)-{Uv)-{Uv)-Uv$(MS$+q'zret&D{9 |*/-7!|*/-7,|U},U},U}]M!? n}_ly~,T Q@R@X0Y0{/ /-'4Yeaσ   a   +-64z  z aZ  jaB  T_la R Äτ Є-܄--$ -)-U}T4{2 ڀ*/-74Ā*-7,U},U},U}]4 ,T4;-8U|)-U|5*map5$*regG];]*val*]mF*devF>Zm5ȁ*dev56Z5*dev8Z5*dev6Z55*dev5ق*dev:oK+8A b@D bHG+PH+XK?`,N@TMWMZM^Mk 1mMp{5 q5(t+8u+@0fsxNH{NP~NXN`=Rh Rp F:x F: F:=+ X\R AX8~> b  b 6 A# uI 6( v8 R@  qH RP RX R` zSh Sp +x S E? X  b  b  b M9 2A  T   D  D "T )"U    ,U0  /68  XX 1U\ FU` /6h  PU       !X "X # $+ & b ' b ( b ,)4 3ZU C% D+ L_U N+ RoU SD( TD, Y+0 ] 8 ^ < _ @ ` D ,a4H d?X gyU i> lU w x z+ } ~U  b b  % v v+XYWWWX X(X,I0ercu40t9@ DvH8P#Xxt9 q "-X 7XAXq  b >,4 !"4$"4,.4<KX,F@@[H  G   "   l( P%0 o8 @ #H #H #H H #H #H #H #H+@PhGG X/60kp# X(X,0 8@ABXD (H{Pemem-@+ X>CMW ,(q0X8q@XHXL\PXXa`Xhfp BxXXU%pXXX%q X!%"X%&(9X:?AD F vP QX(TZ%05 ;4cs=b4sl?b4wfeAb E{4ssGb4stiIb Kb4nmiMb Pb Sb0 Vb84lmXb9 ]b: db<5cs!5csxb5ss!5ssxb g r15m+ r14n+ r13o+ r12p+ bpq+ bxr+( r11u+0 r10v+8 r9w+@ r8x+H axy+P cxz+X dx{+` si|+h di}+p+x ip+{+ sp+ BC!D! E! E!(4sE!,4dplE!-4pE'!/ F!04avlF!44lF!54dF!64gF%!7 F+!8+++++  pte"  pmd"%2%%?%/a' Xpgd'?'"?ap ~pudp?p"e?@HI+1oCo0 v4+8e f+gBhL uBv5w5 keyx  G UrV vjkeykQnkeyoQ ;<= ? X @ X$ A X( B X++@@V 2sp+es ds"$&+(+0$28+X+`cr2+h+p+xC2+XD++ d1Zfpu 0@Xk v`  (   (u  +@@ 1u@U{@X  K!1s  2t (,`t027t8Xjth%cup+xs qhu(PUmu s~& "  &-"!!M"5val v! " a"-",M"&" " " +" vm"  ""a""  #  #n!n!  "A#"a""&# ###A#### ##X#+,$$fmt$G$G$G$X$G$G$#%6A$%7w%88%$%G%G%G%G'%X'%X'%4X key%9$(X%=$ 8%UP%%V mod%WP%%XG%YU% %Z (%[ ,%\$0G %u%%v%%w%%xX%yXA$$+ L% + &/%&1X set&3d get&5}&7 PX%G'P%o    ( 08!@" 5H# SP$ SX%l`&h'p(x)*+,/-4./ \0 1 H23 5 9 ; H>?k@& '!'('% '+ '-'/ ( O((!5 key("5(?}((A+(B((C( }('( (=((>qO( +( + ;u (?( u ( +) (+@A@*+2*@*$!*&5*: 65*<+5*=+5*>+5*@6*Ab6*Bb 6*E'86*G v6*H+6*K/66*Mv6*N6*O66*Q6*T6*U66*Vb6*Wv7*X7*^+7*d+7*e+ 7,*i@@7*tx@7*yX`7*{+h7*}Xp7*Xt7*+x7*7*+=*=*zx>,*@?*$7?*<?*QA*A 0+c++dG+e+gؠ+i +l (+ ,,,b end,b- -  p., cwd.D swd.D twd.D fip.D fcs.D foo.D fos.D.,.Dl D, +&.*, rip.+b rdp.,b&..- fip./D fcs.0D foo.1D fos.2D .))-,,0.@K-.AK-.BK- D[- + 6.$- cwd.%! swd.&! twd.'! fop.(!-.5D.6D.9- .<-.>K-o)- D- + D . +? .Q. cwd.RD swd.SD twd.TD fip.UD fcs.VD foo.WD fos.XD.Z,.[ l.\ m.] n.^ o rm._ p.` q.a.x.bD" . + b/ +@.:H/.; b.< b.= H/ bX/ ++@@.O/2.P[-.Q/.R/@ /-+@.^/!._ ,L.`[-!.a .L.bX/@!.c/  0p++@@.f0.hX.kX.nb.qbxfd.tb.wX.zX.X.X2./@@.0. b.X.X fpu@._1.X.+._1._1.0 .002. 0@@ 0 / 1/ b/b L1 + L1 +? 010 0! P0" ;0#1 b2 + L2p+ $2 + 4242 +92 >2X1l2(1212 val1 D1!D 1"D1#b1$2 D1*21+&31,#@3 2322 2 3@33Z3 531'|31({1)H221.b 1131231314 15+16+ 3(131%l21/E317|3 81,41+ fn1 @43;4;43,4 4>44?+4@+4AD cpu4CD555 684694 6<46=447< 57=X7> v 7:F57;44 src7A! dst7A !X8v5 959 5 5 : 5: ; 5; v<5<&# <65<5= #6="=" 6 >)q6>*(>+A# osq>-5 >/ (? 6? ? ?@6@+@6@66 @ 6@ 6 @#7@6@6 AL7"A 6A  A g7A6XB 7@B'7"B(#7B)  B*8(B+80B, 8B- 9B. :B/ ;g7 8 877@@C/8C0l\C1XC2 { seqC3 AC4 8C5L7 C6v\0C7 88 (D8D D+D 8DD 8888 E9EE vE!9 9F =9F=9 +M9 +F8&9 Gt9G vGY9 H+9H,H- xI9I9IX`I+h maxI+p +9 + J/:J bJ bJK F: sigK=9K/:LRLSj:R:LULV:o:qM:M M qM :M':M(M)M- ;M.M/M0 :M1M5Q;M6M7M8 : M<;M=M>M?M@MAMS;MT %MUqMVq MY;MZ %M[ M^"<M_+M` Ma MJh<MLMQ MW;M\;Mb; ME<MFq"<Mg<Mh _fdMiMm<MnqMoMpX q M%<=M*:M2:5_rtM9 ;MBQ;Mdh<Mj<Mq<&0N z=N N N N < 0N =<=Nz= Ou=Ov nsOw<{ uidOx AOy vOz O{= N ">N!N" F: N%d>N'^:N(+N.{:N0 F: N3~> saN4"> P >P ,P + lenP +P  (Q>Q u R$?R%R'R( 0RDE?RM#>RP(RW) 8S ?SbSbSbSbSb S#b(S,b0 T)?T*bT+L7 PT8 @T9 @T:XHT;XL ?@ +8TDQ@"TE4TF/6TGX0 U>@UKUZUpUUU endU@ L@-+ V!@V" XV&@ VD AVD@VD@ VE2AVE@VEAVT bAVY2AVZ 6V[>AW A valWW nAW A valW W ASAU bV bWA#.X[B0hBi@jkAcpulXmbnb ob( B+C+ DK@@C b b b D D+ +(+0X8+@4E b b b b b  b( b0 b8 X@ bH bP XX X` bh bp bx  b  b  b  b b b b b b b b b b+@FB2 6! b(" b0# b8%@&P'Q(R)S, bX- b`. bh/ bp0 Xx1 b3 b6 7F9F;F=+ZavgGC@4E F0K GLM+N+OX P$Q&S G(F?]G G/G/G4GK`H2a6h bi b j b(k b0l b8s X@t bHuXPXXXXXXXX27X27rqHGH/G?^HHvH/GfrqH I7X 7X 7X7XaOI    uIrb IrsDIIuIn II I HI +(( IKJZjc ;@ vD vH6P+` +h)fp+x J6jc qIspidpX7`KX9 t9X:XX; 6X<0 inoX=bX? X@@XBbH/rcuXC4`XDpJ uK + YKYXYcuKZoLZp( uidZq A gidZr A Zs AZt AZu AZv AZw A Zx A$Zy X(Zz;0Z{;8Z|;@Z};HZ~;PZXZM`ZMhZMpZMxZ qZZ<{Z=Z1KLskey[M[t9[@1[ sem[jc([P[ qX`[ \Yh uid[ Ap gid[ At[Lx[|[~[ [+_[M M M  N N H\ N\! t9\" \# \$ \% \& (\'0\(8\)R@N6X]^=R]_t9]` v]a]b ]c]eb ]hv8]k=@]nX]q`]sd]tvh]wp]xXt]zx']X']X]X]]"]7]  it] ]]?]0h] v]`K]Btty]E]O] bA]b] b]b]b]b]b]A]+]+]+]'+]+ ]+(]"+0],+8]+@]+H]"+P],+X]+`]+h]E?p]]T]]f] X]p]]]] ]/6]jc0NC ]R]6]t9]b] BR R R^R^^R R _R_+_*R X`czS`d(`e v`g `k 6`m`n(`o0`q\8S S=6PaTaa t9paTxaaa a a aaaaa"a(a.a/a0a9 a:(a;T0a>8,aA4@S T b"Ub/bb#T 'U AU + AU KU UU +oU +Q@ tU ~U 9U +6@cYW/csscN idc(gc@t!*@ccc6 c\(c+HcPc XcccccHcM*cR*cR*c+c cW(cW0c8c(g*HcPc='`cl*c xxcd{c7|*U0cWc̐cYWc v1* ^W WhdyXdzwid|Xd}j1Ujdj(d80d+Xd#j`W X (X 2X ]nr\ns8 wqnvC]H cpunwP >]8nz}]n{\/rcun|4 wqnC]0 o]oo oph]]-[]q@pz^p{]p| qp}qp~^p] pv(p^0 irqpX8pX<p+@p+HpGP dirp^X] ^3p8p ^irqp Xp\p\p _(p )_0__I^^$_$_\_ X>_ +0p2k_p3u p4X@>_.Xp_Xp,_  r __ ` ``6@@sCbsDLsEhsFtsG_sH^sIXsJXsKXsLXsMXsNXsO+sPXsQ vsRsSA#sTysUp sWp sX_sZ(s]+0s^ v8s_b@saXXsbX\scX`sdXdBdirsg^h|rcusn4psosq/6srssP%stGsv tbtEb tEbtEbt#JbbEbu ![b (ubuXu qubu ubbbbXq[b u#bu$6u%u' b}v v"cv7cv6v c veccvXvqq (w0cw1(w7( osqw95w;A#w<3w3w3w3w3w x+"dx,A#x-\ xydy\ydyd( leny(HydPy p "dd + +d + d +6@zezezez "z6@@z 'dHz!+z"+z#z$8z%\gz&4 z'f0z(+8Bcpuz*@Bsspz+MfH (e + `z6fz76z8dz:d(z;+Hz<fPz=Xz>\e zeMfzfX sdazggzh#zig fCxzDgzEfzFgzH zI/6(zJ6HzK/6PzL+pzM+xzN+zO+zP+zQ+zR+zS+zTzU+zV/6zWuKzY vz\+z]+z^\z_Mfp fg +dRf{|3gggg+qg |6h|7g|8g|9 0|ACh|Bjc|Cg(}eh}.}.}"h}#5}$ }% }'h}( }) }+h}, }- }! i}&eh}*h}.h }3iCh ops}=ih 3i8i }2wi}4+}6X}7X Xd@iXdHi dpjdqidrdsj j&d.jdBid+dUj"d4d+Hdjj j.j@djdid+d+d+ d (d,dj0/rcud48dkHjj i dkd idd j.k-+ dIkdNk Ik (~k~A#~X~~  .lb& )jc ldt*3l8.+@9/6H:qh;Bmp= vxC!|D~ .l =mq+ alt+++ +(t08@HPX`hpx !8l=mFk&\wm^ q`XXm5lruYSmdeimj +k+&(RmwmhJms+ &(uFnz+ pp{Kn|+}+~( Fn&gn+&no q oV ref̐8uKH hXl+p ops !xqo!nH(QCommPngnU4eoX va ~oval+?eoMMoN qPXDJorlruKoDWo!X q!Y~oM@G_pI+oUJV + o([ v0\ v4^+8\@F}poLjM(mpn+o+q vr vs vt vvX \@lq}pLzM0}gq~++ q q q  q(M q++\@|qqgqLKDq1_p1p@1q?+qK r  6 G  J q Z(X0X4M8D@P p  qx#$ J% J'1qq5&sctx6+s &s=[s>\@@(XxsYjc(\sb+h+t7w }$Ms++\tsL4D7t!q!q `tZrb6+[s etb^uc "h "j."kB"qe" s!(t~"0u"8w"@{!H~!P"X"`#h##p<#xot^u0sxsubcid @@ u va u+ YW@@y1u@7c@+P+X+`+h+ppgd  x) v5 v?yE+LXS vZA#](_a6pjcr+++++ +(+0+8@@6D+H+P'+X3+`+h0brk+p!+x++%+0+yy@zGm+h6p zxv<{s&F{++ v v.k(\P{++( uru +y +3 Sky + y z6hOJ<{OKOL@OMON<{OOOP AOQ A nsOR OS+OV O^O_MO`jcOeM@Og\H|setOi hOjCOl=OmOnd@Oq`z A{ K{ +d{-++{-/ 6? X{p/,|!7,|(pmd9 0pud; !8!@EHFPpteL XptlPX`T h.X| @(((((36393<3G |( h*u}*v}*w+` } +X*}T}X*}    X*         !"#$%&'()*+,-./0.X*@G@**+*7*d*8*9*U*U8*kx***(0gen* )0seg* **b0 9 + + + U + + + +k + + + + + + ( + + +H*seq*+****( % + + + +**Iseq*+*+*N*j***G *eI*fׂ*h6P*n+X*o+`*q(h*s7p*u+*x@*{*(*| j + + + z +*&seq*(+**_U*, *. 6 bׂ + +  ++@** 6*** *** * * **  + @*ۃ*ۃ* *  + + +1*&**& 6 +/.X*l+@*7ц*;d*<+ *>+(*?+0*Jц8*M`*O(h*P!p*Q$x*V*W*X*c+*(*+*+*+*+*G*+* bA*,*@**x*+*6,*@*+*+*7*+*+*X*X** * ,*@** `  + | + ( + ( +*F*F*lG *h*h x + ** 6**+(**+*+* +* +* + bl@ + K' + b7 + (L +/ L 8+22++ +(0 Xψ + G opsp q X(X,/60PtX` gc"uh devpx SXψ[X @/o0t ops1" dev456(7 8  get put  %C % W( p08@ϏHϏPX`hGpxe~y+z@pe HGPXbus`Oh qp qx/6 2 j o y  0msiR( 8 @bHbP X `h x  TXt W0idD6 z!!# 9$ % '# )+ `, a- b. c/ d9 e< f QRX idSXTo PfgthXi.ttt%t>>z*WHpG\GXquGU%GϏtԏtttGBGGXXB``Lq~tjXt<ǐǐ̐ in+ve8_``(a`b` c  d /rcue4 reffǐ0  v +%j YXML (((((( (@()))))) hXX q((@  8(D irqXS( ( q0LG G    ( 0 8 @ H )P =X V` Vh p x      =  8 8 [ y   ! # =$ &+--YX(((((( (@()))))) )@))))))) )@X )p =.VXBkkp x0 buf0,0 0 0 0  0 (0 00/68 op0 X0`0 h0qp[..3 Vp_V=yp_`q~Xp ,- 6/ ;0q 03M4678  xa9 idrXX Ř+6ʘ rev+ Ř  v vG/rb6 nst0X8< c>ƚ@ idb` qhp/rcu4x  ops! h֛ "$ % ; & P(( s02 89@: sH= P@XA ͜`  5dirϘ  › knsk q/6 /6@`h ,x    @  A %cuћћ›ћۛkqqkq;kq"Pkq@sћ,U?ћ xћ ͜ћX 0'R(Ҝ) * \+z, - PX([qWtppu a[t ܞD cX  bb ino)b dev* W(+ W, uid, A0 gid- A4. 8/hY@0hYP1hY`2hYp3b4b5D6D7b8b9D:D;D ++G+ c+m&+nƟ+o&ПX+0+1ܞ+2 +3 q+4 +5 2(+7 _0+9 28+; _@+= H+?P&˟&ڟ՟c @@AGBCDb EȢ( sdF0G\8'IX'JX'KX'LX'MXܞߟcؠ՟՟ݠ[J2s˟, _s՟,7s՟ds՟ +ڡ+ + ,ߡG `b 6 TX 0tâu آvݢw!x*y z =(gâآ͢ڡ+Rt 338AAC }~Bbuf , + , +? Lţp+ ,OţG''EEB1J st cntsXYu 0+++ack+eoi+ +(GPI-~_8D@DD 2Hx!T"A##q$ c% x& ' ((X0)X4*D8+D<,D@-XD. qH/+P0+X1`2h3xDcqTxDqhI} -+.X@Ѧ RASXTXUXVX WX gcYA P-+8kݧlGm_nXoXpXqXr s (t 0ݧX i      wy + w + bi+  idi clsȒCHH X@t LX + Lh + D ,q t 0X1G2 h3G46X7`8Xh9Xp:Xx>+?q P?@tAB D + Pe2fPhs mapjk lث q(s 0u38v H@wkHPX7nn]UXSxXӫXӫX%V NXXqݫXX3H8kn%V M2Ѧ z -+`56t7X8X 9S: ;X<X =$>G(ops? p0@ q8E@G'HH PI XP +@ ȭqf 8fGq c q(q0 st vubk Ʈ"6CXC1K ( set60d8i@HPƮ& HHhrcu4YXů" h pİxůh6}/dir; `d"Ʈ6X;}6n6C38İC qɰ q BuDuEzFGȱHIq  !X"X  ñ&A#K :@ɰͱN3O+P Q  (+, -./  0pqsr s &t qu v!$(3 "#7 &7'7' <7&e6 HUA1e&34D len4D2Գ6b 18rԳijkbrRstUu4R+TXU2AVW0XԳ YZ0[_8_"+``ha+pbqx"dmn/d_uv!RR+x{Z| c}~ A AX >>! (J0 q8+@kH WL P \YX \Y` \YhDpDtDxD|6 9 /Djc++!! t0@H vP vT vX v\o`h,Ip8oH P(X`h qp5 o +'@&..Qy ( 0 8 ƽ@ HqPX`o&+@ W+  o(!0!8@" H+P+X+`0hjcp vq&#5?$NS   s  X (,` qD\Y\Y!D"/ H0 1 4 6X</6 BG@D"+HFdPI(XL`O JdRC]hSpZ<{xabercuc4d\f/6k0,n6@@oHq6Xr`0X.0XGGL+Գ3tGXGtVG~00ƽ0Z,0,˽ E+F0GHI::?D l mnt : 0D+lv00C־־Bmap=9 ( +?/rcu4 ++-+ "#; nid&-+4+7YWRPSnUnXYZ Xc t9 duK(/rcue4HgqXj` idmpptqGxr0us+ddi0P(  " $6@@- lru/x0(  X2 nrX3 nsX4v5  + $-+ ; valb$X kzqk+@@a2aNa+aaaaaaaaa0knaaa@axa!Xa!Za!\a!^a$`aaaa aaa$a ,a@@a@aHapaAa"a#/6a&ba)\0psia,h0bpfa/  a2a5#-Xa93 6;+ 6[[ [l/rcu[m4[nt9[o &[v[x![y $[u5x[+ ([r[t+[["[G Xq [M[q[ R' qb +[nsMMM [[b key[M[H[[U[6[[ \Y[ \Y&([_[+[+[["[ , ([z[M [[[ D [!['z   Z t9Sk+0(8@ uid AP(X v`$M#h ZZ t9Z gidZ  A-+HZZhrcuZ4Z d> +? 8]A] ]! ]"+]#b]#b ]$+(]$+0 ]'i](b])b ]0]1 ]2 ]3  ]C]Di ]L]Mv]N 8]Q]R v]S]TuK A0 + `K@ + @ J 9d +6)f/06w7w "IJQ R(U0V8^@fHkHP"lwpnyq"oxq|rsu"vxyz{   (08@HPX`h pgx      d k v0b"4 ` #/rss V 0u8b@ vX  J fn PX arg q D`Sx`T`UH`W`XU`Y48`I q`J ioc`KzSV1x `\X0   val - val o. 0 4o 45X67 +   A 9 A - PX c  hYhY(hY8 sHЭ(n)*+ ,0-/6@. 6`/ vd0h1p2 x3+4 val nzX6BE5uidF A5gidG AH DJ H      ( 0 \Y8 \Y@ H"i+ X(X, 0 8q@ i!P%i"@89:;<= >(?0@88n 33XDEFG HI J(K0N (8OF@Q_HS8P=##ZAZA-_Z#KxYSZ[b\b]b^b _b(`b0aX8cX@dHeLfbPgbXhb`iXhjp8XXXX XXXino  /( /0X S) + XXX XXXXXQt (08@HPtVXy)d3  G8 o X jc o0 H0ops!  Z + +  +Dw!}! 83456Obq&R  9 (00 I8 c@ |H P X`h p x-8 Ha+kkpC+-/6 7 9' '; X '< X!'= X"'> X#'? X$'@ X%'A X&'I X'P3'(S0V&8W +8X@Bwb[H\ZP_X`\a`b hc pd xWsq Jk 9J%IIN8DEsFJraG*I +JX KX$L(M+0>sJXec0sJXXq#IJ#5cN|;hJGVV-JKKs3PG_#3_$̐_%+_&_'q6 _(pHmax_)XL_*-+P_+%X_,2+`_-h_.x_/7+_17+(_3%_4X_5X_6X_7X_8X_9X_:V _;"G+_<6_= _>s(_?uK0_@ 6P_M 6T_Q\X_R\x_S_TL+#2Hs=aMRD!_!X\!L4D!!! 'ZD/!yU!4! ,! X / 9+@Z[\]^`$ bL(dj0e8f@hHjPkXm`oAhpnpr xsuvy{;}^C6i bdijl+m+op(q8rHs 6Xu v\vy`x+y+z+{+|+ +(+0#8hM$l 6px\\8̐H#Xt$    (5s #6pid`KF5uid AA $  +XX XX D !/6! b\ )L*4!+4!,5!-?Pq+0^  2^bo +   /H \( 0 l8@HPX`hp lx  C\ u u ltQ  &! +0 : DI6)* #+ #,W-.;% /+(0 v09 W4:J8< v@=6D> qH? qP@J%XA/6`BCE vF/6HT%IK q"QX6` idb"6 +0+8\@XDXHXLXP(X+`/wbh`p/6jcbBdev1(800X   L +$???GbXDo pos ? Xs|s,sGX s??5s!SsX+:ls XZsqssss +/s++++ Y\yUsX9syUXasec sksssXHssX aaXf MaXp0Z0XG0Z#Z>Z$0, LZ0c)j0Z0QZ0oZ0GZ0cZ0cWZ0Z0X<0<9#iiDXF0,sZbb ZZ0sXcZsc>;0"^0>@|0| c0| mt 7c +Z.X Z /ZHZk4\ZMlaq0 [ ,k0,CG WWZHuia z 0oGq # +sbio %9Y% v"$ %4%8 q@%He%PbX%` %hpr  vt %x&&* 5. DbLb# dXLp|G_ (&E_&FG mod&GP% ops&H!;&I +&J&K  },i&L5arg&M q5str&N5arr&O6 &V&WX&X, &\1 max&^X&_X num&`V  ops&a!;&bq1%0(\")\b6m +  +  X [   L +7 `--. mod/P%@0H mp12P2KX - 856ܞ7 9 ; <(= 0,7GP%GP%P%.X>AK8EmmodFP%2G@KPpqqrqstXZmtnwA   X,, ?}]bm> +' H RZMfZ uk z#m X + (+++++ 0-/rcu142\3- <-+ HIJK LM+NU{  :;<)  9!)")#) $)(%)0&)8')@()H))P*)X+)`,)h-)p.)x/)0)1)2)3)4)5))9..Um~.XlHxy 6zX|X}/6~0@ +8E7  7 !7 "7 #7 $7 %7 &7 '7 (7 )D6 uK Z@ @ A B C D E27Pb\bd v vX                Xm>>bbbbi  ~(0qos0 +Z,G id-./6 0d(1802+X3 `4 h5 p6 x7 8+9+:+;+<+ dev='> '? E _~5n ops) ) 9 9''X M=NGOGP!Q!R! Tb(U{0V)8W 9@X 9HY 9P[)X\)`^h_)pa)xc)d 9 pmfh,VV] `]aG busbdP%eGg h$j;(k@0m)8n 9@o)Hp 9PqXr)`s!ht!p pmvxw 9 pyJ[B{>Eg= `2L3G5!6!8{9 j ; (< 90>)8@(@AHC P pmEX,e>ecQzzLot>>38 0X YGZ![{\ y^ 9 pm`( X-;C E[,y>e38[XX+.X.X 8R 0}!" }.X1.XB.XO c` d&e2f4g lidh ` < t  ~  b   ~fcma         Q  X X X X  X X X$   X X  Q    X V   Z  [G \G ^X _X `'  a  cX$ dX( eX, fX0 gX4 h 8 iX@ jX  kX! lX" mX# nX$ oX% pX& qX' rX( sX) tX* vH x P yX {\ |` ~zh zp  x -  U  q  _  XXq ( ( X qV  XK K XP  2 YX 1r    0 ops #  X t9         fnet  0Rns <{= T(  OODODOD&@OOOD< W +&OOOW@O @OXO*q    XO>  +  ( +X%   X5 + @ ~     %&C7|9|@0A`DGJ̐M\  +%  +%  +%XX)X9^XN@T/seqX @@[._^Dadb8"i@@ D + D + +CĢhģhĤħ/6Ī!m0ĭ18ĮbpįbxIJ\ĵĶrĹBavgĺxĽv ľ8(ĿbP vh vl/6prDb1bb D + b + + + + +Xa+      8aN knaa+a8aa ssaa̐a a0a@ idaPaXTabXa v`a\h"aH]aaaa aa a a  a (a 0a8a@aHa Pa Xa `a!ha 6pa k xa k a k a aaaidaaGaGaa MaaaaXN  + (aD*aE9aHbaJb aaaf5agam(auPa{xaa aaaaa  +  + +@aAaBʘaEXaH aKZrcuaL4 2aS@@aVaY va\Xa_2ab1* -+alar1as+@ay Ha|XPaXTssaXa`apa֛xa aa8aa a ;a PaVata sa a#bX8$Vb=tX[yk !vT 6vT&X       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu6@ ("@@+@(H(P+X(`(h+p+x+""@$ min%+ low&+'+ max(+)  x  ++++ 6 (/68\XXE  N T Z!e3!   {!{!3!o++!}&`!8!`! +o!-+!+ "!? !@ "  "." +"B" 3"e" +++G"{~"{Xj"{"{++"+" "" +q"G" "# PU"PU## +% #<# +(#Xv#      0#Sk X(" @, 0,$.Sk0X(1A#,XM$X,$ ?$ cnt@ vAH $\hrcu4M%N #PXRX TX+%6% 6% @%E% O%`  %bX% %X% % % %G^n&^o^pX^u#f(^w U(^x U(`^z U(^{ U(^~X8^6<^R@^\P^C]p^x% &-+C' nr i ' ' +X!.' 8'.' x' 6#88+`+h+p'q';q''qq HK( 6 ecqK( P((b0''' a(Xc-( cC( idcD refcE t9 cN)cOYWcQ v6@cW)cYYWc\')c])c^)"cl@@cp@gcq@cr)cs!(H ) ) +) + + (c*cbc atcbc$Hc!*chrcuc4@cH*Uc@Uc@ H* (b* + b* )|* + **-+).XcC*5 _+_ 6_!_ _ _(_-+_%* G+ + + q6[+-+ ̍+̎G̏+̐ ret̓ +fclk+  +$+ ++  +$+ :H, mV; <X =X! >X" ?X# B}, srcCXDXE H, maxI keyJ},C0M.NZQ+T+WZX] `.$g8jDmEpFsGvHyL|XPTςXXυ\ψX`ϋXdώXhϑXlϔpϗ#.xϘϛ.ϜϟjϢ.Ϫjϭ.ϰ.ϳ϶ϹX$ϼ(ϿX, X. +,H, +. + . + X. + YX/XI/Cpw0x0 devy{/ rev|X~0 Ѐ+PЁXЃ,`'ЅX BirqЇЈЉK ЊK ЌЍXЏ/6АВ0ДЖ0И0Й0 Л М Н/6 П h@ 0 [+0 + +0 + 0 1 +E% E % E"% E#% E$% E&% E(% E)% E+ E, =4q =>q =Hq =- @#@#=$2 A `2SV Nӧ3232[AXY2SY2k_ALu2u2A 20XXXVV2X++V2X2_G V 3 `A( "3XqA8R3XӫXR3V SNI r3 bNӕ332NӫZ3XNJ 3V 3XA 30XV u%4%>GvV )4V  <4XV T4K Nry4X+Gu44>GvA 4044 K u24>GvA-4XA 50XXAp 55XXNptP5XqA l5K Np5X]]+Gq8&8XWN6NNNOO/86OO8PP56T-#P5T-#55TsWP 7PPP] QT#1T1QvWP n7PPP] QT#1T0QvWN58NNNQO8 8OOP8PP5 8T'#P5T'#55Ts$<4)4Z8U|$<4)48Uv$4558Ts$YI/CF&8Riretiaod 4iirq&4RRXwCerrXXXXXXX*:%$ %C *3:%2$ %2C *e:%>$ %>C *:%F$ %FC *:%N$ %NC *:%V$ %VC *-;%^$ %^C *_;%e$ %eC *;%o$ %oC *;%z$ %zC *;%$ %C *'<%$ %C WP/ <#P0P=PJP#z2T  Q R0X0Y0SFQP;Z=WQdQqQ~Q]Q~8QSU D=)U#^2U~SQ D =+Q8Q#82T0Q0SQT >+Q8Q#82T1Q0SS dZ>S$3$2WR>RWSe>S$3$2SSh?S$3$24-?T@Q04X?Q R0X}Ys4?Q R0X~Ysl5?T0Q R| $ &X YsN@UsT-Q R XsNB@UsT'Q R XsT4f@Q1R $4$Yy4@T 4@T 4@T 4AT QvPAT0$)4$44XAT Qv4}AT Rv55ATsPAT1<4AT|PAT1$)4PAT0<4BT|46BT 4^BT R~NBUsT-Qs4BT 4BT Qv4BT Rv#4T  SC +C$x RDTh/F?XThwSR8OtRCRRyR#2UsT R0OQDQQ^LRYRfR#2UsT0Q O RDR#2UsT0Q #3Usx EF2TonEXR8OQEQj5TT E>2c E>1`-[LLTirq`+F`6qRb8RcvaldXHiretew\L*F=i$ =iC *F=x$ =xC *F=$ =C QwPgIPP8PSPIPzT R OTYTeTkqT {rT8~T8T8TkT 8T#3U}T4QP{JPPP] QL#1T0Q|OS_J/S$3$3QPJPP$r3QXPJiP#W3T=OP AKPP] QL#1T1Q|OS K/S$3$33KT Q Qv3KT @ Qv$3$34LT $Y40LT #y4T  S\L +LLxS-[#MTirqS+FS6qRU8w\L*L=[$ =[C #4T IJ-[M9irqJ*>J5q@L8M dNA$ *MNd@N SM +M@SNF@*8Tirq@7Ton@@QOBpNOOP8PP5ZNTv#P5Tvj5TQ6N>6'89irq64>6?q*tOF*)8Tirq*6F*A,F+]F+$qQO-OOOP8PP5OT~#P5T~jl5T0QRR XQYXI P>,89irq9ret: XPmap 50reg GX; Xval *X:wPdev=:Pdev<lretcP9dev=dcP9dev9:!XQ;!@;"Slirq$X: XFQ; B; S:"Q;LX;Xops$p; qld:i%tQ;iKX:@qQd@A_ Rirq7X;A_$Rirq1X_LRirq8XclrK+_tRirq6XsetI+_Rirq:X;!2;__sRirqs$X;s@R;s R#:DSd:IjS>j(XIXX4X:oSvoSa$u+v: Sv !oSa (u /:u Svu 'oSau .uu 5lcz :OTvO"oSoldO*[ newO3:9Tv!9TI iT9v i?oS9old iG[ 9new iPd@ k @ k [ @ k @ k *T@ k T*T@ k T*T@ k Td@ k T0SlI U9v =9TI A!6U9ptr A^Y{I"U9key"JU>"Z(QUcU9ptrH>I,U9p,;ZU>,KXmEVEUmPRVPP] Ql1}VUUTTQl$YmM6=X!M-M89MYMcWrMkM{Mz_U NpU|UUzMJ!M-M{9MkYMMX8M_UNypUy|UU#3U Q mNSYNNNQO8XOOP8PP5XTv#P5Tvj55TQ'YX ,. .J .V,O,[s,,,,Zint[,,*,4s8g4u8z4s164u164s32-4u324s644u64A[ s~,.1[2[HI~X]^~_`O,,<[ <4  #p,%&*.4=Bh-l mn<} F P P [ [ S< vF_ O  .44 D D49[P\u  (val SQu,    .( S I (I I    e        [ .@  x  O].^.W!-@  3 [ [  I  9( [, ![0 ( 4 )48 *[H +.P ,X 5 ` 6 d 8 h : l ; p < t =[x:se ?D@$rt @8FBdl AF BF FHI" IF6 J. K[ ORI XWI ]WI" `"-C@ d h[ k[  l. m  ngI  olI( p{(0 q IX s` ub x d yHh zp {vI .               H     .B  6(" F6P$mm !h !p jJx         . [  [,  [,  [,  [-  [-  [-  [-  [-  [-  [-  [-  [-  [ -  [ -  [ -  [ - "[ - . 3$pid  X  X .     ( 0 @ JP KX  ".8 A P@ D PH G.P H.X Kv?`" N? TL WL ZL ^M k ,1 mM p5  q@5( t.8 u.@$fs xMH {MP ~MX ?N` Qh  #Rp  9x  9  9 = .   [ 4 -R  %A [ 8 >  P   P  5    I  6(  8  7R@   IH  gRP  qRX  R`  Sh  #Sp  .x  (S  >  [   P   P   P  8  @    yT     <   <  "T  )T    T0  58  [X  T\  T`  5h    T           ![  "[  #  $.  & P  ' P  ( P " )   3T  Cd%  D.  LT  N.  RU  S<(  T<,  Y.0  ] 8  ^ <  _ @  ` D " a H  d>X  gU  i{>  l"U  w  x  z.  }  ~'U   P  P     d%    S  S . [ V 9W CW W  [( [, 6I0Brcu  0 9@  D H 08P Wx 9  I "W W W I    P    >"     !"N4 $"N4" .  <W" F @@,;_H  J   "   o( %0 b8 @ UH UH UH H UH UH UH UH!@KPhJJr ![5$kp& [([,0 !8p@pApB[D +HPBmem0@. [AFPZ (I0[8I@[H[L_P[Xd`[hip x[[%s[[[d%I [!d%"[%&E(9[:?AD F SP Q[(T%0-;U)cs=P)sl?P)wfeAPE)ssGP)stiIPKP)nmiMPPP SP0VP8)lmXP9]P:dP<(cs(csxPG(ss(ssxPUgM r15m. r14n. r13o. r12p. bpq. bxr.( r11u.0 r10v.8 r9w.@ r8x.H axy.P cxz.X dx{.` si|.h di}.p.x ip.. sp.BCDE E()sE,)dplE-)pE'/F0)avlF4)lF5)dF6)gF%7F+8..... X pte"A { pmd"d%%%5/%/=' pgd')/'"=p pudp/p"/ @HQI.%hh0 S4.8ef.ghuv-w- keyx UV SQj keykn# keyo; <=? [ @ [$A [(B [+!@@!1sp.es ds"$&.(.018.X.`cr2.h.p.x1.[<.. 1:fpu 0@[!!( ! k("!@@)"%o@u@X{="5H#%m! m p(, n0&m8Xnh%op.xl Io(Tol u#  u#G,#fmtJJJ[JJ$`6#78 8{$JJJJ [ [ 4[ key9#([=$8U%V modW%XJY% Z ([ ,\{$0JuZ%vZ%w_%x[y[#$. Oy% . /%1[ set3g get57 Wy%6'%r    ( 08!@" 8H# VP$ VX%o`&h'p(x)*+ ,2-7. / _0 1 ;23 5 9 ; K>?n@% !'% + -/   (!- key"-?;(A.B@(CE( ;('=k(>I ( .{( . ;!{( v(!@A@ &+& @ $! &5 : 55 <.5 =.5 >.5 @6 A5Z6 B5Z 6 Eҁ86 G S6 H.6 K56 M6 N6 O}6 Q6 T6 U}6 V5Z6 W7 Xp7 ^.7 d.7 e. 7" i@@7 t#@7 y[`7 {.h7 }[p7 [t7 .x7 H{7 .= z= %|x>" @? $? ? A \A0!c{+!dJ!e4!gR!i p!lu ~(&+"+"P end"P# |# |p$E, cwd$< swd$< twd$< fip$< fcs$< foo$< fos$<$E,$<l <U, .$*y, rip$+P rdp$,P$., fip$/< fcs$0< foo$1< fos$2< $),U,y,0$@,$A,$B, <, . -$$- cwd$% swd$& twd$' fop$(,$5<$6<$9- $<- $>,J, <- . <- .?$Q. cwd$R< swd$S< twd$T< fip$U< fcs$V< foo$W< fos$X<$ZE,$[ l$\ m$] n$^ o rm$_ p$` q$a.x$b<M# . . P. .@$:.$; P$< P$= . P. .!@@$O8/&$P,$Q.$R8/@ G/..a@$^/$_+7$`,$a-7$b.@$c/ /C.!@@$fR0$h[$k[$nP$qPxfd$tP$w[$z[$[$[&$G/@@$0$ P$[$[ bfpu@$0$[$.$0$0$R0 $R00&$/@@/% ,1% P%P O<1 . OL1 .? &1& &! ʇ&" &#yL1 P1 . O1C. M1 . 11 .1 1[' 2('d2'd2 val' <'!< '"<'#P'$d2 <'*2'+&2',#2(2(( 2)2)\) -2''3'(d')1i2'.P '1g3'2l3'3'4 '5.'6. g3('3'% 2'/2'738'3'. fn' 3q33333*>'4*?.*@.*A< cpu*C<+|+|+|,8i4,94,<4,=4i4-<4-=[-> S-:4-;i44 src-A dst-A [.5 /65/ ;5 650 [501 v51 S252e25v5253 53I3"5 4)64*(4+ osq4-[5 4/(5 F65 5 56{66.6{66{6F66 66 {666666{6 767 F67 7 776[8 %7@8'78(68)  8*7(8++808, 88- 98. :8/ ;777%77@@9/+89091[92 d seq93@947956 96097 87(:r8: :.: 8:< }8}808r8;8;; S;8 8< 8<8 .8 .<88=9= S=8>+H9>,>-x?9?9?[`?.h max?.p .9 . @9@ P@ P@A 9 sigA8A9BRsBS :9BUBV'::KCR:C C IC ,:C':C(C)C-:C.C/C0 R:C1C5:C6C7C8 R: C<<;C=C>C?C@CACSm;CT i%CUICVI CY;CZ i%C[ C^;C_.C` Ca CJ<CLCQ CW<;C\m;Cb; CE%<CFI;CgI<Ch _fdCiCmz<CnICoCp[ K C%<C*^:C2:(_rtC9:CB:Cd<Cj%<CqI<0D =D D D D z<0D .=<D=Eu=Ev nsEwt uidEx %AEy SEz E{:=D =D!D" 9 D%>D'9D(.D.:D0 9 D3> saD4= F `>F F . lenF .F p(G{>G !H$>H% H'H( 0HD>HM#`>HPp(HWp)8I N?IPIPIPIPIP I#P(I,P0J)v?J*PJ+6PJ8?J9?J:[HJ;[L N?? .8JD?JE JF5JG[0 K>Z@KKKZKpKKK endKZ@ Oi@..L!@L" [L&i@LD@LD@LD@LE@LE@LE@LT ALY@LZ 5L[@M %A valMM AM HA valM M 1A SA U P V P W*[ [A0 h.B i@ j kAcpu l[ mP nP  oP( uB .    B .  <5@@ -C  P  P  P  <  < .  .( .0 [8!@ D  P  P  P  P  P   P(  P0  P8  F@  PH  PP  FX  F`  Ph  Pp  Px  P  P  P  P  P  P  P  P  P  P  P  P  P!@ )F uB& F6 ! P( " P0 # P8 %@ &P 'Q (R )S , PX - P` . Ph / Pp 0 Fx 1 P 3 P 6  7)F 93F ;3F =.:avg GB@D .F0 KF L M. N. O[  P$ Q& SF(8F/ ]FFpFFF5 `7H& aF6 h P i P  j P( k P0 l P8 s F@ t PH u[P [ [ [ [ [ [ [ [& %7X& %7rq \H F 7H F/ ^DHIHXHFDrqXH H+ [ + [ + [+ [= H        c ILb HLs < 1I 1III  >ICI MI aHgI .({( qI5jJZ $@ SD SH6P.` .h)Yp.x ]5Z I{IMpidpN7JN9 9N:[N; 5N<ӧ inoN=PN? N@@NB5ZH#rcuNC `NDpoJ K . Op S S6 S SH S [ SR Sp S S S! S5 SZ0DN0 S#RS5S9S5ZS Q (R 2RTgRTTp8"WA @-S ~T XTX2XX&T T T . T T T .U .? U U H97U .-@YV#cssYE idYEY@N@ Y Y Y5  Y]( Y.H YpP YX Yp Y Y Y YH YC YH YH Y. Y  Y9W( Y9W0 Y8Y(]HYPY4`YbY #xYuY7r7U0Y9WYhYVY S% V >WhZyWZz&cZ|[Z}d%dZc(Z080Z.XZ#d`HW W W W W WWWI[|[|[|[!|[%|['|[,|[/|5[3|[5|[9|[<||||||||'\|'\|'\|1Y]|^YY^Y^Y^Y^#YYYY_ !Y(_Y_[_ I_Y_ _YYZZ[IY_#5Z_$5_%_' Z`\Z` 9Oa a"\ZaZa5a`ZaZlZa[aII(b0[b1(b7( osqb9[5b;b<'b|'b|'b|'b|'b|c+y[c,c-dd [d y[de[eIeIee \e!e" e$[He'\e(J keye) e*\e+I e,I(e-I0e. \8 exte/\@J([[e3 e8\ tpe9\e: Ie;<e<<\)-f ] ]]]] fQ]f(ff\Xgq]gr]gs08 wqgv]H cpugwP ]8gz]g{]#rcug|  wqg]04xh2^h4h2^hB^( lenh(HhR^Ph p ]B^ . .R^ . b^ .-@i<_i<_i<_i i5@@i ]Hi!.i".i#pi$08 i%]Ei&   i'_0 i(.82cpui*@2sspi+_H (L_ .`i6_i75i8B^i:B^(i;.Hi<_Pi=Xi>\L_ie_if[ sdaigOaih]iiTa_0xiD?aiE_iF?aiH iI5(iJ5HiK5PiL.piM.xiN.iO.iP.iQ.iR.iS.iTpiU.iV5iWK iY S i\. i]. i^Q] i__p _Oa .b^`j|k3rawaaa.Iak6ak7fak8ak90kAakBZkCa(lbl.l.l"Ebl#-l$ l% l'ibl( l) l+bl, l- l!bl&bl*Ebl.ib lba opslbb bbl2&cl4.l6[l7[ [Z@Pc[ZHzcZpcZqPcZrZsc cZcZbZ.dZdZ Z.3Zdcec@ZdZzcZ.Z.Z. Z p(Z,Zd0#rcuZ 8ZdHdbZdZ idZ dd..ZdZd d(mBemmFmm n enPn& vn)Z ldtn*e8n..@n95Hn:Ihn;fpn= SxnC|nD~ eo foIo. alto.o.o. o.(oK0o8o@oHoPoXo`ohopoxoo o!efnFBe\$g^ I`[XWg(lruYgdeiygj .k.(Rg$ghjJWgs. (ugz. pp{g|.}.~( gh.8hh Iphp refph8pKHp~hp[lp.p opsp xpIpf8h3(Qhygggh9 i[ S= +ival./i8M_iN IP[1J|iLlruK8i1WiX IY+i8@G jI._iUjJV . |i([ S0\ S4^.8<@F*ji7j8(mjn.o.q Sr Ss St Sv[ <@lj*j7z80}k~.. I I I  I(8 Ik..<@|lkjk75Dk% j%j@%Ik/.k5 l t 5 0  jJ I ([0[4L8@P p  Ix#$ ]% ]'%kk5lctx6l l=m>AZ@Z@(X%mYZ(\zmb.h.t:w }$8m..<mzm7 1mkkf  n:rbF6.m nqb oqc qh qj%qk9qq\ qs(qtu0qu8qw@q{Hq~PqXq`qhqpq3xn ol%mWoPcid g@@ qo S= o. Vh@@s%Wo@Z@.P.X.`.h.ppgd  )"x) S5 S?sE.L[S SZ](_a5pZr....v. .(.0.8@@5D.H.P'.X3.`.h$brk.p!.x..%.0.ss@sf.h5psxtl&t.. S Sd(]t..( qoo .s .3 es . s s-hEJtEKEL@EMENtEOEP %AEQ HA nsERES.EV p E^ E_M E`Z EeM@ Eg]HisetEih Ej El= Em EnR^@ Eq`s t t .u..+:u-/ 5/ [Lupq/uq7u(pmdq9 3"0pudq; H#8@qE HqF PpteqL ."XptlqPgX`qT h*[>>>>'r6|'r9|'r<|'rG|svs(h uv vv w.` v .[ }v[ ew    [ x        !"#$%&'()*+,-./0*[ x6@ y . : B^ y8 y z z8 zx 2z 2z p($gen  )$seg  * YY0 y . . . z . . . .z . . .2z . . . (Nz . . .H zseq .   z z( d%z . .z . . H{ {seq . . { |  p p6  e{ f| h5P n.X o.` q(h s:p u. xx {Nz ( pvH{ | . . . %| . &l|seq (. *T ,l|  . 5 >Y| . . | .!@ =}  5              =} M} . @ } }   } } . .} .1 }  } } ./*[ ~!@ 7| ;B^ <.  >.( ?.0 J|8 M` O(h P!p Q$x V W X c. ( . . . . J .  A " @  x . 5" @ . . : . . [ [   p  p" @  `  .|M} v . ( . (ƀ .   ~6   ƀ# . \  5  .(  . . . . . ?~@ . ҁ . 5Z .} ( ./ 8pjp.p5p5p.p. p.(pp0 [z . z;pt,ǂt- 5t/ $t0I0u3u4xu6u7u8 p xau9 jidrvOvv[v[ ww.w6w revw. wwrwrw Sw SwrwJ#rbwF6 nswK0w[8w<w L>@ idwP`w IhwŅp#rcuw x w opsww!w wrhw~wPw `w"yw$ w% w& ʇ(w( 0w2 8w9p@w: Hw= Pw@)XwA G`~  w(dirwOwww υx&x buf&& & & &  & (& 0&58 op&vX&`&{h&Ipw< knwrwlwʅw Iw5 w5@w`whw xw  w  p@w  pAw %oKKx<`KUyʅIeIʅ~IʅIʇʅIKχ(K )K8"GK.[xp0x'̈x(Lx) x* ֈx+x, x- W(p;IшK ۈ;KyVy<y Ly[y  yPyP inoy)P devy* @(y+ @, uidy, %A0 gidy- HA4y. 8y/[@y0[Py1[`y2[py3Py4Py5<y6<y7Py8Py9<y:<y;<!~!J! L!m!n@!o&JX!0;!1V!2 !3 I!4 !5 (!7 ٌ0!9 8!; ٌ@!= H!?$PET;OLrr/w@z@*zAJzBzCrzD܍ zEB( sdzFr0zGAZ8 zI[ zJ[ zK[ zL[ zM[wVYLRrO9prOW/;jJzlrEٌlrOlrOތ$lrO8"!T! r! )rr/Yr/Jw`z܍zz 5zwz ΏX0zt=zu RzvWzw!\zx*zy zz (=RrGTa{+uuz̈*fKzz%AHA0 z}z~z z2bufz. z  . . .? O?C.ztzzzɏ?zyJzzďt [ .({2{.{.{.{.{. {0h#rcu{1 {2AZ{3h w.. {HӐ{IӐ{J{K {L{M.{Nu 2ݐ!||w|ؐ@p|{H|JP|FXbus|Ҟ`|eh| Ip| Ix|5|!&|9||| $msi|h(|8|@|PH|PP|X| `|h|x| |j|m||| @$id|<|5|| |!!\|# h|$|%|'#|)|+ p`|, pa|- pb|. pc|/ pd|9 pe|< pfݐ-@@9g9h cpu9i[9j[9k[ 9l[9m[9n[9o[9p[9r[9s9t9u[9{  9|7(9} 09~789@@;?7@̔ .}:};}<̔}D}X}  h}!X}"X}#X }$X(}%X0}&X8}'X@}(XH})XP}*XX}+X`},Xh}-Xp}.Xx}/X}0X}1X}2X}3X}4X}5XXؐIhؐ]*}UP*[}l̖H}x/}y 5}z[}|[}}5}~0}4@ /!8}t}+} p +} p!+} p"+} p#+} p$+} p%+} p&+} p'+} p(+} p)}<}5 }}K }@} p@} pA} pB} pC} pD} pE&}%7P}P}]}5Z}} S} S}[} p} p} p} p} p} p} p } p } p } p } p }[}}m}m}}}P}P}P}P} } ($qos}0~+~,J id~-~.~/5 ~0(~1080~2.X~3 `~4 h~5 p~6 x~7 ~8.~9.~:.~;.~<. dev~=ؐ ~> p ~? pt ̖ؐ- }-ops}}X} =}X} h} h}V=ؐp-Vؐ[BMlNJOJP!\Q!\R!\ T(U0VX8W h@X hHY hP[XX\X`^Ȟh_XpaXxcXd h pmf͞hp[ؐ`aJ busbҞd%eJgp h$j (kV0mX8n h@oXHp hPqȞXrX`s!\ht!\p pmv͞xw h py`qȞؐDl`23J5!\6!\89 ; (< h0>X8@(u@AǟHC P pmE͞XמLKǟ̟0|XA|YJ|Z!\|[|\ |^ h pm|`͞(A [ .@ lI[ 8 JI L7< I(I0 s7t Su5Z` jF6X%7 .?8S#S S! S".S#PS#P S$.(S$.0S'KS(PS)PS0S1 vS2 vS3 vSCSDKSLûSMSNû8SQSR SSSSTKȻ # . J" . " , 9F .-)H/06z7z IJQ R(U0V8^@fHkPlzpnAqoxq|rsuvxyz{       ( 0 8 @ H P X ` h pEx      F Mr05Z  ` #rss r!0W85Z@ SX , fn W arg I z< . Q b,< <VSVTVU3VWVX9VY 8VI qVJ iocVKSi% V\[0    val @ val)<Xcchin.v8_`(abc pd p#rcue  reffc0L  v .% ]. t0 v4] 45[67 .   %A ' HA @P[ L  [[([8 lHР(\)*+ ,0-5@. 5`/ Sd0h1p2 x3.4   val \h[6BE(uidF %A(gidG HAH D JH      ( 0 y[8 y[@HW. [([, 0 8I@ W!%W@89:;<= >(?0@&8\!! XDEFG HI J(K0N 8O4@QMHS&P+//M9xYAZ[P\P]P^P _P(`P0aF8cF@dHeLfPPgPXhP`iFhjp8[[[[ [[[ino  ( 0[ A . [[[ [[[[X?b{{ (08@H{Pb-D{[gR!68 ] [ Z ]0 mH$ops!}  m . } .  .1w} 83456YI@ ' (0 78 Q@ jH zP X`h p x + ;TY Y^0+-/6 7 9 ; [  < [! = [" > [# ? [$ @ [% A [& I ['P*(S0V8 W .8 X@2wb[H \P _X `\ a` b h c p d xEllkjJYp'jJ77<8DElFjJraGI .J[ K[$Lp(M.0,ljJ[ZljJ[[I 7jJ #Q<pj$VzojJpp jJ >>l&C6U#&U$hU%.U&U'6 U(sHmaxU)[LU*#PU+d%XU,(`U-hU.xU/-U1-(U3U4[U5[U6[U7[U8[U9[U:!U;"=U<6U= U>l(U?K0U@ 5PUM 5TUQ]XUR]xUSUTB %;l0T@@1b[<7 1! '1"U'  [ " ,!@Z[\]^ `' bO(dm0e8f@hHjPkXm!`oDhpqpr xsuvy {>}a6-i bdijl.m.op(q8rHs 5Xu S\vs` x. y. z. {. |.  .( .0 8 h Dl 5p x Q] Q] 8 hH X        N    ((l 5pidJ4uid %A%A $  .[[ [[ 1 5 P< )7* +i4,(-/PI!0Q  &Q?b .   2K _( 0 o8@HPX`hp ox  F_ x x og?    # - 7<-)* + ,CW-.2 /.(0 S09 @4:jJ8< S@=5D> IH? IP@AXA5`BCrE SF5HKIK IQݐK-` idPF6 .0.8AZ@[D[H[L[P(X.`#wbh ` p 5 Z 5Z2devؐ <1 ؐ( 080 ӧX   O . O .$/pBBJP[Gr pos / [lllJ[ lB (8l$Vl[.=ol8"[ltllll .2l...."Y_Ul[<lU[dlZ lʅlll[Kll[#dd[i Pd[sӧӧ[Jӧ1 p'ӧOӧLp,mӧӧTӧrӧJӧLӧL@!ӧӧ[?ӧ?'&l-l<[IӧvPP ӧl[L lL1>ӧ%aӧ1Cӧ fӧ mt Z .*[2"KY7_Podtӧ !ʅӧFJ#ZZKx d } ӧbJI U .Mbio w'P S 48 I@H\PPX` hpr  St x* -. <XOX&g[OsJb(EbFJ modG% opsH!>I (JK  lL(argM I(strN(arrO9VW[X \4 max^[_[ num`! opsa!>bI4%0(_)_?F6p . . [ ! # O .7`-0.w mod/%@0rH mp15P2D58EpmodF%&GC5PpqIrIspt[:mtnwD   [ 7?pA .' K U\_\ xn }z#p[-ȫ $@K Q id,$ clsQ [Qq||[|[|.*[|*[|!8|h||| |0||!|" *[|1*[|B*[|O!|cv|d&|e2|f4|gp lid|hp vw  P Dcma 0m1J2 $3J4r6m$X7m$`8mh9mp:mx>.?I@/0 ops1" dev4ؐ56(7 8rr  !||Dclk'| [% .l[,w  'jb[ get[ put k   ( 08@$H$P8XQ`jhpQx8[QR[ idS[TPfLgh[i.[Lk`ppKpJJ[IJ%J$8)Q=jJVJJ[[oI[[A/QW regR[ defS[/ ` rega[ defb[c[\[[[ /4[4[WW68qJ [  ( 0 8 @ HPX`h/p x pppp9EI[p$4$4$4$4$4$49[K[..ppppppp[[ $!([0Qpؐ[vI[!I[[I[[[IKI/IK/W(J[[ [[[[ >8[[[[ [[[$q[[8[!vZ[J\J^[_[`'a c[$d[(e[,f[0g[4h8i[@j[ k[!l["m[#n[$o[%p[&q['r[(s[)t[*vHxPyX{\|`~\h\px<Ibq[[I[I![22[7  zQ .A[v1l  ӧ ops # [ 9    Dnet 0Inst= yT( EE<E<E<@EEE<< N .EEEN@E@E[E*h    [E>  .  ( .[   [, . Q@P     %&07s9s @0 A` D G Jh M]  .%  .%  .%[[) [9U[Ny@T#seqX @@[^<adP8i@@ < . < . .0__p5!d018PpPxQ]i y2avgx   08( 5ZP Sh Sl 5p  i < P 1 P Py <y . P . . . . .[W+     8WE knWrW.W08W W޶ ssW WhW W0W@ idWPW[TWPXW S`W]hW]W WW W WW W W  W (W 0W8W@WHW PW XW `WhW -pW !xW !W !W WpWpWpidWWJWJW W WWWW[ E   . (WD! WE9WHPWJP Wa Wf,Wg Wm (Wu PW{ xW޶W޶ W WpWpWW   .  . !@WA WBWE[WH WK:rcuWL  &WSa@@WV޶WY SW\[W_1Wb<1 !  ޶ ..Wl Wr<1Ws.@Wy HW|[PW[TssW XW`W pWPxW `WW/WyW W W ʇWMWkW W WUP   F/ M P4k FR  p   ʅ  yT-yT[       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu-@ (@@.@(H(P.X(`(h.p.x."@$p min%. low&.'. max(.)x ~.... 5 (58]X[pEpNpT pZpe* :uGu*h.. OppWp/pW +f..pp+38(q0vmaq18"q2 $q3 .q4.q5. 1q>q? Xq@ { 8"%8".98"*\8"...>:uuGu[a:uGu..z.8"8".IJ8"8"TT8".d% 38".[v     0e [(" @,0,.e0[(1,[D[,? cnt@ SA3 ]Frcu MN P[R[ T["- - 7< F` wP[ [   #6TnToTp[Tu#]Tw LTx L`Tz LT{ LT~[8T5<T9Y@9Y@ > (X . X r . ..*[YC(zUU 5UU U U(U#U = .  6Q..J ret  $  $:4 mV;<[ =[!>["?[# Bi srcC[D[EpH maxI keyJi00M!N!QTWZ[] `!$gӏ8jpDmpEppFspGvpHyL|[PpT‚[X…\ˆ[`‹[dŽ[h‘[l”pp—#!x˜›!œŸ|¢!ª|­!°! ³j ¶j ¹[$ ¼( ¿[, ! [! .4 ! . ! . [! . A[![?"0pw#x# devyؐ{! rev|[~# ÀPÁpXÃ` Å[ 2irqÇ È É2 Ê2 Ìp Í[ Ï5 Ð Ò# Ôp Ö# Ø# Ù#  Û  Ü  Ý5  ß a@ # Q# . # . # $ .. O$ . < m$I m$+$G#qG#qG%G % $ . $@"$  $ .$@9"$  q% .J$@b % R$o @{ % R$  Wb%C.Q%@!b% S}$z TI Sr$ TI n%#%U!p1&Vdev!ؐUWreg!G[Upt&VdevؐUWregG[oN8'pN"'XP%XQqr%&HT HQ!s%HT HQA?"#"]t,. .J .V,O,[s,,,,^int[,,*,6s8g6u8z6s166u166s32-6u326s646u64N[v s~,.1[2[HI~X]^~_`O,,<[ <4  #p,%&*.4=Bh-l mn<} F P P [ [ S< vF_ O  .44 D D49_P`a.W-@ x Ob.     <cH  J   " #   (  i%0  8  @  6#H  6#H 6#H (H 6#H 6#H  6#H  6#H!@      ]P h  J J     [ 6$kp   [( [, 0  8 p@ pA pB [D  $H PEmem )@  .  [  : ?  I S  ( I0 [8 I@ [H [L XP [X ]` [h bp x [ [ n% l [ { [ [ % I [ !% "[ % &( 9[ : ? A D  F S P  Q[( Ts%0 ;P (cs =P(sl ?P(wfe AP E (ss GP(sti IP KP(nmi MP PP  SP0 VP8(lm XP9 ]P: dP<  )cs )csx P   B )ss )ssx P P  gH r15 m. r14 n. r13 o. r12 p. bp q. bx r.( r11 u.0 r10 v.8 r9 w.@ r8 x.H ax y.P cx z.X dx {.` si |.h di }.p .x ip .  . sp .  B  C D E  E((s E,(dpl E-(p E'/ F0(avl F4(l F5(d F6(g F%7 F+8..... S pte "<  v pmd "_ % %%0 /%/ ?' pgd'$ /'" ?p pudp /p" / @HLI.%Nkxk0 S4.8ezf.ghuv-w- keyxz UV SLjkeyknkeyo;y<=? [ @ [$A [(B [+!-@ 64[[ I T9( [,![0( 4)28*[H+.P,6X5 `6 d8 h: l; p< t=[x=se?E@$rt@xFEdlAGBGFI"I6J.K[OIXI]I"`"mC@dh[k[ l.m nI oI(p(0q IXs`ubx dy/Ihzp{I.      /I nBR6("6P$mm h pJx    .[ [, [, [, [- [- [- [- [- [- [- [- [- [ - [ - [ - [ -"[ -.4$pid X X.6 66(0@?KPDKX "|K% ( + I- P. P3 P4A6A: S(=.0>.8A P@D PHG.PH.XK?`"N?TLWLZL^Mk 1mMp\5 q5(t.8u.@$fsxMH{MP~MXN`Rh cRp &:x &: &:=. [4mR eA[8^> P  P 5 a# TI 6( 68 wR@  IH RP RX R` YSh cSp .x hS %? [  P  P  P -9 A  T   <  < "T )U     U0  68  [X U\ %U` 6h  /U       ![ "[ # $. & P ' P ( P ")  39U C% D. L>U N. RNU S<( T<, Y.0 ] 8 ^ < _ @ ` D "a H d>X gXU i> lbU w x z. } ~gU  P P  % S S.[8WyWWW [([,vI0Ercu 0T9@ D6Hp8PXxT9 I " X X XI  P >"  !"j2$"j2". <*X"F;@@y!@@ 2sp.es ds"$&.(.028.X.`cr2.h.p.x>2.[<.. _1=fpu 0@[ 6 (   ( !@@ %.r@]v@ S v  7"%)p  Gp p(,p0&lp8Xph%qp.x9o Iq(/Uq>o )"  M"m")val S")""M",m"" " " ." S" """" 1#  1#B OO a#"F# #a# [.,9$fmtJJJ[JJ$d6[$788$JJJJ[[4[ key99$( [=%8Ui%V modWi%XJYn% Z ([ ,\$0Ju%v%w%x[y[[$%. O% . /&1[ set3` get5y7 3%8 ' i%   ;  ^    6(  60 8 !@ " H # P $ X %` &5h 'Np (5x )q * + , - . /  0 4 1 ޸ 2f 3  5 L 9 y ;  >q ? @& !@(% + -/  h( !- key "- ?( A. B( C( (@( =( >Ih( .( . ; (! v(!@A@"+&"k@"$|!"&5": 55"<.5"=.5">.5"@6"A ^6"B ^ 6"E86"G S6"H.6"K66"M66"N6"O~6"Q6"T6"U~6"V ^6"W67"Xp7"^.7"d.7"e. 7""ii@@7"t݁@7"y[`7"{.h7"}[p7"[t7".x7"|7".="{="|x>""i@?"$?"?"A"A0#c+#dJ#eK#gi#i #l R(+$,$P end$P% |% |p&, cwd&< swd&< twd&< fip&< fcs&< foo&< fos&<&,&<l <, .&*, rip&+P rdp&,P&.- fip&/< fcs&0< foo&1< fos&2< &)&-,,0&@H-&AH-&BH- <X- . -&$- cwd&% swd&& twd&' fop&(-&5<&6<&9- &<- &>H-P&- <- . < . .?&Q. cwd&R< swd&S< twd&T< fip&U< fcs&V< foo&W< fos&X<&Z,&[ l&\ m&] n&^ o rm&_ p&` q&a.x&b< # . . P / .@&:E/&; P&< P&= E/ PU/ .!@@&O/&&PX-&Q /&R/@ /..e@&^/&_,9&`X-&a .9&bU/@&c/ 0F.!@@&f0&h[&k[&nP&qPxfd&tP&w[&z[&[&[&&/@@&0& P&[&[ ffpu@&Z1&[&.&Z1&Z1&0 &00&&0@@0' 1' P'P O1 . O1 .? (1( (! (" (#1 P1 . O2F. H 2 . /2/2 .42 92)|)|)|*82*92*<2*=22+<2+=[+> S+:3+;22 src+A dst+A 33I [,53(,3,3 val, <,!< ,"<,#P,$3 <,*3,+&3,,#3-3-|Z- -3,'4,(d,)33,.P ,1h4,2m4,3,4 ,5.,6. h4(,4,%53,/3,748,4,. fn, 4r44444.>(5.?..@..A< cpu.C< [/W5 0w50 |5 w51 512 52 S353F#355354 64"4"5 5)R65*(5+a# osq5-5 5/(6 66 6 6767.767667 67 6777676 8-78 68 8 H786 [9 e7@9'79(79)  9*7(9+k809, 89- 99. :9/ ;H777e77@@:/k8:0/:1[:2 d seq:3@:47:5-7 :690:7 87(;8; ;.; 8;< 88p88<8<< S<9 8= 9=9 .-9 .=89>T9> S>99?+9?,?-x@9@9@[`@.h max@.p .9 . A:A PA PAB &: sigB9B:CRsCSJ:2:CUCVg:O:QD:D D ID l:D':D(D)D-;D.D/D0 :D1D51;D6D7D8 : D<|;D=D>D?D@DADS;DT %DUIDVI DY;DZ %D[ D^<D_.D` Da DJH<DLDQ DW|;D\;Db; DEe<DFI<Dg<Dh _fdDiDm<DnIDoDp[ Q D%=D*:D2:)_rtD9;DB1;DdH<Dje<Dq<0E Z=E E E E <0E n==EZ=Fu=Fv nsFwDv uidFx eAFy SFz` F{~z=E >E!E" &: E%D>E'>:E(.E.[:E0 &: E3^> saE4> G >G G . lenG .G p(H>H  I$>I%I'I( 0ID%?IM#>IPp(IWp)8J ?JPJPJPJPJP J#P(J,P0K)?K*PK+-7PK8?K9?K:[HK;[L ?? .8KD1@KE KF6KG[0 L>@LKLZLpLLL endL@ O@..M!@M" [M&@MD@MD@MD@MEAME@ME@MT BAMYAMZ 5M[AN eA valNN NAN A valN N qASAU PV PWa#*[[A0hnBi@jkAcpul[mPnP oP( B.B. <7@@mC P P P < <. .(.0[8!@E P P P P P  P( P0 P8 F@ PH PP FX F` Ph Pp Px  P  P  P  P P P P P P P P P P!@iFB& 6! P(" P0# P8%@&P'Q(R)S, PX- P`. Ph/ Pp0 Fx1 P3 P6 7iF9sF;sF=.=avgGB@E nF0KFLM.N.O[ P$Q&SF(xF/]FGpGGG7`wH&a6h Pi P j P(k P0l P8s F@t PHu[P[[[[[[[[&e7X&e7rqHFwHG/^HH6HGGrqHH+[ +[ +[+[?/I    gTIRbHRs<qIqITIO ~II I HI .(( I7 J 7 m ^  $@  SD  SH 6P .`  .h )p .x   5  ^  IISpidpO7?KO9 T9O:[O; 5O<  inoO=PO?/ O@@OB ^H#rcuOC `OD?pJ TK . P|KP[P]_TKQoLQp( uidQq eA gidQr A Qs eAQt AQu eAQv AQw eA Qx A$Qy [(Qze0Q{e8Q|e@Q}eHQ~ePQXQM`QMhQMpQMxQ IQ&QDvQ=Q+%KLSkeyRMRT9R%8R+ semR^(R5PR IXZ`R h uidR eAp gidR AtRxR|R~R R.ǜ R:L M M M MHS NS! T9S"2S#<S$FS%* S&P(S'Z0S(Z8S)@M-XT^RT_T9T` STaTb TcTe ^ Th68Tk=@TnXTq`TsdTt6hTwpTx[tTzxT[T[T[TTTe7T  itT T% T? Th T S T?K T4ttyT̠ T֠ T BA TP T P TP TP TP TP TA T. T. T. T'. T.  T.( T".0 T,.8 T.@ T.H T".P T,.X T.` T.h T%?p T T۠ T_ T T [ T Tp T T T  T6 T^0N0 TcRT5TT9T ^TO !R hR rRURUU|R RVRV.VRXWcYSWd(We SWg Wk 5WmmWn(Wo0Wq_8R ^Sn=-PXTXAX T9pXTxXdXX X X XX}XXX"X(X.X/X0X9d X:d(X;T0X>p8"XA @mS T YUYJY2Y>T U  U .  U *U 4U .NU .1@ SU ]U 9wU .-@Z8W#cssZ idZHZ@T@ Z Z Z5  Z_( Z.H ZpP ZX Zp Z Zz Zz ZzH Z Z Z Z. Z  ZyW( ZyW0 Z8Z(HZPZ`ZZ ݁xZlvZ7wU0ZyWZ Z8WZ S%a =W ~Wh[yW[ze[|[[}#g%f[\ajebjf[ sdajgcjh>#jicDb0xjDcjE?bjFcjH jI6(jJ5HjK6PjL.pjM.xjN.jO.jP.jQ.jR.jS.jTpjU.jV6jWTK jY S j\. j]. j^_ j_bp ?bc .`bk|l3cddd.Idl6Tdl7cl8dl90lA|dlB^lCd(mdm.m.m"dm#-m$ m% m'dm( m) m+em, m- m!Eem&dm*dm.d mle|d opsmvee leqem2em4.m6[m7[ [[@e [[Hf[p7f[qe[r[s@Fl)l9j :(mmn.o.q Sr Ss St Sv[ >@l=ml9z :0}m~.. I I I  I(: m..>@|m=mm9 7Dn%l%m@%m/.n7 4o  5  0   q J  I  7( [0 [4 L8  @.P  p  Ix # $  %  '%S*n*n5[octx6`o [o=o>@^@@(XoY^(\pb.h.t:w }$:)p..>Gpp9 1lp%nnk p=rb6.o prbqrc rh rjrkrq rs(rt0ru%8rw9@r{Hr~PraXru`rhrprxpqeooqPcid l@@ q S? .r. 8Wm@@ v%q@^@.P.X.`.h.ppgd  x) S5 S? vE.L[S SZa#](_a5p^r....v. .(.0.8@@5D.H.P'.X3.`.h$brk.p!.x..%.0.v v@5v|i.h5p?vx6Dv9o&Nv.. S Scg(_Xv..( qq . v .3 g0v . 0v :vZ Iv Sv .lv..+v-/ 5/ [vpr/4wir74w(pmdr9 0pudr; "8n@rEHrFPpterL XptlrPX`rT h*[w @@@@@@'s6|'s9|'s<|'sG|twt(h"ux"vx"w.`  x . ["oy        !"#$%&'()*+,-./0*["y8@"z".":"`"z8"z"z"z8"zx"z"z"p($gen" )$seg" *"1]0 z . . . z . . . .z . . .z . . . ({ . . .H"]{seq"."""]{"m{( %m{ . .{ . ."|"|seq"."."|"|""p"p8 "e|"f<}"h5P"n.X"o.`"q(h"s:p"u."xy"{{"("w| | . . . | ."&&}seq"(."*>U",&} ". 5 ]<} . . L} .!@"}" 5""" """ " " ""} ~ . @"@~"@~" "P~ P~ . .`~ .1"~""~ ~ ./*["~!@"76";`"<. ">.("?.0"J68"M`"O(h"P!Fp"Q$Kx"V"W"X"c."("."."."."J"." BA"""i@"P"x"."5""i@".".":"."."["["" p" p""i@"`"p` F .L}~ w` . (p . ( ."""~8 "́"́ ݁ . "" 5"".("k"."." ." ." . A~@| . . ^ .`~ ( ./ 8q$q.q5q5q.q. q.(qp0 [4 . 4u@ Y||IH8uuJuIuu Lu)u. uI(uI0 us)ut Suu ^M u\u6uلXuل%)u|Ku| u( setu̅0u8u@uHuBP\u)u|uu uu5uBބIrcuu N[u[uʞuu'hu Kpudx[hu̅u#diruх`uu\u6Xх3̅̅'AلAFeAA,dل|PwwIwixxIx xBxDxExFYxGhxHxIIyTy y![y"[ T ^cz,z- 5z/ $z0ImxAȇÆxK x:x@ixNxO.xP xQ (x+_x, x-px.px/ ȇ 0 pȈ q9o r  s  t I u  v$0(_{"{#{&{'{' |C|5| 5|^;||s%C}3}4< len}4<}2s}6P}1Ӊ}8d}i}j}k ^n}r/}s}t;}u }R}T[}UA}V}W }X }Y70}[<8}_"`}`Ԓh}a.p}bIx}d^؉}m}n#d_u}v//!x {7 | L } ~ eA  A [  Թ Թ !M  Ԓ( J0  I8 .@H  @L  P  X  `  h <p <t <x <| 5    ̦   < ^ . .   -       T&0 v@ vH  SP  ST  SX  S\PL` 7h" Ip 8PH  P (AX K` Uh  Ip L .'@}} } }-}U}i }}(} 0} 8} @} H}MP}kX}`L!@ Ԓ   @  .    ( !0 !8 @ "H .P .X .`  h ^p   S I & #  $   ҈  ) 9o r |  [  (" `  I <   !< " /  0  1  4  6[ <6  BJ@ D"H F@P I(X L` O d R!`h Sp ZDvx aT bTErcu c  d_ f6 k0" n5@@ oH q5X r` [}  [##(P#[JPӉ2i#Z} n  7  ~E~F ~GԒ~H~Iœ H mnt    ffpHR  ْp04map9 (” .?#rcu  .. "[#$ nid&-.4.78WR,SJUJXYZ [c T9 dTK(#rcue HgIXj` idmpptqJxr uO.@@E[ ,(034678 p xa9m  ז " $5@@- lru/0( זO2* nrO3 nsO4*W5 ? . N.. e valPN [   ӗ Iӗ!@@Xd&XX.XXXXXXXXX$knXWXzXz@XBxXXXZX\X^X$A`XRXXX} XdXdX$X "Xi@@Xd@XQHXQpXAX"X#6X& ^X)_$psiX,4$bpfX/ X2X5# XX9'|. RRRl#rcuRm RnT9Ro pRvRxRy Ru3)xR.(Rr{Rt.RRRJ {{Q RRIR  Iʛ .R֛ۛMMR8Rʛ keyRMR5RZR;R6R|R R (RǜR.R.RRR  (RR3|: R RR v1 R&R & 0 T9g.0(8@ uid eAP(X S`$m#hQQ T9Q gidQ  A..5Q&QIrcuQ ?-@@:g/:ha# cpu:i[:j[:k[ :l[:m[:n[:o[:p[:r[:s:t:u[:{  :|7(:} 0:~78:>@@0<4A7@O . D>_ .?8TȟT T! T".T#PT#P T$.(T$.0T'T(PT)PT0%T1 vT2 vT3 vTC@TDTLhTM6TNh@8TQTR STS@TTTKm ȟ . ?KǠ . Ǡ Ѡ `9 .-)/06z7z IJQ R(U0V8^@fHkPlzpnqoxq|rsuvxyz{       ( 0 8 @ H P X ` h pHx       60Z ^  ` #rss  08 ^@ SX Ѥ fn 3 arg I z . bѤ <WS0WTWU5WWRWX;WY 8WI qWJ iocWKYS%0 W\[0 R  ¥ val valΥ< i5n.v8_`(abc pd p#rcue  reff05 v .%  . 0 v4 4Y5[6Y7 ii .s n x}  eA ¥ ˧ A P D [ L    ( 8 9oHIЕ()*+ ,0-6@. 5`/ Sd0Ԓh1p2 x3.4 # val  [6RBE)uidF eA)gidG AH #D^J/H0 R R R R R  R( R0 8 @H. [([, R0 R8I@ !i%@8~9:;<= >(?0@ɫ8ԒDīԒīXDwEFG HI J(K0N 8O׬@QHSɫPΫDԒ|D7RҬ7Ҭ#7ܬxYZ[P\P]P^P _P(`P0aF8cF@dHeLfPPgPXhP`iFhjp8[[[[ [[[ino  ( 0[ . 9[[[ [[[[X A(d08d@HP9ԒfԒ[ <Ԓ<#_Ԓ_FԒī_iԒ~88  [ ^ 0 H$ops!  7 . 0 . 0 .1 wU }  83456c]UIȈ  z    ʴ  ]  ( 0  ڵ8  @  H  P  6X Y` mh  p  x ö θ  ޸ 0+z-/6 7 9r ; [ < [!= ["> [#? [$@ [%A [&I ['P(S0V#8 W .8 X@4wb[-H \7P _X `\ a` b h c p d x9omJpʴJڴڴߴ8D]E9oFJraGI .J[ K[$Lp(M.0ϴ9oJ[^b9oJ[[I ڵJ Ƶߵp $6Ȉ͈"YJq;m^prpöJ9oɸ8V#ɸV$ V%.V&V'R6 V(sHmaxV)[LV*PV+%XV,`V-hV.xV/V1(V3V4[V5[V6[V7[V8[V9[V: V;"V<6V=) V>9o(V?TK0V@ 5PVM 5TVQ_XVR_xVSVT ȶ޸9oӸȈ͈1 & b [> L 9  1 q !q  '7v1 Ź XU ʹ    [ Ź Ϲ!@ ZH [ \( ]F ^d `  b( d0 e8 f@ h'H jP kOX m|` oh pp r x s u0 vX y{ { }   @ٹH-i- bdijrl.m.op(q8rHs 5Xu S\v v` x. y. z. {. |.  .( .0 8 h 4l 5p x _ _ 8  H X < <    TR 2 < F P( ˽ 9o  6pid ?K (5uid  eA eA  $ .  . [ [  [ [  1 S 6  P>  )9 *  +2 ,˽ -Z/ PI!0      & AZ .  x         (  0  8 @ H P X ` h 8p  x Q Q Q Q  y          w     $-))* + ,W-. /.(0 S09 @4:J8< S@=5D> IH? IP@XA6`BCE SF6HIK IQ-`r idP6 .0.8@^@[D[H[L[P(X.`#wbRh ` mp 6 ^  ^4devW 1 W( p80  X. w  O . O .$/ pJP[   pos  /  [;9o"^9o@9oJcȈ[ 9o(9o 9o[.9o 579o!N9o:q9oS9ov9o .9o....+Y XU9o[49oXU[W9oW^\a 99ok9ox(L buf(( ( ( (  ( (( 0(68 op(X(`(h(Ipy9o9o[Q9o9o[~[ [ 7 [J# 7# F7-Թd7pK i7 Lp 7 7 7 J'7 L O7 L@,|7 7 [T ˧f<[[  7 PP 07X7 9o[L5{79oL]Թ  Թ    ,mt ^ .;;7,*[ i7xԒi7}77ԒԒEԒ  8Ԓ Q =yԒVԒJ~7DԒE   #JI 6#8 .@@AJBCD EY( sdFW0G@^8I[J[K[L[M[88Sbio2) ̦ S 48 I@&HPPX0` :hpr  St ?x* -. <YgY>sgoidr4m[[ v.6{ rev. vWW S SWJ#rb6 nsK0[8< L>w@ idP` Ihp#rcu x  opsh!r Whc "$ % & (( 02 89p@: H= 8P@QXA o`c m )dir4\ s knW9o I6 6@`h x    p@  pA %qsIIIII(8$Q =oV [0'(t) C* +,% - 3(=78 Eimod Fi%& G<7P p qI rI sp t[=mtn w=    [    7Ai: .' D N*Zb6Z qg v#iGclk'| [ .'jb [@/G0L ops1" dev4W56(7 8} get put   /( H0p8@HPX`hpx=VoQ}!R8W@pdHJP Xbus `N h Ip Ix6 &xinx $msiQ(8@PHPPX `hx S VL @$id<5  !!s# $`%j'#o) + p`, pa- pb. pc/ pd9 pe< pfQR[ idS[TGPfgLh[i.LLLpKR/ pHJ4pJ[IMJn%uJLLLLJJJ[[88\$IVLBo[[Lt [AQ regR[ defS[ ` rega[ defb[c[ [Ai[[A [[ni3388J [  ( 0 8 @ H)PGXj`hp x ppppI[p$$$$$$[K[..ppppppp[[ $!C([0p W[)I[ GI[[.jI[[[LIKIoIK(>J[[ [[[[ >[[[[ [[[$[[H"[ Z6[J\J^[_[`';a c[$d[(e[,f[0g[4h@8i[@j[ k[!l["m[#n[$o[%p[&q['r[(s[)t[*vHxEPyX{\|`~hphxI'"bh[[IJ[EI m[[  z .14o   ops #( [ T9 # - 7 AGnetK U0nsDv= T(_ FF<F<F<@FFF<<  .F7F7F7@FP@Fd< t . t ( . [ . X@079 @.0 A>` D G$ J  M_ $$ .%) > .% N .%@T#seqX @@[^<adP8i@@ < . < . .044p6!9018PpPx_> N4avgdx 6  p8(  ^P Sh Sl 6p  > < P 1 P PN <N . Pd . . .z . .8X knXWX.Xp8XqXd ssX7X X X0X@ idXPX[TXPXX S`X_hX&`X<XX7X XX X X X (X !0X:8X:@XXHX hPX hXX `XhX pX xX X X XpXpXpidXXJXJXX XXzXzX[q <Q . (XDXE9XHPXJP XaXfXgQXmQ(XuQPX{QxXdXd XBXpXpXX zR . b . !@XAXB{XE[XH XK=rcuXL  &XS@@XVdXY SX\[X_1Xb1b d-..XlaXr1Xs.@Xy HX|[PX[TssX7XX`XapXxX XXXX X X XXX X 8X6#Pz<z-fF<z<zP<zF<<< <!<:<&NNS ?hN]6Tm6T-@ (i@@.@(H(P.X(`(h.p.x."i@$p min%. low&.'. max(.)x .... 5 (68_X [qE@qNuqT qZqe@zvvIk..Wqqqq +..qq+u:(r0ivmar1 r2 $r3 .r4.r5. 1r>r? S r@ v   .  ...vv[v%v.. .9 *a .I>Ju f /Uz/U .% .0g [(" @,0,4.g0[(1a#, [,{? cnt@ SA5 _Ircu yMyN yP[yR[ yT[ [ .(d..... 0#rcu1 2@^3 .. HIJK LM.N]v d:%;<   !"# $(%0&8'@(H)P*X+`,h-p.x/0123451WW*Up*[l Hxny 5z[|[}6~0s@ n!8%+ p + p!+ p"+ p#+ p$+ p%+ p&+ p'+ p(+ p)<5 TK @ p@ pA pB pC pD pE&e7PP_ ^ S S[ p p p p p p p  p  p  p  p [PPPP  ($qos0+,J id-./5 0(1p802.X3 `4 h5 p6 x7 8.9.:.;.<. dev=W> p? p  W- lops1 |  |WplW[M NJOJP!sQ!sR!s T (U 0V8W @X HY P[X\`^ h_paxcd  pmf hp W  ` aJ busb di%eJgp h $j (k? 0m8n @oHp Pq Xr`s!sht!sp pmv xw  pyI      W%  `2 3J5!s6!s8 9  ; (< 0>8@(@A HC  P pmE X   L     K   AF 0X{ YJZ!s[ \ x ^  pm` ( {  [- ȷ  w@K   :  idѤk cls :  D  Xx  AFZ  [[.*[ *[ 8Q  0|!9" |*[1*[B*[O c_d&e2f4gp lidhp _ s }P } Gcma 0V1J2 3J46X7`8Vh9Vp:Vx>.?I [ e |   ` P[ [ ! + 58UnUoUp[Uu#Uw Ux `Uz U{ U~[8U5<U|R@U_PU!`pUxD #..0b nr ip b r . [! x 5p88.`.h.pI$I&6IIH 5 ^I ( ^06  [Z- ZC@ idZD refZE T9ZNhZO8WZQ S-@ZWZY8WZ\'Z]Z^Zli@@Zp|@HZqi@ Zr  Zs!@H  ” .  . .(ZaZPZ atZPZ{5ZZIrcuZ q@Z;Z@;Z@  ( .   . ..h*[ZC˽{VoV 5VV V V(VV  . o R6..J ret  !$+ !& K$+: mV;<[ =[!>["?[# B srcC[D[EpH maxI keyJ00MNQ0TWZ[] `$g8jpDmpEppFspGvpHyL|[PpT[X\[`[d[h[lpp# x||'7 $ $ [$ ( [,  [  . K' . 7 . [G . N[f [0pw'x, devyW{f rev|[~1 PpX`[ 4irq 9   p [ 6  A p V [ [    6  Td@ ' A . Q . Q k .. O . < I B#B#B"%6B#%6B$%6 ! .mJ!  J .V:JJ  s .cJs   .J 2I   .J2  C( 23I 25  C 2I 2  C 2I  F.s2! Cz  2 I C  2 I r7,7K pLdev 5WLreg G[Y t M M UZ D!3UT[ KQp LdevQ5WLregQG[Y  M M UZ D! 3UT[ sE p VdevE2WVregED[tG K.p!\reg.[UKp=!\reg[Uua "v" UD!3T 3QnD!3T 3QFD!3T 3QWw3T 3Q6xIVdev:gU[,. .J .V,O,[s,,,,Vint[,,*,4s8g4u8z4s164u164s32-4u324s644u64F[v s~,.1[2[HI~X]^~_`O,,<[ <4  #p,%&*.4=Bh-l mn<} F P P [ [ S< vF_ O  .44 D D49WPXY.W-@ x OZ.     ;[H  J   " #   (  i%0  8  @  6#H  6#H 6#H (H 6#H 6#H  6#H  6#H!@      ]P h  J J     [ 6$kp   [( [, 0  8 p@ pA pB [D  $H PAmem )@  .  [  : ?  I S  ( I0 [8 I@ [H [L XP [X ]` [h bp x [ [ n% l [ { [ [ % I [ !% "[ % &( 9[ : ? A D  F S P  Q[( Ts%0 ;P (cs =P(sl ?P(wfe AP E (ss GP(sti IP KP(nmi MP PP  SP0 VP8(lm XP9 ]P: dP<  )cs )csx P   B )ss )ssx P P  gH r15 m. r14 n. r13 o. r12 p. bp q. bx r.( r11 u.0 r10 v.8 r9 w.@ r8 x.H ax y.P cx z.X dx {.` si |.h di }.p .x ip .  . sp .  B  C D E  E((s E,(dpl E-(p E'/ F0(avl F4(l F5(d F6(g F%7 F+8..... S pte "<  v pmd "_ % %%0 /%/ >' pgd'$ /'" >p pudp /p" / @HLI.%Nkxk0 S4.8ezf.ghuv-w- keyxz UV SLjkeyknkeyo;y<=? [ @ [$A [(B [+!-@ 64[[ I T9( [,![0( 4)28*[H+.P,6X5 `6 d8 h: l; p< t=[x.8A P@D PHG.PH.XK?`"N?TLWLZL^Mk 1mMp\5 q5(t.8u.@$fsxMH{MP~MXN`Rh cRp &:x &: &:=. [4mR eA[8^> P  P 5 a# TI 6( 68 wR@  IH RP RX R` YSh cSp .x hS %? [  P  P  P -9 A  T   <  < "T )U     U0  68  [X U\ %U` 6h  /U       ![ "[ # $. & P ' P ( P ")  39U C% D. L>U N. RNU S<( T<, Y.0 ] 8 ^ < _ @ ` D "a H d>X gXU i> lbU w x z. } ~gU  P P  % S S.[8WyWWW [([,vI0Arcu 0T9@ D6Hp8PXxT9 I " X X XI  P >"  !"j2$"j2". <*X"F;@@y!@@ 2sp.es ds"$&.(.028.X.`cr2.h.p.x>2.[<.. _1o )"  M"m")val S")""M",m"" " " ." S" """" 1#  1#B GG a#"F# #a# [.,9$fmtJJJ[JJ$\6[$788$JJJJ[[4[ key99$( [=%8Ui%V modWi%XJYn% Z ([ ,\$0Ju%v%w%x[y[[$%. O% . /&1[ set3` get5y7 3%6 ' i%   ;  ^    6(  60 8 !@ " H # P $ X %` &5h 'Np (5x )q * + , - . /  0 4 1 ޸ 2f 3  5 L 9 y ;  >q ? @& !@(% + -/  h( !- key "- ?( A. B( C( (@( =( >Ih( .( . ; (! v(!@A@"+&"k@"$|!"&5": 55"<.5"=.5">.5"@6"A ^6"B ^ 6"E86"G S6"H.6"K66"M66"N6"O~6"Q6"T6"U~6"V ^6"W67"Xp7"^.7"d.7"e. 7""ii@@7"t݁@7"y[`7"{.h7"}[p7"[t7".x7"|7".="{="|x>""i@?"$?"?"A"A0#c+#dJ#eK#gi#i #l R(+$,$P end$P% |% |p&, cwd&< swd&< twd&< fip&< fcs&< foo&< fos&<&,&<l <, .&*, rip&+P rdp&,P&.- fip&/< fcs&0< foo&1< fos&2< &)&-,,0&@H-&AH-&BH- <X- . -&$- cwd&% swd&& twd&' fop&(-&5<&6<&9- &<- &>H-H&- <- . < . .?&Q. cwd&R< swd&S< twd&T< fip&U< fcs&V< foo&W< fos&X<&Z,&[ l&\ m&] n&^ o rm&_ p&` q&a.x&b< # . . P / .@&:E/&; P&< P&= E/ PU/ .!@@&O/&&PX-&Q /&R/@ /..]@&^/&_,7&`X-&a .7&bU/@&c/ 0B.!@@&f0&h[&k[&nP&qPxfd&tP&w[&z[&[&[&&/@@&0& P&[&[ ^fpu@&Z1&[&.&Z1&Z1&0 &00&&0@@0' 1' P'P O1 . O1 .? (1( (! (" (#1 P1 . O2B. H 2 . /2/2 .42 92)|)|)|*82*92*<2*=22+<2+=[+> S+:3+;22 src+A dst+A 33I [,53(,3,3 val, <,!< ,"<,#P,$3 <,*3,+&3,,#3-3-|Z- -3,'4,(d,)33,.P ,1h4,2m4,3,4 ,5.,6. h4(,4,%53,/3,748,4,. fn, 4r44444.>(5.?..@..A< cpu.C< [/W5 0w50 |5 w51 512 52 S353F#355354 64"4"5 5)R65*(5+a# osq5-5 5/(6 66 6 6767.767667 67 6777676 8-78 68 8 H786 [9 e7@9'79(79)  9*7(9+k809, 89- 99. :9/ ;H777e77@@:/k8:0/:1[:2 d seq:3@:47:5-7 :690:7 87(;8; ;.; 8;< 88p88<8<< S<9 8= 9=9 .-9 .=89>T9> S>99?+9?,?-x@9@9@[`@.h max@.p .9 . A:A PA PAB &: sigB9B:CRsCSJ:2:CUCVg:O:ID:D D ID l:D':D(D)D-;D.D/D0 :D1D51;D6D7D8 : D<|;D=D>D?D@DADS;DT %DUIDVI DY;DZ %D[ D^<D_.D` Da DJH<DLDQ DW|;D\;Db; DEe<DFI<Dg<Dh _fdDiDm<DnIDoDp[ I D%=D*:D2:)_rtD9;DB1;DdH<Dje<Dq<0E Z=E E E E <0E n==EZ=Fu=Fv nsFwDv uidFx eAFy SFz` F{~z=E >E!E" &: E%D>E'>:E(.E.[:E0 &: E3^> saE4> G >G G . lenG .G p(H>H  I$>I%I'I( 0ID%?IM#>IPp(IWp)8J ?JPJPJPJPJP J#P(J,P0K)?K*PK+-7PK8?K9?K:[HK;[L ?? .8KD1@KE KF6KG[0 L>@LKLZLpLLL endL@ O@..M!@M" [M&@MD@MD@MD@MEAME@ME@MT BAMYAMZ 5M[AN eA valNN NAN A valN N qASAU PV PWa#*[[A0hnBi@jkAcpul[mPnP oP( B.B. <5@@mC P P P < <. .(.0[8!@E P P P P P  P( P0 P8 F@ PH PP FX F` Ph Pp Px  P  P  P  P P P P P P P P P P!@iFB& 6! P(" P0# P8%@&P'Q(R)S, PX- P`. Ph/ Pp0 Fx1 P3 P6 7iF9sF;sF=./I    _TIJbHJs<qIqITIG ~II I HI .(( I5 J 7 m ^  $@  SD  SH 6P .`  .h )p .x   5  ^  IIKpidpO7?KO9 T9O:[O; 5O<  inoO=PO?/ O@@OB ^H#rcuOC `OD?pJ TK . P|KP[P]_TKQoLQp( uidQq eA gidQr A Qs eAQt AQu eAQv AQw eA Qx A$Qy [(Qze0Q{e8Q|e@Q}eHQ~ePQXQM`QMhQMpQMxQ IQ&QDvQ=Q+%KLKkeyRMRT9R%8R+ semR^(R5PR IXZ`R h uidR eAp gidR AtRxR|R~R R.ǜ R:L M M M MHS NS! T9S"2S#<S$FS%* S&P(S'Z0S(Z8S)@M-XT^RT_T9T` STaTb TcTe ^ Th68Tk=@TnXTq`TsdTt6hTwpTx[tTzxT[T[T[TTTe7T  itT T% T? Th T S T?K T2ttyT̠ T֠ T BA TP T P TP TP TP TP TA T. T. T. T'. T.  T.( T".0 T,.8 T.@ T.H T".P T,.X T.` T.h T%?p T T۠ T_ T T [ T Tp T T T  T6 T^0N0 TcRT5TT9T ^TO !R hR rRURUU|R RVRV.VRXWcYSWd(We SWg Wk 5WmmWn(Wo0Wq_8R ^Sn=-PXTXAX T9pXTxXdXX X X XX}XXX"X(X.X/X0X9d X:d(X;T0X>p8"XA @mS T YUYJY2Y>T U  U .  U *U 4U .NU .1@ SU ]U 9wU .-@Z8W#cssZ idZDZ@L@ Z Z Z5  Z_( Z.H ZpP ZX Zp Z Zz Zz ZzH Z Z Z Z. Z  ZyW( ZyW0 Z8Z(HZPZ`ZZ ݁xZlvZ7wU0ZyWZ Z8WZ S%a =W ~Wh[yW[ze[|[[}#g%f[\ajebjf[ sdajgcjh>#jicDb0xjDcjE?bjFcjH jI6(jJ5HjK6PjL.pjM.xjN.jO.jP.jQ.jR.jS.jTpjU.jV6jWTK jY S j\. j]. j^_ j_bp ?bc .`bk|l3cddd.Idl6Tdl7cl8dl90lA|dlB^lCd(mdm.m.m"dm#-m$ m% m'dm( m) m+em, m- m!Eem&dm*dm.d mle|d opsmvee leqem2em4.m6[m7[ [[@e [[Hf[p7f[qe[r[s kval./k8MkN IP[1JlJlruKk1W)lX IYk8@GlI.kUJV . l([ S0\ S4^.8=@Fl)l7j 8(mmn.o.q Sr Ss St Sv[ =@l=ml7z 80}m~.. I I I  I(8 m..=@|m=mm7 5Dn%l%m@%m/.n5 4o  5  0   q J  I  7( [0 [4 L8  @.P  p  Ix # $  %  '%S*n*n5[octx6`o [o=o>@^@@(XoY^(\pb.h.t:w }$8)p..=Gpp7 1lp%nnc p .r. 8We@@ v%q@^@.P.X.`.h.ppgd  x) S5 S? vE.L[S SZa#](_a5p^r....v. .(.0.8@@5D.H.P'.X3.`.h$brk.p!.x..%.0.v v@5v|i.h5p?vx6Dv9o&Nv.. S Scg(_Xv..( qq . v .3 g0v . 0v :vZ Iv Sv .lv..+v-/ 5/ [vpr/4wir74w(pmdr9 0pudr; "8n@rEHrFPpterL XptlrPX`rT h*[w @?????'s6|'s9|'s<|'sG|twt(h"ux"vx"w.`  x . ["oy        !"#$%&'()*+,-./0*["y6@"z".":"`"z8"z"z"z8"zx"z"z"p($gen" )$seg" *"1]0 z . . . z . . . .z . . .z . . . ({ . . .H"]{seq"."""]{"m{( %m{ . .{ . ."|"|seq"."."|"|""p"p6 "e|"f<}"h5P"n.X"o.`"q(h"s:p"u."xy"{{"("w| | . . . | ."&&}seq"(."*>U",&} ". 5 ]<} . . L} .!@"}" 5""" """ " " ""} ~ . @"@~"@~" "P~ P~ . .`~ .1"~""~ ~ ./*["~!@"76";`"<. ">.("?.0"J68"M`"O(h"P!Fp"Q$Kx"V"W"X"c."("."."."."J"." BA"""i@"P"x"."5""i@".".":"."."["["" p" p""i@"`"p` F .L}~ w` . (p . ( ."""~6 "́"́ ݁ . "" 5"".("k"."." ." ." . @~@| . . ^ .`~ ( ./ 8q$q.q5q5q.q. q.(qp0 [4 . 4;p>u@ Y||IH8uuJuIuu Lu)u. uI(uI0 us)ut Suu ^M u\u6uلXuل%)u|Ku| u( setu̅0u8u@uHuBP\u)u|uu uu3uBބErcuu F[u[uʞuu'hu Kpudx[hu̅u#diruх`uu\u6Xх3̅̅'AلAFeAA,dل|PwwIwixxIx xBxDxExFYxGhxHxIIyTy y![y"[ T ^cz,z- 5z/ $z0ImxAȇÆxK x:x@ixNxO.xP xQ (x+_x, x-px.px/ ȇ 0 pȈ q9o r  s  t I u  v$0(_{"{#{&{'{' |C|5| 3|^9||s%C}3}4< len}4<}2s}6P}1Ӊ}8d}i}j}k ^f}r/}s}t9}u }R}T[}UA}V}W }X }Y70}[<8}_"`}`Ԓh}a.p}bIx}d^؉}m}n#d_u}v//!x {7 | L } ~ eA  A [  Թ Թ !M  Ԓ( J0  I8 .@H  @L  P  X  `  h <p <t <x <| 5    ̦   < ^ . .   -       L&0 v@ vH  SP  ST  SX  S\HL` 7h" Ip 8HH  P (AX K` Uh  Ip L .'@}} } }-}U}i }}(} 0} 8} @} H}MP}kX}`L!@ Ԓ   @  .    ( !0 !8 @ "H .P .X .`  h ^p   S I & #  $   ҈  ) 9o r |  [  (" `  I <   !< " /  0  1  4  6[ <6  BJ@ D"H F@P I(X L` O d R!`h Sp ZDvx aT bTArcu c  d_ f6 k0" n5@@ oH q5X r` [}  [##(P#[JPӉ2i#Z} n  7  ~E~F ~GԒ~H~Iœ H mnt    ffpHR  ْp02map9 (” .?#rcu  .. "[#$ nid&-.4.78WR,SJUJXYZ [c T9 dTK(#rcue HgIXj` idmpptqJxr uO.@@E[ ,(034678 p xa9m  ז " $5@@- lru/0( זO2* nrO3 nsO4*W5 ? . N.. e valPN [   ӗ Iӗ!@@Xd&XX.XXXXXXXXX$knXWXzXz@XBxXXXZX\X^X$A`XRXXX} XdXdX$X "Xi@@Xd@XQHXQpXAX"X#6X& ^X)_$psiX,4$bpfX/ X2X5# XX9'|. RRRl#rcuRm RnT9Ro pRvRxRy Ru3)xR.(Rr{Rt.RRRJ {{I RRIR  Iʛ .R֛ۛMMR8Rʛ keyRMR3RZR9R6R|R R (RǜR.R.RRR  (RR3|8 R RR v1 R&R & 0 T9g.0(8@ uid eAP(X S`$m#hQQ T9Q gidQ  A..3Q&QErcuQ ?-@@:g/:ha# cpu:i[:j[:k[ :l[:m[:n[:o[:p[:r[:s:t:u[:{  :|7(:} 0:~78:>@@0;4@7@O . D>_ .?8TȟT T! T".T#PT#P T$.(T$.0T'T(PT)PT0%T1 vT2 vT3 vTC@TDTLhTM6TNh@8TQTR STS@TTTKm ȟ . ?KǠ . Ǡ Ѡ `9 .-)/06z7z IJQ R(U0V8^@fHkPlzpnqoxq|rsuvxyz{       ( 0 8 @ H P X ` h pDx       60Z ^  ` #rss  08 ^@ SX Ѥ fn 3 arg I z . bѤ <WS0WTWU3WWRWX9WY 8WI qWJ iocWKYS%0 W\[0 R  ¥ val valΥ< i5n.v8_`(abc pd p#rcue  reff05 v .%  . 0 v4 4Y5[6Y7 ii .s n x}  eA ¥ ˧ A P D [ L    ( 8 9oHIЕ()*+ ,0-6@. 5`/ Sd0Ԓh1p2 x3.4 # val  [6RBE)uidF eA)gidG AH #D^J/H0 R R R R R  R( R0 8 @H. [([, R0 R8I@ !i%@8~9:;<= >(?0@ɫ8ԒDīԒīXDwEFG HI J(K0N 8O׬@QHSɫPΫDԒ|D7RҬ7Ҭ#7ܬxYZ[P\P]P^P _P(`P0aF8cF@dHeLfPPgPXhP`iFhjp8[[[[ [[[ino  ( 0[ . 9[[[ [[[[X A(d08d@HP9ԒfԒ[ <Ԓ<#_Ԓ_FԒī_iԒ~68  [ ^ 0 H$ops!  7 . 0 . 0 .1 wU }  83456c]UIȈ  z    ʴ  ]  ( 0  ڵ8  @  H  P  6X Y` mh  p  x ö θ  ޸ 0+z-/6 7 9r ; [ < [!= ["> [#? [$@ [%A [&I ['P(S0V#8 W .8 X@2wb[-H \7P _X `\ a` b h c p d x9omJpʴJڴڴߴ8D]E9oFJraGI .J[ K[$Lp(M.0ϴ9oJ[^b9oJ[[I ڵJ Ƶߵp $6Ȉ͈"YJq;m^prpöJ9oɸ6V#ɸV$ V%.V&V'R6 V(sHmaxV)[LV*PV+%XV,`V-hV.xV/V1(V3V4[V5[V6[V7[V8[V9[V: V;"V<6V=) V>9o(V?TK0V@ 5PVM 5TVQ_XVR_xVSVT ȶ޸9oӸȈ͈1 & b [= L 7  1 q !q  '7v1 Ź XU ʹ    [ Ź Ϲ!@ ZH [ \( ]F ^d `  b( d0 e8 f@ h'H jP kOX m|` oh pp r x s u0 vX y{ { }   @ٹH-i- bdijrl.m.op(q8rHs 5Xu S\v v` x. y. z. {. |.  .( .0 8 h 4l 5p x _ _ 8  H X < <    LR 2 < F P( ˽ 9o  6pid ?K (5uid  eA eA  $ .  . [ [  [ [  1 S 6  P=  )7 *  +2 ,˽ -Z/ PI!0      & @Z .  x         (  0  8 @ H P X ` h 8p  x Q Q Q Q  y          w     $-))* + ,W-. /.(0 S09 @4:J8< S@=5D> IH? IP@XA6`BCE SF6HIK IQ-`r idP6 .0.8@^@[D[H[L[P(X.`#wbRh ` mp 6 ^  ^2devW 1 W( p80  X. w  O . O .$/ pJP[   pos  /  [;9o"^9o@9oJcȈ[ 9o(9o 9o[.9o 579o!N9o:q9oS9ov9o .9o....+Y XU9o[49oXU[W9oW^\a 99ok9ox(L buf(( ( ( (  ( (( 0(68 op(X(`(h(Ipy9o9o[Q9o9o[~[ [ 7 [J# 7# F7-Թd7pK i7 Lp 7 7 7 J'7 L O7 L@,|7 7 [T ˧f<[[  7 PP 07X7 9o[L5{79oL]Թ  Թ    ,mt ^ .;;7,*[ i7xԒi7}77ԒԒEԒ  8Ԓ Q =yԒVԒJ~7DԒE   #JI 6#8 .@@AJBCD EY( sdFW0G@^8I[J[K[L[M[88Kbio2) ̦ S 48 I@&HPPX0` :hpr  St ?x* -. <YgY>sggidr4m[[ v.6{ rev. vWW S SWJ#rb6 nsK0[8< L>w@ idP` Ihp#rcu x  opsh!r Whc "$ % & (( 02 89p@: H= 8P@QXA o`c m )dir4\ s knW9o I6 6@`h x    p@  pA %qsIIIII(8$Q =oV [0'(t) C* +,% - 3(;IK ;K #R#J# L#mt#n#o&X#0#1*#2 #3 I#4 #5 (#7 0#9 8#; @#= H#?;Ptt(#LFF*-Li#P#nF;J9o9o#9o#;9o# #k# # @FpFJ` 58 X0tTu ivnw!sx*y z (Ti^kx+}KAF0 }~+ 2buf;  + . ; .? OLB.LJJ[(E[FJ modGi% opsH!7I (JK ~ yeL)argM I)strN)arrO2VW[X \- max^[_[ num`  opsa!7bI-&0(X)X@6i . . [    O .7` -) .8 mod /i%@ 0H mp 1.P 2|KX )8 5 6* 7  9  ;  <( = 03Ji%Ji%i%*[ >=58 Eimod Fi%& G<5P p qI rI sp t[J[[ [[[[ >[[[[ [[[$[[H"[ Z6[J\J^[_[`';a c[$d[(e[,f[0g[4h@8i[@j[ k[!l["m[#n[$o[%p[&q['r[(s[)t[*vHxEPyX{\|`~hphxI'"bh[[IJ[EI m[[  z .14o   ops #( [ T9 # - 7 ACnetK U0nsDv= T(_ FF<F<F<@FFF<<  .F7F7F7@FP@Fd< t . t ( . [ . O@079 @.0 A>` D G$ J  M_ $$ .%) > .% N .%@T#seqX @@[^<adP8i@@ < . < . .044p6!9018PpPx_> N2avgdx 6  p8(  ^P Sh Sl 6p  > < P 1 P PN <N . Pd . . .z . .8X knXWX.Xp8XqXd ssX7X X X0X@ idXPX[TXPXX S`X_hX&`X<XX7X XX X X X (X !0X:8X:@XXHX hPX hXX `XhX pX xX X X XpXpXpidXXJXJXX XXzXzX[q <Q . (XDXE9XHPXJP XaXfXgQXmQ(XuQPX{QxXdXd XBXpXpXX zR . b . !@XAXB{XE[XH XKr? S r@ v   .  ...vv[v%v.. .9 *a .I>Ju f /Uz/U .% .0g [(" @,0,4.g0[(1a#, [,{? cnt@ SA3 _Ercu yMyN yP[yR[ yT[ [ .(d..... 0#rcu1 2@^3 .. HIJK LM.N]v d:%;<   !"# $(%0&8'@(H)P*X+`,h-p.x/0123451WW*Uh*[l Hxny 5z[|[}6~0s@ n!8%+ p + p!+ p"+ p#+ p$+ p%+ p&+ p'+ p(+ p)<5 TK @ p@ pA pB pC pD pE&e7PP_ ^ S S[ p p p p p p p  p  p  p  p [PPPP  ($qos0+,J id-./5 0(1p802.X3 `4 h5 p6 x7 8.9.:.;.<. dev=W> p? p  W- lops1 |  |WplW[M NJOJP!sQ!sR!s T (U 0V8W @X HY P[X\`^ h_paxcd  pmf hp W  ` aJ busb di%eJgp h $j (k? 0m8n @oHp Pq Xr`s!sht!sp pmv xw  pyI      W%  `2 3J5!s6!s8 9  ; (< 0>8@(@A HC  P pmE X   L     K   AF 0X{ YJZ!s[ \ x ^  pm` ( {  [- ȷ  w@K   :  idѤk cls :  D  Ox  AFZ  [[.*[ *[ 8Q  0|!9" |*[1*[B*[O c_d&e2f4gp lidhp _ s }P } Ccma 0V1J2 3J46X7`8Vh9Vp:Vx>.?I [ e |   ` P[ [ ! + 56UnUoUp[Uu#Uw Ux `Uz U{ U~[8U5<U|R@U_PU!`pUxD #..0b nr ip b r . [! x 5p88.`.h.pI$I&6IIH 5 ^I ( ^06  [Z- ZC@ idZD refZE T9ZNhZO8WZQ S-@ZWZY8WZ\'Z]Z^Zli@@Zp|@DZqi@ Zr  Zs!@H  ” .  . .(ZaZPZ atZPZ{3ZZErcuZ i@Z9Z@9Z@  ( .   . ..h*[ZC˽{VoV 5VV V V(VV  . o R6..J ret  !$+ !& K$+: mV;<[ =[!>["?[# B srcC[D[EpH maxI keyJ00MNQ0TWZ[] `$g8jpDmpEppFspGvpHyL|[PpT[X\[`[d[h[lpp# x||'7 $ $ [$ ( [,  [  . K' . 7 . [G . F[f [0pw'x, devyW{f rev|[~1 PpX`[ 2irq 9   p [ 6  A p V [ [    6  Td@ ' A . Q . Q k .. O . < I M#M(%6M)%6   .:"  :'I  J .J::) J P0 :9I :; J P :I  B.u:! j kI l9,9Qp;RdevWUSregG[QpRdevWUSregG[mn"op+qrstuTT TQ7U ,. .J .V,O,[s,,,,Vint[,,*,4s8g4u8z4s164u164s32-4u324s644u64F[v s~,.1[2[HI~X]^~_`O,,<[ <4  #p,%&*.4=Bh-l mn<} F P P [ [ S< vF_ O  .44 D D49WPXY.W-@ x OZ.     :[H  J   " #   (  i%0  8  @  6#H  6#H 6#H (H 6#H 6#H  6#H  6#H!@      ]P h  J J     [ 6$kp   [( [, 0  8 p@ pA pB [D  $H P@mem )@  .  [  : ?  I S  ( I0 [8 I@ [H [L XP [X ]` [h bp x [ [ n% l [ { [ [ % I [ !% "[ % &( 9[ : ? A D  F S P  Q[( Ts%0 ;P (cs =P(sl ?P(wfe AP E (ss GP(sti IP KP(nmi MP PP  SP0 VP8(lm XP9 ]P: dP<  )cs )csx P   B )ss )ssx P P  gH r15 m. r14 n. r13 o. r12 p. bp q. bx r.( r11 u.0 r10 v.8 r9 w.@ r8 x.H ax y.P cx z.X dx {.` si |.h di }.p .x ip .  . sp .  B  C D E  E((s E,(dpl E-(p E'/ F0(avl F4(l F5(d F6(g F%7 F+8..... S pte "<  v pmd "_ % %%0 /%/ =' pgd'$ /'" =p pudp /p" / @HLI.%Nkxk0 S4.8ezf.ghuv-w- keyxz UV SLjkeyknkeyo;y<=? [ @ [$A [(B [+!-@ 64[[ I T9( [,![0( 4)28*[H+.P,6X5 `6 d8 h: l; p< t=[x;se?E@$rt@xF@dlAGBGFI"I6J.K[OIXI]I"`"mC@dh[k[ l.m nI oI(p(0q IXs`ubx dy/Ihzp{I.      /I nBR6("6P$mm h pJx    .[ [, [, [, [- [- [- [- [- [- [- [- [- [ - [ - [ - [ -"[ -.4$pid X X.6 66(0@?KPDKX "|K% ( + I- P. P3 P4A6A: S(=.0>.8A P@D PHG.PH.XK?`"N?TLWLZL^Mk 1mMp\5 q5(t.8u.@$fsxMH{MP~MXN`Rh cRp &:x &: &:=. [4mR eA[8^> P  P 5 a# TI 6( 68 wR@  IH RP RX R` YSh cSp .x hS %? [  P  P  P -9 A  T   <  < "T )U     U0  68  [X U\ %U` 6h  /U       ![ "[ # $. & P ' P ( P ")  39U C% D. L>U N. RNU S<( T<, Y.0 ] 8 ^ < _ @ ` D "a H d>X gXU i> lbU w x z. } ~gU  P P  % S S.[8WyWWW [([,vI0@rcu 0T9@ D6Hp8PXxT9 I " X X XI  P >"  !"j2$"j2". <*X"F;@@y!@@ 2sp.es ds"$&.(.028.X.`cr2.h.p.x>2.[<.. _1;fpu 0@[ 6 (   ( !@@ %.r@]v@ S v  5"%)p  Gp p(,p0&lp8Xph%qp.x9o Iq(/Uq>o )"  M"m")val S")""M",m"" " " ." S" """" 1#  1#B GG a#"F# #a# [.,9$fmtJJJ[JJ$\6[$788$JJJJ[[4[ key99$( [=%8Ui%V modWi%XJYn% Z ([ ,\$0Ju%v%w%x[y[[$%. O% . /&1[ set3` get5y7 3%6 ' i%   ;  ^    6(  60 8 !@ " H # P $ X %` &5h 'Np (5x )q * + , - . /  0 4 1 ޸ 2f 3  5 L 9 y ;  >q ? @& !@(% + -/  h( !- key "- ?( A. B( C( (@( =( >Ih( .( . ; (! v(!@A@"+&"k@"$|!"&5": 55"<.5"=.5">.5"@6"A ^6"B ^ 6"E86"G S6"H.6"K66"M66"N6"O~6"Q6"T6"U~6"V ^6"W67"Xp7"^.7"d.7"e. 7""ii@@7"t݁@7"y[`7"{.h7"}[p7"[t7".x7"|7".="{="|x>""i@?"$?"?"A"A0#c+#dJ#eK#gi#i #l R(+$,$P end$P% |% |p&, cwd&< swd&< twd&< fip&< fcs&< foo&< fos&<&,&<l <, .&*, rip&+P rdp&,P&.- fip&/< fcs&0< foo&1< fos&2< &)&-,,0&@H-&AH-&BH- <X- . -&$- cwd&% swd&& twd&' fop&(-&5<&6<&9- &<- &>H-H&- <- . < . .?&Q. cwd&R< swd&S< twd&T< fip&U< fcs&V< foo&W< fos&X<&Z,&[ l&\ m&] n&^ o rm&_ p&` q&a.x&b< # . . P / .@&:E/&; P&< P&= E/ PU/ .!@@&O/&&PX-&Q /&R/@ /..]@&^/&_,7&`X-&a .7&bU/@&c/ 0A.!@@&f0&h[&k[&nP&qPxfd&tP&w[&z[&[&[&&/@@&0& P&[&[ ^fpu@&Z1&[&.&Z1&Z1&0 &00&&0@@0' 1' P'P O1 . O1 .? (1( (! (" (#1 P1 . O2A. H 2 . /2/2 .42 92)|)|)|*82*92*<2*=22+<2+=[+> S+:3+;22 src+A dst+A 33I [,53(,3,3 val, <,!< ,"<,#P,$3 <,*3,+&3,,#3-3-|Z- -3,'4,(d,)33,.P ,1h4,2m4,3,4 ,5.,6. h4(,4,%53,/3,748,4,. fn, 4r44444.>(5.?..@..A< cpu.C< [/W5 0w50 |5 w51 512 52 S353F#355354 64"4"5 5)R65*(5+a# osq5-5 5/(6 66 6 6767.767667 67 6777676 8-78 68 8 H786 [9 e7@9'79(79)  9*7(9+k809, 89- 99. :9/ ;H777e77@@:/k8:0/:1[:2 d seq:3@:47:5-7 :690:7 87(;8; ;.; 8;< 88p88<8<< S<9 8= 9=9 .-9 .=89>T9> S>99?+9?,?-x@9@9@[`@.h max@.p .9 . A:A PA PAB &: sigB9B:CRsCSJ:2:CUCVg:O:ID:D D ID l:D':D(D)D-;D.D/D0 :D1D51;D6D7D8 : D<|;D=D>D?D@DADS;DT %DUIDVI DY;DZ %D[ D^<D_.D` Da DJH<DLDQ DW|;D\;Db; DEe<DFI<Dg<Dh _fdDiDm<DnIDoDp[ I D%=D*:D2:)_rtD9;DB1;DdH<Dje<Dq<0E Z=E E E E <0E n==EZ=Fu=Fv nsFwDv uidFx eAFy SFz` F{yz=E >E!E" &: E%D>E'>:E(.E.[:E0 &: E3^> saE4> G >G G . lenG .G p(H>H  I$>I%I'I( 0ID%?IM#>IPp(IWp)8J ?JPJPJPJPJP J#P(J,P0K)?K*PK+-7PK8?K9?K:[HK;[L ?? .8KD1@KE KF6KG[0 L>@LKLZLpLLL endL@ O@..M!@M" [M&@MD@MD@MD@MEAME@ME@MT BAMYAMZ 5M[AN eA valNN NAN A valN N qASAU PV PWa#*[[A0hnBi@jkAcpul[mPnP oP( B.B. <5@@mC P P P < <. .(.0[8!@E P P P P P  P( P0 P8 F@ PH PP FX F` Ph Pp Px  P  P  P  P P P P P P P P P P!@iFB& 6! P(" P0# P8%@&P'Q(R)S, PX- P`. Ph/ Pp0 Fx1 P3 P6 7iF9sF;sF=.;avgGB@E nF0KFLM.N.O[ P$Q&SF(xF/]FGpGGG5`wH&a6h Pi P j P(k P0l P8s F@t PHu[P[[[[[[[[&e7X&e7rqHFwHG/^HH6HGBrqHH+[ +[ +[+[=/I    _TIJbHJs<qIqITIG ~II I HI .(( I5 J 7 m ^  $@  SD  SH 6P .`  .h )p .x   5  ^  IIKpidpO7?KO9 T9O:[O; 5O<  inoO=PO?/ O@@OB ^H#rcuOC `OD?pJ TK . P|KP[P]_TKQoLQp( uidQq eA gidQr A Qs eAQt AQu eAQv AQw eA Qx A$Qy [(Qze0Q{e8Q|e@Q}eHQ~ePQXQM`QMhQMpQMxQ IQ&QDvQ=Q+%KLKkeyRMRT9R%8R+ semR^(R5PR IXZ`R h uidR eAp gidR AtRxR|R~R R.ǜ R:L M M M MHS NS! T9S"-S#7S$AS%* S&K(S'U0S(U8S)@M-XT^RT_T9T` STaTb TcTe ^ Th68Tk=@TnXTq`TsdTt6hTwpTx[tTzxT[T[T[TTTe7T  itT T% T? Th T S T?K T2ttyT̠ T֠ T BA TP T P TP TP TP TP TA T. T. T. T'. T.  T.( T".0 T,.8 T.@ T.H T".P T,.X T.` T.h T%?p T T۠ T_ T T [ T Tp T T T  T6 T^0N0 TcRT5TT9T ^TO !R hR rRURUU|R RVRV.VRXWcYSWd(We SWg Wk 5WmmWn(Wo0Wq_8R ^Sn=-PXTX<X T9pXTxXdXX X X XX}XXX"X(X.X/X0X9d X:d(X;T0X>p8"XA @mS T YUYJY2Y>T U  U .  U *U 4U .NU .1@ SU ]U 9wU .-@Z8W#cssZ idZCZ@L|@ Z Z Z5  Z_( Z.H ZpP ZX Zp Z Zu Zu ZuH Z Z Z Z. Z  ZyW( ZyW0 Z8Z(HZPZ`ZZ ݁xZlvZ7wU0ZyWZ Z8WZ S%\ =W ~Wh[yW[ze[|[[}#g%f[\ajebjf[ sdajgcjh>#jicDb0xjDcjE?bjFcjH jI6(jJ5HjK6PjL.pjM.xjN.jO.jP.jQ.jR.jS.jTpjU.jV6jWTK jY S j\. j]. j^_ j_bp ?bc .`bk|l3cddd.Idl6Tdl7cl8dl90lA|dlB^lCd(mdm.m.m"dm#-m$ m% m'dm( m) m+em, m- m!Eem&dm*dm.d mle|d opsmvee leqem2em4.m6[m7[ [[@e [[Hf[p7f[qe[r[s@^@@(XoY^(\pb.h.t:w }$8)p..<Gpp7 1lp%nnc p;rb6.o prbqrc rh rjrkrq rs(rt0ru 8rw4@r{Hr~Pr\Xrp`rhrprxpqeooqPcid d@@ q S= .r. 8We@@ v%q@^@.P.X.`.h.ppgd  x) S5 S? vE.L[S SZa#](_a5p^r....v. .(.0.8@@5D.H.P'.X3.`.h$brk.p!.x..%.0.v v@5v|i.h5p?vx6Dv9o&Nv.. S Scg(_Xv..( qq . v .3 g0v . 0v :vZ Iv Sv .lv..+v-/ 5/ [vpr/4wdr74w(pmdr9 0pudr; "8i@rEHrFPpterL XptlrPX`rT h*[w @>>>>>'s6|'s9|'s<|'sG|twt(h"ux"vx"w.`  x . ["oy        !"#$%&'()*+,-./0*["y6@"z".":"`"z8"z"z"z8"zx"z"z"p($gen" )$seg" *"1]0 z . . . z . . . .z . . .z . . . ({ . . .H"]{seq"."""]{"m{( %m{ . .{ . ."|"|seq"."."|"|""p"p6 "e|"f<}"h5P"n.X"o.`"q(h"s:p"u."xy"{{"("w| | . . . | ."&&}seq"(."*>U",&} ". 5 ]<} . . L} .!@"}" 5""" """ " " ""} ~ . @"@~"@~" "P~ P~ . .`~ .1"~""~ ~ ./*["~!@"76";`"<. ">.("?.0"J68"M`"O(h"P!Fp"Q$Kx"V"W"X"c."("."."."."J"." BA"""i@"P"x"."5""i@".".":"."."["["" p" p""i@"`"p` F .L}~ w` . (p . ( ."""~6 "́"́ ݁ . "" 5"".("k"."." ." ." . ?~@| . . ^ .`~ ( ./ 8q$q.q5q5q.q. q.(qp0 [4 . 4:p>u@ Y||IH8uuJuIuu Lu)u. uI(uI0 us)ut Suu ^M u\u6uلXuل%)u|Ku| u( setu̅0u8u@uHuBP\u)u|uu uu3uBބDrcuu F[u[uʞuu'hu Kpudx[hu̅u#diruх`uu\u6Xх3̅̅'AلAFeAA,dل|PwwIwixxIx xBxDxExFYxGhxHxIIyTy y![y"[ T ^cz,z- 5z/ $z0ImxAȇÆxK x:x@ixNxO.xP xQ (x+_x, x-px.px/ ȇ 0 pȈ q9o r  s  t I u  v$0(_{"{#{&{'{' |C|5| 3|^9||s%C}3}4< len}4<}2s}6P}1Ӊ}8d}i}j}k ^f}r/}s}t9}u }R}T[}UA}V}W }X }Y70}[<8}_"`}`Ԓh}a.p}bIx}d^؉}m}n#d_u}v//!x {7 | L } ~ eA  A [  Թ Թ !M  Ԓ( J0  I8 .@H  @L  P  X  `  h <p <t <x <| 5    ̦   < ^ . .   -       L&0 v@ vH  SP  ST  SX  S\HL` 7h" Ip 8HH  P (AX K` Uh  Ip L .'@}} } }-}U}i }}(} 0} 8} @} H}MP}kX}`L!@ Ԓ   @  .    ( !0 !8 @ "H .P .X .`  h ^p   S I & #  $   ҈  ) 9o r |  [  (" `  I <   !< " /  0  1  4  6[ <6  BJ@ D"H F@P I(X L` O d R!`h Sp ZDvx aT bT@rcu c  d_ f6 k0" n5@@ oH q5X r` [}  [##(P#[JPӉ2i#Z} n  7  ~E~F ~GԒ~H~Iœ H mnt    ffpHR  ْp02map9 (” .?#rcu  .. "[#$ nid&-.4.78WR,SJUJXYZ [c T9 dTK(#rcue HgIXj` idmpptqJxr uO.@@E[ ,(034678 p xa9m  ז " $5@@- lru/0( זO2* nrO3 nsO4*W5 ? . N.. e valPN [   ӗ Iӗ!@@Xd&XX.XXXXXXXXX$knXWXuXu@X=xXXXZX\X^X$<`XMXXX} XdXdX$X "Xi@@Xd@XLHXLpXAX"X#6X& ^X)_$psiX,/$bpfX/ X2X5# XX9'|. RRRl#rcuRm RnT9Ro pRvRxRy Ru3)xR.(Rr{Rt.RRRJ {{I RRIR  Iʛ .R֛ۛMMR8Rʛ keyRMR3RZR9R6R|R R (RǜR.R.RRR  (RR3|8 R RR v1 R&R & 0 T9g.0(8@ uid eAP(X S`$m#hQQ T9Q gidQ  A..3Q&QDrcuQ ?-@@:g/:ha# cpu:i[:j[:k[ :l[:m[:n[:o[:p[:r[:s:t:u[:{  :|7(:} 0:~78:>@@0:4?7@O . D>_ .?8TȟT T! T".T#PT#P T$.(T$.0T'T(PT)PT0%T1 vT2 vT3 vTC@TDTLhTM6TNh@8TQTR STS@TTTKm ȟ . ?KǠ . Ǡ Ѡ `9 .-)/06z7z IJQ R(U0V8^@fHkPlzpnqoxq|rsuvxyz{       ( 0 8 @ H P X ` h pCx       60Z ^  ` #rss  08 ^@ SX Ѥ fn 3 arg I z . bѤ <WS0WTWU3WWRWX9WY 8WI qWJ iocWKYS%0 W\[0 R  ¥ val valΥ< i5n.v8_`(abc pd p#rcue  reff05 v .%  . 0 v4 4Y5[6Y7 ii .s n x}  eA ¥ ˧ A P D [ L    ( 8 9oHIЕ()*+ ,0-6@. 5`/ Sd0Ԓh1p2 x3.4 # val  [6RBE)uidF eA)gidG AH #D^J/H0 R R R R R  R( R0 8 @H. [([, R0 R8I@ !i%@8~9:;<= >(?0@ɫ8ԒDīԒīXDwEFG HI J(K0N 8O׬@QHSɫPΫDԒ|D7RҬ7Ҭ#7ܬxYZ[P\P]P^P _P(`P0aF8cF@dHeLfPPgPXhP`iFhjp8[[[[ [[[ino  ( 0[ . 9[[[ [[[[X A(d08d@HP9ԒfԒ[ <Ԓ<#_Ԓ_FԒī_iԒ~68  [ ^ 0 H$ops!  7 . 0 . 0 .1 wU }  83456c]UIȈ  z    ʴ  ]  ( 0  ڵ8  @  H  P  6X Y` mh  p  x ö θ  ޸ 0+z-/6 7 9m ; [ < [!= ["> [#? [$@ [%A [&I ['P(S0V8 W .8 X@2wb[-H \7P _X `\ a` b h c p d x9omJpʴJڴڴߴ8D]E9oFJraGI .J[ K[$Lp(M.0ϴ9oJ[^b9oJ[[I ڵJ Ƶߵp $6Ȉ͈"YJq;m^prpöJ9oɸ6V#ɸV$ V%.V&V'R6 V(sHmaxV)[LV*PV+%XV,`V-hV.xV/V1(V3V4[V5[V6[V7[V8[V9[V: V;"V<6V=) V>9o(V?TK0V@ 5PVM 5TVQ_XVR_xVSVT ȶ޸9oӸȈ͈1 & b [< L 7  1 q !q  '7v1 Ź XU ʹ    [ Ź Ϲ!@ ZH [ \( ]F ^d `  b( d0 e8 f@ h'H jP kOX m|` oh pp r x s u0 vX y{ { }   @ٹH-i- bdijrl.m.op(q8rHs 5Xu S\v v` x. y. z. {. |.  .( .0 8 h /l 5p x _ _ 8  H X 7 7    LR 2 < F P( ˽ 9o  6pid ?K (5uid  eA eA  $ .  . [ [  [ [  1 S 6  P<  )7 *  +2 ,˽ -Z/ PI!0      & ?Z .  x         (  0  8 @ H P X ` h 8p  x Q Q Q Q  y          w     $-))* + ,W-. /.(0 S09 @4:J8< S@=5D> IH? IP@XA6`BCE SF6HIK IQ-`r idP6 .0.8@^@[D[H[L[P(X.`#wbRh ` mp 6 ^  ^2devW 1 W( p80  X. w  O . O .$/ pJP[   pos  /  [;9o"^9o@9oJcȈ[ 9o(9o 9o[.9o 579o!N9o:q9oS9ov9o .9o....+Y XU9o[49oXU[W9oW^\a 99ok9ox(L buf(( ( ( (  ( (( 0(68 op(X(`(h(Ipy9o9o[Q9o9o[~[ [ 7 [J# 7# F7-Թd7pK i7 Lp 7 7 7 J'7 L O7 L@,|7 7 [T ˧f<[[  7 PP 07X7 9o[L5{79oL]Թ  Թ    ,mt ^ .;;7,*[ i7xԒi7}77ԒԒEԒ  8Ԓ Q =yԒVԒJ~7DԒE   #JI 6#8 .@@AJBCD EY( sdFW0G@^8I[J[K[L[M[88Kbio2) ̦ S 48 I@!HPPX+` 5hpr  St :x * -. <YgY>sggidr4m[[ v.6{ rev. vWW S SWJ#rb6 nsK0[8< L>w@ idP` Ihp#rcu x  opsh!r Whc "$ % & (( 02 89p@: H= 8P@QXA o`c m )dir4\ s knW9o I6 6@`h x    p@  pA %qsIIIII(8$Q =oV [0'(t) C* +,% - 3(:IK :K #R#J# L#mt#n#o&X#0#1*#2 #3 I#4 #5 (#7 0#9 8#; @#= H#?;Ptt(#LFF*-Li#P#nF:J9o9o#9o#;9o# #k# # @FpFJ` 58 X0tTu ivnw!sx*y z (Ti^kx+}KAF0 }~+ 2buf;  + . ; .? OLA.LJJ[(E[FJ modGi% opsH!7I (JK ~ yeL)argM I)strN)arrO2VW[X \- max^[_[ num`  opsa!7bI-&0(X)X?6i . . [    O .7` -) .8 mod /i%@ 0H mp 1.P 2|KX )8 5 6* 7  9  ;  <( = 03Ji%Ji%i%*[ >=58 Eimod Fi%& G<5P p qI rI sp t[;mtn w=    [    7?i: .' D N*Zb6Z qg v#iBclk'| [ .'jb [@/G0L ops1" dev4W56(7 8} get put   /( H0p8@HPX`hpx=VoQ}!R8W@p_HJP{ Xbus `I h Ip Ix6&sdis $msiL(8@PHPPX `hx N QL @$id<5  !!s# $[%e'#j) + p`, pa- pb. pc/ pd9 pe< pfQR[ idS[TGPfgLh[i.LLLpKR/ pHJ4pJ[IMJn%uJLLLLJJJ[[88\$IVLBo[[Lt [AQ regR[ defS[ ` rega[ defb[c[ [Ai[[A [[ni3368J [  ( 0 8 @ H)PGXj`hp x ppppI[p$$$$$$[K[..ppppppp[[ $!C([0p W[)I[ GI[[.jI[[[LIKIoIK(>J[[ [[[[ >[[[[ [[[$[[H"[ Z6[J\J^[_[`'6a c[$d[(e[,f[0g[4h;8i[@j[ k[!l["m[#n[$o[%p[&q['r[(s[)t[*vHx@PyX{\|`~hpcxI"bc[[IE[@I h[[  z .14o   ops ## [ T9  ( 2 <BnetF P0nsDv= T(Z FF<F<F<@FFF<<  .F2F2F2@FK@F_7 o . o ( . [ . O@079 @)0 A9` D G J  M_  .%$ 9 .% I .%@T#seqX @@[^<adP8i@@ < . < . .0//p6!4018PpPx_9 I2avg_x 6  p8(  ^P Sh Sl 6p  9 < P 1 P PI <I . P_ . . .u . .8X knXWX.Xp8XlXd ssX2X X X0X@ idXPX[TXPXX S`X_hX&`X7XX2X XX X X  X (X 0X58X5@XSHX cPX cXX `X|hX pX xX X X XpXpXpidXXJXJXX XXuXuX[l 7L . (XDXE9XHPXJP XaXfXgLXmL(XuLPX{LxXdXd X=XpXpXX uM . ] . !@XAXB{XE[XH XK;rcuXL  &XS@@XVdXY SX\[X_1Xb1] d(..Xl\Xr1Xs.@Xy HX|[PX[TssX2XX`X\pXxX XzXXX X X XXX X 8X6#Pu7u(aF7u7uP7uF77777 57!IIN :cIX|6Th6T-@ (i@@.@(H(P.X(`(h.p.x."i@$p min%. low&.'. max(.)x  .... 5 (68_X [qE;qNpqT qZqe;uvvIk..Nqqqq +..qq+p8(r0dvmar1 r2 $r3 .r4.r5. 1r>r? S r@ v   .  ...vv[v v...4 %\ .I9Jp a /Uu/U .% .0g [(" @,0,/.g0[(1a#, [,v? cnt@ SA3 _Drcu yMyN yP[yR[ yT[ [ .(_..... 0#rcu1 2@^3 .. HIJK LM.N]v _: ;<}  !"# $(%0&8'@(H)P*X+`,h-p.x/012345,WW*Uh*[lHxiy 5z[|[}6~0n@ i!8 + p + p!+ p"+ p#+ p$+ p%+ p&+ p'+ p(+ p)<5 TK @ p@ pA pB pC pD pE&e7PP_ ^ S S[ p p p p p p p  p  p  p  p [PPPP  ($qos0+,J id-./5 0(1p802.X3 `4 h5 p6 x7 8.9.:.;.<. dev=W> p? p W- gops, w  wWpgW[|M NJOJP!sQ!sR!s T (U 0V8W @X HY P[X\`^ h_paxcd  pmf hp W  ` aJ busb di%eJgp h $j (k: 0m8n @oHp Pq Xr`s!sht!sp pmv xw  pyD      W  } `2 3J5!s6!s8 9  ; (< 0>8@(@A HC  P pmE X   L     K   AF 0Xv YJZ!s[ \ s ^  pm` ( v  [- ȷ  r@K   5  idѤf cls 5  ?  Os  AFU  [[.*[ *[8L  0w!9"| w*[1*[B*[OcZd&e2f4gp lidhp Z n x}P x Bcma 0Q1J2 3J46X7`8Qh9Qp:Qx>.?I V `|   ` P[ [|  & 06Un UoUp[Uu#Uw Ux `Uz U{ U~[8U5<U|R@U_PU!`pUx? ..0] nr ip ] m . [! x 5p88.`.h.pI$I!1IIH 5 ^I ( ^01  [Z- ZC; idZD refZE T9ZNcZO8WZQ S-@ZWZY8WZ\'Z]Z^Zli@@Zp|@CZqi@ Zr Zs!;H  ” . . .(Z\ZPZ atZPZv3Z|ZDrcuZ i@Z9Z@9Z@  ( .   . ..c*[ZC˽{VjV 5VV V V(VV  . j R6..J ret  $& ! F$&: mV;<[ =[!>["?[# B srcC[D[EpH maxI keyJ00MNQ+TWZ[] `$g8jpDmpEppFspGvpHyL|[PpT[X\[`[d[h[lpp#x ||"2 $ $ [$ ( [,  [ . F" . 2 . [B . F[a [0pw"x' devyW{a rev|[~, PpX`[ 2irq 9   p [ 6  < p Q V V    6  Td@ " < . L . L f .. O . < I M#M+'M,'  .E"  0 .J E2 0 P? EK 0 P  A.wE! j  kI l'Qp,=RdevWUSregG[Q+pRdev+WUSreg+G[m+n+"oTT TQB>V,. .J .V,O,[s,,,,Wint[,,*,4s8g4u8z4s164u164s32-4u324s644u64F[v s~,.1[2[HI~X]^~_`O,,<[ <4  #p,%&*.4=Bh-l mn<} F P P [ [ S< vF_ O  .44 D D49XPYZ.W-@ x O[.     :\H  J   " #   (  i%0  8  @  6#H  6#H 6#H (H 6#H 6#H  6#H  6#H!@      ]P h  J J     [ 6$kp   [( [, 0  8 p@ pA pB [D  $H PAmem )@  .  [  : ?  I S  ( I0 [8 I@ [H [L XP [X ]` [h bp x [ [ n% l [ { [ [ % I [ !% "[ % &( 9[ : ? A D  F S P  Q[( Ts%0 ;P (cs =P(sl ?P(wfe AP E (ss GP(sti IP KP(nmi MP PP  SP0 VP8(lm XP9 ]P: dP<  )cs )csx P   B )ss )ssx P P  gH r15 m. r14 n. r13 o. r12 p. bp q. bx r.( r11 u.0 r10 v.8 r9 w.@ r8 x.H ax y.P cx z.X dx {.` si |.h di }.p .x ip .  . sp .  B  C D E  E((s E,(dpl E-(p E'/ F0(avl F4(l F5(d F6(g F%7 F+8..... S pte "<  v pmd "_ % %%0 /%/ =' pgd'$ /'" =p pudp /p" / @HLI.%Nkxk0 S4.8ezf.ghuv-w- keyxz UV SLjkeyknkeyo;y<=? [ @ [$A [(B [+!-@ 64[[ I T9( [,![0( 4)28*[H+.P,6X5 `6 d8 h: l; p< t=[x;se?E@$rt@xFAdlAGBGFI"I6J.K[OIXI]I"`"mC@dh[k[ l.m nI oI(p(0q IXs`ubx dy/Ihzp{I.      /I nBR6("6P$mm h pJx    .[ [, [, [, [- [- [- [- [- [- [- [- [- [ - [ - [ - [ -"[ -.4$pid X X.6 66(0@?KPDKX "|K% ( + I- P. P3 P4A6A: S(=.0>.8A P@D PHG.PH.XK?`"N?TLWLZL^Mk 1mMp\5 q5(t.8u.@$fsxMH{MP~MXN`Rh cRp &:x &: &:=. [4mR eA[8^> P  P 5 a# TI 6( 68 wR@  IH RP RX R` YSh cSp .x hS %? [  P  P  P -9 A  T   <  < "T )U     U0  68  [X U\ %U` 6h  /U       ![ "[ # $. & P ' P ( P ")  39U C% D. L>U N. RNU S<( T<, Y.0 ] 8 ^ < _ @ ` D "a H d>X gXU i> lbU w x z. } ~gU  P P  % S S.[8WyWWW [([,vI0Arcu 0T9@ D6Hp8PXxT9 I " X X XI  P >"  !"j2$"j2". <*X"F;@@y!@@ 2sp.es ds"$&.(.028.X.`cr2.h.p.x>2.[<.. _1;fpu 0@[ 6 (   ( !@@ %.r@]v@ S v  5"%)p  Gp p(,p0&lp8Xph%qp.x9o Iq(/Uq>o )"  M"m")val S")""M",m"" " " ." S" """" 1#  1#B GG a#"F# #a# [.,9$fmtJJJ[JJ$]6[$788$JJJJ[[4[ key99$( [=%8Ui%V modWi%XJYn% Z ([ ,\$0Ju%v%w%x[y[[$%. O% . /&1[ set3` get5y7 3%6 ' i%   ;  ^    6(  60 8 !@ " H # P $ X %` &5h 'Np (5x )q * + , - . /  0 4 1 ޸ 2f 3  5 L 9 y ;  >q ? @& !@(% + -/  h( !- key "- ?( A. B( C( (@( =( >Ih( .( . ; (! v(!@A@"+&"k@"$|!"&5": 55"<.5"=.5">.5"@6"A ^6"B ^ 6"E86"G S6"H.6"K66"M66"N6"O~6"Q6"T6"U~6"V ^6"W67"Xp7"^.7"d.7"e. 7""ii@@7"t݁@7"y[`7"{.h7"}[p7"[t7".x7"|7".="{="|x>""i@?"$?"?"A"A0#c+#dJ#eK#gi#i #l R(+$,$P end$P% |% |p&, cwd&< swd&< twd&< fip&< fcs&< foo&< fos&<&,&<l <, .&*, rip&+P rdp&,P&.- fip&/< fcs&0< foo&1< fos&2< &)&-,,0&@H-&AH-&BH- <X- . -&$- cwd&% swd&& twd&' fop&(-&5<&6<&9- &<- &>H-H&- <- . < . .?&Q. cwd&R< swd&S< twd&T< fip&U< fcs&V< foo&W< fos&X<&Z,&[ l&\ m&] n&^ o rm&_ p&` q&a.x&b< # . . P / .@&:E/&; P&< P&= E/ PU/ .!@@&O/&&PX-&Q /&R/@ /..^@&^/&_,7&`X-&a .7&bU/@&c/ 0B.!@@&f0&h[&k[&nP&qPxfd&tP&w[&z[&[&[&&/@@&0& P&[&[ _fpu@&Z1&[&.&Z1&Z1&0 &00&&0@@0' 1' P'P O1 . O1 .? (1( (! (" (#1 P1 . O2B. H 2 . /2/2 .42 92)|)|)|*82*92*<2*=22+<2+=[+> S+:3+;22 src+A dst+A 33I [,53(,3,3 val, <,!< ,"<,#P,$3 <,*3,+&3,,#3-3-|Z- -3,'4,(d,)33,.P ,1h4,2m4,3,4 ,5.,6. h4(,4,%53,/3,748,4,. fn, 4r44444.>(5.?..@..A< cpu.C< [/W5 0w50 |5 w51 512 52 S353F#355354 64"4"5 5)R65*(5+a# osq5-5 5/(6 66 6 6767.767667 67 6777676 8-78 68 8 H786 [9 e7@9'79(79)  9*7(9+k809, 89- 99. :9/ ;H777e77@@:/k8:0/:1[:2 d seq:3@:47:5-7 :690:7 87(;8; ;.; 8;< 88p88<8<< S<9 8= 9=9 .-9 .=89>T9> S>99?+9?,?-x@9@9@[`@.h max@.p .9 . A:A PA PAB &: sigB9B:CRsCSJ:2:CUCVg:O:ID:D D ID l:D':D(D)D-;D.D/D0 :D1D51;D6D7D8 : D<|;D=D>D?D@DADS;DT %DUIDVI DY;DZ %D[ D^<D_.D` Da DJH<DLDQ DW|;D\;Db; DEe<DFI<Dg<Dh _fdDiDm<DnIDoDp[ I D%=D*:D2:)_rtD9;DB1;DdH<Dje<Dq<0E Z=E E E E <0E n==EZ=Fu=Fv nsFwDv uidFx eAFy SFz` F{~z=E >E!E" &: E%D>E'>:E(.E.[:E0 &: E3^> saE4> G >G G . lenG .G p(H>H  I$>I%I'I( 0ID%?IM#>IPp(IWp)8J ?JPJPJPJPJP J#P(J,P0K)?K*PK+-7PK8?K9?K:[HK;[L ?? .8KD1@KE KF6KG[0 L>@LKLZLpLLL endL@ O@..M!@M" [M&@MD@MD@MD@MEAME@ME@MT BAMYAMZ 5M[AN eA valNN NAN A valN N qASAU PV PWa#*[[A0hnBi@jkAcpul[mPnP oP( B.B. <5@@mC P P P < <. .(.0[8!@E P P P P P  P( P0 P8 F@ PH PP FX F` Ph Pp Px  P  P  P  P P P P P P P P P P!@iFB& 6! P(" P0# P8%@&P'Q(R)S, PX- P`. Ph/ Pp0 Fx1 P3 P6 7iF9sF;sF=.;avgGB@E nF0KFLM.N.O[ P$Q&SF(xF/]FGpGGG5`wH&a6h Pi P j P(k P0l P8s F@t PHu[P[[[[[[[[&e7X&e7rqHFwHG/^HH6HGCrqHH+[ +[ +[+[=/I    `TIJbHJs<qIqITIG ~II I HI .(( I5 J 7 m ^  $@  SD  SH 6P .`  .h )p .x   5  ^  IIKpidpO7?KO9 T9O:[O; 5O<  inoO=PO?/ O@@OB ^H#rcuOC `OD?pJ TK . P|KP[P]_TKQoLQp( uidQq eA gidQr A Qs eAQt AQu eAQv AQw eA Qx A$Qy [(Qze0Q{e8Q|e@Q}eHQ~ePQXQM`QMhQMpQMxQ IQ&QDvQ=Q+%KLKkeyRMRT9R%8R+ semR^(R5PR IXZ`R h uidR eAp gidR AtRxR|R~R R.ǜ R:L M M M MHS NS! T9S"2S#<S$FS%* S&P(S'Z0S(Z8S)@M-XT^RT_T9T` STaTb TcTe ^ Th68Tk=@TnXTq`TsdTt6hTwpTx[tTzxT[T[T[TTTe7T  itT T% T? Th T S T?K T2ttyT̠ T֠ T BA TP T P TP TP TP TP TA T. T. T. T'. T.  T.( T".0 T,.8 T.@ T.H T".P T,.X T.` T.h T%?p T T۠ T_ T T [ T Tp T T T  T6 T^0N0 TcRT5TT9T ^TO !R hR rRURUU|R RVRV.VRXWcYSWd(We SWg Wk 5WmmWn(Wo0Wq_8R ^Sn=-PXTXAX T9pXTxXdXX X X XX}XXX"X(X.X/X0X9d X:d(X;T0X>p8"XA @mS T YUYJY2Y>T U  U .  U *U 4U .NU .1@ SU ]U 9wU .-@Z8W#cssZ idZDZ@L@ Z Z Z5  Z_( Z.H ZpP ZX Zp Z Zz Zz ZzH Z Z Z Z. Z  ZyW( ZyW0 Z8Z(HZPZ`ZZ ݁xZlvZ7wU0ZyWZ Z8WZ S%a =W ~Wh[yW[ze[|[[}#g%f[\ajebjf[ sdajgcjh>#jicDb0xjDcjE?bjFcjH jI6(jJ5HjK6PjL.pjM.xjN.jO.jP.jQ.jR.jS.jTpjU.jV6jWTK jY S j\. j]. j^_ j_bp ?bc .`bk|l3cddd.Idl6Tdl7cl8dl90lA|dlB^lCd(mdm.m.m"dm#-m$ m% m'dm( m) m+em, m- m!Eem&dm*dm.d mle|d opsmvee leqem2em4.m6[m7[ [[@e [[Hf[p7f[qe[r[s@^@@(XoY^(\pb.h.t:w }$8)p..<Gpp7 1lp%nnd p;rb6.o prbqrc rh rjrkrq rs(rt0ru%8rw9@r{Hr~PraXru`rhrprxpqeooqPcid e@@ q S= .r. 8Wf@@ v%q@^@.P.X.`.h.ppgd  x) S5 S? vE.L[S SZa#](_a5p^r....v. .(.0.8@@5D.H.P'.X3.`.h$brk.p!.x..%.0.v v@5v|i.h5p?vx6Dv9o&Nv.. S Scg(_Xv..( qq . v .3 g0v . 0v :vZ Iv Sv .lv..+v-/ 5/ [vpr/4wir74w(pmdr9 0pudr; "8n@rEHrFPpterL XptlrPX`rT h*[w @>>>>>'s6|'s9|'s<|'sG|twt(h"ux"vx"w.`  x . ["oy        !"#$%&'()*+,-./0*["y6@"z".":"`"z8"z"z"z8"zx"z"z"p($gen" )$seg" *"1]0 z . . . z . . . .z . . .z . . . ({ . . .H"]{seq"."""]{"m{( %m{ . .{ . ."|"|seq"."."|"|""p"p6 "e|"f<}"h5P"n.X"o.`"q(h"s:p"u."xy"{{"("w| | . . . | ."&&}seq"(."*>U",&} ". 5 ]<} . . L} .!@"}" 5""" """ " " ""} ~ . @"@~"@~" "P~ P~ . .`~ .1"~""~ ~ ./*["~!@"76";`"<. ">.("?.0"J68"M`"O(h"P!Fp"Q$Kx"V"W"X"c."("."."."."J"." BA"""i@"P"x"."5""i@".".":"."."["["" p" p""i@"`"p` F .L}~ w` . (p . ( ."""~6 "́"́ ݁ . "" 5"".("k"."." ." ." . ?~@| . . ^ .`~ ( ./ 8q$q.q5q5q.q. q.(qp0 [4 . 4:p>u@ Y||IH8uuJuIuu Lu)u. uI(uI0 us)ut Suu ^M u\u6uلXuل%)u|Ku| u( setu̅0u8u@uHuBP\u)u|uu uu3uBބErcuu F[u[uʞuu'hu Kpudx[hu̅u#diruх`uu\u6Xх3̅̅'AلAFeAA,dل|PwwIwixxIx xBxDxExFYxGhxHxIIyTy y![y"[ T ^cz,z- 5z/ $z0ImxAȇÆxK x:x@ixNxO.xP xQ (x+_x, x-px.px/ ȇ 0 pȈ q9o r  s  t I u  v$0(_{"{#{&{'{' |C|5| 3|^9||s%C}3}4< len}4<}2s}6P}1Ӊ}8d}i}j}k ^g}r/}s}t9}u }R}T[}UA}V}W }X }Y70}[<8}_"`}`Ԓh}a.p}bIx}d^؉}m}n#d_u}v//!x {7 | L } ~ eA  A [  Թ Թ !M  Ԓ( J0  I8 .@H  @L  P  X  `  h <p <t <x <| 5    ̦   < ^ . .   -       L&0 v@ vH  SP  ST  SX  S\HL` 7h" Ip 8HH  P (AX K` Uh  Ip L .'@}} } }-}U}i }}(} 0} 8} @} H}MP}kX}`L!@ Ԓ   @  .    ( !0 !8 @ "H .P .X .`  h ^p   S I & #  $   ҈  ) 9o r |  [  (" `  I <   !< " /  0  1  4  6[ <6  BJ@ D"H F@P I(X L` O d R!`h Sp ZDvx aT bTArcu c  d_ f6 k0" n5@@ oH q5X r` [}  [##(P#[JPӉ2i#Z} n  7  ~E~F ~GԒ~H~Iœ H mnt    ffpHR  ْp02map9 (” .?#rcu  .. "[#$ nid&-.4.78WR,SJUJXYZ [c T9 dTK(#rcue HgIXj` idmpptqJxr uO.@@E[ ,(034678 p xa9m  ז " $5@@- lru/0( זO2* nrO3 nsO4*W5 ? . N.. e valPN [   ӗ Iӗ!@@Xd&XX.XXXXXXXXX$knXWXzXz@XBxXXXZX\X^X$A`XRXXX} XdXdX$X "Xi@@Xd@XQHXQpXAX"X#6X& ^X)_$psiX,4$bpfX/ X2X5# XX9'|. RRRl#rcuRm RnT9Ro pRvRxRy Ru3)xR.(Rr{Rt.RRRJ {{I RRIR  Iʛ .R֛ۛMMR8Rʛ keyRMR3RZR9R6R|R R (RǜR.R.RRR  (RR3|8 R RR v1 R&R & 0 T9g.0(8@ uid eAP(X S`$m#hQQ T9Q gidQ  A..3Q&QErcuQ ?-@@:g/:ha# cpu:i[:j[:k[ :l[:m[:n[:o[:p[:r[:s:t:u[:{  :|7(:} 0:~78:>@@0:4?7@O . D>_ .?8TȟT T! T".T#PT#P T$.(T$.0T'T(PT)PT0%T1 vT2 vT3 vTC@TDTLhTM6TNh@8TQTR STS@TTTKm ȟ . ?KǠ . Ǡ Ѡ `9 .-)/06z7z IJQ R(U0V8^@fHkPlzpnqoxq|rsuvxyz{       ( 0 8 @ H P X ` h pDx       60Z ^  ` #rss  08 ^@ SX Ѥ fn 3 arg I z . bѤ <WS0WTWU3WWRWX9WY 8WI qWJ iocWKYS%0 W\[0 R  ¥ val valΥ< i5n.v8_`(abc pd p#rcue  reff05 v .%  . 0 v4 4Y5[6Y7 ii .s n x}  eA ¥ ˧ A P D [ L    ( 8 9oHIЕ()*+ ,0-6@. 5`/ Sd0Ԓh1p2 x3.4 # val  [6RBE)uidF eA)gidG AH #D^J/H0 R R R R R  R( R0 8 @H. [([, R0 R8I@ !i%@8~9:;<= >(?0@ɫ8ԒDīԒīXDwEFG HI J(K0N 8O׬@QHSɫPΫDԒ|D7RҬ7Ҭ#7ܬxYZ[P\P]P^P _P(`P0aF8cF@dHeLfPPgPXhP`iFhjp8[[[[ [[[ino  ( 0[ . 9[[[ [[[[X A(d08d@HP9ԒfԒ[ <Ԓ<#_Ԓ_FԒī_iԒ~68  [ ^ 0 H$ops!  7 . 0 . 0 .1 wU }  83456c]UIȈ  z    ʴ  ]  ( 0  ڵ8  @  H  P  6X Y` mh  p  x ö θ  ޸ 0+z-/6 7 9r ; [ < [!= ["> [#? [$@ [%A [&I ['P(S0V#8 W .8 X@2wb[-H \7P _X `\ a` b h c p d x9omJpʴJڴڴߴ8D]E9oFJraGI .J[ K[$Lp(M.0ϴ9oJ[^b9oJ[[I ڵJ Ƶߵp $6Ȉ͈"YJq;m^prpöJ9oɸ6V#ɸV$ V%.V&V'R6 V(sHmaxV)[LV*PV+%XV,`V-hV.xV/V1(V3V4[V5[V6[V7[V8[V9[V: V;"V<6V=) V>9o(V?TK0V@ 5PVM 5TVQ_XVR_xVSVT ȶ޸9oӸȈ͈1 & b [< L 7  1 q !q  '7v1 Ź XU ʹ    [ Ź Ϲ!@ ZH [ \( ]F ^d `  b( d0 e8 f@ h'H jP kOX m|` oh pp r x s u0 vX y{ { }   @ٹH-i- bdijrl.m.op(q8rHs 5Xu S\v v` x. y. z. {. |.  .( .0 8 h 4l 5p x _ _ 8  H X < <    LR 2 < F P( ˽ 9o  6pid ?K (5uid  eA eA  $ .  . [ [  [ [  1 S 6  P<  )7 *  +2 ,˽ -Z/ PI!0      & ?Z .  x         (  0  8 @ H P X ` h 8p  x Q Q Q Q  y          w     $-))* + ,W-. /.(0 S09 @4:J8< S@=5D> IH? IP@XA6`BCE SF6HIK IQ-`r idP6 .0.8@^@[D[H[L[P(X.`#wbRh ` mp 6 ^  ^2devW 1 W( p80  X. w  O . O .$/ pJP[   pos  /  [;9o"^9o@9oJcȈ[ 9o(9o 9o[.9o 579o!N9o:q9oS9ov9o .9o....+Y XU9o[49oXU[W9oW^\a 99ok9ox(L buf(( ( ( (  ( (( 0(68 op(X(`(h(Ipy9o9o[Q9o9o[~[ [ 7 [J# 7# F7-Թd7pK i7 Lp 7 7 7 J'7 L O7 L@,|7 7 [T ˧f<[[  7 PP 07X7 9o[L5{79oL]Թ  Թ    ,mt ^ .;;7,*[ i7xԒi7}77ԒԒEԒ  8Ԓ Q =yԒVԒJ~7DԒE   #JI 6#8 .@@AJBCD EY( sdFW0G@^8I[J[K[L[M[88Kbio2) ̦ S 48 I@&HPPX0` :hpr  St ?x* -. <YgY>sghidr4m[[ v.6{ rev. vWW S SWJ#rb6 nsK0[8< L>w@ idP` Ihp#rcu x  opsh!r Whc "$ % & (( 02 89p@: H= 8P@QXA o`c m )dir4\ s knW9o I6 6@`h x    p@  pA %qsIIIII(8$Q =oV [0'(t) C* +,% - 3(:IK :K #R#J# L#mt#n#o&X#0#1*#2 #3 I#4 #5 (#7 0#9 8#; @#= H#?;Ptt(#LFF*-Li#P#nF:J9o9o#9o#;9o# #k# # @FpFJ` 58 X0tTu ivnw!sx*y z (Ti^kx+}KAF0 }~+ 2buf;  + . ; .? OLB.LJJ[(E[FJ modGi% opsH!7I (JK ~ yeL)argM I)strN)arrO2VW[X \- max^[_[ num`  opsa!7bI-&0(X)X?6i . . [    O .7` -) .8 mod /i%@ 0H mp 1.P 2|KX )8 5 6* 7  9  ;  <( = 03Ji%Ji%i%*[ >=58 Eimod Fi%& G<5P p qI rI sp t[;mtn w=    [    7?i: .' D N*Zb6Z qg v#iCclk'| [ .'jb [@/G0L ops1" dev4W56(7 8} get put   /( H0p8@HPX`hpx=VoQ}!R8W@pdHJP Xbus `N h Ip Ix6 &xinx $msiQ(8@PHPPX `hx S VL @$id<5  !!s# $`%j'#o) + p`, pa- pb. pc/ pd9 pe< pfQR[ idS[TGPfgLh[i.LLLpKR/ pHJ4pJ[IMJn%uJLLLLJJJ[[88\$IVLBo[[Lt [AQ regR[ defS[ ` rega[ defb[c[ [Ai[[A [[ni3368J [  ( 0 8 @ H)PGXj`hp x ppppI[p$$$$$$[K[..ppppppp[[ $!C([0p W[)I[ GI[[.jI[[[LIKIoIK(>J[[ [[[[ >[[[[ [[[$[[H"[ Z6[J\J^[_[`';a c[$d[(e[,f[0g[4h@8i[@j[ k[!l["m[#n[$o[%p[&q['r[(s[)t[*vHxEPyX{\|`~hphxI'"bh[[IJ[EI m[[  z .14o   ops #( [ T9 # - 7 ACnetK U0nsDv= T(_ FF<F<F<@FFF<<  .F7F7F7@FP@Fd< t . t ( . [ . N@079 @.0 A>` D G$ J  M_ $$ .%) > .% N .%@T#seqX @@[^<adP8i@@ < . < . .044p6!9018PpPx_> N2avgdx 6  p8(  ^P Sh Sl 6p  > < P 1 P PN <N . Pd . . .z . .8X knXWX.Xp8XqXd ssX7X X X0X@ idXPX[TXPXX S`X_hX&`X<XX7X XX X X X (X !0X:8X:@XXHX hPX hXX `XhX pX xX X X XpXpXpidXXJXJXX XXzXzX[q <Q . (XDXE9XHPXJP XaXfXgQXmQ(XuQPX{QxXdXd XBXpXpXX zR . b . !@XAXB{XE[XH XK;rcuXL  &XS@@XVdXY SX\[X_1Xb1b d-..XlaXr1Xs.@Xy HX|[PX[TssX7XX`XapXxX XXXX X X XXX X 8X6#Pz<z-fF<z<zP<zF<<< <!<:<&NNS ?hN]6Tm6T-@ (i@@.@(H(P.X(`(h.p.x."i@$p min%. low&.'. max(.)x .... 5 (68_X [qE@qNuqT qZqe@zvvIk..Mqqqq +..qq+u8(r0ivmar1 r2 $r3 .r4.r5. 1r>r? S r@ v   .  ...vv[v%v.. .9 *a .I>Ju f /Uz/U .% .0g [(" @,0,4.g0[(1a#, [,{? cnt@ SA3 _Ercu yMyN yP[yR[ yT[ [ .(d..... 0#rcu1 2@^3 .. HIJK LM.N]v d:%;<   !"# $(%0&8'@(H)P*X+`,h-p.x/0123451WW*Ui*[l Hxny 5z[|[}6~0s@ n!8%+ p + p!+ p"+ p#+ p$+ p%+ p&+ p'+ p(+ p)<5 TK @ p@ pA pB pC pD pE&e7PP_ ^ S S[ p p p p p p p  p  p  p  p [PPPP  ($qos0+,J id-./5 0(1p802.X3 `4 h5 p6 x7 8.9.:.;.<. dev=W> p? p  W- lops1 |  |WplW[M NJOJP!sQ!sR!s T (U 0V8W @X HY P[X\`^ h_paxcd  pmf hp W  ` aJ busb di%eJgp h $j (k? 0m8n @oHp Pq Xr`s!sht!sp pmv xw  pyI      W%  `2 3J5!s6!s8 9  ; (< 0>8@(@A HC  P pmE X   L     K   AF 0X{ YJZ!s[ \ x ^  pm` ( {  [- ȷ  w@K   :  idѤk cls :  D  Nx  AFZ  [[.*[ *[ 8Q  0|!9" |*[1*[B*[O c_d&e2f4gp lidhp _ s }P } Ccma 0V1J2 3J46X7`8Vh9Vp:Vx>.?I [ e |   ` P[ [ ! + 56UnUoUp[Uu#Uw Ux `Uz U{ U~[8U5<U|R@U_PU!`pUxD #..0b nr ip b r . [! x 5p88.`.h.pI$I&6IIH 5 ^I ( ^06  [Z- ZC@ idZD refZE T9ZNhZO8WZQ S-@ZWZY8WZ\'Z]Z^Zli@@Zp|@DZqi@ Zr  Zs!@H  ” .  . .(ZaZPZ atZPZ{3ZZErcuZ j@Z9Z@9Z@  ( .   . ..h*[ZC˽{VoV 5VV V V(VV  . o R6..J ret  !$+ !& K$+: mV;<[ =[!>["?[# B srcC[D[EpH maxI keyJ00MNQ0TWZ[] `$g8jpDmpEppFspGvpHyL|[PpT[X\[`[d[h[lpp# x||'7 $ $ [$ ( [,  [  . K' . 7 . [G . F[f [0pw'x, devyW{f rev|[~1 PpX`[ 2irq 9   p [ 6  A p V [ [    6  Td@ ' A . Q . Q k .. O . < I O#O&%6  .@" @!I  ? .J/@# ? k @I  B.S@! lH mWI n,Pp!`QdevWURregH[SBTPp"QdevWURregH[STo  ppreg 1[q<r#<sUT UQ4]H  5A : F ^  q q     Iint F ,  * +s8R+u8e+s16}+u16 +s32+u32+s64+u64P \    1F 2F Hc IP X ] ^P _ `:   <F  '   o   #SB  %{ & 4 = B h n' } 1  ;  ;  F  F   $1  XXX0xx : JKL Wx K  s \x1MH  5  G "V y  ( ;$0 t8 ]@ "H "H "H ~H "H "H "H "H$@    0  RP h  5 5 F @  E F 1/kp J  F( F, @0  E8 B@ BA BB FD  OH sP8mem T@ t   F 0 e j  t ~  ( 0 F8 @ FH FL P FX ` Fh p  x F F @$  F  F F $  F !$ "F % &r' 9F : ?0 A0 D } F  P  QF( TE$0N  ; cs =;sl ?;wfe A; Ex ss G;sti I; K;nmi M; P;  S;0 V;8lm X;9 ];: d;<  cs  csx ;    ss  ssx ;   g r15 mr14 nr13 or12 pbp q bx r(r11 u0r10 v8r9 w@r8 xHax yPcx zXdx {`si |hdi }p xip x  sp   B  C  D  E   E (s E ,dpl E -p E' / F 0avl F 4l F 5d F 6g F% 7 F+ 8  % %% )%/ 9' pgd' )'"  @H? I!_0_0 48em f g h u vwkeyx\m  U V ? j keyk n keyo ;l<=? F @ F$A F(B F+$-@ (y0FF  4( F,!F0( 4)Y.8*FH+P,(X5 `6 d8 h: l; p< t=Fx5se?@@/rt@A8dlABBBFD%I2JKFODXD]D%`"w>@d]hFkF lm nD oD(p'0q Xs`ubx dy/Dhz0p{D 0 0  /D00 x=01(%2P/mmhpEx    F F, F, F, F- F- F- F- F- F- F- F- F- F - F - F - F -"F -30/pid * *( (00((000@>FPCFX 0"{F%v(v+ - ;. ;3 ;4<6=: (=0>8A ;@D ;HGPHXK:`%N;TGWGZG^Hk -mHp0 q1(t8u@/fsxHH{HP~HXI`Lh Lp 5x 5 58 ~FL o<F\4h9 ;  ; u1 2" TD p2( (8 L@  H MP  MX M` Mh Mp x M /: F  ;  ;  ; 4 <  M 0  '  ' "M )M  0  M0  18  FX N\ N` 1h 0  N      !F "F # $ & ; ' ; ( ; %) 3*N C$ D L/N N R?N S'( T', Y0 ] 8 ^ < _ @ ` D %aH d9X gIN i9 lSN w x z } ~XN  ; ;  $  FmNwNNN F(F,vD08rcu04@ D(H4POx4  " O OO  ; >% !"-$"-%.<(O%F-@@l$@@q-spes ds"$&(0-8X`cr2hpx-F' i-5fpu ,@F(  '$@@!d@&i@ , !c c B(,Gd0&d80XQdh%`dpxb ed' Njdb !  >!val   R!! ,>!!! !!  ^! !!R! ! " \ " ?? 2"R! " "2" F, #fmt555F55$O6,# 7 8 8#5555'F'F'4Fkey9 #("F=#   8U;$V0modW;$X5Y@$ Z ([ ,\#05u$v$w$xFyF,## :$ /$1Fset3Cget5\7 .$D&;$ 5 X {  -( -08!@" ߙH# P$ X%`&/h'Hp(/x)k*+,ٚ-ޚ./ 0 .1 2`3 5 9 ϛ; >k?@=$ !'% + -/  :' !key " ?h' A Bm' Cr' h'' =' >:' '  ;{' ! $0"c("d5"e."gL"i j"lo 5('# N# Np$(cwd$'swd$'twd$'fip$' fcs$'foo$'fos$'$($'l '($*(rip$+;rdp$,;$..)fip$/'fcs$0'foo$1'fos$2' $)B)((0$@d) $Ad) $Bd) 't) :$$*cwd$% swd$& twd$' fop$( .)$5'$6'$9* $<*$>d)@B) '* '&*?$Q+cwd$R'swd$S'twd$T'fip$U' fcs$V'foo$W'fos$X'$Z($[l$\m$]n$^orm$_p$`q$a+x$b'! +@$:Q+$; ;$< ;$= Q+ ;a+$@@$O+&$Pt)$Q+$R+@ +2P@$^,$_9(-$`t)$a&*-$ba+@$c, ,E$@@$f,$hF$kF$n;$q;xfd$t;$wF$zF$F$F&$+@@$,$ ;$F$F Qfpu@$d-$F$$d-$d-$, $,0&$,@@,% -% ;%; :- - --- -&N&N&N'8.'92.'<2.'=2..(<Y. (=F (> (:.(;.7.src(A  dst(A .."F).  () /) /val) ')!' )"')#;)$ / ')*G/ )+&G/ ),#t/#*t/*uQ* L/)'/)(6)).%/).; )1/)20)3)4 )5)6 /()30 )%. )/y/ )7/8)`0)fn) t00\o0o030`0+>0+?+@+A'cpu+C'"F,0     - 1- 1  1. 01.0/ K1/ 0a1 0"0u1K1 0a11 11! 1"1 2)12*'2+2"osq2-01 2/0(3 23 3 0304P244P24P224 p24 P2424U24P2 52(5 25 5 25p2"F6 2 @6'q3(6(26)  6*3(6+406,86-96.:6/;2332q3@@7/470~71F72 6 seq73;743752 76077 83(8G48 x88 W48' R4R44G49499 94 4: 4:4 4 :84;4;  ;4<+5<,c<-cx=_5=_5=F`=hmax=p o5 > 5sig>4 >o5 ?RE ?S55 ?U ?V55A@5 @  @  @ 5@'"6@(o@){@-`6@.@/@0 5@1@56@6o@7{@8 5 @<6@=o@>{@?@@@A@S 7@T $@U@V @Y17@Z $@[ @^b7@_@` @a @J7 @L @Q @W6 @\ 7 @b17 @E7@Fb7@g7@h\_fd@i@m8@n@o@pF A @%|8 @*5 @2"6_rt@9`6 @B6 @d7 @j7 @q70A 8A A A A 80A 8|8 A8 8A  9A!0A" 5 A%N9A'5A(A.5A0 5 A3h9saA4 9 B 9B B lenB B B(C9C {D$9D% D'D( 0DD/:DM#9DPB(DWB)8E :E;E;E;E;E; E#;(E,;0F):F*;F+2PF8:F9:F:FHF;FL :;8FD;;(FEFF1FGF0 G>;GKGZGpGGGendG; :;2H!;H" F H&;HD;HD; HD;HE<HE; HE<HT L<HY<HZ u1 H[(<I o<valIZ I X<I <valI f I {<S<U ;V ;W2"6F[=    0hx=i;jk<cpulFm;n; o;( == ',@@w> ; ; ; ' ' (0F8$@@ ; ; ; ; ;  ;( ;0 ;8 1@ ;H ;P 1X 1` ;h ;p ;x  ;  ;  ;  ; ; ; ; ; ; ; ; ; ;$@qA=& 2! ;(" ;0# ;8%0@&qP'qQ(qR)qS, ;X- ;`. ;h/ ;p0 1x1 ;3 ;6 7qA9{A;{A=5avgG=@@ vA0KAL0MNOF P$Q&SA(A)]BBBBBB,`C&a2h ;i ; j ;(k ;0l ;8s 1@t ;HuFPFFFFFFFF&2X&2rqCACB)^CC(CBRrqCC;F ;F ;F;F9/DSTDBbCBs'qDqDTD? ~DD D CD'' D,EqRjS @ D Hp2P` h)px u10S DFpidpJ7>FJ9 4J:FJ; u1J<minoJ=;J?y J@]@JBSH.rcuJC`JDypE xSF K{FKFKZTSFLoGLp'uidLq o<gidLr < Ls o<Lt <Lu o<Lv <Lw o< Lx <$Ly F(Lzy0L{y8L|y@L}yHL~yPLqXLH`LHhLHpLHxL L}L iL8L}!}FGFkeyMHM4Moz!{M| semMS(M|PM X|`M huidM o<pgidM <tM{zxM|M~M M||M|G H H H H H:XN^LN_4N` NaNb Nc0NeS Nh(8Nk8@Nn]XNq`NsdNt(hNwpNxFtNzx'NF'NFNFN]N](N2N itNN4N:NƀhN N>FN\V_eNW_fFsda_gX_h"_iX WCx_DX_EW_FX_H _I1(_Ju1H_K1P_Lp_Mx_N_O_P_Q_R_S_TB_U_V1_WSF_Y _\_]_^T__NWp WXUSW`NaX a+ a+a" Ya#a$a%a'/Ya(a)a+SYa,a-a!Y a&X a* Y a./Y aYXopsaYSY YYa2Ya4a6Fa7F "FQ@Z   "FQH@Z   QpuZQqZQrQszZ uZQZQYQVQZ(QQ3QZZWZ@Q`[Q@ZQQQ Q B(Q,Q`[0.rcuQ8Q[HZYQ[QidQ j[[2Q[Q[ [(b\b2"b1b0b  c \c;c& $c)Sldtc*\8c.@c91Hc:hc;]pc= xcC |cD~ \d ]ddaltddd d(d0d\8d\@d\Hd\Pd\Xd\`d\hd\pd\xd\d \d!\\] cF\\]^ `FX^lruY0] d0 e0i>^ j  k(Rn^]hE^s (u^zpp{^|}~' ^^^_  ^3(Q0_>^n^^^7R_ F  9 k_val)R_0M_N PF*J_BlruK0x_*W_X Yk_0@GL`I_UEV  _([ 0\ 4^84@Fj`_-j 0(m`noq r s t vF 4@l`j`-z 00}Ta~     (0 a04@|a`Ta- ,Da!L`!`@!a)a, b  u1   E  q(F0F4G8w@pP rp  x#Օ$ % 'ڕ!a5cctx6c c=Cc>AS@;(X`cYS(\cbht%w }$0c4cc-*daaX Gd5rb2Cc Ld Vd[dc`cd;cid Y@@ d 9 d0 mNZ@@h!d@S@PX`hppgd  x) 5 ?hELFS Z2"]'_au1pSr0$ (08;@u1DHP'X3`h/brkp!x%0hh@h]hu1pix( ib&i  ['T!i' dod h3 [h h iQ i i 5i2#e6N#e9N#ej gGMj gHj gIii 4j9j CjHjh,jh- u1h/ h0RjgAjigK ~g:j g@~ijgNj gO gP gQ r(g+Dkg,g-Bg.Bg/ ~jj 0pkqbr rs t u v $H(Dkji"ki#ki&ki'ki' kkkj(lju1j 3jBl7jljWl!(lk3{lk4'lenk4'k2lWl k6;k1l{lk8lkil kj0 kklS[krm ksx ktk7kukRmkTFkU<kVkkWmkXl kYq0k[q8k_"q`k`uhkapkbx(kdBllkmxkn].d_ukvlmm$x{q| }~ o< <F !e u(E0 8@H L rP X ` h'p't'x'|u1^ 'Sx0o  000 \?0$@$H P T X \@e`yh%Dp08@H P(X`h pm q-q'@kqkukukvk6vkJv k^v(k nv0k nv8k v@k vHk.wPkLwXkew`-qq$@u0 q r t(!0!8@"HPX`mhSp &!#:D$SXk 0 b b l vxF (%` '!'"/ 0 14 6F<1 B5@D"qHFxPI'XL`O dRUhS]pZ ixaxbx8rcucdTf1k0%nu1@@o0Hqu1Xr0`q"Fku umFuvv vmlu1vvF51vlvJvv;v^vmOvnvmcvvmqsvvmv lEvlFmlGulHlIvvvvwm)wmntm vm mwvGwGwB)w3wmewmuQw n"wn#nidn&n-n4n7mNnRxnSxnUxnX\nYnZ Fnc 4 ndSF(.rcuneHngXnj0`idnmpnptnq5xnrmnuxxxxwjwx'0o3xo4\yo60o7o8 Bxao9Rj  o4yo 0o" \o$u1@@o-\ylruo/xo0' 4yJ2ynrJ3nsJ4y0 ]y ayy2p yvalp; py"Fq y   y r1zrr r#sNteztjzt ez M MMlz.rcuMmMn4Mo BMvzMx My MuzzxM(MrA{MtzMK{MP{M5 A{A{zA M{{ M M {U{ { M{{{H{{HF{{{M{M{keyMHMK{3M| M07M2MA| M  M (M|MMMK{MP{M  (M| MzA|0 M|M0M =z* M|MU{| | |{u}u 4u[u0u'8ux@uidu o<Pu'Xu `u$>"hL}L 4LgidL } <}23L} L]rcuL}}:@@7g~7h2"cpu7iF7jF7kF 7lF7mF7nF7oF7pF7rF7s7t7uF7{  7|3(7} 07~38(7M@@}1~"F7:M        =3@^ N9n?8NN N! \N"N#;N#; N$(N$0N'N(;N);N04N1 $N2 $N3 $NCONDNLwNM(NNwO8NQNR NSONTSF| ƀ >Fր ր  4  v)v(0wlwwwS(w `x .rssx )xq0x8xS@x Xy fny .argy  ez bz z { 'OSA OT0 OUy3OWb OXx7OY8OIqOJiocOKM!A O\F0 b | ҂val|Z || val|f |ނ} v}  }%6F}T^    "q~      . 0 $ 4"F.ۃ   45F679 * % /4`  o<  ҂  <  PF >`  rKK(K8 bHЁ()x*0+0 ,00-1@. u1`/ d0uh1bp2 rx34 { څval ÅGF  "F6(   BEbuidF o<gidG < H څD4JH ( ( ( ( (  (( (0 8 @HЇ0 F(F, (0 (8@ Ї!;$ЇGF        @89:;<=È >È(?È0@8uÈ܈u܈bȈXDEÈFG HÈIÈ JÈ(K0N щ8O@QHSPủ̉q(qڅ։q̉xYZ[;\;];^; _;(`;0a18c1@dHeLf;Pg;Xh;`i1hjp8FFFF FFFino  ( 0‹F‹ ҋ QFFF FFFFX66 Y(|08|@H6PQuGw6uF"TuTҋ;wubw ^u܈wuD8  F S 0 (H/ops!8  q( 8 H*wm}r mwk\Ǐ! : T (0 ѐ8 @ H P -XP`dh p x   ̏ba!E B:E&JJO ?bErFSYbErFFѐE~~֐B -kkPEy2dUB~~iBEؑؑbݑ bkkǏ*?MF4e]-*! &q*ޒIN  F ޒ $@Z`[[\~]^`؜ b(d0e78fZ@h}Hj7PkXmҝ`ohp"pr @xsmuvyў{}:S` j t ~  ( b 1pid>F0uid o<o< $ p FF FF r* 1 ;4 )Օ-*+., -])P^F    $0c  &c=ltΟ    ( 0 8@9HMP9XM`php x Ϡ  ) ) y  +& 05 ? INۃ ] g q { : :$)Bߘߘ5r;F pos r) Fr5brXb~oi:{b5~oi]kF bߘՙbՙڙ \bFb/qbHbߕ4kbrrMbpb ٚb$PINboi~F.boiIN~F QbQSV[ 3\brreb ϛbrbr~FrbrbrrFԛF =F$m[qmFB5ymqy`qqB؜mqmBݜmqm7qm#Zqm5<}qm_qmҝqmqmFmםGw'FQ@m~'cqc;;h EqrqmbFўqbm֞m0m05 Sm0? mt S qX6F   qΟuqӟqq u9u%Mu>fmfk RuvumϠu~ru5~rԠ q\)ux==B . LQmyt5[ "@@AA5B0CFD֪ E<(sdF90GAS8'IF'JF'KF'LF'MF *  . 'PPW     qq  ZU2_rev Z99  95.rb2ns0F8< >Y@id;` hp.rcux opsJ!T r9hEi y"$ % ɦ & ަ(( 02 ~89B@: H= P@3XA Q`E O dir d > Ukn9b 1 1@`0h x  ~  B@  BA %`dddUydn~oiɦoiަΦd~rdՙ3drQdr8"Fz  0'֧(V) ji* +, - .(z1ۧ 1"5"5" "mW "n "o&X"0"1 "2 ~"3 "4y "5 ("7 ө0"9 8"; ө@"= H"?PWW )F) LF3~jFQ)1EtbFr~~өbFr~rbFrةbF"N" l" #lF)SF)5~q`֪0 u1 X0t7u LvQw!Vx*yy z (۪7LFAN[(oot֧A`t~ttiyiC }~(E>F5modG;$opsH!I JKa ܬì\׬HLargM strNarrOVWFX \max^F_Fnum`qopsa!b$0(;();=2L t F v   :7` -  .mod /;$@ 0FHmp 1P 2{FX  8 5r 6  7  9  ; ͯ  <( = 0r5~ͯ;$5;$ү;$6F >   ,8 ELmod F;$& G6 J       _,P p q r sB tF5mtn w  1  1 F   6;"ܬy=e& o y#QNW/Q  "L Aϱ >ϱ `   A > >(  AG"7>+G % Kint 1u8? #W   1 <!%',/359<ADHLQUYɲʲ˲  6 9 < GK 1 :@ 1T| 1.111-  g l - - - `J 9   % V9  `/V ,4p ,   : ; 9 I8  : ;9 I8  !II : ;9 I8( I~ : ; 9  : ; 9 I8 'I : ; 9 I8 !I/ IH}1B<: ; 9 I4:!;9 I&I  : ; 9 IH} : ;9 4:!; 9 I : ;9 I k I8 H}' : ;9 I8   : ; 9! : ; 9  > I: ; 9!!1RBUX YW " : ; 9 # : ; 9 I k$ : ;9 I%.?: ;9 '<& U' I(4: ;9!I ) : ; 9 I k *: ;9 I+ : ; 9 I 8 ,4:!;9 IB-41B..?: ; 9 '</ U0 : ; 9 1.?: ; 9 'I<2  : ;9 3 : ;9 I 841RBX YW 5.: ;9 'I 6 : ; 9 I 8 7 : ;9 I88 : ;9 I 8 9 I 8 :4: ; 9 I ;: ;9 I<: ; 9 I= : ; 9 I> : ; 9 I k ?  : ; 9!@> !I: ;9!A : ;9 I k B4I4C$ > D!IE: ;9 IF4:!;9 IBG : ;9 H I J : ; 9!K4:!;9 I L : ; 9 I8M !: ; 9!N4: ; 9 IO.?: ;9 'I<P:!;9 IBQ R4: ;9 IS:!; 9 IBT.: ; 9 'I !U: ; 9 IV:!; 9!IW : ;9!X  : ;9!Y : ;9 I Z : ;9 [1RBUX!YW \ 1]1RBX!Y W ^ : ; 9 I _4:!;9 I` :!;9!a1RBX YW b'Ic : ;9 I 8 d  : ;9!e:!;9 IBf5Ig : ;9 hI i(jk.:!;9! 'I@zl.:!;9! 'IU@zm.: ;9!' !n4:!; 9 IBo.: ; 9 ' !p>! !I: ; 9 q : ;9 I 8r<s : ;9 It : ; 9 I 8u : ; 9!I!v.?: ;9!'<w 1Ux4I4y:!; 9 IBz4:!; 9!IB{1RBUX!Y W | !: ;9!} I8~!I/ : ; 9  !: ; 9! I 8 !: ; 9!41.:!; 9 'IU@z4:!; 9!I1!1! !: ; 9 (!.?:! ; 9!'<.?:!; 9 'I<4:!;!9 I1 :!;9!.?:!; 9!'I@z 1% U$ >  &4: ; 9 I?' : ; 9 !I7   : ;9   : ;9  : ;9 > I: ;9   : ; 9  I   : ;9   : ;9   : ;9  : ; 9 I 8 : ; 9   : ; 9  : ;9   : ; 9 4: ; 9 I?<4G: ;9 .?: ; 9 '<.?: ;9 'I@z.?: ;9 'IU@z  UH}1X YW .: ;9 '@zH}.: ; 9 'I@z4: ; 9 I : ; 9 1RBX Y W 41.?: ; 9 '<.?: ;9 'I  : ; 9 .?<n : ; 9 I8  : ;9 I8  !II : ;9 I8( 'I : ; 9 I8  : ; 9  : ; 9 I8 !I/ I <I~: ; 9 I&I : ; 9 I1B : ;9  : ;9 I k' I8  : ;9 I8   : ; 9!H} : ; 9 > I: ; 9! : ; 9 : ;9 I I4: ;9!I : ; 9 I k ! : ;9 I" : ; 9 I 8 #H}$H}%4:!;9 I& : ; 9 ' : ; 9 I k(()(* +  : ;9 , : ;9 I 8-!I.> !I: ;9!/ : ; 9 I 8 0 : ;9 I81 I 8 2 : ;9 I 8 34: ; 9 I 4 : ; 9 I k 5 : ; 9 I6  : ; 9!7 : ;9 I k 841B9: ; 9 I:.: ;9 'I !;: ;9 I<$ > =4:!; 9 I>: ; 9 I?: ;9 I@4: ; 9 IA.?: ;9 'I<B : ; 9 I8C : ; 9!D : ;9 E4:!; 9 I?<F:!; 9 IBG : ;9!H !: ; 9!I.: ; 9 'I J:! ; 9!IK  : ;9!L : ;9 I M : ;9 N.?: ; 9 'I<O1RB X!Y W P UQ1RB UX!Y W R4:!; 9 IBS1RB X YW T:!; 9 IBU : ; 9 I V.?: ;9 '<W1RB UX!YW X :!;9!Y>! !I: ; 9 Z : ;9 I 8 ['I\  : ;9!]41^1RB X YW _.: ;9 ' !`5Ia : ;9 bI c.: ; 9 ' d e : ;9 I 8f<g : ; 9 I 8h : ; 9!I!i4:!; 9 IBjH}k 1l4: ;9 Im.1@zn !: ;9!o I8p!I/q : ; 9 r : ;9 Is !: ; 9!t I 8u.?: ; 9!'<vw4I4x.:!; 9 'I@zy1z1RB X Y W {41| : ; 9 I!8} !: ; 9 ~(! !: ; 9! 1.?: ; 9!'<.?:!; 9!'I@z 1 1% U$ >  &!I7 4: ; 9 I?' : ; 9   : ;9   : ;9  : ;9 > I: ;9   : ; 9  I   : ;9   : ;9   : ;9  : ; 9   : ; 9   : ; 9 .?: ; 9 'I<.?: ;9 'I@z: ;9 IB4: ;9 IB.?: ; 9 'IU@z : ;9 .: ; 9 '.: ; 9 'IU@z4: ; 9 I4I44: ; 9 I .?: ; 9 ' 4: ; 9 I4: ;9 I : ; 9 11X Y W .?<n : ; 9 I8  : ;9 I8  !II : ;9 I8( 'I : ; 9  : ; 9 I8 : ; 9 I8 !I/ < I: ; 9 I&I : ; 9 I : ;9  : ;9 I k I8 ' : ;9 I8   : ; 9! : ; 9 > I: ; 9! : ; 9  I4: ;9!I  : ; 9 I k  : ;9 I : ; 9 I 8  : ; 9  : ; 9 I k!  : ;9 " : ;9 I 8# : ; 9 I 8 $ : ;9 I8% I 8 & : ;9 I 8 '4: ; 9 I ( : ; 9 I) : ; 9 I k *> !I: ;9!+ : ;9 I k ,$ > -  : ; 9!.!I/: ;9 I0 : ; 9!1 : ;9 2 : ; 9 I83 !: ; 9!4:!; 9!I5  : ;9!6 : ;9!7 : ;9 I 8 : ;9 9 : ; 9 I : : ;9 I 8 ;'I<  : ;9!= : ;9 >(?I @4:!; 9 IA>! !I: ; 9 B : ;9 I 8C!I/D<E : ; 9 I 8F : ; 9!I!G4:!; 9 I?<HI~I !: ;9!J I8K : ; 9 L : ;9 IM !: ; 9!N I 8O !: ; 9 P(!Q !: ; 9!R4G:!; 9!S4G:!;9!T4:!;9!IU.:!;9! 'I@zV:!;9!5IW:!;9 IBX4:!; 9 IBY% Z$ > [ \&]!I7 ^4: ; 9 I?_'` : ; 9 a  : ;9 b  : ;9 c : ;9 d  : ; 9 e I f  : ;9 g  : ;9 h  : ;9 i : ; 9 I 8j : ; 9 k  : ; 9 l> I: ;9 m  : ; 9 n.?: ;9 'I<o.?: ; 9 'I@zp: ; 9 IBq UrH}sH} : ; 9 I8  : ;9 I8  !II : ;9 I8( 'I : ; 9  : ; 9 I8 : ; 9 I8 !I/ I <: ; 9 I&I : ; 9 I : ;9  : ;9 I k I8 ' : ;9 I8   : ; 9! : ; 9  : ; 9  I4: ;9!I  : ; 9 I k  : ;9 I : ; 9 I 8  : ; 9  : ; 9 I k >! I: ; 9!!  : ;9 " : ;9 I 8# : ; 9 I 8 $ : ;9 I8% I 8 & : ;9 I 8 '4: ; 9 I ( : ; 9 I k ) : ; 9 I*> !I: ;9!+ : ;9 I k ,$ > -  : ; 9!.!I/: ;9 I0 : ; 9!1 : ;9 24:!;9 I3I~4 : ; 9 I85 !: ; 9!6:!; 9!I7  : ;9!8 : ;9!9 : ;9 I : : ;9 ; : ; 9 I <'I= : ;9 I 8 >  : ;9!? : ;9 @(AI B4:!; 9 I?<C4G:!;9 DH}E : ;9 I 8F!I/G<H : ; 9 I 8I : ; 9!I!J4:!; 9!"IK.:!;9! 'I@zL:!;9 IBM1BN>! !I: ; 9 O !: ;9!P I8Q : ; 9 R : ;9 IS !: ; 9!T I 8U UV: ;9 IW !: ; 9 X !: ; 9!Y1RB UX!YW! Z41B[H}\:!;9!6I]% ^$ > _ `&a4: ; 9 I?b!I7 c'd : ; 9 e  : ;9 f  : ;9 g : ;9 h : ; 9 I 8i  : ; 9 j I k  : ;9 l  : ;9 m  : ;9 n  : ; 9 o : ; 9 p( q  : ; 9 r.?: ;9 'I<s.: ;9 'I t4: ;9 Iu.?: ;9 'I@zv: ;9 IBwH}x.: ;9 'I  : ; 9 I8  : ;9 I8  !II : ;9 I8( 'I : ; 9  : ; 9 I8 : ; 9 I8 !I/ < I: ; 9 I&I : ; 9 I : ;9  : ;9 I k I8 ' : ;9 I8   : ; 9! : ; 9  : ; 9  I4: ;9!I  : ; 9 I k  : ;9 I : ; 9 I 8  : ; 9  : ; 9 I k >! I: ; 9!!  : ;9 " : ;9 I 8# : ; 9 I 8 $ : ;9 I8% I 8 & : ;9 I 8 '4: ; 9 I ( : ; 9 I k ) : ; 9 I*> !I: ;9!+ : ;9 I k ,$ > -  : ; 9!.!I/: ;9 I0 : ; 9!1 : ;9 2 : ; 9 I83 !: ; 9!4:!; 9!I5  : ;9!6 : ;9!7 : ;9 I 8 : ;9 9 : ; 9 I :4:!; 9 I;'I< : ;9 I 8 =  : ;9!> : ;9 ?(@I A : ;9 I 8B!I/C<D : ; 9 I 8E : ; 9!I!F>! !I: ; 9 G !: ;9!H I8I : ; 9 J : ;9 IK !: ; 9!L I 8M4:!; 9 I?<N !: ; 9 O !: ; 9!P4G:!; 9!Q.:!;9! 'I@zR:!;9!5IS:!;9 IBTI~U% V$ > W X&Y4: ; 9 I?Z!I7 ['\ : ; 9 ]  : ;9 ^  : ;9 _ : ;9 ` : ; 9 I 8a  : ; 9 b I c  : ;9 d  : ;9 e  : ;9 f  : ; 9 g : ; 9 h( i  : ; 9 j4G: ;9 k4: ;9 Il.?: ;9 'I<m.?: ; 9 'I n: ; 9 Io p.1@zq1Br1RB X Y W s1t 1uH} : ; 9 I8  : ;9 I8  !II : ;9 I8( 'I : ; 9  : ; 9 I8 : ; 9 I8 !I/ < I: ; 9 I&I : ; 9 I : ;9  : ;9 I k I8 ' : ;9 I8   : ; 9! : ; 9  : ; 9  I4: ;9!I  : ; 9 I k  : ;9 I : ; 9 I 8  : ; 9  : ; 9 I k >! I: ; 9!!  : ;9 " : ;9 I 8# : ; 9 I 8 $ : ;9 I8% I 8 & : ;9 I 8 '4: ; 9 I ( : ; 9 I k ) : ; 9 I*> !I: ;9!+ : ;9 I k ,$ > -  : ; 9!.!I/: ;9 I0 : ; 9!1 : ;9 2 : ; 9 I83 !: ; 9!4:!; 9!I5  : ;9!6 : ;9!7 : ;9 I 8 : ;9 9 : ; 9 I :'I; : ;9 I 8 <  : ;9!= : ;9 >(?I @ : ;9 I 8A!I/B<C : ; 9 I 8D : ; 9!I!E4:!; 9 IF>! !I: ; 9 G !: ;9!H I8I : ; 9 J : ;9 IK !: ; 9!L I 8M4:!; 9 I?<N !: ; 9 O !: ; 9!P4G:!; 9!Q.:!;9! 'I@zR:!;9!5IS:!;9 IBTI~U% V$ > W X&Y4: ; 9 I?Z!I7 ['\ : ; 9 ]  : ;9 ^  : ;9 _ : ;9 ` : ; 9 I 8a  : ; 9 b I c  : ;9 d  : ;9 e  : ;9 f  : ; 9 g : ; 9 h( i  : ; 9 j4G: ;9 k4: ;9 Il.?: ;9 'I<m.?: ; 9 'I@zn: ; 9 IBoH} : ; 9 I8  : ;9 I8  !II : ;9 I8( 'I : ; 9  : ; 9 I8 : ; 9 I8 !I/ < I: ; 9 I&I : ; 9 I : ;9  : ;9 I k I8 ' : ;9 I8   : ; 9! : ; 9  : ; 9  I4: ;9!I  : ; 9 I k  : ;9 I : ; 9 I 8  : ; 9  : ; 9 I k >! I: ; 9!!  : ;9 " : ;9 I 8# : ; 9 I 8 $ : ;9 I8% I 8 & : ;9 I 8 '4: ; 9 I ( : ; 9 I k ) : ; 9 I*> !I: ;9!+ : ;9 I k ,$ > -  : ; 9!.!I/: ;9 I0 : ; 9!1 : ;9 2 : ; 9 I83 !: ; 9!4:!; 9!I5  : ;9!6 : ;9!7 : ;9 I 8 : ;9 9 : ; 9 I :'I; : ;9 I 8 <  : ;9!= : ;9 >(?I @4:!; 9 IA : ;9 I 8B!I/C<D : ; 9 I 8E : ; 9!I!F>! !I: ; 9 G !: ;9!H I8I : ; 9 J : ;9 IK !: ; 9!L I 8M !: ; 9 N !: ; 9!O4:!; 9 I?<P.:!;9! 'I@zQ:!;9!6IR:!;9 IBS1RB UX!YW! T1BUI~V% W$ > X Y&Z4: ; 9 I?[!I7 \'] : ; 9 ^  : ;9 _  : ;9 ` : ;9 a : ; 9 I 8b  : ; 9 c I d  : ;9 e  : ;9 f  : ;9 g  : ; 9 h : ; 9 i( j  : ; 9 k4G: ; 9 l4G: ;9 m4: ;9 In.?: ;9 'I<o.: ;9 'I p: ;9 Iq.?: ; 9 'I@zr: ; 9 IBsH} : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 'I : ; 9 I8 < ( : ; 9 I : ; 9 I I&I!I/  : ; 9 I8 : ;9  I8  : ;9 I k : ; 9  : ; 9 4: ;9!I '  : ; 9! : ;9 I I : ;9 I8  : ; 9 I k  : ; 9  : ; 9 I k  : ; 9 I $ > ! I 8 ">! I: ; 9 #4: ; 9!I $  : ;9!% : ;9 I 8& : ;9 I 8 ' : ; 9 I k( : ; 9 I 8 ): ;9 I* : ;9 +:!; 9!I,  : ;9!- : ;9 I . : ; 9 I!8 / : ;9 I80 : ;9 1'I2!I3 !: ; 9!4  : ;9!5 : ;9 I 8 6> !I: ;9!7 : ; 9 I!8 : ;9 I 89 : ;9 :  : ; 9!; :!;9!I k < : ; 9 I8=I >4:!; 9!I!? !: ;9!@ I8A : ; 9 B : ;9 IC : ; 9!D : ;9!E!I/F !: ; 9!G>! !I: ; 9!H% I$ > J K&L4: ; 9 I?M'N4: ; 9 I?<O : ; 9 P  : ;9 Q  : ;9 R<S : ;9 T : ; 9 U : ; 9 I 8V  : ; 9 W I X  : ;9 Y  : ;9 Z  : ;9 [  : ; 9 \ I 8] : ; 9 I ^> I: ;9 _( `4G: ; 9 ( 4: ;9!I $ > 4: ; 9!I &II!I/ 4:!; 9!I  : ; 9 I :!; 9!I!8 >! !I: ; 9  :!;9!I8 > !I: ;9!>! !I: ; 9! !!:!; 9! :!; 9!I8!% $ > : ; 9 I4: ; 9 I?> I: ;9  : ;9 ( -          JtZXX}  .JUJS          IKX uW X Xs Xw XyXX& *X  ~X  .JUJJxX          J          X~ ~X ~ ~"~XX  X ~ M~f.<BX.X=X.YWvX!.X .X .X.X0X wJYtx XtX  !x/XXB !x !xzJXytpXXX_X}X~X VZ X| X:v>WX<Yy esxtt2LY K [<.$tM=J f<v[T ."+< U<& Z.X, !!%;(J"fy F/yX  X<   esytXu~.rX esqt$< y esqt<YwK erxt<u esrt  X VZpX XN .&t Z.X1 O 9^!'/Xv 0<vvvv .֬fy ! ~  J~z.fZ<zX     X< t~  J~z.fZ<zX     X<|tY =JY ~~  wX~<~JXYfXZX X}<]7Z J XX XtJX <u.~<  0 J< Zi~X  .t....XX6Y28@T\<Y.0.01 J!J.qX./...XX9X/Jtnt.00Oz.2YXX9YM@8@uJt~  J~z.fZ<zX     X<et~  J~z.fZ<zX     X<{t%SO7[UZBzJ/ /:/;g%e/ -M J ~JMq.?<ZyX#.<<bt<  tE/w  X.v Ki JJ} tJw |./Kw.w.}   ]p | t  L }< p  d!s =<Zf:hJ< oX  Xfv<twJtX |twJjX.h<   =fYy wJYt=IZ<pXz f }{.~<< ~u t ~< z    ~<< ~u    0.Ƀ  /f5 ~u  ɃXz."L|JYt=Iz   ~x< ~ z  .z ~ X.z  ~ Xz ~ Xz  .z ~ Xz  .zX~| tJ||X|X Y WvX }XXt{X   . |     /< < .AX }XXtf.; }XXtן<<X"  ffz  .z~1XXt ~ ff.z ~1XXt  ffz  .z }1XXtkX Z< .vHzXtzXJ J~Y | 3 u !y.u !y. <  :vt66u " ,0<I K !x/!  y#JXxXt0F "   z0~JYtXJL !x !xXf<} /x=X XX*         f p  u;P?J X~Xt@ } Ygt [+Y J|XRX&X <X=8ftV [+Y J|.} ]p | t L }< p  . 5tX0 w<v84t<J  Xfx   .x" twXX= !}vY .~ 0 t .~0f#0$~Js W~X <X  J:ZJ fu _sGOo0{t t XpsX~ <X ~f<[~ <Xqh} e tY   XtV X< tVXY J.vf |t .f {t} eY N  JtZ* Xp XXWX4 [X Xttt<.\.[ttt<.~XX rLWX^ XtsXt 3         /myXS+eyyX:yX7yX2yXYyX  XyX<yX(yX $yXyX $yX4yX(yX yXyX yXyX$ge b+[y#yX(yX$ yX$yX$#yX yX vXyX<<<<"/ PX+e?XX X Xge b+[X  XX X#X XXr$  ty<Wt X9Wt X$         Yee0 f*qX*e*e*e*e*e*e*e*e*e*e*e*eYg,/ f*qX*eY*e*e*e*e*es$ ><     0=wXu w N*h X]wX XOwXIwXIwXXwXcwXOwXwX$#wX2wX5wX$;wX,wX$(wX<$$(wX5wX5wX$$#wXwX$wXwXwX<<<wX<<<<wX<<'=n~t*6J u N*h X9%w XC$<XX .$         jzXVE $zX&  $zX&&<XX Q (X,.TXt#|vt <$         e@{322? \zX 8zX֬ f $zX ff(XȺtffXfffffff( ,fTX֬fff ,\PXfft <$         / YzXo.t zoWXEtzt'fKJ5 J zX)t@# z. TzXztXzt-.Ⱥ zX zXȬ <zXȬX zX zXX zXy/ < $ JX yXf>XȬ$ y"< yf yXf.        x #$MJT E e$MJT E e,\Fl J A E ,LFDG tAA> JD $B h AE TGEB E(D0D8KH{ 8C0A(B BBBE $;HDGLD  ABE `ABu <GAA D0{  CABE "0<}GAA D0b  AABE $MJT E e$MJT E eKJI($M(h AE D(KBH A(l  ABBE y0](TJHq AE E [l AE p AE SA$J E T:JAD0K CAE 8[0\8]0R8[0R8[0T8[00\\KAD @ ABE  ABE f(X H(Z B(X  dKPB B(A0A8DHP^HZ 8C0A(B BBBE D0HPfHP`HtPZHPQHx \tKEE D(D0l (A BBBE O(C DBB#$RDD E 6$RJCDSKDC k ABE ADDDSKDC k ABE ADDDKBA A(D8 (A ABBE $.8\KBB A(A0DXr 0C(A BBBE $<KAA D0  CABE x 8x ax ;+x ,x "!line_entry_ptrlinkstart_timekernfs_nodercu_workPSI_IRQ_FULLRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEfront_paddup_xol_addrZSWPOUTcapture_controlnr_wakeupspost_attachstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGalways_onuclamp_seFORTIFY_FUNC_kmemdupElf64_Worderr_resetgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterscss_resetwm5110_devsarizona_sysclk_stateNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsNUMA_INTERLEAVE_HITneed_qsunder_voltage_limitscompact_defer_shiftswap_deactivateblkcnt_tnum_micd_configsicq_treesi_codethread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batchrstat_flush_nextzeromapmap_pagesreschedule_countvfsmountcss_onlineextable_basenoinstr_text_sizenargsattributesMTHP_STAT_SWPOUT_FALLBACKTASKLET_SOFTIRQ__UNIQUE_ID_ddebug620set_child_tidNUMA_HINT_FAULTS_overrunrestrict_link__UNIQUE_ID_ddebug626tmpfilemicd_bias_start_timercu_read_lock_nestingem_perf_statemin_nrnotification_limittick_dep_maskgpio_desclistthrottle_disksi_errnobsynce_freezememcg_lrus_inode_lrumemcg_nodesrcu_size_stateblk_plug__pm_runtime_disablewm5102_suppliesuid_gid_mapPGSCAN_SKIP_DMA32unpinned_netfs_wbof_noderefsmmap_compat_base__UNIQUE_ID_ddebug630WB_SYNC_NONEtrace_eventsenv_startcgrp_ancestor_storagedma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedcgroup_tasksetVTIME_GUESTrtpoll_next_updateregsslice_maxlast_switch_countqsize_tDIRECT_MAP_LEVEL3_SPLITblkio_delay_totaltime_ns_for_childrenfilesdqb_bhardlimitlivevm_faultatomic_write_unit_maxs_staterun_listixolSCHED_SOFTIRQbd_mappingsym_vvar_pagemodule_sect_attrspm_runtime_put_syncmg_src_preload_nodereturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idGPIOD_OUT_LOW_OPEN_DRAINautosuspend_delayunsigned intCGROUP_INET6_GETSOCKNAMEnotifier_callrtpoll_taskgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqbi_crypt_contextia_vfsgidcgroup_bpfzone_typeregcache_syncsize_tacpi_device_idcap_permittedwm8997_patchTT_NATIVEzone_pgdatclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesu64_stats_syncrcu_tasks_idxsync_modercu_tasks_holdoutmin_uAtarget_listavg_write_bandwidthb_attachedpasid_activatedpi_semin_uVzonerefget_offset_ctxcore_forceidle_sum__compiletime_assert_127mfd_cell_acpi_match__compiletime_assert_129freeze_ucounti_ctime_nseccpuhp_deads_remove_countDEV_PROP_U64syscall_workcompletionsdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_headmemory_failure_statss_vopu64_dataperf_eventf_securityi_sb_listvm_rcupgtables_bytesstate_memget_linkfmode_tdevtPSI_IO__compiletime_assert_130restoredelayed_callbi_iter__compiletime_assert_134max_nr_cid__compiletime_assert_137_statusignore_resource_conflictsd_sibkernel_ulong_tdma_opsTHP_COLLAPSE_ALLOC_FAILEDbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedbvec_iterdl_dev_statearizona_clkgen_errgsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countPGPGOUTreturn_consumermclk_namerelease_dqblkarizona_clk32k_enablein_thrashinguaddr2css_extra_stat_show__kernel_timer_tclass_srcu_is_conditionalcss_releasedDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskavail_listsatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionsnd_soc_dapm_contextbv_lendiscard_workstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispblkcg_noderegmap_writercu_specialclear_child_tidf_refextable_lenper_cpu_zonestatbacking_dev_infoNET_RX_SOFTIRQsaved_scratch_registerplatform_device_iddev_pagemap_opss_stack_depthdata_vmregcache_mark_dirty__s32entry_eiptaskstatshugetlb_usagetree_reclaimedratelimit_states_pinsattrget_next_child_nodeFAULT_FLAG_WRITEwrite_syscallsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDext_capdebug_dirfind_special_pagebacktrace_entire_mapcount__UNIQUE_ID___addressable_arizona_clk32k_disable619software_noderegmap_irq_chip_dataforce_atomicmmap_compat_legacy_basedefault_groupspollac_padgraph_get_next_endpointmemcg_iducount_typenr_wakeups_idleFORTIFY_FUNC_memsetrtpoll_waitio_cqprobeelf64_sym__UNIQUE_ID___addressable_arizona_clk32k_enable618arizona_is_jack_det_activelatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSMAX_CGROUP_BPF_ATTACH_TYPEsyscorewb_reason__s64LRU_ACTIVE_ANONdqi_bgracewm5102_patch__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_panelctl_tableuid_tflush_requiredprocs_filesum_block_runtimepgmapmin_perf_statektime_comparedq_opnum_micd_rangesrcu_tasks_nvcswwriteNR_WB_STAT_ITEMStypetabclk32k_refclass_read_lock_irqsave_is_conditionalcan_forkFORTIFY_FUNC_strlcatfor_backgrounddma_pools_addr_lsbctl_table_polli_generation_sigpollmxcsrrange_cyclicd_rt_spc_hardlimiteminbi_end_ioblk_holder_opsfreepages_delay_totalNR_ZONE_ACTIVE_FILEnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affineupdated_childrenpteval_ti_inocgwb_listdyndbg_infocompact_cached_free_pfnindexfree_clustersdriver_datathread_headac_exe_devdev_pm_qosbi_sectormap_typeNR_PSI_TASK_COUNTSperiod_timef_opPGPGINpids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizeperf_event_cgrp_idwm8998_devsdq_sbNR_FILE_THPSarch_static_branchcgroupsighand_structflagsi_lock_keykmem_cacheCPUTIME_STEALKCOMPACTD_FREE_SCANNEDinodedrivers_dirback_paddev_prop_typeNR_ZONE_ACTIVE_ANONbug_entryraw_atomic_add_unlesscancel_attachwaiterscmin_fltWM1831rw_semdqio_semprev_sum_exec_runtimeinmodenestederr_earlyrtpoll_nr_triggersnr_forced_migrationsac_pidseq_operationsnum_argsri_timerstack_canaryinactiveblksizesiblingmnt_rootnext_scanunregisteringf_raquota_writesrcu_barrier_cpu_cntNR_LRU_LISTSiopl_warnrmdirsockbi_write_hinthash_lenget_policyshrinker_info_unitnr_reclaim_startTHP_FILE_FALLBACK__bi_nr_segmentstask_iterssym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecss_freecpu_basedevice_is_availabledquotdl_runtimechildren_min_usage__ret_do_oncenumbersswapin_delay_totalbi_vcnt_softexpiresPSI_POLLkey_user_hugetlb_cgroup_rsvddischargefaultableio_comp_batchshutdowndq_lockzswap_maxi_cdevldt_structenv_endobj_cgrouprescue_workqueueprogsextra1ptrace_messageNUMA_OTHERnum_trace_events_sys_privatemin_usagearizona_underclockedinit_fs_contexts_subtypeheaderfuncperf_event_contextno_cgroup_ownernbp_th_nr_candrelease_dquottlbflush_unmap_batchsoftfreepages_count__sifieldsDIRECT_MAP_LEVEL2_SPLITrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authregulator_enablevirtual_dr6attachTHP_DEFERRED_SPLIT_PAGEkprobes_text_sizestatic_call_sitesTHP_FILE_FALLBACK_CHARGEthread_group_cputimernuma_scan_period_maxstart_stackTHP_SWPOUT_FALLBACKwatchersKSM_SWPIN_COPYrange_endcompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrshow_options_workingsetregmap_bulk_readgpswbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodebpf_cgrp_storagecurr_nrcorememsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataWORKINGSET_REFAULT_ANONget_dquotsnextentsnum_orcscma_pageserr_pmclass_task_lock_is_conditionalUCOUNT_RLIMIT_SIGPENDINGFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotover_temp_detectiond_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_on__warn_printkvm_operations_structNR_ACTIVE_FILEjd_gpio5bin_attrs_newbio_alloc_cacheruntime_idleiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersPGSCAN_DIRECTexp_hintnregis_softbindcntsRPM_SUSPENDEDreclaim_stateMEMCG_SWAP_HIGHevictedvma_numab_staterethooksnum_symtabPGSCAN_SKIP_MOVABLEwrite_inoded_fsdataRPM_SUSPENDINGcacheline_paddingCGROUP_SUBSYS_COUNTnrpages_refcounti_crypt_infopermissionsnr_frozen_descendantsbdi_nodeerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepwm5102_clear_write_sequencerenvp_idxcgroup_namespaceZONE_DEVICE_head_1_head_2subsysbd_size_lockbackstate_add_uevent_sentOOM_KILLi_hashregulator_disablehlist_nodeclk_unprepareio_uringregulator_init_datareg_sequencecore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setCOMPACTFAILbio_listwrite_dquotclass_read_lock_irq_is_conditionalfolio_batchNUMA_MISSioctx_lockkveccurrent_stack_pointersect_attrsmg_dst_cgrpsoft_start__UNIQUE_ID_ddebug622__UNIQUE_ID_ddebug624online__UNIQUE_ID_ddebug628runtime_resumedup_xol_workKCOMPACTD_WAKEwrite_charlocal_watermarktdm_slotsMEMORY_DEVICE_PCI_P2PDMAsuspend_state_ttotal_vmjobctls_time_maxnode_listdio_offset_alignhpdet_channel__UNIQUE_ID_ddebug634delay_worksuccessUCOUNT_CGROUP_NAMESPACESCGROUP_INET6_CONNECToublockinuse_pagesrecent_cidkf_opskernel_paramdeferred_resumektime_getd_spc_softlimitreported_split_lockmicvddgfp_t__UNIQUE_ID___addressable_arizona_dev_init638seccomp_filterstime__pm_runtime_resumei_mmapthaw_superd_lrusignal_structperf_event_mutexNR_PAGETABLEcrcsUNEVICTABLE_PGMLOCKEDpgdval_tinitial_stateconstraintssetattrf_mappingnoinstr_text_startpreparebin_attrsprotectedsas_ss_flagsf_modeki_completenonfull_clustersvtime_statewakee_flipsset_aclpids_activedriverZONE_NORMALi_opldt_usr_semHRTIMER_RESTARTwpcopy_countkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEcredjump_entryswap_iocbfrag_clustersproactive_compact_triggersrcu_gp_seq_needed_expgpioaddress_space_operationsspinlock_t__task_fpstatemask__ret_oncewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssites__lruveccluster_nextDEVICE_VERT_POS_UPPERmem_cgroup_reclaim_iterarizona_irq_exitevents_lockptracequota_disablekprobe_blacklistwork_lockcpus_ptrnotified_atpaccti_dentryunder_voltage_detectiongrab_current_nsaltmapdescsfsnotify_mark_connector__pm_runtime_set_status_sigsysdelay_uskswapd_lockchangeabledirty_limit_tstampsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMED__NR_MEMCG_DATA_FLAGSCGROUP_INET_EGRESSexpiresrcuwaitnivcswpsi_resMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_minregmap_reads_devcpus_allowed_lockget_next_idrwlock_tpgprotbstatfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depth__UNIQUE_ID_license641ac_utime_dummy_pkeyiommu_mm_datavm_event_itemmce_countswap_info_structsequencecpu_cgrp_idrt_spc_warnlimitac_flagblocking_notifier_headcoredump_datavm_stattasksmem_cgroup_per_node_pidaddress_spacemm_context_t__old__q_sizeuid_gid_extent__call_single_nodestartupseqcount_spinlock_tbio_issuei_wbcss_local_stat_showuint8_tregulation_constraintsMEMCG_HIGHpanelclass_id__read_overflow2_fieldinactive_timer_pkeypm_runtime_no_callbacksfilenames_export_opdisable_irqwrite_u64PSI_IRQi_flctxarizona_disable_freerun_sysclkstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqlowmem_reservepagemutex_unlocktrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_folioGPIOD_OUT_HIGH_OPEN_DRAINi_pipebaseCGROUP_INET6_BINDforce_scanhostuaddrfailedcgrps_wb_errold_subtree_ss_maskshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descscontiguousrecoveredTHP_MIGRATION_SPLITexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidi_rt_spc_timelimitrseq_sigLRU_INACTIVE_FILEarizona_micd_configdev_pm_domainlimit0limit1nr_zonespages_skippedmigrate_modeSWAP_RA_HITbio_poolfree_area__compiletime_assert_621__compiletime_assert_623kswapd_failures__compiletime_assert_625zswap_lruvec_state__compiletime_assert_627ftrace_callsites__compiletime_assert_629d_hashis_confidentialdl_bwkobjfsyncmtd_infoWB_DIRTIEDlru_gen_mm_listi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_statenum_parent_suppliesFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeUCOUNT_IPC_NAMESPACESpushable_tasksplatform_datad_compare__compiletime_assert_633sighanditerate_sharedis_visiblesignalWB_REASON_FORKER_THREADreleaseddep_mapalloc_dquotpm_messagemay_split__q_size_fieldmem_cgrouplast_update_timerobust_list_headswap_peaksnum_consumer_supplies__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackstat_thresholdlevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventCOMPACTSTALLhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowunsigned charzone_start_pfnvdsomemtiermmap_legacy_basePAGEOUTRUNTHP_SCAN_EXCEED_SHARED_PTEpipe_inode_infononresident_ageuint16_tsecurebitspartition_meta_infostate_initializeduring_cmd_iopollbi_poolcompat_uptr_tuevent_opsSWPIN_ZEROCGROUP_UDP6_RECVMSGslicesas_ss_spNR_ZONE_INACTIVE_ANONnr_dirtieddev_get_drvdatanum_kprobe_blacklistNR_FREE_PAGESsubtree_ss_maskclass_local_lock_is_conditionalsuspend_latewakeupcg_listcgwb_release_mutexsrcu_barrier_completionwb_completionshrink_controlwritten_stampdriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapaod_irq_chipspan_seqlocksessionidarch_atomic_readlast_bdp_sleep_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistCPUTIME_SOFTIRQZONE_DMAdebugfs_entryelemnr_retriescgwb_frnavg_refaultedPGSCAN_DIRECT_THROTTLEsigval_talimitundo_listdirty_foliorcharZONE_MOVABLEALLOCSTALL_DEVICEnr_populated_domain_childrenmissedkswapd_highest_zoneidxparent_could_setfcapquota_readst_shndxldo1freedevices_cgrp_idpageset_high_maxi_wb_frn_avg_timePGSCAN_KSWAPDbd_fsfreeze_countfile_ref_tCMA_ALLOC_SUCCESStypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wqDROP_SLAB_dummy_bndmin_unmapped_pagessas_ss_sizespk_fmtuser_xfeaturesnr_wakeups_passivefile_system_typewb_tcand_idmtimeserver_has_tasksswap_events_fileoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_thigh_worknode_zonelistspath__UNIQUE_ID_description640st_sizenr_frozen_taskslru_gen_foliormtpwait_sumnum_tracepointsupidexit_codemempool_texec_startclass_read_lock_is_conditionalramp_disableconsumersrtpoll_min_periodkernfs_elem_symlinkclock_was_set_seqPGSCAN_KHUGEPAGEDDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerPGREUSEiommu_groupover_voltage_limitsperiod_contribforceidle_sumrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockis_preparedCOMPACTFREE_SCANNEDvm_opshighest_bitiopollTHP_MIGRATION_FAILpagesizes_blocksizevm_pgofftimesauprobearizona_disable_resetcan_swaprelease_agent_worknuma_workupdate_timeptrace_dr7disable_irq_nosyncpriority_call_addrexpireloginuidcheckregulator_putTHP_FILE_MAPPEDrtpoll_untilexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneDEV_PROP_REFnbp_rl_nr_candCPUTIME_GUEST_NICE__lstateupdated_nextueventlock_countrefcount_tcset_linksplugchild_countio_cgrp_idsaved_auxvTHP_MIGRATION_SUCCESSmce_addrlast_bstatnum_bugsqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenmemory_tierunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotesettling_timellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalorig_objcgrseq_csdcvddnum_ftrace_callsitessoftirq_expires_nextHTLB_BUDDY_PGALLOC_FAILDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnode_zonesnbp_th_startelow_pincounttablesDEVICE_PANEL_BOTTOMmin_seqlist_headlru_lockWB_REASON_FOREIGN_FLUSHtgidbatchedfor_reclaimwrite_protect_seqtdm_widthcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holderend_codeblkio_countqspinlocklru_genNR_VMSCAN_WRITEinsnfilldir_tNUMA_PTE_UPDATESlow_usagedl_non_contendingdir_contextPGFREEtracepoint_ptr_tutaskfailcntNR_UNEVICTABLEsched_entityd_spc_hardlimitgpio_defaultslockdep_keypm_runtime_mark_last_busylong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baserescue_workio_contexthpdet_acc_id_linegpl_symsgroupseq_showctl_nodePGSCAN_SKIP_DMAswait_queue_headcow_pageinumac_btimeblockSWPOUT_ZEROi_spc_timelimitreturn_instancesDEV_PROP_U16class_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevicebi_integrityCPUTIME_USERs_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namekernfs_open_filenoderesetfor_kupdateBALLOON_INFLATEvm_lockMTHP_STAT_NR_ANON_PARTIALLY_MAPPEDPGMIGRATE_SUCCESSwb_tcand_bytesno_cgroup_migrationMTHP_STAT_SPLIT_FAILEDnextevtpull_downs_writers_key__countxcomp_bvcma_areaWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatipc_namespaceexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputime__func__state_remove_uevent_sentread_charcgroup_nsia_sizein_hrtirqs_master_keysCGROUP_LSM_STARTac_stimescaledpropertywchar_addr_bndkernel_symboli_opflagssubsys_databi_statusnr_cgrpstv_secCPUTIME_SYSTEMDEV_PROP_U32pid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdpsi_filesMEMCG_OOM_KILLnr_failed_migrations_affineIS_ERRproperty_entryNR_SWAPCACHEuser_cpus_ptrirq_delay_totalpi_top_taskunlinkNR_WRITEBACK_TEMPactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writebiasutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthmax_seqi_sizedl_deadline_hugetlb_hwpoisonpsi_group_cpuarizona_of_get_core_pdataCPUTIME_NICEubufksm_rmap_itemspageset_batcharizona_micsupp_pdatanr_populated_csetsCGROUP_INET4_CONNECTmodulepcpu_cidPGACTIVATEngroupsfree_file_info__kernel_time64_tNR_VM_NUMA_EVENT_ITEMSstate_diskautaskuser_namespacevfsuid_traw_spinlockdmic_refkswapd_waittimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flagsPGREFILLkeyring_name_listMTHP_STAT_ANON_FAULT_FALLBACK__compiletime_assert_631err_enablearizona_isolate_dcvddfile_costarizona_dev_initread_posstatic_call_trampTHP_SWPOUTbtrace_seq_pp_mapping_padsa_maskrequest_queueCGROUP_UNIX_GETPEERNAMEalloc_factorKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenMTHP_STAT_SPLITrdma_cgrp_idcodegtimenr_populated_threaded_childrensigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimeCOMPACTMIGRATE_SCANNEDsched_rt_mutexlocked_pendinghlist_nulls_nodenr_deferredfown_structfeatures_lockedlruvec_statstracing_graph_pauseavg_triggerspermcompat_robust_listbi_blkgktypelockrefin_dpm_listsrcu_struct_ptrsmm_structrtpoll_wakeupvlagregmap_update_bits_basei_uidbi_iocost_costusleep_range_statespinlockpm_runtime_enablenr_dying_subsystimestampspid_namespace_syscallmod_arch_specificmax_write_lennum_static_call_sitesend_pfnvm_mmfortify_memcpy_chkdebugfs_idwb_lcand_bytesguest_permmem_dqinfotruei_countHRTIMER_NORESTARTWB_SYNC_ALLbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameerr_irqget_ownershipcgwb_treeUNEVICTABLE_PGMUNLOCKEDufdsexe_filehlist_bl_nodeipc_nspcp_listpid_linksfree_counts_sysfs_nameclk_disable_unprepareq_size_fieldrefcountvaddrrequestpglist_datarw_hintIRQ_POLL_SOFTIRQtimeoutlast_switch_timenum_classesorc_unwind_ippage_counterqc_dqblkuse_of_regfprop_local_percpuavg_next_updatemmappedseqcount_raw_spinlockbd_holder_dirinitial_modecpu_run_virtual_totalkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersproc_ns_operationsi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failthrashing_countllist_headuv_less_critical_window_mswait_startpercpu_clusterf_freeptrnr_freeclass_raw_spinlock_irqsave_try_is_conditionalmap_nr_maxu8_dataget_dqblk__ret_condshow_fdinfofixupirq_gethashposix_acldd_key_falsehp_enabug_addr_dispdqi_igracemax_slack_shiftclass_rwsem_write_try_is_conditionalthaw_noirqrcu_syncdac_comp_enabledpreempt_notifierssrcu_last_gp_endbdi_ids_fsnotify_infocpu_delay_totaluser_keyring_registermempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keysubdevsremovePGSCAN_ANONs_magicdl_overrunallocd_parentmax_uV_steponline_cntpayloadac_minflti_sbmin_ratiomatchcommcompcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxatomic_open_zonerefsbio_end_io_tstart_prevent_timeMEMCG_OOM_GROUP_KILLpm_runtime_set_activelru_zone_sizereadahead_controlrtpoll_timerdirty_limit__kernel_gid32_tcompact_init_free_pfnNR_BOUNCEstate_maskf_credMODULE_STATE_COMINGnotify_countmg_dst_csetoffline_disabled__empty_rangesbd_devread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodpsi_statesfsnotify_sb_info__sigrestore_tbi_idx__kernel_loff_tdetachget_unmapped_areaTHP_FAULT_FALLBACK_CHARGEdev_pagemapPGDEACTIVATEwritepagessched_statisticsheadgpio_base__state_permpsi_task_countuprobe_taskdevice_get_dma_attrselfwriteback_controluclampirq_gpiosuper_operationsbi_cookiesplice_eofnr_threaded_childrenCGROUP_INET_INGRESSutil_avgtaskrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockPGSCAN_SKIP_NORMALcputimeD_REAL_DATAbd_holderspt_regspipe_bufsNR_IOMMU_PAGEScapabilitiesctx_iddirty_ratelimitd_rt_spc_warnsCGROUP_INET6_GETPEERNAMEi_verity_infoxsavetimespec_type__rb_parent_colorLRU_UNEVICTABLEdevres_lockbitsWB_REASON_MAXiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsCGROUP_DEVICEevents_fileout_vol_limitCOW_KSMFORTIFY_FUNC_memscanntimeover_current_protectionnet_prio_cgrp_idvm_private_dataio_bitmap__bi_remainingsubtree_bstatuprobe_task_statetimerkobj_typeb_dirty_timemsleepi_pageshlist_bl_headino_warnlimitpfmemalloc_waitfasyncpidlistsi_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGEScharqf_ownerunix_inflightholders_dircont_lockfpu_state_permi_fsnotify_maskbio_vecUNEVICTABLE_PGCLEAREDsysctlsprotection_supportKSWAPD_LOW_WMARK_HIT_QUICKLYgraph_get_port_parentUNEVICTABLE_PGRESCUED__restorefn_tclass_raw_spinlock_irq_try_is_conditionalmax_uAthread_shstkvm_node_stat_diffbio_slabmax_uVd_aliasNR_SHMEM__iovcpumaskPGLAZYFREEDdumpernode_size_lockwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectiveregulator_consumer_supply__read_overflow2taintsclosidsum_exec_runtimes_rootsDEV_PROP_U8write_bandwidthd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensupply_regulatorsaved_trap_nrover_curr_limitsbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesclk_preparelegacy_cftypesTT_COMPATexternal_dcvddfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountsupplypage_freeUCOUNT_PID_NAMESPACESread_syscallshlist_nulls_headNR_FILE_MAPPED_nr_pagesparentatimecopy_file_rangetask_cputime_atomicBALLOON_DEFLATEuser_definedkey_typecgrp_linksget_named_child_nodelaunder_foliocurr_targetis_suspendedtemp_limitsuts_namespace__keyfor_syncburstetypeei_funcsmodule_kobjectmemoryorderactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0rtpoll_totalno_updatecap_bsetsysclktagged_writepagesilim_uAarchdata_sourcepower_statenr_perf_statesstack_vm_areamfd_cellsaved_stateGPIOD_OUT_HIGHbasess_bdev_filenuma_faultsperiodcgroup_subsysWORKINGSET_NODESfile_offsetlinux_binfmtpage_table_lock_sigfaultcountersactive_dischargeacpi_matchname_linkNR_ANON_THPScmaxrsstimer_slack_nsbus_typerstat_css_listpolicysharedTHP_SCAN_EXCEED_SWAP_PTEwait_queue_entrydismissd_real_typelookaheadarizona_enable_freerun_sysclk_bandwm8997_suppliesnum_core_suppliesseq_starttask_cputimepnpidraw_lockd_dnamearizona_wait_for_bootac_schedid_entryspk_mutemax_hang_timecpus_mask_pad_b_dirtysubdirstask_groupinitializedstarttimeWM5110mmap_missquota_format_opsclass_rwsem_write_is_conditionalregulator_bulk_disablemin_sliceargs__poll_tfwnode_operationsusleep_rangeshow_devnamepm_runtime_resume_and_getrun_delaytailsvmstatslinenobi_io_vecbase_pfnstatgpiod_flagsget_inode_acl_addr_pkeymigrate_foliocustom_sliceNR_ACTIVE_ANONNUMA_LOCALspanned_pagesthread_keyringeffectivekparam_arrayutimestart_codedevm_clk_getis_hardfsbasecompatibleblk_status_tac_uidclock_listmicd_timeoutattrsnuma_stat_itempercpu_drift_markcpumask_tgid_mapwm8998_patchswregs_statedqb_isoftlimitdma_iommuorig_axn_subdevsbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEcs47l24_devsnr_cached_objectsia_mtimeregcache_cache_onlywm5102_devstrc_ipi_to_cpudirty_exceedednodeinfomxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldis_seentotalreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetrstat_cputime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclmicd_rangesktime_add_uswrite_newwb_listswap_filelist_lockpm_domaininstrument_atomic_read_writecpu_bitmapconsumerucount_maxstatic_call_keyutil_estucountsqc_stateKCOMPACTD_MIGRATE_SCANNEDpageset_high_minsoftirq_next_timerpresent_early_pagescheck_flagsswp_entry_tbi_inline_vecsmemcg_csssystem_critical_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventLRU_ACTIVE_FILENR_MLOCKset_performance_statephys_addr_tclass_preempt_is_conditionalraw_atomic_try_cmpxchgplatform_dma_maskconsumers_cntmodule_memorypi_entryimplicit_on_dflk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreserveCGROUP_UDP4_SENDMSGquota_infoload_sumvfsgid_tinit_datacoublockioacac_exe_inodenr_to_scanthreaded_csetsDEVICE_PANEL_UNKNOWNfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treedentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalper_cpu_zonestatsDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkBALLOON_MIGRATEpushmm_walkDEV_DMA_COHERENTNR_ZONE_LRU_BASElinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workuV_offsethiwater_rsskretprobe_instancesstart_all_reasonwb_bytesrangeCGROUP_UNIX_GETSOCKNAME__ptrcgroup_base_statfutex_exit_mutexCGROUP_UNIX_RECVMSGjd_gpio5_nopull__MTHP_STAT_COUNTmicd_force_micbiaswb_stat_itemcompact_blockskip_flushtrc_blkd_nodeclk32k_srcwriteback_inodesd_spaceWB_REASON_PERIODICgraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameread_s64bi_iopriou_flagserr_fllnvcswac_tgetimewatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingdevm_gpiod_getUCOUNT_RLIMIT_MEMLOCKi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typeNUMA_FOREIGNhighi_rdevlist_lru_nodeCGROUP_INET4_GETSOCKNAMEself_exec_idkernfs_opsfile_lockMTHP_STAT_NR_ANONMODULE_STATE_LIVEstopnr_migrationsa_opsxa_flagsNR_STATSfreezebin_sizeNR_ZONE_WRITE_PENDINGcloseGPIOD_INdev_dma_attrgrphiPSI_CPU_FULLmfd_add_devicescftyped_spc_timerjump_entriesctl_dirasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNset_policyarizona_overclocked_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorbvec_integrity_poolassoc_arraytype_namemnt_idmapdq_dqbmm_statesaved_tfElf64_XwordCGROUP_INET_SOCK_CREATEold_timespec32lock_class_keymemory_events_localnum_symsmodule_notes_attrsvm_lock_seqgenerationPIDTYPE_MAXroot_listnlinkcpu_countdefault_setavg_totalpercpu_refns_commonhorizontal_positionrlimit_maxarizona_ldo1_pdatapref_node_forkwait_queue__int128reclaimeddqi_privrss_statmems_allowed_seqmicd_rateTHP_UNDERUSED_SPLIT_PAGErefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxac_niceDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrploPGALLOC_DEVICEclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightCGROUP_GETSOCKOPTvm_fileidr_basekswapd_orderNR_PSI_AGGREGATORSUNEVICTABLE_PGCULLEDuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDraw_atomic_readclass_raw_spinlock_nested_is_conditionalUCOUNT_INOTIFY_INSTANCESworker_privateis_relassoc_array_ptrTHP_SPLIT_PAGEqstrWORKINGSET_REFAULT_FILEma_flagsarizona_suspendfutex_statePGSTEAL_KHUGEPAGEDorig_pmdacct_timexpds_op__rcu_icq_cachesizeZONE_DMA32CS47L24em_perf_tablewakeup_sourcef_posNR_FILE_DIRTYNR_RUNNINGnext_posix_timer_id__kernel_long_twb_switch_rwsemtask_fragsrcu_gp_mutexMEMCG_OOMdatalennr_wakeups_affine_attemptsNR_LRU_BASEPSI_CPUalt_lenu32_datacinblockextableexitcompact_consideredkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_countac_utimescaled__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexbpf_prog_arraycore_stateMTHP_STAT_SHMEM_FALLBACK_CHARGEtimerqueue_headserial_nrdac_comp_coeffdeferred_split_queuefutex_pi_statekstat__kernel_uid32_tsubsys_maskDEVICE_FIXEDpte_tPGSTEAL_ANONregulator_bulk_enabledevice_driverdying_tasksdl_server_has_tasks_frunnable_sumreal_credCOMPACTISOLATEDget_namefwnode_endpointcancel_forkepoll_watchesWM8997WM8998non_rcuPGALLOC_NORMALWORKINGSET_ACTIVATE_BASEkcompactd_waitUCOUNT_RLIMIT_COUNTSdqb_curspace_entrygp_statebitsetload_avgaccesscstimecfs_rqbi_bdev_uidst_spacelast_busyfull_clustersmm_cid_next_scanns_typedfl_cgrpof_regac_majfltposix_cputimers_work_upperwpcopy_delay_totalmodule_param_attrsshort unsigned intCGROUP_LSM_ENDwatermark_boostunitcpu_scaled_run_real_totali_mutex_dir_keyq_nodespc_warnlimitcluster_next_cpuarizona_runtime_suspendNR_WRITTENctl_table_sizes_encodingwm5102_apply_hardware_patchgpl_crcsorc_entrykeysarizona_micbiasperiod_timerorig_ptedqb_curinodesnbp_thresholdload__s8pids_cgrp_idcss_allocZSWPINinvalidate_lock_keyUCOUNT_NET_NAMESPACESdma_maskprealloc_mutex__already_donenode_stat_itemobjcg_listsrcu_gp_seq_neededu16_datadq_dqb_lock__kernel_ulong_tlruvec_stats_percpuregmapPSWPOUTenable_timedl_period_dev_warnsym___kernel_vsyscalli_fsnotify_markswakeup_patharizonadio_mem_alignARIZONA_NUM_MCLKNR_THROTTLED_WRITTENbtimeextra2__u8is_roxlockCGROUP_SYSCTLcompact_cached_migrate_pfnrlim_maxDEVICE_PANEL_FRONTPGALLOC_DMA32runtime_deferred_listd_waitlocal_fwnodelist_lru_onerlimit_typezswap_writebackdevice_physical_location_horizontal_positionpercpu_ref_func_tseekswm5110_sleep_patchseq_stopkf_rootswnodekiocbKSWAPD_HIGH_WMARK_HIT_QUICKLYbv_offsetclass_rwsem_read_intr_is_conditionalcompact_order_failedfsuidUCOUNT_UTS_NAMESPACESctl_table_argcompact_init_migrate_pfns_blocksize_bitsnuma_scan_periodmanaged_pagesmigration_disablediter_typepositionclass_device_is_conditionalshrinker_idbio_setrootprojid_mapoom_reaper_listnr_reserved_highatomicvalid_ops_maskshutdown_presym_VDSO32_NOTE_MASKbpf_storagenotifierno_callbacks__u16timers_activewait_countvirqNR_SHMEM_THPSsig_okdelaysirq_safereadaheadNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBwork_listNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingMEMCG_DATA_KMEMextentfsindexshstksrcu_sspwake_irqcan_attach__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32PGINODESTEALptracedtrc_reader_specialdevice_get_match_dataNUMA_HITHPROBE_GONEHRTIMER_SOFTIRQMTHP_STAT_SWPOUTactive_timeTHP_SPLIT_PAGE_FAILEDthrashing_delay_totali_sequencepool_datapage_memcg_data_flagsMTHP_STAT_ANON_FAULT_FALLBACK_CHARGEpgdatkeyring_semdisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfTHP_ZERO_PAGE_ALLOC_FAILEDi_dir_seqirqreturnkqiddefer_syncPSI_CPU_SOMEKOBJ_NS_TYPE_NONE_watermarkclk_disableswap_activatemkobjcore_cookiesrcu_supd_deleteb_more_ioPRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typenum_resourcesnotifier_fn_tmf_statsf_iocb_flagshpdet_acc_idpoweroffcmaj_fltvtimewm5102_core_suppliesmath_emu_infoNR_MEMSTALL_RUNNINGiowait_sumALLOCSTALL_NORMALf_pathpidlist_mutex__u64journal_infoFORTIFY_FUNC_memmoveHTLB_BUDDY_PGALLOCsched_contributes_to_loadstatic_key_trueb_ioweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimevalid_modes_maskdeadlinemempool_spinned_vmnode_start_pfnTHP_ZERO_PAGE_ALLOCNET_TX_SOFTIRQ_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimevm_starts_flagsfaultshow_statsdl_densityfreeptr_tread_dqblkac_giddq_flagspm_runtime_set_autosuspend_delayarizona_connect_dcvddDD_CLASS_TYPE_DISJOINT_NAMESp_sizememcg_datatracepoint_extkprobes_text_startrunnable_avgZSWPWBs_time_grancgroup_freezer_statekernel_cap_twait_listrequest_pendingdworkhrtimerMEMORY_DEVICE_COHERENTNR_PSI_STATESperf_event_ctxp__TASKSTATS_CMD_MAXi_dio_counts_bdiposix_cputimer_baseavgs_worknum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listarizona_dev_exitFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionmax_descendantswb_lcand_idserialclass_releasealloc_locks_dquotarch_atomic_try_cmpxchgfolioqfoliosthreadedUCOUNT_TIME_NAMESPACESmemcg_memory_eventNR_MEMSTALLWM8280prev_posNR_ISOLATED_FILEdelayedseqcount_spinlockexpire_countuid_maps_umountis_bin_visiblepgoffsyscall_user_dispatchumount_beginnr_disk_swapinsrcu_tasks_exit_listarchdataia_uidPSI_IO_FULLchildrenrb_subtree_lastno_pm_callbacksbuild_idPGMIGRATE_FAILpoweroff_latevfork_donenanosleeppud_tplatform_deviceWM5102rt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcWB_REASON_LAPTOP_TIMERbi_issuequota_format_typeid_autoignoredpointervmstats_percputask_structanon_costdma_configuresrcu_n_exp_nodelaysuspend_timerquotalenPSI_AVGStotalreserve_pagesf_pipei_wb_frn_historylast_wakeenextmin_slab_pagesio_tlb_memarch_spinlock_tnr_tasksi_mtime_nsecperformancemmlistset_dqblksuppress_bind_attrsRPM_RESUMINGreg_offsetgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesNR_ZONE_INACTIVE_FILEwrite_s64f_llistIRQ_NONEhigh_maxphandleread_u64i_nlinkwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalnet_cls_cgrp_idsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_treclaim_waitfbatchALLOCSTALL_MOVABLEnr_writeback_throttled_dev_errshareFORTIFY_FUNC_strscpypagefault_disabledstate_startsyscwnr_memcgsil_prevget_name_prefixMEMCG_NR_MEMORY_EVENTScgroup_bpf_attach_typewlockedNR_VM_EVENT_ITEMSfreeze_superarizona_pdataPTR_ERRs_inode_list_lockUCOUNT_RLIMIT_MSGQUEUECGROUP_INET_SOCK_RELEASEsweventfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICoffline_nodequota_enablesched_avgntabzonedevice_typePGROTATEDmaj_fltarch_rwlock_ttree_scannedclock_basefrag_cluster_nrSLABS_SCANNEDcdevmy_qgroup_leadermkdirzoneliste_csetsreal_blockedarg_locknum_exentriespid_ns_for_childrens_writerslaptop_mode_wb_timerlower_firstint32_tio_pagesoffset_ctxd_childrennr_failed_migrations_runningcompact_delay_totalclassesnext_timerclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyNR_FREE_CMA_PAGESqrwlocksplit_queueSWAP_RAfile_ra_statemax_depthuser_structon_rq__p_size_fieldusersfs_contextswap_extent_rootmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfbypasswm5110_apply_sleep_patchllseekregulator_set_voltageDEVICE_HORI_POS_CENTERDL_DEV_PROBINGout_monolast_old_flushnext_offsetcommit_dqblknamespacei_ino_warnlimitdirtied_stampwritable_sizercu_nodeinit_name__UNIQUE_ID___addressable_arizona_pm_ops636unfreeze_fsintervalclasslast_mm_cidcookiebd_stamptargethigh_mina_flagstrace_overrunwriteback_sync_modesswap_cluster_infosession_keyringcpusfop_flagsSYSCTL_TABLE_TYPE_DEFAULTkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuUNEVICTABLE_PGSTRANDEDDEV_PROP_STRINGilenmnt_flagsCGROUP_BPF_ATTACH_TYPE_INVALIDmemory_peakscred_guard_mutexsigcntfiltershrtimer_cpu_baseresourcescb_headcheck_quota_fileFORTIFY_FUNC_memchrPGDEMOTE_DIRECTattributeclass_raw_spinlock_is_conditionaldev_archdatamclki_devicesktime_get_mono_fast_nskey_perm_tcss_rstat_flushbio_integrity_payloadrescue_listswappinesspi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsrescue_lock__compiletime_assert_489list_lruusing_gplonly_symbolstarget_knsival_ptrthreaded_csets_nodelast_subtree_bstatrobust_listsym___kernel_rt_sigreturnsplit_queue_locksym_pvclock_pageserial_nodelen_descs_incoredqs__UNIQUE_ID___addressable_arizona_dev_exit639d_iputcompat_ioctllockdep_mapfiltercurr_ret_stackirqreturn_tdockcgroup_fileforwarddev_links_infoloff_tthread_pidsrcu_gp_seq__pm_runtime_use_autosuspendmicd_pol_gpiofreezer_cgrp_idCOMPACTSUCCESSPSI_MEM_FULLcgroup_rstat_cpu_archst_valueclass_write_lock_irq_is_conditionalWB_WRITEBACKKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodemm_statsof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typePROBE_PREFER_ASYNCHRONOUSicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secenable_irqWB_WRITTENmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpaddingmax_prop_frac__fillersaved_sigmaskd_timelru_listentriescpu_iddevm_regulator_bulk_getPGMAJFAULTfop_flags_tPGSCAN_SKIP_DEVICE__MAX_NR_ZONESFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_lockgpiod_set_raw_value_cansleepsched_delayedbd_statsbi_sizemodule_state_dev_info__write_overflow_fieldlast_used_atmemcg_vmstats__mutex_initALLOCSTALL_DMAvm_endregulatorlast_queuednuma_migrate_retryuser_ns__statePSWPINfirstmigrate_to_ramwb_domainwait_pidfdptrace_bpss_umount_keymax_ratiovm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsNUMA_HINT_FAULTS_LOCALramp_delayia_ctimeproc_handlerFAULT_FLAG_INSTRUCTIONmigrate_from_cpuPSI_IO_SOMEasync_in_progressavgs_locksrcu_barrier_mutexi_private_dataUCOUNT_COUNTSElf64_Halfuse_autosuspendcompact_countFORTIFY_FUNC_memcpynsproxycan_wakeupTIMER_SOFTIRQxol_areaPGPROMOTE_SUCCESSerr_dcvddrlockfl_owner_tjd_invertcgroup_subsys_idMEMCG_DATA_OBJEXTScls_mskeuidwaitbug_tableis_inlinedirtied_time_whensequential_io_avgmicd_detect_debounceoom_groupnum_trace_bprintk_fmtcpu_run_real_totalTHP_SCAN_EXCEED_NONE_PTEvm_policypsi_aggregatorsWM1814perf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVE__state_sizethread_structcached_requested_keyenvp_indexrstat_css_nodeUCOUNT_FANOTIFY_GROUPSper_cpu_pagesctimeCPUTIME_IOWAITreleasemax_segment_sizewm5110_patchnr_pagessched_dl_entity__kernel_dev_tatomic_write_lenpdata_sizedqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_idPGALLOC_MOVABLENR_ZSPAGESs_dentry_lrubp_offsetnet_nsfolio_queuelast_task_numa_placementnr_descendantsCPUTIME_FORCEIDLEpgtable_tblock_startcgtimeWB_REASON_VMSCANsymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcusocket_pressureki_waitqnotify_timertrace_eval_mapdonePGSCAN_ZONE_RECLAIM_FAILEDfscrypt_operationsrelease_workWB_REASON_FS_FREE_SPACEksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexac_btime64mg_dst_preload_noderatelimitfree_folioMIGRATE_SYNCatomic_add_unlessexport_operationsPIDTYPE_PGIDrm_xquotaPSI_MEM_SOMEswapin_countdl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERcs47l24_suppliespropertiesFAULT_FLAG_ORIG_PTE_VALIDCPUTIME_GUESTsysv_semanon_vma_namefileattrwatermarkdeadpropsavg_nr_triggersfprop_globallong long unsigned intanon_nameblkcg_gqia_filesival_intcpu_usage_statnuma_preferred_nid_hugetlb_cgroupcore_suppliesdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatemm_listcss_idri_linkmicd_software_comparelistxattr_lowertrap_nrbinfmt_miscasync_probe_requestedcompat_long_tac_etimeapply_uVactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupsirq_chippmd_tmnt_namespacePSI_MEMnode_spanned_pagesd_sbsysv_shmdq_countctrlif_errorearly_devsutf8data_tableset_latency_tolerancehugetlb_cgrp_idwarnresource_size_tfoliowake_entryTHP_SPLIT_PMDxa_headsuidof_compatiblecluster_infoi_readcounttimeout_msUCOUNT_USER_NAMESPACESlocked_vmpm_runtime_disablerb_leftmg_src_cgrpseq_nextclk_enableUCOUNT_INOTIFY_WATCHESerr_refsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tmisc_cgrp_idcpuacct_cgrp_idclass_rcu_is_conditionalbpf_local_storageactionclockid_tboot_onquota_syncover_voltage_detectiondq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countmemcg_completionsGPIOD_ASISksm_merging_pagesfree_listNR_SOFTIRQSarizona_runtime_resumeautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_tbv_pagedomain_flagsnotify_nexte_cset_nodebus_dma_limitshort intmynodemicd_dbtimenr_free_highatomic__compiletime_assert_635pdata__compiletime_assert_637of_device_idarizona_micd_rangewb_waitqNR_VM_ZONE_STAT_ITEMSclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitover_current_detectionread_iterwritablef_ownerbp_regPGDEMOTE_KSWAPDVTIME_USERsa_flagstestarizona_resumeregulator_stateFORTIFY_FUNC_memchr_invcss_offlinepad_untilDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2destroy_rworklast_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datanr_extentsnr_scannedpoll_table_structfifodirect_IOmax_spreadwait_queue_entry_tCMA_ALLOC_FAILpcpucurrent_may_mountseqlock_tbd_queuenuma_scan_offsetcgroup_subsys_stateMTHP_STAT_ANON_FAULT_ALLOCCGROUP_INET4_POST_BINDarizona_pm_opsvertical_positionkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskMEMCG_SWAP_MAXfreezerNR_INACTIVE_FILE__ret_warn_onPSI_NONIDLELRU_INACTIVE_ANONregfuncindex_keymemalloc_noiohpdet_id_gpioGRPQUOTArwsemi_private_listia_validSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcluster_nrvirtmemFORTIFY_FUNC_strncati_rcui_atime_secmutex_lockqc_type_stateCGROUP_INET6_POST_BINDkey_serial_tdev_ueventsetupf_lockUNEVICTABLE_PGSCANNEDwm8997_devsactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsgetattrFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listCGROUP_UNIX_SENDMSGxarray_start__flagsp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidCGROUP_SOCK_OPSNR_UNACCEPTEDattribute_groupcontextposix_timersTHP_COLLAPSE_ALLOCper_cpu_nodestatselectorMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nskcsan_check_accesssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_tctl_table_rootARIZONA_MCLK1ARIZONA_MCLK2group_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizesettling_time_downdfl_cftypeshpdet_clampdeferred_splitmce_kill_meuuid_tproperty_read_int_arraystate_standbyKSWAPD_INODESTEALcount_objectsctl_table_setq_size_stimezone_device_datakcompactd_max_orderpeaks_lockf_wb_erruseddefparamsaved_errfred_csfault_flagkprojid_tptracer_credtlb_gencgwb_domainpage_mkwritekobjectaudit_ttyirq_flagsrtpoll_triggersmce_ripvstatfsctl_table_headerdma_skip_syncpm_runtime_put_noidleDROP_PAGECACHEnumab_stateremovabledev_get_platdatafeatureson_listinput_uVkgid_ton_cpuFAULT_FLAG_VMA_LOCKdev_set_drvdataNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cbliststoragesTHP_SPLIT_PUDclass_groupspsi_groupnuma_nodePGSCAN_FILEWB_RECLAIMABLEi_mmap_rwsemUCOUNT_RLIMIT_NPROCDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchangedbdi_listwatch_list__fortify_sizeaudit_contextpp_ref_countsysfs_opsregulator_bulk_datasequential_iotime_namespaceregmap_update_bitsCGROUP_INET4_BIND_large_mapcountsda_is_staticformatftopenclavereclaim_workcmp1cmp2bi_privateALLOCSTALL_DMA32PGLAZYFREEsp_regcreateiattrMTHP_STAT_SHMEM_FALLBACKrseqnfdssigvalvma_lockperf_event_listarizona_typeregulator_getget_reserved_space__compiletime_assert_119stack_refcountinvalidate_lockbmapkey_payloadd_realancestorstot_write_bandwidthmax_channels_clockedPGSCAN_ZONE_RECLAIM_SUCCESSexpiry_active__compiletime_assert_120__compiletime_assert_121__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126dqi_max_spc_limit__compiletime_assert_128vm_numa_eventexception_table_entrynr_isolate_pageblockevent_countnr_to_writefallocatei_spc_warnlimitbuddy_listi_ino_timelimitnode_present_pages__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135__compiletime_assert_136mems_allowed__compiletime_assert_138MEMCG_SWAP_FAILtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderclk_lockMTHP_STAT_ZSWPOUTold_subtree_controltimewakee_flip_decay_tsmemcg_vmstats_percpus_max_linksnr_wakeups_syncNR_PSI_RESOURCESkallsymskcompactdprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tblocksset_infofileattr_getvectorGPIOD_OUT_LOWFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcat__bi_cntCGROUP_UDP6_SENDMSGtimer_listrefaulted_oldarizona_poll_reg_delaydevice_dma_supportedd_ino_warnsraw_atomic_fetch_add_unlesshiwater_vmtracepointTASKSTATS_CMD_NEWcompound_headia_vfsuidunaccepted_pageslrugen__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersino_timelimitsplice_writestate_in_sysfsTHP_FILE_ALLOCbd_nr_sectorsarizona_resume_noirq__UNIQUE_ID_ddebug632qf_nextWB_REASON_BACKGROUNDCGROUP_UDP4_RECVMSGrangescpuset_cgrp_idmemory_eventsiommu_mmcutimeem_tableNUMA_HUGE_PTE_UPDATESpersonalityget_stateNR_IOWAITtask_sizes_inodes_addrbinfmtirq_domainsigned charpersistent_keyring_registerprioprividle_notificationsched_infoMTHP_STAT_SHMEM_ALLOCd_fieldmaskuprobe_xol_opsseq_filefreeze_noirqNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledsettling_time_upfixupsfile_operationsno_pmbi_max_vecsgroup_stop_countdac_comp_lockavg_last_updatelowest_bit_killktime_tarizona_irq_initNUMA_PAGE_MIGRATEUCOUNT_MNT_NAMESPACESchildren_low_usageclk_prepare_enablesymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387iterd_ino_timeravx512_timestampfuncsend_dataarizona_request_irqpercpu_pvec_drainedsubtree_controlPGSTEAL_KSWAPDsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncrange_startper_cpu_nodestatsnr_charged_bytessetleasepinscs47l24_patchpacct_structmust_resumescannedlong intpresent_pagesfile_lock_contextusagel_yesPGALLOC_DMAsiglockper_cpu_pagesetstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ss__dynamic_dev_dbgproperty_presentapply_patch__write_overflowUSRQUOTApm_runtime_use_autosuspendprintk_index_sizesymtabtimes_previnit_load_uArt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegidiomapdq_hashput_superfwnode_reference_argsnext_addrpushable_dl_tasksf_flags__newf_inodeprocnameCPUTIME_IDLEmark_dirtyprotnr_dying_descendantsnum_srcu_structsbdi_writeback_pad1_kobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEmicd_configsbalanced_dirty_ratelimit__kernel_timespec_pad2_cancelled_write_bytesac_tgidsrcu_usagebitmapacpi_match_tableCGROUP_INET4_GETPEERNAMEmemcgbw_time_stamp_sigvalmax_perf_statebvecnameidatalatency_recordmod_kallsymsmnt_idrefaultshas_fully_powered_offdepth_pad3_wait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldlistsssize_tsr_lockiopl_emulwork_structdesc_lenMTHP_STAT_SPLIT_DEFERREDflocktask_io_accountingmremaphprobe__fortify_panicarizona_poll_regtracepoint_funcargventryfree_cached_objectsworkqueue_structreversepi_locklru_gen_mm_state___orig_eipprobestubget_timedapmmm_cid_activeelemsizedirty_paused_whenarizona_suspend_noirqblkcg_cssmaxlenNR_ZONE_UNEVICTABLErelease_agent_pathclass_spinlock_irq_try_is_conditionaloom_mmsystem_loadFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavortv_nseci_lruFORTIFY_FUNC_strcpyzone_idxdom_cgrpNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvolusecNR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tmg_tasksuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infortpoll_trigger_locksrcu_structrlim_curnofaultarizona_clk32k_disablemm_countcputime_atomicdrv_groupsstackoffline_waitqmnt_nsac_ppidfunctionwb_idki_flagsbvec_poolbd_start_sectsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timecgroup_rootdatastrtabtty_old_pgrpold_dom_cgrpdl_throttledmfd_remove_devicesi_rwsemrtpoll_statesget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1CPUTIME_IRQ__int128 unsignedpcountTHP_FAULT_FALLBACKregmap_multi_reg_write_bypassedrestore_noirqki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaTASKSTATS_CMD_UNSPECUCOUNT_FANOTIFY_MARKSruntime_autoPROBE_DEFAULT_STRATEGYrlimread_foliosplit_queue_lennr_eventsWB_REASON_SYNCmicbiasiommubi_opfBLOCK_SOFTIRQprivatehlistcftsTASKSTATS_CMD_GETst_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxswap_plugCGROUP_UNIX_CONNECTMEMCG_MAXsplice_pipes_lock_keymg_nodepdev_archdatakswapdsrcu_gp_startopentime_nsit_real_incrwaitqmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmem_cgroup_idmodstqheads_activesym_vvar_startMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionaldeadremap_file_rangeac_commnr_hangskcompactd_highest_zoneidxgid_twake_cpuchainedio_uring_taskparent_suppliestask_worksmemory_failurerb_root_cacheds_copPGSTEAL_DIRECTset_ownershipMEMCG_LOWdd_key_truezone_stat_itemhres_activejd_activebpf_raw_eventsswap_mapdq_dirtydl_deferbug_listdirect_completenbp_rl_startidr_rtlegacy_namexa_lockfxregs_statememcg_cgwb_frnload_weightdiscard_clusterskuid_tarch_datafpstateshrinker_infoblock_maxmthp_stat_itemrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateuts_nsMTHP_STAT_SWPINis_late_suspendedsysvsemTHP_FAULT_ALLOCucountvm_stat_diffCGROUP_SETSOCKOPTkmemcg_idignore_childrenlru_gen_mm_walkresource_pflagsrestore_earlyhap_actclock_mutexfs_supersdom_csetevents_local_fileroot_csetarizona_enable_resetdqb_bsoftlimitpendingf_task_worklru_gen_memcgiowait_countRCU_SOFTIRQPGFAULTnotifier_blockmemswdma_io_tlb_memrtpoll_scheduledstringread_countstoreforklruvecfutex_offsetvmpressurelong long intbdevatomic_flagssysvshmHI_SOFTIRQbw_dworktimer_expirestrace_evalsactive_baseshierarchy_idearly_init__pm_runtime_idlemprotectac_exitcodesecurityxmm_spacememory_cgrp_idactivatef_pos_locksuspend_noirqPGSTEAL_FILEi_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structarizona_free_irqconsumer_suppliesi_bytesdepends_ondomain_dataidr_nextrelax_countline_entry_ptrlinkstart_timekernfs_nodercu_workPSI_IRQ_FULLRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEfront_paddup_xol_addrrevmapZSWPOUTcapture_controlnr_wakeupspost_attachstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statebd_deviceirq_domain_add_linearsubsys_fmt_prefixmm_mtacquire_dquotis_vallocparameterscss_resetNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsNUMA_INTERLEAVE_HITneed_qscompact_defer_shiftswap_deactivatedomain_suffixblkcnt_tnum_micd_configsicq_treesi_codethread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batchrstat_flush_nextzeromapmap_pagesreschedule_countvfsmountcss_onlineextable_basenoinstr_text_sizenargsirq_domain_removeattributesMTHP_STAT_SWPOUT_FALLBACKTASKLET_SOFTIRQ__UNIQUE_ID_ddebug621set_child_tidNUMA_HINT_FAULTS_overruntmpfilemicd_bias_start_timercu_read_lock_nestingem_perf_statemin_nrtick_dep_maskgpio_desclistthrottle_disksi_errnobsynce_freezememcg_lrus_inode_lrumemcg_nodesrcu_size_stateblk_pluguid_gid_mapPGSCAN_SKIP_DMA32irq_set_chip_and_handler_nameunpinned_netfs_wbof_noderefsmmap_compat_baseWB_SYNC_NONEtrace_eventsenv_startcgrp_ancestor_storagedma_addrcnivcswirq_nmi_setupd_flagsxattr_handlerfreeze_lated_inodehprobe_statemask_unmask_non_invertedUTASK_SSTEPpkrureal_parentlockedcgroup_tasksetVTIME_GUESTrtpoll_next_updateregsslice_maxlast_switch_countqsize_tregmap_irq_typeblkio_delay_totaltime_ns_for_childrenIRQD_IRQ_ENABLED_ON_SUSPENDfilesdqb_bhardlimitlivevm_faultatomic_write_unit_maxs_staterun_listixolSCHED_SOFTIRQbd_mappingsym_vvar_pageirq_modify_statusmodule_sect_attrsmg_src_preload_nodereturn_instancesoftirq_activatedfree_clustersnum_irqsclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intCGROUP_INET6_GETSOCKNAMEnotifier_callrtpoll_taskgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqbi_crypt_contextia_vfsgidcgroup_bpfzone_typesize_tacpi_device_id__UNIQUE_ID___addressable_arizona_free_irq619cap_permittedTT_NATIVEzone_pgdataffinity_hintclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesu64_stats_syncrcu_tasks_idxsync_modercu_tasks_holdouttarget_listtype_level_low_valavg_write_bandwidthb_attachedpasid_activatedpi_sezonerefget_offset_ctxcore_forceidle_sumnum_main_regsCPUTIME_NICEfreeze_ucounti_ctime_nseccpuhp_deads_remove_countsyscall_workcompletionsdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalstatus_invertcallback_headmemory_failure_statss_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkirq_shutdownfmode_tdevtmsi_parent_opsPSI_IOrestoredelayed_callbi_itermax_nr_cidIRQD_IRQ_INPROGRESS_statusd_sibkernel_ulong_tIRQD_FORWARDED_TO_VCPUdma_opsTHP_COLLAPSE_ALLOC_FAILEDbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedbvec_iterdl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countPGPGOUTreturn_consumerrelease_dqblkin_thrashinguaddr2css_extra_stat_show__kernel_timer_tclass_srcu_is_conditionalcss_releasedDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskavail_listsatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectsIRQ_NESTED_THREADpid_typewb_errstatus_use_accessorscputimertrace_recursionsnd_soc_dapm_contextbv_lendiscard_workstart_dataposix_cputimerskrefprocs_filejit_keyringsrcu_unlock_countfile_dispblkcg_noderegmap_writercu_specialclear_child_tidf_refextable_lenper_cpu_zonestatbacking_dev_infoNET_RX_SOFTIRQsaved_scratch_registerdev_pagemap_opsIRQ_TYPE_DEFAULTdata_vm__s32entry_eiptaskstatshugetlb_usagearizona_map_irqtree_reclaimedratelimit_states_pinsattrextra2get_next_child_nodeFAULT_FLAG_WRITEirq_set_irqchip_statewrite_syscallsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDext_capdebug_dirfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollac_padgraph_get_next_endpointmemcg_iducount_typenr_wakeups_idlertpoll_waitio_cqprobeelf64_symlatch_tree_nodepercpu_ref_datadestroy_workDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSMAX_CGROUP_BPF_ATTACH_TYPEnum_main_status_bitssyscorewb_reason__s64LRU_ACTIVE_ANONdqi_bgrace__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_panelpoweroff_latectl_tableuid_tflush_requiredIRQD_SETAFFINITY_PENDINGsum_block_runtimepgmapmin_perf_statedq_opnum_micd_rangesrcu_tasks_nvcswwriteNR_WB_STAT_ITEMStypetabclk32k_refirq_release_resourcesclass_read_lock_irqsave_is_conditionalcan_forkfor_backgrounddma_poolsgpio_to_irq_addr_lsbctl_table_pollarizona_ctrlif_erri_generation_sigpollmxcsrrange_cyclicd_rt_spc_hardlimiteminbi_end_ioblk_holder_opsfreepages_delay_totalNR_ZONE_ACTIVE_FILEnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affineupdated_childrenpteval_ti_inocgwb_listdyndbg_infocompact_cached_free_pfnindexirq_affinity_descdriver_datathread_headac_exe_devirq_create_mappingdev_pm_qosbi_sectormap_typeNR_PSI_TASK_COUNTSperiod_timef_opPGPGINpids_active_resetconfirm_switch__pm_runtime_suspendseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizeperf_event_cgrp_iddq_sbNR_FILE_THPSarch_static_branchcgroupsighand_structflagsi_lock_keykmem_cacheCPUTIME_STEALKCOMPACTD_FREE_SCANNEDinodedrivers_dirback_padNR_ZONE_ACTIVE_ANONbug_entryraw_atomic_add_unlessgc_flagscancel_attachwaiterscmin_fltWM1831rw_semDEV_DMA_COHERENTprev_sum_exec_runtimeinmodenestedpm_devnr_forced_migrationsac_pidseq_operationsnum_argsri_timerstack_canaryinactiveblksizesiblingmnt_rootnext_scanunregisteringf_raquota_writesrcu_barrier_cpu_cntNR_LRU_LISTSiopl_warnrmdirsockbi_write_hinthash_lenget_policyshrinker_info_unitnr_reclaim_startTHP_FILE_FALLBACK__bi_nr_segmentstask_iterssym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecss_freecpu_basedevice_is_availabledquotdl_runtimechildren_min_usagenumbersswapin_delay_totalbi_vcnt_softexpiresPSI_POLLkey_user_hugetlb_cgroup_rsvdhandle_mask_syncfaultableio_comp_batchshutdowndq_lockzswap_maxi_cdevldt_structenv_endobj_cgrouprescue_workqueueprogsextra1ptrace_messageNUMA_OTHERnum_trace_events_sys_privatemicd_configsmin_usageinit_fs_contexts_subtypeheaderfuncperf_event_contextno_cgroup_ownernbp_th_nr_candcputimetlbflush_unmap_batchtype_in_masksoftfreepages_count__sifieldsIRQ_NOAUTOENirqs_per_chiprcu_read_unlock_specialread_bytesfsverity_operationswm8998_aodwake_q_noderequest_key_authirq_bus_sync_unlockvirtual_dr6attachTHP_DEFERRED_SPLIT_PAGEkprobes_text_sizestatic_call_sitesTHP_FILE_FALLBACK_CHARGEthread_group_cputimernuma_scan_period_maxirq_hw_number_tstart_stackTHP_SWPOUT_FALLBACKwatchersKSM_SWPIN_COPYrange_endcompletionrtpoll_nr_triggerssw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsgpswbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodebpf_cgrp_storagecurr_nrcorememsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataWORKINGSET_REFAULT_ANONirq_flow_handler_tIRQD_IRQ_STARTEDirqstatget_dquotsnextentsnum_orcscma_pagesclass_task_lock_is_conditionalUCOUNT_RLIMIT_SIGPENDINGFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structNR_ACTIVE_FILEjd_gpio5bin_attrs_newhwirq_maxbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statedevm_gpio_request_onesched_classmultiprocesspi_waitersPGSCAN_DIRECTexp_hintd_childrennregIRQCHIP_STATE_LINE_LEVELis_softbindcntsRPM_SUSPENDEDreclaim_stateMEMCG_SWAP_HIGHevictedvma_numab_staterethooksnum_symtabIRQD_MANAGED_SHUTDOWNPGSCAN_SKIP_MOVABLEwrite_inoded_fsdataRPM_SUSPENDINGcacheline_paddingCGROUP_SUBSYS_COUNTnrpages_refcounti_crypt_infopermissionsnr_frozen_descendantsbdi_nodeerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idxcgroup_namespaceZONE_DEVICE_head_1_head_2subsysbd_size_lockbackstate_add_uevent_sentOOM_KILLi_hashhlist_nodeio_uringregulator_init_datacore_occupationftrace_timestampwriterwait_page_queueirq_clear_status_flagssched_remote_wakeupresumeirq_disablewake_qfileattr_setCOMPACTFAILbio_listwrite_dquotclass_read_lock_irq_is_conditionalfolio_batchNUMA_MISSioctx_lockkveccurrent_stack_pointersect_attrsDOMAIN_BUS_WAKEUPmg_dst_cgrpsoft_startonlineruntime_resumedup_xol_workerr_aodKCOMPACTD_WAKEwrite_charlocal_watermarktdm_slotsconfig_baseMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignhpdet_channelDOMAIN_BUS_NEXUSdelay_worksuccesstot_countUCOUNT_CGROUP_NAMESPACESCGROUP_INET6_CONNECToublockinuse_pagesrecent_cidkf_opskernel_paramdeferred_resumed_spc_softlimitreported_split_lockmicvddgfp_tIRQ_LEVELseccomp_filterstimetrace_eval_map__pm_runtime_resumei_mmapirq_startupthaw_superd_lrusignal_structDOMAIN_BUS_VMD_MSIperf_event_mutexNR_PAGETABLEcrcsUNEVICTABLE_PGMLOCKEDpgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrsprotectedsas_ss_flagsf_modeerr_boot_doneki_completenonfull_clustersvtime_statewakee_flipsset_aclpids_activedriverZONE_NORMALi_opldt_usr_semHRTIMER_RESTARTwpcopy_countIRQ_TYPE_EDGE_BOTHkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEcredjump_entryswap_iocbfrag_clustersproactive_compact_triggersrcu_gp_seq_needed_expgpioaddress_space_operationsspinlock_t__task_fpstatemaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startdisablehuge_faultkstatfssites__lruveccluster_nextDEVICE_VERT_POS_UPPERmem_cgroup_reclaim_iterarizona_irq_exitevents_lockptraceatomic_write_segments_maxquota_disablekprobe_blacklistwork_lockcpus_ptrnotified_atpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsyskswapd_lockdirty_limit_tstampsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDMTHP_STAT_SHMEM_FALLBACK__NR_MEMCG_DATA_FLAGSCGROUP_INET_EGRESSexpiresrcuwaitnivcswhandle_irqpsi_resIRQ_NOTHREADMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_minregmap_reads_devcpus_allowed_lockget_next_idrwlock_tIRQ_NO_DEBUGpgprotbstatfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGID__UNIQUE_ID___addressable_arizona_request_irq618curr_ret_depthac_utime_dummy_pkeyarizona_irq_chipiommu_mm_datavm_event_itemmce_countswap_info_structblkcg_csssequencecpu_cgrp_idrt_spc_warnlimits_stack_depthac_flagblocking_notifier_headcoredump_datavm_stattasksmem_cgroup_per_node_pidaddress_spacemm_context_t__oldirq_reg_strideuid_gid_extent__call_single_nodestartupirq_mask_ackseqcount_spinlock_tbio_issuei_wbcss_local_stat_showuint8_tMEMCG_HIGHregmap_irq_chippanelclass_idinactive_timer_pkeyfilenames_export_opclear_on_unmaskwrite_u64PSI_IRQi_flctxstashedcond_suspend_depthvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqlowmem_reservepagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipebaseCGROUP_INET6_BINDforce_scanhostuaddrfailedcgrps_wb_errold_subtree_ss_maskshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descscontiguousrecoveredTHP_MIGRATION_SPLITexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoNR_FILE_PMDMAPPEDunusedalloc_inodeuser_event_mmd_inamedevres_headi_mappingIRQD_TRIGGER_MASKinblockrmidi_rt_spc_timelimitrseq_sigDIRECT_MAP_LEVEL2_SPLITLRU_INACTIVE_FILEhandlearizona_micd_configdev_pm_domainlimit0limit1nr_zonespages_skippedwm8997_irqmigrate_modeSWAP_RA_HITbio_poolfree_area__compiletime_assert_622kswapd_failureszswap_lruvec_stateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoWB_DIRTIEDlru_gen_mm_listi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeUCOUNT_IPC_NAMESPACESpushable_tasksack_invertplatform_datad_comparesighanditerate_sharedis_visiblesignalWB_REASON_FORKER_THREADreleasedthread_fndep_mapalloc_dquotirq_set_status_flagspm_messageregmap_del_irq_chipmay_splitmem_cgrouplast_update_timeirq_suspendrobust_list_headswap_peaks__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackstat_thresholdlevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventCOMPACTSTALLhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowunsigned charzone_start_pfnaffinity_notifyvdsomemtiermmap_legacy_basePAGEOUTRUNTHP_SCAN_EXCEED_SHARED_PTEpipe_inode_infononresident_ageuint16_tsecurebitspartition_meta_infostate_initializeduring_cmd_iopollbi_poolcompat_uptr_tuevent_opssub_reg_offsetsSWPIN_ZEROCGROUP_UDP6_RECVMSGslicesas_ss_spNR_ZONE_INACTIVE_ANONnr_dirtiednum_kprobe_blacklistNR_FREE_PAGESirq_domain_instantiatesubtree_ss_maskclass_local_lock_is_conditionalsuspend_latewakeupcg_listcgwb_release_mutexsrcu_barrier_completionwb_completionshrink_controlwritten_stampdriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapaod_irq_chipspan_seqlocksessionidarch_atomic_readlast_bdp_sleep_sifields_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_infopadding1llistof_node_to_fwnodeCPUTIME_SOFTIRQZONE_DMAdebugfs_entryelemnr_retriesIRQCHIP_STATE_PENDINGcgwb_frnavg_refaultedwm5110_aodPGSCAN_DIRECT_THROTTLEsigval_talimitundo_listdirty_folioirq_datamask_cachercharZONE_MOVABLEALLOCSTALL_DEVICEnr_populated_domain_childrenmissedkswapd_highest_zoneidxparent_could_setfcapquota_readst_shndxldo1freedevices_cgrp_idpageset_high_maxi_wb_frn_avg_timePGSCAN_KSWAPDbd_fsfreeze_countfile_ref_tCMA_ALLOC_SUCCESStypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wqDROP_SLAB_dummy_bndmin_unmapped_pagessas_ss_sizespk_fmtuser_xfeaturesnr_wakeups_passivefile_system_typewb_tcand_idmtimeserver_has_tasksswap_events_filerequest_threaded_irqoom_score_adj_minkobj_uevent_envfolioq_slotirq_data_get_irq_chip_datainv_weightdirty_inodesrcu_barrier_headac_memblk_opf_thigh_worknode_zonelistspathst_sizenr_frozen_taskslru_gen_foliormtpf_llistwait_sumnum_tracepointsupidexit_codemempool_ttype_falling_valexec_startclass_read_lock_is_conditionalconsumersrtpoll_min_periodkernfs_elem_symlinkclock_was_set_seqPGSCAN_KHUGEPAGEDDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerPGREUSEiommu_groupperiod_contribforceidle_sumrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncCOMPACTFREE_SCANNEDproc_dir_entryvm_opshighest_bitirq_get_irq_dataiopollarizona_irq_threadTHP_MIGRATION_FAILpagesizes_blocksizevm_pgofftimesauprobecan_swaprelease_agent_worknuma_workdevice_dma_supportedptrace_dr7priority_call_addrexpireloginuidcheckTHP_FILE_MAPPEDrtpoll_untilexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_donenbp_rl_nr_candCPUTIME_GUEST_NICE__lstateupdated_nextueventlock_countrefcount_tcset_linksplugchild_countio_cgrp_idsaved_auxvTHP_MIGRATION_SUCCESSmce_addrlast_bstatnum_bugsqf_ops__vm_flagsKOBJ_NS_TYPE_NETnum_config_regsmod_nametype_rising_valproperty_read_string_arraymm_cidmemory_tierunlocked_ioctlrseq_lenparamwake_depthpollfdnr_wakeups_remoteerr_domainllist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awarestate_use_accessorsclass_spinlock_irqsave_is_conditionalorig_objcgrseq_csdcvddnum_ftrace_callsitessoftirq_expires_nextHTLB_BUDDY_PGALLOC_FAILDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsname_suffixnode_zonesnbp_th_startelow_pincounttablesDEVICE_PANEL_BOTTOMmin_seqlist_headlru_lockWB_REASON_FOREIGN_FLUSHtgidbatchedfor_reclaimwrite_protect_seqtdm_widthcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holderend_codeblkio_countqspinlockirq_compose_msi_msglru_genNR_VMSCAN_WRITEinsnfilldir_tNUMA_PTE_UPDATESlow_usagedl_non_contendingdir_contextPGFREEtracepoint_ptr_tutaskfailcntNR_UNEVICTABLEsched_entityd_spc_hardlimitgpio_defaultslockdep_keypm_runtime_mark_last_busylong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baserescue_workio_contexthpdet_acc_id_linegpl_symsgroupseq_showctl_nodePGSCAN_SKIP_DMAswait_queue_headcow_pageinumac_btimeblockSWPOUT_ZEROi_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevicebi_integrityCPUTIME_USERs_shrinkhrtimer_restartUTASK_RUNNINGIRQ_NO_BALANCINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namekernfs_open_fileirq_find_mappingnoderesetfor_kupdateBALLOON_INFLATEvm_lockMTHP_STAT_NR_ANON_PARTIALLY_MAPPEDPGMIGRATE_SUCCESSwb_tcand_bytesno_cgroup_migrationMTHP_STAT_SPLIT_FAILEDnextevts_writers_key__countirq_cntxcomp_bvcma_areatype_reg_offsetWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatipc_namespaceexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimereg_writelstate_remove_uevent_sentread_charcgroup_nsia_sizein_hrtirqs_master_keysCGROUP_LSM_STARTac_stimescaledpropertywchar_addr_bndkernel_symboli_opflagssubsys_databi_statusnr_cgrpstv_secCPUTIME_SYSTEMwm8998_irqpid_ttask_listftrace_sleeptimeset_type_configrun_nodema_rooturing_cmdpsi_filesMEMCG_OOM_KILLnr_failed_migrations_affineIS_ERRNR_SWAPCACHEuser_cpus_ptrirq_delay_totalpi_top_taskunlinkNR_WRITEBACK_TEMPactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writebiasutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthmax_seqi_sizedl_deadline_hugetlb_hwpoisonpsi_group_cpuubufksm_rmap_itemspageset_batcharizona_micsupp_pdatapm_runtime_put_autosuspendnr_populated_csetsCGROUP_INET4_CONNECTmodulepcpu_cidPGACTIVATEngroupsfree_file_info__kernel_time64_tIRQ_TYPE_SENSE_MASKNR_VM_NUMA_EVENT_ITEMSautaskuser_namespacevfsuid_traw_spinlockdmic_refkswapd_waittimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flagsPGREFILLkeyring_name_listMTHP_STAT_ANON_FAULT_FALLBACKfile_costread_posstatic_call_trampTHP_SWPOUTbtrace_seq_pp_mapping_padsa_maskrequest_queueCGROUP_UNIX_GETPEERNAMEalloc_factorirq_descdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageMTHP_STAT_SPLITrdma_cgrp_idcodegtimenr_populated_threaded_childrensigactionwake_activedev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimeCOMPACTMIGRATE_SCANNEDsched_rt_mutexlocked_pendinghlist_nulls_nodenr_deferredfown_structfeatures_lockedlruvec_statstracing_graph_pauseavg_triggerspermcompat_robust_listbi_blkgIRQD_CAN_RESERVEunmapktypelockrefin_dpm_listIRQ_TYPE_LEVEL_MASKsrcu_struct_ptrsmm_structrtpoll_wakeupvlagIRQ_GC_MASK_CACHE_PER_TYPEi_uidparent_dataspinlocknr_dying_subsystimestampspid_namespace_syscallmod_arch_specificmax_write_lennum_static_call_sitesend_pfngpiod_to_irqvm_mmirq_domain_chip_genericdebugfs_idwb_lcand_bytesguest_permmem_dqinfotruei_countHRTIMER_NORESTARTWB_SYNC_ALLbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipcgwb_treeUNEVICTABLE_PGMUNLOCKEDufdsexe_filehlist_bl_nodeipc_nspcp_listpid_linksfree_counts_sysfs_namerefcountvaddrrequestpglist_datarw_hintIRQ_POLL_SOFTIRQtimeoutdma_configurelast_switch_timenum_classesorc_unwind_ippage_counterqc_dqblkfprop_local_percpuavg_next_updatewm5102_aodmmappedseqcount_raw_spinlockbd_holder_dirirq_pm_shutdowncpu_run_virtual_totalkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersproc_ns_operationsi_write_hintfxsaveprocess_keyringlist_op_pendingargv__stack_chk_failthrashing_countllist_headwait_startpercpu_clusterf_freeptrnr_freeclass_raw_spinlock_irqsave_try_is_conditionalmap_nr_maxget_dqblkshow_fdinfofixupirq_getIRQD_AFFINITY_ON_ACTIVATEuse_ackhashposix_acldd_key_falsehp_enabug_addr_dispdgc_infodqi_igracemax_slack_shiftclass_rwsem_write_try_is_conditionalthaw_noirqdac_comp_enabledpreempt_notifiersDOMAIN_BUS_TI_SCI_INTA_MSIsrcu_last_gp_endbdi_ids_fsnotify_infocpu_delay_totalDOMAIN_BUS_PCI_DEVICE_MSIXuser_keyring_registermempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyremovePGSCAN_ANONs_magicdl_overrunallocd_parentirq_drv_dataonline_cntpayloadac_minflti_sbmin_ratiomatchcommcompwake_invertcan_matchlast_timePIDTYPE_PIDeventsthreads_handled_lastthreads_oneshotirqsatomic_open_zonerefsbio_end_io_tstart_prevent_timeMEMCG_OOM_GROUP_KILLlru_zone_sizereadahead_controlrtpoll_timerdirty_limit__kernel_gid32_tcompact_init_free_pfnNR_BOUNCEstate_maskf_credMODULE_STATE_COMINGnotify_countmg_dst_csetoffline_disabled__empty_rangesbd_devselecthost_dataread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnamereg_baseasync_put_workmknodpsi_statesirq_gc_flagsfsnotify_sb_info__sigrestore_tbi_idx__kernel_loff_tdetachget_unmapped_areaTHP_FAULT_FALLBACK_CHARGEdev_pagemapPGDEACTIVATEerr_map_aodwritepagessched_statisticsheadgpio_base__state_permpsi_task_countuprobe_taskdevice_get_dma_attrselfwriteback_controluclampirq_gpiosuper_operationsdomain_flagsbi_cookiesplice_eofDIRECT_MAP_LEVEL3_SPLITnr_threaded_childrenCGROUP_INET_INGRESSutil_avgtaskrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockPGSCAN_SKIP_NORMALD_REAL_DATAbd_holderspt_regsenablepipe_bufsNR_IOMMU_PAGESUCOUNT_COUNTSctx_iddirty_ratelimitd_rt_spc_warnsCGROUP_INET6_GETPEERNAMEi_verity_infoirq_retriggerxsavetimespec_type__rb_parent_colorLRU_UNEVICTABLEdevres_lockmodule_attributebitsWB_REASON_MAXiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsCGROUP_DEVICEevents_fileout_vol_limitCOW_KSMntimenet_prio_cgrp_idvm_private_dataio_bitmap__bi_remainingsubtree_bstatuprobe_task_statetimerkobj_typeb_dirty_timedeactivatei_pageshlist_bl_headino_warnlimitpfmemalloc_waitfasyncpidlistsi_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGESchardomainIRQD_PER_CPUunix_inflightholders_dircont_lockfpu_state_permi_fsnotify_maskbio_vecUNEVICTABLE_PGCLEAREDsysctlsprotection_supportKSWAPD_LOW_WMARK_HIT_QUICKLYack_basegraph_get_port_parentUNEVICTABLE_PGRESCUED__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkvm_node_stat_diffbio_slabd_aliasNR_SHMEM__iovcpumaskPGLAZYFREEDdumpernode_size_lockwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootswrite_bandwidthd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_t__irq_resolve_mappingrunningrseq_event_masks_rootra_pageslegacy_cftypesTT_COMPATexternal_dcvddfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountsupplypage_freeUCOUNT_PID_NAMESPACESarizona_set_irq_wakeread_syscallshlist_nulls_headNR_FILE_MAPPED_nr_pagesparentirq_set_affinityatimecopy_file_rangetask_cputime_atomicBALLOON_DEFLATEuser_definedkey_typeIRQD_IRQ_MASKEDcgrp_linksget_named_child_nodelaunder_foliocurr_targetis_suspendeduts_namespacefor_syncburstetypeei_funcsmodule_kobjectmemoryorderactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0rtpoll_totalno_updateIRQCHIP_STATE_ACTIVEcap_bsettagged_writepagesarchdata_sourcepower_statenr_perf_statesstack_vm_areakstat_irqssaved_statekernfs_elem_attrIRQ_PER_CPUbasess_bdev_filenuma_faultsperiodcgroup_subsysWORKINGSET_NODESfile_offsetlinux_binfmtpage_table_lock_sigfaultregmap_irq_sub_irq_mapcountersname_linkchipNR_ANON_THPScmaxrsstimer_slack_nsbus_typerstat_css_listpolicysharedTHP_SCAN_EXCEED_SWAP_PTEpercpu_dev_idwait_queue_entrydismissd_real_typelookahead_bandnum_core_suppliesseq_starttask_cputimenum_chipsraw_lockd_dnameac_schedwm5110_irqIRQ_NOREQUESTspk_mutemax_hang_timeirq_nmi_teardowncpus_maskDOMAIN_BUS_ANY_pad_b_dirtysubdirstask_groupinitializedstarttimei_fieldmaskWM5110mmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnamepm_runtime_resume_and_getrun_delaytailsvmstatslinenobi_io_vecbase_pfnstatget_inode_acl_addr_pkeymigrate_foliocustom_sliceNR_ACTIVE_ANONNUMA_LOCALspanned_pagesthread_keyringeffectivekparam_arrayutimestart_codeis_managedis_hardfsbasecompatibleblk_status_tac_uidclock_listmicd_timeoutattrsnuma_stat_itempercpu_drift_markcpumask_tgid_mapswregs_statedqb_isoftlimitdma_iommuorig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEIRQ_DISABLE_UNLAZYnr_cached_objectsIRQ_TYPE_NONEia_mtimetrc_ipi_to_cpudirty_exceedednodeinfomxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldis_seentotalreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetrstat_cputime64_ti_blocksnuma_faults_localityhas_child_subreaperirq_chip_regsi_aclwake_enabledmicd_rangeswrite_newwb_listswap_filelist_lockpm_domaininstrument_atomic_read_writecpu_bitmapconsumerucount_maxstatic_call_keyutil_estucountsqc_stateKCOMPACTD_MIGRATE_SCANNEDpageset_high_minarizona_irq_enablesoftirq_next_timerpresent_early_pagescheck_flagshandlerswp_entry_tmsi_descirq_get_irqchip_statebi_inline_vecsmemcg_css_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventIRQCHIP_STATE_MASKEDLRU_ACTIVE_FILENR_MLOCKirq_maskset_performance_stateclass_preempt_is_conditionalraw_atomic_try_cmpxchgconsumers_cntmodule_memorypi_entryimplicit_on_dflk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreserveCGROUP_UDP4_SENDMSGquota_infoload_sumvfsgid_tinit_datacoublockioacac_exe_inodenr_to_scanthreaded_csetsDEVICE_PANEL_UNKNOWNfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treedentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalper_cpu_zonestatsDEVICE_PANEL_LEFTautogroupIRQ_HIDDENnr_threads__i_nlinkBALLOON_MIGRATEpushmm_walkNR_ZONE_LRU_BASElinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancesstart_all_reasonwb_bytesrangeCGROUP_UNIX_GETSOCKNAME__ptrcgroup_base_statfutex_exit_mutexCGROUP_UNIX_RECVMSGjd_gpio5_nopull__MTHP_STAT_COUNTmicd_force_micbiashandle_post_irqwb_stat_itemcompact_blockskip_flushtrc_blkd_nodewrite_s64clk32k_srcIRQ_GC_NO_MASKd_spaceWB_REASON_PERIODICgraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameread_s64bi_iopriou_flagswait_for_threadsnvcswirq_set_nested_threadac_tgetimewatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingbus_tokenUCOUNT_RLIMIT_MEMLOCKi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typeNUMA_FOREIGNhighi_rdevlist_lru_nodeCGROUP_INET4_GETSOCKNAMEself_exec_idDOMAIN_BUS_WIRED_TO_MSIkernfs_opspercpu_enabledMTHP_STAT_NR_ANONtype_level_high_valMODULE_STATE_LIVEstopnr_migrationsa_opsxa_flagsNR_STATSpercpu_affinityfreezebin_sizeNR_ZONE_WRITE_PENDINGclosedev_dma_attrgrphiPSI_CPU_FULLcftyped_spc_timerjump_entriesctl_dirasync_suspendmsi_device_dataalignsuper_blockirq_baseset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorbvec_integrity_poolassoc_arraymnt_idmapdq_dqbmm_statesaved_tfElf64_XwordCGROUP_INET_SOCK_CREATEold_timespec32lock_class_keymemory_events_localnum_symsmodule_notes_attrsvm_lock_seqgenerationPIDTYPE_MAXroot_listnlinkcpu_countdefault_setavg_totalpercpu_refns_commonhorizontal_positionrlimit_maxarizona_ldo1_pdatapref_node_forkwait_queue__int128reclaimeddqi_privrss_statmems_allowed_seqmicd_rateTHP_UNDERUSED_SPLIT_PAGErefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxac_niceDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingofflineRPM_INVALIDgrploPGALLOC_DEVICEclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightcommonCGROUP_GETSOCKOPTwm5102_irqvm_fileidr_basekswapd_orderNR_PSI_AGGREGATORSUNEVICTABLE_PGCULLEDuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDraw_atomic_readclass_raw_spinlock_nested_is_conditionalUCOUNT_INOTIFY_INSTANCESworker_privateis_relassoc_array_ptrTHP_SPLIT_PAGEqstrWORKINGSET_REFAULT_FILEma_flagsirq_set_chip_datahandle_nested_irqfutex_statePGSTEAL_KHUGEPAGEDtranslateorig_pmdacct_timexpds_optype_reg_mask__rcu_icq_cachesizeZONE_DMA32CS47L24em_perf_tablewakeup_sourcef_posNR_FILE_DIRTYirq_print_chipnext_posix_timer_id__kernel_long_twb_switch_rwsemtask_fragsrcu_gp_mutexMEMCG_OOMdatalennr_wakeups_affine_attemptsNR_LRU_BASEPSI_CPUalt_lencinblockextableexitcompact_consideredirq_dispose_mappingkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_countac_utimescaled__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexbpf_prog_arraycore_stateMTHP_STAT_SHMEM_FALLBACK_CHARGEtimerqueue_headserial_nrdac_comp_coeffdeferred_split_queuefutex_pi_statekstat__kernel_uid32_tsubsys_maskDEVICE_FIXEDpte_tPGSTEAL_ANONdevice_driverdying_tasksdl_server_has_tasks_frunnable_sumreal_credCOMPACTISOLATEDget_namefwnode_endpointcancel_forkhwirq_baseWM8997WM8998non_rcuPGALLOC_NORMALWORKINGSET_ACTIVATE_BASEkcompactd_waitUCOUNT_RLIMIT_COUNTSdqb_curspace_entrygp_statebitsetload_avgaccesscstimecore_internal_state__do_not_mess_with_itcfs_rq_uidst_spacefull_clustersmm_cid_next_scanns_typedfl_cgrpIRQ_MOVE_PCNTXTIRQ_IS_POLLEDac_majfltposix_cputimers_work_upperforce_resume_depthwpcopy_delay_totalmodule_param_attrsshort unsigned intCGROUP_LSM_ENDwatermark_boostunitno_suspend_depthcpu_scaled_run_real_totali_mutex_dir_keyq_nodespc_warnlimitcluster_next_cpuNR_WRITTENctl_table_sizes_encodinggpl_crcsorc_entrykeysarizona_micbiasperiod_timerorig_ptedqb_curinodesnbp_thresholdload__s8pids_cgrp_idcss_allocZSWPINinvalidate_lock_keyUCOUNT_NET_NAMESPACESdma_maskprealloc_mutexDOMAIN_BUS_FSL_MC_MSInode_stat_itemobjcg_listsrcu_gp_seq_neededPGMAJFAULTdq_dqb_lock__kernel_ulong_tlruvec_stats_percpucs47l24_irqregmapPSWPOUTdl_period_dev_warnsym___kernel_vsyscalli_fsnotify_markswakeup_patharizonadio_mem_alignARIZONA_NUM_MCLKNR_THROTTLED_WRITTENbtimeIRQ_TYPE_EDGE_FALLING__u8is_roxlockCGROUP_SYSCTLcompact_cached_migrate_pfnrlim_maxDOMAIN_BUS_AMDVIPGALLOC_DMA32runtime_deferred_listd_waitlocal_fwnodelist_lru_onerlimit_typezswap_writebackdevice_physical_location_horizontal_positionseeksseq_stopkf_rootdev_idkiocbKSWAPD_HIGH_WMARK_HIT_QUICKLYbv_offsetclass_rwsem_read_intr_is_conditionalcompact_order_failedfsuidUCOUNT_UTS_NAMESPACESctl_table_argcompact_init_migrate_pfns_blocksize_bitsnuma_scan_periodmanaged_pagesmigration_disablediter_typepositionclass_device_is_conditionalshrinker_idbio_setrootprojid_mapoom_reaper_listnr_reserved_highatomicshutdown_presym_VDSO32_NOTE_MASKbpf_storageIRQ_GC_INIT_MASK_CACHEirq_flags_to_clearnotifierno_callbacks__u16timers_activewait_countvirqNR_SHMEM_THPSsig_okhwirqIRQD_IRQ_DISABLEDdelaysqf_ownerreadaheadNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBwork_listNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingMEMCG_DATA_KMEMextentfsindexshstknum_ctsrcu_sspwake_irqcan_attach__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32PGINODESTEALptracedtrc_reader_specialNUMA_HITHPROBE_GONEHRTIMER_SOFTIRQMTHP_STAT_SWPOUTactive_timeTHP_SPLIT_PAGE_FAILEDthrashing_delay_totali_sequencepool_datapage_memcg_data_flagsMTHP_STAT_ANON_FAULT_FALLBACK_CHARGEpgdatkeyring_semdisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfTHP_ZERO_PAGE_ALLOC_FAILEDi_dir_seqirqreturnkqiddefer_syncPSI_CPU_SOMEKOBJ_NS_TYPE_NONE_watermarkswap_activateIRQD_RESEND_WHEN_IN_PROGRESSmkobjcore_cookiesrcu_supd_deleteb_more_ioPRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeirq_resumenotifier_fn_tmf_statsf_iocb_flagshpdet_acc_idpoweroffcmaj_fltvtimemath_emu_infoNR_MEMSTALL_RUNNINGiowait_sumALLOCSTALL_NORMALnum_config_basesf_pathpidlist_mutex__u64journal_infocapabilitiesHTLB_BUDDY_PGALLOCsched_contributes_to_loadirq_domain_infostatic_key_trueb_ioweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vmnode_start_pfnTHP_ZERO_PAGE_ALLOCNET_TX_SOFTIRQ_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimearizona_boot_donevm_startIRQ_GC_BE_IOs_flagsgpio_to_desccpumask_var_tfaultshow_statsdl_densityfreeptr_tread_dqblkac_giddq_flagsarizona_irq_mapnestDD_CLASS_TYPE_DISJOINT_NAMESirq_set_irq_wakememcg_datatracepoint_extkprobes_text_startrunnable_avgZSWPWBs_time_grancgroup_freezer_statekernel_cap_twait_listrequest_pendingdworkhrtimerMEMORY_DEVICE_COHERENTNR_PSI_STATESperf_event_ctxp__TASKSTATS_CMD_MAXi_dio_counts_bdiposix_cputimer_baseavgs_worknum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionmax_descendantswb_lcand_idserialclass_releasealloc_locks_dquotarch_atomic_try_cmpxchgfolioqfoliosthreadedUCOUNT_TIME_NAMESPACESmemcg_memory_eventNR_MEMSTALLWM8280prev_posNR_ISOLATED_FILEdelayedseqcount_spinlockexpire_countuid_maps_umountis_bin_visiblepgoffpending_masksyscall_user_dispatchumount_beginnr_disk_swapinsrcu_tasks_exit_listclear_ackarchdataia_uidPSI_IO_FULLchildrenrb_subtree_lastno_pm_callbacksbuild_idPGMIGRATE_FAILdevice_get_match_datavfork_donenanosleeppud_tWM5102rt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcWB_REASON_LAPTOP_TIMERbi_issuequota_format_typeignoredvmstats_percputask_structanon_costrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenPSI_AVGStotalreserve_pagesf_pipei_wb_frn_historylast_wakeenextmin_slab_pagesio_tlb_memarch_spinlock_tnr_tasksi_mtime_nsecperformanceDOMAIN_BUS_PCI_DEVICE_MSImmlistIRQ_TYPE_LEVEL_LOWset_dqblksuppress_bind_attrsRPM_RESUMINGreg_offsetgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesNR_ZONE_INACTIVE_FILEirqchip_irq_stateDOMAIN_BUS_IPIIRQ_NONEhigh_maxphandleirq_set_chip_and_handlerread_u64i_nlinkwrite_begingroupspi_blocked_onDOMAIN_BUS_DEVICE_MSIs_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalnet_cls_cgrp_idsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_treclaim_waitfbatchALLOCSTALL_MOVABLEnr_writeback_throttled_dev_errsharepagefault_disabledstate_startsyscwnr_memcgsil_prevget_name_prefixMEMCG_NR_MEMORY_EVENTScgroup_bpf_attach_typewlockedNR_VM_EVENT_ITEMSfreeze_superarizona_pdatainstalleds_inode_list_lockUCOUNT_RLIMIT_MSGQUEUEruntime_idleCGROUP_INET_SOCK_RELEASEsweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICoffline_nodequota_enablesched_avgntabzonedevice_typePGROTATEDmaj_fltarch_rwlock_ttree_scannedIRQ_TYPE_EDGE_RISINGclock_basefrag_cluster_nrSLABS_SCANNEDcdevmy_qgroup_leadermkdirzoneliste_csetserr_ctrlifreal_blockedarg_locknum_exentriespid_ns_for_childrens_writerslaptop_mode_wb_timerlower_firstint32_tio_pagesoffset_ctxnr_failed_migrations_runningcompact_delay_totalclassesnext_timerclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockregmap_add_irq_chipfsavekeyring_index_keyNR_FREE_CMA_PAGESqrwlocksplit_queueSWAP_RAfile_ra_statemax_depthuser_structon_rqusersfs_contextswap_extent_rootmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfbypassfree_irqgpiod_get_raw_value_cansleepllseekDEVICE_HORI_POS_CENTERtypes_supportedDL_DEV_PROBINGout_monolast_old_flushnext_offsetcommit_dqblknamespacei_ino_warnlimitdirtied_stampIRQD_LEVELwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidfile_lockcookiebd_stamptargethigh_mina_flagstrace_overrunwriteback_sync_modesswap_cluster_infosession_keyringcpusfop_flagsSYSCTL_TABLE_TYPE_DEFAULTkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuUNEVICTABLE_PGSTRANDEDilenmnt_flagsCGROUP_BPF_ATTACH_TYPE_INVALIDmemory_peaksIRQ_TYPE_LEVEL_HIGHcred_guard_mutexsigcntfiltershrtimer_cpu_basecb_headcheck_quota_filePGDEMOTE_DIRECTattributerestrict_linkdev_archdatamclki_devicesktime_get_mono_fast_nskey_perm_tcss_rstat_flushbio_integrity_payloadrescue_listswappinesspi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsrescue_lock__compiletime_assert_489list_lruusing_gplonly_symbolstarget_knchip_typessival_ptrlock_classthreaded_csets_nodelast_subtree_bstatrobust_listsym___kernel_rt_sigreturnsplit_queue_locksym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackirqreturn_tdockcgroup_fileforwarddev_links_infoirq_bus_lockloff_tthread_pidsrcu_gp_seqmicd_pol_gpiofreezer_cgrp_idirq_domain_chip_generic_infoCOMPACTSUCCESSPSI_MEM_FULLcgroup_rstat_cpu_archipi_send_singlest_valueclass_write_lock_irq_is_conditionalWB_WRITEBACKKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodemm_statsof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typePROBE_PREFER_ASYNCHRONOUSicq_list__kernel_size_tactive_mmia_mode_trapnoirq_calc_maskuintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secDOMAIN_BUS_PLATFORM_MSIWB_WRITTENmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpaddingmax_prop_frac__fillersaved_sigmaskd_timelru_listentriescpu_idfop_flags_tPGSCAN_SKIP_DEVICE__MAX_NR_ZONESirq_fwspecFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_lockarizona_irq_set_wakesched_delayedbd_statsbi_sizemodule_statelast_used_atmemcg_vmstatsirq_chip_typeALLOCSTALL_DMAvm_endregulatorlast_queuednuma_migrate_retryuser_nsirq_ack__statePSWPINfirsthandle_pre_irqmigrate_to_ramepoll_watcheswb_domainwait_pidfdptrace_bpss_umount_keyrstat_css_nodemax_ratiovm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsNUMA_HINT_FAULTS_LOCALia_ctimeproc_handlerDOMAIN_BUS_WIREDFAULT_FLAG_INSTRUCTIONmigrate_from_cpuPSI_IO_SOMEasync_in_progressavgs_locksrcu_barrier_mutexi_private_dataElf64_Halfbw_dworkcompact_countnsproxycan_wakeupTIMER_SOFTIRQxol_areaPGPROMOTE_SUCCESSirq_request_resourcesirq_chip_genericrlockfl_owner_tjd_invertcgroup_subsys_idMEMCG_DATA_OBJEXTScls_mskeuidwaitbug_tabledirtied_time_whensequential_io_avgmicd_detect_debounceoom_groupnum_trace_bprintk_fmtIRQD_HANDLE_ENFORCE_IRQCTXcpu_run_real_totalTHP_SCAN_EXCEED_NONE_PTEvm_policypsi_aggregatorsWM1814perf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayirq_flags_to_setRPM_ACTIVE__state_sizethread_structcached_requested_keyenvp_indexreg_readlUCOUNT_FANOTIFY_GROUPSper_cpu_pagesctimeCPUTIME_IOWAITreleasemax_segment_sizenr_pagessched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datarevmap_treemm_usersbd_holder_locks_idPGALLOC_MOVABLENR_ZSPAGESs_dentry_lrubp_offsetnet_nsmask_basefolio_queuelast_task_numa_placementnr_descendantsCPUTIME_FORCEIDLEpgtable_tblock_startcgtimeWB_REASON_VMSCANsymlinkoom_flag_origindqio_semcounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcusocket_pressureki_waitqnotify_timerbi_iocost_costdonePGSCAN_ZONE_RECLAIM_FAILEDerr_main_irqfscrypt_operationsrelease_workparent_irqksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexac_btime64mg_dst_preload_noderatelimitfree_folioNR_RUNNINGMIGRATE_SYNCatomic_add_unlessexport_operationsPIDTYPE_PGIDrm_xquotaPSI_MEM_SOMEDOMAIN_BUS_DMARswapin_countdl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDCPUTIME_GUESTsysv_semanon_vma_namefileattrwatermarkdeadpropsavg_nr_triggersfprop_globallong long unsigned intanon_nameblkcg_gqia_filesival_intcpu_usage_statnuma_preferred_nidirq_create_mapping_affinity_hugetlb_cgroupcore_suppliesdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatemm_listcss_idri_linkmicd_software_comparelistxattr_lowertrap_nrbinfmt_miscasync_probe_requestedcompat_long_tac_etimeactive_countIRQD_DEFAULT_TRIGGER_SETs_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatebus_groupsirq_chippmd_tmnt_namespacePSI_MEMnode_spanned_pagesd_sbsysv_shmregmap_irqdq_countctrlif_errorutf8data_tableset_latency_tolerancehugetlb_cgrp_id__func__foliowake_entryTHP_SPLIT_PMDxa_headsuidregmap_irq_chip_datacluster_infoirq_domain_opsi_readcountUCOUNT_USER_NAMESPACESirq_write_msi_msglocked_vmrb_leftmg_src_cgrpseq_nextdirect_maxsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tmisc_cgrp_idcpuacct_cgrp_idclass_rcu_is_conditionalIRQ_GC_INIT_NESTED_LOCKIRQD_WAKEUP_STATEbpf_local_storageactionclockid_tquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countmemcg_completionsregmap_update_bits_baseksm_merging_pagesfree_listNR_SOFTIRQSautosleep_enabledptrace_entryuse_autosuspendrecent_used_cpunum_jump_entriesrequest_mutexs_qcopatomic_tbv_page_flagsnotify_nexte_cset_nodebus_dma_limitshort intmynodemicd_dbtimenr_free_highatomicpdataof_device_idarizona_micd_rangewb_waitqNR_VM_ZONE_STAT_ITEMSIRQD_AFFINITY_SETclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritableUCOUNT_INOTIFY_WATCHESf_ownerbp_regPGDEMOTE_KSWAPDVTIME_USERsa_flagstestcss_offlinepad_untilDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2destroy_rworklast_arrivalmapcountem_pdIRQD_AFFINITY_MANAGEDis_guestdevice_physical_locationpm_domain_datanr_extentsnr_scannedpoll_table_structfifodirect_IOthreads_activemain_statuswait_queue_entry_tgpio_get_value_cansleepCMA_ALLOC_FAILpcpucurrent_may_mountseqlock_tbd_queuenuma_scan_offsetcgroup_subsys_stateMTHP_STAT_ANON_FAULT_ALLOCCGROUP_INET4_POST_BINDvertical_positionkernfs_iattrssched_migratedfrozenarizona_irq_request_classmlock_countin_lru_faultgrpmaskMEMCG_SWAP_MAXfreezerNR_INACTIVE_FILEarizona_irq_disablePSI_NONIDLELRU_INACTIVE_ANONregfuncindex_keymemalloc_noiohpdet_id_gpioGRPQUOTArwsemi_private_listia_validSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcluster_nrvirtmemi_rcui_atime_secqc_type_stateCGROUP_INET6_POST_BINDkey_serial_tdev_ueventsetupf_lockmsi_msgUNEVICTABLE_PGSCANNEDactivexlateno_statusdqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsIRQ_PER_CPU_DEVIDFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listCGROUP_UNIX_SENDMSGarizona_domain_opsxarray_startfadvisevmem_altmaparg_endsyscall_dispatchtime_namespacerevoked_atlast_sum_exec_runtimewm8997_aodiov_iteria_gidCGROUP_SOCK_OPSNR_UNACCEPTEDattribute_groupcontextposix_timersTHP_COLLAPSE_ALLOCper_cpu_nodestatselectorMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nskcsan_check_accessirq_set_typesource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_tctl_table_rootARIZONA_MCLK1ARIZONA_MCLK2wm5110_revd_irqgroup_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizedfl_cftypeshpdet_clampirq_set_noprobedeferred_splitmce_kill_meuuid_tproperty_read_int_arraynr_actionsKSWAPD_INODESTEALcount_objectsctl_table_setnum_regs_stimezone_device_datakcompactd_max_orderpeaks_lockf_wb_erruseddefparamsaved_errlast_unhandledfred_csfault_flagresend_nodekprojid_tptracer_credtlb_gencgwb_domainIRQ_TYPE_PROBEpage_mkwritekobjectaudit_ttyirq_flagsrtpoll_triggersmce_ripvstatfsctl_table_headerdma_skip_syncpm_runtime_put_noidleDROP_PAGECACHEnumab_stateruntime_pmremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cbliststoragesTHP_SPLIT_PUDclass_groupspsi_groupnuma_nodeerr_map_main_irqPGSCAN_FILEWB_RECLAIMABLEtrace_event_calli_mmap_rwsemUCOUNT_RLIMIT_NPROCDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchangedbdi_listwatch_listrevmap_sizeaudit_contextpp_ref_countsysfs_opsregulator_bulk_datasequential_ioipi_send_maskregmap_update_bitsCGROUP_INET4_BIND_large_mapcountsda_is_staticformatftopenclavemask_cache_privreclaim_workbi_privateIRQD_SINGLE_TARGETALLOCSTALL_DMA32PGLAZYFREEsp_regcreateiattrirq_domain_bus_tokenrseqnfdssigvalvma_lockperf_event_listarizona_typeget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadirqactiond_realancestorstot_write_bandwidthmax_channels_clockedPGSCAN_ZONE_RECLAIM_SUCCESSexpiry_activedqi_max_spc_limitvm_numa_eventexception_table_entrynr_isolate_pageblockevent_countparam_countnr_to_writefallocatei_spc_warnlimitbuddy_listi_ino_timelimitnode_present_pagesi_mmap_writablemems_allowedMEMCG_SWAP_FAILtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderclk_lockMTHP_STAT_ZSWPOUTold_subtree_controltimewakee_flip_decay_tsmemcg_vmstats_percpus_max_linksnr_wakeups_syncNR_PSI_RESOURCESkallsymskcompactdprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tDOMAIN_BUS_PCI_MSIblocksirq_affinity_notifyset_infofileattr_getvector__bi_cntCGROUP_UDP6_SENDMSGtimer_listrefaulted_oldaffinityd_ino_warnsraw_atomic_fetch_add_unlesshiwater_vmtracepointTASKSTATS_CMD_NEWcompound_headia_vfsuidunaccepted_pagesirq_eoilrugen__kernel_ssize_trequest_classorig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersthread_maskino_timelimitsplice_writestate_in_sysfsTHP_FILE_ALLOCbd_nr_sectorsqf_nextWB_REASON_BACKGROUNDCGROUP_UDP4_RECVMSGunmask_baserangescpuset_cgrp_idmemory_eventsiommu_mmirq_enablecutimeem_tableNUMA_HUGE_PTE_UPDATESpersonalityget_stateNR_IOWAITtask_sizes_inodes_addrbinfmtirq_domainsigned charpersistent_keyring_registerprioprivgetattrsched_infoMTHP_STAT_SHMEM_ALLOCarizona_irq_lock_classd_fieldmaskuprobe_xol_opsseq_filefreeze_noirqNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsno_pmbi_max_vecsgroup_stop_countdac_comp_lockavg_last_updatelowest_bit_killktime_tarizona_irq_initNUMA_PAGE_MIGRATEUCOUNT_MNT_NAMESPACESchildren_low_usagesymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387iterd_ino_timeravx512_timestampfuncsend_dataarizona_request_irqpercpu_pvec_drainedsubtree_controlPGSTEAL_KSWAPDsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncrange_startper_cpu_nodestatsnr_charged_bytessetleasepinspacct_structmust_resumescannedlong intpresent_pagesfile_lock_contextusagel_yesPGALLOC_DMAsiglockper_cpu_pagesetstatuserror_injection_entrymigration_pendingreal_addressac_stimeWB_REASON_FS_FREE_SPACEuidhash_nodefred_ss__dynamic_dev_dbgproperty_presentUSRQUOTAprintk_index_sizesymtabtimes_previnit_load_uArt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONthreads_handledegidiomapIRQD_NO_BALANCINGdq_hashput_superfwnode_reference_argshandle_simple_irqnext_addrpushable_dl_tasksf_flags__newf_inodeprocnameCPUTIME_IDLEmark_dirtythread_flagsnr_dying_descendantsnum_srcu_structsbdi_writeback_pad1_kobj_completionIRQD_ACTIVATED__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEirq_common_databalanced_dirty_ratelimit__kernel_timespecIRQ_NOPROBE_pad2_cancelled_write_bytesac_tgidsrcu_usagebitmapacpi_match_tableCGROUP_INET4_GETPEERNAMEmemcgbw_time_stamp_sigvalmax_perf_statebvecnameidatalatency_recordmod_kallsymsmnt_idrefaultshas_fully_powered_offdepth_pad3_wait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldstatus_baselistsDOMAIN_BUS_GENERIC_MSIssize_tsr_lockiopl_emulwork_structdesc_lenMTHP_STAT_SPLIT_DEFERREDflocktask_io_accountinginit_ack_maskedmremaphprobetracepoint_funccoherent_dma_maskentryfree_cached_objectsworkqueue_structreversepi_locklru_gen_mm_state___orig_eipprobestubget_timedapmmm_cid_activeIRQD_WAKEUP_ARMEDelemsizedirty_paused_whenupdate_timemaxlenNR_ZONE_UNEVICTABLErelease_agent_pathclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argsirq_unmaskwriteback_inodessrcu_reader_flavorirq_safetv_nseci_lrudischargezone_idxdom_cgrpNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvolNR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tmg_tasksuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infortpoll_trigger_locksrcu_structrlim_curnofaultirqd_get_trigger_typemm_countcputime_atomicdrv_groupsstackirq_set_wakeoffline_waitqmnt_nsac_ppidfunctionwb_idki_flagsbvec_poolbd_start_sectsrcu_have_cbsIRQD_MOVE_PCNTXTd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timecgroup_rootdatastrtabtty_old_pgrpold_dom_cgrpdl_throttledirqs_unhandledi_rwsemrtpoll_statesget_projidsched_reset_on_forkHPROBE_CONSUMEDregmap_irq_get_virqbpf_net_contextwake_baseopc1CPUTIME_IRQ__int128 unsignedpcountTHP_FAULT_FALLBACKrestore_noirqki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaTASKSTATS_CMD_UNSPECUCOUNT_FANOTIFY_MARKSruntime_autoPROBE_DEFAULT_STRATEGYvirq_baserlimread_foliosplit_queue_lennr_eventsWB_REASON_SYNCmicbiasiommubi_opfBLOCK_SOFTIRQprivateDEVICE_VERT_POS_LOWERhlistcftsTASKSTATS_CMD_GETst_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxswap_plugCGROUP_UNIX_CONNECTMEMCG_MAXsplice_pipeeffective_affinitys_lock_keymg_nodekswapdsrcu_gp_startopentime_nsit_real_incrwaitqmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmem_cgroup_idmodstqheads_activesym_vvar_startMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalget_irq_regirq_set_lockdep_classdeadremap_file_rangeac_commnr_hangskcompactd_highest_zoneidxgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copPGSTEAL_DIRECTset_ownershipMEMCG_LOWdd_key_truezone_stat_itemhres_activeDEVICE_PANEL_FRONTbpf_raw_eventsswap_mapdq_dirtydl_deferbug_listdirect_completenbp_rl_startidr_rtlegacy_namexa_lockfxregs_statememcg_cgwb_frnload_weightdiscard_clusterskuid_tarch_datafpstateshrinker_infoblock_maxmthp_stat_itemrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateuts_nsirq_domain_xlate_twocellMTHP_STAT_SWPINis_late_suspendedsysvsemTHP_FAULT_ALLOCucountvm_stat_diffCGROUP_SETSOCKOPTkmemcg_idignore_childrenlru_gen_mm_walk_pflagsrestore_earlyhap_actclock_mutexfs_supersdom_csetevents_local_fileroot_csetnotifydqb_bsoftlimitpendingf_task_worklru_gen_memcgiowait_countRCU_SOFTIRQPGFAULTnotifier_blockmemswdma_io_tlb_memrtpoll_scheduledstringread_countstoreforklruvecfutex_offsetvmpressurelong long int__UNIQUE_ID___addressable_arizona_set_irq_wake620bdevatomic_flagssysvshmHI_SOFTIRQtimer_expiresirq_set_vcpu_affinitytrace_evalsactive_baseshierarchy_idearly_initmprotectac_exitcodesecurityxmm_spacememory_cgrp_idactivatef_pos_locksuspend_noirqPGSTEAL_FILEchip_datatls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structarizona_free_irqi_bytesdepends_ondomain_dataidr_nextrelax_countlinelinkstart_timekernfs_nodercu_workPSI_IRQ_FULLRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEfront_paddup_xol_addrZSWPOUTcapture_controlnr_wakeupspost_attachstartstart_brkstatic_key_modd_ino_softlimitxregs_statelock_argWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterscss_resetNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsNUMA_INTERLEAVE_HITneed_qscompact_defer_shiftswap_deactivatedomain_suffixblkcnt_tnum_micd_configsicq_treesi_codethread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batchrstat_flush_nextzeromapmap_pagesreschedule_countvfsmountcss_onlineextable_basenoinstr_text_sizenargsattributesMTHP_STAT_SWPOUT_FALLBACKTASKLET_SOFTIRQset_child_tidNUMA_HINT_FAULTS_overrunwrite_u64tmpfilemicd_bias_start_timercu_read_lock_nestingem_perf_statemin_nrtick_dep_maskgpio_descprecious_tablelistthrottle_disksi_errnobsynce_freezememcg_lrus_inode_lrumemcg_nodesrcu_size_stateblk_pluguid_gid_mapPGSCAN_SKIP_DMA32unpinned_netfs_wbof_noderefsmmap_compat_baseWB_SYNC_NONEtrace_eventsenv_startcgrp_ancestor_storagedma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_statemask_unmask_non_invertedUTASK_SSTEPpkrureal_parentlockedcgroup_tasksetVTIME_GUESTrtpoll_next_updateregsslice_maxlast_switch_countqsize_tregmap_irq_typeblkio_delay_totaltime_ns_for_childrenfilesdqb_bhardlimitlivevm_faultatomic_write_unit_maxs_staterun_listixolSCHED_SOFTIRQbd_mappingsym_vvar_pagemodule_sect_attrsmg_src_preload_nodereturn_instancesoftirq_activatednum_irqsclass_preempt_notrace_is_conditionalret_stacknode_id_workingsetautosuspend_delayunsigned intCGROUP_INET6_GETSOCKNAMEnotifier_callrtpoll_taskgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqbi_crypt_contextia_vfsgidcgroup_bpfzone_typesize_tacpi_device_idcap_permittedTT_NATIVEzone_pgdatclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesu64_stats_syncrcu_tasks_idxsync_modercu_tasks_holdouttarget_listtype_level_low_valavg_write_bandwidthb_attachedpasid_activatedpi_sezonerefget_offset_ctxcore_forceidle_sumnum_main_regsCPUTIME_NICEfreeze_ucounti_ctime_nseccpuhp_deads_remove_countsyscall_workcompletionsdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalstatus_invertcallback_headmemory_failure_statss_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tdevtPSI_IOrestoredelayed_callbi_itermax_nr_cid_statusd_sibkernel_ulong_tdma_opsTHP_COLLAPSE_ALLOC_FAILEDbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedbvec_iterdl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countPGPGOUTreturn_consumerrelease_dqblkin_thrashinguaddr2css_extra_stat_show__kernel_timer_tclass_srcu_is_conditionalcss_releasedDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskavail_listsatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionsnd_soc_dapm_contextbv_lendiscard_workstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispblkcg_nodercu_specialclear_child_tidf_refextable_lenper_cpu_zonestatbacking_dev_infoNET_RX_SOFTIRQsaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usagetree_reclaimedratelimit_states_pinsattrget_next_child_nodeFAULT_FLAG_WRITEreg_bitswrite_syscallsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDext_capdebug_dirfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollac_padgraph_get_next_endpointmemcg_iducount_typenr_wakeups_idlertpoll_waitio_cqprobeelf64_symlatch_tree_nodepercpu_ref_datadestroy_workreadable_noinc_regDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSval_format_endianMAX_CGROUP_BPF_ATTACH_TYPEnum_main_status_bitssyscorewb_reason__s64LRU_ACTIVE_ANONdqi_bgracewm5102_patch__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_panelctl_tableuid_tflush_requiredprocs_filesum_block_runtimepgmapmin_perf_statedq_opnum_micd_rangesrcu_tasks_nvcswwriteNR_WB_STAT_ITEMStypetabclk32k_refclass_read_lock_irqsave_is_conditionalcan_forkfor_backgrounddma_pools_addr_lsbctl_table_polli_generation_sigpollmxcsrrange_cyclicd_rt_spc_hardlimiteminbi_end_ioblk_holder_opsfreepages_delay_totalNR_ZONE_ACTIVE_FILEnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affineupdated_childrenpteval_ti_inocgwb_listdyndbg_infocompact_cached_free_pfnindexfree_clustersdriver_datathread_headac_exe_devdev_pm_qosbi_sectormap_typeNR_PSI_TASK_COUNTSperiod_timef_opPGPGINpids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizeperf_event_cgrp_iddq_sbNR_FILE_THPScgroupsighand_structflagsi_lock_keykmem_cacheCPUTIME_STEALKCOMPACTD_FREE_SCANNEDinodedrivers_dirback_padNR_ZONE_ACTIVE_ANONbug_entrycancel_attachwaiterscmin_fltWM1831rw_semdqio_semprev_sum_exec_runtimeinmodenestedrtpoll_nr_triggersnr_forced_migrationsac_pidseq_operationsnum_argsri_timerstack_canaryinactiveblksizesiblingmnt_rootnext_scanunregisteringf_raquota_writesrcu_barrier_cpu_cntNR_LRU_LISTSiopl_warnrmdirsockreg_stridebi_write_hinthash_lenget_policyshrinker_info_unitnr_reclaim_startTHP_FILE_FALLBACK__bi_nr_segmentstask_iterssym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecss_freecpu_basedevice_is_availabledquotdl_runtimechildren_min_usagenumbersswapin_delay_totalbi_vcnt_softexpiresPSI_POLLkey_user_hugetlb_cgroup_rsvdhandle_mask_syncfaultableio_comp_batchshutdowndq_lockzswap_maxi_cdevldt_structenv_endobj_cgrouprescue_workqueueprogsextra1ptrace_messageNUMA_OTHERnum_trace_events_sys_privateuse_raw_spinlockmin_usageinit_fs_contexts_subtypeheaderfuncperf_event_contextno_cgroup_ownernbp_th_nr_candrelease_dquottlbflush_unmap_batchtype_in_masksoftfreepages_countyes_ranges__sifieldsDIRECT_MAP_LEVEL2_SPLITrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6attachTHP_DEFERRED_SPLIT_PAGEkprobes_text_sizestatic_call_sitesTHP_FILE_FALLBACK_CHARGEthread_group_cputimernuma_scan_period_maxstart_stackTHP_SWPOUT_FALLBACKwatchersKSM_SWPIN_COPYrange_endcompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsgpswbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodebpf_cgrp_storagenum_rangescurr_nrcorememsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataWORKINGSET_REFAULT_ANONtype_reg_maskget_dquotsnextentsnum_orcscma_pagesclass_task_lock_is_conditionalUCOUNT_RLIMIT_SIGPENDINGFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onvm_operations_structNR_ACTIVE_FILEjd_gpio5bin_attrs_newbio_alloc_cacheruntime_idleiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersPGSCAN_DIRECTexp_hintd_childrennregis_softbindcntsRPM_SUSPENDEDreclaim_stateMEMCG_SWAP_HIGHevictedvma_numab_staterethooksnum_symtabPGSCAN_SKIP_MOVABLEwrite_inoded_fsdataRPM_SUSPENDINGcacheline_paddingCGROUP_SUBSYS_COUNTnrpages_refcounti_crypt_infopermissionsnr_frozen_descendantsbdi_nodeerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idxcgroup_namespaceZONE_DEVICE_head_1_head_2subsysbd_size_lockbackstate_add_uevent_sentOOM_KILLi_hashhlist_nodeio_uringregulator_init_datareg_sequencecore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setCOMPACTFAILbio_listwrite_dquotclass_read_lock_irq_is_conditionalfolio_batchNUMA_MISSioctx_lockkveccurrent_stack_pointersect_attrsmg_dst_cgrpsoft_startonlineruntime_resumedup_xol_workKCOMPACTD_WAKEwrite_charlocal_watermarktdm_slotsconfig_baseMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignhpdet_channeldelay_workUCOUNT_CGROUP_NAMESPACESCGROUP_INET6_CONNECToublockinuse_pagesrecent_cidkf_opscan_sleepkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmicvddgfp_tseccomp_filterstimei_mmapthaw_superREGMAP_ENDIAN_DEFAULTd_lrusignal_structperf_event_mutexrd_noinc_tableNR_PAGETABLEcrcsUNEVICTABLE_PGMLOCKEDpgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrsprotectedsas_ss_flagsf_modeki_completenonfull_clustersvtime_statewakee_flipsset_aclpids_activedriverZONE_NORMALREGMAP_ENDIAN_NATIVEi_opldt_usr_semHRTIMER_RESTARTwpcopy_countkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEreg_shiftcredjump_entryreg_defaultreg_defaultsfrag_clustersproactive_compact_triggersrcu_gp_seq_needed_expgpioaddress_space_operationsspinlock_t__task_fpstatemaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_starthuge_faultkstatfssites__lruveccluster_nextDEVICE_VERT_POS_UPPERmem_cgroup_reclaim_iterevents_lockptracequota_disablekprobe_blacklistwork_lockcpus_ptrnotified_atpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysdelay_uskswapd_lockdirty_limit_tstampsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMED__NR_MEMCG_DATA_FLAGSCGROUP_INET_EGRESSexpiresrcuwaitnivcswpsi_resMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotbstatfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datavm_event_itemmce_countswap_info_structsequencecpu_cgrp_idrt_spc_warnlimitac_flagblocking_notifier_headcoredump_datavm_stattasksmem_cgroup_per_node_pidaddress_spacemm_context_tirq_reg_strideuid_gid_extent__call_single_nodestartupseqcount_spinlock_tbio_issuei_wbcss_local_stat_showuint8_tMEMCG_HIGHregmap_irq_chippanelclass_idinactive_timer_pkeyfilenames_export_opclear_on_unmaskselector_maskPSI_IRQi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqlowmem_reservepagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipebaseCGROUP_INET6_BINDforce_scanhostuaddrfailedcgrps_wb_errold_subtree_ss_maskshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descscontiguousrecoveredTHP_MIGRATION_SPLITexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidi_rt_spc_timelimitrseq_sigLRU_INACTIVE_FILEarizona_micd_configdev_pm_domainlimit0limit1nr_zonespages_skippedmigrate_modeSWAP_RA_HITbio_poolfree_areakswapd_failureszswap_lruvec_stateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoWB_DIRTIEDlru_gen_mm_listi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeUCOUNT_IPC_NAMESPACESpushable_tasksack_invertplatform_datad_comparesighanditerate_sharedis_visiblesignalWB_REASON_FORKER_THREADreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headswap_peaks__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackstat_thresholdlevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventfast_ioCOMPACTSTALLhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowunsigned charzone_start_pfnvdsomemtiermmap_legacy_basePAGEOUTRUNTHP_SCAN_EXCEED_SHARED_PTEpipe_inode_infononresident_ageuint16_tsecurebitspartition_meta_infostate_initializeduring_cmd_iopollbi_poolcompat_uptr_tuevent_opssub_reg_offsetsSWPIN_ZEROzero_flag_maskCGROUP_UDP6_RECVMSGslicesas_ss_spNR_ZONE_INACTIVE_ANONnr_dirtiednum_kprobe_blacklistNR_FREE_PAGESsubtree_ss_maskclass_local_lock_is_conditionalsuspend_latewakeupcg_listcgwb_release_mutexsrcu_barrier_completionwb_completionshrink_controlwritten_stampdriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapaod_irq_chipspan_seqlocknum_reg_defaultssessionidlast_bdp_sleep_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistCPUTIME_SOFTIRQZONE_DMAdebugfs_entryelemnr_retriescgwb_frnavg_refaultedPGSCAN_DIRECT_THROTTLEsigval_talimitundo_listdirty_foliorcharZONE_MOVABLEALLOCSTALL_DEVICEnr_populated_domain_childrenmissedkswapd_highest_zoneidxparent_could_setfcapquota_readst_shndxldo1freedevices_cgrp_idpageset_high_maxi_wb_frn_avg_timePGSCAN_KSWAPDbd_fsfreeze_countfile_ref_tCMA_ALLOC_SUCCESStypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securitys_dio_done_wqDROP_SLAB_dummy_bndmin_unmapped_pagessas_ss_sizespk_fmtuser_xfeaturesnr_wakeups_passivefile_system_typewb_tcand_idmtimeserver_has_tasksswap_events_fileoom_score_adj_minreadable_regkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_thigh_worknode_zonelistsrange_maxpathst_sizenr_frozen_taskslru_gen_foliormtpwait_sumnum_tracepointsupidexit_codemempool_ttype_falling_valexec_startclass_read_lock_is_conditionalconsumersrtpoll_min_periodkernfs_elem_symlinkclock_was_set_seqPGSCAN_KHUGEPAGEDDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerPGREUSEiommu_groupperiod_contribforceidle_sumrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockis_preparedCOMPACTFREE_SCANNEDvm_opshighest_bitiopollregmap_unlockTHP_MIGRATION_FAILpagesizes_blocksizevm_pgofftimesauprobecan_swaprelease_agent_worknuma_workupdate_timeptrace_dr7priority_call_addrexpireloginuidcheckTHP_FILE_MAPPEDrtpoll_untilexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_donenbp_rl_nr_candCPUTIME_GUEST_NICE__lstateupdated_nextueventlock_countrefcount_tcset_linksplugchild_countio_cgrp_idsaved_auxvTHP_MIGRATION_SUCCESSmce_addrlast_bstatnum_bugsqf_ops__vm_flagsnum_config_regsmod_nametype_rising_valproperty_read_string_arraymm_cidmemory_tierunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalorig_objcgrseq_csdcvddnum_ftrace_callsitessoftirq_expires_nextHTLB_BUDDY_PGALLOC_FAILDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnode_zoneswindow_startnbp_th_startelow_pincounttablesDEVICE_PANEL_BOTTOMmin_seqlist_headlru_lockhwlock_idrange_mintgidbatchedfor_reclaimwrite_protect_seqtdm_widthcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holderend_codeblkio_countqspinlocklru_genNR_VMSCAN_WRITEinsnfilldir_tNUMA_PTE_UPDATESlow_usagedl_non_contendingdir_contextPGFREEtracepoint_ptr_tutaskfailcntNR_UNEVICTABLEsched_entityd_spc_hardlimitgpio_defaultslockdep_keylong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baserescue_workio_contexthpdet_acc_id_linegpl_symsgroupseq_showctl_nodePGSCAN_SKIP_DMAswait_queue_headcow_pageinumac_btimeblockSWPOUT_ZEROi_spc_timelimitreturn_instancesn_yes_rangesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevicebi_integrityCPUTIME_USERs_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namekernfs_open_filenoderesetfor_kupdateBALLOON_INFLATEvm_lockMTHP_STAT_NR_ANON_PARTIALLY_MAPPEDPGMIGRATE_SUCCESSwb_tcand_bytesno_cgroup_migrationMTHP_STAT_SPLIT_FAILEDnextevts_writers_key__countxcomp_bvcma_areatype_reg_offsetWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatipc_namespaceexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentread_charcgroup_nsia_sizein_hrtirqs_master_keysCGROUP_LSM_STARTac_stimescaledpropertywchar_addr_bndkernel_symboli_opflagssubsys_databi_statusnr_cgrpstv_secCPUTIME_SYSTEMpid_ttask_listftrace_sleeptimeset_type_configrun_nodema_rooturing_cmdpsi_filesMEMCG_OOM_KILLnr_failed_migrations_affineNR_SWAPCACHEuser_cpus_ptrirq_delay_totalpi_top_taskunlinkNR_WRITEBACK_TEMPactoruprobenotifier_subscriptionss_readonly_remountbiasutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthmax_seqi_sizedl_deadline_hugetlb_hwpoisonpsi_group_cpuubufksm_rmap_itemspageset_batcharizona_micsupp_pdatanr_populated_csetsCGROUP_INET4_CONNECTmodulepcpu_cidPGACTIVATEngroupsfree_file_info__kernel_time64_tNR_VM_NUMA_EVENT_ITEMSautaskuser_namespacevfsuid_traw_spinlockdmic_refkswapd_waittimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flagsPGREFILLkeyring_name_listMTHP_STAT_ANON_FAULT_FALLBACKfile_costread_posstatic_call_trampTHP_SWPOUTbtrace_seq_pp_mapping_padsa_maskrequest_queueCGROUP_UNIX_GETPEERNAMEalloc_factorKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageMTHP_STAT_SPLITrdma_cgrp_idcodegtimenr_populated_threaded_childrensigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimeCOMPACTMIGRATE_SCANNEDsched_rt_mutexdisable_lockinglocked_pendinghlist_nulls_nodenr_deferredfown_structfeatures_lockedlruvec_statstracing_graph_pauseavg_triggerspermcompat_robust_listbi_blkgktypelockrefin_dpm_listsrcu_struct_ptrsmm_structrtpoll_wakeupvlagi_uidwm5102_i2c_regmapREGCACHE_NONEbi_iocost_costwm5102_reg_defaultspinlocknr_dying_subsystimestampspid_namespace_syscallmod_arch_specificmax_write_lennum_static_call_sitesend_pfnvm_mmdebugfs_idwb_lcand_bytesguest_permmem_dqinfotruei_countHRTIMER_NORESTARTWB_SYNC_ALLbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipcgwb_treeUNEVICTABLE_PGMUNLOCKEDufdsexe_filehlist_bl_nodeipc_nspcp_listhwlock_modepid_linksfree_counts_sysfs_namerefcountvaddrrequestregmap_configpglist_datarw_hintIRQ_POLL_SOFTIRQtimeoutlast_switch_timenum_classesorc_unwind_ippage_counterqc_dqblkfprop_local_percpuavg_next_updatewm5102_aodmmappedseqcount_raw_spinlockbd_holder_dircpu_run_virtual_totalkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersproc_ns_operationsi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWERthrashing_countllist_headwait_startpercpu_clusterf_freeptrnr_freeclass_raw_spinlock_irqsave_try_is_conditionalmap_nr_maxget_dqblkshow_fdinfofixupirq_getuse_ackhashposix_acldd_key_falsehp_enabug_addr_dispdqi_igracemax_slack_shiftclass_rwsem_write_try_is_conditionalthaw_noirqrcu_syncdac_comp_enabledpreempt_notifierssrcu_last_gp_endbdi_ids_fsnotify_infocpu_delay_totaluser_keyring_registermempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyremovePGSCAN_ANONs_magicdl_overrunallocd_parentirq_drv_datamask_basepayloadac_minflti_sbmin_ratiomatchcommcompwake_invertcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxirqsatomic_open_zonerefsbio_end_io_tstart_prevent_timeMEMCG_OOM_GROUP_KILLlru_zone_sizereadahead_controlrtpoll_timerdirty_limit__kernel_gid32_tcompact_init_free_pfnNR_BOUNCEstate_maskf_credMODULE_STATE_COMINGnotify_countmg_dst_csetoffline_disabled__empty_rangesbd_devread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodpsi_statesfsnotify_sb_info__sigrestore_tbi_idx__kernel_loff_tdetachget_unmapped_areaTHP_FAULT_FALLBACK_CHARGEdev_pagemapPGDEACTIVATEwritepagessched_statisticsheadgpio_base__state_permpsi_task_countuprobe_taskdevice_get_dma_attrselfwriteback_controluclampirq_gpiosuper_operationsbi_cookiesplice_eofDIRECT_MAP_LEVEL3_SPLITnr_threaded_childrenCGROUP_INET_INGRESSutil_avgtaskrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockPGSCAN_SKIP_NORMALcputimeD_REAL_DATAbd_holderspt_regspipe_bufsNR_IOMMU_PAGESUCOUNT_COUNTSctx_iddirty_ratelimitd_rt_spc_warnsCGROUP_INET6_GETPEERNAMEi_verity_infoxsavetimespec_type__rb_parent_colorLRU_UNEVICTABLEdevres_lockbitsWB_REASON_MAXiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsCGROUP_DEVICEevents_fileout_vol_limitCOW_KSMntimenet_prio_cgrp_idvm_private_dataio_bitmap__bi_remainingsubtree_bstatuprobe_task_statetimerkobj_typeb_dirty_timei_pageshlist_bl_headino_warnlimitpfmemalloc_waitfasyncpidlistsi_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGEScharqf_ownerunix_inflightholders_dircont_lockfpu_state_permi_fsnotify_maskbio_vecUNEVICTABLE_PGCLEAREDsysctlsprotection_supportKSWAPD_LOW_WMARK_HIT_QUICKLYack_basegraph_get_port_parentUNEVICTABLE_PGRESCUED__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkREGCACHE_MAPLEvm_node_stat_diffbio_slabd_aliasNR_SHMEM__iovcpumaskPGLAZYFREEDdumpernode_size_lockwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootswrite_bandwidthd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nrbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tuse_single_writerunningrseq_event_masks_rootra_pageslegacy_cftypesTT_COMPATexternal_dcvddfwnode_handleNR_SLAB_RECLAIMABLE_Bwm5102_aod_irqsElf64_Symd_automountsupplypage_freeUCOUNT_PID_NAMESPACESread_syscallshlist_nulls_headNR_FILE_MAPPED_nr_pagesparentatimecopy_file_rangetask_cputime_atomicBALLOON_DEFLATEuser_definedkey_typecgrp_linksget_named_child_nodelaunder_foliocurr_targetis_suspendeduts_namespacefor_syncburstetypeei_funcsmodule_kobjectmemoryorderactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0rtpoll_totalno_updatecap_bsettagged_writepagesarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statebasess_bdev_filenuma_faultsperiodcgroup_subsysWORKINGSET_NODESfile_offsetlinux_binfmtpage_table_lock_sigfaultregmap_irq_sub_irq_mapcountersname_linkNR_ANON_THPScmaxrsstimer_slack_nsbus_typerstat_css_listpolicysharedTHP_SCAN_EXCEED_SWAP_PTEwait_queue_entrydismissd_real_typelookahead_bandio_portvolatile_tablenum_core_suppliesseq_starttask_cputimeraw_lockd_dnameac_schedspk_mutemax_hang_timecpus_mask_pad_b_dirtysubdirstask_groupinitializedstarttimeWM5110mmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnamewm5102_reva_patchrun_delaytailsvmstatslinenobi_io_vecbase_pfnstatget_inode_acl_addr_pkeymigrate_foliocustom_sliceNR_ACTIVE_ANONNUMA_LOCALspanned_pagesthread_keyringeffectivekparam_arrayutimestart_codeis_hardfsbasecompatibleblk_status_tac_uidclock_listmicd_timeoutattrsnuma_stat_itempercpu_drift_markcpumask_tgid_mapswregs_statedqb_isoftlimitdma_iommuorig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEonline_cntnr_cached_objectsia_mtimetrc_ipi_to_cpudirty_exceedednodeinfomxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldis_seentotalreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetrstat_cputime64_tWB_REASON_FOREIGN_FLUSHi_blocksnuma_faults_localityhas_child_subreaperi_aclmicd_rangeswrite_newwb_listswap_filelist_lockpm_domaincpu_bitmapconsumerucount_maxregmap_rangestatic_call_keyutil_estucountsqc_stateKCOMPACTD_MIGRATE_SCANNEDpageset_high_minsoftirq_next_timerpresent_early_pagescheck_flagsswp_entry_tbi_inline_vecsmemcg_css_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventLRU_ACTIVE_FILENR_MLOCKset_performance_stateclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryimplicit_on_dflk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreserveCGROUP_UDP4_SENDMSGquota_infoload_sumvfsgid_tinit_datacoublockioacac_exe_inodenr_to_scanthreaded_csetsDEVICE_PANEL_UNKNOWNfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treedentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalper_cpu_zonestatsDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkBALLOON_MIGRATEpushmm_walkDEV_DMA_COHERENTNR_ZONE_LRU_BASElinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancesstart_all_reasonwb_bytesrangeCGROUP_UNIX_GETSOCKNAMEcgroup_base_statfutex_exit_mutexCGROUP_UNIX_RECVMSGjd_gpio5_nopull__MTHP_STAT_COUNTmicd_force_micbiashandle_post_irqval_bitswb_stat_itemcompact_blockskip_flushtrc_blkd_nodewrite_s64clk32k_srcwriteback_inodesd_spaceWB_REASON_PERIODICgraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameread_s64bi_iopriou_flagsnvcswac_tgetimewatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingUCOUNT_RLIMIT_MEMLOCKi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typeNUMA_FOREIGNhighi_rdevlist_lru_nodeCGROUP_INET4_GETSOCKNAMEwr_noinc_tableself_exec_idkernfs_opsfile_lockMTHP_STAT_NR_ANONtype_level_high_valMODULE_STATE_LIVEstopnr_migrationsa_opsxa_flagsNR_STATSpad_bitsfreezebin_sizeNR_ZONE_WRITE_PENDINGclosedev_dma_attrgrphiPSI_CPU_FULLcftyped_spc_timerjump_entriesctl_dirasync_suspendmsi_device_dataalignsuper_blockset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorbvec_integrity_poolassoc_arraymnt_idmapdq_dqbmm_statesaved_tfElf64_XwordCGROUP_INET_SOCK_CREATEold_timespec32lock_class_keymemory_events_localnum_symsmodule_notes_attrsvm_lock_seqgenerationPIDTYPE_MAXroot_listnlinkcpu_countdefault_setavg_totalpercpu_refns_commonhorizontal_positionrlimit_maxarizona_ldo1_pdatapref_node_forkwait_queue__int128reclaimeddqi_privrss_statmems_allowed_seqmicd_rateTHP_UNDERUSED_SPLIT_PAGErefcntthawD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxac_niceDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrplocan_multi_writePGALLOC_DEVICEclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightCGROUP_GETSOCKOPTwm5102_irqvm_fileidr_basekswapd_orderNR_PSI_AGGREGATORSUNEVICTABLE_PGCULLEDuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalUCOUNT_INOTIFY_INSTANCESworker_privateis_relassoc_array_ptrTHP_SPLIT_PAGEqstrWORKINGSET_REFAULT_FILEma_flagsfutex_statePGSTEAL_KHUGEPAGEDorig_pmdacct_timexpds_op__rcu_icq_cachesizeZONE_DMA32CS47L24em_perf_tablewakeup_sourcef_posNR_FILE_DIRTYNR_RUNNINGnext_posix_timer_id__kernel_long_twb_switch_rwsemtask_fragsrcu_gp_mutexMEMCG_OOMdatalennr_wakeups_affine_attemptsNR_LRU_BASEPSI_CPUalt_lenuse_single_readcinblockextableexitcompact_consideredkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_countac_utimescaled__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexbpf_prog_arraycore_stateMTHP_STAT_SHMEM_FALLBACK_CHARGEtimerqueue_headserial_nrdac_comp_coeffdeferred_split_queuefutex_pi_statekstat__kernel_uid32_tsubsys_maskDEVICE_FIXEDpte_tPGSTEAL_ANONdevice_driverdying_tasksdl_server_has_tasks_frunnable_sumreal_credCOMPACTISOLATEDget_namefwnode_endpointcancel_forkepoll_watchesWM8997WM8998non_rcuPGALLOC_NORMALWORKINGSET_ACTIVATE_BASEkcompactd_waitUCOUNT_RLIMIT_COUNTSdqb_curspacegp_statebitsetload_avgcache_typeaccesscstimecfs_rqbi_bdev_uidst_spacefull_clustersmm_cid_next_scanns_typedfl_cgrpac_majfltposix_cputimers_work_upperwpcopy_delay_totalmodule_param_attrsshort unsigned intCGROUP_LSM_ENDwatermark_boostunitcpu_scaled_run_real_totali_mutex_dir_keyq_nodespc_warnlimitcluster_next_cpuNR_WRITTENctl_table_sizes_encodinggpl_crcsorc_entrykeysarizona_micbiasperiod_timerorig_ptedqb_curinodesnbp_thresholdload__s8pids_cgrp_idcss_allocZSWPINinvalidate_lock_keyUCOUNT_NET_NAMESPACESdma_maskprealloc_mutexselector_shiftnode_stat_itemreg_update_bitsobjcg_listsrcu_gp_seq_neededPGMAJFAULTdq_dqb_lock__kernel_ulong_tlruvec_stats_percpuregmapPSWPOUTdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_patharizonadio_mem_alignARIZONA_NUM_MCLKNR_THROTTLED_WRITTENbtimeextra2__u8is_roxlockCGROUP_SYSCTLcompact_cached_migrate_pfnrlim_maxDEVICE_PANEL_FRONTPGALLOC_DMA32runtime_deferred_listd_waitlocal_fwnodelist_lru_onerlimit_typezswap_writebackdevice_physical_location_horizontal_positionpercpu_ref_func_tseeksseq_stopkf_rootkiocbKSWAPD_HIGH_WMARK_HIT_QUICKLYbv_offsetprecious_regclass_rwsem_read_intr_is_conditionalcompact_order_failedfsuidread_flag_maskctl_table_argcompact_init_migrate_pfns_blocksize_bitsnuma_scan_periodmanaged_pagesmigration_disabledREGCACHE_FLATiter_typepositionclass_device_is_conditionalshrinker_idbio_setrootprojid_mapoom_reaper_listnr_reserved_highatomicshutdown_presym_VDSO32_NOTE_MASKbpf_storagenotifierno_callbacks__u16timers_activewait_countvirqNR_SHMEM_THPSsig_okdelaysirq_safereadaheadNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBwork_listNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingMEMCG_DATA_KMEMextentfsindexshstksrcu_sspwake_irqcan_attach__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32PGINODESTEALptracedtrc_reader_specialdevice_get_match_dataNUMA_HITHPROBE_GONEHRTIMER_SOFTIRQMTHP_STAT_SWPOUTactive_timeTHP_SPLIT_PAGE_FAILEDthrashing_delay_totali_sequencepool_datapage_memcg_data_flagsMTHP_STAT_ANON_FAULT_FALLBACK_CHARGEpgdatkeyring_semdisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfTHP_ZERO_PAGE_ALLOC_FAILEDi_dir_seqkqiddefer_syncPSI_CPU_SOMEKOBJ_NS_TYPE_NONE_watermarkswap_activatemkobjcore_cookiesrcu_supd_deleteb_more_ioPRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typenotifier_fn_tmf_statsf_iocb_flagshpdet_acc_idpoweroffcmaj_fltvtimemath_emu_infoNR_MEMSTALL_RUNNINGiowait_sumALLOCSTALL_NORMALnum_config_basesf_pathpidlist_mutex__u64journal_infocapabilitiesHTLB_BUDDY_PGALLOCsched_contributes_to_loadstatic_key_trueb_ioweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vmnode_start_pfnTHP_ZERO_PAGE_ALLOCNET_TX_SOFTIRQ_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimevm_starts_flagsfaultshow_statsdl_densityfreeptr_tread_dqblkac_giddq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgZSWPWBs_time_grancgroup_freezer_statekernel_cap_twait_listrequest_pendingdworkhrtimerMEMORY_DEVICE_COHERENTNR_PSI_STATESperf_event_ctxp__TASKSTATS_CMD_MAXi_dio_counts_bdiposix_cputimer_baseavgs_worknum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionmax_descendantswb_lcand_idserialclass_releasealloc_locks_dquotfolioqfoliosthreadedUCOUNT_TIME_NAMESPACESmemcg_memory_eventNR_MEMSTALLWM8280prev_posNR_ISOLATED_FILEdelayedseqcount_spinlockexpire_countuid_maps_umountis_bin_visiblepgoffsyscall_user_dispatchumount_beginnr_disk_swapinsrcu_tasks_exit_listclear_ackarchdataia_uidPSI_IO_FULLchildrenrb_subtree_lastno_pm_callbacksbuild_idPGMIGRATE_FAILpoweroff_latevfork_donenanosleeppud_tWM5102rt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcWB_REASON_LAPTOP_TIMERbi_issuequota_format_typeignoredvmstats_percputask_structanon_costdma_configuresrcu_n_exp_nodelaysuspend_timerquotalenPSI_AVGStotalreserve_pagesf_pipei_wb_frn_historylast_wakeenextmin_slab_pagesio_tlb_memarch_spinlock_tnr_tasksi_mtime_nsecperformancemmlistreg_readset_dqblksuppress_bind_attrsselector_regRPM_RESUMINGreg_offsetgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesNR_ZONE_INACTIVE_FILErd_tablef_llistreg_writehigh_maxphandleread_u64i_nlinkwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalnet_cls_cgrp_idsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_treclaim_waitfbatchALLOCSTALL_MOVABLEnr_writeback_throttledsharepagefault_disabledstate_startsyscwnr_memcgsil_prevget_name_prefixMEMCG_NR_MEMORY_EVENTScgroup_bpf_attach_typewlockedNR_VM_EVENT_ITEMSfreeze_superREGMAP_ENDIAN_LITTLEs_inode_list_lockUCOUNT_RLIMIT_MSGQUEUECGROUP_INET_SOCK_RELEASEsweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICoffline_nodequota_enablesched_avgntabzonedevice_typePGROTATEDmaj_fltarch_rwlock_ttree_scannedreg_defaults_rawclock_basefrag_cluster_nrSLABS_SCANNEDcdevmy_qgroup_leadermkdirzoneliste_csetsreal_blockedarg_locknum_exentriespid_ns_for_childrens_writerslaptop_mode_wb_timerlower_firstint32_tio_pagesoffset_ctxnr_failed_migrations_runningcompact_delay_totalclassesnext_timerclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyNR_FREE_CMA_PAGESqrwlocksplit_queueSWAP_RAwm5102_spi_regmapfile_ra_statemax_depthuser_structon_rqusersfs_contextswap_extent_rootmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfbypassllseekDEVICE_HORI_POS_CENTERtypes_supportedDL_DEV_PROBINGout_monolast_old_flushnext_offsetcommit_dqblknamespacei_ino_warnlimitdirtied_stampwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidcookiebd_stamp__UNIQUE_ID___addressable_wm5102_i2c_regmap618targethigh_mina_flagstrace_overrunwriteback_sync_modesswap_cluster_infosession_keyringcpusfop_flagsSYSCTL_TABLE_TYPE_DEFAULTkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuUNEVICTABLE_PGSTRANDEDilenmnt_flagsCGROUP_BPF_ATTACH_TYPE_INVALIDmemory_peakscred_guard_mutexsigcntfiltershrtimer_cpu_basecb_headcheck_quota_filePGDEMOTE_DIRECTwm5102_volatile_registerattributerestrict_linkdev_archdatamclki_deviceskey_perm_tcss_rstat_flushbio_integrity_payloadrescue_listswappinesspi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsrescue_locklist_lruusing_gplonly_symbolstarget_knsival_ptrthreaded_csets_nodelast_subtree_bstatrobust_listsym___kernel_rt_sigreturnsplit_queue_locksym_pvclock_pageserial_nodelen_descs_incoredqsregcache_typed_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockcgroup_fileforwarddev_links_infoloff_tthread_pidsrcu_gp_seqmicd_pol_gpiofreezer_cgrp_idCOMPACTSUCCESSPSI_MEM_FULLcgroup_rstat_cpu_archst_valueclass_write_lock_irq_is_conditionalWB_WRITEBACKKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodemm_statsof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typeUCOUNT_UTS_NAMESPACESPROBE_PREFER_ASYNCHRONOUSicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secWB_WRITTENmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpaddingmax_prop_frac__fillersaved_sigmaskd_timelru_listentriescpu_idfop_flags_tPGSCAN_SKIP_DEVICE__MAX_NR_ZONESFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedbd_statsbi_sizeswap_iocbmodule_statelast_used_atmemcg_vmstatsALLOCSTALL_DMAvm_endregulatorlast_queuednuma_migrate_retryuser_ns__statePSWPINfirsthandle_pre_irqmigrate_to_ramwb_domainwait_pidfdptrace_bpss_umount_keymax_ratiovm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsNUMA_HINT_FAULTS_LOCALia_ctimeproc_handlerFAULT_FLAG_INSTRUCTIONmigrate_from_cpuPSI_IO_SOMEasync_in_progressvolatile_regavgs_locksrcu_barrier_mutexi_private_dataElf64_Halfuse_autosuspendcompact_countnsproxycan_wakeupTIMER_SOFTIRQxol_areaPGPROMOTE_SUCCESSrlockfl_owner_tjd_invertcgroup_subsys_idMEMCG_DATA_OBJEXTScls_mskeuidwaitbug_tablemax_raw_writedirtied_time_whensequential_io_avgmicd_detect_debounceoom_groupnum_trace_bprintk_fmtcpu_run_real_totalTHP_SCAN_EXCEED_NONE_PTEvm_policypsi_aggregatorsWM1814perf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVEnum_reg_defaults_raw__state_sizethread_structcached_requested_keyenvp_indexrstat_css_nodeUCOUNT_FANOTIFY_GROUPSper_cpu_pagesctimeCPUTIME_IOWAITreleasemax_segment_sizenr_pagessched_dl_entity__kernel_dev_tatomic_write_lenwindow_lendqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_idPGALLOC_MOVABLENR_ZSPAGESs_dentry_lrubp_offsetnet_nsREGMAP_ENDIAN_BIGfolio_queuelast_task_numa_placementnr_descendantsCPUTIME_FORCEIDLEpgtable_tblock_startcgtimeWB_REASON_VMSCANsymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcusocket_pressureki_waitqnotify_timertrace_eval_mapdonemax_registerPGSCAN_ZONE_RECLAIM_FAILEDfscrypt_operationsrelease_workWB_REASON_FS_FREE_SPACEksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexac_btime64mg_dst_preload_noderatelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaPSI_MEM_SOMEswapin_countdl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDCPUTIME_GUESTsysv_semanon_vma_namefileattrwatermarkdeadpropsavg_nr_triggersfprop_globallong long unsigned intanon_nameblkcg_gqia_filesival_intcpu_usage_statnuma_preferred_nid_hugetlb_cgroupcore_suppliesdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatemm_listcss_idri_linkmicd_software_comparelistxattr_lowertrap_nrbinfmt_miscasync_probe_requestedcompat_long_tac_etimeactive_counts_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidateregmap_endianbus_groupsirq_chippmd_tmnt_namespacePSI_MEMnode_spanned_pagesd_sbsysv_shmregmap_irqdq_countctrlif_errorutf8data_tableset_latency_tolerancehugetlb_cgrp_idfoliowake_entryTHP_SPLIT_PMDxa_headsuidregmap_irq_chip_datacluster_infoi_readcountUCOUNT_USER_NAMESPACESlocked_vmrb_leftmg_src_cgrpseq_nextUCOUNT_INOTIFY_WATCHESsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tmisc_cgrp_idcpuacct_cgrp_idclass_rcu_is_conditionalbpf_local_storageactionclockid_tregmap_lockquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countmemcg_completionsksm_merging_pagesreg_format_endianfree_listregmap_range_cfgNR_SOFTIRQSautosleep_enabledptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_tbv_pagedomain_flagsnotify_nexte_cset_nodebus_dma_limitshort intmynodemicd_dbtimenr_free_highatomicpdataof_device_idarizona_micd_rangewb_waitqNR_VM_ZONE_STAT_ITEMSclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regPGDEMOTE_KSWAPDVTIME_USERsa_flagstestcss_offlinepad_untilDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2regmap_access_tabledestroy_rworklast_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datanr_extentsnr_scannedpoll_table_structfifodirect_IOn_no_rangesmain_statusno_rangeswait_queue_entry_tCMA_ALLOC_FAILpcpucurrent_may_mountseqlock_tbd_queuenuma_scan_offsetcgroup_subsys_stateMTHP_STAT_ANON_FAULT_ALLOCCGROUP_INET4_POST_BINDvertical_positionkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskMEMCG_SWAP_MAXfreezerNR_INACTIVE_FILEPSI_NONIDLELRU_INACTIVE_ANONregfuncindex_keymemalloc_noiohpdet_id_gpioGRPQUOTArwsemi_private_listia_validSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcluster_nrvirtmemi_rcui_atime_secqc_type_stateCGROUP_INET6_POST_BINDkey_serial_tdev_ueventsetupf_lockUNEVICTABLE_PGSCANNEDactiveno_statusdqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsgetattrFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listCGROUP_UNIX_SENDMSGxarray_startfadvisevmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidCGROUP_SOCK_OPSNR_UNACCEPTEDattribute_groupcontextposix_timersTHP_COLLAPSE_ALLOCper_cpu_nodestatselectorMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpmdval_tctl_table_rootARIZONA_MCLK1ARIZONA_MCLK2group_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizedfl_cftypeshpdet_clampdeferred_splitmce_kill_mewm5102_irqsuuid_tproperty_read_int_arrayuse_hwlockKSWAPD_INODESTEALcount_objectsctl_table_setnum_regs_stimezone_device_datakcompactd_max_orderpeaks_lockf_wb_erruseddefparamsaved_errfred_csfault_flagkprojid_tptracer_credtlb_gencgwb_domainmax_register_is_0page_mkwritekobjectaudit_ttyirq_flagsrtpoll_triggersmce_ripvstatfsctl_table_headeruse_relaxed_mmiodma_skip_syncDROP_PAGECACHEnumab_stateruntime_pmremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cbliststoragesTHP_SPLIT_PUDclass_groupspsi_groupnuma_nodePGSCAN_FILEWB_RECLAIMABLEi_mmap_rwsemUCOUNT_RLIMIT_NPROCDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchangedbdi_listwatch_listaudit_contextpp_ref_countsysfs_opsregulator_bulk_datasequential_iotime_namespaceCGROUP_INET4_BIND_large_mapcountsda_is_staticformatftopenclavereclaim_workbi_privateALLOCSTALL_DMA32PGLAZYFREEsp_regcreateiattrMTHP_STAT_SHMEM_FALLBACKrseqnfdssigvalvma_lockperf_event_listarizona_typeget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadwriteable_regd_realancestorstot_write_bandwidthmax_channels_clockedPGSCAN_ZONE_RECLAIM_SUCCESSexpiry_activedqi_max_spc_limitvm_numa_eventexception_table_entrynr_isolate_pageblockevent_countnr_to_writefallocatei_spc_warnlimitbuddy_listi_ino_timelimitnode_present_pagesi_mmap_writablemems_allowedMEMCG_SWAP_FAILtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderclk_lockMTHP_STAT_ZSWPOUTold_subtree_controltimewakee_flip_decay_tsmemcg_vmstats_percpus_max_linksnr_wakeups_syncNR_PSI_RESOURCESkallsymskcompactdprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvector__bi_cntCGROUP_UDP6_SENDMSGtimer_listrefaulteddevice_dma_supportedd_ino_warnshiwater_vmtracepointTASKSTATS_CMD_NEWcompound_headia_vfsuidunaccepted_pagesreg_baselrugen__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structunlockrpm_statussb_writersino_timelimitsplice_writestate_in_sysfsTHP_FILE_ALLOCbd_nr_sectorsqf_nextWB_REASON_BACKGROUNDCGROUP_UDP4_RECVMSGunmask_baserangescpuset_cgrp_idmemory_eventsiommu_mmcutimeem_tableNUMA_HUGE_PTE_UPDATESpersonalityget_stateNR_IOWAITtask_sizes_inodes_addrbinfmtirq_domainsigned charpersistent_keyring_registerprioprividle_notificationsched_infoMTHP_STAT_SHMEM_ALLOCd_fieldmaskuprobe_xol_opsseq_filefreeze_noirqNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsno_pmbi_max_vecsgroup_stop_countdac_comp_lockavg_last_updatelowest_bit_killktime_tNUMA_PAGE_MIGRATEUCOUNT_MNT_NAMESPACESchildren_low_usagesymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387iterd_ino_timeravx512_timestampfuncsend_datapercpu_pvec_drainedsubtree_controlPGSTEAL_KSWAPDsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncrange_startper_cpu_nodestatsnr_charged_bytessetleasepinspacct_structmust_resumescannedlong intpresent_pagesfile_lock_contextusagePGALLOC_DMAsiglockper_cpu_pagesetstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ssproperty_presentUSRQUOTAprintk_index_sizesymtabtimes_previnit_load_uArt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegidiomapdq_hashput_superfwnode_reference_argsnext_addrpushable_dl_tasksf_flagspatch_sizef_inodeprocnameCPUTIME_IDLEmark_dirtynr_dying_descendantsnum_srcu_structsbdi_writeback_pad1_kobj_completion__kernel_clockid_tseccompiteratorwm5102_revb_patchqc_infodev_nameTT_NONEVTIME_INACTIVEmicd_configsbalanced_dirty_ratelimit__kernel_timespec_pad2_cancelled_write_bytesac_tgidsrcu_usagebitmapacpi_match_tableCGROUP_INET4_GETPEERNAMEmemcgbw_time_stamp_sigvalmax_perf_statebvecnameidatalatency_recordwm5102_readable_registermod_kallsymsmnt_idrefaultshas_fully_powered_offdepth_pad3_wait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldstatus_baselistsssize_tsr_lockiopl_emulwork_structdesc_lenMTHP_STAT_SPLIT_DEFERREDflocktask_io_accountinginit_ack_maskedmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structreversepi_locklru_gen_mm_state___orig_eipprobestubget_timedapmmm_cid_activeelemsizedirty_paused_whenblkcg_cssmaxlenNR_ZONE_UNEVICTABLErelease_agent_pathclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavortv_nseci_lrudischargezone_idxdom_cgrpNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvol__UNIQUE_ID___addressable_wm5102_spi_regmap617NR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tmg_tasksuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_max_ino_limitdqi_fmt_idwr_tabledev_pin_infortpoll_trigger_locksrcu_structrlim_curnofaultmm_countcputime_atomicdrv_groupsstackoffline_waitqmnt_nsac_ppidfunctionwb_idki_flagsbvec_poolbd_start_sectsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timecgroup_rootdatastrtabtty_old_pgrpold_dom_cgrpdl_throttledi_rwsemrtpoll_statesget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextwake_baseopc1CPUTIME_IRQ__int128 unsignedpcountTHP_FAULT_FALLBACKregmap_multi_reg_write_bypassedrestore_noirqki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaTASKSTATS_CMD_UNSPECUCOUNT_FANOTIFY_MARKSruntime_autoPROBE_DEFAULT_STRATEGYrlimread_foliomax_raw_readsplit_queue_lennr_eventsWB_REASON_SYNCmicbiasiommuwriteable_noinc_regbi_opfBLOCK_SOFTIRQprivatehlistcftsTASKSTATS_CMD_GETst_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxswap_plugCGROUP_UNIX_CONNECTMEMCG_MAXsplice_pipes_lock_keymg_nodekswapdsrcu_gp_startopentime_nsit_real_incrwaitqmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmem_cgroup_idmodstqheads_activesym_vvar_startMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalget_irq_regdeadremap_file_rangeac_commnr_hangskcompactd_highest_zoneidxgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copPGSTEAL_DIRECTset_ownershipMEMCG_LOWdd_key_truezone_stat_itemhres_activebpf_raw_eventsswap_mapdq_dirtydl_deferbug_listdirect_completenbp_rl_startidr_rtlegacy_namexa_lockfxregs_statememcg_cgwb_frnload_weightdiscard_clusterskuid_tarch_datafpstateshrinker_infoblock_maxmthp_stat_itemrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateuts_nsMTHP_STAT_SWPINis_late_suspendedsysvsemTHP_FAULT_ALLOCucountvm_stat_diffCGROUP_SETSOCKOPTkmemcg_idignore_childrenlru_gen_mm_walk_pflagsrestore_earlyhap_actarizona_pdataclock_mutexfs_supersREGCACHE_RBTREEdom_csetevents_local_fileroot_csetdqb_bsoftlimitpendingf_task_worklru_gen_memcgiowait_countRCU_SOFTIRQPGFAULTnotifier_blockmemswdma_io_tlb_memrtpoll_scheduledstringread_countstoreforklruvecfutex_offsetvmpressurelong long intwrite_flag_maskbdevatomic_flagssysvshmHI_SOFTIRQbw_dworktimer_expirestrace_evalsactive_baseshierarchy_idearly_initmprotectac_exitcodesecurityxmm_spacememory_cgrp_idactivatef_pos_locksuspend_noirqPGSTEAL_FILEi_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesdepends_ondomain_dataidr_nextrelax_countlinelinkstart_timekernfs_nodercu_workRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEfront_paddup_xol_addrcapture_controlnr_wakeupspost_attachstartstart_brkstatic_key_modd_ino_softlimitxregs_statelock_argWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterscss_resetNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qscompact_defer_shiftswap_deactivatedomain_suffixblkcnt_tnum_micd_configsicq_treesi_codethread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batchrstat_flush_nextzeromapmap_pagesreschedule_countvfsmountcss_onlineextable_basenoinstr_text_sizenargsattributesmicd_force_micbiaswm5110_i2c_regmapset_child_tid_overrunwrite_u64tmpfilemicd_bias_start_timercu_read_lock_nestingem_perf_statemin_nrtick_dep_maskgpio_descprecious_tablelistthrottle_disksi_errnobsynce_freezememcg_lrus_inode_lrumemcg_nodesrcu_size_stateblk_plugunpinned_netfs_wbof_noderefsmmap_compat_baseWB_SYNC_NONEtrace_eventsenv_startcgrp_ancestor_storagedma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_statemask_unmask_non_invertedUTASK_SSTEPpkrureal_parentlockedcgroup_tasksetVTIME_GUESTrtpoll_next_updateregsslice_maxlast_switch_countqsize_tregmap_irq_typeblkio_delay_totaltime_ns_for_childrenfilesdqb_bhardlimitlivevm_faultatomic_write_unit_maxs_staterun_listixolbd_mappingsym_vvar_pagemodule_sect_attrsmg_src_preload_nodereturn_instancesoftirq_activatednum_irqsclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intnotifier_callrtpoll_taskgendiskspc_timelimits_instances__UNIQUE_ID___addressable_wm5110_patch617descseqcountoom_score_adjd_seqbi_crypt_contextia_vfsgidzone_typesize_tacpi_device_idcap_permittedTT_NATIVEzone_pgdatclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesu64_stats_syncrcu_tasks_idxsync_modercu_tasks_holdouttarget_listtype_level_low_valavg_write_bandwidthb_attachedpasid_activatedpi_sezonerefget_offset_ctxcore_forceidle_sumnum_main_regsfreeze_ucounti_ctime_nseccpuhp_deads_remove_countsyscall_workcompletionsdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalstatus_invertcallback_headmemory_failure_statss_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicrestoredelayed_callbi_itermax_nr_cid_statusd_sibkernel_ulong_tdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2css_extra_stat_show__kernel_timer_tclass_srcu_is_conditionalcss_releasedDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskavail_listsatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionsnd_soc_dapm_contextbv_lendiscard_workstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispblkcg_nodercu_specialclear_child_tidf_refextable_lenper_cpu_zonestatbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usagetree_reclaimedratelimit_states_pinsattrget_next_child_nodeFAULT_FLAG_WRITEreg_bitsstate_in_sysfswm5110_revd_irqswrite_syscallsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDext_capdebug_dirfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollac_padgraph_get_next_endpointmemcg_idnr_wakeups_idlertpoll_waitio_cqprobeelf64_symlatch_tree_nodepercpu_ref_datadestroy_workreadable_noinc_regDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSval_format_endiannum_main_status_bitssyscorewb_reason__s64LRU_ACTIVE_ANONdqi_bgrace__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_panelpoweroff_latectl_tableuid_tflush_requiredprocs_filesum_block_runtimepgmapmin_perf_statedq_opnum_micd_rangesrcu_tasks_nvcswwritetypetabclk32k_refclass_read_lock_irqsave_is_conditionalcan_forkfor_backgrounddma_poolswm5110_readable_register_addr_lsbctl_table_polli_generation_sigpollmxcsrdevtrange_cyclicd_rt_spc_hardlimiteminbi_end_ioblk_holder_opsfreepages_delay_totalnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inocgwb_listdyndbg_infocompact_cached_free_pfnindexfree_clustersdriver_datathread_headac_exe_devdev_pm_qosbi_sectormap_typeperiod_timef_oppids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizethawdq_sbNR_FILE_THPScgroupsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entrycancel_attachwaiterscmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimeinmodenestedrtpoll_nr_triggersnr_forced_migrationsac_pidseq_operationsnum_argsri_timerstack_canaryinactiveblksizesiblingmnt_rootnext_scanunregisteringf_raquota_writesrcu_barrier_cpu_cntNR_LRU_LISTSiopl_warnrmdirsockreg_stridebi_write_hinthash_lenget_policyshrinker_info_unitnr_reclaim_start__bi_nr_segmentstask_iterssym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecss_freecpu_basedevice_is_availabledquotdl_runtimechildren_min_usagenumbersswapin_delay_totalbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdhandle_mask_syncfaultableio_comp_batchshutdowndq_lockzswap_maxi_cdevldt_structenv_endobj_cgrouprescue_workqueueprogsextra1ptrace_messagenum_trace_events_sys_privateuse_raw_spinlockmin_usageinit_fs_contexts_subtypeheaderfuncperf_event_contextno_cgroup_ownernbp_th_nr_candwm5110_reva_patchcputimetlbflush_unmap_batchtype_in_masksoftfreepages_countyes_ranges__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6attachkprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatchersrange_endcompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsgpswbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodebpf_cgrp_storagenum_rangescurr_nrcorememsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataWORKINGSET_REFAULT_ANONtype_reg_maskget_dquotsnextentsnum_orcscma_pagesclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onregmap_register_patchvm_operations_structNR_ACTIVE_FILEjd_gpio5bin_attrs_newbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrennregis_softbindcntsRPM_SUSPENDEDreclaim_stateMEMCG_SWAP_HIGHevictedvma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGcacheline_paddingnrpages_refcounti_crypt_infopermissionsnr_frozen_descendantsbdi_nodeerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idxcgroup_namespaceZONE_DEVICE_head_1_head_2subsysbd_size_lockbackstate_add_uevent_senti_hashhlist_nodeio_uringregulator_init_datareg_sequencecore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointersect_attrsmg_dst_cgrpsoft_startonlineruntime_resumedup_xol_workwrite_charlocal_watermarktdm_slotsMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignhpdet_channeldelay_workoublockinuse_pagesrecent_cidkf_opscan_sleepkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmicvddgfp_tseccomp_filterstimei_mmapthaw_superREGMAP_ENDIAN_DEFAULTd_lrusignal_structperf_event_mutexrd_noinc_tableNR_PAGETABLEwm5110_reg_defaultcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrsprotectedsas_ss_flagsf_modeki_completenonfull_clustersvtime_statewakee_flipsset_acldismisspids_activedriverZONE_NORMALREGMAP_ENDIAN_NATIVEi_opldt_usr_semHRTIMER_RESTARTwpcopy_countkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEreg_shiftcredjump_entryreg_defaultreg_defaultsfrag_clustersproactive_compact_triggersrcu_gp_seq_needed_expgpioaddress_space_operationsspinlock_t__task_fpstatemaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startneeds_force_resumehuge_faultkstatfssites__lruveccluster_nextreg_writemem_cgroup_reclaim_iterevents_lockptracequota_disablekprobe_blacklistwork_lockcpus_ptrnotified_atpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysdelay_uskswapd_lockdirty_limit_tstampsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMED__NR_MEMCG_DATA_FLAGSexpiresrcuwaitnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotbstatfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutexblocking_notifier_headcoredump_datavm_stattasksmem_cgroup_per_node_pidaddress_spacemm_context_tirq_reg_strideuid_gid_extent__call_single_nodestartupseqcount_spinlock_tbio_issuei_wbcss_local_stat_showuint8_tMEMCG_HIGHregmap_irq_chippanelclass_idinactive_timer_pkeyfilenames_export_opclear_on_unmaskselector_maski_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqlowmem_reservepagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipebaseforce_scanhostuaddrfailedcgrps_wb_errold_subtree_ss_maskshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descscontiguousrecoveredexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidrseq_sigLRU_INACTIVE_FILEarizona_micd_configdev_pm_domainlimit0limit1nr_zonespages_skippedmigrate_modebio_poolfree_areakswapd_failureszswap_lruvec_stateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infolru_gen_mm_listi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksack_invertplatform_datad_comparesighanditerate_sharedis_visiblesignalWB_REASON_FORKER_THREADreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headswap_peaks__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackstat_thresholdlevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventfast_iohlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowunsigned charzone_start_pfnvdsomemtiermmap_legacy_basepipe_inode_infononresident_ageuint16_tsecurebitspartition_meta_infostate_initializeduring_cmd_iopollbi_poolcompat_uptr_tuevent_opssub_reg_offsetszero_flag_maskslicesas_ss_spnr_dirtiednum_kprobe_blacklistsubtree_ss_maskclass_local_lock_is_conditionalsuspend_latewakeupcg_listcgwb_release_mutexsrcu_barrier_completionwb_completionwm5110_is_adsp_memoryshrink_controlwritten_stampdriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapaod_irq_chipspan_seqlocknum_reg_defaultssessionidlast_bdp_sleep_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistZONE_DMAdebugfs_entryelemnr_retriescgwb_frnavg_refaultedwm5110_aodsigval_talimitundo_listdirty_foliorcharZONE_MOVABLEnr_populated_domain_childrenmissedkswapd_highest_zoneidxparent_could_setfcapquota_readst_shndxldo1freepageset_high_maxi_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securityactive_counts_dio_done_wq_dummy_bndmin_unmapped_pagessas_ss_sizespk_fmtuser_xfeaturesnr_wakeups_passivefile_system_typewb_tcand_idmtimeserver_has_tasksswap_events_fileoom_score_adj_minreadable_regkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_thigh_worknode_zonelistsrange_maxpathst_sizenr_frozen_taskslru_gen_foliormtp__UNIQUE_ID___addressable_wm5110_aod618wait_sumnum_tracepointsupidexit_codemempool_ttype_falling_valexec_startclass_read_lock_is_conditionalconsumersrtpoll_min_periodkernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workkeyring_semsrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribforceidle_sumrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opshighest_bitiopollregmap_unlockpagesizes_blocksizevm_pgofftimesauprobecan_swaprelease_agent_worknuma_workupdate_timeptrace_dr7priority_call_addrexpireloginuidcheckrtpoll_untilexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_donenbp_rl_nr_cand__lstateupdated_nextueventlock_countrefcount_tcset_linksplugchild_countsaved_auxvmce_addrlast_bstatnum_bugsqf_ops__vm_flagsnum_config_regsmod_nametype_rising_valproperty_read_string_arraymm_cidmemory_tierunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalorig_objcgrseq_csdcvddnum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnode_zoneswindow_startnbp_th_startelow_pincounttablesDEVICE_PANEL_BOTTOMmin_seqlist_headlru_lockhwlock_idrange_mintgidbatchedfor_reclaimwrite_protect_seqtdm_widthcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holderend_codeblkio_countqspinlocklru_genNR_VMSCAN_WRITEinsnfilldir_tfolio_batchlow_usagedl_non_contendingdir_contexttracepoint_ptr_tutaskfailcntNR_UNEVICTABLEsched_entityd_spc_hardlimitgpio_defaultslockdep_keylong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baserescue_workio_contexthpdet_acc_id_linegpl_symsgroupseq_showctl_nodeswait_queue_headcow_pageinumac_btimeblocki_spc_timelimitreturn_instancesn_yes_rangesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevicebi_integritys_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namedisable_lockingnoderesetfor_kupdatevm_lockwb_tcand_bytesno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areatype_reg_offsetWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatipc_namespaceexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentread_charcgroup_nsia_sizein_hrtirqs_master_keysac_stimescaledpropertywchar_addr_bndkernel_symboli_opflagssubsys_databi_statusnr_cgrpstv_secpid_ttask_listftrace_sleeptimeset_type_configrun_nodema_rooturing_cmdpsi_filesMEMCG_OOM_KILLnr_failed_migrations_affineNR_SWAPCACHEuser_cpus_ptrirq_delay_totalpi_top_taskNR_WRITEBACK_TEMPactoruprobenotifier_subscriptionss_readonly_remountbiasutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthmax_seqi_sizedl_deadline_hugetlb_hwpoisonpsi_group_cpuubufksm_rmap_itemspageset_batcharizona_micsupp_pdatanr_populated_csetsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlockdmic_refkswapd_waittimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flagskeyring_name_listfile_costread_posstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuealloc_factorKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimenr_populated_threaded_childrensigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendinghlist_nulls_nodenr_deferredfown_structfeatures_lockedlruvec_statstracing_graph_pauseavg_triggerspermcompat_robust_listbi_blkgktypelockrefin_dpm_listsrcu_struct_ptrsmm_structrtpoll_wakeupvlagi_uidREGCACHE_NONEbi_iocost_costspinlocknr_dying_subsystimestampspid_namespace_syscallmod_arch_specificmax_write_lennum_static_call_sitesend_pfnvm_mmdebugfs_idwb_lcand_bytesguest_permmem_dqinfotruei_countHRTIMER_NORESTARTWB_SYNC_ALLbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipcgwb_treeufdsexe_filehlist_bl_nodeipc_nspcp_listhwlock_modepid_linksfree_counts_sysfs_namerefcountvaddrrequestregmap_configpglist_datarw_hinttimeoutdma_configurelast_switch_timenum_classesorc_unwind_ippage_counterqc_dqblkfprop_local_percpuavg_next_updatemmappedseqcount_raw_spinlockbd_holder_dircpu_run_virtual_totalkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWERthrashing_countllist_headwait_startpercpu_clusterf_freeptrnr_freeclass_raw_spinlock_irqsave_try_is_conditionalmap_nr_maxget_dqblkshow_fdinfofixupirq_getuse_ackset_ownershipposix_acldd_key_falsehp_enabug_addr_dispdqi_igracemax_slack_shiftclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_endbdi_ids_fsnotify_infocpu_delay_totaluser_keyring_registermempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentirq_drv_datamask_basepayloadac_minflti_sbmin_ratiod_sbcommcompwake_invertcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxirqsatomic_open_zonerefsbio_end_io_tstart_prevent_timeMEMCG_OOM_GROUP_KILLlru_zone_sizereadahead_controlrtpoll_timerdirty_limit__kernel_gid32_tcompact_init_free_pfnkernfs_open_filestate_maskf_credMODULE_STATE_COMINGnotify_countmg_dst_csetoffline_disabled__empty_rangesbd_devread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_tbi_idx__kernel_loff_tpropertiesdetachget_unmapped_areadev_pagemapwritepagessched_statisticsheadgpio_base__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampirq_gpiosuper_operationsbi_cookiesplice_eofnr_threaded_childrenutil_avgtaskrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsNR_IOMMU_PAGESctx_iddirty_ratelimitd_rt_spc_warnsclk32k_srci_verity_infoxsavetimespec_type__rb_parent_colorLRU_UNEVICTABLEdevres_lockbitsWB_REASON_MAXiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsevents_fileout_vol_limitwm5110_revd_irqntimevm_private_dataio_bitmap__bi_remainingsubtree_bstatuprobe_task_statetimerkobj_typeb_dirty_timei_pageshlist_bl_headino_warnlimitpfmemalloc_waitarch_uprobe_taskfasyncpidlistsi_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGESchardomainunix_inflightholders_dircont_lockfpu_state_permi_fsnotify_maskbio_vecsysctlsprotection_supportack_basegraph_get_port_parentWM1831__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkREGCACHE_MAPLEvm_node_stat_diffbio_slabd_aliasNR_SHMEM__iovcpumaskdumpernode_size_lockwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootswrite_bandwidthd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tuse_single_writerunningrseq_event_masks_rootra_pageslegacy_cftypesTT_COMPATexternal_dcvddfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountsupplypage_freeread_syscallshlist_nulls_headNR_FILE_MAPPED_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typecgrp_linksget_named_child_nodelaunder_foliocurr_targetis_suspendeduts_namespacefor_syncburstwm5110_revd_patchetypeei_funcsmodule_kobjectmemoryorderactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsettagged_writepagesarchdata_sourcepower_statewm5110_is_rev_b_adsp_memorynr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsperiodcgroup_subsysWORKINGSET_NODESfile_offsetlinux_binfmtpage_table_lock_sigfaultregmap_irq_sub_irq_mapcountersname_linkNR_ANON_THPScmaxrsstimer_slack_nsbus_typerstat_css_listpolicysharedwait_queue_entryrtpoll_totald_real_typelookahead_bandio_portvolatile_tablenum_core_suppliesseq_starttask_cputimeraw_lockd_dnameac_schedwm5110_irqspk_mutemax_hang_timecpus_mask_pad_b_dirtysubdirstask_groupinitializedstarttimeWM5110mmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailsvmstatslinenobi_io_vecbase_pfnstatget_inode_acl_addr_pkeymigrate_foliocustom_sliceNR_ACTIVE_ANONspanned_pagesthread_keyringeffectivekparam_arrayutimestart_codeis_hardfsbasecompatibleblk_status_tac_uidclock_listmicd_timeoutattrspercpu_drift_markcpumask_tgid_mapswregs_statedqb_isoftlimitdma_iommuorig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEonline_cntnr_cached_objectsia_mtimetrc_ipi_to_cpudirty_exceedednodeinfomxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain__UNIQUE_ID___addressable_wm5110_i2c_regmap622wm5110_aod_irqs_sigchldis_seentotalreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetrstat_cputime64_tWB_REASON_FOREIGN_FLUSHi_blocksnuma_faults_localityhas_child_subreaperi_aclmicd_rangeswrite_newwb_listswap_filelist_lockpm_domaincpu_bitmapconsumerucount_maxregmap_rangestatic_call_keyutil_estucountsqc_statepageset_high_minsoftirq_next_timerpresent_early_pagescheck_flagsswp_entry_tbi_inline_vecsmemcg_css_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventLRU_ACTIVE_FILEset_performance_stateclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryimplicit_on_dflk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacac_exe_inodenr_to_scanthreaded_csetsDEVICE_PANEL_UNKNOWNfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treedentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalper_cpu_zonestatsDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushmm_walkDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancesstart_all_reasonwb_bytesrangecgroup_base_statfutex_exit_mutexjd_gpio5_nopullhandle_post_irqval_bitscompact_blockskip_flushtrc_blkd_nodewrite_s64writeback_inodesd_spacewm5110_spi_regmapWB_REASON_PERIODICgraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameread_s64bi_iopriou_flagsnvcswac_tgetimewatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidproc_ns_operationsmin_vruntimefaults_disabled_mappingquota_typehighi_rdevlist_lru_nodewr_noinc_tableself_exec_idkernfs_opsfile_locktype_level_high_valMODULE_STATE_LIVEstopnr_migrationsa_opsxa_flagspad_bitsfreezebin_sizeclosedev_dma_attrgrphicftyped_spc_timerjump_entriesctl_dirasync_suspendmsi_device_dataalignsuper_blockset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorbvec_integrity_poolassoc_arraymnt_idmapdq_dqbmm_statesaved_tfElf64_Xwordold_timespec32lock_class_keymemory_events_localnum_symsmodule_notes_attrsvm_lock_seqpdeath_signalgenerationPIDTYPE_MAXroot_listnlinkcpu_countdefault_setavg_totalpercpu_refns_commonhorizontal_positionrlimit_maxarizona_ldo1_pdatapref_node_forkwait_queue__int128reclaimeddqi_privrss_statmems_allowed_seqmicd_raterefcntregmap_irqD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxac_niceDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrplocan_multi_writeclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_fileidr_basekswapd_orderuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrqstrWORKINGSET_REFAULT_FILEma_flagsfutex_stateorig_pmdacct_timexpds_op__rcu_icq_cachesizeZONE_DMA32CS47L24em_perf_tablewakeup_sourcef_posNR_FILE_DIRTYnext_posix_timer_id__kernel_long_twb_switch_rwsemtask_fragsrcu_gp_mutexMEMCG_OOMdatalennr_wakeups_affine_attemptsNR_LRU_BASEalt_lenuse_single_readcinblockextableexitcompact_consideredwm5110_revb_patchkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_countac_utimescaled__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexbpf_prog_arraycore_statetimerqueue_headserial_nrdac_comp_coeffdeferred_split_queuefutex_pi_statekstat__kernel_uid32_tsubsys_maskDEVICE_FIXEDpte_tdevice_driverdying_tasksdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointcancel_forkepoll_watchesWM8997WM8998non_rcuWORKINGSET_ACTIVATE_BASEkcompactd_waitdqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidst_spacefull_clustersmm_cid_next_scanns_typedfl_cgrpac_majfltposix_cputimers_work_upperwpcopy_delay_totalmodule_param_attrsshort unsigned intwatermark_boostunitcpu_scaled_run_real_totali_mutex_dir_keyq_nodespc_warnlimitcluster_next_cpuNR_WRITTENctl_table_sizes_encodinggpl_crcsorc_entrykeysarizona_micbiasperiod_timerorig_ptedqb_curinodesnbp_thresholdload__s8css_allocinvalidate_lock_keydma_maskprealloc_mutexselector_shiftnode_stat_itemreg_update_bitsobjcg_listsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tlruvec_stats_percpuregmapdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_patharizonadio_mem_alignARIZONA_NUM_MCLKNR_THROTTLED_WRITTENbtimeextra2__u8is_roxlockcompact_cached_migrate_pfnrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onezswap_writebackdevice_physical_location_horizontal_positionseeksseq_stopkf_rootkiocbbv_offsetprecious_regclass_rwsem_read_intr_is_conditionalcompact_order_failedfsuidread_flag_maskctl_table_argcompact_init_migrate_pfns_blocksize_bitsnuma_scan_periodmanaged_pagesmigration_disabledREGCACHE_FLATiter_typepositionclass_device_is_conditionalshrinker_idbio_setrootprojid_mapoom_reaper_listnr_reserved_highatomicshutdown_presym_VDSO32_NOTE_MASKbpf_storagenotifierno_callbacks__u16timers_activewait_countvirqNR_SHMEM_THPSsig_okdelaysqf_ownerreadaheadNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBwork_listNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingMEMCG_DATA_KMEMextentfsindexshstksrcu_sspwake_irqcan_attach__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timethrashing_delay_totali_sequencepool_datapage_memcg_data_flagspgdatdisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONE_watermarkswap_activatemkobjcore_cookiesrcu_supd_deleteb_more_ioPRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tmf_statsf_iocb_flagshpdet_acc_idpoweroffcmaj_fltvtimemath_emu_infoiowait_sumnum_config_basesf_pathpidlist_mutex__u64journal_infocapabilitiessched_contributes_to_loadstatic_key_trueb_ioweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vmnode_start_pfn_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimevm_starts_flagsfaultshow_statsdl_densityfreeptr_tread_dqblkac_giddq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grancgroup_freezer_statekernel_cap_twait_listrequest_pendingdworkhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_baseavgs_worknum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionmax_descendantswb_lcand_idserialclass_releasealloc_locks_dquotfolioqfoliosthreadedupdated_childrenmemcg_memory_eventWM8280prev_posNR_ISOLATED_FILEdelayedseqcount_spinlockexpire_countuid_maps_umountis_bin_visiblepgoffsyscall_user_dispatchumount_beginnr_disk_swapinsrcu_tasks_exit_listclear_ackarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_donenanosleeppud_tWM5102rt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcWB_REASON_LAPTOP_TIMERbi_issuequota_format_typeignoredvmstats_percputask_structanon_costrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalentotalreserve_pagesf_pipei_wb_frn_historylast_wakeenextmin_slab_pagesio_tlb_memarch_spinlock_tnr_tasksi_mtime_nsecperformancemmlistreg_readset_dqblksuppress_bind_attrsselector_regRPM_RESUMINGreg_offsetgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesrd_tablef_llisthigh_maxphandleread_u64i_nlinkwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_treclaim_waitfbatchnr_writeback_throttledsharepagefault_disabledstate_startsyscwnr_memcgsil_prevget_name_prefixMEMCG_NR_MEMORY_EVENTSwlockedfreeze_superREGMAP_ENDIAN_LITTLEs_inode_list_lockruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICoffline_nodequota_enablesched_avgntabzonedevice_typemaj_fltarch_rwlock_ttree_scannedreg_defaults_rawclock_basefrag_cluster_nrcdevmy_qgroup_leadermkdirzoneliste_csetsreal_blockedarg_locknum_exentriespid_ns_for_childrens_writerslaptop_mode_wb_timerlower_firstint32_tio_pagesoffset_ctxnr_failed_migrations_runningcompact_delay_totalclassesnext_timerclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlocksplit_queuefile_ra_statemax_depthuser_structon_rqusersfs_contextswap_extent_rootmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfbypassllseekDEVICE_HORI_POS_CENTERtypes_supportedDL_DEV_PROBINGout_monolast_old_flushnext_offsetcommit_dqblknamespacei_ino_warnlimitdirtied_stampwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidcookiebd_stamptargethigh_mina_flagstrace_overrunwriteback_sync_modesswap_cluster_infosession_keyringcpusfop_flagsSYSCTL_TABLE_TYPE_DEFAULTkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsmemory_peakscred_guard_mutexsigcntfiltershrtimer_cpu_basecb_headcheck_quota_filePGDEMOTE_DIRECTattributerestrict_linkdev_archdatamclki_deviceskey_perm_tcss_rstat_flushbio_integrity_payloadrescue_listswappinesspi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symswm5110_irqsrescue_locklist_lruusing_gplonly_symbolstarget_knsival_ptrthreaded_csets_nodelast_subtree_bstatrobust_listsym___kernel_rt_sigreturnsplit_queue_locksym_pvclock_pageserial_nodelen_descs_incoredqsregcache_typed_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockcgroup_fileforwarddev_links_infoloff_tthread_pidsrcu_gp_seqmicd_pol_gpiocgroup_rstat_cpu_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodemm_statsof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typePROBE_PREFER_ASYNCHRONOUSicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpaddingmax_prop_frac__fillersaved_sigmaskd_timelru_listentriescpu_idfop_flags_t__MAX_NR_ZONESFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedbd_statsbi_sizemodule_statelast_used_atmemcg_vmstatsvm_endregulatorlast_queuednuma_migrate_retryuser_ns__stateRPM_REQ_NONEfirstiommu_grouphandle_pre_irqmigrate_to_ram__UNIQUE_ID___addressable_wm5110_spi_regmap621wb_domainwait_pidfdptrace_bpss_umount_keymax_ratiovm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeproc_handlerFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progressvolatile_regavgs_locksrcu_barrier_mutexi_private_dataElf64_Halfbw_dworkcompact_countnsproxycan_wakeupcache_typexol_areaPGPROMOTE_SUCCESSrlockfl_owner_tjd_invertMEMCG_LOWMEMCG_DATA_OBJEXTScls_mskeuidwaitbug_tablemax_raw_writedirtied_time_whensequential_io_avgmicd_detect_debounceoom_groupnum_trace_bprintk_fmtcpu_run_real_totalvm_policyWM1814perf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVEnum_reg_defaults_raw__state_sizethread_structcached_requested_keyenvp_indexbvec_iterper_cpu_pagesctimereleasemax_segment_sizewm5110_patchnr_pagessched_dl_entity__kernel_dev_tatomic_write_lenwindow_lendqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetnet_nsREGMAP_ENDIAN_BIGfolio_queuelast_task_numa_placementnr_descendantspgtable_tblock_startcgtimeWB_REASON_VMSCANsymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcusocket_pressureki_waitqnotify_timertrace_eval_mapdonemax_registerfscrypt_operationsrelease_workWB_REASON_FS_FREE_SPACEksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexac_btime64mg_dst_preload_noderatelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaswapin_countdl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERrstat_css_nodeFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrwatermarkdeadpropsavg_nr_triggersfprop_globallong long unsigned intanon_nameblkcg_gqhashia_filesival_intnuma_preferred_nid_hugetlb_cgroupcore_suppliesdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatemm_listcss_idri_linkmicd_software_comparelistxattr_lowertrap_nrbinfmt_miscasync_probe_requestedcompat_long_tac_etimeconfig_bases_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidateregmap_endianbus_groupsirq_chippmd_tmnt_namespacenode_spanned_pagessysv_shmdq_countctrlif_errorutf8data_tableset_latency_tolerancedev_get_drvdatafoliowake_entryxa_headsuidregmap_irq_chip_datacluster_infoi_readcountlocked_vmrb_leftmg_src_cgrpseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tregmap_lockquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countmemcg_completionsksm_merging_pagesreg_format_endianfree_listregmap_range_cfgautosleep_enabledptrace_entryuse_autosuspendrecent_used_cpunum_jump_entriess_qcopatomic_tbv_page_flagsnotify_nexte_cset_nodebus_dma_limitshort intmynodemicd_dbtimenr_free_highatomicpdataof_device_idarizona_micd_rangewb_waitqclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_owner__UNIQUE_ID___addressable_wm5110_revd_irq620bp_regPGDEMOTE_KSWAPDVTIME_USERsa_flagstestcss_offlinepad_untilDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2regmap_access_tabledestroy_rworklast_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datanr_extentsnr_scannedpoll_table_structfifodirect_IOn_no_rangesmain_statusno_rangeswait_queue_entry_tpcpucurrent_may_mountseqlock_tbd_queuenuma_scan_offsetcgroup_subsys_statevertical_positionkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskMEMCG_SWAP_MAXfreezerNR_INACTIVE_FILELRU_INACTIVE_ANONregfuncindex_keymemalloc_noiohpdet_id_gpioGRPQUOTArwsemi_private_listia_validSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcluster_nrvirtmemi_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockinit_dataactiveno_statusdqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisevmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersper_cpu_nodestatselectorMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nssource_listcgroup_bpfswap_readahead_info__fpstateactive_refpmdval_tctl_table_rootARIZONA_MCLK1ARIZONA_MCLK2group_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizedfl_cftypeshpdet_clampdeferred_splitmce_kill_meuuid_tproperty_read_int_arrayuse_hwlockcount_objectsctl_table_setnum_regs_stimezone_device_datakcompactd_max_orderpeaks_lockf_wb_erruseddefparamsaved_errfred_csfault_flagkprojid_tptracer_credtlb_gencgwb_domainmax_register_is_0page_mkwritekobjectaudit_ttyirq_flagsrtpoll_triggersmce_ripvstatfsctl_table_headeruse_relaxed_mmionumab_stateruntime_pmremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cbliststoragesclass_groupspsi_groupnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchangedbdi_listwatch_listaudit_contextpp_ref_countsysfs_opsregulator_bulk_datasequential_iotime_namespace_large_mapcountsda_is_staticformatftopenclavereclaim_workbi_privatecreateiattrrseqnfdssigvalvma_lockperf_event_listarizona_typeget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadwriteable_regd_realancestorstot_write_bandwidthmax_channels_clockedexpiry_activedqi_max_spc_limitvm_numa_eventexception_table_entrynr_isolate_pageblockevent_countnr_to_writefallocatei_spc_warnlimitbuddy_listi_ino_timelimitnode_present_pagesi_mmap_writablemems_allowedMEMCG_SWAP_FAILtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderclk_lockold_subtree_controltimewm5110_volatile_registerwakee_flip_decay_tsmemcg_vmstats_percpus_max_linksnr_wakeups_synckallsymskcompactdprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvector__bi_cnttimer_listrefaulteddevice_dma_supportedd_ino_warnshiwater_vmtracepointdac_comp_enabledcompound_headia_vfsuidunaccepted_pagesreg_baselrugen__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structunlockrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitbd_nr_sectorsqf_nextWB_REASON_BACKGROUNDunmask_baserangesmemory_eventsiommu_mmcutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charpersistent_keyring_registerprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupswm5110_reve_patchfile_operationsno_pmbi_max_vecsgroup_stop_countdac_comp_lockavg_last_updatelowest_bit_killktime_tchildren_low_usagesymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387iterd_ino_timeravx512_timestampfuncsend_datapercpu_pvec_drainedsubtree_controlsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncrange_startper_cpu_nodestatsnr_charged_bytessetleasepinspacct_structmust_resumescannedlong intpresent_pagesfile_lock_contextusagesiglockper_cpu_pagesetstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ssproperty_presentUSRQUOTAprintk_index_sizesymtabtimes_previnit_load_uArt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegid__UNIQUE_ID___addressable_wm5110_irq619iomapdq_hashput_superfwnode_reference_argsnext_addrpushable_dl_tasksf_flagsf_inodeprocnamemark_dirtynr_dying_descendantsnum_srcu_structsbdi_writeback_pad1_kobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEmicd_configsbalanced_dirty_ratelimit_pad2_cancelled_write_bytesac_tgidsrcu_usagebitmapacpi_match_tablememcgbw_time_stamp_sigvalmax_perf_statebvecnameidatalatency_recordmod_kallsymsmnt_idrefaultshas_fully_powered_offdepth_pad3_wait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldstatus_baselistsssize_tsr_lockiopl_emulwork_structdesc_lenflocktask_io_accountinginit_ack_maskedmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structreversepi_locklru_gen_mm_state___orig_eipprobestubget_timedapmmm_cid_activeelemsizedirty_paused_whenblkcg_cssmaxlensuspend_noirqDEVICE_VERT_POS_UPPERrelease_agent_pathclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lrudischargezone_idxdom_cgrpNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvolNR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tmg_tasksuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_max_ino_limitdqi_fmt_idwr_tableuid_gid_maprtpoll_trigger_locksrcu_structrlim_curnofaultmm_countdrv_groupsstackoffline_waitqmnt_nsac_ppidfunctionwb_idki_flagsbvec_poolbd_start_sectsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timecgroup_rootdatastrtabtty_old_pgrpold_dom_cgrpdl_throttledi_rwsemrtpoll_statesget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextwake_baseopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_foliomax_raw_readsplit_queue_lennr_eventsWB_REASON_SYNCmicbiasiommuwriteable_noinc_regbi_opfswap_iocbprivatehlistcftsst_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxswap_plugMEMCG_MAXsplice_pipes_lock_keymg_nodekswapdsrcu_gp_startopentime_nsit_real_incrwaitqmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmem_cgroup_idmodswm5110_is_rev_d_adsp_memorytqheads_activesym_vvar_startMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalget_irq_regdeadremap_file_rangeac_commnr_hangskcompactd_highest_zoneidxgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsswap_mapdq_dirtydl_deferbug_listdirect_completenbp_rl_startidr_rtlegacy_namexa_lockfxregs_statememcg_cgwb_frnload_weightdiscard_clusterskuid_tarch_datafpstateshrinker_infoblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateuts_nsis_late_suspendedsysvsemucountvm_stat_diffkmemcg_idignore_childrenlru_gen_mm_walk_pflagsrestore_earlyhap_actarizona_pdataclock_mutexfs_supersREGCACHE_RBTREEdom_csetevents_local_fileroot_csetdqb_bsoftlimitpendingf_task_worklru_gen_memcgiowait_countnotifier_blockmemswdma_io_tlb_memrtpoll_scheduledstringread_countstoreforklruvecfutex_offsetvmpressurelong long intwrite_flag_maskbdevatomic_flagssysvshmtimer_expirestrace_evalsactive_baseshierarchy_idearly_initmprotectac_exitcodesecurityxmm_spaceactivatef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesdepends_ondomain_dataidr_nextrelax_countlinelinkstart_timekernfs_nodercu_workRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEfront_paddup_xol_addrcapture_controlnr_wakeupspost_attachstartstart_brkstatic_key_modd_ino_softlimitxregs_statelock_argWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterscss_resetNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qscompact_defer_shiftswap_deactivatedomain_suffixblkcnt_tnum_micd_configsicq_treesi_codethread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batchrstat_flush_nextzeromapmap_pagesreschedule_countvfsmountcss_onlineextable_basenoinstr_text_sizenargsattributesmicd_force_micbiasset_child_tid_overrunwrite_u64tmpfilemicd_bias_start_timercu_read_lock_nestingem_perf_statemin_nrtick_dep_maskgpio_descprecious_tablelistthrottle_disksi_errnobsynce_freezememcg_lrus_inode_lrumemcg_nodesrcu_size_stateblk_plugunpinned_netfs_wbof_noderefsmmap_compat_baseWB_SYNC_NONEtrace_eventsenv_startcgrp_ancestor_storagedma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_statemask_unmask_non_invertedUTASK_SSTEPpkrureal_parentlockedcgroup_tasksetVTIME_GUESTrtpoll_next_updateregsslice_maxlast_switch_countqsize_tregmap_irq_typeblkio_delay_totaltime_ns_for_childrenfilesdqb_bhardlimitlivevm_faultatomic_write_unit_maxs_staterun_listixolbd_mappingsym_vvar_pagemodule_sect_attrsmg_src_preload_nodereturn_instancesoftirq_activatednum_irqsclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intnotifier_callrtpoll_taskgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqbi_crypt_contextia_vfsgidzone_typesize_tacpi_device_idcap_permittedwm8997_patchTT_NATIVEzone_pgdatclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesu64_stats_syncrcu_tasks_idxsync_modercu_tasks_holdouttarget_listtype_level_low_valavg_write_bandwidthb_attachedpasid_activatedpi_sezonerefget_offset_ctxcore_forceidle_sumnum_main_regsfreeze_ucounti_ctime_nseccpuhp_deads_remove_countsyscall_workcompletionsdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalstatus_invertcallback_headmemory_failure_statss_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicrestoredelayed_callbi_itermax_nr_cid_statusd_sibkernel_ulong_tdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2css_extra_stat_show__kernel_timer_tclass_srcu_is_conditionalcss_releasedDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskavail_listsatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionsnd_soc_dapm_contextbv_lendiscard_workstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispblkcg_nodercu_specialclear_child_tidf_refextable_lenper_cpu_zonestatbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usagetree_reclaimedratelimit_states_pinsattrget_next_child_nodeFAULT_FLAG_WRITEreg_bitsstate_in_sysfswrite_syscallsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDext_capdebug_dirfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollac_padgraph_get_next_endpointmemcg_idnr_wakeups_idlertpoll_waitio_cqprobeelf64_symlatch_tree_nodepercpu_ref_datadestroy_workreadable_noinc_regDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSval_format_endiannum_main_status_bitssyscorewb_reason__s64LRU_ACTIVE_ANONdqi_bgrace__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_panelpoweroff_latectl_tableuid_tflush_requiredprocs_filesum_block_runtimepgmapmin_perf_statedq_opnum_micd_rangesrcu_tasks_nvcswwritetypetabclk32k_refclass_read_lock_irqsave_is_conditionalcan_forkfor_backgrounddma_pools_addr_lsbctl_table_polli_generation_sigpollmxcsrdevtrange_cyclicd_rt_spc_hardlimiteminbi_end_ioblk_holder_opsfreepages_delay_totalnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inocgwb_listdyndbg_infocompact_cached_free_pfnindexfree_clustersdriver_datathread_headac_exe_devdev_pm_qosbi_sectormap_typeperiod_timef_oppids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizethawdq_sbNR_FILE_THPScgroupsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entrycancel_attachwaiterscmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimeinmodenestedrtpoll_nr_triggersnr_forced_migrationsac_pidseq_operationsnum_argsri_timerstack_canaryinactiveblksizesiblingmnt_rootnext_scanunregisteringf_raquota_writesrcu_barrier_cpu_cntNR_LRU_LISTSiopl_warnrmdirsockreg_stridebi_write_hinthash_lenget_policyshrinker_info_unitnr_reclaim_start__bi_nr_segmentstask_iterssym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecss_freecpu_basedevice_is_availabledquotdl_runtimechildren_min_usagenumbersswapin_delay_totalbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdhandle_mask_syncfaultableio_comp_batchshutdowndq_lockzswap_maxi_cdevldt_structenv_endobj_cgrouprescue_workqueueprogsextra1ptrace_messagenum_trace_events_sys_privateuse_raw_spinlockmin_usageinit_fs_contexts_subtypeheaderfuncperf_event_contextno_cgroup_ownernbp_th_nr_candcputimetlbflush_unmap_batchtype_in_masksoftfreepages_countyes_ranges__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6attachkprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatchersrange_endcompletionsw_reservedwm8997_reva_patchdevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsgpswbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodebpf_cgrp_storagenum_rangescurr_nrcorememsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataWORKINGSET_REFAULT_ANONtype_reg_maskget_dquotsnextentsnum_orcscma_pagesclass_task_lock_is_conditional__UNIQUE_ID___addressable_wm8997_patch617FAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onregmap_register_patchvm_operations_structNR_ACTIVE_FILEjd_gpio5bin_attrs_newbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrennregis_softbindcntsRPM_SUSPENDEDreclaim_stateMEMCG_SWAP_HIGHevictedvma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGcacheline_paddingnrpages_refcounti_crypt_infopermissionsnr_frozen_descendantsbdi_nodeerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idxcgroup_namespaceZONE_DEVICE_head_1_head_2subsysbd_size_lockbackstate_add_uevent_senti_hashhlist_nodeio_uringregulator_init_datawm8997_irqsreg_sequencecore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointersect_attrsmg_dst_cgrpsoft_startonlineruntime_resumedup_xol_workwrite_charlocal_watermarktdm_slotsMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignhpdet_channeldelay_workoublockinuse_pagesrecent_cidkf_opscan_sleepkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmicvddgfp_tseccomp_filterstimei_mmapthaw_superREGMAP_ENDIAN_DEFAULTd_lrusignal_structperf_event_mutexrd_noinc_tableNR_PAGETABLEcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrsprotectedsas_ss_flagsf_modeki_completenonfull_clustersvtime_statewakee_flipsset_acldismisspids_activedriverZONE_NORMALREGMAP_ENDIAN_NATIVEi_opldt_usr_semHRTIMER_RESTARTwpcopy_countkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEreg_shiftcredjump_entryreg_defaultreg_defaultsfrag_clustersproactive_compact_triggersrcu_gp_seq_needed_expgpioaddress_space_operationsspinlock_t__task_fpstatemaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startneeds_force_resumehuge_faultkstatfssites__lruveccluster_nextreg_writemem_cgroup_reclaim_iterevents_lockptracequota_disablekprobe_blacklistwork_lockcpus_ptrnotified_atpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysdelay_uskswapd_lockdirty_limit_tstampsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMED__NR_MEMCG_DATA_FLAGSexpiresrcuwaitnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotbstatfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutexblocking_notifier_headcoredump_datavm_stattasksmem_cgroup_per_node_pidaddress_spacemm_context_tirq_reg_strideuid_gid_extent__call_single_nodestartupseqcount_spinlock_tbio_issuei_wbcss_local_stat_showuint8_tMEMCG_HIGHregmap_irq_chippanelclass_idinactive_timer_pkeyfilenames_export_opclear_on_unmaskselector_maski_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqlowmem_reservepagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipebaseforce_scanhostuaddrfailedcgrps_wb_errold_subtree_ss_maskshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descscontiguousrecoveredexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidrseq_sigLRU_INACTIVE_FILEarizona_micd_configdev_pm_domainlimit0limit1nr_zonespages_skippedwm8997_irqmigrate_modebio_poolfree_areakswapd_failureszswap_lruvec_stateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infolru_gen_mm_listi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksack_invertplatform_datad_comparesighanditerate_sharedis_visiblesignalWB_REASON_FORKER_THREADreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headswap_peaks__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackstat_thresholdlevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventfast_iohlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowunsigned charzone_start_pfnvdsomemtiermmap_legacy_basepipe_inode_infononresident_ageuint16_tsecurebitspartition_meta_infostate_initializeduring_cmd_iopollbi_poolcompat_uptr_tuevent_opssub_reg_offsetszero_flag_maskslicesas_ss_spnr_dirtiednum_kprobe_blacklistsubtree_ss_maskclass_local_lock_is_conditionalsuspend_latewakeupcg_listcgwb_release_mutexsrcu_barrier_completionwb_completionshrink_controlwritten_stampdriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapaod_irq_chipspan_seqlocknum_reg_defaultssessionidlast_bdp_sleep_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistZONE_DMAdebugfs_entryelemnr_retriescgwb_frnavg_refaultedsigval_talimitundo_listdirty_foliorcharZONE_MOVABLEnr_populated_domain_childrenmissedkswapd_highest_zoneidxparent_could_setfcapquota_readst_shndxldo1freepageset_high_maxi_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securityactive_counts_dio_done_wq_dummy_bndmin_unmapped_pagessas_ss_sizespk_fmtuser_xfeaturesnr_wakeups_passivefile_system_typewb_tcand_idmtimeserver_has_tasksswap_events_fileoom_score_adj_minreadable_regkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_thigh_worknode_zonelistsrange_maxpathst_sizenr_frozen_taskslru_gen_foliormtpwait_sumnum_tracepointsupidexit_codemempool_ttype_falling_valexec_startclass_read_lock_is_conditionalconsumersrtpoll_min_periodkernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workkeyring_semsrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribforceidle_sumrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opshighest_bitiopollregmap_unlockpagesizes_blocksizevm_pgofftimesauprobecan_swaprelease_agent_worknuma_workupdate_timeptrace_dr7priority_call_addrexpireloginuidcheckrtpoll_untilexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_donenbp_rl_nr_cand__lstateupdated_nextueventlock_countrefcount_tcset_linksplugchild_countsaved_auxvmce_addrlast_bstatnum_bugsqf_ops__vm_flagsnum_config_regsmod_nametype_rising_valproperty_read_string_arraymm_cidmemory_tierunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalorig_objcgrseq_csdcvddnum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnode_zoneswindow_startnbp_th_startelow_pincounttablesDEVICE_PANEL_BOTTOMmin_seqlist_headlru_lockhwlock_idrange_mintgidbatchedfor_reclaimwrite_protect_seqtdm_widthcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holderend_codeblkio_countqspinlocklru_genNR_VMSCAN_WRITEinsnfilldir_tfolio_batchlow_usagedl_non_contendingdir_contexttracepoint_ptr_tutaskfailcntNR_UNEVICTABLEsched_entityd_spc_hardlimitgpio_defaultslockdep_keylong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baserescue_workio_contexthpdet_acc_id_linegpl_symsgroupseq_showctl_nodeswait_queue_headcow_pageinumac_btimeblocki_spc_timelimitreturn_instancesn_yes_rangesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevicebi_integritys_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namedisable_lockingnoderesetfor_kupdatevm_lockwb_tcand_bytesno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areatype_reg_offsetWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatipc_namespaceexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentread_charcgroup_nsia_sizein_hrtirqs_master_keysac_stimescaledpropertywchar_addr_bndkernel_symboli_opflagssubsys_databi_statusnr_cgrpstv_secpid_ttask_listftrace_sleeptimeset_type_configrun_nodema_rooturing_cmdpsi_filesMEMCG_OOM_KILLnr_failed_migrations_affineNR_SWAPCACHEuser_cpus_ptrirq_delay_totalpi_top_taskNR_WRITEBACK_TEMPactoruprobenotifier_subscriptionss_readonly_remountbiasutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthmax_seqi_sizedl_deadline_hugetlb_hwpoisonpsi_group_cpuubufksm_rmap_itemspageset_batcharizona_micsupp_pdatanr_populated_csetsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlockdmic_refkswapd_waittimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flags__UNIQUE_ID___addressable_wm8997_irq619keyring_name_listfile_costread_posstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuealloc_factorKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimenr_populated_threaded_childrensigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendinghlist_nulls_nodenr_deferredfown_structfeatures_lockedlruvec_statstracing_graph_pauseavg_triggerspermcompat_robust_listbi_blkgktypelockrefin_dpm_listsrcu_struct_ptrsmm_structrtpoll_wakeupvlagi_uidREGCACHE_NONEbi_iocost_costspinlocknr_dying_subsystimestampspid_namespace_syscallmod_arch_specificmax_write_lennum_static_call_sitesend_pfnvm_mmdebugfs_idwb_lcand_bytesguest_permmem_dqinfotruei_countHRTIMER_NORESTARTWB_SYNC_ALLbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipcgwb_treeufdsexe_filehlist_bl_nodeipc_nspcp_listhwlock_modepid_linksfree_counts_sysfs_namerefcountvaddrrequestregmap_configpglist_datarw_hinttimeoutdma_configurelast_switch_timenum_classesorc_unwind_ippage_counterqc_dqblkfprop_local_percpuavg_next_updatemmappedseqcount_raw_spinlockbd_holder_dircpu_run_virtual_totalkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWERthrashing_countllist_headwait_startpercpu_clusterf_freeptrnr_freeclass_raw_spinlock_irqsave_try_is_conditionalmap_nr_maxget_dqblkshow_fdinfofixupirq_getuse_ackset_ownershipposix_acldd_key_falsehp_enabug_addr_dispdqi_igracemax_slack_shiftclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_endbdi_ids_fsnotify_infocpu_delay_totaluser_keyring_registermempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentirq_drv_datamask_basepayloadac_minflti_sbmin_ratiod_sbcommcompwake_invertcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxirqsatomic_open_zonerefsbio_end_io_tstart_prevent_timeMEMCG_OOM_GROUP_KILLlru_zone_sizereadahead_controlrtpoll_timerdirty_limit__kernel_gid32_tcompact_init_free_pfnkernfs_open_filestate_maskf_credMODULE_STATE_COMINGnotify_countmg_dst_csetoffline_disabled__empty_rangesbd_devread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_tbi_idx__kernel_loff_tpropertiesdetachget_unmapped_areadev_pagemapwritepagessched_statisticsheadgpio_base__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampirq_gpiosuper_operationsbi_cookiesplice_eofnr_threaded_childrenutil_avgtaskrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsNR_IOMMU_PAGESctx_iddirty_ratelimitd_rt_spc_warnsclk32k_srci_verity_infoxsavetimespec_type__rb_parent_colorLRU_UNEVICTABLEdevres_lockbitsWB_REASON_MAXiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsevents_fileout_vol_limitntimevm_private_dataio_bitmap__bi_remainingsubtree_bstatuprobe_task_statetimerkobj_typeb_dirty_timei_pageshlist_bl_headino_warnlimitpfmemalloc_waitarch_uprobe_taskfasyncpidlistsi_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGESchardomainunix_inflightholders_dircont_lockfpu_state_permi_fsnotify_maskbio_vecsysctlsprotection_supportack_basegraph_get_port_parentWM1831__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkREGCACHE_MAPLEvm_node_stat_diffbio_slabd_aliasNR_SHMEM__iovcpumaskdumpernode_size_lockwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootswrite_bandwidthd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tuse_single_writerunningrseq_event_masks_rootra_pageslegacy_cftypesTT_COMPATexternal_dcvddfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountsupplypage_freeread_syscallshlist_nulls_headNR_FILE_MAPPED_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typecgrp_linksget_named_child_nodelaunder_foliocurr_targetis_suspendeduts_namespacefor_syncburstetypeei_funcsmodule_kobjectmemoryorderactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsettagged_writepagesarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsperiodcgroup_subsysWORKINGSET_NODESfile_offsetlinux_binfmtpage_table_lock_sigfaultregmap_irq_sub_irq_mapcountersname_linkNR_ANON_THPScmaxrsstimer_slack_nsbus_typerstat_css_listpolicysharedwait_queue_entryrtpoll_totald_real_typelookahead_bandio_portvolatile_tablenum_core_suppliesseq_starttask_cputimeraw_lockd_dnameac_schedspk_mutemax_hang_timecpus_mask_pad_b_dirtysubdirstask_groupinitializedstarttimeWM5110mmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailsvmstatslinenobi_io_vecbase_pfnstatget_inode_acl_addr_pkeymigrate_foliocustom_sliceNR_ACTIVE_ANONspanned_pagesthread_keyringeffectivewm8997_readable_registerkparam_arrayutimestart_codeis_hardfsbasecompatibleblk_status_tac_uidclock_listmicd_timeoutattrspercpu_drift_markcpumask_tgid_mapswregs_statedqb_isoftlimitdma_iommuorig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEonline_cntnr_cached_objectsia_mtimetrc_ipi_to_cpudirty_exceedednodeinfomxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldis_seentotalreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetrstat_cputime64_tWB_REASON_FOREIGN_FLUSHi_blocksnuma_faults_localityhas_child_subreaperi_aclmicd_rangeswrite_newwb_listswap_filelist_lockpm_domaincpu_bitmapconsumerucount_maxregmap_rangestatic_call_keyutil_estucountsqc_statepageset_high_minsoftirq_next_timerpresent_early_pagescheck_flagsswp_entry_tbi_inline_vecsmemcg_css_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventLRU_ACTIVE_FILEset_performance_statewm8997_aod_irqsclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryimplicit_on_dflk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacac_exe_inodenr_to_scanthreaded_csetsDEVICE_PANEL_UNKNOWNfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treedentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalper_cpu_zonestatsDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushmm_walkDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancesstart_all_reasonwb_bytesrangecgroup_base_statfutex_exit_mutexjd_gpio5_nopullhandle_post_irqval_bitscompact_blockskip_flushtrc_blkd_nodewrite_s64writeback_inodesd_spaceWB_REASON_PERIODICgraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameread_s64bi_iopriou_flagsnvcswac_tgetimewatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidproc_ns_operationsmin_vruntimefaults_disabled_mappingquota_typehighi_rdevlist_lru_nodewr_noinc_tableself_exec_idkernfs_opsfile_locktype_level_high_valMODULE_STATE_LIVEstopnr_migrationsa_opsxa_flagspad_bitsfreezebin_sizeclosedev_dma_attrgrphicftyped_spc_timerjump_entriesctl_dirasync_suspendmsi_device_dataalignsuper_blockset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorbvec_integrity_poolassoc_arraymnt_idmapdq_dqbmm_statesaved_tfElf64_Xwordold_timespec32lock_class_keymemory_events_localnum_symsmodule_notes_attrsvm_lock_seqpdeath_signalgenerationPIDTYPE_MAXroot_listnlinkcpu_countdefault_setavg_totalpercpu_refns_commonhorizontal_positionrlimit_maxarizona_ldo1_pdatapref_node_forkwait_queue__int128reclaimeddqi_privrss_statmems_allowed_seqmicd_raterefcntregmap_irqD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxac_niceDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrplocan_multi_writeclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_fileidr_basekswapd_orderuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrqstrWORKINGSET_REFAULT_FILEma_flagsfutex_stateorig_pmdwm8997_volatile_registeracct_timexpds_op__rcu_icq_cachesizeZONE_DMA32CS47L24em_perf_tablewakeup_sourcef_posNR_FILE_DIRTYnext_posix_timer_id__kernel_long_twb_switch_rwsemtask_fragsrcu_gp_mutexMEMCG_OOMdatalennr_wakeups_affine_attemptsNR_LRU_BASEalt_lenuse_single_readcinblockextableexitcompact_consideredkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_countac_utimescaled__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexbpf_prog_arraycore_statetimerqueue_headserial_nrdac_comp_coeffdeferred_split_queuefutex_pi_statekstat__kernel_uid32_tsubsys_maskDEVICE_FIXEDpte_tdevice_driverdying_tasksdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointcancel_forkepoll_watchesWM8997WM8998non_rcuWORKINGSET_ACTIVATE_BASEkcompactd_waitdqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidst_spacefull_clustersmm_cid_next_scanns_typedfl_cgrpac_majfltposix_cputimers_work_upperwpcopy_delay_totalmodule_param_attrsshort unsigned intwatermark_boostunitcpu_scaled_run_real_totali_mutex_dir_keyq_nodespc_warnlimitcluster_next_cpuNR_WRITTENctl_table_sizes_encodinggpl_crcsorc_entrykeysarizona_micbiasperiod_timerorig_ptedqb_curinodesnbp_thresholdload__s8css_allocinvalidate_lock_keydma_maskprealloc_mutexselector_shiftnode_stat_itemreg_update_bitsobjcg_listsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tlruvec_stats_percpuregmapdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_patharizonadio_mem_alignARIZONA_NUM_MCLKNR_THROTTLED_WRITTENbtimeextra2__u8is_roxlockcompact_cached_migrate_pfnrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onezswap_writebackdevice_physical_location_horizontal_positionseeksseq_stopkf_rootkiocbbv_offsetprecious_regclass_rwsem_read_intr_is_conditionalcompact_order_failedfsuidread_flag_maskctl_table_argcompact_init_migrate_pfns_blocksize_bitsnuma_scan_periodmanaged_pagesmigration_disabledREGCACHE_FLATiter_typepositionclass_device_is_conditionalshrinker_idbio_setrootprojid_mapoom_reaper_listnr_reserved_highatomicshutdown_presym_VDSO32_NOTE_MASKbpf_storagenotifierno_callbacks__u16timers_activewait_countvirqNR_SHMEM_THPSsig_okdelaysqf_ownerreadaheadNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBwork_listNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingMEMCG_DATA_KMEMextentfsindexshstksrcu_sspwake_irqcan_attach__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timethrashing_delay_totali_sequencepool_datapage_memcg_data_flagspgdatdisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONE_watermarkswap_activatemkobjcore_cookiesrcu_supd_deleteb_more_ioPRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tmf_statsf_iocb_flagshpdet_acc_idpoweroffcmaj_fltvtimemath_emu_infoiowait_sumnum_config_basesf_pathpidlist_mutex__u64journal_infocapabilitiessched_contributes_to_loadstatic_key_trueb_ioweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vmnode_start_pfn_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimevm_starts_flagsfaultshow_statsdl_densityfreeptr_tread_dqblkac_giddq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grancgroup_freezer_statekernel_cap_twait_listrequest_pendingdworkhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_baseavgs_worknum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionmax_descendantswb_lcand_idserialclass_releasealloc_locks_dquotfolioqfoliosthreadedupdated_childrenmemcg_memory_eventWM8280prev_posNR_ISOLATED_FILEdelayedseqcount_spinlockexpire_countuid_maps_umountis_bin_visiblepgoffsyscall_user_dispatchumount_beginnr_disk_swapinsrcu_tasks_exit_listclear_ackarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_donenanosleeppud_tWM5102rt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcWB_REASON_LAPTOP_TIMERbi_issuequota_format_typeignoredvmstats_percputask_structanon_costrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalentotalreserve_pagesf_pipei_wb_frn_historylast_wakeenextmin_slab_pagesio_tlb_memarch_spinlock_tnr_tasksi_mtime_nsecperformancemmlistreg_readset_dqblksuppress_bind_attrsselector_regRPM_RESUMINGreg_offsetgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesrd_tablef_llisthigh_maxphandleread_u64i_nlinkwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_treclaim_waitfbatchnr_writeback_throttledsharepagefault_disabledstate_startsyscwnr_memcgsil_prevget_name_prefixMEMCG_NR_MEMORY_EVENTSwlockedfreeze_superREGMAP_ENDIAN_LITTLEs_inode_list_lockruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICoffline_nodequota_enablesched_avgntabzonedevice_typemaj_fltarch_rwlock_ttree_scannedreg_defaults_rawclock_basefrag_cluster_nrcdevmy_qgroup_leadermkdirzoneliste_csetsreal_blockedarg_locknum_exentriespid_ns_for_childrens_writerslaptop_mode_wb_timerlower_firstint32_tio_pagesoffset_ctxnr_failed_migrations_runningcompact_delay_totalclassesnext_timerclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlocksplit_queuefile_ra_statemax_depthuser_structon_rqusersfs_contextswap_extent_rootmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfbypassllseekDEVICE_HORI_POS_CENTERtypes_supportedDL_DEV_PROBINGout_monolast_old_flushnext_offsetcommit_dqblknamespacei_ino_warnlimitdirtied_stampwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidcookiebd_stamptargethigh_mina_flagstrace_overrunwriteback_sync_modesswap_cluster_infosession_keyringcpusfop_flagsSYSCTL_TABLE_TYPE_DEFAULTkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsmemory_peakscred_guard_mutexsigcntfiltershrtimer_cpu_basecb_headcheck_quota_filePGDEMOTE_DIRECTattributerestrict_linkdev_archdatamclki_deviceskey_perm_tcss_rstat_flushbio_integrity_payloadrescue_listswappinesspi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsrescue_locklist_lruusing_gplonly_symbolstarget_knsival_ptrthreaded_csets_nodelast_subtree_bstatrobust_listsym___kernel_rt_sigreturnsplit_queue_locksym_pvclock_pageserial_nodelen_descs_incoredqsregcache_typed_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockcgroup_fileforwarddev_links_infoloff_tthread_pidsrcu_gp_seqmicd_pol_gpiocgroup_rstat_cpu_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodemm_statsof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typePROBE_PREFER_ASYNCHRONOUSicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpaddingmax_prop_frac__fillersaved_sigmaskd_timelru_listentriescpu_idfop_flags_t__MAX_NR_ZONESFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedbd_statsbi_sizemodule_statelast_used_atmemcg_vmstatsvm_endregulatorlast_queuednuma_migrate_retryuser_ns__stateRPM_REQ_NONEfirstiommu_grouphandle_pre_irqmigrate_to_ramwm8997_reg_defaultwb_domainwait_pidfdptrace_bpss_umount_keymax_ratiovm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeproc_handlerFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progressvolatile_regavgs_locksrcu_barrier_mutexi_private_dataElf64_Halfbw_dworkcompact_countnsproxycan_wakeupcache_typexol_areaPGPROMOTE_SUCCESSrlockfl_owner_tjd_invertMEMCG_LOWMEMCG_DATA_OBJEXTScls_mskeuidwaitbug_tablemax_raw_writedirtied_time_whensequential_io_avgmicd_detect_debounceoom_groupnum_trace_bprintk_fmtcpu_run_real_totalvm_policyWM1814perf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVEnum_reg_defaults_raw__state_sizethread_structcached_requested_keyenvp_indexbvec_iterper_cpu_pagesctimereleasemax_segment_sizenr_pagessched_dl_entity__kernel_dev_tatomic_write_lenwindow_lendqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetnet_nsREGMAP_ENDIAN_BIGfolio_queuelast_task_numa_placementnr_descendantspgtable_tblock_startcgtimeWB_REASON_VMSCANsymlinkwm8997_i2c_regmapoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcusocket_pressureki_waitqnotify_timertrace_eval_mapdonemax_registerfscrypt_operationsrelease_workWB_REASON_FS_FREE_SPACEksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexac_btime64mg_dst_preload_noderatelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaswapin_countdl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERrstat_css_nodeFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrwatermarkdeadpropsavg_nr_triggersfprop_globallong long unsigned intanon_nameblkcg_gqhashia_filesival_intnuma_preferred_nid_hugetlb_cgroupcore_suppliesdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatemm_listcss_idri_linkmicd_software_comparelistxattr_lowertrap_nrbinfmt_miscasync_probe_requestedcompat_long_tac_etimeconfig_bases_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidateregmap_endianbus_groupsirq_chippmd_tmnt_namespacenode_spanned_pagessysv_shmdq_countctrlif_errorutf8data_tableset_latency_tolerancefoliowake_entryxa_headsuidregmap_irq_chip_datacluster_infoi_readcountlocked_vmrb_leftmg_src_cgrpseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tregmap_lockquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countmemcg_completionsksm_merging_pagesreg_format_endianfree_listregmap_range_cfgautosleep_enabledptrace_entryuse_autosuspendrecent_used_cpunum_jump_entriess_qcopatomic_tbv_page_flagsnotify_nexte_cset_nodebus_dma_limitshort intmynodemicd_dbtimenr_free_highatomicpdataof_device_idarizona_micd_rangewb_waitqclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regPGDEMOTE_KSWAPDVTIME_USERsa_flagstestcss_offlinepad_untilDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2regmap_access_tabledestroy_rworklast_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datanr_extentsnr_scannedpoll_table_structfifodirect_IOn_no_rangesmain_statusno_rangeswait_queue_entry_tpcpucurrent_may_mountseqlock_tbd_queuenuma_scan_offsetcgroup_subsys_statevertical_positionkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskMEMCG_SWAP_MAXfreezerNR_INACTIVE_FILELRU_INACTIVE_ANONregfuncindex_keymemalloc_noiohpdet_id_gpioGRPQUOTArwsemi_private_listia_validSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcluster_nrvirtmemi_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockinit_dataactiveno_statusdqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisevmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimewm8997_aodiov_iteria_gidattribute_groupcontextposix_timersper_cpu_nodestatselectorMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nssource_listcgroup_bpfswap_readahead_info__fpstateactive_refpmdval_tctl_table_rootARIZONA_MCLK1ARIZONA_MCLK2group_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizedfl_cftypeshpdet_clampdeferred_splitmce_kill_meuuid_tproperty_read_int_arrayuse_hwlockcount_objectsctl_table_setnum_regs_stimezone_device_datakcompactd_max_orderpeaks_lockf_wb_erruseddefparamsaved_errfred_csfault_flagkprojid_tptracer_credtlb_gencgwb_domainmax_register_is_0page_mkwritekobjectaudit_ttyirq_flagsrtpoll_triggersmce_ripvstatfsctl_table_headeruse_relaxed_mmionumab_stateruntime_pmremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cbliststoragesclass_groupspsi_groupnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchangedbdi_listwatch_listaudit_contextpp_ref_countsysfs_opsregulator_bulk_datasequential_iotime_namespace_large_mapcountsda_is_staticformatftopenclavereclaim_workbi_privatecreateiattrrseqnfdssigvalvma_lockperf_event_listarizona_typeget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadwriteable_regd_realancestorstot_write_bandwidthmax_channels_clockedexpiry_activedqi_max_spc_limitvm_numa_eventexception_table_entrynr_isolate_pageblockevent_countnr_to_writefallocatei_spc_warnlimitbuddy_listi_ino_timelimitnode_present_pagesi_mmap_writablemems_allowedMEMCG_SWAP_FAILtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderclk_lockold_subtree_controltimewakee_flip_decay_tsmemcg_vmstats_percpus_max_linksnr_wakeups_synckallsymskcompactdprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvector__bi_cnttimer_listrefaulteddevice_dma_supportedd_ino_warnshiwater_vmtracepointdac_comp_enabledcompound_headia_vfsuidunaccepted_pagesreg_baselrugen__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structunlockrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitbd_nr_sectorsqf_nextWB_REASON_BACKGROUNDunmask_baserangesmemory_eventsiommu_mmcutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charpersistent_keyring_registerprioprivgetattrsched_info__UNIQUE_ID___addressable_wm8997_i2c_regmap620d_fieldmaskuprobe_xol_opsseq_filefreeze_noirqNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsno_pmbi_max_vecsgroup_stop_countdac_comp_lockavg_last_updatelowest_bit_killktime_tchildren_low_usagesymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387iterd_ino_timeravx512_timestampfuncsend_datapercpu_pvec_drainedsubtree_controlsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncrange_startper_cpu_nodestatsnr_charged_bytessetleasepinspacct_structmust_resumescannedlong intpresent_pagesfile_lock_contextusagesiglockper_cpu_pagesetstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ssproperty_presentUSRQUOTAprintk_index_sizesymtabtimes_previnit_load_uArt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegidiomapdq_hashput_superfwnode_reference_argsnext_addrpushable_dl_tasksf_flagsf_inodeprocnamemark_dirtynr_dying_descendantsnum_srcu_structsbdi_writeback_pad1_kobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEmicd_configsbalanced_dirty_ratelimit_pad2_cancelled_write_bytesac_tgidsrcu_usagebitmapacpi_match_tablememcgbw_time_stamp_sigvalmax_perf_statebvecnameidatalatency_recordmod_kallsymsmnt_idrefaultshas_fully_powered_offdepth_pad3_wait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldstatus_baselistsssize_tsr_lockiopl_emulwork_structdesc_lenflocktask_io_accountinginit_ack_maskedmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structreversepi_locklru_gen_mm_state___orig_eipprobestubget_timedapmmm_cid_activeelemsizedirty_paused_whenblkcg_cssmaxlensuspend_noirqDEVICE_VERT_POS_UPPERrelease_agent_pathclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lrudischargezone_idxdom_cgrpNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvolNR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tmg_tasksuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_max_ino_limitdqi_fmt_idwr_tableuid_gid_maprtpoll_trigger_locksrcu_structrlim_curnofaultmm_countdrv_groupsstackoffline_waitqmnt_nsac_ppidfunctionwb_idki_flagsbvec_poolbd_start_sectsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timecgroup_rootdatastrtabtty_old_pgrpold_dom_cgrpdl_throttledi_rwsemrtpoll_statesget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextwake_baseopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_foliomax_raw_readsplit_queue_lennr_eventsWB_REASON_SYNCmicbiasiommuwriteable_noinc_regbi_opfswap_iocbprivatehlistcftsst_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxswap_plugMEMCG_MAXsplice_pipes_lock_keymg_nodekswapdsrcu_gp_startopentime_nsit_real_incrwaitqmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmem_cgroup_idmodstqheads_activesym_vvar_startMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalget_irq_regdeadremap_file_rangeac_commnr_hangskcompactd_highest_zoneidxgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsswap_mapdq_dirtydl_deferbug_listdirect_completenbp_rl_startidr_rtlegacy_namexa_lockfxregs_statememcg_cgwb_frnload_weightdiscard_clusterskuid_tarch_datafpstateshrinker_infoblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateuts_nsis_late_suspendedsysvsemucountvm_stat_diffkmemcg_idignore_childrenlru_gen_mm_walk_pflagsrestore_early__UNIQUE_ID___addressable_wm8997_aod618hap_actarizona_pdataclock_mutexfs_supersREGCACHE_RBTREEdom_csetevents_local_fileroot_csetdqb_bsoftlimitpendingf_task_worklru_gen_memcgiowait_countnotifier_blockmemswdma_io_tlb_memrtpoll_scheduledstringread_countstoreforklruvecfutex_offsetvmpressurelong long intwrite_flag_maskbdevatomic_flagssysvshmtimer_expirestrace_evalsactive_baseshierarchy_idearly_initmprotectac_exitcodesecurityxmm_spaceactivatef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesdepends_ondomain_dataidr_nextrelax_countlinelinkstart_timekernfs_nodercu_workRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEfront_paddup_xol_addrcapture_controlnr_wakeupspost_attachstartstart_brkstatic_key_modd_ino_softlimitxregs_statelock_argWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterscss_resetNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qscompact_defer_shiftswap_deactivatedomain_suffixblkcnt_tnum_micd_configsicq_treesi_codethread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batchrstat_flush_nextzeromapmap_pagesreschedule_countvfsmountcss_onlineextable_basenoinstr_text_sizenargsattributesmicd_force_micbiasset_child_tid_overrunwrite_u64tmpfilemicd_bias_start_timercu_read_lock_nestingem_perf_statemin_nrtick_dep_maskgpio_descprecious_tablelistthrottle_disksi_errnobsynce_freezememcg_lrus_inode_lrumemcg_nodesrcu_size_stateblk_plugunpinned_netfs_wbof_noderefsmmap_compat_baseWB_SYNC_NONEtrace_eventsenv_startcgrp_ancestor_storagedma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_statemask_unmask_non_invertedUTASK_SSTEPpkrureal_parentlockedcgroup_tasksetVTIME_GUESTrtpoll_next_updateregsslice_maxlast_switch_countqsize_tregmap_irq_typeblkio_delay_totaltime_ns_for_childrenfilesdqb_bhardlimitlivevm_faultatomic_write_unit_maxs_staterun_listixolbd_mappingsym_vvar_pagemodule_sect_attrsmg_src_preload_nodereturn_instancesoftirq_activatednum_irqsclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intnotifier_callrtpoll_taskgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqbi_crypt_contextia_vfsgidzone_typesize_tacpi_device_idcap_permittedTT_NATIVEzone_pgdatclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesu64_stats_syncrcu_tasks_idxsync_modercu_tasks_holdouttarget_listtype_level_low_valavg_write_bandwidthb_attachedpasid_activatedpi_sezonerefget_offset_ctxcore_forceidle_sumnum_main_regsfreeze_ucounti_ctime_nseccpuhp_deads_remove_countsyscall_workcompletionsdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalstatus_invertcallback_headmemory_failure_statss_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicrestoredelayed_callbi_itermax_nr_cid_statusd_sibkernel_ulong_tdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2css_extra_stat_show__kernel_timer_tclass_srcu_is_conditionalcss_releasedDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskavail_listsatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionsnd_soc_dapm_contextbv_lendiscard_workstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispblkcg_nodercu_specialclear_child_tidf_refextable_lenper_cpu_zonestatbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usagetree_reclaimedratelimit_states_pinsattrget_next_child_nodeFAULT_FLAG_WRITEreg_bitsstate_in_sysfswrite_syscallsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDext_capdebug_dirfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollac_padgraph_get_next_endpointmemcg_idnr_wakeups_idlertpoll_waitio_cqprobeelf64_symlatch_tree_nodepercpu_ref_datadestroy_workreadable_noinc_regDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSval_format_endiannum_main_status_bitssyscorewb_reason__s64LRU_ACTIVE_ANONdqi_bgrace__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_panelpoweroff_latectl_tableuid_tflush_requiredprocs_filesum_block_runtimepgmapmin_perf_statedq_opnum_micd_rangesrcu_tasks_nvcswwritetypetabclk32k_refclass_read_lock_irqsave_is_conditionalcan_forkfor_backgrounddma_pools_addr_lsbctl_table_polli_generation_sigpollmxcsrdevtrange_cyclicd_rt_spc_hardlimiteminbi_end_ioblk_holder_opsfreepages_delay_totalnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inocgwb_listdyndbg_infocompact_cached_free_pfnindexfree_clustersdriver_datathread_headac_exe_devdev_pm_qosbi_sectormap_typeperiod_timef_oppids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizethawdq_sbNR_FILE_THPScgroupsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entrycancel_attachwaiterscmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimeinmodenestedrtpoll_nr_triggersnr_forced_migrationsac_pidseq_operationsnum_argsri_timerstack_canaryinactiveblksizesiblingmnt_rootnext_scanunregisteringf_raquota_writesrcu_barrier_cpu_cntNR_LRU_LISTSiopl_warnrmdirsockreg_stridebi_write_hinthash_lenget_policyshrinker_info_unitnr_reclaim_start__bi_nr_segmentstask_iterssym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecss_freecpu_basedevice_is_availabledquotdl_runtimechildren_min_usagenumbersswapin_delay_totalbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdhandle_mask_syncfaultableio_comp_batchshutdowndq_lockzswap_maxi_cdevldt_structenv_endobj_cgrouprescue_workqueueprogsextra1ptrace_messagenum_trace_events_sys_privateuse_raw_spinlockmin_usageinit_fs_contexts_subtypeheaderfuncperf_event_contextno_cgroup_ownernbp_th_nr_candcputimetlbflush_unmap_batchtype_in_masksoftfreepages_countyes_ranges__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswm8998_aodwake_q_noderequest_key_authvirtual_dr6attachkprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatchersrange_endcompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsgpswbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodebpf_cgrp_storagenum_rangescurr_nrcorememsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataWORKINGSET_REFAULT_ANONtype_reg_maskget_dquotsnextentsnum_orcscma_pagesclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onregmap_register_patchvm_operations_structNR_ACTIVE_FILEjd_gpio5bin_attrs_newbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrennregis_softbindcntsRPM_SUSPENDEDreclaim_stateMEMCG_SWAP_HIGHevictedvma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGcacheline_paddingnrpages_refcounti_crypt_infopermissionsnr_frozen_descendantsbdi_nodeerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idxcgroup_namespaceZONE_DEVICE_head_1_head_2subsysbd_size_lockbackstate_add_uevent_senti_hashhlist_nodeio_uringregulator_init_datareg_sequencecore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointersect_attrsmg_dst_cgrpsoft_startonlineruntime_resumedup_xol_workwrite_charlocal_watermarktdm_slotsMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignhpdet_channeldelay_workoublockinuse_pagesrecent_cidkf_opscan_sleepkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmicvddgfp_tseccomp_filterstimei_mmapthaw_superREGMAP_ENDIAN_DEFAULTd_lrusignal_structperf_event_mutexrd_noinc_tableNR_PAGETABLEcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrsprotectedsas_ss_flagsf_modeki_completenonfull_clustersvtime_statewakee_flipsset_acldismisspids_activedriverZONE_NORMALREGMAP_ENDIAN_NATIVEi_opldt_usr_semHRTIMER_RESTARTwpcopy_countkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEreg_shiftcredjump_entryreg_defaultreg_defaultsfrag_clustersproactive_compact_triggersrcu_gp_seq_needed_expgpioaddress_space_operationsspinlock_t__task_fpstatemaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startneeds_force_resumehuge_faultkstatfssites__lruveccluster_nextreg_writemem_cgroup_reclaim_iterevents_lockptracequota_disablekprobe_blacklistwork_lockcpus_ptrnotified_atpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysdelay_uskswapd_lockdirty_limit_tstampsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMED__NR_MEMCG_DATA_FLAGSexpiresrcuwaitnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotbstatfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutexblocking_notifier_headcoredump_datavm_stattasksmem_cgroup_per_node_pidaddress_spacemm_context_tirq_reg_strideuid_gid_extent__call_single_nodestartupseqcount_spinlock_tbio_issuei_wbcss_local_stat_showuint8_tMEMCG_HIGHregmap_irq_chippanelclass_idinactive_timer_pkeyfilenames_export_opclear_on_unmaskselector_maski_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqlowmem_reservepagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipebaseforce_scanhostuaddrfailedcgrps_wb_errold_subtree_ss_maskshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descscontiguousrecoveredexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidrseq_sigLRU_INACTIVE_FILEarizona_micd_configdev_pm_domainlimit0limit1nr_zonespages_skippedmigrate_modebio_poolfree_areakswapd_failureszswap_lruvec_stateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infolru_gen_mm_listi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksack_invertplatform_datad_comparesighanditerate_sharedis_visiblesignalWB_REASON_FORKER_THREADreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headswap_peaks__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackstat_thresholdlevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventfast_iohlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowunsigned charzone_start_pfnvdsomemtiermmap_legacy_basepipe_inode_infononresident_ageuint16_tsecurebitspartition_meta_infostate_initializeduring_cmd_iopollbi_poolcompat_uptr_tuevent_opssub_reg_offsetszero_flag_maskslicesas_ss_spnr_dirtiedwm8998_irqsnum_kprobe_blacklistsubtree_ss_maskclass_local_lock_is_conditionalsuspend_latewakeupcg_listcgwb_release_mutexsrcu_barrier_completionwb_completionshrink_controlwritten_stampdriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapaod_irq_chipspan_seqlocknum_reg_defaultssessionidlast_bdp_sleep_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistZONE_DMAdebugfs_entryelemnr_retriescgwb_frnavg_refaultedsigval_talimitundo_listdirty_foliorcharZONE_MOVABLEnr_populated_domain_childrenmissedkswapd_highest_zoneidxparent_could_setfcapquota_readst_shndxldo1freepageset_high_maxi_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securityactive_counts_dio_done_wq_dummy_bndmin_unmapped_pagessas_ss_sizespk_fmtuser_xfeaturesnr_wakeups_passivefile_system_typewb_tcand_idmtimeserver_has_tasksswap_events_fileoom_score_adj_minreadable_regkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_thigh_worknode_zonelistsrange_maxpathst_sizenr_frozen_taskslru_gen_foliormtpwait_sumnum_tracepointsupidexit_codemempool_ttype_falling_valexec_startclass_read_lock_is_conditionalconsumersrtpoll_min_periodkernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workkeyring_semsrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribforceidle_sumrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opshighest_bitiopollregmap_unlockpagesizes_blocksizevm_pgofftimesauprobecan_swaprelease_agent_worknuma_workupdate_timeptrace_dr7priority_call_addrexpireloginuidcheckrtpoll_untilexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_donenbp_rl_nr_cand__lstateupdated_nextueventlock_countrefcount_tcset_linksplugchild_countsaved_auxvmce_addrlast_bstatnum_bugsqf_ops__vm_flagsnum_config_regsmod_nametype_rising_valproperty_read_string_arraymm_cidmemory_tierunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalorig_objcgrseq_csdcvddnum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnode_zoneswindow_startnbp_th_startelow_pincounttablesDEVICE_PANEL_BOTTOMmin_seqlist_headlru_lockhwlock_idrange_mintgidbatchedfor_reclaimwrite_protect_seqtdm_widthcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holderend_codeblkio_countqspinlocklru_genNR_VMSCAN_WRITEinsnfilldir_tfolio_batchlow_usagedl_non_contendingdir_contexttracepoint_ptr_tutaskfailcntNR_UNEVICTABLEsched_entityd_spc_hardlimitgpio_defaultslockdep_keylong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baserescue_workio_contexthpdet_acc_id_linegpl_symsgroupseq_showctl_nodeswait_queue_headcow_pageinumac_btimeblocki_spc_timelimitreturn_instancesn_yes_rangesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevicebi_integritys_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namedisable_lockingnoderesetfor_kupdatevm_lockwb_tcand_bytesno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areatype_reg_offsetWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatipc_namespaceexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentread_charcgroup_nsia_sizein_hrtirqs_master_keysac_stimescaledpropertywchar_addr_bndkernel_symboli_opflagssubsys_databi_statusnr_cgrpstv_secwm8998_irqpid_ttask_listftrace_sleeptimeset_type_configrun_nodema_rooturing_cmdpsi_filesMEMCG_OOM_KILLnr_failed_migrations_affineNR_SWAPCACHEuser_cpus_ptrirq_delay_totalpi_top_taskNR_WRITEBACK_TEMPactoruprobenotifier_subscriptionss_readonly_remountbiasutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthmax_seqi_sizedl_deadline_hugetlb_hwpoisonpsi_group_cpuubufksm_rmap_itemspageset_batcharizona_micsupp_pdatanr_populated_csetsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlockdmic_refkswapd_waittimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flagskeyring_name_listfile_costread_posstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuealloc_factorwm8998_aod_irqsKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimenr_populated_threaded_childrensigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendinghlist_nulls_nodenr_deferredfown_structfeatures_lockedlruvec_statstracing_graph_pauseavg_triggerspermcompat_robust_listbi_blkgktypelockrefin_dpm_listsrcu_struct_ptrsmm_structrtpoll_wakeupvlagi_uidREGCACHE_NONEbi_iocost_costspinlocknr_dying_subsystimestampspid_namespace_syscallmod_arch_specificmax_write_lennum_static_call_sitesend_pfnvm_mmdebugfs_idwb_lcand_bytesguest_permmem_dqinfotruei_countHRTIMER_NORESTARTWB_SYNC_ALLbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipcgwb_treeufdsexe_filehlist_bl_nodeipc_nspcp_listhwlock_modepid_linksfree_counts_sysfs_namerefcountvaddrrequestregmap_configpglist_datarw_hinttimeoutdma_configurelast_switch_timenum_classesorc_unwind_ippage_counterqc_dqblkfprop_local_percpuavg_next_updatemmappedseqcount_raw_spinlockbd_holder_dircpu_run_virtual_totalkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWERthrashing_countllist_headwait_startpercpu_clusterf_freeptrnr_freeclass_raw_spinlock_irqsave_try_is_conditionalmap_nr_maxget_dqblkshow_fdinfofixupirq_getuse_ackset_ownershipposix_acldd_key_falsehp_enabug_addr_dispdqi_igracemax_slack_shiftclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_endbdi_ids_fsnotify_infocpu_delay_totaluser_keyring_registermempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentirq_drv_datamask_basepayloadac_minflti_sbmin_ratiod_sbcommcompwake_invertcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxirqsatomic_open_zonerefsbio_end_io_tstart_prevent_timeMEMCG_OOM_GROUP_KILLlru_zone_sizereadahead_controlrtpoll_timerdirty_limit__kernel_gid32_tcompact_init_free_pfnkernfs_open_filestate_maskf_credMODULE_STATE_COMINGnotify_countmg_dst_csetoffline_disabled__empty_rangesbd_devread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_tbi_idx__kernel_loff_tpropertiesdetachget_unmapped_areadev_pagemapwritepagessched_statisticsheadgpio_base__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampirq_gpiosuper_operationsbi_cookiesplice_eofnr_threaded_childrenutil_avgtaskrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsNR_IOMMU_PAGESctx_iddirty_ratelimitd_rt_spc_warnsclk32k_srci_verity_infoxsavetimespec_type__rb_parent_colorLRU_UNEVICTABLEdevres_lockbitsWB_REASON_MAXiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsevents_fileout_vol_limitntimevm_private_dataio_bitmap__bi_remainingsubtree_bstatuprobe_task_statetimerkobj_typeb_dirty_timei_pageshlist_bl_headino_warnlimitpfmemalloc_waitarch_uprobe_taskfasyncpidlistsi_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGESchardomainunix_inflightholders_dircont_lockfpu_state_permi_fsnotify_maskbio_vecsysctlsprotection_supportack_basegraph_get_port_parentWM1831__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkREGCACHE_MAPLEvm_node_stat_diffbio_slabd_aliasNR_SHMEM__iovcpumaskdumpernode_size_lockwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootswrite_bandwidthd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tuse_single_writerunningrseq_event_masks_rootra_pageslegacy_cftypesTT_COMPATexternal_dcvddfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountsupplypage_freeread_syscallshlist_nulls_headNR_FILE_MAPPED_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typecgrp_linksget_named_child_nodelaunder_foliocurr_targetis_suspendeduts_namespacefor_syncburstetypeei_funcsmodule_kobjectmemoryorderactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsettagged_writepagesarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsperiodcgroup_subsysWORKINGSET_NODESfile_offsetlinux_binfmtpage_table_lock_sigfaultregmap_irq_sub_irq_mapcountersname_linkNR_ANON_THPScmaxrsstimer_slack_nsbus_typerstat_css_listpolicysharedwait_queue_entryrtpoll_totald_real_typelookahead_bandio_portvolatile_tablenum_core_suppliesseq_starttask_cputimeraw_lockd_dnameac_schedspk_mutemax_hang_timecpus_mask_pad_b_dirtysubdirstask_groupinitializedstarttimeWM5110mmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailsvmstatslinenobi_io_vecbase_pfnstatget_inode_acl_addr_pkeymigrate_foliocustom_sliceNR_ACTIVE_ANONspanned_pagesthread_keyringeffectivekparam_arrayutimestart_codeis_hardfsbasecompatibleblk_status_tac_uidclock_listmicd_timeoutattrspercpu_drift_markcpumask_tgid_mapwm8998_patchswregs_statedqb_isoftlimitdma_iommuorig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEonline_cntnr_cached_objectsia_mtimetrc_ipi_to_cpudirty_exceedednodeinfomxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldis_seentotalreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetrstat_cputime64_tWB_REASON_FOREIGN_FLUSHi_blocksnuma_faults_localityhas_child_subreaperi_aclmicd_rangeswrite_newwb_listswap_filelist_lockpm_domaincpu_bitmapconsumerucount_maxregmap_rangestatic_call_keyutil_estucountsqc_statepageset_high_minsoftirq_next_timerpresent_early_pagescheck_flagsswp_entry_tbi_inline_vecsmemcg_css_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventLRU_ACTIVE_FILEset_performance_stateclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryimplicit_on_dflk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacac_exe_inodenr_to_scanthreaded_csetsDEVICE_PANEL_UNKNOWNfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treewm8998_rev_a_patchdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalper_cpu_zonestatsDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushmm_walkDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancesstart_all_reasonwb_bytesrangecgroup_base_statfutex_exit_mutexjd_gpio5_nopullhandle_post_irqval_bitscompact_blockskip_flushtrc_blkd_nodewrite_s64writeback_inodesd_spaceWB_REASON_PERIODICgraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameread_s64bi_iopriou_flagsnvcswac_tgetimewatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidproc_ns_operationsmin_vruntimefaults_disabled_mappingquota_typehighi_rdevlist_lru_nodewr_noinc_tableself_exec_idkernfs_opsfile_locktype_level_high_valMODULE_STATE_LIVEstopnr_migrationsa_opsxa_flagspad_bitsfreezebin_sizeclosedev_dma_attrgrphicftyped_spc_timerjump_entriesctl_dirasync_suspendmsi_device_dataalignsuper_blockset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorbvec_integrity_poolassoc_arraymnt_idmapdq_dqbmm_statesaved_tfElf64_Xwordold_timespec32lock_class_keymemory_events_localnum_symsmodule_notes_attrsvm_lock_seqpdeath_signalgenerationPIDTYPE_MAXroot_listnlinkcpu_countdefault_setavg_totalpercpu_refns_commonhorizontal_positionrlimit_maxarizona_ldo1_pdatapref_node_forkwait_queue__int128reclaimeddqi_privrss_statmems_allowed_seqmicd_raterefcntregmap_irqD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxac_niceDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrplocan_multi_writeclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_fileidr_basekswapd_orderuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrqstrWORKINGSET_REFAULT_FILEma_flagsfutex_stateorig_pmdacct_timexpds_op__rcu_icq_cachesizeZONE_DMA32CS47L24em_perf_tablewakeup_sourcef_posNR_FILE_DIRTYnext_posix_timer_id__kernel_long_twb_switch_rwsemtask_fragsrcu_gp_mutexMEMCG_OOMdatalennr_wakeups_affine_attemptsNR_LRU_BASEalt_lenuse_single_readcinblockextableexitcompact_consideredkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_countac_utimescaled__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexbpf_prog_arraycore_statetimerqueue_headserial_nrdac_comp_coeffdeferred_split_queuewm8998_i2c_regmapfutex_pi_statekstat__kernel_uid32_tsubsys_maskDEVICE_FIXEDpte_tdevice_driverdying_tasksdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointcancel_forkepoll_watchesWM8997WM8998non_rcuWORKINGSET_ACTIVATE_BASEkcompactd_waitdqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidst_spacefull_clustersmm_cid_next_scanns_typedfl_cgrpac_majfltposix_cputimers_work_upperwpcopy_delay_totalmodule_param_attrsshort unsigned intwatermark_boostunitcpu_scaled_run_real_totali_mutex_dir_keyq_nodespc_warnlimitcluster_next_cpuNR_WRITTENctl_table_sizes_encodinggpl_crcsorc_entrykeysarizona_micbiasperiod_timerorig_ptedqb_curinodesnbp_thresholdload__s8css_allocinvalidate_lock_keydma_maskprealloc_mutexselector_shiftnode_stat_itemreg_update_bitsobjcg_listsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tlruvec_stats_percpuregmapdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_patharizonadio_mem_alignARIZONA_NUM_MCLKNR_THROTTLED_WRITTENbtimeextra2__u8is_roxlockcompact_cached_migrate_pfnrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onezswap_writebackdevice_physical_location_horizontal_positionwm8998_readable_registerseeksseq_stopkf_rootkiocbbv_offsetprecious_regclass_rwsem_read_intr_is_conditionalcompact_order_failedfsuidread_flag_maskctl_table_argcompact_init_migrate_pfns_blocksize_bitsnuma_scan_periodmanaged_pagesmigration_disabledREGCACHE_FLATiter_typepositionclass_device_is_conditionalshrinker_idbio_setrootprojid_mapoom_reaper_listnr_reserved_highatomicshutdown_presym_VDSO32_NOTE_MASKbpf_storagenotifierno_callbacks__u16timers_activewait_countvirqNR_SHMEM_THPSsig_okdelaysqf_ownerreadaheadNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBwork_listNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingMEMCG_DATA_KMEMextentfsindexshstksrcu_sspwake_irqcan_attach__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timethrashing_delay_totali_sequencepool_datapage_memcg_data_flagspgdatdisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONE_watermarkswap_activatemkobjcore_cookiesrcu_supd_deleteb_more_ioPRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tmf_statsf_iocb_flagshpdet_acc_idpoweroffcmaj_fltvtimemath_emu_infoiowait_sumnum_config_basesf_pathpidlist_mutex__u64journal_infocapabilitiessched_contributes_to_loadstatic_key_trueb_ioweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vmnode_start_pfn_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimevm_starts_flagsfaultshow_statsdl_densityfreeptr_tread_dqblkac_giddq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grancgroup_freezer_statekernel_cap_twait_listrequest_pendingdworkhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_baseavgs_worknum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionmax_descendantswb_lcand_idserialclass_releasealloc_locks_dquotfolioqfoliosthreadedupdated_childrenmemcg_memory_eventWM8280prev_posNR_ISOLATED_FILEdelayedseqcount_spinlockexpire_countuid_maps_umountis_bin_visiblepgoffsyscall_user_dispatchumount_beginnr_disk_swapinsrcu_tasks_exit_listclear_ackarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_donenanosleeppud_tWM5102rt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcWB_REASON_LAPTOP_TIMERbi_issuequota_format_typeignoredvmstats_percputask_structanon_costrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalentotalreserve_pagesf_pipei_wb_frn_historylast_wakeenextmin_slab_pagesio_tlb_memarch_spinlock_tnr_tasksi_mtime_nsecperformancemmlistreg_readset_dqblksuppress_bind_attrsselector_regRPM_RESUMINGreg_offsetgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesrd_tablef_llisthigh_maxphandleread_u64i_nlinkwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_treclaim_waitfbatchnr_writeback_throttledsharepagefault_disabledstate_startsyscwnr_memcgsil_prevget_name_prefixMEMCG_NR_MEMORY_EVENTSwlockedfreeze_superREGMAP_ENDIAN_LITTLEs_inode_list_lockruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICoffline_nodequota_enablesched_avgntabzonedevice_typemaj_fltarch_rwlock_ttree_scannedreg_defaults_rawclock_basefrag_cluster_nrcdevmy_qgroup_leadermkdirzoneliste_csetsreal_blockedarg_locknum_exentriespid_ns_for_childrens_writerslaptop_mode_wb_timerlower_firstint32_tio_pagesoffset_ctxnr_failed_migrations_runningcompact_delay_totalclassesnext_timerclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlocksplit_queuefile_ra_statemax_depthuser_structon_rqusersfs_contextswap_extent_rootmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfbypassllseekDEVICE_HORI_POS_CENTERtypes_supportedDL_DEV_PROBINGout_monolast_old_flushnext_offsetcommit_dqblknamespacei_ino_warnlimitdirtied_stampwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidcookiebd_stamptargethigh_mina_flagstrace_overrunwriteback_sync_modesswap_cluster_infosession_keyringcpusfop_flagsSYSCTL_TABLE_TYPE_DEFAULTkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsmemory_peakscred_guard_mutexsigcntfiltershrtimer_cpu_basecb_headcheck_quota_filePGDEMOTE_DIRECTattributerestrict_linkdev_archdatamclki_deviceskey_perm_tcss_rstat_flushbio_integrity_payloadrescue_listswappinesspi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsrescue_locklist_lruusing_gplonly_symbolstarget_knsival_ptrthreaded_csets_nodelast_subtree_bstatrobust_listsym___kernel_rt_sigreturnsplit_queue_locksym_pvclock_pageserial_nodelen_descs_incoredqsregcache_typed_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockcgroup_fileforwarddev_links_infoloff_tthread_pidsrcu_gp_seqmicd_pol_gpiocgroup_rstat_cpu_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodemm_statsof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typePROBE_PREFER_ASYNCHRONOUSicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpaddingmax_prop_frac__fillersaved_sigmaskd_timelru_listentriescpu_idfop_flags_t__MAX_NR_ZONESFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedbd_statsbi_sizemodule_statelast_used_atmemcg_vmstatsvm_endregulatorlast_queuednuma_migrate_retryuser_ns__stateRPM_REQ_NONEfirstiommu_grouphandle_pre_irqmigrate_to_ramwb_domainwait_pidfdptrace_bpss_umount_keymax_ratiovm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeproc_handlerFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progressvolatile_regavgs_locksrcu_barrier_mutexi_private_dataElf64_Halfbw_dworkcompact_countnsproxycan_wakeupcache_typexol_areaPGPROMOTE_SUCCESSrlockfl_owner_tjd_invertMEMCG_LOWMEMCG_DATA_OBJEXTScls_mskeuidwaitbug_tablemax_raw_writedirtied_time_whensequential_io_avgmicd_detect_debounceoom_groupnum_trace_bprintk_fmtcpu_run_real_totalvm_policyWM1814perf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVEnum_reg_defaults_raw__state_sizethread_structcached_requested_keyenvp_indexbvec_iterper_cpu_pagesctimereleasemax_segment_sizenr_pagessched_dl_entity__kernel_dev_tatomic_write_lenwindow_lendqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetnet_nsREGMAP_ENDIAN_BIGfolio_queuelast_task_numa_placementnr_descendantspgtable_tblock_startcgtimeWB_REASON_VMSCANsymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcusocket_pressureki_waitqnotify_timertrace_eval_mapdonemax_registerfscrypt_operationsrelease_workWB_REASON_FS_FREE_SPACEksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexac_btime64mg_dst_preload_noderatelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaswapin_countdl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERrstat_css_nodeFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrwatermarkdeadpropsavg_nr_triggersfprop_globallong long unsigned intanon_nameblkcg_gqhashia_filesival_intnuma_preferred_nid_hugetlb_cgroupcore_suppliesdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatemm_listcss_idri_linkmicd_software_comparelistxattr_lowertrap_nrbinfmt_miscasync_probe_requestedcompat_long_tac_etimeconfig_bases_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidateregmap_endianbus_groupsirq_chippmd_t__UNIQUE_ID___addressable_wm8998_i2c_regmap617mnt_namespacenode_spanned_pagessysv_shmdq_countctrlif_errorutf8data_tableset_latency_tolerancefoliowake_entryxa_headsuidregmap_irq_chip_datacluster_infoi_readcountlocked_vmrb_leftmg_src_cgrpseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tregmap_lockquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countmemcg_completionsksm_merging_pagesreg_format_endianfree_listregmap_range_cfgautosleep_enabledptrace_entryuse_autosuspendrecent_used_cpunum_jump_entriess_qcopatomic_tbv_page_flagsnotify_nexte_cset_nodebus_dma_limitshort intmynodemicd_dbtimenr_free_highatomicpdataof_device_idarizona_micd_rangewb_waitqclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regPGDEMOTE_KSWAPDVTIME_USERsa_flagstestcss_offlinepad_untilDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2regmap_access_tabledestroy_rworklast_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datanr_extentsnr_scannedpoll_table_structfifodirect_IOn_no_rangesmain_statusno_rangeswait_queue_entry_tpcpucurrent_may_mountseqlock_tbd_queuenuma_scan_offsetcgroup_subsys_statevertical_positionkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskMEMCG_SWAP_MAXfreezerNR_INACTIVE_FILELRU_INACTIVE_ANONregfuncindex_keymemalloc_noiohpdet_id_gpioGRPQUOTArwsemi_private_listia_validSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcluster_nrvirtmemi_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockinit_dataactiveno_statusdqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisevmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersper_cpu_nodestatselectorMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nssource_listcgroup_bpfswap_readahead_info__fpstateactive_refpmdval_tctl_table_rootARIZONA_MCLK1ARIZONA_MCLK2group_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizedfl_cftypeshpdet_clampdeferred_splitmce_kill_meuuid_tproperty_read_int_arrayuse_hwlockcount_objectsctl_table_setnum_regs_stimezone_device_datakcompactd_max_orderpeaks_lockf_wb_erruseddefparamsaved_errfred_csfault_flagkprojid_tptracer_credtlb_gencgwb_domainmax_register_is_0page_mkwritekobjectaudit_ttyirq_flagsrtpoll_triggersmce_ripvstatfsctl_table_headeruse_relaxed_mmionumab_stateruntime_pmremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cbliststoragesclass_groupspsi_groupnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchangedbdi_listwatch_listaudit_contextpp_ref_countsysfs_opsregulator_bulk_datasequential_iotime_namespace_large_mapcountsda_is_staticformatftopenclavereclaim_workbi_privatecreateiattrrseqnfdssigvalvma_lockperf_event_listarizona_typeget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadwriteable_regd_realancestorstot_write_bandwidthmax_channels_clockedexpiry_activedqi_max_spc_limitvm_numa_eventexception_table_entrynr_isolate_pageblockevent_countnr_to_writefallocatei_spc_warnlimitbuddy_listi_ino_timelimitnode_present_pagesi_mmap_writablemems_allowedMEMCG_SWAP_FAILtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderclk_lockold_subtree_controltimewakee_flip_decay_tsmemcg_vmstats_percpus_max_linksnr_wakeups_synckallsymskcompactdprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvector__bi_cnttimer_listrefaulteddevice_dma_supportedd_ino_warnshiwater_vmtracepointdac_comp_enabledcompound_headia_vfsuidunaccepted_pagesreg_baselrugen__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structunlockrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitbd_nr_sectorsqf_nextWB_REASON_BACKGROUNDunmask_baserangesmemory_eventsiommu_mmcutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charpersistent_keyring_registerprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsno_pmbi_max_vecsgroup_stop_countdac_comp_lockavg_last_updatelowest_bit_killktime_tchildren_low_usagesymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387iterd_ino_timeravx512_timestampfuncsend_datapercpu_pvec_drainedsubtree_controlsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncrange_startper_cpu_nodestatsnr_charged_bytessetleasepinspacct_structmust_resumescannedlong intpresent_pagesfile_lock_contextusagesiglockper_cpu_pagesetstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ssproperty_presentUSRQUOTAprintk_index_sizesymtabtimes_previnit_load_uArt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegidiomapdq_hashput_superfwnode_reference_argsnext_addrpushable_dl_tasksf_flagsf_inodeprocnamemark_dirtynr_dying_descendantsnum_srcu_structsbdi_writeback_pad1_kobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEmicd_configsbalanced_dirty_ratelimit_pad2_cancelled_write_bytesac_tgidsrcu_usagebitmapacpi_match_tablememcgbw_time_stamp_sigvalmax_perf_statebvecnameidatalatency_recordmod_kallsymsmnt_idrefaultshas_fully_powered_offdepth_pad3_wait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldstatus_baselistsssize_tsr_lockiopl_emulwork_structdesc_lenflocktask_io_accountinginit_ack_maskedmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structreversepi_locklru_gen_mm_state___orig_eipprobestubget_timedapmmm_cid_activeelemsizedirty_paused_whenblkcg_cssmaxlensuspend_noirqDEVICE_VERT_POS_UPPERrelease_agent_pathclass_spinlock_irq_try_is_conditionalwm8998_volatile_registeroom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lrudischargezone_idxdom_cgrpNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvolNR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tmg_tasksuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_max_ino_limitdqi_fmt_idwr_tableuid_gid_maprtpoll_trigger_locksrcu_structrlim_curnofaultmm_countdrv_groupsstackoffline_waitqmnt_nsac_ppidfunctionwb_idki_flagsbvec_poolbd_start_sectsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timecgroup_rootdatastrtabtty_old_pgrpold_dom_cgrpwm8998_reg_defaultdl_throttledi_rwsemrtpoll_statesget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextwake_baseopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_foliomax_raw_readsplit_queue_lennr_eventsWB_REASON_SYNCmicbiasiommuwriteable_noinc_regbi_opfswap_iocbprivatehlistcftsst_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxswap_plugMEMCG_MAXsplice_pipes_lock_keymg_nodekswapdsrcu_gp_startopentime_nsit_real_incrwaitqmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmem_cgroup_idmodstqheads_activesym_vvar_startMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalget_irq_regdeadremap_file_rangeac_commnr_hangskcompactd_highest_zoneidxgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsswap_mapdq_dirtydl_deferbug_listdirect_completenbp_rl_startidr_rtlegacy_namexa_lockfxregs_statememcg_cgwb_frnload_weightdiscard_clusterskuid_tarch_datafpstateshrinker_infoblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateuts_nsis_late_suspendedsysvsemucountvm_stat_diffkmemcg_idignore_childrenlru_gen_mm_walk_pflagsrestore_earlyhap_actarizona_pdataclock_mutexfs_supersREGCACHE_RBTREEdom_csetevents_local_fileroot_csetdqb_bsoftlimitpendingf_task_worklru_gen_memcgiowait_countnotifier_blockmemswdma_io_tlb_memrtpoll_scheduledstringread_countstoreforklruvecfutex_offsetvmpressurelong long intwrite_flag_maskbdevatomic_flagssysvshmtimer_expirestrace_evalsactive_baseshierarchy_idearly_initmprotectac_exitcodesecurityxmm_spaceactivatef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesdepends_ondomain_dataidr_nextrelax_countlinelinkstart_timekernfs_nodercu_workRPM_REQ_IDLEsuppliersdev_tFREEZE_HOLDER_USERSPACEfront_paddup_xol_addrcapture_controlnr_wakeupspost_attachstartstart_brkstatic_key_modd_ino_softlimitxregs_statelock_argWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterscss_resetNR_SECONDARY_PAGETABLEd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qscompact_defer_shiftswap_deactivatedomain_suffixblkcnt_tnum_micd_configsicq_treesi_codethread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batchrstat_flush_nextzeromapmap_pagesreschedule_countvfsmountcss_onlineextable_basenoinstr_text_sizenargsattributesmicd_force_micbiasset_child_tid_overrunwrite_u64tmpfilemicd_bias_start_timercu_read_lock_nestingem_perf_statemin_nrtick_dep_maskgpio_descprecious_tablelistthrottle_disksi_errnobsynce_freezememcg_lrus_inode_lrumemcg_nodesrcu_size_stateblk_plugunpinned_netfs_wbof_noderefsmmap_compat_baseWB_SYNC_NONEtrace_eventsenv_startcgrp_ancestor_storagedma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_statemask_unmask_non_invertedUTASK_SSTEPpkrureal_parentlockedcgroup_tasksetVTIME_GUESTrtpoll_next_updateregsslice_maxlast_switch_countqsize_tregmap_irq_typeblkio_delay_totaltime_ns_for_childrenfilesdqb_bhardlimitlivevm_faultatomic_write_unit_maxs_staterun_listixolbd_mappingsym_vvar_pagemodule_sect_attrsmg_src_preload_nodereturn_instancesoftirq_activatednum_irqsclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intnotifier_callrtpoll_taskgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqbi_crypt_contextia_vfsgidzone_typesize_tacpi_device_idcap_permittedTT_NATIVEzone_pgdatclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesu64_stats_syncrcu_tasks_idxsync_modercu_tasks_holdouttarget_listtype_level_low_valavg_write_bandwidthb_attachedpasid_activatedpi_sezonerefget_offset_ctxcore_forceidle_sumnum_main_regsfreeze_ucounti_ctime_nseccpuhp_deads_remove_countsyscall_workcompletionsdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwriteclass_raw_spinlock_is_conditionalstatus_invertcallback_headmemory_failure_statss_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicrestoredelayed_callbi_itermax_nr_cid_statusd_sibkernel_ulong_tdma_opsbin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migrateddl_dev_stategsindexexpires_nexti_io_listf_epsrcu_barrier_seqlinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2css_extra_stat_show__kernel_timer_tclass_srcu_is_conditionalcss_releasedDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskavail_listsatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionsnd_soc_dapm_contextbv_lendiscard_workstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_dispblkcg_nodercu_specialclear_child_tidf_refextable_lenper_cpu_zonestatbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usagetree_reclaimedratelimit_states_pinsattrget_next_child_nodeFAULT_FLAG_WRITEreg_bitsstate_in_sysfswrite_syscallsvm_fault_ttty_structUTASK_SSTEP_TRAPPEDext_capdebug_dirfind_special_pagebacktrace_entire_mapcountforce_atomicmmap_compat_legacy_basedefault_groupspollac_padgraph_get_next_endpointmemcg_idnr_wakeups_idlertpoll_waitio_cqprobeelf64_symlatch_tree_nodepercpu_ref_datadestroy_workreadable_noinc_regDEVICE_HORI_POS_RIGHTPROBE_FORCE_SYNCHRONOUSval_format_endiannum_main_status_bitssyscorewb_reason__s64LRU_ACTIVE_ANONdqi_bgrace__kernel_pid_tstatic_call_mod_timerdma_map_opsma_external_lockdevice_physical_location_panelpoweroff_latectl_tableuid_tflush_requiredprocs_filecs47l24_spi_regmapsum_block_runtimepgmapmin_perf_statedq_opnum_micd_rangesrcu_tasks_nvcswwritetypetabclk32k_refclass_read_lock_irqsave_is_conditionalcan_forkfor_backgrounddma_pools_addr_lsbctl_table_polli_generation_sigpollmxcsrdevtrange_cyclicd_rt_spc_hardlimiteminbi_end_ioblk_holder_opsfreepages_delay_totalnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inocgwb_listdyndbg_infocompact_cached_free_pfnindexfree_clustersdriver_datathread_headac_exe_devdev_pm_qosbi_sectormap_typeperiod_timef_oppids_active_resetconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizethawdq_sbNR_FILE_THPScgroupsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entrycancel_attachwaiterscmin_fltdev_pin_inforw_semdqio_semprev_sum_exec_runtimeinmodenestedrtpoll_nr_triggersnr_forced_migrationsac_pidseq_operationsnum_argsri_timerstack_canaryinactiveblksizesiblingmnt_rootnext_scanunregisteringf_raquota_writesrcu_barrier_cpu_cntNR_LRU_LISTSiopl_warnrmdirsockreg_stridebi_write_hinthash_lenget_policyshrinker_info_unitnr_reclaim_start__bi_nr_segmentstask_iterssym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecss_freecpu_basedevice_is_availabledquotdl_runtimechildren_min_usagenumbersswapin_delay_totalbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdhandle_mask_syncfaultableio_comp_batchshutdowndq_lockzswap_maxi_cdevldt_structenv_endobj_cgrouprescue_workqueueprogsextra1ptrace_messagenum_trace_events_sys_privateuse_raw_spinlockmin_usageinit_fs_contexts_subtypeheaderfuncperf_event_contextno_cgroup_ownernbp_th_nr_candcputimetlbflush_unmap_batchtype_in_masksoftfreepages_countyes_ranges__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authvirtual_dr6attachkprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatchersrange_endcompletionsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrshow_optionsgpswbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodebpf_cgrp_storagenum_rangescurr_nrcorememsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_dataWORKINGSET_REFAULT_ANONtype_reg_maskget_dquotsnextentsnum_orcscma_pagesclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onregmap_register_patchvm_operations_structNR_ACTIVE_FILEjd_gpio5bin_attrs_newbio_alloc_cachebi_bdeviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrennregis_softbindcntsRPM_SUSPENDEDreclaim_stateMEMCG_SWAP_HIGHevictedvma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGcacheline_paddingnrpages_refcounti_crypt_infopermissionsnr_frozen_descendantsbdi_nodeerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepenvp_idxcgroup_namespaceZONE_DEVICE_head_1_head_2subsysbd_size_lockbackstate_add_uevent_senti_hashhlist_nodeio_uringregulator_init_datareg_sequencecore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumewake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointersect_attrsmg_dst_cgrpsoft_startonlineruntime_resumedup_xol_workwrite_charlocal_watermarktdm_slotsMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignhpdet_channeldelay_workoublockinuse_pagesrecent_cidkf_opscan_sleepkernel_paramdeferred_resumed_spc_softlimitreported_split_lockmicvddgfp_tseccomp_filterstimei_mmapthaw_superREGMAP_ENDIAN_DEFAULTd_lrusignal_structperf_event_mutexrd_noinc_tableNR_PAGETABLEcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrsprotectedsas_ss_flagsf_modeki_completenonfull_clustersvtime_statewakee_flipsset_acldismisspids_activedriverZONE_NORMALREGMAP_ENDIAN_NATIVEi_opldt_usr_semHRTIMER_RESTARTwpcopy_countkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphoreWORKINGSET_ACTIVATE_FILEreg_shiftcredjump_entryreg_defaultreg_defaultsfrag_clustersproactive_compact_triggersrcu_gp_seq_needed_expgpioaddress_space_operationsspinlock_t__task_fpstatemaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodeis_dirty_writebacktrace_bprintk_fmt_startneeds_force_resumehuge_faultkstatfssites__lruveccluster_nextreg_writemem_cgroup_reclaim_iterevents_lockptracequota_disablekprobe_blacklistwork_lockcpus_ptrnotified_atpaccti_dentrygrab_current_nsaltmapdescsfsnotify_mark_connector_sigsysdelay_uskswapd_lockdirty_limit_tstampsrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMED__NR_MEMCG_DATA_FLAGSexpiresrcuwaitnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotbstatfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutexblocking_notifier_headcoredump_datavm_stattasksmem_cgroup_per_node_pidaddress_spacemm_context_tirq_reg_strideuid_gid_extent__call_single_nodestartupseqcount_spinlock_tbio_issuei_wbcss_local_stat_showuint8_tMEMCG_HIGHregmap_irq_chippanelclass_idinactive_timer_pkeyfilenames_export_opclear_on_unmaskselector_maski_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedresume_noirqlowmem_reservepagetrc_holdout_listget_inode_usagedevice_nodenormal_priodestroy_inoderelease_foliolast_busyi_pipebaseforce_scanhostuaddrfailedcgrps_wb_errold_subtree_ss_maskshm_clistis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descscontiguousrecoveredcs47l24_reva_patchexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoNR_FILE_PMDMAPPEDalloc_inodeuser_event_mmd_inamedevres_headi_mappinginblockrmidrseq_sigLRU_INACTIVE_FILEarizona_micd_configdev_pm_domainlimit0limit1nr_zonespages_skippedmigrate_modebio_poolfree_areakswapd_failureszswap_lruvec_stateftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infolru_gen_mm_listi_flagsNR_ISOLATED_ANONkernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodepushable_tasksack_invertplatform_datad_comparesighanditerate_sharedis_visiblesignalWB_REASON_FORKER_THREADreleaseddep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timerobust_list_headswap_peaks__ubuf_iovecignored_posix_timersNR_ANON_MAPPEDcountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackstat_thresholdlevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventfast_iohlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesshowunsigned charzone_start_pfnvdsomemtiermmap_legacy_basepipe_inode_infononresident_ageuint16_tsecurebitspartition_meta_infostate_initializeduring_cmd_iopollbi_poolcompat_uptr_tuevent_opssub_reg_offsetszero_flag_maskslicesas_ss_spnr_dirtiednum_kprobe_blacklistsubtree_ss_maskclass_local_lock_is_conditionalsuspend_latewakeupcg_listcgwb_release_mutexsrcu_barrier_completionwb_completionshrink_controlwritten_stampdriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapaod_irq_chipspan_seqlocknum_reg_defaultssessionidcs47l24_volatile_registerlast_bdp_sleep_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistZONE_DMAdebugfs_entryelemnr_retriescgwb_frnavg_refaultedsigval_talimitundo_listdirty_foliorcharZONE_MOVABLEnr_populated_domain_childrenmissedkswapd_highest_zoneidxparent_could_setfcapquota_readst_shndxldo1freepageset_high_maxi_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_statepage_poolsuspendinitfiles_structwrite_iters_securityactive_counts_dio_done_wq_dummy_bndmin_unmapped_pagessas_ss_sizespk_fmtuser_xfeaturesnr_wakeups_passivefile_system_typewb_tcand_idmtimeserver_has_tasksswap_events_fileoom_score_adj_minreadable_regkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_thigh_worknode_zonelistsrange_maxpathst_sizenr_frozen_taskslru_gen_foliormtpwait_sumnum_tracepointsupidexit_codemempool_ttype_falling_valexec_startclass_read_lock_is_conditionalconsumersrtpoll_min_periodkernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workkeyring_semsrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribforceidle_sumrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncvm_opshighest_bitiopollregmap_unlockpagesizes_blocksizevm_pgofftimesauprobecan_swaprelease_agent_worknuma_workupdate_timeptrace_dr7priority_call_addrexpireloginuidcheckrtpoll_untilexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_donenbp_rl_nr_cand__lstateupdated_nextueventlock_countrefcount_tcset_linksplugchild_countsaved_auxvmce_addrlast_bstatnum_bugsqf_ops__vm_flagsnum_config_regsmod_nametype_rising_valproperty_read_string_arraymm_cidmemory_tierunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalorig_objcgrseq_csdcvddnum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsnode_zoneswindow_startnbp_th_startelow_pincounttablesDEVICE_PANEL_BOTTOMmin_seqlist_headlru_lockhwlock_idrange_mintgidbatchedfor_reclaimwrite_protect_seqtdm_widthcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holderend_codeblkio_countqspinlocklru_genNR_VMSCAN_WRITEinsnfilldir_tfolio_batchlow_usagedl_non_contendingdir_contexttracepoint_ptr_tutaskfailcntNR_UNEVICTABLEsched_entityd_spc_hardlimitgpio_defaultslockdep_keylong unsigned intsleep_maxPGDEMOTE_KHUGEPAGEDmmap_baserescue_workio_contexthpdet_acc_id_linegpl_symsgroupseq_showctl_nodeswait_queue_headcow_pageinumac_btimeblocki_spc_timelimitreturn_instancesn_yes_rangesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfddevicebi_integritys_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgfull_namedisable_lockingnoderesetfor_kupdatevm_lockwb_tcand_bytesno_cgroup_migrationnextevts_writers_key__countxcomp_bvcma_areatype_reg_offsetWORKINGSET_RESTORE_FILEstatic_priomay_skip_resumeshrinkerdl_yieldeddqi_formatipc_namespaceexec_update_lockl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentread_charcgroup_nsia_sizein_hrtirqs_master_keysac_stimescaledpropertywchar_addr_bndkernel_symboli_opflagssubsys_databi_statusnr_cgrpstv_secpid_ttask_listftrace_sleeptimeset_type_configrun_nodema_rooturing_cmdpsi_filesMEMCG_OOM_KILLnr_failed_migrations_affineNR_SWAPCACHEuser_cpus_ptrirq_delay_totalpi_top_taskNR_WRITEBACK_TEMPactoruprobenotifier_subscriptionss_readonly_remountbiasutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimedisable_depthmax_seqi_sizedl_deadline_hugetlb_hwpoisonpsi_group_cpuubufksm_rmap_itemspageset_batcharizona_micsupp_pdatanr_populated_csetsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlockdmic_refkswapd_waittimer_autosuspendspudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flagskeyring_name_listfile_costread_posstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuealloc_factorKOBJ_NS_TYPE_NETdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepagecodegtimenr_populated_threaded_childrensigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendinghlist_nulls_nodenr_deferredfown_structfeatures_lockedlruvec_statstracing_graph_pauseavg_triggerspermcompat_robust_listbi_blkgktypelockrefin_dpm_listsrcu_struct_ptrsmm_structrtpoll_wakeupvlagi_uidREGCACHE_NONEbi_iocost_costspinlocknr_dying_subsystimestampspid_namespace_syscallmod_arch_specificmax_write_lennum_static_call_sitesend_pfnvm_mmdebugfs_idwb_lcand_bytesguest_permmem_dqinfotruei_countHRTIMER_NORESTARTWB_SYNC_ALLbd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipcgwb_treeufdsexe_filehlist_bl_nodeipc_nspcp_listhwlock_modepid_linksfree_counts_sysfs_namerefcountvaddrrequestregmap_configpglist_datarw_hinttimeoutdma_configurelast_switch_timenum_classesorc_unwind_ippage_counterqc_dqblkfprop_local_percpuavg_next_updatemmappedseqcount_raw_spinlockbd_holder_dircpu_run_virtual_totalkill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWERthrashing_countllist_headwait_startpercpu_clusterf_freeptrnr_freeclass_raw_spinlock_irqsave_try_is_conditionalmap_nr_maxget_dqblkshow_fdinfofixupirq_getuse_ackset_ownershipposix_acldd_key_falsehp_enabug_addr_dispdqi_igracemax_slack_shiftclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifierssrcu_last_gp_endbdi_ids_fsnotify_infocpu_delay_totaluser_keyring_registermempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskNR_INACTIVE_ANONVTIME_IDLEstatic_keyremoves_magicdl_overrunalloccs47l24_reg_defaultd_parentirq_drv_datamask_basepayloadac_minflti_sbmin_ratiod_sbcommcompwake_invertcan_matchlast_timePIDTYPE_PIDeventsofflineatomic_write_segments_maxirqsatomic_open_zonerefsbio_end_io_tstart_prevent_timeMEMCG_OOM_GROUP_KILLlru_zone_sizereadahead_controlrtpoll_timerdirty_limit__kernel_gid32_tcompact_init_free_pfnkernfs_open_filestate_maskf_credMODULE_STATE_COMINGnotify_countmg_dst_csetoffline_disabled__empty_rangesbd_devread_newPGPROMOTE_CANDIDATEsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_tbi_idx__kernel_loff_tpropertiesdetachget_unmapped_areadev_pagemapwritepagessched_statisticsheadgpio_base__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controluclampirq_gpiosuper_operationsbi_cookiesplice_eofnr_threaded_childrenutil_avgtaskrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regspipe_bufsNR_IOMMU_PAGESctx_iddirty_ratelimitd_rt_spc_warnsclk32k_srci_verity_infoxsavetimespec_type__rb_parent_colorLRU_UNEVICTABLEdevres_lockbitsWB_REASON_MAXiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsevents_fileout_vol_limitntimevm_private_dataio_bitmap__bi_remainingsubtree_bstatuprobe_task_statetimerkobj_typeb_dirty_timei_pageshlist_bl_headino_warnlimitpfmemalloc_waitarch_uprobe_taskfasyncpidlistsi_rt_spc_warnlimitpage_fragwrite_bytesNR_FILE_PAGESchardomainunix_inflightholders_dircont_lockfpu_state_permi_fsnotify_maskbio_vecsysctlsprotection_supportack_basegraph_get_port_parentWM1831__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkREGCACHE_MAPLEvm_node_stat_diffbio_slabd_aliasNR_SHMEM__iovcpumaskdumpernode_size_lockwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootswrite_bandwidthd_rt_spc_timerevict_inodepercpu_ref_func_tlengthbuflensaved_trap_nrbio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_tuse_single_writerunningrseq_event_masks_rootra_pageslegacy_cftypesTT_COMPATexternal_dcvddfwnode_handleNR_SLAB_RECLAIMABLE_BElf64_Symd_automountsupplypage_freeread_syscallshlist_nulls_headNR_FILE_MAPPED_nr_pagesparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typecgrp_linksget_named_child_nodelaunder_foliocurr_targetis_suspendeduts_namespacefor_syncburstetypeei_funcsmodule_kobjectmemoryorderactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsettagged_writepagesarchdata_sourcepower_statenr_perf_statesstack_vm_areasaved_statekernfs_elem_attrbasess_bdev_filenuma_faultsperiodcgroup_subsysWORKINGSET_NODESfile_offsetlinux_binfmtpage_table_lock_sigfaultregmap_irq_sub_irq_mapcountersname_linkNR_ANON_THPScmaxrsstimer_slack_nsbus_typerstat_css_listpolicysharedwait_queue_entryrtpoll_totald_real_typelookahead_bandio_portvolatile_tablenum_core_suppliesseq_starttask_cputimeraw_lockd_dnameac_schedspk_mutemax_hang_timecpus_mask_pad_b_dirtysubdirstask_groupinitializedstarttimeWM5110mmap_missquota_format_opsclass_rwsem_write_is_conditionalcs47l24_readable_registermin_sliceargs__poll_tfwnode_operationsshow_devnamerun_delaytailsvmstatslinenobi_io_vecbase_pfnstatget_inode_acl_addr_pkeymigrate_foliocustom_sliceNR_ACTIVE_ANONspanned_pagesthread_keyringeffectivekparam_arrayutimestart_codeis_hardfsbasecompatibleblk_status_tac_uidclock_listmicd_timeoutattrspercpu_drift_markcpumask_tgid_mapswregs_statedqb_isoftlimitdma_iommuorig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEonline_cntnr_cached_objectsia_mtimetrc_ipi_to_cpudirty_exceedednodeinfomxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domain_sigchldis_seentotalreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetrstat_cputime64_tWB_REASON_FOREIGN_FLUSHi_blocksnuma_faults_localityhas_child_subreaperi_aclmicd_rangeswrite_newwb_listswap_filelist_lockpm_domaincpu_bitmapconsumerucount_maxregmap_rangestatic_call_keyutil_estucountsqc_statepageset_high_minsoftirq_next_timerpresent_early_pagescheck_flagsswp_entry_tbi_inline_vecsmemcg_css_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventLRU_ACTIVE_FILEset_performance_stateclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryimplicit_on_dflk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacac_exe_inodenr_to_scanthreaded_csetsDEVICE_PANEL_UNKNOWNfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2adma_cleanupmaple_treecs47l24_irqsdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalper_cpu_zonestatsDEVICE_PANEL_LEFTautogroupnr_threads__i_nlinkpushmm_walkDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancesstart_all_reasonwb_bytesrangecgroup_base_statfutex_exit_mutexjd_gpio5_nopullhandle_post_irqval_bitscompact_blockskip_flushtrc_blkd_nodewrite_s64writeback_inodesd_spaceWB_REASON_PERIODICgraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameread_s64bi_iopriou_flagsnvcswac_tgetimewatchdog_stampseglentask_delay_infoprealloc_ptevmemmap_shiftFAULT_FLAG_USERshared_pendingi_gidproc_ns_operationsmin_vruntimefaults_disabled_mappingquota_typehighi_rdevlist_lru_nodewr_noinc_tableself_exec_idkernfs_opsfile_locktype_level_high_valMODULE_STATE_LIVEstopnr_migrationsa_opsxa_flagspad_bitsfreezebin_sizeclosedev_dma_attrgrphicftyped_spc_timerjump_entriesctl_dirasync_suspendmsi_device_dataalignsuper_blockset_policy_typercu_tasks_holdout_listcpuset_mem_spread_rotorbvec_integrity_poolassoc_arraymnt_idmapdq_dqbmm_statesaved_tfElf64_Xwordold_timespec32lock_class_keymemory_events_localnum_symsmodule_notes_attrsvm_lock_seqpdeath_signalgenerationPIDTYPE_MAXroot_listnlinkcpu_countdefault_setavg_totalpercpu_refns_commonhorizontal_positionrlimit_maxarizona_ldo1_pdatapref_node_forkwait_queue__int128reclaimeddqi_privrss_statmems_allowed_seqmicd_raterefcntregmap_irqD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxac_niceDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicdquot_operationsmappingRPM_INVALIDgrplocan_multi_writeclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_fileidr_basekswapd_orderuser_sizedev_pm_opsscheduledFAULT_FLAG_TRIEDclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrqstrWORKINGSET_REFAULT_FILEma_flagsfutex_stateorig_pmdacct_timexpds_op__rcu_icq_cachesizeZONE_DMA32CS47L24em_perf_tablewakeup_sourcef_posNR_FILE_DIRTYnext_posix_timer_id__kernel_long_twb_switch_rwsemtask_fragsrcu_gp_mutexMEMCG_OOMdatalennr_wakeups_affine_attemptsNR_LRU_BASEalt_lenuse_single_readcinblockextableexitcompact_consideredkernel_param_opsbus_dma_regionio_uring_cmddirtied_when_batch_countac_utimescaled__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexbpf_prog_arraycore_statetimerqueue_headserial_nrdac_comp_coeffdeferred_split_queuefutex_pi_statekstat__kernel_uid32_tsubsys_maskDEVICE_FIXEDpte_tdevice_driverdying_tasksdl_server_has_tasks_frunnable_sumreal_credget_namefwnode_endpointcancel_forkepoll_watchesWM8997WM8998non_rcuWORKINGSET_ACTIVATE_BASEkcompactd_waitdqb_curspacegp_statebitsetload_avgaccesscstimecfs_rq_uidst_spacefull_clustersmm_cid_next_scanns_typedfl_cgrpac_majfltposix_cputimers_work_upperwpcopy_delay_totalmodule_param_attrsshort unsigned intwatermark_boostunitcpu_scaled_run_real_totali_mutex_dir_keyq_nodespc_warnlimitcluster_next_cpuNR_WRITTENctl_table_sizes_encodinggpl_crcsorc_entrykeysarizona_micbiasperiod_timerorig_ptedqb_curinodesnbp_thresholdload__s8css_allocinvalidate_lock_keydma_maskprealloc_mutexselector_shiftnode_stat_itemreg_update_bitsobjcg_listsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tlruvec_stats_percpucs47l24_irqregmapdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_patharizonadio_mem_alignARIZONA_NUM_MCLKNR_THROTTLED_WRITTENbtimeextra2__u8is_roxlockcompact_cached_migrate_pfnrlim_maxDEVICE_PANEL_FRONTruntime_deferred_listd_waitlocal_fwnodelist_lru_onezswap_writebackdevice_physical_location_horizontal_positionseeksseq_stopkf_rootkiocbbv_offsetprecious_regclass_rwsem_read_intr_is_conditionalcompact_order_failedfsuidread_flag_maskctl_table_argcompact_init_migrate_pfns_blocksize_bitsnuma_scan_periodmanaged_pagesmigration_disabledREGCACHE_FLATiter_typepositionclass_device_is_conditionalshrinker_idbio_setrootprojid_mapoom_reaper_listnr_reserved_highatomicshutdown_presym_VDSO32_NOTE_MASKbpf_storagenotifierno_callbacks__u16timers_activewait_countvirqNR_SHMEM_THPSsig_okdelaysqf_ownerreadaheadNR_SLAB_UNRECLAIMABLE_Bmutexpgd_tnr_cpus_allowedNR_KERNEL_STACK_KBwork_listNR_VM_NODE_STAT_ITEMSraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingMEMCG_DATA_KMEMextentfsindexshstksrcu_sspwake_irqcan_attach__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEactive_timethrashing_delay_totali_sequencepool_datapage_memcg_data_flagspgdatdisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqkqiddefer_syncKOBJ_NS_TYPE_NONE_watermarkswap_activatemkobjcore_cookiesrcu_supd_deleteb_more_ioPRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typenotifier_fn_tmf_statsf_iocb_flagshpdet_acc_idpoweroffcmaj_fltvtimemath_emu_infoiowait_sumnum_config_basesf_pathpidlist_mutex__u64journal_infocapabilitiessched_contributes_to_loadstatic_key_trueb_ioweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinemempool_spinned_vmnode_start_pfn_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimevm_starts_flagsfaultshow_statsdl_densityfreeptr_tread_dqblkac_giddq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grancgroup_freezer_statekernel_cap_twait_listrequest_pendingdworkhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_baseavgs_worknum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionmax_descendantswb_lcand_idserialclass_releasealloc_locks_dquotfolioqfoliosthreadedupdated_childrenmemcg_memory_eventWM8280prev_posNR_ISOLATED_FILEdelayedseqcount_spinlockexpire_countuid_maps_umountis_bin_visiblepgoffsyscall_user_dispatchumount_beginnr_disk_swapinsrcu_tasks_exit_listclear_ackarchdataia_uidchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_donenanosleeppud_tWM5102rt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcWB_REASON_LAPTOP_TIMERbi_issuequota_format_typeignoredvmstats_percputask_structanon_costrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalentotalreserve_pagesf_pipei_wb_frn_historylast_wakeenextmin_slab_pagesio_tlb_memarch_spinlock_tnr_tasksi_mtime_nsecperformancemmlistreg_readset_dqblksuppress_bind_attrsselector_regRPM_RESUMINGreg_offsetgsbaseNR_VMSCAN_IMMEDIATEs_quota_typesrd_tablef_llisthigh_maxphandleread_u64i_nlinkwrite_begingroupspi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_treclaim_waitfbatchnr_writeback_throttledsharepagefault_disabledstate_startsyscwnr_memcgsil_prevget_name_prefixMEMCG_NR_MEMORY_EVENTSwlockedfreeze_superREGMAP_ENDIAN_LITTLEs_inode_list_lockruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICoffline_nodequota_enablesched_avgntabzonedevice_typemaj_fltarch_rwlock_ttree_scannedreg_defaults_rawclock_basefrag_cluster_nrcdevmy_qgroup_leadermkdirzoneliste_csetsreal_blockedarg_locknum_exentriespid_ns_for_childrens_writerslaptop_mode_wb_timerlower_firstint32_tio_pagesoffset_ctxnr_failed_migrations_runningcompact_delay_totalclassesnext_timerclass_write_lock_is_conditionalWORKINGSET_NODERECLAIMbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_lockfsavekeyring_index_keyqrwlocksplit_queuefile_ra_statemax_depthuser_structon_rqusersfs_contextswap_extent_rootmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfbypassllseekDEVICE_HORI_POS_CENTERtypes_supportedDL_DEV_PROBINGout_monolast_old_flushnext_offsetcommit_dqblknamespacei_ino_warnlimitdirtied_stampwritable_sizercu_nodeinit_nameunfreeze_fsintervalclasslast_mm_cidcookiebd_stamptargethigh_mina_flagstrace_overrunwriteback_sync_modesswap_cluster_infosession_keyringcpusfop_flagsSYSCTL_TABLE_TYPE_DEFAULTkey_restrict_link_func_tNR_WRITEBACKs_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsmemory_peakscred_guard_mutexsigcntfiltershrtimer_cpu_basecb_headcheck_quota_filePGDEMOTE_DIRECTattributerestrict_linkdev_archdatamclki_deviceskey_perm_tcss_rstat_flushbio_integrity_payloadrescue_listswappinesspi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsrescue_locklist_lruusing_gplonly_symbolstarget_knsival_ptrthreaded_csets_nodelast_subtree_bstatrobust_listsym___kernel_rt_sigreturnsplit_queue_locksym_pvclock_pageserial_nodelen_descs_incoredqsregcache_typed_iputcompat_ioctllockdep_mapfiltercurr_ret_stackdockcgroup_fileforwarddev_links_infoloff_tthread_pidsrcu_gp_seqmicd_pol_gpio__UNIQUE_ID___addressable_cs47l24_irq618cgroup_rstat_cpu_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodemm_statsof_node_reusedWORKINGSET_RESTORE_BASEinsnlenclass_map_typePROBE_PREFER_ASYNCHRONOUSicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchNR_FOLL_PIN_ACQUIREDasync_sizeacct_vm_mem1i_mtime_secmatchmemory_typerb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpaddingmax_prop_frac__fillersaved_sigmaskd_timelru_listentriescpu_idfop_flags_t__MAX_NR_ZONESFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_locksched_delayedbd_statsbi_sizemodule_statelast_used_atmemcg_vmstatsvm_endregulatorlast_queuednuma_migrate_retryuser_ns__stateRPM_REQ_NONEfirstiommu_grouphandle_pre_irqmigrate_to_ramwb_domainwait_pidfdptrace_bpss_umount_keymax_ratiovm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimeproc_handlerFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progressvolatile_regavgs_locksrcu_barrier_mutexi_private_dataElf64_Halfbw_dworkcompact_countnsproxycan_wakeupcache_typexol_areaPGPROMOTE_SUCCESSrlockfl_owner_tjd_invertMEMCG_LOWMEMCG_DATA_OBJEXTScls_mskeuidwaitbug_tablemax_raw_writedirtied_time_whensequential_io_avgmicd_detect_debounceoom_groupnum_trace_bprintk_fmtcpu_run_real_totalvm_policyWM1814perf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayRPM_ACTIVEnum_reg_defaults_rawcs47l24_is_adsp_memory__state_sizethread_structcached_requested_keyenvp_indexbvec_iterper_cpu_pagesctimereleasemax_segment_sizenr_pagessched_dl_entity__kernel_dev_tatomic_write_lenwindow_lendqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_locks_ids_dentry_lrubp_offsetnet_nsREGMAP_ENDIAN_BIGfolio_queuelast_task_numa_placementnr_descendantspgtable_tblock_startcgtimeWB_REASON_VMSCANsymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcusocket_pressureki_waitqnotify_timertrace_eval_mapdonemax_registerfscrypt_operationsrelease_workWB_REASON_FS_FREE_SPACEksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexac_btime64mg_dst_preload_noderatelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaswapin_countdl_timerWORKINGSET_ACTIVATE_ANONi_dataDL_DEV_NO_DRIVERrstat_css_nodeFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrwatermarkdeadpropsavg_nr_triggersfprop_globallong long unsigned intanon_nameblkcg_gqhashia_filesival_intnuma_preferred_nid_hugetlb_cgroupcore_suppliesdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionaldriver_privatemm_listcss_idri_linkmicd_software_comparelistxattr_lowertrap_nrbinfmt_miscasync_probe_requestedcompat_long_tac_etimeconfig_bases_iflagsprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidateregmap_endianbus_groupsirq_chippmd_tmnt_namespacenode_spanned_pagessysv_shmdq_countctrlif_errorutf8data_tableset_latency_tolerancefoliowake_entryxa_headsuidregmap_irq_chip_datacluster_infoi_readcountlocked_vmrb_leftmg_src_cgrpseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_locktotal_timeiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tregmap_lockquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countmemcg_completionsksm_merging_pagesreg_format_endianfree_listregmap_range_cfg__UNIQUE_ID___addressable_cs47l24_patch617autosleep_enabledptrace_entryuse_autosuspendrecent_used_cpunum_jump_entriess_qcopatomic_tbv_page_flagsnotify_nexte_cset_nodebus_dma_limitshort intmynodemicd_dbtimenr_free_highatomicpdataof_device_idarizona_micd_rangewb_waitqclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regPGDEMOTE_KSWAPDVTIME_USERsa_flagstestcss_offlinepad_untilDEVICE_PANEL_BACKi_writecounti_wb_frn_winnerprio_list_flags_1_flags_2regmap_access_tabledestroy_rworklast_arrivalem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datanr_extentsnr_scannedpoll_table_structfifodirect_IOn_no_rangesmain_statusno_rangeswait_queue_entry_tpcpucurrent_may_mountseqlock_tbd_queuenuma_scan_offsetcgroup_subsys_statevertical_positionkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskMEMCG_SWAP_MAXfreezerNR_INACTIVE_FILELRU_INACTIVE_ANONregfuncindex_keymemalloc_noiohpdet_id_gpioGRPQUOTArwsemi_private_listia_validSYSCTL_TABLE_TYPE_PERMANENTLY_EMPTYcluster_nrvirtmemi_rcui_atime_secqc_type_statekey_serial_tdev_ueventsetupf_lockinit_dataactiveno_statusdqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listxarray_startfadvisevmem_altmaparg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersper_cpu_nodestatselectorMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nssource_listcgroup_bpfswap_readahead_info__fpstateactive_refpmdval_tctl_table_rootARIZONA_MCLK1ARIZONA_MCLK2group_infovdso_imageblk_qc_tfileof_match_tablepercpu_count_ptr__user_state_sizedfl_cftypeshpdet_clampdeferred_splitmce_kill_meuuid_tproperty_read_int_arrayuse_hwlockcount_objectsctl_table_setnum_regs_stimezone_device_datakcompactd_max_orderpeaks_lockf_wb_erruseddefparamsaved_errfred_csfault_flagkprojid_tptracer_credtlb_gencgwb_domainmax_register_is_0page_mkwritekobjectaudit_ttyirq_flagsrtpoll_triggersmce_ripvstatfsctl_table_headeruse_relaxed_mmionumab_stateruntime_pmremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKNR_HUGETLBfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cbliststoragesclass_groupspsi_groupnuma_nodei_mmap_rwsemDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableNR_SHMEM_PMDMAPPEDVTIME_SYSchangedbdi_listwatch_listaudit_contextpp_ref_countsysfs_opsregulator_bulk_datasequential_iotime_namespace_large_mapcountsda_is_staticformatftopenclavereclaim_workbi_privatecreateiattrrseqnfdssigvalvma_lockperf_event_listarizona_typeget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadwriteable_regd_realancestorstot_write_bandwidthmax_channels_clockedexpiry_activedqi_max_spc_limitvm_numa_eventexception_table_entrynr_isolate_pageblockevent_countnr_to_writefallocatei_spc_warnlimitbuddy_listi_ino_timelimitnode_present_pagesi_mmap_writablemems_allowedMEMCG_SWAP_FAILtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleaderclk_lockold_subtree_controltimewakee_flip_decay_tsmemcg_vmstats_percpus_max_linksnr_wakeups_synckallsymskcompactdprevdma_parmsfs_structclockiduint32_targ_startblocksset_infofileattr_getvector__bi_cnttimer_listrefaulteddevice_dma_supportedd_ino_warnshiwater_vmtracepointdac_comp_enabledcompound_headia_vfsuidunaccepted_pagesreg_baselrugen__kernel_ssize_torig_ret_vaddrpoweroff_noirqrenamevm_area_structunlockrpm_statussb_writersino_timelimitsplice_writei_rt_spc_timelimitbd_nr_sectorsqf_nextWB_REASON_BACKGROUNDunmask_baserangesmemory_eventsiommu_mmcutimeem_tablepersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charpersistent_keyring_registerprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filefreeze_noirqNR_DIRTIEDrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsno_pmbi_max_vecsgroup_stop_countdac_comp_lockavg_last_updatelowest_bit_killktime_tchildren_low_usagesymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387iterd_ino_timeravx512_timestampfuncsend_datapercpu_pvec_drainedsubtree_controlsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncrange_startper_cpu_nodestatsnr_charged_bytessetleasepinscs47l24_patchpacct_structmust_resumescannedlong intpresent_pagesfile_lock_contextusagesiglockper_cpu_pagesetstatuserror_injection_entrymigration_pendingreal_addressac_stimeuidhash_nodefred_ssproperty_presentUSRQUOTAprintk_index_sizesymtabtimes_previnit_load_uArt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncWORKINGSET_RESTORE_ANONegidiomapdq_hashput_superfwnode_reference_argsnext_addrpushable_dl_tasksf_flagsf_inodeprocnamemark_dirtynr_dying_descendantsnum_srcu_structsbdi_writeback_pad1_kobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEmicd_configsbalanced_dirty_ratelimit__UNIQUE_ID___addressable_cs47l24_spi_regmap619_pad2_cancelled_write_bytesac_tgidsrcu_usagebitmapacpi_match_tablememcgbw_time_stamp_sigvalmax_perf_statebvecnameidatalatency_recordmod_kallsymsmnt_idrefaultshas_fully_powered_offdepth_pad3_wait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldstatus_baselistsssize_tsr_lockiopl_emulwork_structdesc_lenflocktask_io_accountinginit_ack_maskedmremaphprobetracepoint_funcargventryfree_cached_objectsworkqueue_structreversepi_locklru_gen_mm_state___orig_eipprobestubget_timedapmmm_cid_activeelemsizedirty_paused_whenblkcg_cssmaxlensuspend_noirqDEVICE_VERT_POS_UPPERrelease_agent_pathclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argssrcu_reader_flavorirq_safetv_nseci_lrudischargezone_idxdom_cgrpNR_FOLL_PIN_RELEASEDgfp_maskpi_state_listrcu_segcblistsubvolNR_KERNEL_MISC_RECLAIMABLEfree_inodeprojid_tmg_tasksuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_max_ino_limitdqi_fmt_idwr_tableuid_gid_maprtpoll_trigger_locksrcu_structrlim_curnofaultmm_countdrv_groupsstackoffline_waitqmnt_nsac_ppidfunctionwb_idki_flagsbvec_poolbd_start_sectsrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infosuspended_timecgroup_rootdatastrtabtty_old_pgrpold_dom_cgrpdl_throttledi_rwsemrtpoll_statesget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextwake_baseopc1__int128 unsignedpcountrestore_noirqki_filpcap_ambientWORKINGSET_REFAULT_BASEruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_foliomax_raw_readsplit_queue_lennr_eventsWB_REASON_SYNCmicbiasiommuwriteable_noinc_regbi_opfswap_iocbprivatehlistcftsst_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxswap_plugMEMCG_MAXsplice_pipes_lock_keymg_nodekswapdsrcu_gp_startopentime_nsit_real_incrwaitqmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTmem_cgroup_idmodstqheads_activesym_vvar_startMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalget_irq_regdeadremap_file_rangeac_commnr_hangskcompactd_highest_zoneidxgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsswap_mapdq_dirtydl_deferbug_listdirect_completenbp_rl_startidr_rtlegacy_namexa_lockfxregs_statememcg_cgwb_frnload_weightdiscard_clusterskuid_tarch_datafpstateshrinker_infoblock_maxrcu_blocked_nodegp_countirq_countkey_restrictionnr_rangeexit_stateuts_nsis_late_suspendedsysvsemucountvm_stat_diffkmemcg_idignore_childrenlru_gen_mm_walk_pflagsrestore_earlyhap_actarizona_pdataclock_mutexfs_supersREGCACHE_RBTREEdom_csetevents_local_fileroot_csetdqb_bsoftlimitpendingf_task_worklru_gen_memcgiowait_countnotifier_blockmemswdma_io_tlb_memrtpoll_scheduledstringread_countstoreforklruvecfutex_offsetvmpressurelong long intwrite_flag_maskbdevatomic_flagssysvshmtimer_expirestrace_evalsactive_baseshierarchy_idearly_initmprotectac_exitcodesecurityxmm_spaceactivatef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesdepends_ondomain_dataidr_nextrelax_countlinelinkstart_timekernfs_nodedev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchreschedule_countvfsmountextable_basenoinstr_text_sizeattributesset_child_tid_overruntmpfilercu_read_lock_nestingtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugrefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tUTF8_NMAXfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqia_vfsgidsize_tcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workatomic_long_tpreallocclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicdelayed_callmax_nr_cid_statusd_sibbin_attributepercpu_counternuma_pages_migratedgsindexexpires_nexti_io_listf_epsrcu_barrier_seqreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tHRTIMER_BASE_BOOTTIMEclass_srcu_is_conditionalnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionHRTIMER_BASE_REALTIME_SOFTstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registers_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrstate_in_sysfstty_structUTASK_SSTEP_TRAPPEDbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollnr_wakeups_idleio_cqelf64_symlatch_tree_nodedestroy_work__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerma_external_lockuid_tflush_requiredsum_block_runtimepgmapdq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditional_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitnuma_groupdescriptionclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinei_inodyndbg_infoindexthread_headmap_typef_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenHRTIMER_RESTARTMOD_MEM_NUM_TYPESsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxcpu_basedquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_events_sys_privateUTF8_NFDIinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authHRTIMER_BASE_TAIvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherscompletionsw_reservedUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treequota_onvm_operations_structbin_attrs_newiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdatanrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupwake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlinedup_xol_worktotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramd_spc_softlimitreported_split_lockgfp_tseccomp_filterstimei_mmapthaw_superd_lrusignal_structperf_event_mutexcrcspgdval_tSB_FREEZE_WRITEsetattrf_mappingnoinstr_text_startbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activei_opldt_usr_semkobj_ns_type_operationsDQST_FREE_DQUOTSseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tis_dirty_writebacktrace_bprintk_fmt_startkstatfssitesptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutex_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupseqcount_spinlock_ti_wbclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedpagetrc_holdout_listget_inode_usagenormal_priodestroy_inoderelease_folioi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inameHRTIMER_BASE_MONOTONIC_SOFTi_mappinginblockrmidrseq_siglimit0limit1dqi_max_ino_limitmigrate_modeftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksd_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrDQST_SYNCSstack_vm_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalcg_listsrcu_barrier_completionrw_semaphoremnt_sb_ddebuginfofiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypemembarrier_statepage_poolinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_mempathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwrcu_syncvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstateueventlock_countrefcount_tplugsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttableslist_headtgidwrite_protect_seqcompat_robust_list_head_tids_inode_wblist_lockend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutask__UNIQUE_ID_srcversion473sched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextgpl_symsseq_showswait_queue_headblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfds_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceobjcgnodeDQST_READSvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvstatic_prioshrinkerdl_yieldeddqi_formatexec_update_lockDQF_PRIVATEDQF_SYS_FILE_Bl1d_flush_killi_versionprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symboltv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskSB_FREEZE_PAGEFAULTactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlock__rcu_headmce_vaddrquota_offdq_inusedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmod_tree_nodef_sb_errwritepagecodegtimesigactionclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listktypelockrefsrcu_struct_ptrsmm_structvlagi_uidspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesvm_mmmod_mem_typedebugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipMOD_INIT_RODATAqc_dqblkmmappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCi_write_hintfxsaveprocess_keyringlist_op_pendingllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyioveci_private_lockVTIME_IDLEstatic_keys_magicdl_overrunDQST_ALLOC_DQUOTSd_parentpayloadac_minflti_sbd_sbcommPIDTYPE_PIDatomic_write_segments_maxatomic_openreadahead_control__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupblockedi_securitystats_lockD_REAL_DATApt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colorbitsiopriocap_inheritablegp_waitlookupDD_CLASS_TYPE_LEVEL_NAMESvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vec__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATElf64_Symd_automountparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcestack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkDQST_CACHE_HITScmaxrsstimer_slack_nspolicysharedd_real_typelookahead_bandseq_startraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamerun_delaytailslinenoget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseattrscpumask_tswregs_statedqb_isoftlimitorig_axsched_rt_entitytimerqueue_nodeil_weightmem_dqblknr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pause_sigchldreservedlatency_record_countcgroupsprev_scan_seq_DQST_DQSTAT_LASTrcu_usersoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockUTF8_NFDICFcpu_bitmapstatic_call_keyutil_estucountsMOD_RODATAqc_statesoftirq_next_timercheck_flagsswp_entry_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aMOD_INVALIDmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalautogroupnr_threads__i_nlinkpushdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magicfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsMOD_INIT_DATAnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_infoshared_pendingi_gidmin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idHRTIMER_MAX_CLOCK_BASESkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsxa_flagsbin_sizegrphid_spc_timerjump_entriesassoc_array_ptrsuper_block_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_array__UNIQUE_ID_depends472mnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpref_node_fork__int128dqi_privrss_statmems_allowed_seqrefcntD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxresult_maskdquot_operationsmappinggrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizescheduledclass_raw_spinlock_nested_is_conditionalworker_privateis_relqstrma_flagsfutex_stateHRTIMER_BASE_TAI_SOFTacct_timexpd__rcu_icq_cacheDQST_WRITESsizef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tdl_server_has_tasks_frunnable_sumreal_credepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgcstimecfs_rq_uidst_spacemm_cid_next_scanac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysMOD_TEXTdqb_curinodesload__s8invalidate_lock_keyprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_marksdio_mem_alignbtime__u8is_roxlockrlim_maxruntime_deferred_listd_waitlist_lru_oneseq_stopkiocbclass_rwsem_read_intr_is_conditionalfsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeshrinker_idrootoom_reaper_listsym_VDSO32_NOTE_MASKbpf_storage__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingfsindexshstksrcu_ssp__page_1__page_2__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEi_sequencedqb_ihardlimitd_lockrefnum_bpf_raw_eventsaddr_perfi_dir_seqkqidKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typef_iocb_flagscmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagshrtimer_base_typestart_boottimevm_starts_flagsiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listhrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendings_listdqb_rsvspaceversionserialalloc_locks_dquotfolioqprev_posseqcount_spinlocks_umountis_bin_visiblesyscall_user_dispatchrcu_tasks_exit_listia_uidchildrenrb_subtree_lastbuild_idvfork_donenanosleeprt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelayquotalenf_pipei_wb_frn_historylast_wakeenextarch_spinlock_ti_mtime_nsecmmlistutf8_normalizationset_dqblkreg_offsetgsbases_quota_typesf_llisti_nlinkwrite_beginpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedHRTIMER_BASE_BOOTTIME_SOFTfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tquota_enablesched_avgntabmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextprealloc_bufprojiddrop_inodenum_trace_evalsllseeknext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeunfreeze_fsintervallast_mm_cidcookietargeta_flagstrace_overrunsession_keyringfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributerestrict_linkMOD_DATAi_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackloff_tthread_pidsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringma_locksched_delayedmodule_statelast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimemigrate_from_cpusrcu_barrier_mutexi_private_dataElf64_Halfnsproxyxol_arearlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_datasignumfscrypt_keyrings_mountsuse_memdelay__state_sizethread_structcached_requested_keyenvpctimereleasesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_datasysv_semanon_vma_namefileattrDQST_DROPSlong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionali_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_ts_iflagsmce_kflagstotal_numa_faultss_countd_revalidates_opsysv_shmdq_countutf8data_tablefoliowake_entryxa_headsuidi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_lockiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_t_flagsnotify_nextshort intmynodeclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_ownerbp_regVTIME_USERsa_flagstesti_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivaltrace_event_callis_guestpoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keyGRPQUOTAi_private_listia_validi_rcuHRTIMER_BASE_REALTIMEi_atime_secqc_type_statekey_serial_tsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsi_wb_listxarray_startfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectordefault_timer_slack_nssource_listswap_readahead_info__fpstateactive_refgroup_infovdso_imagefile__user_state_sizemce_kill_meuuid_tcount_objects_stimezone_device_dataf_wb_errdefparamfred_cskprojid_tptracer_credtlb_genstorekobjectaudit_ttymce_ripvstatfsnumab_statefeatureson_listkgid_ton_cpufregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisti_mmap_rwsemwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadd_realexpiry_activedqi_max_spc_limitexception_table_entryfallocateHRTIMER_BASE_MONOTONICi_spc_warnlimitbuddy_listi_ino_timelimitSB_FREEZE_FSi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infotracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevfs_structclockiduint32_targ_startblocksset_infofileattr_getvectortimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrrenamevm_area_structsb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextiommu_mmcutimepersonalityget_statetask_sizes_inodes_addrbinfmtsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filercu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataki_posexecute_only_pkeysetleasepacct_structlong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typein_iowaitunregfuncegiddq_hashput_superMOD_INIT_TEXTpushable_dl_tasksf_flagsf_inodemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infoTT_NONEVTIME_INACTIVEcancelled_write_bytessrcu_usagebitmapmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_cold__UNIQUE_ID_name470ssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenDQST_LOOKUPSclass_spinlock_irq_try_is_conditionaloom_mmsrcu_reader_flavortv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idsrcu_structrlim_curnofaultmm_countSB_FREEZE_COMPLETEstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infodatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountki_filpcap_ambientatomic64_tanon_vmarlimread_folionr_eventsprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keysrcu_gp_startopenit_real_incrmodert_prioritymm_lock_seq__UNIQUE_ID_intree471KMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksrb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionexit_statesysvsemMOD_RO_AFTER_INITDQF_ROOT_SQUASH_Bfs_supersSB_UNFROZENdqb_bsoftlimitpendingf_task_workiowait_countstringread_countfutex_offsetlong long intatomic_flagssysvshmtrace_evalsactive_basessecurityxmm_spacef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesclass_rwsem_read_intr_is_conditionalclass_mutex_is_conditionalclass_preempt_notrace_is_conditionalMOD_INIT_RODATAMOD_TEXTclass_srcu_is_conditional_nameclass_rcu_is_conditionalclass_migrate_is_conditionallong long unsigned intNR_KMALLOC_TYPESclass_rwsem_read_is_conditionallong long intsigned charPIDTYPE_SIDclass_preempt_is_conditionalElf32_Wordorc_headerPIDTYPE_TGIDlong intclass_raw_spinlock_irq_is_conditional_descclass_local_lock_nested_bh_is_conditionalHRTIMER_BASE_MONOTONIC_SOFT__UNIQUE_ID_retpoline471class_rwsem_read_try_is_conditionalUTF8_NFDIDQST_LOOKUPSclass_spinlock_irqsave_is_conditionalclass_spinlock_try_is_conditionalclass_local_lock_is_conditionalhrtimer_base_typeMOD_RO_AFTER_INITn_descsz__u8DQST_ALLOC_DQUOTSSB_FREEZE_FSKMALLOC_NORMALDQST_WRITESunsigned int__int128class_irqsave_is_conditionalHRTIMER_BASE_REALTIMElong unsigned int__u32HRTIMER_MAX_CLOCK_BASESclass_spinlock_irqsave_try_is_conditionalclass_spinlock_is_conditionalshort unsigned intHRTIMER_BASE_TAIclass_local_lock_irqsave_is_conditionalclass_read_lock_is_conditionalelf32_noteboolDQST_DROPSclass_local_lock_irq_is_conditionalMOD_RODATAKMALLOC_CGROUPclass_rwsem_write_is_conditionalclass_spinlock_irq_try_is_conditionalclass_spinlock_irq_is_conditionalclass_write_lock_is_conditionaln_typeMOD_DATAclass_write_lock_irqsave_is_conditionalHRTIMER_BASE_BOOTTIMEn_nameszSB_FREEZE_COMPLETESB_FREEZE_WRITEclass_raw_spinlock_nested_is_conditionalMOD_MEM_NUM_TYPESDQST_SYNCSDQST_FREE_DQUOTSmod_mem_typeHRTIMER_BASE_MONOTONICclass_mutex_intr_is_conditionalclass_task_lock_is_conditionalUTF8_NMAX_nhdrPIDTYPE_PGID_Boolunsigned charKMALLOC_RECLAIMHRTIMER_BASE_BOOTTIME_SOFTcurrent_stack_pointershort int_note_18_note_19utf8_normalizationKMALLOC_RANDOM_STARTDQST_CACHE_HITSclass_irq_is_conditionalDQF_PRIVATEPIDTYPE_PIDDQST_READSMOD_INIT_DATAclass_raw_spinlock_try_is_conditionalclass_raw_spinlock_irqsave_is_conditionalPIDTYPE_MAXcharGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackSB_FREEZE_PAGEFAULTUTF8_NFDICFclass_mutex_try_is_conditional_DQST_DQSTAT_LASTclass_write_lock_irq_is_conditionalKMALLOC_RANDOM_ENDMOD_INIT_TEXTclass_raw_spinlock_irqsave_try_is_conditionalpid_typeHRTIMER_BASE_REALTIME_SOFTKMALLOC_DMAclass_read_lock_irq_is_conditionalHRTIMER_BASE_TAI_SOFTSB_UNFROZENclass_raw_spinlock_is_conditionalkmalloc_cache_typeclass_read_lock_irqsave_is_conditionalclass_rwsem_write_try_is_conditionalDQF_SYS_FILE_Bclass_raw_spinlock_irq_try_is_conditionalDQF_ROOT_SQUASH_B__UNIQUE_ID_vermagic470__int128 unsignedMOD_INVALIDdrivers/mfd/arizona-core.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingdrivers/mfd./include/linux./arch/x86/include/asm./include/linux/atomic./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/linux/gpio./include/linux/device./include/linux/mfd./include/linux/regulator./include/linux/mfd/arizonaarizona-core.carizona-core.cdevice.hjump_label.hdelay.hktime.hclk.hregmap.hpm_runtime.hatomic-instrumented.hatomic-arch-fallback.hatomic.hfortify-string.herr.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.hcache.hsched.hspinlock_types.hrwlock_types.hbug.hcpumask_types.hatomic-long.hmmzone.hsysfs.hllist.hsmp_types.hpreempt.hrestart_block.htime_types.htime32.hrange.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hprocessor.hmath_emu.hirqflags.htypes.hshstk.hseq_file.hthread_info.hosq_lock.hmutex_types.hmutex.hspinlock.hrwsem.hrcupdate.htime64.hpid_types.hsem_types.hshm.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hswap.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hwait.hswait.hsrcutree.hsrcu.hnotifier.hconsumer.hirqreturn.hkref.hextable.hinterrupt.hstddef.hlist_nulls.hmaple_tree.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hxarray.hlist_lru.hidr.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hioport.hpm.hpm_wakeup.hbus.hdriver.hclass.hsysctl.huio.huio.hbvec.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.hwriteback.hbacking-dev-defs.hblk_types.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hdevice.hof.hfwnode.hplatform_device.hcore.hproperty.hns_common.hcgroup.hkernel_stat.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hvm_event_item.hpage_counter.hvmpressure.hhuge_mm.hflex_proportions.hpagevec.hmempool.hsuspend.hconsumer.hmachine.harizona-ldo1.harizona-micsupp.hpdata.hcore.hasm.harizona.hdev_printk.htimekeeping.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/mfd/arizona-irq.c/home/thomas/Documents/kernels/stagingdrivers/mfd./include/linux./arch/x86/include/asm./include/linux/atomic./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/linux/regulator./include/linux/mfd/arizona./include/linux/gpioarizona-irq.carizona-irq.cirq.hirqdomain.hjump_label.hpm_runtime.hgpio.hatomic-instrumented.hatomic-arch-fallback.hatomic.hregmap.herr.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hcache.hsched.hfs.hmodule.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hmmzone.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hrestart_block.htime_types.htime32.hthread_info.hpreempt.hllist.hsmp_types.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hswap.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hspinlock.htime64.htracepoint-defs.hdelay.hirqreturn.hrcupdate.hmutex.hkref.hworkqueue_types.hworkqueue.hextable.hinterrupt.hstddef.hirqhandler.hirqdesc.hlist_nulls.hwait.hmaple_tree.hrwsem.hswait.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hfwnode.hdevice.hpercpu-refcount.hslab.hxarray.hlist_lru.hidr.hkernfs.hkobject_ns.hstat.hkobject.hirqdomain_defs.huuid.hmod_devicetable.hof.hsysctl.huio.huio.hbvec.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.hwriteback.hbacking-dev-defs.hblk_types.hcompat.helf.hrbtree_latch.herror-injection.hmodule.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hns_common.hcgroup.hkernel_stat.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hvm_event_item.hpage_counter.hvmpressure.hhuge_mm.hflex_proportions.hpagevec.hmempool.hconsumer.harizona-ldo1.harizona-micsupp.hpdata.hcore.hasm.harizona.hconsumer.hdev_printk.htimekeeping.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/mfd/wm5102-tables.c/home/thomas/Documents/kernels/stagingdrivers/mfd./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/linux/regulator./include/linux/mfd/arizonawm5102-tables.cwm5102-tables.cint-ll64.hint-ll64.hposix_types.htypes.htypes.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hcache.hsched.hfs.hmodule.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hprocessor.hcpumask_types.hmath_emu.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hmmzone.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hrestart_block.htime_types.htime32.hthread_info.hpreempt.hllist.hsmp_types.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hswap.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hspinlock.hmutex.hrcupdate.hlist_nulls.hwait.hkref.hmaple_tree.hrwsem.hswait.htime64.htracepoint-defs.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hxarray.hlist_lru.hidr.hkernfs.hkobject_ns.hstat.hkobject.henergy_model.hdevice.hpm.hpm_wakeup.hbus.hdriver.hclass.hsysctl.hstddef.huio.huio.hbvec.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.hwriteback.hbacking-dev-defs.hblk_types.hcompat.helf.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.hdevice.hof.hfwnode.hinterrupt.hdelay.hregmap.hns_common.hcgroup.hkernel_stat.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hvm_event_item.hpage_counter.hvmpressure.hhuge_mm.hflex_proportions.hpagevec.hmempool.hconsumer.harizona-ldo1.harizona-micsupp.hpdata.hcore.hasm.harizona.hdrivers/mfd/wm5110-tables.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingdrivers/mfd./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/linux/regulator./include/linux/mfd/arizonawm5110-tables.cwm5110-tables.cint-ll64.hint-ll64.hposix_types.htypes.htypes.hcache.htime64.htime_types.hfs.hmodule.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hmmzone.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hswap.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hspinlock.htracepoint-defs.hstat.hlist_nulls.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hsysctl.hstddef.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.hwriteback.hbacking-dev-defs.hblk_types.hkobject.hcompat.helf.hidr.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hinterrupt.hdelay.hfwnode.hdevice.hregmap.hns_common.hcgroup.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hmod_devicetable.hdevice.hof.hpagevec.hmempool.hconsumer.harizona-ldo1.harizona-micsupp.hpdata.hcore.hasm.harizona.h/home/thomas/Documents/kernels/stagingdrivers/mfd/wm8997-tables.c/home/thomas/Documents/kernels/stagingdrivers/mfd./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/linux/regulator./include/linux/mfd/arizonawm8997-tables.cwm8997-tables.cint-ll64.hint-ll64.hposix_types.htypes.htypes.hcache.htime64.htime_types.hfs.hmodule.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hmmzone.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hswap.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hspinlock.htracepoint-defs.hstat.hlist_nulls.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hsysctl.hstddef.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.hwriteback.hbacking-dev-defs.hblk_types.hkobject.hcompat.helf.hidr.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hinterrupt.hdelay.hfwnode.hdevice.hregmap.hns_common.hcgroup.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hmod_devicetable.hdevice.hof.hpagevec.hmempool.hconsumer.harizona-ldo1.harizona-micsupp.hpdata.hcore.hasm.harizona.h/home/thomas/Documents/kernels/stagingdrivers/mfd/wm8998-tables.c/home/thomas/Documents/kernels/stagingdrivers/mfd./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/linux/regulator./include/linux/mfd/arizonawm8998-tables.cwm8998-tables.cint-ll64.hint-ll64.hposix_types.htypes.htypes.hcache.htime64.htime_types.hfs.hmodule.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hmmzone.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hswap.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hspinlock.htracepoint-defs.hstat.hlist_nulls.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hsysctl.hstddef.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.hwriteback.hbacking-dev-defs.hblk_types.hkobject.hcompat.helf.hidr.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hinterrupt.hdelay.hfwnode.hdevice.hregmap.hns_common.hcgroup.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hmod_devicetable.hdevice.hof.hpagevec.hmempool.hconsumer.harizona-ldo1.harizona-micsupp.hpdata.hcore.hasm.harizona.h/home/thomas/Documents/kernels/stagingdrivers/mfd/cs47l24-tables.c/home/thomas/Documents/kernels/stagingdrivers/mfd./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/device./include/linux/regulator./include/linux/mfd/arizonacs47l24-tables.ccs47l24-tables.cint-ll64.hint-ll64.hposix_types.htypes.htypes.hcache.htime64.htime_types.hfs.hmodule.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hmmzone.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.htypes.hsignal.hsignal-defs.hsiginfo.hsignal_types.huser_namespace.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hnsproxy.hsignal.hbio.hswap.hiocontext.hcgroup-defs.hcompat.hmemcontrol.huprobes.hspinlock.htracepoint-defs.hstat.hlist_nulls.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.hnotifier.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hzswap.hsysctl.hstddef.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.htaskstats.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.hwriteback.hbacking-dev-defs.hblk_types.hkobject.hcompat.helf.hidr.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hinterrupt.hdelay.hfwnode.hdevice.hregmap.hns_common.hcgroup.hu64_stats_sync.hbpf-cgroup-defs.hpsi_types.hpage_counter.hvmpressure.hflex_proportions.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hmod_devicetable.hdevice.hof.hpagevec.hmempool.hconsumer.harizona-ldo1.harizona-micsupp.hpdata.hcore.hasm.harizona.h/home/thomas/Documents/kernels/stagingdrivers/mfd/arizona.mod.c/home/thomas/Documents/kernels/stagingdrivers/mfd./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/schedarizona.mod.cint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hirqflags.htypes.hshstk.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hquota.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.harizona.mod.c/home/thomas/Documents/kernels/stagingscripts/module-common.c/home/thomas/Documents/kernels/stagingscripts./include/uapi/asm-generic./include/linux./include/linux/sched./include/uapi/linux./arch/x86/include/asm./include/asm-genericmodule-common.cint-ll64.htypes.hirqflags.hpreempt.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hpid_types.hhrtimer_defs.hslab.hunicode.hquota.hquota.hfs.helf.hmodule.hasm.hmodule-common.cint-ll64.h#USUS s SMUMSUSS\\\000.0L00 0  0  0  0000.0L00 0 0 0000.0L00 0  0 0000.0L00 0 5 0 0 P3P3OV\lPloVo~P~VPV0PVPVP0VPVPVPVPP-P-LVcrPrsVsz zPVPQVPPVPVPVPVPVPV PVPVPVPVPVPP V P V P V V P V P   P VPV"0"E1Ea2as0s{1{222.2L210220VvV0TVvV 2 V V 0 T V3 03 3 3 03  0 8PP  PP\SPPNSSPVPVV^WSSSP6V6EPEFVPVPV SPP   SPs 3qR s ss! !3!2stTv  sU#U#5U5MUS:S1    00UU#U#5U5MUS:S1    00UU#U#5U5MUS:S1    00UU#U#5U5MUS:S1    00U)U)UUUUSSS0V001000.@0@MVM_0_lV0VPPPPV).V~VTPT1  001    00,SSPPV6SSPVPV,SSSPPPV S,SSS PPPVUsU  11/S\SSPV]jPVsU\asazU! \~ !1\~1-SSPPTsU 1UVUUVUVUVUVV\\\\P(P(xSSSPSPPSPSSSPS00P0PSPS-P-3S3EPEfSfvPv|S|PSPSPS0S0S1    001    00U8\\PSPS VS8\\PSPS VS8\\PSPS VS-\\\ PPPS|U   1 0-\\PSS|U 10(\\PPS|U   1 0-U-pSpxUx}SPP%P%-\-U-LVLSUSV"VPP#5P58S8YPY\S\`P`o0oPSPP"SUFSFLULLS>STGVGLTLLV>VP P++PPd4P4>dUVUVUVuVTQ\T\T\u\P7P7:S:^P^aSaePeSPSPPS(P(.S.?P?ESEXPXuSPP U 2S2<U<=S=BUB\S    ';U;]U];];T;T;T;Q;\Q\;\;R;_R_;_;X;^X^;^^VkpV;VS'+P+DSnnS*S PV3BVnnVV  L P66PP V66VVUUU1T1S)S).T.S T S)S).T.SPPPUUU,T,S)S).T.S T S)S).T.S PqqPP U #UT#TT#TUCSCDv|DIUIzSzv|USv|USv|U p $0,&A p $0, p $0,sU @0S sSUBSBE||ELULS50L0PV0V0V0V0 ]] P V]]PPVsU! !@]Zu]PKRPRfV]} } }Pq }} }  Q }  Q  P Q  }]4]PPV] P V s/U/SUS8\8}V\V7SS/-/7P/S/-PU&11U00;S$'$,P$S$'PrUrSUSS  s !     PPPPVPPVPVPV  -P-OVTePekVkPVP~ PVPVP]]]]]^^^^^^ PP P@`PPPsU   0P000P222P   PSSS PPPPP 0 s1UP s sURUTMSMRTQRQ u S 1SS SUUTTu0PU7U7U.U-T-STS.STSTS.S{000.0 P#1PPQPP(P]]PPQ]} 0 }  0 }  0Pr }} }  R }  R  P R  }U0 sVsU 1U U #UT#TT#TU=S=EUEFSFSU%T%8V8EP%Q%@\@EQEN\NRTRSQU8S%T%8VP$U$N]NUUUm]mtU0T0D^DUP0Q0JVJUQUgVgsXstQ0R0ISIURUdSdsQstR0X0L\LUXUk\ksYstX$U$D]0T0D^P%U%RU%T%RT'U'6UT6TT6T  ,   0,0UUTT1U=S=EUEFSFSU%T%8V8EP%Q%@\@EQEN\NRTRSQU8S%T%8VPTQTQT QUUUUT T Q!QAUPUUPUPTTTTTPUUUTTTTpPPUQUQUQTTTTTUQUQUTTTTuPPUU T t  T t TTt TtTtTtTtTtTtTtTTTtTtTt TtTt TtTt tTt T t T t T t T t U U T t  T t T T t T t T t T t T t~T~t TtTtTtTtTt TTtTt TtTtTtTtTtTTtT t T t T t  T t T t  T t T t T t T t T t U U T tTtTtTq&Tq&TtTtTTTq&TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT P T P T P T P T P T P T P T P T P T PPTPT U U,,  L>;!!),3Bu",, Zu4 !+6,2K22,/\!\{|~- 8 8 8 - -( ;BJOE))R##)) ! .BGN  W:%  d##C  Dm!!"+#\; / /. $   *-7 /B+#)7      "$&'()+-/013568:;<>3#|M-p8pM*-8\@LD3>hqB `; 0uD c"f}$0M-88M -8PK#M :<-8V-8p\-8-P80`#p0`0  0, 080DO ,X`,al,u ,`,,, ,`,,, ,`,,, ,`,,, ,&`,0,:,D ,N`,X,bn,x@,,,,@,,, ,@ , , ,  ,` , , , ,$` ,. ,8 ,B ,L` ,V ,` ,j ,t` ,~ , , ,`,,, ,`,,, ,`,,,  "0.P:pF,P\,f0r`,|,,0`,,,@,p,, ,`,,&,00=`,H,S,^ ,i`,t,,(+++++ +(+0%+84+@C+HR+Pa+Xp+`+h+p+x++++++++$+3+B+Q+` #0p ++++++++ +  +(' +06 +8E +@T +Hc +Pr +X +` +h +p +x + + + + + + +& +5 +D +S +b +q + + + + + + + + +  +( +0 +8% +@4 +HC +PR +Xa +`p +h +p +x + + + + + + + + 3  $PL#?RV6) -8n@RB )S 3.k `)P~ aD$O%,X@%, %, %u%&, 0&`&,&,&, ',`',',', (,`(,(,(, ), + + + + + + + +# +1 +? +M +[ + i +(w +0 +8 & [  Z @,P @D O P)`* (*<H9+X4N _#a` r ~ w7<;T @ 0>C,@ ! 1@E"B%0K!Ui v`0P >`@ @9pPh0~&@)P*3+R4q7< >C0E K-F_m .4/M>h<?P$Qb 'cEweHx0T5Qo(=Ti~4Pl"#01<.=CHZoI[\no3}Mle~{`x7#Z 3c Il ]my 5`8-;Rf0/ @8(%9G&#Y) dq)8|P+a&'Ey+8WqP(r#\8 @S!ES^@ )p@CK>]8d`\=+/gwN @`8   ) A pKU a x   =    )8 !!p3!?!)@J!]!o!!@+!!E!!!!"."WKC"N"d"v"}"ot"arizona-core.c__UNIQUE_ID_ddebug630.139__UNIQUE_ID_ddebug634.137arizona_disable_freerun_sysclk.coldarizona_underclocked.coldarizona_poll_reg.coldarizona_enable_freerun_sysclk.coldwm5102_apply_hardware_patch.coldwm5110_sleep_patch__UNIQUE_ID_ddebug632.138__UNIQUE_ID_ddebug628.140arizona_overclocked.cold__UNIQUE_ID_ddebug624.144__UNIQUE_ID_ddebug626.141arizona_runtime_suspend.cold__UNIQUE_ID_ddebug620.153__UNIQUE_ID_ddebug622.152arizona_runtime_resume.cold__key.72early_devsarizona_dev_init.coldwm8997_devscs47l24_devswm8998_devswm5102_devswm5110_devs__func__.0_entry.1_entry.2__func__.3_entry.4__func__.5_entry.6_entry.7_entry.8_entry.9_entry.10_entry.11_entry.12_entry.13_entry.14_entry.15_entry.16_entry.17_entry.18_entry.19_entry.20_entry.21_entry.22_entry.23_entry.24_entry.25_entry.26_entry.27_entry.28__func__.29_entry.30_entry.31_entry.32_entry.33_entry.34_entry.35_entry.36_entry.37_entry.38_entry.39_entry.40_entry.41__func__.42_entry.43_entry.44_entry.45_entry.46_entry.47_entry.48_entry.49_entry.50_entry.51_entry.52_entry.53_entry.54_entry.55_entry.56_entry.57_entry.58_entry.59_entry.60_entry.61_entry.62_entry.63_entry.64_entry.65_entry.66_entry.67_entry.68_entry.69_entry.70__func__.73__func__.74__func__.75__func__.76__func__.77_entry.78__func__.79_entry.80__func__.81_entry.82_entry.83__func__.84_entry.85__func__.86_entry.87_entry.88__func__.89_entry.90_entry.91__func__.92_entry.93_entry.94_entry.95_entry.96_entry.97__func__.98_entry.99__func__.100_entry.101_entry.102_entry.103_entry.104_entry.105_entry.106_entry.107__UNIQUE_ID_license641__UNIQUE_ID_description640_entry_ptr.108_entry_ptr.109_entry_ptr.110_entry_ptr.111_entry_ptr.112_entry_ptr.113_entry_ptr.114_entry_ptr.115_entry_ptr.116_entry_ptr.117_entry_ptr.118_entry_ptr.119_entry_ptr.120_entry_ptr.121_entry_ptr.122_entry_ptr.123_entry_ptr.124_entry_ptr.125_entry_ptr.126_entry_ptr.127_entry_ptr.128_entry_ptr.129_entry_ptr.130_entry_ptr.131_entry_ptr.132_entry_ptr.133_entry_ptr.134_entry_ptr.135wm5102_supplieswm8997_suppliescs47l24_supplies_entry_ptr.142_entry_ptr.143_entry_ptr.145_entry_ptr.146_entry_ptr.147_entry_ptr.148_entry_ptr.149_entry_ptr.150_entry_ptr.151_entry_ptr.154_entry_ptr.155_entry_ptr.156_entry_ptr.157_entry_ptr.158_entry_ptr.159_entry_ptr.160_entry_ptr.161_entry_ptr.162_entry_ptr.163_entry_ptr.164_entry_ptr.165_entry_ptr.166_entry_ptr.167_entry_ptr.168_entry_ptr.169_entry_ptr.170_entry_ptr.171_entry_ptr.172_entry_ptr.173_entry_ptr.174_entry_ptr.175_entry_ptr.176_entry_ptr.177_entry_ptr.178_entry_ptr.179_entry_ptr.180_entry_ptr.181_entry_ptr.182_entry_ptr.183_entry_ptr.184_entry_ptr.185_entry_ptr.186_entry_ptr.187_entry_ptr.188_entry_ptr.189_entry_ptr.190_entry_ptr.191_entry_ptr.192_entry_ptr.193_entry_ptr.194_entry_ptr.195_entry_ptr.196_entry_ptr.197_entry_ptr.198_entry_ptr.199_entry_ptr.200_entry_ptr.201_entry_ptr.202_entry_ptr.203_entry_ptr.204.LC55arizona-irq.c__UNIQUE_ID_ddebug621.36arizona_irq_chiparizona_irq_thread.coldarizona_domain_opsarizona_irq_init.cold_entry.3__func__.4__func__.7_entry_ptr.20_entry_ptr.21_entry_ptr.22_entry_ptr.23_entry_ptr.24_entry_ptr.25_entry_ptr.26_entry_ptr.27_entry_ptr.28_entry_ptr.29_entry_ptr.30_entry_ptr.31_entry_ptr.32_entry_ptr.33_entry_ptr.34_entry_ptr.35wm5102-tables.cwm5102_reva_patchwm5102_revb_patchwm5102_reg_defaultwm5102_irqswm5102_aod_irqswm5110-tables.cwm5110_reva_patchwm5110_revd_patchwm5110_revb_patchwm5110_reve_patchwm5110_reg_defaultwm5110_revd_irqswm5110_irqswm5110_aod_irqswm8997-tables.cwm8997_reva_patchwm8997_reg_defaultwm8997_irqswm8997_aod_irqswm8998-tables.cwm8998_rev_a_patchwm8998_reg_defaultwm8998_irqswm8998_aod_irqscs47l24-tables.ccs47l24_reva_patchcs47l24_reg_defaultcs47l24_irqs__pfx_arizona_suspend_noirq__pfx_arizona_resume__pfx_arizona_disable_reset__pfx_arizona_disable_freerun_sysclk__pfx_arizona_underclocked__pfx_arizona_poll_reg__pfx_arizona_enable_freerun_sysclk__pfx_wm5102_apply_hardware_patch__pfx_wm5110_apply_sleep_patch__pfx_arizona_resume_noirq__pfx_arizona_suspend__pfx_arizona_overclocked__pfx_arizona_runtime_suspend__pfx_arizona_runtime_resume__pfx_arizona_irq_enable__pfx_arizona_irq_set_wake__pfx_irq_find_mapping__pfx_arizona_boot_done__pfx_arizona_irq_map__pfx_arizona_irq_disable__pfx_arizona_irq_thread__pfx_wm5102_readable_register__pfx_wm5102_volatile_register__pfx_wm5110_is_rev_b_adsp_memory__pfx_wm5110_is_rev_d_adsp_memory__pfx_wm5110_readable_register__pfx_wm5110_volatile_register__pfx_wm8997_readable_register__pfx_wm8997_volatile_register__pfx_wm8998_readable_register__pfx_wm8998_volatile_register__pfx_cs47l24_readable_register__pfx_cs47l24_volatile_register__pfx_arizona_clkgen_err__pfx_arizona_ctrlif_errarizona.mod.c__kstrtab_arizona_clk32k_enable__kstrtabns_arizona_clk32k_enable__ksymtab_arizona_clk32k_enable__kstrtab_arizona_clk32k_disable__kstrtabns_arizona_clk32k_disable__ksymtab_arizona_clk32k_disable__kstrtab_arizona_pm_ops__kstrtabns_arizona_pm_ops__ksymtab_arizona_pm_ops__kstrtab_arizona_dev_init__kstrtabns_arizona_dev_init__ksymtab_arizona_dev_init__kstrtab_arizona_dev_exit__kstrtabns_arizona_dev_exit__ksymtab_arizona_dev_exit__kstrtab_arizona_request_irq__kstrtabns_arizona_request_irq__ksymtab_arizona_request_irq__kstrtab_arizona_free_irq__kstrtabns_arizona_free_irq__ksymtab_arizona_free_irq__kstrtab_arizona_set_irq_wake__kstrtabns_arizona_set_irq_wake__ksymtab_arizona_set_irq_wake__kstrtab_wm5102_spi_regmap__kstrtabns_wm5102_spi_regmap__ksymtab_wm5102_spi_regmap__kstrtab_wm5102_i2c_regmap__kstrtabns_wm5102_i2c_regmap__ksymtab_wm5102_i2c_regmap__kstrtab_wm5110_patch__kstrtabns_wm5110_patch__ksymtab_wm5110_patch__kstrtab_wm5110_aod__kstrtabns_wm5110_aod__ksymtab_wm5110_aod__kstrtab_wm5110_irq__kstrtabns_wm5110_irq__ksymtab_wm5110_irq__kstrtab_wm5110_revd_irq__kstrtabns_wm5110_revd_irq__ksymtab_wm5110_revd_irq__kstrtab_wm5110_spi_regmap__kstrtabns_wm5110_spi_regmap__ksymtab_wm5110_spi_regmap__kstrtab_wm5110_i2c_regmap__kstrtabns_wm5110_i2c_regmap__ksymtab_wm5110_i2c_regmap__kstrtab_wm8997_patch__kstrtabns_wm8997_patch__ksymtab_wm8997_patch__kstrtab_wm8997_aod__kstrtabns_wm8997_aod__ksymtab_wm8997_aod__kstrtab_wm8997_irq__kstrtabns_wm8997_irq__ksymtab_wm8997_irq__kstrtab_wm8997_i2c_regmap__kstrtabns_wm8997_i2c_regmap__ksymtab_wm8997_i2c_regmap__kstrtab_wm8998_i2c_regmap__kstrtabns_wm8998_i2c_regmap__ksymtab_wm8998_i2c_regmap__kstrtab_cs47l24_patch__kstrtabns_cs47l24_patch__ksymtab_cs47l24_patch__kstrtab_cs47l24_irq__kstrtabns_cs47l24_irq__ksymtab_cs47l24_irq__kstrtab_cs47l24_spi_regmap__kstrtabns_cs47l24_spi_regmap__ksymtab_cs47l24_spi_regmap__UNIQUE_ID_srcversion473__UNIQUE_ID_depends472__UNIQUE_ID_intree471__UNIQUE_ID_name470module-common.c__UNIQUE_ID_retpoline471__UNIQUE_ID_vermagic470_note_19_note_18orc_headerregulator_enableirq_domain_xlate_twocellregcache_cache_onlyregcache_syncregmap_write__x86_indirect_thunk_rbpregulator_get__pfx_arizona_free_irqregmap_irq_get_virq__pfx_arizona_set_irq_wakektime_get_mono_fast_ns__this_module__pfx_arizona_clk32k_enablegpiod_set_raw_value_cansleeppm_runtime_set_autosuspend_delayirq_domain_remove__pfx_wm5102_patchirq_dispose_mappingregulator_put__stop_alloc_tagswm8998_irqgpiod_to_irqenable_irqregcache_mark_dirtyusleep_range_state__dynamic_dev_dbgdevm_clk_get__fentry____start_alloc_tags__pm_runtime_set_statusclk_prepareirq_modify_status__stack_chk_failirq_set_chip_and_handler_namepm_runtime_enable__pfx_arizona_request_irqregulator_bulk_disablehandle_simple_irq_dev_inforegmap_add_irq_chipgpiod_get_raw_value_cansleepdevm_gpio_request_oneregmap_multi_reg_write_bypassed_dev_errrequest_threaded_irq__pfx_arizona_irq_initwm5102_irqirq_get_irq_datamutex_lockmfd_add_deviceswm5102_aod__mutex_init__irq_resolve_mappinghandle_nested_irq__pfx_arizona_irq_exit_dev_warn__x86_return_thunk__pfx_arizona_dev_exitirq_set_irq_wakeregulator_bulk_enabledevm_regulator_bulk_get__pfx_cs47l24_patchregmap_readirq_domain_instantiate__pm_runtime_resumemutex_unlock__pfx_wm8997_patchdevm_gpiod_getktime_getregmap_bulk_readirq_create_mapping_affinity__pfx_arizona_clk32k_disablegpio_to_desc__pfx_arizona_dev_initclk_disablewm8998_aodmfd_remove_devicesirq_set_chip_dataregmap_update_bits_base__pfx_wm5110_patchregulator_disable__pfx_wm8998_patch__pm_runtime_suspendregmap_register_patchdisable_irq_nosync__pm_runtime_use_autosuspendregmap_del_irq_chip__pm_runtime_disableclk_enableregulator_set_voltage__pm_runtime_idlemsleepdisable_irqclk_unprepare '/<: A pF QY<u < ,  < <"A ]e/u}N< Bm}dK 2$,4<Fa HBH<1 KBS/fBpH<<! o<_ = $B(t<y c< P 8 c< c< m! & 1c9<U IjQ8,5>GtP[YBb)jrz 0E<"_KTlDa_ee  0, E5 <Q Tn Ov e~ E < a O e E < E <   c ] V$ 8 RH %X %h %p    <    B J g n Ns   B  ` p   V <? BI n v  V   V Z   ~    T* Q Ta : T Q T : T    A?K5U_v      P *K4KFOYd<V<BTReoTT  {3=]`hc  L 5 _% 8C |H [khws   `#3@=  S!?+G4>&P`Bj]B B9&UB]wVb G R0<<&S]q{] < <0*U d>6< <    "<E SS^ e jx< < <E bt<> DBF5B=/gMo|X<67M 607[ `)l  , 4-T8z `)C]fJ{JA H M*Wa p ud< Q  d M5 :&GR-[e  P   ' / M :M&U 6\6(\/;Ih<r i < <T!<!<!<"<d"<}"<"<"<4#<#<#<$<'$<K$<$<$<$<%<&%<`%<~%<%<%<%<&<'&<E&<[&<&<& Y'<'<'<'<'<?(<X(<(<(<(<(<(<) ) [ )(/)  Z4)(Q) E*<a* -+<U+ u+  z+Y+ +Y+ +Y+ +Y+ `,<H-<-<-<=.<V.<.</<0/<l/</</<0<I0<m0<0<0<1</1<g1<1<1<1<1<12<k2<2<2<2<2<3<;3<_3<3<3<3<4<}4<4 M5<7 D8<8<8<H9<y9<9<:<G:<i:<:<:<:<:<:<:<:<;</;<];<n;<;<;<;<;<;<<<<<<<,<<=<<K<<\<<m<<~<<< =<2=<V=<o=<=<=<=<=<=<=<=<= ><> >Y5> ><><t?<?<?< @<i@<s@<@<@<A<1A<MA<A<A<A<A<B<3B<IB<bB<iB<B<B<B<B<B<C<C<-C<>C<OC<]C<nC<C<C<C<C<C D<YD<mD<D<D<D<D<D<D<D<E $E )EYEE F<I<4I<HI<K K %KYK 6L<yL<L<L<M<M<#M< I)5 x), 0) )  )* /)8C H)Q\ a)ju z) ) ) ) )  a)  )  ( -)5 :T G aL)Q ^ ag)p } )  )2 a   ) X) ) )!Y05Y> 0F)KYY ^)cq v){ ) ) ) H) 0) V !)& 1 6)F  N)S\ f)ky | e[ _ e8 ) )  )  !)/ 7)BGP 0X)]f pn)~ )  )  ) N :- `4 1; !E P ] p u )  T  7 @ H 2` ]w   X ) 4  ^ :  ^ (  ^ D< gA :U  \ $c 6u  | $   :  K   :   = . X3 )E L S /p z ) T3 TC Q [c j o d P  d   d 3    )    %)/<< A)FCS X:]%q v){ +) C)| ) )|)\:|AV|`\v {) )% _) x) X) 0)(,  8 $(,0%48<!@DHdLPT#X\`Qdhl^ptx|'" .;/1  (03<D`hp3|3 P(03<D`hp3|33 (03<D`hp3|33  (03<D`hp3|03x3 I(03<D`dhp3|3~3 (03<D`hp3|33 (03<D` hp3| 3`3$@DHP3\dW3j3}3$@HP3\d33   3 $ @ H P 3\ d    3     3   e(  0 3< D ` h  p 3|     3      3   (  0 3< D ` Hh  p 3|   0  3     3   p(  0 3< D ` h  p 3|     3     3   (  0 3< D ` ph  p 3|   0  3     3  ( 03<D`4h p3|N 3g 3 ( 03<D`h p3| 3 3 X( 03<D`Xh p3| 3 3ap33$`h0p3|033$`h0p3|0033$@HP3\dp3p3 (p03<D`4hpp3|0p3(3$`0h0p3|0303 X(003<D`h0p3|0303  p(4H #` @( ANU\b 0(ixN\b (` w  # P! !0"("# # #N(#U0#8#\@#H#`###p$$p$$pP$X$`$h$p$x$$ $%%$%%$%@%H%$P%\% d%%%$%%%&&%&&$&`&h&0&p&|&&&&0&&&&&&0&&&' '+('0&0'<'D'`'Ch'0&p'|'''_'0&''''x'0&''( (((0&0(<( D(`(0h(0&p(|(((X(0&(((((0&(() )()0&0)<)D)p)@)))&*@,(+0+&+@,CC@DN0OO\+\4] _^+^4^ _%`%P@07<@`;F@h0>pC @EK@@gt @(0`80@ HPX`Thpx  TDDT&)P)`* T+(+0487@<H=P4>XC`EhDEpKxKI\ .X    $n(s,0488<@4 D H L P T Xc\`/dhlpt!x|gh  S!!!"c"|"""3###$&$J$$$$%%%_%}%%%%&&&D&Z& &X'''' '$>((W(,(0(4(8(<(@D*D,+H_,LG-P-T-X<.\U.`.d/h//lk/p/t/x0|H0l0001.1f1111102j222223:3^33334|4L5C888G9x99:F:h:: ::::: :$;(.;,\;0m;4;8;<;@;D;H;L<P<T+<X<<\J<`[<dl<h}<l=p1=tU=xn=|=======>>>s??? @h@r@@@A0ALAAAAAB2BHBaBhBBBBBBC C,C=CNC\C mC$~C(C,C0C4D8XD<lD@DDDHDLDPDTDXD\F`Id3IhGIl5LpxLtLxL|MM"M;MEMYMMMMMM..&E Pt $(!,@0\4t8<@`DHLPTX0\J`edhlpt xI|)AOx%0T!Jk + P m u }   $ ( , 0 4 8 < @# D7 HG LW Pg To X \ ` d h lI pr t x |   > m u ~         P     @Tu );N  Ad n$(,0482<<@\DHL$PGTgX\`d h3lEpOt_x| Tv RpzTDRiwD as 4$f(n,{048<@DH/L_PkTX\,`dhlptLxt| 9Q%T'.:Hq&)P)`*T++47 <=4>CE DE$K(K,0$4D8c<~@DHLPTX(\A`Zdshlptx|)BYp{8Qj.G`y ,Kf  $/(E,]0u48<@DHL P T5XM\e`dhlpt x |6AWm O t    6 ? G _ v    @    2 y  2 B P n      $@W u$(,048<@DH(L9P@TUX_\z`dhlptP. 3X]`z $(,048< @ DH,L0PFTJXQ\`dhlptxJ|Pglnsw{    7CG'()-hk lns $( , 0o4p8q<s@xD}HLPTX\`dhlp8t=x@|Zc5R 3 4 9 > Y                   $ ( , 0# 4 8 <; @X Dj H L P T X \ `dhl p`taxc|h /Glp#&')+-/4     $(,0$4'8+<-@/D4H@LhPpTX\`dh&l0pJtx| #0KOR}~ p $(,0428<@DHLPT5X@\[`\d]halapdtexg|l&&((8)@)I*P*1+@+++4477<<==> >CCDE-E0EbKpKKKM 3q $(,c048<@DHL P T X \ `8 d h l pt3xa|, 3~* $(b048@ D` HBP T X `$dhp1txz` (008P@ HPX`h@px  p@p00p@&(@) P*(@+0+84@7H<P=X >`ChEp0ExpKK hP Qp@\`  (0`8 @HP`X ` h p` x   `    `    `  ``  `(08@`H PX``hp`x @` ` ` `  (`0 8@H`P X ` h@ p x@@ )((`( (''`' '&&`& %(@%0%8& 3,8@PH3PPpx033m03~ 0(30NPX0`3h03% ! 30V !`p3 !  !A@) !h*76 !I@ >f !hp0E ! !S:  " %3 & & (x' #. %ET %\` %j %|x %} %} %7 % %3 % %z % % % % %d % %3+ %=Q %v % %| % %x %W %ř %  %X  %gL %u$ %i 0 %C %sJ %>O %7e[ %g %Ys %W %J %ը %9  %3 %1 %W % %X % %M % %, %>8  %, %= %I %U %g%a %e m %jy %9 % % % % %C %V % %M7  % %F"% %V2 %,Z % g %Vt %d %Z# %#= % o %P %C % %$ %HS2 %@ %VN %\ %.j %՜x %pj %9H % %8K %9| %({ %5L %( % % o %ۊ %# %1 %0? % 7M %][ %i %&w %r % % %˖ %F %{ % % %  %Ґ %aw) %<H %DbW %^f %Au %= %՞ %y %j! %p# %  %2e %l % %X&  %g %=>) %׹8 %UG %OV %@e %t %Pq %֩ %, %( % % %T %ݒ %1C %Y1 %ˇ %( %>)7 % 9F %PU %d %'s % % % %iw %s %a %1 %g % %V %KO& %ZT %Dh %u} %6 %hA %E %# %/ %J %r % %L %=d %9' %4 %}A % N %a[ %-h %;u % %' %$k %d % % %6 % %[< % %V& %'3 %N@ %4` %j %!Vw % % %w % %T %: %ZX % %_- %) %e8 %-G %d %u %{ %> % %p[ %- % %B % %X_ %. % % %) %w( %:/5 %Rg %wt % %; % % % % %J % %6 %< %?, %2: %BH %^BV %d %UXr %d % % %1 %\ %} %X %i % %u %n  %Y %( %6 %TD %`R %` %n %3J| %x8 %+* %S %[< % %( % %xi %d % A %ɋQ %k_ %m %b{ % %9 % %)) % %O %& %# %K %Ʃ %] %c# %н1 %yH? %X.M % %% % % % %" %Y %W %Y %D %OU %M- %c< %ƿK %Z %Y)i %Jx %d % % %C %3 % %? % % %p  %X  %I, %q; %"7J %Y %/h %gw % %+. %n %' % %8, %Z2 % %ՙ  %p %4+ %R>: %I %X %]$g %]v % % % %" % % %G %& %6 %4F %FV % f %L%v %A  % %I %D %: %  %` % %X  % %+ %: %_I %RX %g %v % % %u %Kf %% %N % I % %q %Ho  %* %* %9 %NH %BW %f %zv % %Cy %' % %V % %h %* %Z %R %) %_"8 %>G %2V %2e %Zt % % %V %8 %< %& % %R %@ %T:  % %( %7 %gpF %iU %%d %"s %  %J %s %j %" %A %X  %E % %  %/ %k' %ц6 %E %T %Evc %or %s %q %bh %q9 %^ %,0 %W %O % % %!n %v& %>5 %mD %%S %b %Uq % %bg %ks %7 % % %ˤ %v %Gl %r % %u@& %5 %bD %YS %hb %| q %j %mB %D0 %_ %6B % % %b % ? %h %" %v& %5 %8D % hS %yb %Mhq % %]c %ް % %j+ % %" %J %L %O %k %% %a4 %hGC %R %/Ea %p % %=l %h % % % %pb %۶ % %] %-% %4 %MC %NR %Aa %Kq %5 % % %+ %m % %H %/ %* ! %! %iP-! %(B! %=dP! %+\! %fi! %Tv! %! %! %! %<*! %! %=B! %N! %! %! %! %! %! %*! %w! %[! %q! %! %" % " %_" %q" %L^#" % [A" %fR" % c" %]Rs" %C" %=" %0" %g^" %" %ϸ" %" %" %L" %\ # %_# %'# %6# %)E# %OT# %tc# %;r# %1# %# %=# %y# %# %'# % # %<# %[# %t $ %x$ %V'$ %FA6$ %|E$ %CT$ %c$ %(r$ %$ %)m$ %$ %$ %$ %0,$ %7$ %$ %b$ % o% %2% %: % %p-% %fF% %SS% %a% %Bn% %V% %8o% %D% %,% %:% %j% %& %& %Z&& %,& %2& % `B& %.\& %i& %zv& %& %N & %/>& %Rl& %& %I& %Q& %r& %I& %Q' %(' %[<;' %*R' %Q_' %ol' %y' %I' %Q' %B' %t' % ' %B' %I' %( %m( %:( %Բp( %( %( %( %[<( %( %( %() %ԲU) %b) %cZ)* %gH* %h* %!lu* %0* %a* %a* %[<* %0+ %a + %N,+ %J8+ %LD+ %#&P+ %^s+ %x+ %+ %&++ %&++ % + % , %, %*, %.7, %Q, %!^, %l, %{y, %pQ, %U, %=, %Q, %[<, %2, % , % - %- % -- %qf;- %I- %ʜW- %[e- %@- %ۥ- %- %\- %]- %- %- %Ƴ- %O- %+. % PB. %Yif. %B{. %P. %-. %!. %r. %G. %c. %. %. %?/ %,@/ %t/ % \*/ %8/ %!F/ %nT/ %b/ %v/ %/ %>/ %K/ %*/ %/ %%0 %Az20 %i0 %:0 %;0 %~@1 %cM1 %gZ1 %Azg1 %t1 %Қ1 %f2 %Az2 %,2 %'92 %cF2 %b_2 %;;l2 %:y2 %2 %4G2 %M2 %OH2 %Dh2 %3 %ۿ3 %]#3 %eC3 %xS3 %`3 %Sn3 %{3 %Z3 %w3 %3 %gv3 %0u3 %M3 %=3 %4 %K4 %1.4 %B>4 %KN4 %&]\4 %0Yj4 %x4 %±4 %4 %4 %4 %(4 %O4 %'Q4 %55 %^5 %.5 %gvI5 %V5 %c5 %pp5 %V}5 %75 % 5 %\5 %k5 %5 % 6 %i'6 %A46 %ZB6 %O6 %\6 %/v6 % 6 %6 %%6 %~^6 %6 %F6 %pu6 %V6 %]6 %ڪ6 %IT 7 %7 %l*7 %B77 %D7 %BQ7 %d^7 %q>k7 %#x7 %7 %7 %7 %t7 %97 %37 %7 %/7 % 7 %N8 %?(8 %~"8 %d/8 %U<8 %I8 %hU8 %-b8 %Io8 %Q}8 %R8 %V8 %]+8 %8 %-8 %r8 %P8 %/8 %B;8 %w8 %զ8 %.8 %^8 %н 9 %9 %o$'9 %<249 %ZA9 %tN9 %ۧa9 %Zn9 %<2|9 %9 %Z9 %_9 %Rg9 %G9 %*9 %`x9 %Z9 %G9 %JQ9 %': %@: %G!: %8.: %;: %.H: %(U: %ub: %8 o: %if: %IK: %: %: %: %_: %E: %T: %h; %F; %+; %*8; %E; %h; %u; %; %l; %; %%; % [; %/; %:; %K; %A< %Y< %x< %})< %6< %C< %3P< %{< %*d< %%< %Kf< %^< %_< %ۏ< %< %]< %X = %t= %&= %&3= %2;H= %R,U= % %K> %|&> %<3> %ԥ@> %zW> %+d> %A-{> %*,> %q> %> %> %4> %I> %e> %g> %? %c3? %@@? %PM? %ޘ[? %h? %t? %? %-h? %c? %Z? %)? %? %? %? %~:? %1@ %+2@ %i(@ %GN@ %3[@ %h@ %Y{@ %r@ %@ %2@ %N@ %=?@ %s@ %@ %M@ %=k@ %O A %A %h3A %AA %NA %L^\A %\iA %.vA %hA %gvA %A %DbA %7A %@A %A %X;A %IA %A %B %B %\!B %/B %VF %xdF %2rF %9F %EF %VF %F %F %QF %4lF %PF %4F %VJF %F G %zmG %(G %6G %XDG %RG %b`G %BnG %+|G %wG %=G %{G % G %LEG %|G %"JG %yG %oG %(e H %H %c(H %՛6H %lDH %eRH %f>`H %^nH %|H %\KH %$PH %8H %pH %H %`H %-zH %H %i7I %-zI %Bg'I %5I %RCI %YoQI %]G_I %cmI %ϳ{I % "I % yI %I %<2I %I %KI % }I %1 J %&J %~&J %y4J %BJ %RJ %HbJ %DrJ %OVJ %%J %4J %pJ %AJ %J %2-J %F=J % K % K %FBK %PK %_K %UnK %E}K %`K %ZK %nK %* K %'K %K %-L %VL %=l L %/L %dSL %]L %W,kL %.yL %y\L %L %L %-L %AL %%L %!L %xL %pL %M %[M %U!M %X/M %=M %^M %3kM %6xM %}M %-M %8,M %M %M %M %0N %N %О$N %'1N %9XN %peN %5rN %˞N %N %,N %?N %G8N %@[N %N %^N %bN %N %O %O %SO %%f(O %95O %BO %OO %\O %iiO %~O %9O %TO %O %O %O %"P %O$P %1P %w>P %(KP %dP %xP %P %P %<P %nP %>P %3P %?P %QP %P %P %_P %iQ %Q %DI(Q %%6Q %~CQ %PQ %l]Q %OGjQ %wQ %Q %AaQ %oQ % Q % Q %WQ % Q %߾Q %Q %5xQ %/R %hR %v$R %z1R %w3>R %LR %qeR %bsR %R %qR %qR %R %R %lR %&ZR %KfR %%R %7 S %&zS %N)S %¡7S % IES %HoSS %*aS % oS %}S %NS %BS %S %S %$0S %$S %XwS %kS %߅S %Uc T %kT %O%T %53T %n)AT %DOT %']T %kT %yT %WT %h=T %T %mT %HT %T %QT %3T %HXT %Ψ U %RU %X U %".U %!Y^ %}^ %N^ %|^ %'^ %zQ_ %$_ %Y_ %=,_ %=:_ %u_ %0_ %}_ %_ %_ %'_ %x!_ %t_ %q_ %l_ %h ` %2` %*` %47` %GD` %6Q` %^` %*k` %}x` %v` %j` %|` %'` %V` %aU` %` %#?` %` %ݵ` % a %ѝa %9!a %/a %C=a %5Ka %YYa %a %z a %a %a % a %Va %@a % ,b %R b %!Y%b %T7b %b %b %VIc %Jjc %sc %#*c %U7c %:Dc %4Qc %d^c % kc %xc %FCc %ic %ec %c %FRc %Wc %Dc %Td %d %6d %cd %2id %Qod %ud %T{d %d %qRd %d %d %Ud %d %d %`d %d %ZOd %Vd %,d % e %e %&e %tl9e %vFe %+Jbe %Dne %e %/e %2e %-e %e %2e %ٌe %2e %2 f %f %$m"f %'If %Xf %?ef %crf %w_f %Vrf %C\f %Gf %f %xf %df %f %Vf %f %If % f %f %(f %hg %Jg %J)g %L6g %OROg %#]g %g %cg %g %dg %g %g %fg %kg %Vg %>h % h %$Dh %1Qh %__h %_ih %b vh %}h %3h %h %ch %Zh %h %&h %h %}i %7i %i %)i %6i %jDi %Ni %[i %hi %gvi %Gwi %Zi %&i %awi %i %i %i %#Gi %*i %Hj %"j %cj % }+j %D8j %=Ej %]j %e,rj %j %j %j %Qj %j %j %qtk %k %Wt4k %MAk %Nk %`\k %}<ok %ܻk %ck %k %Xk %)k %k %[<k %k %o l %l %+Kl % bl %anl %5jl %jl %l %l %l %Bm %(m %qt6m %Jm %5jXm %!fm %m %.m %m %!m %͵m %m %m %Cm %7n %(n %6n %!Dn %:Rn %ޤ`n %Wnn %Kn %^ln %Ȇn %~n %ȁn %In %/ o %o % 'o %5o %&Co %Qo %N&_o %mo %{o %o %Ʉo %Wo %Oo %vo %' o %Io %o %qNo % p %{ %v{{ %z}{ %{ %{ %{ %{ %%{ %| %uZ| %J | %h| %4X| %X| %Օ$| %E*| %0| %#7| %H| % N| %T| %M0Z| %j`| %[f| %m| %!>{| %sK| %C| %P| %| %| % ;| %s| %}&| %v | %Q } %:} %} %-} %!Y} %Z~ %~ %DK~ %Y~ %u~ %~ %~ %[~ %D~ %Y@~ %.~ %~ %G~ %C~ %Ջ %M %.8 %, %: %H %MrW %f %-1 %j % % %} %_$ %}2 %3@ %4pN %;\ %>j %x % %-N %@ % R %Gπ %2݀ % %6 %I( %6 %6D %^c %t %:z %lv %& %^; %! %` %' %˃ %zŁ %Ӂ %P % . %G % %Y %l' %i5 %;C %KQ %7_ %m %f{ % %i % % o %m %G:ς %d݂ %t %0 % % %}) %9 %fH %sW %}f %Vu %W %nw % % %n %D/σ %߃ %0, %IH % V %'d %sx % %W % %} %+τ %Eބ % %>h % %. %$ %O/y %RB % %e %P %k %;ą %qх %ZVޅ %BG % %^ %v, %p: %hN %[ %Gh %u % %B %c %tĆ %҆ %+߆ %d % % %h %>+ %9 % F %3S %E` %`m % o %T % %̇ %սه %K %G_ %d! %gv. % < %tpJ %dX %f %Ft % d % %~ %J %Р % Ȉ %ֈ %B %UX % %* %ڡ6 %C %R %(l %gvy %D %3 %ī % %M %}Ӊ %57 % % %xG %! %(. %ս< %J %l|X %jf %t % %Р %R %2 %? %ϋ % % %:N % %%' %[< % %)' %O4 %:A %)r % %x %>t % %r %Pnj %Ԍ % %" %gv/ %`< %@=I %mV %}c %κp %} %[} %y$ %b % % %ˍ %Vٍ % % o % %s& %# %E 1 %? %gvM %[ %N&i %Jw %+X % % i % %UX % % o %! %`. %DK; %OT %a %f8p % %" %!I %9 %m %7Ȑ % %DK* %7 %(iD %1Q %8d %[\q %~ %m %3 %Xj % %Q? %z=L %Y %-f %! %__’ %Mϒ %ܒ % o %~Af %Is % %\ % %_[ % %vГ %ݓ %( %h %> %ab! %i. %; %H %` %Fp %1~ %` %Ǔ %[<” %&Д %i2ޔ % % %Sm % %2i& %45 %S %# b %c|q % %% %%: % %* %XH˕ %ڕ % %C %}( % %m 3 %[B %0Q %` %lo %~ %P? %v %: % %Xʖ %Vږ %d %Jt %V %l %g0 %= %W % od %q %I~ %` %X %:[ %2— %jЗ %Uܗ %:u %k& %9g %< %"" %p0 %s> %L % Z %]9h %9v % %Z % % % %-ʘ %1ؘ %*U %, % % %# %V %Qh %ytm %s %̌y %J  % %4 % %B % %h %֑ %Rę %}ҙ %FR %! % %f % %m# %d[3 %UbA %FP %eq_ %On %?} %Ma %Ĺ %V %; %zȚ %Fך %9 %} % %0 %j9 %G}- %= %ˊM %] %m %H} % %F %Y %zs %v^ě %7қ %A %eK %ڽ %* %"% %o0 %@ %P %r` %p % %L %- % %UR %zʜ %iD؜ % % %Jz %v %w! %с0 %I? %^ %vk % o % %} %v^ %U\ %Fŝ %bҝ %ZNߝ %V %W %; % %% %- %: %T %Ec %x % % %s0ž %О %Xޞ % % %c %jE %lcR % o_ %l %y %q % %V %~A % %Xǟ %4Vԟ % %# %V %< %" %" %ߋ/ %hlH %?t %y % o % %B %  %xhϠ %ܠ %F % %X %4V % %<* %"7 %lD %q ] %!, %Ρ % oۡ %q %q %  % %[ %ʰ) %;6 %szC %P %QТ %,ݢ % o %l %~A % %J %t~ %' % % % % %ṭ %B٣ % %} %> %j %О+ %F8 %GF %]T %[h %su %H % %` %G %ä %[<ߤ %' %{ % %3 %3 F %L %pS %S` %sn %X[{ % %! %g %6hɥ %]q֥ %] %W %Ud %q %m %U# % %m %F^Ʀ %U#Ҧ %ަ % %^ %K %E] %' %4 %~L %fj %3 %j3 %fm %= %į %4Χ %ۧ % %Ib %m %~ %+ %c9 %&G %U %c % %\ % %Q %V %,ب %} %3 %A %O, %TU %b %uu % o %% %~ %5^Ʃ %$ҩ %D %l % %e %1 %`V! %Q. %; %0H %PSU %Цb %o % | %* % %;ê %)Ӫ %: %I %AP %o %1 %h' %95 %&C %VQ %0_ %Zm %W %9p %{K %® %, %ǫ %7ի % %O %M %Q %m %) %S7 %hE %S %a %wo %} %-" % %, % % <ì %:Ѭ %Y %2 % %H %% %BQ4 %C %R %h %-w %ӣ %# %5] %6} %!ʭ %Z٭ %Յ % % %9+% %12 %w2? % L %^Y %f %-s % %Fd %Q` %: % %qϮ %ݮ %* %o % @ % %s# %Rv1 %? %M %h-[ % i %2w %GV %_ %1 %k % %<˯ %ٯ % %`I %  %{ %X7 %_- %ܟ; %I %bW %f %u %= % %t % %t %а %*߰ %d$ %s %yU %( %* %G9 %RH %LW %f %Su %. %F %g %J %. %<ϱ %ޱ %7 %H % %/* %V9 %H %sX %g %uDv %ʑ %c %LZ %sx %F %` %9 %7 %ʶ %ֶ %0 %US %! %O % % %lY# %1 %6? %MM %[ %@i %8w % L %}; %N %Y %F̷ %[۷ %=J %9 %-9 %  %.& %!5 %PD %S %Ab %q %| % %h %uc %d %̸ %A۸ %-+ % I %\ %V %& %b@S %֭b %q % % %&r % %J %uŹ %ѹ %Dݹ %H %9 %K+ %s) %IP %] %Tp %[<} %?j % % a % %aź % % %- %@G %j] %ni % %@ % %T % %[<ɻ %?jֻ % %# %>c %{0 %VC %8M %N\ %Wi %GHv %y %] %kZ % %ļ %> Ѽ %:߼ %~ %9 %PL+ %y] %j %,w % %= %+ % %V %zƽ %lӽ %* %y7 %` %Kf %% %^# %0 %> %yK %YX %Vk %5xx %l %`^ %,ž %YϾ %l % %0 % %, %!t+ %s9 %UF %DS %` %m %z %B %2S %, %dd %G %fʿ %F׿ % % %PF % %+ %& %V3 %z@ %M %Z %mg %t %:I %$ %` %? % %\ % %Ho %* %w %I %{ %% %3 %SA %O %] %k %cy %, %No % %k %' %z % %J % %* %Y %5U" %z/ %< %P[I %X %a's % %" % %YF % % % %8{! %Wv6 %RB %LP % % %N %<# %/0 %0= %"J %Cm %w % % % %= %| %K %g %ߙ %NI %_ %g& %k4 %H %V %d %Mr % %+ % %| %ަ % % %-l %M %Fr %" %. %p? %E %IK %R %l %˒ % %[< %lg % %G %y %# % %g %{ %" %L0 %2Q= %HJ %@W %KNd %&Mq %~ %T % %. %s % %fj %B %\ %ټ %d % %Ik) %\7 %XLE %;S %{a % o %+ %`t %# %2 %  % %" %00 %> %L %Z %<.h %+ %R %  %YE %<%- %,; %I %nW %e %s %Dq % %nm %v %& %o %,_ %Z %ٮ % %/ %g %3* %?{8 %\F %+b %κp % %i % % % % %1 %kF % %10 % %* %\9 %IG %fU % Mc % q %0) % %պ %T %s % %i % %k % % % %:: %ZG %YmU %"c %Iq % %О %' %zN %: %Y %L; %Ȁ %` %&, %: %H %r.V %Dd %r %e %3a %x %( %J! % % %? %qY % %0( %5 %&B %f O %G^ %m %*b| %$D %i %za %1 %| % % %l % %ʲ %)% %3 %HA %4=O %m] %Qk %G %iW % %qt %2$ %`2 %w@ %N % %+ %x % %н %, %[<H %"V %#d %r % %Tz %& %' %p % %? %B %$ %( % %M{# %(T2 %A %P %i_ %Vn %}} %] % % % % %X % m0 %t)= %V %7?c % %. % % % % %T %E %X[ %\  %@ %e! %C/ %D= %K %JY %ڡg %u % %qX %; %F& %v %ʥ %3: %@ %V % %y %& %"+ %޺9 % R %fm %(z %` %d %Ʌ % %e\ %(i %n %e %v % %9 %_ % ( %Z6 %D % R %g` %mn %O)| % %: %= %A! %s %K %j % % % %  %3 %'= %)G %}/Q %<[ %wOi %w %} %R %˞ %ş %? % %gv % %_ %d %9 %F %3^ %^l %-y % %7T % %\ % %c( %A % %Y %/' %d.5 %C %=Q % _ %Ғm %;_{ % % %P %_ %% % %T %h %e % %_e %S+# %1 %;? %M %y[ %gi %w % %n % % %̟ % % % % %hQ$ %1 %> %+K %X %$Xe %r %/ %! %-g %D %[ % %XZ %S %,< % %X % %=' %/ %CI %<2W %/d %_q %'~ %s %Z %V % %ښ % %o: %i %Q %y9 %v %: %H %V %d %x %1 %X %D % E %J %A % %pX %: %w[ %:( %FK %0f %o % % %_ %E^ %(5 %~? %l %ְ %4z %| % %.o % %I %&\ %  % %) %O6 %C %GPP %k] %Fj %0x %Ӿ %) %e %8 % j % %8 %O %V % o % %1 %_r$ %1 %/> %K %/KX %;e %r % > %G` %% % o %O %6 %X %e %r % %>f %p %: % %G %p" %S/ %a= %PJ %W %Rd % %a %1 %/ %{ %z %vB % %7 % % %|- %; % %p %W %* %I* %cN %G %k# %.1 %u/? %}M %gvk %y %9 % % % %I %) %r %:" %p@ %xhQ %W %] %Rd %r % o %[< %xf % % % %Þ % % %AB %cSP %^ %S l %U{ % %ڣ %H % %* %G %H %δ %x %vg %I %O %> % %i %s$ %2 %A %sqK %\ %b %Ch %ln %t %}z %Ϋ %k % %( % %S %T~ % %1 %< %T % - %p %9s %0$ %X8 %KB %V %wt %j~ %L. % o %G %nG %}( % %Y %` %:[ %X % % %#`- %UT %Oa %>n % %P? %N % % % o % %j % % %& %md4 %ˏB %~bP %_ %zm % o{ % %~b % o %6 %< %" %i2 % %3c %~ %u" %z/ %R< %I %V % c %G-p %2} %| %yJ % o %X_ %ߞ %[< %  %7d7 %E % oS %`a % % % q %sC %)t %1m %@e %( %*5 %wB %XYO %\ %!i %Bv %]y % %  % %a %+ %N % / %] %~7 % %T %U* %fy7 %|P %~c %p %}(} %y %2eQ %Db %_h %Fn %It %v z %" %9A %T %| %Ow % . %; %I %GU %Ib % oo %X_| % %V %|" %) % % % %ʻ %} %/s %-6 %KFC %3Q %yS` %faj %Ht % % %! % %i %( %, % % %3 %( %|O %A\ % % %o % %n` %2 %D2 %M| %J %$ % %u % %H % % %8~ % % % %o  %y7 %Q %b %Fh %Kn %It %:z %2 %# %s % %! %UA % %p %I  % %A %Y %u* %kr %D %[ % %. % L  %$ % %J %" %k( %2. %4 %}: %@ %8F %2nL %tR %X %W^ %Zd %Nj %Npp %v %m| % %nI %z %j % %4f % % %Z %G %s % %&x> %=YO %sU %Չ[ %va %g %n %* %r  % %?w %- %h %wX % % % % % % q %5 % %_ %x % %E %u  %K% %8,2 %W? %5@L %ԎY %@ %~ %` % %ǝ % %s % %R % %O %c %>h9 %G %{WU %c %Pq % %X %; % % %> %b %8 %@6 %G %M %+S %Y %A_ %e %;k %q %w %} %[ %$ %| %N % %  %5 %b) %c % % %s  %X %# %9< %I %pxV %uVc %/p %~ %` % %b %(| %O % %  % % %O  %U  %,% %3 %A %gO %] %k %vyy % %iw % %@  %z %-k % % o %j  % %& %4 %B %_P %uy %n %DZ %? %[ %͘ % %-+ %A %5\ %D  %=  %qA#  %1  %p?  %M  %+![  %>  %  %~  %x  %m  %r  %.  %  %I  %  %,  % oU  %=qc  % oq  %  %P  %  %b  %G  %%  %d  %  %O  %%o  %F  % d&  %4  %~B  %-P  %#^  %l  %Bz  %wE{  %  %+  %  %  %  %|  %E  %}  %y  %-  %t  %J  %!  %=  %s"  %k;(  %!F.  %4  %1Z:  % @  %MF  %EL  %ELR  %XX  %2^  %d  %6j  %T^p  %0Mv  %H?|  %I  %  %)v  %<  %  %>  %;  %;V  %  %x  %  %E  %  %  %  %G  %~]  %~  %7  %8  %  %< %$" %D  %G % %I %8$ %G* %0 %A6 %@< %Y/B %%OH %?N %MyT %@7Z %"` %f %#l %ir %x %~ %[C %I< %Ѭ %u %# %] % & %Q %M] %  %p %W %X % %+  % % % %@ %u % %n %s %Z %U %c %8  %c& %, %m2 %M8 %> %GD %`J %mP %7V %0\ %8b %_Fh %n %[t %2|z % % % %t %> %R %9 %t % %$ % %C %D %` %O %$* %5E7 %E %k]l %4p %` % % %s %X % %U %V %) %Y %N  %& %H, %2 %8 %+$? %L %d`Y %f % %X %  %m0 %> %IL %ۆZ %x %{ % % %‰ %  %- % %w %GJ# %0W) %f / %ǭ5 %; %B %i %(v % %r %>, %p %| %O % %t % % %[W  % %|$ %OI %V %rUc %f| % % %B % %/ %7 %Â* %0 %}6 %_*G %oT %}a %3n %| %a % %(T %V %D$ %w %]`  %di %K2 %`< %U % b %.^o %| % %) %^ %; %4 %, % o %  %.^ %m  %  %]' % %# %/H %%j %[ % % %}) % %^ %! %]`/ %h"= %f_K %:&Y %T3g %[u % %Xs %k %K %k %{ %x %l %#  %  %_05  %!KB  %'P  %}  %]  %G  %`%  %;  %n  %1  %&Y  %iE  %0  %  %Fn ! %! %ք&! %E3! %;@! %$M! %Z! % g! %t! %! %s! %D! %f! %hn! %h! %! %! %! %L! %n" %" %W" %[*" %vd8" %<F" %T" %Yb" %" %b" %p" %i}" %" %," %d" %y" %# %y # %# %# %wv# %S})# %|C# %[<]# %dj# %w# %+C# %# %|# %`# %# %::# %# %# %T$ %$ %$ %+$ %9$ %]G$ %BDU$ %!$c$ %zxq$ %>U$ %$ %i$ %|$ %{$ %a% %% %#% %8% %T% %#bx% %~%$%!% %ѓ% %%`#% %% #& %g& $& %1&:& %G&e& %gr&& %c&& %9&`& %& & %m%& %' %=!' ?' %y+M' V' %Jw' %' %v' %)' %r\' %V' %' %( %-( % 0( %^7( %=( %c( %u( %@( % )( %( %V( %'( %rP) %f) %2) %H) %^) %}v) %o) %) %) %-q* %'* %\fC* %oV* %=w* %t-* %@* %* %-* %j* %2%* %* + %-+ %VPI+ %`+ %4"v+ %+ %+ %+ %g+ %8+ %e, %J, %5, %xP, %m, %փ, %)P, %Q", %, %_, %- %%*- %.<- %ήO- %[- r- %S}}- '- ' - - - '<- ':- -x -x - 'L- 'J. . #. 0.( =.< J.L m.\ .l .t . . . %M/ (/ %S}/ 'c / 'Y%/ % j6 %yw6 6 %6`6 66 (Q6 %y6 6 %6X6 6 7 (7 %y%7`.7 %;7PE7 V74a7 (o7 %y|77 %7H7 7N7 (.7 %y77 %7@7E 8g8 %y!8 *8 %788F8 %yS8`\8 %i80x8 %y88 %8(8 %y88 %8 8 %y8 8 %89 %y9`$9 %19;9 (D9 _9 %yl9u9 %99 %y99 %999 (9 '\9 'Z9 'k9 'i9:: 'z#: 'x-:7:T: 'X: 'b:l: (p}: ': ': (p: ': ':: (: ': ': (:::;8;lB; (S; 'W; '\; (e; '7i; ''r;|;; 'x; 'v;;{;;;<<%0<@<Q<g<q<< '< '<<< '< '<a<a< '< '= ' = '=u4=>=[= '_= 'd=|=W=W= '= '= = (= '= '= '= '= ' = ' = ' = ' = '>0 1>0 N> '3 R> '1 W>; o>Z y>Z > 'C > 'A >d > > (e> 'S > 'Q > 'c > 'a > 'u > 's > ' > ' ? 2? J ': J %IJ (]J %# KK'K %j11K (m:K %2EK 'T IK 'R RK\K (mhK 'f lK 'b uK ' yK ' ~K (mKK*KKmKK (MK ' K ' K K5L %^{ L ( L ' $L ' )L %S}4L ' 8L ' =L % HL 'H LL ', \L ' `L ' eL %InL (wL %#LL L %1L ('L %2L '$L '"L L ('L '6L '2L 'eL 'aL ('M` Mw M-MN=M %yJM`SM %`MoM %y|MM %MM (M %MM M %@1M (M %2M 'M 'M N (N 'N 'N '#N '(N (1N =N NN[N~kN N N (7N 'N 'N (7N 'N 'N NNO O (X/O '%3O '!8O (XNO 'FRO '>WO sOOO, O (rO 'sO 'mO (rO 'O 'OC O1 PP (P EP 'IP 'NP fP pP (P 'P 'P (P ' P 'P P (P ':P '4P '\P 'XP '|P 'xP '|P 'xP Q BQSQaiQ6 sQ (Q 'Q 'Q (Q 'Q 'Q6 Q ( Q 'Q 'Q 'Q 'Q '2Q '.Q '2Q '.QU R ERPVRalRe vR (R 'LR 'HR (R 'kR 'eRe Re R 'R 'R 'R 'R 'R 'R 'R 'R (Sk9SaLSN hS S S S Sr Sz S S T T T ,T DT QTfTvTTT %T (1T 'T 'T %S}T 'TT 'LT 'T 'U %IUU (X"U %0U9U$NU %0XU (jaU %2lU 'pU 'yU$U (jU 'U 'U ')U '%U (jUUUUU (|U %#UPV1V %0"V (+V %26V 'F:V 'DCV1MV (YV 'X]V 'TfV 'jV 'oV (xVVVPVV %yV`V %V V %yVV %WW %y#W,W %9WHW %yUW ^W %kWzW %yW`W %WW %yWW %WW %yWW %XXX (H*X '.X '8XBX (SX 'WX '\X (eX 'iX 'rX|X (X 'X 'X (XXsXXiYhY ()Y '-Y '2Y (;Y '1?Y ')HYRY (cY 'WgY 'SpY (uYYYYYY ( Y 'qZ 'mZ ( Z 'Z 'Z(Z (9Z '=Z 'FZ (0KZXZAfZZ7Z)Z (BZ 'Z 'Z (BZ 'Z 'Z)Z (\[ '([ '$[ '? [ '=)[ 'Q-[ 'O6[ 'a:[ '_?[Fi[z[[[ (l[ 's[ 'o[ (l[ '[ '[[[ '[ '[ '\ ' \ '\ '\ '\ '!\K\\\r\|\ (\ '\ '\ (\ ' \ '\\ (\ 'D\ '@\ '[\ 'Y\ 'm\ 'k\ '}\ '{\!]2]D]E\]Yi]z].]@]S]]]]^^aB^W^Xg^|^^^^4^J^0^b__z(_8_I_o_ %_ %S}_ %I__ %y__ %_(_ %w` %S}+` %I5`?` %yL`U` %b`0m` %M` %S}` %I`p` %y`` %`8` %!` %S}a %Iaa %y,a 5a %BaHMa %yZa`ca %pa@a %aa %S}a 'a 'a %(a 'a 'a 'a 'a.bF/b$>bT\b}jb %{tb (b %S}b 'b 'b %(b 'b 'b 'Ab ')b %Ibub %ybb % cPcN3cQccccccuc( d;d %-Ed (Pd %S}[d '_d 'dd %(od 'sd 'd 'd 'd %Id %yd`d %d`d %ydd %dXdaey+eI@eRehce0e %ce (e %S}e 'Xe 'Je %(e 'e 'e 'e 'e 'e 'e %Ie %@off %yf(f %5fDf %yQfZf %gfvf %yf f %fxf %yf`f %fpf %yff %fhgO&gjEgcggggg4ghh.*h:hGOh_h^ph0h %C@hh %S}h 'h 'hh (lh 'h 'h 'h 'h  i*i (|;i '?i 'Hi 'Li 'Qi&sii %2i %S}i %Ndi %S}i %i (i %S}i '3i ')i %j 'kj 'ej 'j 'j %('j '+j '0j %4:j '>j ' Cj %RMj 'LQj 'Fnj 'vrj 'lwj %Ij %yjj %jj %yj@j %jjj (k 'k 'kk (0k '4k '=kGkbk 'fk 'ok 'sk 'xkkkk 'k 'k ',k '&kkkl!l6lLl]lnl %`~l %Rl %ql (}l 'Rl 'Ll %l 'l 'zl %S}l 'l 'l 'l 'l %Im %ym m %)mP8m %yDm`Mm %YmHhm %ytm}m %m@m %ymm %m8m %ym m %m0m %yn` n %n((n %y4n=n %In Xn %ydnmn %ynn %yn n %nn %yn`n %nn %ynn % oo %y$o-o %9oHo %yTo ]o %ioxo %yo`o %oo %yoo %oo %yoo %op %yp p %)p8p %yDp`Mp %Yphp %ytp}p %pp %ypp %pp %yp p %pp %yq` q %q(q %y4q=q %IqSqwqqPqq qq qqqr rr$4r>r=Sr]rVrr|ror~rrrrdrrIr sxs,s06sKsUsjs ts3ssLssess~sstt$t.t?t`t %.jt (t 't 't %t 'Pt 'Ft %S}t 't 't 't 't %It %ytt %t u %yu@!u %-u} '!C}Os}c}} (} '!} '!} (} '!} '!}}} '"} '!}}~ '"~ ' "~%~>~ '!"B~ '"W~a~z~ '3"~~ '1"~ 'G"~ 'C"~~~ '_"~ ']"~~~ 'q"~ 'o") '"- '"6 '": '"C '"G '"PZs '"w '" '" '" '" '" '" '" '# '" '# '# '# '#p#}- (< '3#@ '/#E (N 'M#R 'G#[e 'h# 'f# 'y# 'u#ŀ߀ '# '# !9N %z %( %  %ȧɁ %EW %;  %le6 %EP %Z %zs % % % %8ڂ %Re %#R %sF %ha %n %x~ %  % %\Ѓ %p %C %j{ %`u %|ф %$݄ %[ %r, %  % n % n* % n8 % n[ %^:w %P %gv % %u %ٯ %9Rʅ %d܅ %¶ %o %  % %, %ӷ< %L %\ % h %0y %(  %y  % % %ņ % Ն %= %V %  %| %* %27 %?J % %# %I %y %OÉ %qω %Kۉ %* %Am % %K+  %& %*|# %/ %B %9FI %?N %7Z %Vtf %r %b~ % %| % %y % %Ɗ %ymҊ %kފ % % %d %C %+  %`& %2 %> % J %]V %b %w %u %} %u % %Ƌ %_Ӌ %? %*  %o %e %_ %lC %pP %_] %< %( %Ȍ %_، %R %o %45 % % %, %-: %H %{V %d %֌r %_ %} % %'f %^ %Cƍ %nԍ %  %a % + %; %*WJ %Y %,h %Ww %1, % %' %a  %?6Î %=Ҏ %(T %w %` %77 % %R, %; %|J %Y %h %w %V % % % %D %я %] %a %?: %PU  %A %HA+ %: %pI %X %+g %o %Qm %B %U % %מА %ɞߐ %X % %ܜ  %X %-- %= %!M % \] %Ҕm %-} %i % %< %{s %*͑ %jݑ %I %B %c  %r %a: %I %!X %Jg %R3v %^ %? %Hd %HU %o} %kВ %~$ߒ %5 %g^ %7  %d %H* %89 %|H %!W %f %8Xu % %B %~ % %+Z %yϓ %cޓ % %M %  %6L %* %s9 %$)H %CW %f %u % %$ % %p %qΔ %ݔ %] %, %wd  %n %y( % 7 %EF %mU %d %`s %9 %X  %2 % %| %1C͕ %\ܕ % % %%  %~ %a' %X6 %#E %T %c %r %> % % %v> %Z %g̖ %mۖ %1I %; %^F %D %:& %u 5 %1D %KS %jb %3"q %r %j %@ %H %rW %[˗ %ڗ % %3( %b %9 %F% %=4 %RC %R %~xa %op %> %u %ރ % % %o5˘ %/zژ %4; % % % %c% %\24 %C %gR %)qa %$p % %^ %# %I %S % ˙ %}:ڙ %M %: %M %6 %% %tk4 %C %R %a %p %g % " % %x %Y4 %ʚ %ٚ % % %vr %>% %:4 %]bC %SR % a %5p %֊ % %MS % % %ʛ %$zٛ %= %Y % %u %( %7 %V@F %U %e %t % %{ %A %TŜ %Ӝ %T %v %% %a  %_ %4' %B5 %QpC %=Q %_ %m %{ %GO %jN % % %ĝ %Aҝ %9^ %$W %p %w\  % %/& %4 %B %iEP %$m %\| %Bj % %N %}j %SǞ %y֞ %d %VJ % %4" %11 %Q@ %^O %Zr^ %,m %| % % %7 %9? %ǟ %>֟ % % % %ڕ %"! %cV0 %4? %BDN %}] %rl %{ % % % %f %Ơ %Wՠ %#[ %v %\ %  %I#  %/ %p> %(nM %\ % k %^Jz %F %44 %  %A %dž %< %`c6 %ōD %R %m %{ %m %džע %< %.- %9ʣ % %> % %p4 %v4 %S % %|4 %( %" %Ƥ %#Ҥ %T %K %wz$ %12 %1A %g %"T %|^ %Lu %< %ӥ %V % [ % %n %_ %) %!6 %gV %u` %(m %8 %Y %J %Nͦ %#ڦ %t %c %~ % %  %s0 %We %Ts % %9 %W` %Fp %K %է %y %;n %. %#  % %E+ %·9 %!G %T %1 %. %" %; %؎ %t# % %) %E7 %lE %F6T %3jb %p %[~ % %G %. %Jx %ĩ %sҩ % % %V  %y! %!. %^\ %@p %_ %b % %}˪ %eު % %c %>X % %% %FE- %ak5 %B %6P %kT\ %>i %Pv %g %(4 % %  % %[Wū %= %< % %  % %$7 %C %'P % ] %*j %w % % %?8 %l %̬ %mݬ %v %j %Z %b. %aW % %* % o7 %1D %Q %i %jv % %'e %@ %%ʭ %J׭ % %> %G %a- %;h; %fI %W %fe %~s % % %e %H % %TkǮ %*ծ %j %-Y %$t %  %v/ %P) %b+7 %<E %[S %a %Ao %i,} %J % %& %p3 %Cï %ѯ % ߯ %e  %R %*' %6 %( %6 %C %vVg %s %ȟ % % %; %<̰ %i9ݰ %wZ %  %$ %5) %b8 %G %61V %Ye %t %z %) % %f/ %b %7bα %ݱ % %U %G  %  %4( %x7 %eF %LU %5d %s %f_ %2 %_ % %K %wβ %ݲ %O %@ %d  % %( %?7 %F %V %'e %~t %  %X %- %A %t %]dz %CԳ %B9 %@ %e %qY" %x/ %  %RM %ғA % M %Nj % %= %f:̵ %RMٵ % %in %{9 %RM % %8 %6 %4Ѷ % ޶ %  % %, %W: % H %:g %w %R %5 %L %ŷ %eҷ %& % %- %J %* %aI8 %GF %WT %Yp %J % %o %a % %/θ %+ܸ %s %  %h %h& %4 %B %."P %#^ % s %0 % %aI %ȹ %eչ %C %_ % H %M %.W %-h %Tn %Ut %2 % % %L %ьź %p % %> % % %*' %7E4 %A %*] %Xj %} %n %R$ % %p %Ȼ %*ֻ % %F %r^ %H %a %ߡT %Ra %n %{ %ғ %|= % %l %Q&ʼ %oؼ %! %_ %A  %g %' % U %f %N)l %hr %4wx %~ %E %# %w %  %J %z %ʽ %l׽ %^ % r %" % $ %62 %> %TK %aX %r %x[ %m1 %^ %s %j % ¾ %-Ͼ %Gܾ %{ %m %   % %m$ %F2 %9? %EM %n[ %iKh %mv % %# % %[ %E % %ɿ %ֿ % %H %p %8$ %1 %> %eK %Xe %T2r %ނ % %; % % %n % % %2 % % %mk+ %m> %.\ %ph %u %z % %, %B %P %M % %x %ь  %6 %|# %80 %1U %52a %vcm %U~ %0 %5+ % %ex %j %v  % %MM % %V %'! %8 %E %MMR %'i %v %MM %D %A %` %' %y %M % %  %x %D# %}: %cmF %R %i^ %l8j %V % %6 %' % # %Jl % % % %:& %52 %4> %T %/a %n %-{ %  % % %< %E %x % %,  %T %# %1 %@!> %K % X %e %| s %= %] %v %; %ba %S %1 %/ %< %; %aI %{, %49 %F %~T %aa % n %c{ %a %|b % %/ % %[ % %͟ % %]5 %S  %f* %M7 %TE %TR %H` %m %z %n % % %) % % % %2 %i%  % %P& %Q]3 %A % V %c %Pq % %ء %߇ % %8 %| %P %  %\ %( %. %% %l, %8X: %H %}7V %r %8 %| %! %p %Q %'8 % %o % %Y % %c %+ %Q>9 %)LG %U %c %Mq %6[ %, %< %+ %\& %F %S % % %`X %y %V %Y* %Vu8 %F %T %>b %p %ח~ %0 %d %@ % %N %  % %m % %  %J %h& %4 %vC %S %Oa %p %Y~ %B %7 % %'f %Lo %@? %8 % %1 %  %' %"& % 4 %CB %P %R3^ %FMl %Cdz %F  %FM %9 %H %$ %(B % %'f %ׇ  %: %LC %FtQ % ` %n %M| %#P % %Z %$Q %Y % % %h % %( %a  %U0 %W@ %P %uw_ %u{ % % %Y %Y % %MY %< %ނ  %3% %,3 %A %>O %u_ %X % %_ %> %  %f7 %g % % %B/ %# %i1 %+? %pM %[ %Ni %Kw %C % % %d( % % %uq %x % %P %, %9 %oF %;pa % %0 %(v %Ur % % %:{ % %Pr  % %+R& %3 %4 @ %2.M %GZ %1g %4t % % %&h % & %8 %& % %͚ %o %< %f! %. %\B %\ %͚i %| %xo %." %T_ %J % % %zi %C %N %" %, %q9 %xF %`S %n$` %m %dz %t %o % % % %'i % %? % % % %3 %yB* %7 %SYD %f*Q %^ %ik %x %>K % %I; %I %E %T %h %w % %  % %) %7 %S %?a %,o %8} %| %ŏ %M %! %bu % %B %~ % %  %y %c% %3 %/XA %CO %] %MJk %m>y %&Y %6 %v> %! %  % % %5 %cY %u % %! %/ %i= %Q %^ %k %xx %* %| %` % %# %+ %^ % % %BF %? %  %$- %: %%.G %PT %$a % n %8m{ %hv %> %5@ %& %$ %> %M %_ % %Ě  %L %% %}3 %>B %jQ %` %3o %~ %v %M %{ % %s* %> %p %+ % % %" %&6 %KP %AZ %3(d % %  %>B % %L4 %h %< % %X %, %hQ: %"H %rV %id %.r %G % %78 % %UE %u % % % %O %_  %7 %+ %= : %KI %cyX %]:m %z %F % %9 % %+ % % %" % %  %A %- %M?7 %|A %K %U %o %@| %3 %>H %\ %0 %~ %& % %W? %7 % %y %*y %* %87 %D %:eQ %il^ %VGk %";w % % %* % %< %y %^ %[ %؁ %ܔ  %V %?& %A@ %;M %D Z %:g % t %y % % %qe % %wg % %L' % %V) %`/ %5 %< %kH %X|U %b %uo %M1| %6i %P %¤ %F % %" %< % % %@ %  %\+ %78 %E %/eR %_ %^<l %d % %$ %m %- %y % %<  %=@ %T& %/M %ΘW %d %T % %v %& %y %s % %< %Q  %f6 %_' %4 %A %Z([ %h %u % %A %L %j % % %T %c %$tM %k[ %&i %8 %` %'  %4 %/= %W % %q %Y % %n %$ % %V %xU % %Q} %o % + %k8 % E %)5R %_ %|l %y %M % % % %2 % % % %a) %P %aC %C %j" % 0 %]> %v)L %7Z %Ah %v %?N % %M % %} %uv %a %A %چ %(3 %o, %!9 %_F %l^ %Rj %t6w % %| %< % % %+ %P %+ %4 %~- %/o9 %F %?Y %Hf %y %  %x %a % %x[ %`! %; %Q %7 %\'  % %P# %6 %C %+P %18] %w %7B % %e %| %$ % %P %= %O %, %#9 %F %TT %5c % ~q %v %R %P % %* % % %AG %D %6' %A %N %6Wa %זn %E{ % %  % %P %I %k %O % %\ %' %  % %3_$ %1 % > %bqK % X %yf %Yt % %T %T % %W % %u %_ %* %X7 %D %+[ %vg %Q} % %h %. %@ %h %L` %h %l % %? %xB %Q %^ %k %1x % E %/ % %9 % % % %y %n %lU % % % % % %" %c/ %$H %V %"y % % %< % % % %= %_ % %E %g= %J %qX %qb %o %P| %x % %5 %d- % % % %P %  %q %%s" %a/ %= %G %qT %ya %aI{ %EJ % %z %VJ %ݟ %o %k % % %8S %{  %j %7P$ %^1 %$> %$V %k %nx %] % %u$ %e %Wb %%G %| % G- %l : %G %nU %h %\ %+ %g %+ % %(v % % %[B %a %LD %p[ %4g %< %< %n %] %| %,  %! %%G/ %eC %<Q %V_ % [} %< %} % %ډ % %t %R %  %T! %/ %= % K %xY %0g %Y %? %Y %,Q %U %{ %} % %t  %. %z< %J %4X %=sf %t % % X %K* %X %I % %~ % %  % %5 %%2? %wM %[ %Aj %x %P % %P % % % %: %LZ %o %+ %wp8 %a` %^t %~ %v %j % D % % % %Z % % %  %  %4& %M4 %AB %DP %^ % % %ь % %i % % % %6, %t: % H %V %!d %  % %t % %iM %(T %% % % % %5  %e %`( %6 %J@D %4S %Ob %{q %Y % %s %p  %f4 % %d %8 %+ % % %k4 %C %iR %a %p % % %UF %$ %= % %q % %a %o %W$ %$ %3 %B %=Q %*\` %Xo %~ % %* % %5} %~ %v %^  %5 %~G! %j/ %p]< %s9I %RV %R3c %p %a} % % % %  %( %'V %B %T %70 %<  %;. %F< %yP %Z %s % %( %P % %! % % %<, %NB; %φL %uR %X %S\^ %d %nj %Hp %iBv %| %q %ƙ %1 %w % %A  %na %:a %> %D %] % %G}  %&' %H98 %cU> %gD %BJ %P %8V %\ %Lc %t % z %? %  %> %` % %r %C %T= %6* %t %e % %_~ %O %1J %( %8 % % % %2 %T  % %8] %5 %" %W( %H. %L4 %~w: %|@ %lF %L %+R %ZeX %i^ %93d %/j %Ip %xhv %| % 1 %S % % % %6 %f %^` %ِ %N %P % %m %T %8T % %i %G- %S %q %* % %`i %`  % %UT %n* %Ɓ0 %V6 %< %D=B %-H %O %] %>k %wy %# %\ %=t %F  %E %c % % %8 % % %+ %^ %.i %-  %;  %W  %ee  %=ts  %l  %  %  %  %  %  %  %_  %1   %   %p  %  %*  %E9  %!VH  %D  %  %b  %(  %P  %t  %P  %x"  %B0  %g>  %`L  %mZ  %h  % v  %2  %$  %  %  %  %  %  %e  %&  %0E  %V  % \  %fIb  %h  % n  % t  %n{  %c  %V  %*N  %S  %~  %-  %E  %_  %“  %y?  %:<  %S%  %3  % A  %RO  %8]  %k  %q<y  %  %A  %  %K   %q7  %  %  %t  %  %P  % %W9* %M9 %PH %URW % *f %cJu % %R %0A %J % %~ %* %_8 %cF %BZ %[dh %) % % k %e %0 %~ %: %^ % %I] %U[ %e %r %P8 %_# %*> %> %uD %( % %+ % %A %* %, %9 %TF %RS %y` %B % %R3 % %^J % %T %t %/ %D % %F %" %2/ %Z(V %c %p % %7 % %Q^ % %, %V % %  %PL %b$ %1 %a> %3K %ߙX %Te %&r %x0 %[  % %& %=( %u % %R3 %g %  %. %E< %}J %TX %?f %)ou %; % %S %x %qO % %} %)  %D  % %) %ѣ8 %]G %rV %ye %wt % %- % %g %a %$t % %a %   %ć %*( %-G8 %lH %FX %:)h %zx %9 %YL % %BQ %= %y % %7 %1 %E % %y % %x %$t* %7 %E %~ %Z % %(: %d %P % %i %` %" %8 % % %c %Q5 % %7 % % %M %t$ %- %6 %M? %:H %?Q %$[ %kh %eu %E %  %< % %/ %< %  %& %S %G %5 %/ %") %M< %nzJ %AX %f %t % % %o %]= % % % %Y3 %- %ӄ % %k %7* %8 %WF %%T %kmb %Ip %q~ % %J %{ %< % % %Pl % % %&7  %5 %1; %B %I %P %/W %u~^ %lge %|l %s %S| %3 %0 %2 %a % % % %4 %y %N" %r %& % %W %Ð %aI % %x %: %e %;  %P %   % %|B % %x1 % %C %2{  %tj  %E(  %5  %RB  %Yj  %w  %G  %ȥ  %|  %^7  %^  %R  %q:  %2  %j  %! %x! %ނ ! %R3-! %AS! %'`! %m! %! %c! %q! %@5! %j! %aI! %}! %VC " %j" %$t&" %4" %6B" %{P" %Q^" %l" %etz" %+" %f" %H" %*" %f" %" %zu" %U# % # %#&# %3# %Ð@# %cN# %T\# %zOj# %)=x# %# %_f# %et# %a%# %# %[$ %$ %W$ %V$ %l$ %l% %,% %% %,% %9% %F% %!S% %% %% %K% %F% %% %E% %7% %% %a & %8s4& %aIA& %j3N& %[& %th& %Pu& %& %i& %rP& %t& %W& %& %& %*& %4& %pi& %A' %' %Y(' %5' %C' %UQ' %aI_' %|m' %4{' %' %*' %f' %;' %f' %* ( %-( %A&( %3( %R3@( %M( %e"f( %s( %S ( %$( %?( %( %{) %{) % ) %/* %<* %I* %;V* %c* % v* % /* %$t* %{* %9* %=* %Dg* %"$Q+ %^+ %+&k+ %sx+ %+ %1+ %+ %mk+ %A+ %h, %, %];, %6-, %, %&, %, %o, %5 - %- %<*- %9- % H- % X- %qf- %Pt- %*- %s- %- %- %- %D- %- % - %q;- %J!. %T. %|. %c*. %8. %/F. %T. %j. %+. %YS. %q|. %". %kA. %UZ. %z#. %. %6 / %pS/ %s&/ %r4/ %^J_/ %lm/ %A{/ %</ %/ %T/ %pS/ %s/ %r/ %/ %^J0 %w0 %A70 %q0 %#0 %)0 %m/0 %50 %`;0 %OA0 %'G0 %M0 %S0 %_Y0 %(_0 %Xwe0 %Qk0 %aq0 %>C0 %0 %R0 % 0 %}0 %Hr 1 %6~1 %A'1 %51 % 9C1 %yw1 %`1 %Z1 %A1 %11 %MY1 %_1 %b1 %A1 %`1 %1 %y 2 %w2 % x%2 %R322 %,.?2 %?L2 %}Y2 %yl2 %ny2 %y2 %ˋ2 %2 %a{2 %)2 %*2 %_"2 %2 %( 3 %>3 %&3 %7/33 %I4 %4 %X4 %y4 %R,4 %aI4 %4 %{ 5 %uL5 %'5 %B55 %)Q5 %*_5 %R3m5 %8'{5 %5 %^J5 %p5 % 6 %6 %y&6 %k36 %@6 %pM6 %HZ6 %g6 %Zz6 %6 %)=6 %Ur6 %6 %E6 %56 %i6 %Z6 %GR7 %R7 %R3*7 %E77 %oD7 %`7 %m7 %Nz7 %7 %x7 %R7 %Eh7 %-7 %+7 %E7 %J.7 % 8 %m8 %I)8 %:J8 %ODW8 %5e8 %R8 %T(8 %8 %"|9 %|9 %9 %"|;9 %1G9 %|S9 %>_9 %\k9 %x1w9 %y9 %09 %}9 %9 %Q9 %u9 %x: %G: %@): %5: %B: %O: %R\: %Ki: %4v: %: %Q: %y: %ڒ: %: %|: %˛: %a; %J/; %o; %`$+; %_8; %lY; %Pf; %x|; %; %k"; %'; %; %H; %A< %< %;Q;< %1G< % S< %ua< %'?n< %{< %< %h< %(< %$< % < %< %%< %z< %n< %< %MV= %L= %GD= %#T= %pb= %p= %"~= %B= %= %k;= %l= %= %)= %'= %,= %1> %C> %F> %j,> %m:> % H> %V> %_d> %r> %'> %$> %> %CY> %%> %+;> %> %> %J> %dr> %^ ? %? %*(? %c6? %dD? %_R? %2a? %p? %Y? %? %U? %#? %[? %V? %p{? %? %w@ %i@ % 0,@ %MP;@ %`J@ %-Y@ %Y~@ %x@ %Vz@ %D@ %h@ %S@ %?W@ %E@ %@ %@ %MkA %6 A %2A % 'A %?A %{DOA %L\]A %kA %nRyA %A %hA %A %>IA %@A %}A %A %bZA %zA %(B %l2B %x]!B %Az/B %ԟ=B %KB %2aYB %͠gB %,uB %B %NB %5 B %1B %rsB %.UB %c5B %[B %oB %C %r`C %\"C %d2C %FAC %J[PC %_C %_nC % n}C %'C %tC %C %lC %$C %C %vC %+C %D %D %"D %1D %@D %OD %N^D %mD %t|D %D %D % |D %BD %cD %D %D %ze E %6E %-"E %FE %F %GF % F %h,F %DSF %qmF %'?F %F %!F %G %&G %:N?G % LG %ifG %>sG % G %G %_G %;G %gG %mG %QG %G %$G %(vH %=sH %*H %#7H %ADH % QH %!H %OQH %H %AH %PH % CH %AH %JI %k[VI %gI %%mI %ėsI %wI %I %,I %I %I %fI %+uI %ŕI %\J %J % J %!!+J %,GJ % VJ %.eJ %tJ %J %1 J %J %J %&J %"J %RJ %J %ddJ %K K %K %;(K %067K %P7GK %mVK %FeK %8tK %K %}/K %XK %K %K %K %K %L %L %D*L %R7L %QEL %HOL %[L %igL %zTL %L %VL %9L %L %eL %'L %M %<M %"M %36M %CM %4OM %yqM %_hM %<M %BM %TM %AM %,k N %eN %Ӄ,N %'9N %8kFN %SN %<`N %wN %N %5N %NN %(N %IN %'N %fN %O %#p O %/O %=-'O %/AO %{NO %[O %viO %fvO %O %O %LO %XO %PP %P %GP %(P %5P %)BP %MPP %.?]P %njP %V xP %3P %8P %|P %1P %P %rP %`P %,P %_P %>KQ %?Q %/1Q %OQ %YQ %?sQ %Q %w\Q %Q %PQ %FQ %EQ %'Q %4Q %Q %hwQ %R %rR %%R %T+R %69R %MFR %#9TR %ZaR %nR %{R %R %yR %R %R %)R %MR % R %\R %J@R %4R % S %S %3%S %2S %?S %/MS %[S %BiS %~wS %JS %KS %PNS %S %S %A&S %US %vS %qS %eT %ϖT %B T %.T %{>HV %$YV %Vn_V %FneV %ukV %qV %wV %ҚV %FV %V %V %w\V %cV %\V %tV %z W %]W %j/W %;W %HW %qUW %$bW %[m{W %W %^W %6:W %pW %]xW %W %+W %W %|W %L X %wX %O(X %z6X %DX %RX %>`X %ZnX %D}X %X %X %BX %gX %X %RWX %X %f Y %VY %+Y %98Y % EY %jRY %L_Y %j\lY %>VyY %9Y %OY %vtY %Y %#Y %sY % Y % Y %Y %fY %A' Z %tZ %#Z %LF1Z %^?Z %=MZ %Z[Z %SiZ %P}Z %7Z %OiZ %=Z %Z %Z %ZZ %7gZ %UZ %L[ %GZ[ %,h[ %v[ %%[ %<[ %%_[ %[ %W[ %Ê[ %ќ[ %R[ %s\ %*%\ %\ %\ %2\ %3\ %\ %zA\ %h\ %\\ %6D\ %  ] %@] %P)] %7] %AE] %1S] %{-b] %vp] %~] %] % ] %^] %N] %X/] %1] %] %] %< ^ %Ak^ %@8^ %CF^ %7T^ %b^ %p^ %~^ %P^ %^ %Ng^ %/^ %{^ %m^ %^ %c^ %N^ %| _ %_ %&'_ %F5_ %!`C_ %Q_ %Aw(` %F>6` %D` %uR` %`` % ` %v` %?` %` %{` %` %Ur:a %Ha % Va %%da %+ra % a %Sa %`a %Ha %a %pa %a %va %-a %w8a %3 b % Kb %(b %6b %VDb %Rb %b %,b %׋b %b %b %&b %b %Pb %b %4b % c %Cc %4'c %`6c %TEc %Rc %_c %blc %ezc %c %#c %śc %\c %c %{@c %#c %]d %)kd %yd %%Gd %sd %H3d %Jd %1d % _f %mf %-f{f %f %^f %f %f %Cf %~f %T{f %f %[Mg %g %$g % d3g %Bg %bQg %1`g %og %~g %Qg %Ng %g&g %>fg %mg %;g %))g %Pg %/h %h %#h %ǡ2h %h %`h %?h %h %dh %h % i %i %#i %sy0i %V>i %>dHi % 'Ri %Kbi %J.pi %~i %6i %^8i %i %ji %i %i %zui %Udi %i %+ j %юj %,&j %h4j %yBj %7 Pj %_^j %)lj %_zj %j %j % j %j %gj %j %j %gk %V7 k %Yk %HW'k %*/4k %;Ak %Nk %Y8[k %ik %^gwk % k %1k %*k %k-k %{k %k %N:k %j@k %mk %KTl %[l %ql %-l %F;l % }Il %<Wl %el %sl %@l %>l %cl %l %l %l %Cl %!l %l %P m %'m %Pr5m %[sDm %fRm %e`m %aInm %m|m %s2m %7m %/]m %'m %y_m %m %m %hm %v&n %r#n %3n %<An %_On %]n %n %A,n %n %zn %n %)n %n %fn %1n %3o %o %bo %2+o %9o %gGo %bUo %co %]qo %o %8o %^o %Zo %%o %mo %o %:o %o %np %"w!p %:p %UvIp %bsSp %gp %Wup %ޛp %Bp %#p %p %Zop %gp %|p %*p %dp %p %-q %9q %!q %|.+q %t8q %#-Eq %%Rq %_q %Zlq %kyq % q %Dq %q %q % q %@q %s2q %dq %Fr %Xr %)r %mp*r %qn7r %!Dr %s ^r %;lr %0$zr %} r %Ir %V~r %Kr %ar %dr %r %r %$+s %{Ss %as %~s %n t %`u %gu %\uv %Jx % y %wy %dy %+gy %hcz % z %z %,z %{ %3f{ %>{ %| %| %g!| %J.| %A;| %H| %U| %.b| %v| %h| %)| %F"| %^| %v| %| %|| % | %]| %̍| %F8 } %v } %<&} %y2} %~ >} %3"L} %_[} %Ag} %qs} %} %E} %} %} %} %} %0} %`l} %v} %2 ~ %~ %A@~ %."M~ %Z~ %~ %o~ %k~ %~ %8  %D2 % O %\ %E| %ٓ %vV %.4 %)# % %% %u %=4 % %). %< %MF %.S %U` % m %z % %) %>& %ko7 %C= %R*C %I %P % l %E| %= % %{ %P %aIҁ %\ % % %~  %} %sW %a %rEz % % %Ă %_т %cނ %)o %Q. % %yI! %. %K %:X %̏e % 5r %1 %/ % %6h % %)=ǃ %G(Ӄ %H %Q %9 %  % %C' %F5 %&XC %Q %a _ % m %{ %, % % %2 %  %̐τ %'݄ %Ž %k %3Y % %:cM %^ %5Gc %si %?`o %u %| %WV % % %<\ %: %e %H %Pȅ %$օ % %( %*9 % % %V.) %57 %qF %WDU %s"d %s %4 %w % %W %ܤ %g͆ % ۆ %P % %0 %n  %^P# %>3 %)^C %FqS %ec %Os %F_ % %T %.F %E1 %y ȇ %և %0 %W %[ %" %B& %6 %F %SV %!f %|}v % % %1 %$ %Ô %Έ %܈ %= % %U %^ % U& %5 %zT %Ia %Az % %P %E1 %/ % %|ȉ % Չ %D) %) %z %  %y %ѥ# %c]0 %J %ނY %]}n %T % % %eƊ %[+Ԋ % % %6 %f=; %'6H %AU %Kb %czo %| % %) % % %ϒ %(ʋ %n׋ % %-G % %  %f %$% %?> %j %Kw %A %a % %+` %:Ō %Ҍ %ߌ % %ϒ %( %n %  %- %a: %S %o %g %A̍ %`ٍ % % % %\  % %+S' %zM4 %DgA %"$ %cΎ %Aێ %a % % %$t& %:7 %= %mC %T %Tyc %i %% %,t % %s(Ə %׏ %wݏ %g %lf % %Z % %߈  %K %9 %k( %6 %D %VR %ғa %Izo %/} %y %eD % %Js %c %? % %!Ő %Dː %>Ґ % % % % %xQ %D  %f % %( %f6 % D %ER %ko %{V % % %J %_ɑ %ӑ %V! %R % %  %CI %' %5 %C %CQ %f` %zn %L`| %& % %5 %W %;Β %Vܒ %A % %F %) % " %0 %> %tL %Z %o0h %$v %* % %t %  %&“ %:ғ %] %b %.) % %" %2 %B %WP %)^ %l %}Xz %} %p %A %E % %Δ %(_ %?{u %ǝ{ % %J %[ %E % %̕ %xڕ %% %4 %~ %}z %ă %6 %oD %<R %Yf %s %o %d %x %T %ؖ %k %ߘ  %$  %u1 %|{7 %2= %1RC %I %[OO %ԑU %[ %\a %gHg %~m %ss %ܝy %V- %\Q %ˈ %#c % %B %L %yڗ %ox % % % %  %3  % %t % %w! %' %:u- %CD %K %b\ %ha %,g %[m %Es %y %. %ȉ % % % % % % %2> %Ս %c %P %mǘ % ͘ %@Ә %G٘ %΢ߘ % %- %  %C %\ %@ %Gc  %: %N % %) %86 %D %R %I` %.n %F| %hv %/Kř %+֙ %ܙ %] %v %LX % % %  %z %=J % %% % +6 %:q< %^B %KwH %,lN %VT %"DZ %` %f %[m %s~ %]_ % %G %k % %@*ƚ %Ӛ %pb % %m" %R3/ %8< %XqI %V %Ec %p %F%} %\ %!" %x %: %Λ %)ܛ % %" % %" %I" %;0 %Ü> % L %4Z %xh %X %$rΜ %Ԝ %%ڜ %H| % % %C %k %a % %.  %z %)O % ! %;|" %:) %kB %O % v] %ǀj % %F %? %^ %^pÝ %Н %yKݝ %( % % %R3 %+u  %5. %6O< %J %.X %f %t %_ %i %w %/ %T %{Ȟ %W֞ %Y % %iL %  %^J %$t* %x8 %ܤH %=X %\u %A % %R %ky % %ɟ %|2ן % %@ %s %* %.9 %9lG %U %8c %Fq %. %j % % %V[ %CƠ %Ԡ %y %~ %m! %Q/ %K= %ϤK %Eh %w % % % % %Aܡ %/D %A %| %;# %" %5= %EK %Y %jg %$tu %` %A % %6 %{ %Qɢ %ע %VA %f %H % %]J %[ %a %=g %om %Ps %y %Q %L %t %GG %o %G %kX %$b %  % %0 %- %Ǥ %nͤ %Ӥ %٤ %+ߤ %X % %O %#1 % % %  %Ӡ % I %v %0! %X' %_ - %(3 %9 %K? %@E %JK %-vQ %;UW %0d] %)c %R0i %Qo % u %c{ % % %U % %Տ %E %p %‘ % %B^ %' %å %_ɥ %!ϥ %8ե %@Lۥ %  % %l % % < %  %X %  % %} %G %Ȃ# %0) % / %:$5 %!0; %hA %G %XM %t+S %RY %_ %3e %k %q %Hw %H} %U %^ %yF %${ %r %M6 %  %R %Y %V %V  %Ŧ %\˦ %3Ѧ %?צ %eݦ % %  % % %. %@O %6 %C[  %l %t, %b  %%. %; %I %cV %c %p %M} % % %x % % %̧ %?0 %B  %R3  %"- %q: %BFG %cT %/a %n %Z){ %! %T %m % %[ % %c %6ƨ %Ө %2 %p %T %*a % %@ %iĩ %]ҩ %Z % %N  %(IP % a %ۀg % m %Us %y % %U % %{ %, %IK %  % %B %pC %t %@« %&xϫ %Z)ܫ %{5 % %3% %Z) %{5 %P, %#A= %C %lI %O %mU %l\ %Fm %Xs %iuy %J %A %^ % % % %. %  %Ԭ %hv % % %co %D+  %. %)E %3VO %r^ %? h %9t %  %MY %N %| %_, %έ %Txح % 2 %i %R %0  % %) %7 %ԛE %xS %Da %5p %Oj %i %~ % %Ю %[ % %\ %g0 %6 %#= %L %1pY %Pf %s %N % % %* %Ofȯ %p %Y %P %  % % % %U2 %(? %>L %Urd %p %z % ] % %K % %J %! %) % %~ %H %bȰ % % %R  %E %% %2 %O? %"L %Y %g %t % %) %W %O %"ϱ %ܱ %' %l %(v %< %,I %ˣW %oq % %U %5r %T %EͲ %hڲ %P %x % %S4 % %g&- %_j %w %2 %; % %o % Fͳ %c>۳ %y % %c> %N %, %8: %H %fW %q %~ % %C~ %bƴ %JӴ %V %9 %`A %? %+ %! %5. %; %@H %rU %Xb %o %| % %zy %r %k %g %oFʵ %~׵ %59 %A %~; %F  % %% %2 %Y? %L %gY %.f %7t %Q %  %8, % %:  %H %P %' %^- %73 %L9 %(]? %LE %sK %Q %qIX %jPe %P % %6 %x % %yͷ %0~ڷ %2 %S %>  %nz! %ȅ/ %#'= %K %Y %ig %zu % % %  %K %' %zɸ %Sظ %P % %V%' %G2 %T = %6H %VS %P^ %i %t % % %u % %;ɹ %չ޹ % %C %w`)  %>2, %g#G %xm %  %} %}ۺ %B %S %H1 %gf % %i %f %jZ %ջ %H %  %D% %8 %vJK %c % %-P %eټ %Nb %n %K( %ZD %f_ %{ % %PϽ %jP۽ '#߽ '# %S '# '# ( '$ '$$ '$( '$1 '$5 '$>Gb '7$f '5$o 'F$s 'D$| 'W$ 'U$v˾Ծ ( 'f$ 'd$ 'w$ 's$ (&/ (? '$C '$L '$P '$U (b ( '$ '$ '$ '$ '$ '$ʿ (ٿ '$ݿ '$ '$ '$ ( '% '%/DQi,v3?M % (8 %jP '% '% % ']% 'O%  '% '%  '&$ '&3 ' '7 '&< % F 'F'J 'B'O %SY 'g'] '_'b % {u %{ %+ %E %- %Hv  % %ld %L`& % %L"&+ %8G %LT&] %jy %L ' % %L`' % %L' % %L'% %2A %LN (W %ds %L`( % %L( % %L( %  %L ) %,:C (OS ''W ''` ''d ''m ''q ''z ''~ ''1GG '' '' '( '( '9( '3( '|( 'v( '( '(#,I '(M '(Smv '( '( '( '( '( '( ') ') ( E ')I ')N[m_v (_ '&) '$) (o '5) '3) 'F) 'D)"*<gQy4AQ>kuVz+C(5BWg| #->EZd&;EZm_xX 00 %Z:@Y 'Y)] 'U)b %Sl 'v)p 'p)~ ') ') %y ') ')WW ') ') ') ')nnn, ')0 ')9 ')= ')FnOnh '*l '*u '*y '*~||| '&* '$*W %7oP( %y2 '7*6 '3*D 'R*H 'N*M %jPW 'm*[ 'i*dYmY '* '*h % %y %K< %y % ( '* '* %y '* '* %jP# '+' '*, %H6 '>+: '6+Y 'y+] 'k+b % {p %L|% %0 %L@% %( %L% %  ( '+ '+  () '+- '+6;?;\ '+` '+i;r; ', ', ', ', '&, '$,;; '6, '4, 'H, 'F, 'Y, 'W,;; 'i,  'g,) '{,- 'y,6 ',: ',C ',G ',P;Y;v ',z ',;; ', ',II ', ', ', ', '- ',II '-# ' -, '!-0 '-9 '5-= '3-FI` 'D-d 'B-m 'X-q 'V-z 'g-~ 'e-I 'v- 't- ( '- '- '- '- ($&`/`J '-N '-Sk`sr{{ ( '- '-{ (( '- '- '- '-% '-) '-6T]x '-| '-94d p E5?\Pp %z '. '. %y '". '. %jP '=. '9. % { %L& %8) %:Z< %yH %jPU % {_%j %!x % %l %3@ %jP '^. 'T. '. '. '. '.I () '.- '.6 '.: '.? (H '/L '/Qfix % %jP %y % %jP ')/ '/ 'X/  'R/ %A '}/ 'q/" %<, '/0 '/5 %y? '/C '/LU (d '#0h '0q ';0u '70z ( 'Q0 'O04 % %jP! %L %&g % % 8 %* %[j % %4 %/ %S) %: %G %SU %f %rs %aI %* %  %  %E % %B  %Z %ԅ3 %[ % %` %5 % %( %j % %S %  %- %e> %K %w %\ % %=+ %.HM %\ % % % % %@ %@ %@ %@  %b ' %LE %;\ %aIn % %l % % %aI % % %aI -H 'b0L '^0U '}0Y 'y0f '0 '0 '0 '0 '0 '0*3K '0O '0X '1\ '1fv '-1 ')1 'H1 'D1 'a1 '_1!2?Pk 'y1o 'o1x '1| '1 '1 '1 ( '1 '1 '2 '2 ( '-2 '+2# %0& %0&( "- %H2 &a6 &::J #>Q %r %~ % % %EU % %l % %D %n % %γ % %(  %h %+" %w? % % %& %VX % %V % % %>5 %S % %l %)C %* %Z= %D %AaI %}U %;a %+m %*y %E %C %" %*@ %¶ %yd %h5 %3 % %z\ %H- %  % %R! %V- %49 %)E %Q %8f %<t %D %< %a %^ %( %R % %7 % %( %4- %Я: %(G %{ %: %^g % %' % %( %_+ %7 %KI %A.\ %j %b,v %~ %3 % % %( % % %/ %H %} %X %7 %! %? %#M %'] %w`k %7y %4 %_ %X %7 %i %M %-B % %LR %|( %hD %d! %./ %mU= %K %Y %c %l* % % %  %R %; %0! %  %ŧ %* %9 %H %.WW %f %u % % %X % % %} %/ %+ %e %  %Y %A) %U8 %JG %V %&e %v*t % % % %>  %= %U %  %4 %Y  %N5 % ( % % %p % %U %e %! %  %  %' %6 %#E %<@T %Z,c %r % %L % % % ; % %[ %pf %Bh %~  %& %ϫ5 %(D %79S %b %fq %W %, %_6 %^g % % % %d %O %G %# %Z% %I4 %CC %R %%a %A]p % %  % %) %1" % % %^ %7 %h % %8$ %c 3 %#B %iQ %5` %o %Q~ % %a %A %/ % % %3 %q %^ %Q2 % # %u2 %!A %$P %#_ %$Pn %} %+ %c % % %p % %? %7 %  %< %J" % 2 %?A %RP %>A_ %n %} % P % % % % %/ %8 %~] % %' %Fc# %F2 %A %P %_ %]n %,} %[ % %J %3 %V % %b %U %Q0 %K %" %@1 %y@ %O %ԩ^ %m %HO| %9 %  %b %* % % %& %TP %h %L" %m1 %a@ %O %3A^ %Km %;M} % %#= %K % %I  % %- %c % %- % ; %?I %dW %se %>s % %i %( %g %Rc %7 %: % %= %d %A  %d %:, %: %ϩH % V %,'d % r %8 %% % %! %V %P % %&V %1% %2 %T %- %2< %K %@Z %,i %x %A % % %_ %Ee %9 %R %p %9 % %x- %& < %K %Z %i %x %R %KZ % %/  %e % %xD %: % % %+ %lh, %.; %J %`Y %;$h %w %~ % %w % %Y %5 %J %k % %;  %T %M+ %ո@ %Lv %X %+ %S % %O % %4. %L[ %Xh %/ %&N %7n % { % % % % % %& %2 %0K> %J %kV %My %< %A % % % % %g' %<0 %= %7W %d %!${ % %}6 %( % %P %90 % %Z %:V  %x"' %ND %Q %^ %P<k %Oy %E % % %; %i % % % %+)! %7/ %= %!Y %@g %6u %4 %\ %ջ %) %M %. % %g %e# %: %&^ %Ss % %I % %. % %$ %2 %a % % %b %$" %?0 %K> %a:L %MZ %μn %!{ %Z] %o % % %K %ݥ % %1 %d %  %- %: %_G %T %Oa %p % %7 %4 %> % %$ % %! % % %6 %< % ! %E9 %QF %S %-` %m % % %7 % %IV %i %0  %/ %˧' %/5 %EC %SQ %_ %nm %{ % %3 % %zc %" %; % % % % % %\# %1T1 % ? %M %'X[ %YQi %w % %=d %I % %' % % % %ݥ %7  %0  %B 7  %C  %cO  %\  %ek  %Rx  %  %  %}  %  %  %  %  %  %D#  %Q(  %A7  %ŬF  %U  %d  %*s  %*  %*  %  %ec  %s  %_  %=  %rL  %_d  %  %R  %'  %Q(6  %E  %(T  %jZd  %s  %^e  %  %   %  %  %  %7  %   %  %[  %X  %(  %7  %!G  %[JT  % a  %}n  %&{  %  %  %w   %  %"  %ح  %MK  %X  %X  %| %c %ef %ѷs % % %h %@6 %8 %E %OR %N_ %il % % % %Գ % %&! % %# %+ %CW: %~I %h %x %. %  % %# %6 %e % % %&! %# %i3 %FC %xS %*c %os %7 %\ %; %K %1 %YW %e %l %l % %K% %2 % ? %m %:z % %a %( %g % %4  %) %Z  %í& %6 %3P %7] %Qj %GRw % % %  %[ %/ %K^ % %/ %K^ %R %/ %F %[S %P` %+8m %/z %K^ % %o %]' % %* %e %w` %7  %9- %XH %U %b %o %V| %7 % %( %  %I0 %e % % % %I$ %>* %a0 %E7 %@< %&?I %W %@a %An %b| %z %' %s9 % %a % %  % %i  %$ %$2 %? %mUL %FY %g %t %7 %< %B %5 % %d %5 %k` %S % %  % %5( %Y9 %? %KF %$S %a %Vn %_{ %  % %) %> % %u % % %R %$ %II1 %p]> %Q %*S^ %]k %x %_ %7 %Z %c % V %3 % %e %H8 %@i' %l5 %A %4N %_[ %i %[v % %B %GR % % %p % % %+ %0 %< %M %PZ %?f %2s % %' % % %M %[ %< %' % %[ %'( %5 %tB %aO %ZLf %s %@ % %n % % %D %D %`5 % % % %V 2 %-UO %ss %5 %N %A4 %  %V %u %  % %ȷ % %1V %  %L- %<; %O %[ %kh % %B %f %4 %a %ϩ % %z % %E  %c %% %? %&L %JY %s %) %r %g % % % % %ʾ % %ȶ %E  %\  %  %-  %8*:  % +G  %GT  %a  %[o  %%|  %{  %c  %  %@  %t  %P  %  %H  %! %! % P! %,! %69! %F! %7S! %Ŭ`! %! %R! %! %! %~! %R! %! %Q&! %R! %" %R" %#" %DGF" %ei" %Mu" %e" %p" %" %" %" %Z" %O" %N" %E" %P" %!" %R" %!# %$# %p2# %@# %UO# %U]# %Sak# %y# %]F# %t7# %e# %"# %U# %0,# %# %> # %# %R$ %$ %X#$ %N$1$ %&?$ %bN$ %<^$ %al$ %uz$ %$ %$ %g$ %!$ %0@$ %$ %#$ %<$ %e$ %% % % %t"% %U\0% %>% %d-L% % Z% %h% %xv% %R% %5_% %5% %% %% %p% %% %4% %֮% %& %& %v"& %'#0& % >& %nL& %VZ& %.h& %7v& %- & %& %%& %& %& %& %& %& %f& % \' %' %z' %,,' %O' %zY' %Cg' %u' %' % ' %' %.' %M' %' %i' %;( %( % ( %.( %<( %J( %#X( %f( %'#t( %7( %`( %( %g( %( %l*( %) %-) %;) %I) %X) %) %) %") %a`) %II) %) %W) %) %%* %-i* %25* %fC* %(W* % _* %n* % * %/* %,* %.* %* %cP* %^* %Q* %Z8* % + %+ %u(+ %t6+ %7D+ %R+ %`+ %Hn+ %yN|+ %8+ %B+ %+ %+ %A+ % + %6+ %7, %35, %XB, %=O, %9b, %o, %X, %NB, %A`, %9, %Y, %#, %I, %, %, % - %- %%- %a2- %?- %0L- %Y- %Jf- %rs- %h- %_- %7- %k- %dK- %X- %%- %6 . %_. %h-. %97T. %la. %?(n. %h{. %. %7. %1. %[. %R. %F. %d. %79. %B. %Gf/ %w/ %_/ % -+/ %Z<8/ %cE/ %R/ %e/ %s/ %s1/ %/ % / %/ %/ %N/ %/ %J / %/ %"/ %0 % 0 %kV0 %7)0 %60 %lE0 %T0 %a0 %sJn0 %{0 %00 %c0 %0 %0 %I0 %0 %`0 %R1 % 1 %j 1 %p.1 %<1 %TJ1 %sX1 %Uf1 %<t1 %e1 % 1 %1 %,\1 %Ū1 %<@1 %Z,1 %Ǻ1 %!1 %2 %T2 %2 %Z *2 %"82 %F2 %c T2 %b2 %8bp2 %~2 %ŧ2 %M2 %"2 %<2 %[2 %2 %^2 %b12 %3 %(3 %X3 %B)3 %t63 %CI3 %OS3 %NY]3 %k3 %My3 %'3 %+3 %^3 %3 % 3 %73 %3 %%K3 %x3 %4 %C4 %`4 %55,4 %=?4 %hN4 %( \4 %i4 %v4 %*g4 %4 %(4 % 4 %_4 %]4 %^4 %D4 % 4 %25 %b5 % 5 %W/5 %@>>5 %]cM5 %B\5 %Dk5 %$z5 %8d5 %Я5 %5 %5 %ϩ5 %g5 % 5 %6 % 6 %6 %?46 %>6 % X6 %6 %l6 %U16 %6 %L6 %6 %Ľ6 %H6 %h6 %:7 %F27 %#7 %3g17 % ?7 %M7 %T[7 %i7 %W=w7 %f7 %7 %}7 %7 %'7 %˸7 %L7 %7 %7 %@ 8 %8 %+8 %;88 %x[E8 %X_8 %+i8 %xv8 %8 % \8 %8 %8 %R8 % 8 %8 %: 8 %pC8 %c8 %a9 %c 9 %-9 %:9 %G9 %ĹT9 %a9 %JEn9 %{9 %c9 %D 9 %)9 %]9 %W9 %R@9 %09 %9 %Y9 %-: %P4: %: %d): %2=6: %R: %WC_: %il: %7z: %: %(: %4: % G: %D: %7: %b: %: %]: %\.; %;; %H; %MV; %b; %o; %; %tE; %6; %; % ; %l; %; %; %B; %i< %#< %$1< %>< %K< %X< %Me< %>r< %< %< %K< %< %V< %/< %K^< %\< %< %`< %mU= %,$= %KH= %Y*= %9= %kSF= % `= %Rm= %vz= %Z= %f]= %jW= %= %= %-= %I= %/> %c> %=> %\J> %`W> %]d> %r> %0 > %H> %m> %(]> %> %H> %^? %M? %? %8? % E? %7? %.? %C? % ? %8^? %? %N? %? %,? %? %@ %H@ %l$@ %D2@ %Gm@ %kz@ %@ %"`@ %W@ %,@ %~@ %@ %@ %_@ %vIA %A % "A %<[/A %C %3KC %'1XC %0aoC %BV|C %'1C % )C %'1C %4C %LC % C %@D %UD %D %,D %J9D %GD %[XD %i^D %dD %jD %tqD %D %D@D %5D %8D %aD %\D %D %vID %D %D %D %E %qE %S8E %kEE %\RE %_E %_lE %SyE %dE %E %(E %OE %^E %/E % F %X9F %X9!F %а.F %;F %BHF %ϩUF %lF %yF %LF %?F %7F %F %F %oKF %:F %>*F %WF %սG %oKG %` G %:G %GG %ԨTG %TaG %nG %c{G %7G %:3G %wG %G %7G %BG %3G %$G %'G %iG %=H %:*H %V67H %G_H %sQkH %~H %H %*H %H %bH %H %H %I %OI %/'I %S>I %KI %aLYI %fI %I %=I %I %7I %, I %iI %3fJ %ЯJ %&J %LJ %cJ %V6qJ %GJ %bJ %J %7J %J %K %K %K %!$V %FLV %[V %^mV %V %7V %V %V % V %L W %5W %W %k%W %W!W %6'W %-W %: 3W %9W %8@W % ^GW %INW %>UW %M]W %jW %*wW %)W %W %MW %&W %3W %"DW %W %W %/W % X % X %ۧ X %1X % X %~ X %e1X %7X % =X %CX %IX %T)OX %+UX %][X %aX %agX %mX %8<sX %/.yX %MJX %4EX %X %X %>X %"X %HX %X %X %X %X %X %8&X %sX %aX %wX %TX %X %>X %X %4Y %Y Y %Y %-Y %3Y %z!Y %'Y %-Y %03Y %9Y %X?Y %EY %NKY %QY %EWY %]Y %-cY %2)iY %UoY %uY %~{Y %^Y %x5Y %u^Y %Y %CY %Y %Y %Y %a9Y %`Y %EY %1Y % Y %MY %Y %t6Y %9HY %.Y %Y %QY %IZ %Ȼ Z %Z %(Z %V6Z %5DZ %%RZ %;aZ %pZ %wZ %Z %|Z %5SZ %:VZ %ϩo[ %I][ %M[ %'[ %z1[ %ŧ[ %f[ %g\ %Y"\ %;0\ %4>\ %L\ %Z\ %#i\ %gw\ %t\\ %h\ %(\ %c\ %\ %[\ %7\ %S\ %\ %] %MF] %rgb] %+p] %F~] %] %g;] %] %B] % ] %@0] %) ^ %r5^ %7%^ %3^ %@A^ %O^ %t\n^ %`|^ %f^ %^ %Q^ %J^ %^ %5_ %_ %_ %_ %%_ %+_ %1_ %68_ %?,H_ % V_ %5d_ %r_ %D_ %_ %_ %ͭ_ %X_ %f _ %_ %_ %_ %z_ % ` %<` %_X(` %6` %D` % R` %,Q`` %n` %|` %jZ` %3` %S` %7` %` %[` %` %` %a %Fa %#a %2a %Aa %Pa %& _a %na %\~a %a %Qa %a %?,b %c^b %,%b %HDb %KRb %)3`b %I.nb %Ub}b %ޯb %b %'b %9b %I&b %c %"c %I/c %e %7Ke %cje %rUwe %Oe %+e %zce %e %De %e %zce %;f %cf % f %B.f %g %Kg %mXg %qg %~g %Kg %bg %g %Kg %Ug %rUg %g %tg %Kh %ϩh %. h %;.h %v>h %Nh %,i %Fmi %p!~i % i %i %4i %hi %i %2Gi %i %Чi %F`i %Mj %$j % 1j %>j %cKj %[Xj %qej %rj %\*j %:j %j %j %j %u;j %k %Rk %[k %_(k %5k %;!Bk %^Ok %'\k %ik %wk %1k % k %ck %k %k %k %k %k %bk %|l %˧l %W#l %/1l %?l %/Ml %l %Ml % l %]l %l %pl %l %l %m %>Tm %,m %r;m %BJn %*OXn %gfn %gn %pn %ϩn %n %n %No %so %;o %*O)o %6o %"Co %/Po %+o %9o % ]o %5;p % p %C`p %mp %3zp % p %q %q %(q %e+q %68q %Eq %7Sq %nq %{q %q %q %Tq %q %q %[q %7q %0q %/r %r %6r %/Dr %`r %nr %N|r % r %r % r %6r %r %jFr %0Xr %s %ks %Ws %D-s %v %9Lv %Zv %hv %Bvv %!v %Lv %v %v %v %Lv %D'v %fv %hv %w %Uw %cw %S,w %a:w %"Hw %bVw %w % Tw %w %:w %)w %Pw %w %# w %Jw %w %T%w %lw %-w %hw % x %x %%x %g3x %Ax %ciPx %FZx %jx % xx %?9x % x %x %hx %$x %Qx %^fx %YVx %hx %Ney %y %*y %]8y %XFy %(Ty %Kdy %ty %'y %8y %BXy %y %1(y %^hy %Hy %y %y %K z %z %'z %wU7z %$Gz %Wz %u gz %bwz %fz %az %z %9z %z %]Hz %Jz %z %pY{ %{ %a{ %٬+{ %:{ %eI{ %`X{ %g{ %v{ %B{ %{ % { %]{ %{ %{ %m{ %^h{ %C | % | %#| %_0| % A=| %AQJ| % AW| %xid| %c&q| %V| %II| %ID| %| %0| %| %} %} %h#} %W1} %U?} %j|} %} % } %Z} %A} %߰} %_} %} %} %V} %W} %e ~ %~ %[%~ %2~ %9?~ %L~ %/Y~ %(f~ % ~ %W~ %O~ % ~ %i~ %~ %(~ %W %K %N[  %V- %W: %eG %T %9a %n %){ %߰ % %/ %  %=N %߰, %I9 %F %%S %J` %*m %z %/ %+ %D, % ! %). %; %H %; %8 % %Zρ %`܁ %] %c %8 % %  %0 %= %KJ %9b %lo %} %~ %KM % %8 %ӂ % % %6 % %# %0 %L= %BJ %9} %0 %H %9K %k % %d %%҃ %CL߃ % %  %~ % %  % %!C %Ȅ %Մ %!C %a %  %[ %%! %- %D %VQ %D^ %˲k % %s< %B %Ӆ % ߅ %I %I %-J % %_ %, %F %T %ab %Wp %~ %b %` %R* %Ɔ %7Ԇ %i %( %4 % %B2 %E %c % % %O % ȇ %ԇ % %P %0` %Q= % # %ͪ0 %i= %qJ %W %$d %q %q~ % %A %m6 % % ƈ %|ӈ %. %x  %S8 %% %3 %o A %O %] %4k %:y % % %_ %Ÿ % ʼn %Ӊ %H %5 %V %  %( %' %5 %C %PiQ %"_ %m %{ % %` %  %9 % %*ϊ %݊ %F % %k( %S^ %% %I< %<K %Z %i %%x %F %uB %9 %> %1ҋ %F %: % % %"3 %?@ %eAM %%Z %qg %\t %  % % %u %z3 %Œ %(ό %W܌ %P %- %d% %  %_. %< %0J %iYX %f % t %D % %# %A %x %ȍ %x&֍ %PA %c %^ %) %d %* %8 %F %T %b %:p %~ %F % % %6 %A %F)Ȏ %%׎ %- %e %b$ % %# %52 %A %#<P % _ %4n %} %uR %"> %t % %Pȏ %*׏ %: %E %i % %" %C<1 %P %_ % Cn %} %+ %$U % %- %]ѐ %א %G % %Ǒ %ԑ %,1 % %" % q %~ % %eŒ %Ғ %E %p %^ %u ( %F5 %x[C %P %5L] %j %r5w % %7 % %= %:Ɠ %ϩߓ % %  % %< %/I %ϩV %`c %q %  %` % %$  % %" %B\( %i>/ %H9 %QF %=S %` %` %! % %7 % %}.˕ %<ٕ %6Z %% % %; %[ %; %׶J %Y %h %Ww % %3R %N % %%– %і % %, %l^ %`  % %+ %; %J %TY %h %ew % %" %_ %ї %H % %P % % %+ %S9 %0C %IO % 2[ %7v %X %7 %\ %MΘ %.ۘ % % %  %J %* %xP7 %C %`e %0 %#f %Př %Yۙ %  %K3 %s  % J  %- %W3: %G % T %Jk %SH % % % %O˚ %lښ %. % % % % %X5 %BB %'O %T>] %dKj %Xw %U %ۛ %5X % %h %~ %e %X) %6 %D % Q %^ %(l %y %p % % % %_ %ɜ %/֜ %( % %  %{ %xC %iM % g %޳u %% %h % %~ %a %ĝ %ѝ %ޝ %> %; %5: % %Nd %- %: %H %#U %3b %_o %| %A %e %X % % %,˞ %H؞ %=  %`S % %  %[ %O& %G3 %A %[O % ] %k %'y % %J % % %F %͟ %5>۟ %)9 %- %4[ %  %%" %h 0 %[> %L %fZ %n %"x % %/ %n %H %f %Ǡ %1֠ % %g %s  % %& %Tr %K~ %N %t % %4 %Ρ %P %7 % %> %a %G m % % %K %` %v %Bˢ %;آ % %Ǵ %E< %#H %Y %-6_ %6e %=k %dIq %Ӧw %"_ %; % % %% %:,ȣ %; %< %A  %& %S/ %6J; %H %OU %Hb %X5{ % %' % %y8 %?Ƥ %Ԥ %Y % %C %3e  % %( %A6 %D %R % ` %#n %} % _ %L %  %Yå %yHɥ % Х % %.  %  %+ %m8 %իE %OgR %;_ %%l % y %  % %; %ZI % %Ȧ %Z_զ % %  %> %#  %P %H_# %1 %'? %0M %h[ % i %jT} %< %1 % %U %]ç %#ѧ %}/ߧ %n %L %Z %h %v %' %I % %+Z %X! %APʨ %`ب % %s %? %U % % %5 %ǩ %r թ %0 %MW % %TS  %  %) %7 % E %S %b %Hp %7~ %3 %#T %t' %{ %Ī % %R % %s  %`3 %8 %ZF %iT %b %p %~Q~ % %cQ %/ % %Bū %oӫ % %#, %p %C  %R %' %W5 %(C %UQ %>( %3 6 %7D %޺R %ϫ` % %g=ŭ % ӭ %z %'B % %9: %HH %)V %=bd %1r %  % %) %a %sP %78Ʈ %Ԯ %^> %F % %   %_ %( %P6 % D % R %O % %MQ % %W %N %Oͯ %ܯ % % %  %׷ %?' %R6 %E %cR %ϩ_ %*l %z %L %x %_ %% %Ͱ %n ۰ % %A] %k %Ky % %:; % % %̱ͬ %fd %r %. %7 %mU %ϩ %Ƴ %*eԳ % %hB % %  % %) %,8 %VG %V %#e %\t %" %H % %l %. %0hδ %ݴ % % %-  %Ҳ %O( %e7 % %) %  % %HԵ % %_ % %ν( %@5 %w C %,M %W %g %u %/ %V % % %O %ɶ %׶ %< %, %߻ % %S %t+ %I9 %@G %U %c %<q %` %V % % %R %Ǯз %\Z % %b/ % %" % , %}9 %F %a S %` %~[n %/| % % % % %Z¸ %Fи %޸ %]  % % %$ %Uh$ %G2 %;@ %CN %\ %]j %x %' % %, %mX %Ĺ %ι %Eع %" %K % %, %9: %:I %o.W %e %s %5 % %2 %/& %hú %d(ۺ %fg %s) % %{ %y9( %T8 %GF %T %b %׺ % %W % %_ %`λ %ܻ %. % %Y %V %y+" %f0 %> %/L %DMZ %^Yh %&v % % %? %# % %ʼ %ؼ % %] % %v>& %ժ? %=N %:X %Rl %c!z %` %\T % %NG %7 %0Ƚ %Cս %P %, %( %  %. %# %0 %<= %J %W %d %#q %~ %W % %' %qƾ %Ծ %N % %P- %; %>" %" %7/ %H6< %PI %-c %q %9 %7 %6 %+E %Zſ %iӿ %'- % % %) %Bh %yv % %6" %& % %u % %i %=? %Y- %q/  %+ %" %1( %Q` %  %. %  %J %) %b6 %iC % P %] %j %>w %a % %O % %' % %o %6 %N %_V % S % %8, %; %@G %@S %qa %(p % | %9 % % %\ % %b %[ % %G4 % %! %. % U %lb %o %7 %6 %] %g %c  %]G %d %fq % %X %B  %N %W % %$ %= %] %* %~C %qZQ %[ %h %u %g %g %&I %E %; %,7L %OR %X %^ %Ae % % % %  % % % %[ %/Y % %` %F3 %l %Ev % %pF %}= %W %!b %5 % % E %  %  % %`1 %J % d %9| %|@ %1 % %; % %( % %> %J/  %. % %o) %F/ %N5 %/; %wB %3P %!^ %Ol % z %X %XA %D %` % % %: %B %x  %c % %E %  %R  %/ %ܱ %0 %X/ %I5 %#/; %B %FP %^ %Gl %z %3 %G  %n_ %| % %( % %   %) %% %2 %>? %P?L %Y %f %ys %D %` % % %! %O %7 % % %) %`2U %Jh[ %J9a %g#g %m %bs %y % % %D %g %=D %. % % % %  % % %  %?S %$ %Y1 %L> %K %X %!+e %r %! % %%^ % % % %- %Y % % %  %% %"8 %YE %R %_ %x& %l37 %= %gC %I %&P %} %E % %rA % %a< %+ %% %E %{ % %;F %( %5 %GB %FZ %Cf %r % %  %F % % %S % %  %P %, %8  % %b( %6 %(D %{)R %` %˧n %/| %Hb %9 %z % %y % % %T %ʦ %= %L %e_$ %j)2 %@ %N % \ %4j %x % %a %}, %: %) % h %t % % %\M  % %L( %I7 %qF %U %Dd %Եs %T %_ %,Dm % { %{ % %) %# % % %; % % % %  %. %w< %;J %:/Y %Ag % )u %{ % % %QL % % %  % %F %  %Y %) %h\7 %E %TS %a %&ao %} %G %\ % % %C %& %¯ % %߾  % %M+ %PI; %QLI %7W %e %"s %z %7 %  % %f %,d %X %SB~ %a %b %vS %$ % %A % %B % %1 % %A %VO$ %? %7M %k[ %Ego %V| %7 %<- %B %| %F %3 %9] %4) %(: %B@ %EF %5L %R %UX %V^ %&d %%j %p %Bv %P;| %a % %< %N %+ % %Y  %& %@ %? %C % %6 %  %5a %Z %{; %S$ %?* %0 %<6 %M %2T %H+e %61j %p %mv %| %=J % %eO % %% %? %(c %G %H %  %S %I % %T % %  %E %f %_[ % % %  % %}   %+ % %& %% %2 %Y? %M %7[ %&Ni %hw %; %= % %i %U %& % %! %N % %E %A %! %1' %R. %? %8E %&K %>Q %#4W % ] %c %i %-Ho %$v %k: %H( %c % % %  % % %* %6Y %JN+ %8 %:VE %8R %-G_ %wl %Vy %[ %'% %_ %Z? % % % %D % %g %{_ %+M+ % 9 %`G %YU %c %\q %f %9 %T % %GC % %h % %4 %(* %  % %B %# %C% %:C+ %2 %3K %X %p=f %hGs %! %; %y %' %A; %7 % % % %OF % %<) %e7 %0E %ɨS %Ea %ϱo %} %~ %2 % % % % % % % %  %g %% %;3 %FA %hQ %a %%~ %  %re % %@ %b %K % %Xi  %  %% %3 % B %04P %^ %l %Tz %M %2 % % %n$ % % %1 % %`* %8 %#F %hT %Qq %@ % %& %7 %] %  % %  %b %i %7+ %F %T %sb %zcp %;~ %) %  %c % %B % %V %L  %/ %  %  %AS %d %rj %Vp %7v %| %X % % %(< % %T7 %O %! %* %) %u %@ %u % %6 % %J %$ %O %g % %o %* %  %W %d % %$ %* %0 %6 %l< %^NB %BH %hN %PT %=Z %` %,f %#Ll %r %x %~ %P, %{M %w %  %L %T %< %b8 %V %/ %5' %5 % % % %t % % % %4 %~ %| %a %K" % % %G  %& %3I, %2 %U8 %C> %^D %1J %xfP %ZaV %\ %Jb %h %MTn %;t %ҿz %V %@ %q % %" %8B %H: %+ % %/N %S# %\  % %" % % %  %U. % %i % %? % %:  %` %[$ % %" %g+) %27 %XD %jZR %_ %Zl % y %, %] %V %F? % % %[ %| %  %) %h6 %NXC %P %p,] %j %\w % %] %H %5 %J %$ %c %, % % %; %7 %d] %Aj %T %w  %^ %& %# %X % %Y %ej %|Gp %Ev %| %!R %Nf %T % %U %O % %3 %d %\ %) %  %  %j? % %^ % %H  % %^' %5 % F %jNL %t4R %X %5^ %5e %v %rT| %< %ob %z  %' %= % % %j %b %c %= % %; %7 %) %7 %RN %X %g %q %} % %" % %zK % %M %? %X %$2 % %G %I$ %2 %*@ % `N %\ %yj %y %2 %:2 %+ % % % %yW  %%( %_09 %? %F %"7U %7b %o %F| % %a % % %. %8 %0# % % %$! %. %; %H %U %9m % y % % & %d % %U %eb %jZp %g} %[ % %HW % %> %e % %  %=! %ϩD %Q %g_ %F7y %`R % %9 %l %W %t0 % %B %7  %s %ϩ' %l5 %(r %4O %4 %1 %AY %j7 % %P  %1 % %P  % %* %Y^8 %PF %/U %o %M| %C %E %f % % % %V  %!M %R % %P, %9 % F %9S %!` %Bm %kHz %  %@ %: %3 %h % %D % %  % %  %Z %2# %0 %~b= %J %Y/W %d %r % %f % % %  %HK %VK %m %4P/ %m'5 %+; %A %(&G %M %{:S %кY %` %Wm %  % % %? % %[ %E % %  % %A) %K7 %E %RS %Na %1o %A} %y] % % % %w %|V %X %   %$ %@ %)L %Y % f %<s %" %( % %]. %k %W %[ %Z  Z( %4OD4M %KY@Di, % @, %^ % 0 %ma %1&H 'J2L 'F2R %[\ 'a2 'Y2 %I) %W '2 '}2 %I '2 '2 %Z '2 '2 ($) [8), ZI "7N %S &!W &![@)k #Er %x %  %3p % % % %/ %u %l %? % %v  %  %*y,  %1  %,?  %  %h  %  %  %   %  %Ky  %  %\  %  %  %m'  %&3  %?  %tK  % ^  %ne  %j  %%v  %1  %i  %  %&  %#  %pq  %6  %y  %  %H  %  %p  %  %  %*  %6  %B  %= N  %>Z  %kf  %$r  %ys  %G  %.  %G  %`  %  %  %  %  %_  %  %&  %N  %s[  %h  %  %ć  %  %L  %  %  %T  %  %"  %T@  %N  %\  %j  %΀x  %k  %-  %  %  %  %  %  %  %  % %} %>  %. %= %M %;k[ %7mi %w % % %  %1 % %# %X  % % %  %! %0 %ۥ? %%N %] %ql %{ % % %S %~ % %  %Z % % %<! %ڇ0 % u? % N %] %|l %ۉ{ %_l %( %  %  % %l %0 % % % %E  %m/ %> %M %\ %Ak %Qz % % % %0 %j % %l  % % %q % %. %= %L %{\ % %J  % %  %+ %  %} %J %w %J  %ͶK %j %| %0 % %! %' %+ %3 %-B %{N %Z %f %r % % % %[ %[ %Tq %- %: %L %אY %|s %څ % %+ %X % %= % % %1j %  % ! %f> %7[ %.h %u % %6 %X %+ %X %w %A %J %Խ % %  %| %͌- %w; % I %GW %`e %s % % %4 %  %ԧ %  % % % %. %= %L %|[ %Ej %y %Wk %1 % %ξ %  % % % % %  %` %. %l= %L %D[ %j %"zy %q %q %f  % % %Y % %* % %ܐ %G %G- % < %KK %Z %_ x %. % %B %= %= % %f % % %L %;  %M0 %@ %P % ` %p %] %h %J %k %T % %q %  %t % %- %< %}K %xnZ %"i %x % ~ % % % % %n %k % %l %Vv %& %, %9; %J %fY %h %mw % % %i %n %H %5 %v %F % %H %8 %, %t; %J %fY %h %nw %߯ %o % % %X %6 % % %:  %2  %*  %9  % H  %W  %f  %6u  %  %   %  %W  %  %j  %1  %h  %  %ҩ ! %! %2)! %|8! %ڡG! %RV! %e! %it! %! %H! %! %J! %! %x! %! %! %! % " %" %(" %7" %F" %2U" %d" %s" %t" %" %r" %," %" %{" %M" %" %J" % # %T# %v|'# %A6# %.E# %T# %/c# %Vr# %# %9# %# %;{# %# %I# %v# %t# %3# % $ %$ %W'$ %i6$ %E$ %T$ %nc$ %s$ %&$ %u$ %%$ %x$ %%$ %h$ %$ %$ %$ % % %% %'% %6% %pE% %%T% %6c% %r% %c% %u% %% % % %% %& %& % & %Hk& %k ' %' %ю*' %9' %H' %.X' %sg' % }' %' %' %T' %5t' %' %' %( %( %2( %@( %N( %'\( %j( %e~z( %sn( %_( %F( %\( %'( %o( %ϭ) %7) %L) %Z) %n) %V|) %) %Q) %վ) %) %k) %) %Ǡ) %) %) % * %* %%* %>3* %LP* %n]* %2t* %* %* %* %* %y* % + %?+ %1+ %.?+ %=K+ %X+ %Je+ %nx+ %m+ %+ %W+ %V+ %+ %w+ %+ %+ %Ǽ+ %+ %+ %| , %, %Q4, %B, %rP, %i^, %ql, %j, %, %ı, %4, %), %, %<, %, %e, %, %|- %)- %3/- %Ο5- %;- %B- %O- %ii- %5v- %- %- %B- %0|- %- %8- %b- %ɑ- %. %#. %|J. %]. % k. %y. % . %. %]k. %2z. %. %e. %. %>. %$x. %|/ %/ %$!/ %// %=/ %K/ %Y/ %¸g/ %u/ %/ %o/ %/ %/ %/ %G/ % / %f/ %/ %/0 %0 %0 %h+0 %ę@0 %1}M0 %رZ0 %5vg0 %it0 %|0 %0 %0 %+0 %0 %0 %Zy0 % 0 %1 %j)1 %r:1 %J1 %Y1 %h1 %w1 %61 %21 %1 %1 % p1 %m1 %1 %1 %1 %~ 2 %g2 %+2 %:2 %I2 %.X2 %Cg2 %v2 %2 %2 %o2 %2 %2 %2 % 2 %2 %s2 % 3 %q3 %+3 %:3 %I3 %|X3 %(g3 %bmv3 %R3 %_ 3 %C3 %Q3 %3 %_3 %3 %M3 %3 %U4 %R4 %*4 %!jE4 %R4 %&q_4 %4 %4 % q5 %}5 %m5 %5 %z5 %Q5 % 6 %g6 %L6 %|6 %6 %6 %j6 %6 %Y7 %M7 %<7 %vN7 %\7 %;j7 %x7 %7 %Pj7 % 7 %7 %7 %j7 %8 %ð8 %b8 %-*8 %I8 %Y8 %g8 %u8 %;8 %ȝ8 %j8 %/8 %i8 %8 %n8 %98 %ص 9 %9 %89 %yF9 % T9 %b9 %ɋp9 %~9 %9 % 9 %ٹ9 %B9 %9 %}9 %!j: %#: %: %*v: %:s{: %': %: %o: %/: %: %_: %: %: %: % ; %; %T; %3d; %j; %qp; %; %W; %|; %; %B; %t; %; %a; %^< %< %T1< %>< %+Q< %эh< %6u< %8< %< %< %T< %< %< %< %$x< %< %(= %A5= %|B= %zrO= % j= %uz= %= %= %= %= %= %3= %<= %T= %)= %= %= %Y= %> %6> %#> %8> %VF> %RR> %_> %l> %.> %T> %m> % > %> %x> %> %A> %> %p? %? %? %+? %8? %5F? %S? %:a? %эo? %|? %? %? %ˮ? %? %t? %:? %? %? %B? %;k? %5@ %2@ % 7@ %OD@ %pQ@ %{^@ %x@ %O@ %@ %`@ %;@ %@ %@ %э@ %@ %| A % A %#A % 0A %>A %*QA %ooA %8{A %A %mA %ġA %uA %tA %A %A %wA %A %BB %I)B %96B %CB %hB %5tB %B %B %B %WB %=B %B %B %DB %eB % C %eC %l'C %4C %KC %eXC %eC %|C %eC %C %sC %kC %+C %C %C %[C %D %6D %=)D %6D %?MD %@YD %zeD %ިqD %}D %D %D %D %$D %AD %DD % E %7 E %jy-E %9E %^EE %zQE %VgE % tE %JmE %kE %E %E %E %&E %:E %E %n F %uF %2)F %7m6F %XDF %QF %^F %zkF %IxF %F %jF %&F %F %;F %LF %kF %'F % G %אG %;$G %2G %@?G %~LG %yYG %gG %tG %jG %بG %|G %:G %G %G %YG %G %|G %(G %vH %H %EH %=H %FJH %XH %eH %sH %3H %}{H %`H %3H %|H % pH %iH %pH %I %k|I %KI %p-I %9I %FI %pTI %iI %pvI %I %I %I %pI %fI %I %9J %J %; J %&J %,J %`2J %o8J %n?J %MJ %p[J %ɿiJ %;kJ %J %9J %J % J %J %MJ % J %#J %K %{K %j"K %0K %>K %LK %;ZK %,hK %'vK %K %K %gK %K %K %K %K %SK %K %TL %L %<!L %/L %=L % KL %YL %ygL %CuL %nL %^L %L %1L %vL %}L % jL %L %L %M %M %{M %O+M %ם9M %QxGM %$rVM %AfM %tM %WM %M %M %M %] M %4M %M %M %M %bN %N %w}N %b+N %9N %GN %(UN %cN %"qN %N %N %ۘN %N %N %ZoN %ɯN % N %O %4O %hO %0O %%VO %!dO %sO %O %O %CO %yO %O %O %O %|O %O %P %P %#P %3P %QCP %^SP %ocP %rP %'P % P %CqP %rP %~P %ujP %Q %+Q %Q %S8Q %FQ %mkTQ %bQ %qQ %JvQ %āQ %Q %LQ %Q %Q %aQ %j R %RR %}'R %5R %CR %QR %J_R %?mR %҅{R %^R %6R %|R %uR %²R %R %R %R % S %qS %$S %w>S %KKS %XS %sS %S %bS %S %{S %8S % S %3T % T %vT % +T %8T %bET %RT %_T %qlT %yT %cT %.T %vT %T %ʰT %T %ЁT %^T %T %BT %&U %S3U % @U %UTU %OnU %{U %^U %U %U %U %GU %;kU %|V %V % V %*V %X4V %>V %KV %XV %MeV %RrV %V %V %V %V %oV %V %mV %V %.oV %V %W %|W %*"W %/W %Z^ %IL^ %Z^ %h^ %iv^ %^ %^ %^ %]^ %}^ %|^ %^ %^ %^ %(_ %_ %h_ %{._ %=_ %"L_ %[_ %j_ %H_ %]_ %_ %_ %q _ %Zp_ %_ %;k_ %_ %:` %` %}` %,` %֠?` %I` % S` %U]` %g` %sq` %r~` %X` %` %|` %` %` %G` %_{` %` %Ԣ` %a %a %^a %m,a %9a %KzFa %uSa %S`a %q|a %a %a %ha % a %a %a % a %a %Za %b % b %(b % 5b %VBb % lb %xb %b %b %}b %Sb %/b %?b %b %tb %b %" c %qc %&c %?c %|Lc %Yc %ͫgc %{uc %c %c %c %`c %&c %c %6c %c %d %d %d %)d %~6d %wlCd %jd %(d %d %)d %d %d %d %d %d %d %e %Pe % e %?u-e %m %Km %bm %nm %pzm %#m %*m %6 m %m %vm %m %Im %Nn %Ǧn %gnn %n %wn %An+n %P1n %7n %=n %Dn %Qn %;k^n %kn %yn %n %8n %n %n %in %on %n %o %o %"o %/o %5q %զKq %Xq %eq %rq %>q %Mq %q %~q %Uuq %xq %1q %Qr %r %Y*r %{6r %Rr %Ger %|r %-r %r %nr %r %Ar %vr %yr %2s %s %1)s %6s %+Cs %|Ps %<js %ws %9s %ss %Es %s %{ t %1t %QPt %]t %ɢut %|t %Gt %{t %t %څt %t %אt % u %u %(u %w6u %fDu %ģRu %pu %u %u %u %u %u %u %u %mu %Av %'v %6v %Zv %lv %rzv %fvv %vv %v %E|v %щv %-v %y v %q v %v %w %w %(w %Es6w %#Dw %bRw %y`w %Ttw %Lw %%w %Ew %vw %w %Dw %w %xw %~ x %J|x %c'x %S5x %Nx %}\x %zx %Zsx %x %x %x %kx %x %y %^y %y %+y %I9y %Gy %pUy %#lcy %qy %y %ry %y %y %y %~y %wy %iy %Bz %,z %Ez %7mSz %az %z %jz %z %Yz %mz %wz %z %0z %{ %{ %{ %+{ %s9{ %4G{ %asU{ %,c{ %Nq{ %{ %L{ %{ %{ %O{ %]{ %f{ %({ %v{ %| %| %!| %10| %?| %N| %]| %ul| % {| %'j| %C| %| %| %m| %U| %| %} %} %o } %|/} %>} %AM} %\} %Bk} %;z} %} %<} %} %v|} %} %} %˓} %v} %1~ %~ %~ %.~ %=~ %r~ %A|~ %~ %~ %Î~ %~ %~ %~ %w~ %3o~ %|/ % = %אg %/v % %>w % %  %+  % % %J %ٓ %h %  % %" %~ %U %X %$ % %> %I* %$7 %D %?b %r %jx %~ % % % %2 % % % % %$ %: % %Qƀ %̀ %Ҁ %؀ %ހ %  % % % %  % % %J %ީ % %c  %M& %|, %U2 %8 %> %D %[ J %P %V %\ %Xb %~h %n %t %kz %߶ % %$ % %_ % % % % %O %ȁ %0y΁ %ԁ %ځ %S %X~ % %y % %( %- %< %+K %Z %i %px %$ %  %7mJ %9f %ɵt % % %WkŃ %Ӄ % %U  %  % %' %ޠ5 %GD %R %}` %n %| %߫ %z % %| %„ %@ф %6 %>! %F= %@K %Y % % % % %ȅ %օ % %R %| %5 %/ %x* %}I %xvW %ue %bs % % %b %݆ %p % % %v %p %  %s %$# %1 %? %M %[ %Ȑi %:w %q %  % %7 % %Ȫˇ %=ه %R % %  %[ %ă %- %9; %uI %W % g %$v % %| % %R %Xˆ %{ш % % %m %  %uk %+ %/: %ӑI %Y %Ch %‰ % rЉ %$މ %l % % %- %X; %I %X %sf %t %` %] % %ޑ %p %   %v %$ %1 %> %K %(X %v % %[Ë %yЋ % ݋ %h % % %[ %$x %+ %C %zP %] %{u % %: % % %$~ % ̌ % %" %: %  %+) %y6 % C %kP %] %- % % %( % %ō %ҍ % % % %  %. % % %҄Ŏ %؎ % %҄ % %! %& %2 %}> %xJ %a %Xn %7{ %u % % %x %ˏ %<ُ %+ % %. %b: %^F %S %O` %m %}z % %j % %& % ː %ِ % % % %! %_/ %D< %I %j %w % % % % %~ %L %# %g/ %(K %W %c %q %~ %n %p %b %. % %9n̒ %ْ % %o %H %  %V! %s. %"T %}d %Cr % % %i % % %Ɠ %ԓ %` % % %{ %  %. %>< %J %h X %f %3t %Sr %z % % % %Ȕ %m֔ % % % % %ن %Jt* %܏8 %F %T %b %\q %Ps % %= %  %îĕ %ӕ % %Z %o % %"- %H< %cK %Z %i % % %p %n %b– %,ϖ %ܖ % %1k % % %_ %ͻ* %Ǜ7 %O %_ %m %.{ %0 % %W %  % % zϗ %'ݗ %E % %" % %g# %1 %[? %/M %p[ %i %w % %4s % %ʘ % %b˘ %٘ % % % %pp %# %u2 %B %Q %&` %#o %m~ % %[ % % %ə %ؙ % %O %ހ %Ak %# %kr2 %A %iP %_ %wn %w} % %lm %x %ɚ %vؚ % % %v % %+ %1 % %>l %~! %-. %; %/b %Ǟ| %˜ %~؜ %. % %u, %N %[ %u % %k % % % %uĝ %Rѝ %ޝ %| % % %-  %7m9 %F %S %` %. % %: %7m %ʞ % %< %7m %k  % %3 %kF %8 %G %ß %ɟ %Kϟ %֟ % } %# %Ф % %h) %|9 %H %|V %qd %r % %  %9 % %} %Ơ %R %y % %r %  %E- %.< %rK %Z %i %x %ϡ % %u % %Bá %ҡ % % l % %b %f %ɸ- %< %K %x % % % %΃ %#Ţ %Ң %D %< %X %, % % * %A %N %pu % % %+ % %F{ %`ѣ %ޣ %O %h  %1E %)R %?l %* % %z %R %.Ǥ %Ԥ % %+ % %F{ %. %< %8U %Nh %{r % %( % %w % %ն¥ %= ܥ %f %uq % %S %  %P %r % % %$ % %$¦ %Ц %ަ %o % % % %! %. %=t; %jH %VU %Hb %i %  % %Rȧ %է % %4  %V %<  % %э$ %2 %?? %L %9Y %g %t %s %# %p % %} %ɨ %/֨ %  %w %- %v; %1H %RU %b %o %} %k % %n % % %˩ %oة % %g %)x %3 % %}( %5 %B % P %] %4 j %Vw %< %6 %0 % %O %Ū %Ҫ %ߪ %xw % % %Y %# %1 %? %M %[ %gi %%{w % % %b % %N %o˫ %ګ %| % % %b %  %©4 %> %ٍK %pY %f %s % % % % %Ĭ %6Ѭ %I}ެ %$ %s8 %D %8Y %e %z % % %mxƭ %|ԭ %' %/ %N' %3 %ߺO % \ %i %hw %x % % %\| %w % % % %$ %* %Z0 %6 %ej< %L %Z % f %s %1 % %Σ %w %ү %ޯ % %X %p  %- %' %8@ %M %[ %!i %Rw % % %-  % %Dð %HѰ %1߰ %  % %|  %u %<% %3 %9B %e %q % %c  % %  %n %α % %+ % %o  %# %# %$0 %G= %J %cW %\d %r % % %4 %S %ë %@y %Ͳ %ڲ %" % %N % % %- %MA %O %] %vk %y y % % % %t %F %6 %, %: %H %jV %d % r %m %j % % %F7 %E %* S %Na %o %&} %@j %p %m %  %~õ %Cѵ %jߵ %z %]q %  %ĺ %& %J4 %|B %bpP %^ %l %z % % % % %.϶ %ݶ %Ro %  % %& %*4 %B %,P %p^ %5l %Ҹ{ % %` % % %Ԍ %9Ϸ %ݷ % % %\ % % % %| %n} %o$ %<| % %U %= % %Ȃ %{ %  % %( %6 %^D %R %` %yun %| %' %# % % %º %к %H޺ %2 % % %k %hC % P %Z] %j %S w %X %q %E %{z %l %%ͻ %zܻ % %m %  %a %7m# %0 %{> %yY %}g %u %I % % % %Y! %1/ %r= %GX %f %t % %p %( %ێ6 %:D %|R % ` %7mn %+ %? %l %M %{¿ % п %*޿ %a %t %,   % %΢) %8 %G %%V %e %&t %K % % %y % %/ %u % % %3uM %Z %r % %8 % % %; %C % % % % %|+ %9 %psG %`U %c %q %& %i %  %/ % %o~ %@ % %ɉ %  %  %a %' %س5 %lC % Q %S_ %om %{ %r %  %;k % % %v % %p %  %_ %$ %2 %E@ %N %\ %qj %x %9 %r %9 % % % %n % % % % %  %. %xm< %?vJ %qX %t % ~ %> % %6 %: %r % %u %v %K  % %!j) %7 %mE %nS %ڿa %z %z % %: % %2~ %5 %< % %J  % %Er& %g}L %,Z %gh %v % %u % % %Ӻ %5  %  % % %F %t % % , %<: %ςH %@V %d %r %͜ %7~ % % % %( % %n % %R %0 %> %K %?X %e %r % % %L % %ho %8 % % % %ٷ % %¶ %a %( %\5 %B %C O %݊\ %jp %v % %r %n % % %? %e % %# %  %' %5 %,C %Q %_ %{ %  % % %w % %F %դ, %: %W %g %" %v % %u %E  %  % %& %3 %{@ %M %f %s %r % %T %ٛ! %SD %&_ % % % %i %W %{. %@8 %z % % % %" %J % %v % %Xw %Æ %s %H %U %ʄb %o %k| % %~ %  %1 %s % { % % %E % %p % %- % ; %I %lW %ՙe %t % %ݙ % % % % %j %R %yx %  %$ %5  %؜ %J' %̞5 %ûN %[ %h %v %f % % % %\ % % %i % % %" %7 %D %|Q %p % } %- % % % %F % % %  % %?& %4 %B %]kP %@^ %rl %2zz %$x %$ % %t  %/ %%w %- %  %r %E $ % 2 %@ %N %\ %7mj %lx %@ %C %w % % % %B %w %Ŋ %+ % %!  %bk %' %X %u~l %y % % % % %s %%w % % %щ %]k  % %2z& %4 %B %$ % %* % %J %7m  % %' %: %fG %T %a %xn %{ %+ %  %N %% %2 %tN % %j % % %; %܈H %o %| %q %| % % %  %: %|a %~ %x %: %  % %߼ %J % % %O %* %D %}] % k %uu % %%w %* % %p % %U %f %l %r %x % %k %: %C %B % % % % %~  %+ %m9 %8zM % %o % % % % %  %d %k  %& %0- %: %a %in %{ %| %. %y % %. % %R  % %N %R" %R/ %{< %*wI %tV %%c %0xp %} % % %'  % % % % %" %j %++ %o9 %G %{U %c %Oq % % % %  %s % %j %^ %S % %z% %4 %vC %wR %ma %+p % %z %c % % % % %e % %A %U# %Ӵ3 %C %S % c %s %A % %[ %| %/ %?  %+ %ql %  % % % %s % %H  %G %^Z %}j %Qp %v %| % % % % % %w %K % % %- % %" %0 %Ow> %z~L %.Z %h %Ev %& % %A % % % %x %S % % %]k %2z %, %: %҈H %V %d %*r % % %\j % % %? % % %(m % %  %T %( %6 %XD %R %a %p % %~ %> %- %a % % % %b % %x %v$ %# % % %+ %9 %zG %aU %c %q %Q %n % % %> %Q %q % % %  % %؋% %+9 %hG %"U %;i %w % %k % %y % %7r %q %D %j %{ % % %- %= %NnM %] %m %m} %s %~ %U %Q %J % %" %ӳ %o % %%# %q1 %? %M %G[ %wi %7 %8 %+ %wE %R %` %oo %y % % % %} %B %& % % %_ %  %* %M7 %`^ %k %) %H % %q % % %y %| %+ %}9 %G %k %n % %K % %Р %. %  %! %". % ; %H %U %b % o %3| % %w %p % %Np %C %ax %٭ % %T %! %}/ %= %K %Y %ng %E % % % % %| %# % ~0 %= %V %|c %p %} %x % %" % % % %Gl % %t %g %k %7# %t1 %? %tM %;}[ %i %jw %rz %k % % % %: %> %Z % % %$ %2 %@ %N %\ %wj % % %8 %6 % %3 %Sm %b % %@ %  %. %= %2K %NY %Ymg %u %Ԟ %\ % % %1 % %d  %m %( %|7 %F %o %w} % % %\ %| %5 %: %ˈ % % % %$ %2 %?@ %N %\ %lj %Ux %2z %$x %l %n %  %  %  %{ %Ā  %- %: %G %E T %\a %*n %*{ %R %h % %" % %  %w %K %v %+ %8 %E %S %c %i %|o %Gu %{ %D %v % % % % %vC %r % %  %T %'  %Z %~  % %& %3 %A % N %[ %h %v % y %U % % % %. % %_ %U %t % % % % %&| %, %f9 %W %ld %@q %V~ % % %| % %v %;k %y %  %  %y  %,  %|9  %L  %Y  %g  %s  %  %  %  %K  %a  %N  %|  %  %s  %u  %   %-n  %)  %y7  %E  %S  %a  %N o  %&}  %  %  %  %  %  %  %O  %x  %  %D  %  %`.  %R4  %i:  %@  %'F  %M  %r[  %i  %w  %_  %  %:  %  %Q  %  %  %  %  %  %o  %#  %2  %TA  % P  %>_  %cn  %|  %  %  %b  %  %t  %y  %  %  %   %  %#  % 1  %?  %cM  %E[  %i  %ߡw  %k  %x  %^  %  %]  %t  %  %2  %K % %y' %7 %jtE %S % a %jo %R} %!p %1 % %M % % % % % %( %5 %EB %`O % \ %i %bv % % %+ %N %{ % % %R{ % % %k3 %|= %ےY %!jg %u %q %N  %[ % % % %  % % t %* %7 %D %sxQ % ^ %k %(x % % %K %a % %ѯ %w %p  %  %2 %? %5L %fY %f %ws % %sx %  % %( %K %a % % t %4S %` %m %z % t %e %_ %\ % % %+ %+ %b %)o %| % % %_ % % % % %x % % %+ %" %h; %pT %{n %n % % % % %s %Ѳ %(t  % % %y %" %y3 %G9 %? %E %L %Z %ih %v % %  %c % %h % %y %: %գ % % % % %  %r % %t! %( %Y9 %? %E %xL %8Z %h %v %" % % %Z} %qy % % % % %" % / %+< %}I %fV %"c %p % ~} %? %h %e % % % %< %{ % %&  %ҏ %$ %0 %iE %=Q %~c %m % w %G % % %i % % % % % %(} % %]# %2 %hA %`re %ߤ %  % % %m %ݮ % % % %r %M %9|! %s. %P< %\\ %x % % % m %. %  % %( % %{ %G % % %Q$ %* %k0 %=6 %|< %B %`H %rN %T %b[ % % % % %Q % %( %V % %  % %R %#$ % 3 %(= %Vb %o %T| %Hx % %7m %ɢ %p % %t1 % B %[H %=N %_ %l %y % %| % %7m %& % %  %ٻ %# % > %H %AU %}c %r %֪ %} %= %w %b % % %ǒ %'  %  %A  %N  %?[  %h  %u  %  %  %ε  %^  %  %  %  %G  %  %ɥ  %! %! %! %+! %%8! %lE! %R! %}_! %El! %ly! %! %z! %,! %k! %d! %! %}! %! %! %{! % " %" %#&" %܂5" %m" %7" %E" %" %]" %" %ӿ" %" %" %" %" %" %" %" %<# %+*# %-7# %D# %;Q# %^# %k# %# %^# %h# %# %# %ѱ# %%# %@z# %# %$ %i$ %C"$ %:0$ %>$ %eL$ % Z$ %)i$ %<$ %u$ %s$ %$ %Ϩ$ %$ %$ % % %% %l'% %x2% %9=% %pH% %h% %&s% % %%% %ͼ%% % %% %|p"& %/&A&'J& %`& %m&&& % & %gw&`&& %+& %& _'.' %9'"B' %X' %i~' %G'4' '!3' '3' 'c3' 'Y3'5' (2' '3' '3' '3' '3' (2' '3( '3(5 (E60( %z:(+\( ' 4`( '4p( 'H4t( '>4}(,( ('( '|4( 'r4( '4( '4( ('( '4( '4(,(Q-( %ʚ) %!) % +)`*P) %Z)P)) % )P+) %) '4) '4) ()~+) )+)*+***+;*L* % p* "%u* %oFz* &3,~* & ,*7* #NM* %V* %/j* %!* %P* %C* %* %J* %j& + %+ % + %T!+ %*(9+ %E+ %l*S+ %1X+ %f+ %6+ %?+ %_+ %+ %,+ %, %*, %, %e*, %ޜ6, % B, %fN, %4\Z, %yf, %&r, %3, %3}, %R, %q, %Ȣ, %G, %, %4Z, %, %", %ߦ, %+, % - %- %Ǜ!- %3"-- %ֿ9- %E- %AAQ- %J]- %7i- %u- %g4- %)- %:- %$- %- %Ǫ- %- %- %T- %Ǒ. %. %J%. %3. %38@. %ǑM. %Eu. %d$. %Ǒ. %2. %#9. %7. %t/ %2^/ %-Z!/ %// %A3 %K3 %_3 %33 % 4 %4 %V(4 % #74 %}F4 %s}U4 %md4 %(s4 %,4 %4 %ż4 %4 %g 5 %aN5 %}45 %.B5 %q5 %5 %ż5 %hr6 %r6 %#.6 %w6 %5D6 %5n6 %;n6 %aN7 %T: %b: %p: %;~: %: %: %: %: %: %k: %X: %UB: %!'; %|6; %H6E; %14U; %d; %t8s; %g; %; %Rg; %; %gc; %:]; %o; %; %; %I> < %Z< %p(< %7< %,F< %TU< %Ud< %2s< %RQ< %<< %d+< %"< %"< %< %{< %I< %%< % = %0s= %'= %(B6= %yE= %p4T= %}c= %@r= %[E= %= %= %Tz= %y= %KP= %= %}|= %9> %> %'> %7> %G> %8W> %Z@g> %w> %I> %5> %ɭ> %vX> %> %> %}4> %W> %J#? %h:? %%'? %T6? %T? %&Uc? %/r? %? %Hm? %S? %2/? %Z? %? %? %Λ? %`? %T@ %@ %&@ %'5@ %~D@ %rS@ %:b@ %]q@ %tY@ %@ %@ %y@ %-?@ %@ %:@ %@ %@ %U'A %A %&A %5A %<DA %WSA %dbA %qA %A %aA %8 A %aA % A %>8A %A %EA %EB %gB %~$B %3B %BB %rKQB %N`B %V;oB % ~B %B %DRB %LB %FB %B %B %zB %6B %C %8C %a6#C %Z2C %ڒAC %PC %8_C %RnC %6}C %VC %|C %1C %CC %vC %C %C %8C %eD %5D %X}"D %{1D %s@D %KOD %k^D %CmD %|D %^D %D %@D %xD %7D %D %_D %:D %ĴE %cE %!E %r0E %}?E %-NE % ]E %E3lE %w{E %E %-wE %pE %E %RE %d,E %nE %E %=tF %g%F %!F %S0F %C?F %}lNF %wS]F %[lF %#{F %F %PF %F %F %F %DF %|KF %nsF %G %sG %'!G %o0G %??G %NG %?]G %s!lG %8{G %DZG %G %^G %'G %G %nG %(XG %G %2VH %6H %N H %#w?H %sNH %]H %lH %S5{H %nH %H %H %H %AH %3H %\H %H %SI %I %"I %2I %GBI %@QI %x`I %6oI %L %LL %ZL %u0wL %L %L %D^L %L %UL %L %E M %R3M %6EM %ȖXM %zCfM % rM %M %M %) M %2|M %}M %e\M %NpM %ňM %a(M %M %LM %m N %AN %M$N %#.1N %?N %(v[N %2iN %wN %N %IN %EN %ON %bN %uLN %_fN %N %AN %qO %RqO %jA#O %#.@O %PO %ܤVO %P\O %bO %hiO %vO % O %CSO %]O %lO %BO %Y-O %dO %>O %.P %CP %&a=P %JP %#.qP %NP %VP %P %٘P %P %P %t+P %P %NP %QQ %EQ %f)Q %S,Q %p:Q %ZfHQ %VQ %_dQ %rQ %DQ %iQ %Q %fQ %6uQ %Q %}Q %{yQ %}gQ %Q %ݵ R %bR %Um(R %6R %mDR %vZRR %KgR %Z.tR %cR %'R %R %#.R %>R %KR %aNR %ZR %=R %*S %tS %2?S %prPS %$aS %`qS %TS %OS %CDS %\kS %S %S %\S %}!S %{\S %iT %T %ʓ%T %/4T %>CT %RT %~aT %MpT %DT %T %T %T % T %<T %T %NT %̑T %U %}U %%U %R4U %=CU %TRU %@2aU %=pU %#.U %wU %U %U %ڻU %@U %JU %~U %֯U %yV %EV %ݏV %{+V %XrDV %xQV %lV %yV %y"V %V %ςV %sW %-MW %3W % X %,X %Ws#X %ς0X %=X %۝sX %rX %ςX %xX %Y %oY %mn(Y %M5Y %}LBY %0(uY %WY %Y %XY %sY %Y %(Y %2Y %80 Z %.Z %(Z %a6Z %y2CZ %chQZ %pZ %Z %Z %~Z %Z %NZ %}Z %Z %DZ %[ %) [ %_j$[ %g2[ %<@[ %_[ %Em[ %>{[ %[ %=[ %^[ %_[ %[ %j[ %B[ %\ %.\ %*\ %z7\ %ǑD\ %J\ %$\ %Mi\ %u\ %B!\ %X0\ %Fb\ %\ %S\ %Ǒ] %y#] %0] %@=] %6M{] %ih] %h] %d"] %l] %B] %#.] %] %] %%^ %(P^ %8w"^ %#|/^ %-Z<^ %X^ %/e^ %aNx^ %?^ %l`^ %^ %^ %-Z^ %^ %S^ %}^ %^ %f) _ %_ %O_ %\_ %#.i_ %#v_ %s_ %&_ %d_ %?_ %^_ %A_ %|_ %i__ %_ %M_ %_ %o_ %B` %gR` %)` %ڠ6` %E_J` % =_` %Npm` %?y` %v` %` %zC` % ` %k` %k` %9` %9` %SE` %wh a %k~a % *a %c7a %SEEa %:Ra %c_a %ma %rza %HXa %?a %Ta %ca %Wa %`a %;a %@a %HXa %0a %b %Bb %b %~*b %67b %r^b %][kb %0xb % -b %/b %ulb %b %b %tb %wb %Qb %?c % c %#.0c %F=c %Jc %Wc %ec %:xc %hc %ܟc %!c %&c %Rc %gc %c %c %'c %) d %iFd %Cd %ApPd %:]d %rjd %kd %[ld %d %rd %jd %fd %d %md %d %zMe %@e %ʂ4e %sUAe %%Ne %[e %1re %@e %ʂe %e %@e %ʂe % %e %4e %e %Ne %wf %'f %@,f %ACf %@Pf %{]f %تtf %f %+f %Yf %qf %_f %+f %pf %2Rg %w_g %#g %20g %g %>g %g %Lg %Lg %Eg %BEg %tg %HXh %iF#h %0h %gCh %Ph %]h %Ekh %]xh %#Qh %h %h %U]h %Avh %h % h %th % i %ri %Mk$i % j1i %#B>i %tKi %Yi %W2fi %nsi % +i %i % i %Mi %Yi %Hi %i %2i %ji %i %j %Xj %_j %U',j %n9j %Fj %ldj %qj %j %vj %~j %j %,j % j %ATj %#.j %}!j %wSk %!k %8@-k %-9k %aFk %!Tk %5<`k %mk %!{k % Ak %!k %k %Ok % k %k %tY l %rl %:'l %6l %;Gl %pMl %.dSl %׳Yl %۫_l % fl %tl %!l %pl %l %rl %:l %]l %}l %dl %:qm %wm %m %,m %G:m %OIm %Wm % Fem %vsm %m %:[m %5Qm %m %m %gm %tm %fm %Qbm %}n %n %-Pn %,n %Nj:n %Hn %VVn %όdn %rn %2n %'+n %wn %. n %n %Zn %n %Mxn %.n %n % o %bo %k(o %S6o %,Do %-Ro % O`o %)no %w#}o %OVo %Ko %eZo %o %Gzo %qo %غo %o %o %~w p %qp %pP(p %k6p %.Dp %p[Rp %_`p %lKnp %z|p %ip %Hmp %Âp %Up %2Jp %Âp %rp % p %` q %yq %X'q %5q %߲Cq %8Wq %}q %q %SEq %0q %[q %q %Dq %kq %݅q %q %#. r %r %Y*r %V:r %SdJr %|Zr %jr %*zr %}Rr %r %sAr %COr %"r %Z#r %W s %s %'s %~6s %Es %ym_s %gms %{s %l6s %s %'s %2s %Ǒs %#ws %H6s %pt %-$t %@2t %B@t %iNt %\t %jt %%xt %t %:t %%7t %*t %zt %#.t %'t %ct %Ut %{u %p$u %iF1u %I>u %Ku %Aeu %@ru %Vu %lu %0u %y3u %}u %u %<u %Uv %̨+v %^8v %Ev %uRv %_v %pQlv %Jyv %hv %I"v %kv %wnv %v %j'v %Ęv %bv %qv %2v %w %Jw %"w %t/w %ʰZw %Ugw %!{w %f3w %Jw %w %w %^w %w %%x %x %#.)x %Ι=x %Gx %%Qx %N[x %ex %rx %iFx %x %`x %x %x %Kx %x %t x %Yx %:x %{y % y %w"y %X/y %--| %| %_"| %0| %>| %!L| %eOZ| %Xh| %jv| %+Y| %.| %[| %iF| %Mf| %| %| %| %8| %f} %} %} %6,} %<}9} %wL} %VY} %`f} %s} %h} %} %C} %M} %՜} %} %|} %fx} %7} %`} %] ~ %~ %&~ %@4~ %AB~ %P~ %0^~ %l~ %v{~ %˚~ %l~ %m~ %!~ %~ %~ %~ %D9~ %e % %d$' %F1 %[U? %M %[ %bo % %2 %c %d, %J %y %F %n %]- %-F; %αI %OW %b1e %s %& %u %5 %i %f %TOǀ %JqՀ %۸ %A| %H %  %(X %6T) %7 %4F %,U %,d %cMs %} %@ %Ns %1 %s} %́ % %! %g %  %i %HW, %39 % /F %qyS %Qf %wp %z % %3 %C %4$ %fW %~ %-̂ %jق %d %}b %, %w %S %2, %T9 %F %{PS %8` %+m %Az % %6~ %< %2 %ʃ %k؃ %Í % %S %91 % %y5 %tB %(]O %N\ %i %O %!V % 4 %xń %/҄ % %7 %M\ %̏  %zr %& %Hm3 %I@ %M %Vf %#.s %M %] %c %P %O %Յ %j %t %t %|  % %) %}6 %C %|P %*/] %j %l %̡ %ņ %Om҆ %=O߆ % % %J %C %T  %9- %: % G %&T % a %d %m % %S^ %Ǒ %Ė %%؇ %o %#. %d %2  %Q %vN %)=[ %h %fv %Gn % %# %sk %e' %`Ĉ %Ո % % %* %Zw %.# %nZ6 %TLC %iFP %j %zCw %  %^ %9= % %p %7cƉ % WӉ % %:Z %k= % %) %Q6 %2D %nxQ %^ %i %k %' %Ɋ %֊ %f %Dq %   %y %#.U %c %p %v'} % % %E %Ą %< %1`̋ %:ً % %O % %֭? %&L %Y %?f %s %< %7 % ~ %6{ % % Ԍ %E % %ʾ %HX %I %( %>5 %B % O %ٛ\ %Ąi %<v % %yc %.6 % Q %g %cč %%э %]ލ %K %l/ % % %# %.L % &Y %p % %! %Ǒ %)R %i@ʎ %O׎ %f %U %  %C %N* %MA %ON %Ne %`r %N %K % %w %ӦՏ %ù %i %' %%l  %| %ti) %W/ %5 %3; %(B %R %X %^ %d %#k %5x % %  %[ %[ %F\ %`ؐ %q9 %o %! %5" %2/ %< %I % V % vc %Ǒ~ %P %% %g̑ %"Eّ % % %M% %  %iF %% %wo< %$hI %$V %;p %#.} % %J %հ % %N %̒ %s1֒ %հ % %  %T %$ %'1 %u> %oK % X %)e %Wr %_? %ԇ %& % % %ΐ %0͓ %& %@ % %/ %; %`Q % -] %y % ~ %d %} %E]ɔ %v֔ %  %wN %Է %9+ %) %f6 %}>P %}] %aNj %#.w %z % %pӕ %d$ %Yn %gu %Bu3 %A %w %d %S %#. % ~ % -Җ %gu %-7 %  %#B% %C3 %7A %SO %!)] %k %Ty %qJ %K %L %7̗ %Lڗ % %1 %[ %Dw % + %N %T] % % % %' % %c;˘ %n-٘ %; %ѡ %̽ %Ľ % %e- %A %O %$] %k %ٱy %] %% %u0ę %KlΙ %ܙ %e' %y % % %6$ %C/2 %s-@ %;N %aQ\ %su %I %Ҟ %$ %ǚ %(S %\ %  %5 %( %#{6 %ED %.R %` %Zn %=| % %Q %J %($ %› %yЛ %{ޛ %/ %) %wS %9 %:S %l %z %վ % %W %VƜ %JԜ %+ %?) %  %fN %( %\6 %D %R %%` %?n %$| % %Fo % % %- %{xН %ߝ %9 % %  %"( %4C* %\J9 %+nH %?UW %f %ru %U %J' %U % %Z3Ϟ %@ޞ % %V %~1  %R %O}) %18 %G %#.V %9e %t % % %q` % [ % %bΟ %-ݟ % %R %"E  %D( %gf( %7 %1F %[U %Ǥd %U %9o %^~ %_C %@ՠ %D % % %( % & %#.V %Wd %#B %y % %( %@5 %َ %ơ %B̡ %~ҡ %zء %0Eޡ %  %_ %. %˥ % %K %$ %) %\v6 %DC %Q %{D^ %Uk %ub % %H %d %q % %5 %@V %lâ %^ɢ %EϢ %բ %oۢ % %4 % %g % %a< % %]  %X %a %ZF %/m# %!j) %/ %5 %Z; %>kA %/G %ijM %.S %CY %o_ %Ue %rk %q %̃w %s} % % % % %: % %h %Z %Ƞ %9f %˫ %ţ %Vˣ % ѣ %أ % % %r* %D %u %h %/ %P %[* %T8 %^_F %PT %c %lMr %| %L; %6 % %Gۤ %q % %f % % % % % %$ %2 %t@ %+UN %Q\ %Bk %y %п % U %O %] %J %Jͦ %#.ۦ % %| % %DH %d % r % % %ŧ %ӧ %iF %wz %~ %  % %#.' %k]5 %=RC %`Q %пp %'~ % %I %ɨ %ר %I %k %)" % %_K %vX %Ne %{r %^d %X %8 % %* %Խ % % %+ %8 %f)E %1R %j %+w %u % %W %HX %2Ů %ٮ %M/ %Ն %  %Hm %HX' %V4 %aNP %*] %׃j %w %iF %6 % %mį %ѯ %|߯ %h %b %D7  % %s: %\{G %2U %Ұ %c߰ %%6 %q %9  %%6 %q5 %GkA %9M %Y %Ie %kq %[ %~j %Ъ %6' %oDZ %dֱ %k % %{ %Ĩ# %iF: %8FU %9xa %Om %`z %Ư %M % %n %#Ȳ %iֲ %y % %j; %d % %b; %iH %V %z`c %Ǒp %E % %iF %Rdz %^ %` %/ %. %yJ %:V %r %6k~ %M %B %ew % %" %D̴ %ddٴ %M` % %C %a  %d %' %64 %"H %%U %u6{ %?. % %Z %"_ %.zõ %Dѵ %ftߵ %R %; %d  %C %g% %,9 %|zG %[U %c %Eq % %I % %# %+ %F`Ŷ %1Ӷ %u %a %4t %@6  % %€' %<5 %,8C %%Q %(A_ %)m %2N{ % % %$ %V %KYͷ %׉ܷ %_ %o %  % %A. %> %T %njc %/r %77 %Uh %N %¸ %ϸ %?ܸ %D %E %Ŋ %10 % %A* %i7 %WpD %lQ %M^ %2v %{ %Ҏ %z? % %Q %#̹ %3ڹ %r %N+ % %A %R  %˧. %Kd< %lJ %ԏX %f %ft %N % %I %Y %$ %Ⱥ %!Jֺ %k % % %n %{ %i, %!; %J %AY %i %}x % %o? %9 %| %cû %/һ %d5 %` %` % % %2, %; %WJ %#Y %"[h %Bw %N %q( %I %4 %Ҽ %) %Z %( %o %" %U- %B %oR %gX %}. %; %:/H %nLU %Sb %{ %O %ew %/ %d^+ %$F %bS %wu %!L % %v %׬ %Ŀ %Xѿ %}޿ %& % %R %#. %` %}: %ѡG %` %_m %yz %EM %d^ % %HX % %| %T  % %% %`2 %@ %zZ %`m %FP % %eD %a % %? %4. % %U! %b. %P % .` %;go %#.} %I % % % % %[ %M %] %g  %+ %i' %Z6 %rE %KT %c %Br %7 %N_ % %R %v % % % t %o %p  % % S' %?6 %tYE %iT %c %r %Q % %;4 %9 %4 %{ % %5 % %Į %) %ԈD %UQ %?h %u %! % %` %aN %qu %o, %m % %cn %3 %l %`y %MR % %by %: %`R % %` %F %aN %qu" %o,9 % U %oc %| %d % % 1 % %X %C %;j % h % % %" %*+ %ʰ8 %UE %\w %_ % % % %P %[ %Y %|u %'! %[9! %. %XM; %H %qpU %%b %6o %dT| %u %5 %  %R@ % %O %?  % %d# %1 %lw> %?K %BJY %emf %rs %: %k %/3 %$ %L0 %g %Ǒ %I %w %Uk %A0 %(: %wT %:(b %o %| %R@ %} %| %c %U %b  %u %0 % %a %  %_p %k)' %9r5 %B %.O %\ %)Wi %w %? % %d % %_4 % %{x % %Y %~9 %m %( %2  %j. %< %yJ %-?X %܀f %Yt %| %~2 %N, %6b % %  % % %¾ %y %9- %v %<+ %.9 %VG %Z[ %e %%?r %g %Q % %M %h % %M< % %8 %r. %2W %$_ %Sk % % %w %k %\ %) %#. %]]  %{+ %\\N %vZ %lv %| % % %) %iF % %- %2) %) %v5 %`E %ȝK %Q %W %] %c %Os %s} %VN %B % % %T % % %L % %ϯ' %"4 %A %dN %g %Yt % %'s % %e %0 % %\ %ݩ % %Z1 %ׄ %x" %-0 %p&> %wL %Z %{i %8 %  %lz %޼ %F %؊ %J  %Y %o %aN %r# % 0 %= %J %W %d %rq %/~ % % %_ %Y % %] %\ %* %c %z %u %F} %* %u8 %!SF %KT %h %pv % %Mv % %%\ % % %% %?7 %}E %8S %Ea %k5o %]} %Y %ݽ %9 % % %9B %?^ %Mal %z %\V %X: %y5 % %Gy %9 %2 %C{ % %Ax %, %"" %y0 %k> %;hM %[ %#.i %!w %o % % %i %A@ %J %4 %t %O % # %W1 %? %DM %8W[ %i %w % % %i %M %5 %\ %Ԕ % > %ҩ %Q %b %}  %(. %< %k %v! %#./ %.= % K %}L %X %,x %8 % %3 %% %<3 %]A %O %f] %Mk %Ty %ǒ %& % %˟ %oB %4 % %q %m % %~= %o7! %/ % = %vQj %@gw %ѵ %LD %λ %o3 %" %SX %+ %n %3U %, %m % ! %020 %= %J %ÓW % -e % %?. % % %1O %x %_ %gXH %geV %d % ~ %q %>m %π %! %O %'@] %k %#.y %k % %aN %v % % %- %؂ %v; %< %@# %2 %QA %SP %:_ %=n %} % %\b % %O %t %d % %Uj %=' % %" %&t % %w %d> % %Q %- %B %l1 %P  %e. %P8 %bB %-R %h` %$n %4| %qq %T % %  %.Q %ƣ %g %/ %vf %< %; %u$ %m2 %L@ %RN %e\ %8j %#x %; %8 %Z %h# % % %ϗ %p %B  %Ί %i$ %t1 %6y> %lqK %Y %g %0Lu %k %+# %+h % %# %?s %x %?> % %: % %f7 %s}+ %9 %]uG %U %c %'q %?# %ǔ %C %> %DC %5 %p^ % % %& %% %4 %ܖB %P %^ %-l %lz %p % % % % % %[/ %kb % %d# %1 %]=? %#M %.s %bg %C %aB %- %O %6 %` %k % %+ %M  %Al %:) %@7 %E %(S %a %3o %-q} %? %` %N %`/ %4 %s %W %Q1 %L %* %9 %C %2W %Ve %1r % %` %Y % %n % %)f %  %C %8 %r %U %i % ( %g5 %aB %DNO %(\ %3i %v %)< %; %' %SE % %l % %s} %  %d  % %' %C4 %LN %t\ %b`j %Kx % %[ %_ % % %( %D %|f %US %Va %Z~ %'  %C1I % %z %&  %ҹ& %3 %U@ %iFM %Z % -g %]t % %J % %d- %{ %MH %k % %ޗ % %4 %M %n~ %=U % _ %v %W %y %Q %Hm %X[ %^ %e' % K %(& %85 %YD %=o %7| %6 %S %i %y %/ %Z %Wi %$ %5, % %^ % %6_, %"9 %WF %0T %lb %np %Yq~ %,K %Nu % %4K %^ %Ǒ %y % % %| %)  %WC %w' %C[4 %NA % N %P\ %lu % %|~ %P % %p %S % %bs %P % % %iF %+ %Hm8 %y^ %`k %#.x % %p % %n % % %ߪ %z %# %1 %V? %7pM %[ %Xi %w %ע %$ %t+ %f) %Zf % % %ƣ %x( % %e1 %> %ҹK %pY %vg %|u %u % %8 %ע %ya %E %Q %c % %x] %7 %<  %aN %=' %m>4 %A %cN %  %/ %ę %y % %B; %5 %0% %x( % %d %;# %1 %0f? %t+M %xt[ %i %Zf % %J % %X[' %4 %tA %DN %BKa %in %{ % %W) %u % %T`2 %O? %LL %lY %7u %l % % %y %Rb %;:o %y %^ %I %#. %o" %/ %G %qa % %SM %) %HX %z %K %m %_ %4 %2a! %D %nQ %Dk %E. %# %A %S %x( %J % %ܮ % %N| % %z %e %4? %> %] %HX %v %B % %& %: %R %Z %; %t %U %O %U %2 %YW %  %# %Ʃ/ %Q; %`I %yW %(e %/s %z< % % { %x %$ %wO %F %y %? %) %  %= %) %7 %t+E %S %.a %1:o %J} %p %8X % %R % % %8 % % %p  % %z% %:3 %<A %LO %] %$k %'y %Ɔ %? %]K %\ %dl % %&~ %r %1 %U %` %C- %3*< %ԸK %L4( %_6 %yD %UR %O` %Fn %A| % %T % %R  %X %4 %LS %_P %# %z %" %z}0 %`> %$=L %aN` %`on %| %t %TA %y % % %E* %MK %# %Ŀ %zd %ȸ %j* %C8 %F %@T %d %t %b %jE %9 %V$ %d %l2 %A % % % % e  %9!. %ҋ< %3SJ %1X %xf %(1t %UZ % %md! %ѨE %|R %Al %$Wy %iF %4z %m %Y %N %D %7 % %t %x %@  %- %Օ: %iFQ %^ %̬ % %| % % %" %b %q( %16 %#.D %QR %!/` %s}n % %: %[ %@ %e %Q % %; %gH %HmU %Gb %So %8| %| % %ia % %^ % %s %! %ye %) %_ %, %: %sH %.V %d %Pr %o %  %SR % %R>  %a %s$ % .= %s}J %2/W %Sd %} %#. %d % s %) %i %Hm % %o %U % % %:&  %0. %< %J %%X %-Af %@t %d. %3 % %+ %7 %  %} % %6 %  %1v  %W/  %y=  %K  %Y  %Hg  %ru  %   %l  %9  %x  %O2  %DQ  %7i  %! %! %?! % S+! %fi9! %ߚG! %`U! %Rd! %r! %{! %! %P7! % P! %! %a! %! %" %|"" %B1" %`@" %$ZO" %#.^" %m" %y" %<{" %y" %d" %_" %#." %-o" %HX# %*:# %!# %/# %=# %yK# %VY# %7pg# %u# %X# %.# %,y# %t+# %f)# %zV$ %% %@a% %U% %-% %0,:% %1G% %0T% %Ta% %Un% %{% %% %9% %8V% %% %j% %wz% %Hm& %&& %$& %<}+& %8& %R(E& %޿R& %d_& % >l& %z& %W& %& %H& %~& %& %9& %(& %m& %@& %+7' %fD' %Ըj' %x' %' %' % ' %' %&' %C3) %)@) %dM) %oZ) %8@h) %Vau) %d) %o) %) %b*) %) %) %") %Oy) %) %) %E) %t) %h) %L) %* %,* %x9* %O-F* %S* %f`* %R~* %k* % * %5* %}* %h* %#.* %* %e'* %+ %s+ %,+ %n9+ %?+F+ % S+ %#.`+ %Ԙs+ %E+ %u+ %c+ %~+ %:;+ %r+ %N+ %8+ %{+ %-+ % , %$, %K&, %aL4, %B, %gP, %*^, %l, %z, %B, %۹, %\c, %-, %k, %e, %b9, %- %Y%- %~+- %1- %S7- %6=- %7D- %,U- %[- %0a- %Žg- %sm- %t- %4- %- %`- %7- %7- %@r- %D- %- %h- %n- %. %d{. %^,. %g!;. %mJ. %qY. %h. %fw. %. %. %>L. %. %Q. %y3. %K. %@. %Z*. %l / %4/ %+/ %X;/ %zJ/ %iX/ %f/ %(}t/ %kk/ %eJ/ %R/ %y[/ %D/ %*/ %H:/ %=/ %/ %0 %0 %.0 %>0 %\N0 %*^0 %%l0 %`z0 %:0 %xU0 %0 %!0 %}B0 %0 %0 %]0 %Z0 %1 %)1 %yB1 %QO1 %\1 %kki1 %iv1 %i1 %f1 %]1 %d1 %1e1 %ԧ1 %ŵ1 %N1 %Y1 %1 %{,2 %!2 %p62 %7Z2 %D-d2 %'D2 %2 %f2 %2 %ɻ2 %;2 %u3 %o3 %y3 %_*3 %473 %\%D3 %Q3 %Q^3 %Rk3 %)x3 %3 %Dd3 %Q13 %[93 %d3 %N3 %83 %{3 %a3 %Nw4 %~Q24 %ׁ?4 %yY4 %f4 %CSs4 %24 %s4 %4 %ܾ4 %)4 %4 %Dd4 %Q14 %N4 %84 %Ӓ5 %\%5 %@z5 %U5 %y5 %Z5 %\%5 %Ѯ5 %05 %(5 %+5 %LJ5 %5 % 6 %T`6 %6 %y6 %Ӓ6 %R6 %06 %6 %s6 %7 % 7 %*7 %;7 %y-7 %aN;7 %!rI7 %b7 %:"{7 %!-7 %7 %17 %ܙ7 %a7 %8 %>%8 %d8 %{%08 %68 %<8 %EB8 %G?I8 %3Z8 %UY`8 %f8 %āl8 %rs8 %8 %=8 %P8 %t8 %s8 % 8 %4j8 %8 %r{8 %*9 %ޡ9 %T 9 %w9 %99 %ʅ9 % $9 %v+9 %#<9 % B9 %G&H9 % bO9 %%`9 %Af9 %l9 %*s9 %9 %dA9 %9 %|9 %9 %P9 %.9 %*9 %: %ۑ": %IB/: %y<: %I: %.XV: %w=c: %fp: %}: %Hm: %h: %2/: %ت: %: %%: %]: %`: %$e; % ; %?,; %J$; %,r0; %A=; %K; %OW; %l; %sgx; %/; %W; %3l; %; %; %-k; %e; %\; %rD; %'< %3< %{< %Q.,< %;< %)J< %VY< %1h< %#< %U< %^< %P< %< %<< %`< %Z= %b= %!= %#.= %;= %b-H= %>U= %ec= %(= %= %= %= %y= %W4= %KL= %= %^d= %N> %> %UP+> % 65> %qE> %K> %IAQ> %W> %]> %Zc> %Dei> %6o> %ޭu> %B{> %.> %L> %=> %W> %|> %@> %> %> %^? %$? %!? %.? %=? %YeK? %-Z? %d? %^? %? %c? %)? %}? %? %S@ %@ %Ğ*@ %ҶX@ %i@ %o@ % u@ %?@ %@ %@ %iF@ %#.@ %n@ %@ %\b@ %Ǒ#A %"0A %l=A %tJA % eA %ٞoA %}|A %A %G8A %[A %A % A %(A %A %P9A %B %D B %5[-B %<;B %HhB %)uB %MXB %|:B %NB %JhB %iB %gB %lVB %WB %5B %xB %C %C %VC %8+C %98C %WEC %`RC %_C %@lC %i}yC %C %KrC %C %ltC %T+C %C %2C %r\C %1C %.C %ƗD %)iD %hp#D %N1D %!?D %YgMD %4\D %D %D %D %bD %ԴD %D %pD %QD %D %XD %E %j E %E %LE %7E %aNQE %%p^E %kE %ITxE %SE %5E %lE %*E %LE %?E %,E %cE %F %+F %F %-F %;F %QUIF %9WF %neF %÷sF %F %F %F %!'F %%F %F %Y G %yG %l#G %0G %ǑCG %ΣNG %YG %ZDyG %3GG %5G %uG@GG %G %[8GH/H %\BH %ONHaH;jH %H %5H %LH<H '5H '5H %qH7#I '5'I 'E5-I %W">I %LUI=lI '7pI ' 7yI>I>I>I>II ",I %yI &6I &a6I >I #RJ %%J %81J %;J %I4IJ %TiNJ %5\J %fJ %tJ %![yJ %8J %M3J %|J %9J %J %zJ % <J %#V:K %@K %RK %/`K %leK %4qK %}K %1K %K %LK %hK %K %U K %YK %aK %nK %3-K %`tK %!L %RL % L %C,L %U 8L %YDL %WL %V\L %YhL % wtL %ML %KL %L %oL %EL %VL %L %HgL %jL %L %L %M %M %S'M %ZP %JP %P %3P %JP %O8P %W Q %EQ %\0+Q %JQ %YQ %hQ %.wQ %wQ %#QQ %gQ %Q %NQ %Q %!Q %w'Q %;Q %< R %@R %L+R %f:R %mIR %XR %J:gR %uwvR %O+R %ZR %~QR %R %R %R %]zR %}GR %eR % S %=S %h*S %C9S %HS %WS %zfS %luS %MS %g`S %^S %d0S %s-S %S %9cS %;S % b$T %lLT %DhT %xgvT %wT %dT %T %LT % b U %lU % U %"U %uV %&)V %J6V %>CV %DQV %wV %QV %JV %"V %`V % V %!W %8'W %1JW %5XVW %dW %sW %W %8W %@W %SW %8W %uX %NX %=)X %w5X %*NAX %ANX %[X % hX %HX %X %BX %)jX %D<X %0X %3X %0Y %@SY %u"Y %[0Y %w>Y %MY %UA]Y %skY %OyY %Y %rY %7lY %uY %.Y %bY %XY %Y %fY %AZ %ZZ %w!Z %G/Z %|i=Z %KZ %jYZ %/vZ %CZ %iZ %|Z %:Z %Z %Z %#;Z %[ [ %8[ %p*[ %3 9[ %H[ %jW[ %8f[ %^u[ % [ % [ %rl[ %>7[ %[ %[ %[ %h[ %Jx[ % \ %L\ %4)\ %i8\ %+G\ %V\ %7@e\ %Ct\ %-#\ %9\ %=\ %)\ %\ %i\ %\ %e\ %m ] %M] %T*(] %x7] %aF] %uU] %},d] %s] %i] %t] %*<] %]] %] %o] %>] %+m] %Fc^ %]^ %"^ %]2^ %RB^ %R^ %b^ %r^ %}^ %9^ %:z^ %C^ %<^ %f^ %G^ %Q^ %e@ _ %_ %lE(_ %97_ %ZF_ %KU_ %d_ %s_ %@_ %v_ %_ %._ %!_ %_ % _ % _ %;_ % ` %)` %B'` %o6` %L=E` %VT` %Ec` %r` % 3` %(b` % 2` %` %VR` %` %n` %x` %Gz` % a %&a %5a %_Da %PSa %ba %qa %a %Ea % Na %wya %|a %a %ka %.wa %da %Zb %b %(n%b %_4b % ZCb %*Rb %H?ab %fppb %b %b % b %Bb %<b %b %b %b %b %c %c %$c %&3c %(=Bc %zQc %JM`c %L/oc %Ff~c %X-c %+c %#c %c %c %c %Kc %c %qd %RJd %(#d %7/2d % ;Ad %q>Pd %_d %dnd %}d %(Dd %"d %-d %d %7d %d %dVd %Od %'e %oSe %_"e %2e %Ae %Pe %W_e %:$ne %}e %de %e % e %e %e %mHe %"Pe %pe % f %Af %u#f %/2f %V8Af %Pf %k#_f %pnf %#}f % of %f %P`f %Kf %f %f %f %e f %Hg %g %c"g %V1g %'@g %>Og % ^g %Hmg %Gd|g %MQg %'g %#g %Cg %7g %tg %g %eh %zh %7"h %1h %At@h % Oh %W^h %mh %b}h %)h %Th %Xah %2h %(h %h %R h %h %mi %HRi %zTi %29bi %pi % "~i %}Bi %vOi %Ui %4i %kWi %Mi %Vi %oi % j %Bj %b(j %6j %:9nj %V{j %j %j %$j %Thj %j %k %k %q,k %u*k %9k %JGk %tUk %ck %qk %t.k %Fk %:Vk %~`k %Qk %bk %k %Sk %wyl %Ml %@Al %Ul %Ajl %WDwl %l %l %Fl %l %El %;l %pl % m %2,m %Km % 'm %W 5m %8Am %Nm %5[m %^Hhm %um %m %m %um %:m %&m %jm %`m %em %m %n %]w"n %/n %5p %Cp %[Qp %_p %mp %{p %p %p %Kp %cp % vp %q<p %Rp %p %p %5q %q %3%#q %o1q %h?q %{)Mq %[q %kiq %ewq %q %^q %vq %_q % q %%q %q %q %q %er %ur %!r %]:Er %wQr %hv]r %jr %yr %$r %jr %`"r %cr %r %r %r %X s %es %='s %#f6s %xXEs %Ts % cs %rs %Cs %Cs %5s %s %us %.s %s %s %as %vt %y2t %g&t %5t %ADt %St %Abt %mrt %d1t %wt %t %64t %t %t %t %ut %'t %1u %nu %k'u %6u %Eu %;Uu %_bu %)ou %|u %?u %+u %H"u %(u %u %<u %u %%cYv %2fv %Ulw %Cw %,w %wtw %Ww %T#w %2w %zw %Mw %"Fx %2Sx %d`x %cmx % zx %vx %x %x %x % x %;x % y %#)y %19y % kHy %cWy %vy %y %Fy %y %y %ly %0y %*xy %n/y %.z %;z %1z %Az %\Qz %az %Cqz %z %hz %z %;Rz %az %WIz % kz %*xz %*{ %{ %{ %`3{ %@{ %M{ %n/{{ %E{ %{ %*{ %A{ %| % | %V| %%$| %1| %>| %OK| %1OY| %f| %A| %)| %H| %| %L| %r| %Jn| %} %} %,} %u9} %2F} %fS} %Fo} %>{} %%'} %#,} %C } %q} %@g} %w} %2} %u~ %d~ %O!~ %C .~ %q<~ %O~ %-[~ %@g~ %t~ %C~ % x~ %s~ %u~ %~ %Ul~ %J  % % %KU %$ %,+ %r0 %U= %K %0U %Xb %p %}} %@ %P %N % %W  % %8 %z % %2>& %3 %|i@ %U\M %[ %]h %u %k. %%Y %uM %] %Hw %uMʀ %s؀ %" %^ %2 %;1 %uM %, % 2 % 9 %R>F %^T %Oa % sn %{ % %. % %"Ɂ %~ ց % %_ %@g  %~ %_$ %p1 %#D %gQ %3p^ %2k % sx %u %(n %*v %i‚ %KЂ % % %O  %{ %( %4 %A %rN %5\ % oi %iv %s %f %J  %ȃ %!Ճ % %d %D %9# %/ %@ %dM %ZVY %Jf %{ % %2 % % %nƄ %!݄ % %2 %n % %2( %]5 %B %aY %f %dWs % 3 % % % %+ȅ %Z߅ %M %( %  %! %q:% %o %| %mv % % %#8 %}eω % 3܉ %8 %8 %. %d % %2N, %W9 %uF %S %} %P %M % % %P %Jˊ %?؊ %P % %P %5 %k]9 %x\ %bh % v %! % %5 % %Rn %7 %cċ %[ʋ %iы %;ߋ %P %  % %!% %3 % B %iP %rt^ %C!l %\z %N %w %Y< % %DŒ %Ќ %&ތ %2 %[  %K %2 %=$ %2 %$A %Q %Z_ %-m %18{ %C %y %; %V % %<ύ %Sݍ %@x %y %' % %o# % 1 %F? %M(M %)[ %i %gw %]r %}M % % %0 %#ˎ %َ % %e %D4 %  %<# %G*1 % !? %jM %G[ %Ni %~'w %! % % % %  %&ˏ %vُ %* %Ko %Q %2 %gE %<B %2L %"Z %)h %v %) %3 %G %b %2 %1 %R %] % % ! %5/ %= %}=K %5Y %<g %uu %s %  % %\ %Cő %wՑ %<; % %oU %  %Y. %< %K %u %V %< %ys %_ %ʒ %ؒ %N % %z %( %86 %AJ %'R %ia %  %?H % % % %eǓ %qՓ %6f %O % %F  %1 %*) %u7 %SE %S %q^a %co %oP %s % %5 %Д %ݔ %hN %kO %,( %5 %jTB %QU %b %7l %X %Ys %Q %Wm %6ʕ %ו % % % %  % %t% %2 %H? % L %!Y %Df %zs %Er %O %$ %`Ŗ %7lҖ %3? % %Er  %z  %NG %T %Aa % 0n %{ %u %I %n %6g %Ɨ % wЗ %Pݗ %s %x % %r %E %JS+ %v8 %E % X %f %Is % %' %% % %c % %*Θ %uۘ %< % % %Zj %u %01) %8 %O$G %/T %_a %On %@I| %v %Z % %E_ %͙ %sۙ %f %' % %!! %/ %i= %2K % Y %Sg % u %) %B %jo % %V %Eɚ %ך %; % %  %S0 %& %j<+ %9 %&G %)U %tc %sq %8 %pb %< %S %Y %{ś %Sqӛ %|I %A  %f %=l %s %V) %Y< %dF %lP %^ %l %@ %b % %<- %' %Ĝ %ќ %`ޜ % %5 % %' %L %T2 %A %f(O %\ %i %Cyv %2 %B % % %L %4 %FA %1 %=bϠ %yޠ %d1 %-W %K# % %s-+ %n8 %kR %)\ %$i %v %Ko %^ %. %] %q) %ѡ %'ۡ %Y %u %At % % %| %.* %7 %D %[Q %^ %p %'} % %q %& %V % %ˢ %آ %SF %%L %6. %p %j( %s5 %|iC %=P %4^] %5mj %y %g %) %$ %!  %0nǣ %pԣ %1k %7  %U# %F0 %T= %1HP %\ %n j %?w %j" %7 %Q % %z %Ѥ %uޤ % %  % % %`i# %8@ %N %$\ %$j %,x %sW %1 %- %*v %, %|ȥ %Xե %~C %Q# %n/0 %X= %SJ %RW %5d %[gq %%o~ %M5 % %.; %r % % ̦ % %' %1O %\ %A %WL7 %A]C %P %u] %ruj %jw %3p %Xo %>Ƨ %5ӧ % %P %v %T %| %! %/ %Y@ %[U %Na %n %G' %./ %  %j %s %zը % %2> %  %N  %6 % $ %@1 % > %5K %[ Y %z %o %s %3p %j %n( %8ɩ % %Mp % %84 %qA %N %M![ %ku %) %u %FΪ %+Z۪ % %q %5 %Vc %4 %* %:7 %D %8R %a %+[o %] %( %5ī %:sѫ %jޫ % % % . %6+ %r% %<_? %L %:_ %nl %^y % %R % %5 %/ %KǬ %4Ԭ % %u % %O % %yA" %td/ %< %\PI %V %d %<r % %8 %@9 %rĭ %; %y %  %A %?( %~5 %k^B %Y %e %2{ % %`I %[t %1j %`IЮ %rBݮ %`I %]L %a  %' %V@ %iO %\ %?i %.v %, %} % %6 % %1 % %Vï %Mɯ %9ϯ %1t֯ %p % %<_ %%   %%  %g + %C %Q %s %v %p %j %r %/h %w %%ΰ %A % % %yH7 %,D %PR %P\ %i %5v %s % % %- %5b %۱ %u %5 % %` %Q %`C) %vk7 %A %`N %s[ %n/u %;0 %3 % %\0 %}v %Bò %;Kв %ݲ %t %7 %BY %K %5 %@+ %b8 %P %e %Nr %] %f % %_ȳ %C % . %ru %-' %> 4 %A %dO %b %gy % %a % % %jTȴ %wմ %u %* %z  %~x> %U %ba %d% %?% %N %] %ru % %u % .) %_= %d%K %NY %=w %8 %_\ % %dd %sȶ %Rֶ % %{ %]9 %h\) %7 % E %wVS %ea % z %1' %= %5 %f9ȷ %X %z %`  %  %^( %x6 %D %2R %Q` %mn %m| %; % %; %/ %ȸ %[ָ %a %  % %/ %T9 %UG %U %)d %dr %5 % % % % %wǹ %# %[= %N  %% %O2 %>Y %n@m %tw % % v %#+ % %p %z˺ %l=ٺ % % % %[b %z %2- %); %+I %W %Wz % %f %4 %r׻ % %n %n %# %1 %? %M %[ %)iw %| %S %5  %2 %8 %R˼ %ټ % %u %O %F %*B %;v- %{(; %gJ %Y %Yh %=w %t %I %f %4 %U½ %Eѽ %! % % %7k  %+ %: %QgI %_X %g %v % %O- %Bi %_ %u %(о %c߾ %z %O %z  %,  %qo* %~]9 %H %>W %cff %,u % %p %h %MZ %  %TϿ % %B %^. %t' %$@ %N %]\ %5k %} % %u %1 %8 %) %b % %a% %>+ %k1 %TN7 %.= %*C %:I % PP %ZqW %J_^ %Ue %cm %z %6C %C %I& % %'@ % %qZ %~ %4 %/0  %& %! %^ %" %V( %. %p84 % : %?@ %%F %tL %R %/X %`2^ %xUd %vj %Lp %?mv %| %sF %d %8 %* %/ %(I %  %G %A8 %c %R % % % %B %i %3 %l5 % r %*M %q %8 % %  % %  %P %B$ %[* %I0 %6 %c< %8C %!NT %"^Z %` %f %%l %r %y %0 %  %  %g %b? %R % %, %a %  %g %)jF % %np % %@ %I" %8W %xe %y %m %R %L %A % % %y %o % %aA %  %* %,o8 %uF %hT %,c %:r % %y %D %] %5  %R0 %5> %sL %w*Z %Hh %Bv %$M %u %d  %S % %o % %x % %e4 % `B %P %$o % %R %s/ % % % %EN %E %: %`3 %7 %>[ %) %^  % %El% %'3 %$A %7O % ] %k %07y %! %l %% %8 %) %e % %  %m % %g %u& %55 %nE %N"T %Gc %5r %6 % %i0 %V %6 %) %4 %Qo % %eT %b %Ep %q %E %# %Ia %*K %F %u % %# %>A %" %?0 %? % %_ %l! % %s& %2 %+ %g % %Ii! %OU %Ob %mo %s| %p %*v %O % % %5 %2 %% %Q % %^" %c0 %bD %Q %6^ %7x %Q %^ %hN %w %O %3 %a %s %" %H( %^/ %`< %,J %W %d %ew %a %# %\+ %c %7= %J %FW %Yj %3w %F %Y %P %3 %n %[? % %  % %Z  % %62 %cSA %O %w] %+k %X %s %B %9( % %|_ %_ %_7 %r  % %3 %{6A %tO %ok] %k %ruy %s %tC % %1O % %A %WL %5  %s %2 %P %MVy % %/ %) % %5 %? %Hs %/T %e' % %g* %7 %mD %VQ %^ %k %x % %N % %4: %e % % %O %  %+  %.*. %< %c$J %dLX %f %t % % %+ %|* %  %^ %WM %j % %B % %A" %O0 %{> %<L %Z %1$h %av %s %0 %;Q %M % %= %E\ %H %A %q % %r_) %a 8 %9G %V %>e %8\t %Y % %U %J %w %(5 %X %^ %`<  %V- %X: %G %T %a %:n %{ % %  %{K %`  % % %Ce %+ %> %  %7 %) %5I7 %mE %Y/S %a %Zo %} %d= %W %T % %? %W %tv % %B %Ww  %  %% %33 %+A %O %R] %9k %y %> %{N %? %B %S? %E %- %> % % %M %. %.S= %L %rL[ %j %fy %T %Y %" % % %C  % % % % %3S %;= %7L %vY[ %fj %Dz %3i % %F % % %- % % % %eI %+ % %e'] %"j %m %2x % %p3 %7 %q %& %\! %n/ % < %aI %=V %$Mc %d6p %u} % %jT %Q % % %) %[ %m( %J5 %^B %O %7\ %v %6 % % %5 %* % %\9 %%>E %oU %[ %oa %,Uh %r %e % % %s %_ %D %u % %F %S %m  %?. % < %J % X %t %n %& %  %Tk % %f % % %W %7  % %E( %q7 %sF %$U %d % t % %# % %  % %; %r %   % ^ %( %Je= %BJ %+W %7d %r %/| %^ % J %8 %7l % %o %K %F %MV' %w4 %n%A %O %c %)ep %l| %s %I %nx %c %9 %b)  %LK7 %vC %_Y %MVf %XKs %w %n% % %<^ % %3 % %d %\ %G  %- %<2: %DG %T %ln %Y{ % %U %` %7l %>  %X2 %I %5, %iz9 %F %iwT % b %y%p %~ %p %&u %n %v %z  % %HF %z % % %GE3 %k@ %gM %zZ %g %t %l % %3 %l' %2 %L %n %! % % % %& %! %. %AA %01N %'[ %^h % %& %' % %? %z %g %- %, % %) %6 %bUC %4P %Q] %j %vw %h  % %)" %= %> %s %? %W % %l %  %3 %# %^0 %{(= %gJ % W %d %q % ~ % % %n %) %B %0 %  %u3 % %  %? %9% %T3 %PA %,FO %n] %)l %z %& % %'3 %dx %  %< %: % % %2 %[x % %I. %bI %yV %c %p %H~ %= %da %c %3 %^/  %}L % & %X %uf %V u %+ %}  %& % %, %a %s  %' %s# %R0 %= %K %[ %= % %M %M %S %*_ %F %Jr %s- %l % %? %D %B % SL %Xd %^@p %g %_ %~ %d %^ % M %  %@ %$# %O  %RV %+ %bm9 % G %YU %wc %q %4 %X %L % %' %= %+ %3r %b %l* %l %b^ %:& %S %kG` %:s %w %" % %hy %2 %? %%: %" %(4 %R % _ % %(  %r+ % 8 % E %R %%_ %el %pry %F- %,A %% %7 %]8 %h %  %I %:& %i  %F  %=' %G5 %+C % %- % % % % %kA %m %K; %d  %t. %N< % %V %i %r %m % %! %G)+ %KI9 %kG %C+U %gc %A(q %o % %) % %D %^ %u %1 %h %@ %3  % %V6 %[gD %&S %$a %aKo %! %9n %z % %N %f %h %e %H %  %iY %) % 7 %DE %5S %Ya %bgo %} %- %:B %i %XU~ %{& %u % % % %ET %,() %7 %XE %<S %Q % %  %t % % %f8 %B % %$e %O %* %!U8 %]F %!T %b %0p %~ % %: %j % %I %e %a %k  % %B# %i2 %A %P %I_ %bn %} %k % %u % %C %_ %b % %s %'? %G# %(1 %? %} %p %` % . %pR %G %0 %" %x %< %G %u %|i % %w %w* %8 %YF %eT %2b %p % %RE %j % % %( % %^ %3 %e %)G %5z$ %$3 %B %5Q %^` %o %d~ %x % %B %' %y %^* %37 %(rd %q %~ %=W %w: %bE % % % % % %z! % %d %j %D- %S; %yEI %W %e %Mhs %* %i %ZW % %( % % %j % % %kg  %& %mA %N %G[ % h %T<u %: % %$ %6) %u! %n %#H %F % %} %4  %nn %,& %<#4 %(B %TP %8^ %L>l %Pz % %s- %;Z %Z% %p %G % % %D %%l % %Y$ %. %y< %`J %5f %J %Q %Q %F % %n/ %?M % %  %?  %z %A1 %y? %BL %Y %tq %P~ %uh %] %r % % %k % %v  %(r  %$  %2  %rG@  %N  %jm\  % jj  %_Dx  %J  %  %RH  %b  % m  %@  %C  %6!  %  %r=  %  %  %.  %#<  %9pJ  %m  %9U|  %  %|T  %Q  %  %h;  %,s  %h  %(  %u]  %N  %H  %Z+  %28  %7E  %R  %%_  %"l  %y  %  %S  %  %  %Z  %:=  %  %k  %>  %  %.  %]*  %c7  %D  %EQ  %s-^  %<k  %x  %O  %M  %Te  %  %$  %k  %  %/  %w[  %An  %z)  %E7  %MK  %U  %  %  %+  %   %9Nx % %\ %*5 %2w %i %n/ % %s %\ %_ %  %5 %  %` %ru %0 %0 %U %F %G %D* %g0 %6 %is % %G %&  %hb %)& %3p3 %Q@ %y M %f %s % % %7 %  %YY %H` %> %au % %) %( %0 5 %`B %JV %c %dp %} %#A %? %m % %G %Nj %g %b! %6 %K% %W %> %, %A; %)G %~PS %`_ %,k % x %l %u %d  %$ %L % % %w %|. %6{ %Z % " %e@/ %7J %_#T %a %Jo %z| %s %_ %Q %) %MV %u %*v %i %d0 %J % vW %n/d %Zr %* % v %R % %@  %9Y %j6 %> %R %q %  % %c( %GA %j` %Sl %y %] % %` %i %i %8 %u4 %% % %JG  %R %( %8 %H %u;X %:^ % d %ILk %&x %w %Y] % %C %^s %1c % %I  %) %*v/ %W; % H %V %d %n/r %ru %2 %> %9 % %u$ %G %c! %)d"! %0! %y! %y ! %! %$! %! %L! %! %R! %)d! %" %% " % H" %]" %" %.p" %kR" %" %' # %r-# %K:# %)G# %# %P# %)$ %$ %$ %u$ %N$ %p$ %y$ %!$ %p$ %i% %% %^=% %\lJ% %]:W% %e% %r% %/% %;% %S% % % %% %% %n% %:3& %& %!& %.& %y;& %^H& % \U& %2& %N& %*& %' %I ' %' % -' %^=' %&K' %Y' %Qg' %5u' %n/' %o' %l' %' %s' %' % ( %P"( %^,;( %\J( %[Tr( %aJ( %0( %)+( %( %-( %(( %( %( %) % ) %u%) %$!L) %Y) %@f) %gs) %0) %l) %ka) %r) %2) %0D) %) %) %) %sq) %* %* %* %Q)* %\m6* %C* %[* %k* %y* %Q* %HH* %w* %* %* %s* %8* %&(+ %N+ %$!+ %\0+ %kN+ %z]+ %l4l+ %{+ %[+ %+ %,g+ %+ %+ %y+ %U@+ %}+ %, %c, %]., %=, %L, %gH[, %Bj, %Ry, %7O, %Gu, %, %b, %, %, %L, %-, %- %(- %"0- % 2=- %6V- %5i- %tmv- %- %R- %!\/ %mKl/ %1r/ %3yx/ %Q7~/ %/ %/ %|/ %/ %X/ %0 %QS0 %lD0 %0 %$"0 %2/0 % B0 %q\O0 %\0 %oi0 %7]v0 %]0 %Y0 %0 %0 %)0 %0 %0 %0 %h0 % +1 %(1 %5e$1 %21 %EP@1 %6N1 %Mu\1 %Dj1 %1Bx1 %1 %41 %>1 %1 % u1 %-Q1 %F1 %1 % 1 %N2 %52 %ch 2 %=.2 %oT<2 %IbJ2 %rX2 %Bf2 % t2 %2 %*2 %2 %2 %2 %P2 %6E2 %&R2 %62 %%z3 %g3 %C0 3 %m/3 %b>3 %&.M3 %a\3 %.k3 %(z3 %3 %_Z3 %3 %h3 %4 %{Z4 %)4 %24 % 4 %XB4 %4 %44 %5 %R5 %*5 %85 % F5 %bT5 %ub5 %jp5 %*~5 %G5 %z-5 %rB5 %95 %w5 %i5 %a5 %#5 %i 6 %)6 %z%6 %+]36 %A6 %WO6 %]6 %ok6 %y6 %h6 %6 %Qt6 %W6 %6 %p6 %6 %6 %t6 %K@7 %7 %/7 %?7 %O7 %b_7 %_o7 %a}7 %7 %7 %;7 %I7 %CO7 %(7 %z7 %v 7 %v7 %v8 %X8 %,8 %8 %:8 %s8 %4*8 %9 %3 9 %jX$9 %Ud.9 %I9 %OW9 %$e9 %^yy9 %9 %1O9 %E9 %s9 %+99 %\9 %K9 %^p: %rC: %sWm: %%t: %s`: %!: %: %u: %bc: %s: %s-: %T: %!1; % 8; %E; %R; %_; % Dl; %l; %xc; %Q; %)j; %RP; %T]; %,; %yj; %r < %>< %#< %V0< %#L< %Z< %h< %v< %< %y< %r< %b< %< %t< %< %< %u< %iI= %Kb= %go= %NT}= %]= %_= %s-= %= %e@= %U= %u= %K1= %# > %7> %\%> %Q2> %S@> %N> %N4\> %(j> %\x> %> %> %> %J> %M> %B> %R9> %> %a> %? %? %02 ? %y.? %d0@ %+@ %(@ %qA % 1A %sAA %s6OA %1]A %vzkA %,A %A %A %: A %uA %qA %)A %<+ B %)B %ru&B %4B %uBB %6]B %^kB %?yB % vB %RB %BB %)B %B %@ B %9YB %j6B %B %,)C %C %!C %"D %ZjD %IxD %7lD %mD %D %?D %D %D %D %jD %UD %D %NE %nE %=E %w*WE %QjE % zwE %lE %<-E %)EE %E %oE %E %"E %8E %iME %&`E %Z>E %vF %DF %F %VF %)F %RO6F %9wF %#F %hF %(F %q G %?G %2=)G %lGG %4TG %C/H %VH %H %H %MH %_H %H %H %5I %I %hI %SI %0u%I %O)+I % A1I %T7I %=I %$CI %JI %)dI %$vzI %TI %wRI %I %NI %I %I %I %BI % J %NJ %%J %u3J %/NJ %[J %xJ %|#J % iJ %J %J %nJ %uJ %HJ %J %%J %K %.K %OK %"*K %8K %FK %+TK %GbK %;pK %5~K %K %wK %K %K %AK %xK %pK %K %iK %e L %>hL %yt&L %w<4L %wBL %DzL %jhL %.L %RL %eBL %L %%L %>:L %$OL %L %>L %#L %FL %L %5L %M %M %y M %0".M %*{=M %\GM %WM %eM %PtM %d+M %M %M %M %fM %xM %HjM %zM %wM %T N %5N %3p%N %3N %AN %95QN %aN %~@qN %3PN %kN % N %AN %OzN %8N %(-N %tN %oN %O % O %V;$O %<>4O %]DO %TO %tdO %xtO %8O %qO %ZO % O %F^O %O %O %mO %O %t P %P %'P %96P %sEP %o9TP %$ cP %XP %/P %)P %3pP %5P %tP %P %OzP %YP % Q %Q %:Q %W*Q %e7Q %DQ %?{QQ %?^Q %xQ %_Q %ZQ %I9Q %Q %<Q %Q %R %zR %kR %,R %%iR %vR %)R %AnR %!XR %R %rR %cMR %R %R %dkR %MR %S %pS %S %,S %9S %GFS %SS %;'lS %S %1S %)S %zS %YS %DBS %#S %`T %n T %T %dk'T %M4T %AT %NT %[T %BhT %T %T %gHT %)T %kcU %U %^!U %.U %:?;U %<`HU %7UU %2bU % HoU %]U %EU %) V %BV %#V %0V %RTV %#dV %tjV %LpV %mwV %W[V %)V %wV %"V %sV %V %sV %QW %W"W %ILW %ZW %RhW %vW %W %W %UW %GW %WGW %\W %W %k W %cW %1W %"W %KW %W %X %:X %Ul X %W.X %=` %eL` %A` %3d` %` %$` %l` %N` %-` %_` %h` %  a %_a %43a %EAa %qOa %e]a %Gla %(a %V a %a %d[a %ya %ca %a %-b %Sb %zbb % )b %6b %heCb %Pb %(]b %Pjb %;wb %b %T^b %b %DWb %_Qb %Kb %b %i-b %2[b %;"b %cc %i$c % c %an-c %:c % Gc %?uTc %ac %Gnc %2{c %q c % c %yc %bc %Pc %"d %`(d %`.d %[55d %dEd %@Kd % Qd %J2Wd %?]d %Q2cd %Qid %od %~/vd %E5d %5d %wd %. d %Vd %_d %5od %Q[d %e %<8#e %1e %,X?e %=aMe %[e %fie %we %Ie %Xe %pe %ge %e %U1e %ge %kje %8e %5 f %s:f %kVf %Bbf % of %)|f % f %<f %Af %y1f %-f %J f %R'f g %q g%gP.g %:g@Jgig %suggg %;Xg %g %:qgCh 'J7 h ',7h %K6h0>Jh '/8Nh '7Th %r"_hEvh %E5h '9h '9h-Ehh "4h %zh &@h &@h0Eh #Wh %i %@i %i %F&i %+i %9i %Ci %Qi %M Vi % di %Jii %bi %i %i %U*i %i %Sj %j %/j %=j %HBj %Nj %ŊZj %fj %rj % ~j %Jj %j %Yj % j %Gj %Oj %Bj %$j %=j %j %{j % k %Yk % !k %4k %9k %?Ek %G'Qk %3]k %ik %xuk %" k %k %Dk %k %tk %k %k %n}k %k %k % l % l % 'l %$3l %$@l %Ml %S`l %!ml %J{l %Bl %l %pl %l %l %cm %&m %"Cm %%Om %/\m %Rim %!wm %ۡm %Rm %!m %Em %m %m %Bm %|m %n %n %+n %-n %g);n % &In %Wn %en %sn %tn %qn %Un %n %2n %}n %~n %n %~n %o %o %o %,o %Z:o %Ho % Vo %ddo %Ao %o %o %o %o %o %?o %o %o %kp %'p %6p %Ep %=Tp %'cp %<rp %@p %p %<p %p %8p %p %4p %*p %&~p %[q %q %&q %5q %:Dq %'Sq %^bq % qq %q %q %q % q %*q %mq %tq %q %q %Vr %1r %%r %4r %hCr %Rr %ar %pr %Dr %sr %r % r %er %4r %7s %)s %Es %Ss %as %|s %s %s %7s %s %t %t %nt % u %Ku %F u %L.u %bu %Ru %Ru %u %u %u %u %v %'v %e3v %Av %Pv %߂vv %~v %v %v %&v %nv %<v %w %w %Cw %+w %8w %Ew %yew %{ow %6|w %Uw %4w %w %w %$w %pw %%w %  x %x %*x %E:x %#Hx %5Vx %dx %8#rx %qx %nx %x %+x %x %x %x %x % x %M'x % y %y %(y %X6y %m&oy %~~y %Wy %jy %y %wy %y %y %cy %}y %dz %7z %%z %!4z %Cz %LRz %az %pz %z %.z %z %~z %z %wz %(z %z %2z %{ %{ %${ %3{ %'B{ %Q{ %B`{ %o{ %+~{ %-{ %{ %{ %{ %f{ %{ %{ %c| %(| %p#| %%2| %A| %șP| %?_| %[$o| %| % | %| %]| %| %e| %r| %| %| % } %'} %/} %·?} %O} %k_} %o} %x*~} %} %K} %_} %-} %Y} %U} %}} %\~ %~ % #~ %2~ %A~ %}P~ %_~ %\~n~ %}~ %~ %~ %~ %Ľ~ %~ %~ %~~ %~ %0 %U{ %<" %1 %@ %O %_ %Tn % } % % % %i %( %* %} % %΀ %M! %0 %? %N %] %l %%{ %) %} % %Y %l'ƀ %:Հ %i %߬ %b % %   %/ %8> % M %ʘ\ %pk %z % % %ޘ %  %Ł %ԁ %{ % % % % %$+. %c= %[L %r[ %gj %y % % % %  %Ă %ӂ %;" %B % %F % %a- %ݚ< %K %Z %i %x %( % % % %à %҃ %/ % % %- % % - %< %OK %Z %i %x % % % %] %;Ä % !҄ % % %& % %F %- %< %$!K %Z %si %x %| % % % %Å %i҅ % % %I % %/ %M, %~; %WJ %sY %fh %% % % % %bÆ %҆ %1 %* % % %$ %Ӽ, %; %)J %Z %}j %1z % %  % % %aLJ %գև %[ %x %+1 %"? %M %,[ %mi %w %C %C % % %^ˈ %2 و %ُ %( % %y %*K %^X %k % % % %ɉ %Ρ݉ % % % % %r$ % %2 %@ %N %\ %Nj %jx % % % % %9̊ %) %A % %2 %G %GT %ϲ{ % % % %  %Nj % ԋ %n %A % % %_ % %+ %8 %NE %R %_ %l %ny % %* %c %& %K{͌ %өی %| %' %  % %p& %[#3 %@ %M %}\ %mk %n % % % % % % %P{؍ %h % %( %  %$ %1 %> %0K %X %# % %n %A̎ %dڎ %+ % % %$} %  % . %< %бJ %X %f %t %r %k %H& %a % %ȏ %֏ % % %H %Q  % %* %8 % F %T %b %fp % '~ % % %& % % ɐ %֐ %K{ %n % %M" %. %&: %ҝG %ԊV %c %c % %I % %ʹȑ % ב %Y %m % %O %y" %1 %@ %O %^ %m %.| % %3& % % %ǒ %֒ %-' %v %I % %! %0 %? %8O %s^ %'m %| %3 % % %؝ %nǓ %֓ % % % % %" %2 %? %L %Y %f %)s %j % %{ % %Δ %Q6 %C % %R %ϓ  %(Q %P^ %ik %x %* % %# %0 %= %J %W %~p %} % %h %˗ % ٗ %͸ % %| %6% %\4 %S %s|c %p %~ %Ē %t % %h(Ș %}֘ % %  %# %| % . %ˤ> %N %n^ %pl %z %k %K %G %LÙ %h(љ %ߙ % %ۿ % % %* %}X %>e %{r % % % %ń %^ % % % %C( %J6 %C %_ %k %x % %[Û %zӛ %ٛ %ߛ % %  %n %# %0 %,L %MX %:j %2w %R %! %l % % ל %i % % %R  %! %س, %8 %D %Q %^ %^( %# %n % %ٝ %0 % % %{ % % %f  % %( %2 %? %բM %Z %q %~ %B %  %_ % %xΞ %+۞ % %" % % % * %ڙ8 %^E %R %z_ %& r % %^ %' % %# %Ÿ %mП % ޟ %J % %  % % %B# %m1 %H> %[#K %X %}e % r % %$ % % %X͠ %l % %; %  %! %. % ; % H %[#U %nx %b %h& %$ % % %ޡ % %E+ %k % % %#+ %9 %sF %OS %t` % %R % % %ע %l % %t %  % %* %6 %C %X %e %| % %j~ %M % %ǣ %ԣ %M % % %C %͔ %6 %C %P %g %t % % % %  %+Ȥ %!Ԥ % % %a %h %C %WP %t] %/k %x % % % %g %G %֥ %L %~ %} %  % %M+ %8 %m^ %tk %(x % % %~ % % %Hͦ %. ڦ %% %R %C % %I) %C %Q %}^ %^l %y %& % %} % % %Eȧ % ֧ %W  %ŭ %  %J  % %$ %&1 %? %L %Y %&g %t % % % % %Ǩ %xԨ % % % %K  %f %n# %0 %Z %6g %;u %ߍ %~ %6 %8 % %6é % ة %6 % %  %W(9 %$E %S %a %o %~ % % %+ % %#  %O % %6ʪ %ت %} % % %Ľ %- %$; %eI % W %f %:(t %I %ů % % % %ɫ %_׫ %Z % % % % %. %N< %J %!X %Rf %)t % % % % % %~(Ȭ %r֬ % %s % % % %\* %"8 %{F %0T %"b %p %߳~ %  %# %2 %ˉ %ŭ %tխ %A % % %V %. %* %8 %F %T %b %p %~ % % % %w %Į %Ү %Y % %W %= %) %7 %E %S %a %Bo %} % %  %ů %ӯ %^ % % %  %ۤ %m( %6 %D %nR %-$b %,r %( %P %~ %' %,° %Ұ % %v %h  %΂ %( %R %<|` %o %#~ %; % % %4}ñ %{ѱ %2+ %Շ %& %' %%/ %W> %b %/l %z % % %@ %2" %b %β %ܲ %4 %  %  %n %9" %0 %> %L %l %ty %ө % %ơ % %dz % %% %ē % %72 %? %qf %s %# %2 % % % % %δ %۴ % % %$ % % %) %6 %2C %*P %"] %-j %w % %q %#õ %ݵ %" %* %$ %1 %> %K %}X %nq % %i %b % %^' % %tǶ %(Զ % %L# % %z %M& %" %ɹ5 %ϚC %}P %] %j %4w %x % % %. %c %ŷ %ҷ %߷ % %n %? %ߢ %d$ %1 %+> %PK %0Y %U&r %@ % %q %~ %$ %Ը % % % %  %/ %( %Ľ6 %D %R %` %0n %| % % % %Ŏ %¹ %й %޹ %b % %Z % %$ %2 %7%@ %aN %}\ %j %x % %? % %! %l %PҺ %_ߺ %w %t %^ %  %:# %4- %ޘ; %I %] %Hg %t %K % % % % %Ȼ %ջ %} %6 % % %{ %u, % 9 %F %)S %` %n %| %" % %P %3  %ü %Ҽ %% % %H %3 %+& %. , %G; %J %'Y %o %'y % %~ %=* %  %ѽ %h۽ % % %̪ %( % P %"g %_u %8 %  % % % %J*ɾ %׾ %7 %. %) %y %u %+ %P9 %eG %)U %Mc %[q % %6 %* %i % %sʿ %]ٿ %` %ё % %9 %/ %9 %,F %}S %` %mt % %V % %  % %  %% %$ %գ %l % % %  %! % . %z; %ӌM %Z %g %~!t %5 %$ % % %؋ %C %> %E %  %c %$ %  %- %`: %oG %V %c %} % %% %j %  %] %F %C %z  %M %!- %9 %rG %T %a %n %Y{ %ө %+ % %n % % % %" % % %+ %9 %G % U %d %q %~ %h& % %u %>~ %n % %}  %` %b' %4 %A %N %[ %Vh %u % %W" %ʆ % % %/ %J %P % %p %m   %- %n: %%G %cT % b % %, % % %X %& %@ % % %  %  % 2 %> %K %\^ %=k %~ %_ %t %+ % %" % %< % % %4 %/ %( %_6 %nW %< d %$q % ~ %c %} % % %  %l{ % %I" %+ %o8 %Q|R %_ %n % %,  % %! % % % %؜ %. %! %/ %ܯ> %W L % % % %# % %؜ % %/ %E %# %h %) %< %I %mV %өc %8p %՞} % % % % %؜ %:& %v %= %. %i %  % %u& %3 %A %O %}] %k %0 %X %r %) % % %N %l % %6 %B %X %e %Pr %$ %] %P %b %P %v %$ %  % %, %9 %%F %6S %a %q %w %} %  % % % % % %o$ %  %} %h %) %) %k %  %t. %{P %\] % j %cw %8# %[ %V' % % % % %i %-! %/ %9 %F %S %t` %~m % %5 %a % %n % % % % %P % % %+ %$8 %}R %J_ %~l %y %k %& %( %+ % %b % %C  % % % %[ %- %ǠB %O %w %4 % %X % % %% % %B % %H, %? %V %c %q %~ % % % %n % %+ %( %2 %j> %yd %T{ % % %% % %n % %X %y( %<6 %T %&m % { % % %Y %, % %| %M %  % %" %0 %^> %ǻW %Fe %s % %V % %:+ %& % %* %f %! % / %= %K %Y %g %u % % %Є %  % % %߅ %  %\ % $ %2 %A %O %^ %ږl %z % % % % %K % % % %M6 %^J % %T %b %H&p %2~ % %z  %* %\ % %} % % %` %  % %& %4 %=W %e % %" %$# %~ %! %9 %| %۶ % %p* %w8 %UT %b %Fp %9~ % % %8 % % %% %W % % %y&  % %' %6 % E %T %Zc %Jr %g %< %d % % %̵ % %c %{ % %}& %5 %D %ɑS %b %^q %n %# %n % % %+ %- %n %0 % %  %% %4 %C %-R %|a %xp %& %N  % % % %J %m %u % %+ %< 9 %H %Z %n %n %@ %& % %? %Ɉ %O % % %m % %  %;& %$- %!4 %v; %B %2J %W %&d %q %^~ % % % %r  %r % %> % % %= % %e %  %` %  % %-# %$) %/ %%5 %]; %A %dG %M %yS %Y %c_ %ee %@k %2q %w %} % %O %1 % %K % % % %t % % %u %^" %C %" % % %| %& %ں % %J %  %  %Ƕ %F %  %:1 %N7 %= %C %I %O %̏V %?d %r % %[ %R % % % %O %Җ % %U# %~ %  % % % %}4 %)B %6*^ %l %z % %P % % %6* %  %. %Q % %ܪ % %n# %C1 %@ %O % %) % %<  % %  % %t) %7 %E %S %=a %no %h} %b % %  % %( %ĩ % %8 %ĩ- %,L %n] %ac %i %śo %˭u %{ %^ % % %] % %j  % %m % % % % %F, %: %H % V %d %Qr %4 %& % % % % %8 % %) %n % %" %p1 %@@ %O %^ %m %x| %<} % % %" % % %1 %? %M % "a %oo %+ %u % % %T% % % %. % %  %-b %l %y % % % %A % %[ %' %u %2 %5? %L %$Y %@!f %h&s % % % % %+ % %7 %& %m %\  %! %. %; %U %Yb %mo %| % %5 % % %t % % %  % %' %4 %A %ST %a % %k %\ % %' %44 % G %!T %4a % } %X %! %d %K % % % %  %n %q % %, %(: %H %k %t %C %H % % % %O %# % %h| %k %$, %: %mH %%V %j#d %d % %J %w % %p % %t % %ݾ- %}V %c % v % %ɚ % %G %# %_ %t % %M %Ĥ %u! %J. %; %H %U %b %3o % | %$ %K % % % %) % %=  % %x' %}5 %C %Q %_ %m %$ % % % %p % % % %ރ %: %C  %U+ %w) %7 %FE %OS %:$a %o %T} %; %Յ %+ %q  %W % %! %ۄ % %p %$ %3 %qB %d Q % g %v % % % %1 %F %f %P %  %6 %$ %Ĥ1 %> %K %|X %|e %r %k %h % %- %o % % %} % % %% %O" %h0 %> % L %Z %Th %v %H % % %! %& %ˮ % %' % % % %, %, %: %H %V %}e %t %% % %C % % % %r %ϙ % %  %^ %s) %8 %G %$V %e %Rt %} % % %G % % % %٩ %c %! %) %w 8 %LG %qW %_f %u % % % %v %~ % %y %U % %" %t: %G %as %p( % %m %, %2" % %  %9  %# %& %#3 %=@ %TM %nZ %g % % %~ % % %j %a % %m %~, %~9 %)S % ` %~m %}z % % %} %k %" %p2 %8 %> %\E %O %\ %i %v %$ %X %L %n %ө % % % %  % %ح' %ʽ5 %Q %T` %.o %~ % % % % %  %K % % %x %" % $# %2 %A %Q %}` %2o %~ % % % %># % %5 %t %v %0' %4 %A %O %Y % e %q % %q %ϟ %H  %1 % %} % % %, %@ %UM %tY %${ % %( %r % %q %< %  %6 %}C %HP %] %j % %h % % % %/ %U % %Ÿ  %9 %L$ %1 %K % X %e %Gs % %q %B %U % %  %* %# %'1 %۹? %M %l[ %^i %d%v %} %$' % %ȅ %8 % %! %7 %' %U* %*7 %D %Q %^ %k %y %{ %  %M %v % % % %z %  % %  %  %?+  %8  %fE  %x  %   %  %r  %  %*  %U  %  %  %  %յ  %  %  %--  %:  %G  %'T  %pb  %o  %K}  %  %7  %S#  %N  %  %  %  %  %  %  %  %  %'  %4  %A  %!N  %[  %h  %&v  %  %  %0  %  %  %r  %ɒ  %  %3  %  %(  %  %,  %:  %I  %W  %e  %s  %$  %(  %  %  %(  %  %  %  %(  %  %  %P&  % *3  %@  %M  %W[  %#  %  %  %  %m  %  %ȼ %5 %nC %ZR %s % % % % %: %$ %  %t %  %Ѝ %j( % q %x} % % % %  %V %,| %" % %{ % % % % %=) %A %NM %c % o %d| % % %# %ӹ % %9 % % % % %$ % 2 %'@ %N %\ %j %Ex % % % %  %" %J %{ % % % %0 %[= %qP %^ %k %Ԁx %) % % % % %% %" %L % %7 %" % %" %/ %< %I %"V %Ud %r % %F %M % % % %O % %J % % %  % %  % % %z %| %[ % %; % %P$  %< % %J % % %[ % %| %V %; %@$ %R2 %@ %PN %h\ %j %x % %L % %n % % % % % %D %! %0 %> %QL %k %sy %+ % %] %? % %$ % %  %j  %• %ݼ %" %#0 % > %L %Z %h %*v %K %[ %i %nw % %΀ % %u %; % %" %*0 %7m %{ % %<% % % %V % % %P % %r %Q %A # %1 %? % M %[ %~i %w %P} % %Q % %b % % %( %x % %- %X< %[K %Z %Qi %{x %& %~ % %X %- % %d# % %V % %̿ % %x %& % % %O % %ʁ %/) %* % %n % %~ % %'  %}  % #  %^1  %?  %yM  %\  %Bk  %z  %ı  %  %  %  %  %  %Y  %  %s*! %! %! %.! %f=! %uL! %[! %F(j! %! %! %! %g! %" %B" %y"A" %N" %[" %mh" %gv" %R" %" %" %" %" %”" %" %" %" %P{" %S # %# %i&# %4# %B# %yP# %^# %l# %z# %# %7# %# %}~# %1# %# %ј# %# %$ %*$ %}+$ %8$ %E$ %DR$ %_$ %l$ %y$ %E$ %$ %?$ %$ %;$ %$ %c$ %<$ %$ %% %Q% %% %B-% %;% %<I% %W% %ue% %s% %< % %o% %6!% %-% %ʇ% %w% %% %_% %% %Z& % & %m& %&'& %C& %0_& %2m& %|& %& %{& %}& %X& %& %& %& %*& %' %)' %)' %6' %hN' %[' %k' % y' %`' %Ѓ' %ێ' %s' %ɣ' %d' %y"' %Я( %( %b( % +( %9( %9G( %OU( %Rc( %q( %B( %( %D( % ( %1( %X( %ן( %b( %(( %( %  ) %') % ') %J) %iY) %r) %) %) %) %X) %}#) %) %) % ) %) %p) % * %:* %"* %/* %<* %I* %µV* % c* %Op* % }* %* %i* %** %* %* %,* %|* %* %^+ %&+ %!+ %.+ %;+ % H+ %U+ %b+ %o+ %|+ %+ %+ %_+ %+ %+ % + %{+ %+, %, %3(, %2, %\, %, %:, %#, %RU- %- %* c. %/ %T/ %n/ %}{/ %/ %t/ %H / %X/ %/ %/ %/ %&/ %%u0 %2 %?3 %3 %3 %3 %4 %U 4 %{4 %#4 %ʝ5 %5 %5 %5 %6 % 6 %Y6 %}*6 %׾C6 %P6 %_6 %n6 %%}6 %6 %Z 6 %t6 %,6 %%6 %}6 %6 %7 %?7 %h7 %037 %@7 %M7 %ϾZ7 %g7 %3t7 %S7 %Է7 %@7 %z7 %7 %7 %77 %`7 %7 %?7 % 8 %8 %$8 %08 %F|<8 %&H8 %U8 %mb8 %%o8 %h|8 %38 %58 %'8 %8 %(8 %8 %t+8 % 8 %8 %U 9 %'9 %t19 %۰>9 %L9 %`{Y9 %tf9 %;s9 %Y9 %9 %}9 %n9 %h&9 %9 % : %': %H&4: %}A: %' O: %]: %H&k: %y: %: %H: %: : %Z: %$}: %: %W: %: %: %k; %; %=; %I; %V; % `; %y; %&; %; %; %x; %r; %; %~; %:; %; %v< %٥< %%= %e5= %;= %uA= %bH= %U= %b= % o= %p|= %)}= %#= %]= %= %= %= %h& > %E> %%> %h3> %A> %}O> %%]> % k> %$}y> %A> %> %> %> %k? %U? % @ %+*b@ %}o@ %~|@ %@ %@ %M@ %@ %@ %U@ %@ %@ %@ %QzA %A % A %A %֗A %/A %X| B %B %$B %B %>B %B %B %өB %n]C %jC %@!wC %*C %C %!C %xC %C %mD %'D %M4D %BD %}OD %\D %/iD %D %D %D %D %?D %7D %dzD %D % E %+*E %$%E %7 2E %AE %E %E %E %7E %E % F %mF %(F %6F %RDF %RF %}pF %~F %F %F % $F %ŋF %F %6F %mG % 'G %OG %QlG %$yG %8G %G %G %G %G %G %{G %G %nH %F)H %6H %CH %PH %8]H %jH %wH %H %H % H %H %H %H %!H %H %H %H %RI %I % I %8I %ͷHI %VI %YpI %8~I %I %I %I %lI %xI %5I %I %I %  J %+J %`:J %iIJ %|XJ %? gJ %vJ %XJ %J %ָJ %)J %EJ %cJ %zJ %J %V K %K %)K %W8K %GK %VK %PeK %%tK %K % K %K %K %K %K %K %'K % L %L %/3L %FL %SL %z`L %8~mL %89N %]IN %%ON %q)UN %A[N %bN %N %jN %N %CN %N %N %\N %ћN %N %A O %O % ,O %ْ9O %~FO %c SO %K kO % wO %ױO %O %O %ڈO %O %}O %:O %O % O %aP %P %^P %{+P %%9P %*GP %!UP %cP %qP %$}P %P %G%P %FP %4P %P %P %]P %P %P %#| Q %Q %u'Q %"5Q %CQ %'QQ %~_Q %mQ %{Q %Q %άQ %Q %&Q %?Q %Q %c*Q %hQ %RQ %u R %R %5*R %9R %'HR %7WR %fR %` uR %kR %R %pS %| ~S %S %AS %S %HS %S %S %شS %S %T %߸T %#T %q1T %?T %PMT %[T %jT %xT %bT %'T %T %qT %T %T %WT %T %`}U %W U %}U %X,U %ƒ:U % HU %VU %dU %rU %$U %U %ԠU %j U %U %U %uU %;U %U % V %V %,V %] %~L] %< Z] %rh] %ېv] %|] %] %3] %0] %B] %] %O] %{] %] %-^ %1*^ %s^ %,^ %:^ %*J^ %3Z^ %Yw^ %^ % (^ %^ %e^ %%^ %]^ %^ %]+_ %_ %_ %i,_ %H;_ %I_ %W_ %e_ %2s_ %w_ %_ %b_ %ز_ %_ %"_ %_ %__ %/` %##` %c1` %?` %*M` %j` %y` %` %I` %n` %k!` %` %K` %` %%a %a %n$a %>?a %mMa %-[a %H&ia %wa %a %a %a %Ha %: a %Za %s~a %;a %a %b %c %@Lc %=Zc %qgc %8uc %{c %8c %c %c %c %c %"c %c %]c %c %d %9d %YLd %J*Yd %@fd %Ksd %d %d %* d %d %d %d %d %Rd %Jd %&d %d %d %<d % e %ke %w'e %+e %e %e %2"e %e %" f %)f %6f %R{g %Fg %g %g %;g %Sg %g %g %g %g %g %h %n%h %^ h %h %h %h %.%h %,h %Fh %b&\h %th %h %h %h %h %h %~h %h %h %h %i %ni %0i %=i %}Zi %gi %6ti %i %i %Ui %ni %i %i %i %i %i %=i % j %j %Ø(j %"6j %@Dj %Rj %`j %׫nj %l|j %j %j %'j %7)j %G!j % j %j %Yj %jj %$k %gk %e$k %\k %mk %#sk %4yk %Uk %k %k %.k %=k %u{k %k %k %k %Ԕk %k %k %k %[)l %Rl %h+l % )l %9l %Gl %Vl %sel %tl %l %l %l %(l %tl %*l %'l %Il %l % m %ēm %#m %B3m %Cm %nSm %Lcm %4sm %m %|m %*m %m %7m %|m %pm %m %m %Fn %,n %K&n %6n %%Fn %)Vn %fn %!vn % n %n %rn %n %n %Vn %n %$n %ցn % o %o %#'o %_6o %3Eo %do %qo %o % o %o %|o %o %*o % o %o %o %Bo % p %p %֮&p %}+3p %@p %ƌZp %;ip % ~p %9p %p %=p %{p %p %*p %q %q %Kq %Xq %eq %{rq %Qq %q %-#q %|q %q %q %q %Aq %q %^q %r %r %Ør %}(r %5r %PNr %zr %r %r %+r %hr %4r %r %+r %(r %r % s %As %#s %0s %Ø=s %Js %cs %s %Ws %s %s %s %t %Ӑt %*t %h*t %7t %Dt %Qt %Qt %t %t %t %u %Ӑu %6u %Fu % %Lu %Ru %SYu % gu %uu %u %3u %$u %u %lu %*u %Nv %.v %xy %!y %y %y %y %y %?y %ty %Dy %y %z %>z %{z %-z %};z %s#Iz %Wz %ez %tz %z %+z %z %ܑz %z %z %l{ %R#{ %3{ %9{ %@{ %%O{ %z\{ %i{ %v{ %{ %{ %ž{ %{ %*{ %{ %{ %| %~| %| %V(| %5| %[B| %AO| %7g| %zs| %}| %s| % | %L| % &| %| %| %U| %–| %&| %| %0| %&| %| %Y } %} %'} %94} %A} %N} %p([} %8i} %6*v} %} %j} %;} %} %} %+(} %} %‰~ %~ %~=~ %J~ %)X~ %r~ %~ %~ %~ % ~ % ~ %~ %~ %t~ %n %) %~  %Y. %k %_x % % %' % % %1 %V %  %1 % %+# %"1 %S? %N %)h %Zu % %  %M) %rʀ %׀ %< %[ % %  % %% %2 %? %L %Y %f %s % %t %x % %~ %x %^ ΁ %]ہ %I~ %~ % % %w} %) %}%6 %C %P %:] %yk %y %E) %j %> %~ %  % %d %' %- %3 %G9 %? %NE %K %Q %X %Ne %  % %6 % %n %̓ %} ڃ % %, % %\! %i/ %= %K %͋Y %g %u %! %v % %d % %Ʉ %؄ %  %Y %Q8 %D %Q %^ %(k %x % %_ % %7…%˅ %  %gQ %G %aSfo % %˕ %K ': '9L (c ':  ': %@EJ ';N ':WH` (Ik '<o 'z<v %T %K %NÇ '<LJ '<̇K݇% "G; %F &5K &K  #] %Q/ %]; %/E %mS %ŌX %Wnf %Jp %2~ % %Wo %Cm %.4 %Ip %$5Ȉ %͈ %qۈ %C %JkQ %hV %nb %55n %clz %Z %W| % %[ %U %‰ %g2Ή % %i % %a % %+ %v %3T) %:5 %[0H %sM %l5Y %e %{q %/} % %!x % % %A; %-Ŋ %>ъ %1 % %̈́  % %# %P0 %u= %uP %KJ] %}k %v=x %u %| %?1 %uNj %9 %2>  %c %V# %,T0 %> %CK %,TX %v %?M %Zg %o %9 %, %+ʌ %X، % %u %- %7 % ~ %d, %9S: %,7H %UV %md %Vms %hU %, %- %Zg %t %pȍ %#~֍ %&t % J %] % %O? %Ei* %RG %sV %ze %Rt %m %z %vo % %w %kΎ %L %t` %^  %O %) %~8 %lG %=V %Y>e %2t %a %f %7 %? %s- %MΏ %ݏ % % % %R %q %$Ú %=Ӛ %C %s %" % %F# %S3 %3C %nS %W;c %Rs %0 %> %S2 % %vЛ %Qߛ %7 %. %_  %t %7* %w9 %OpH %W %{f %UXu %- %t %- %3 %j %jbϜ %?ޜ %wV %S %q  %- %ug) %A8 %+G %rV %e %wt %3 %m %| %l %N@ %ϝ %Zޝ %5 % %  %. %X7 %.F %=U %~d %MFs %+F %Q\ %w %4} %R %3K͞ %Mܞ %? %& %n  %RO %K' %ʏ6 %6E %WT %gc %5tr %? %= %f< %T %v %q̟ %=۟ %O %< % R %+ %d9& %D5 %~eD %rS %b %|q %k % %i %h %zc %}Kˠ %^ڠ %WE %{ %W % %z% %f4 %jC %7qR %sa %>?p % %)Z %w %b %i %6ʡ %n١ %: % %} %e %C$ %R3 %&OC %6R %`a %p %c %1 % %P %\E %M_ʢ %O٢ %y %q~ %f %qN %u% %+4 %ZkC %}oR %=Ka %Bcp %} %ec %? %a % %{ʣ %B٣ %/ %= %CT %y %W$ %O33 %NB %`Q %R` %-o %Q~ % %~ %e %cʤ %v٤ %&o %; %` % %Ζ$ %Ko3 %CB %vQ %U` %o %O~ % %, % % %Bͥ %fܥ %< %S %E  %B  %/ %d % pr %2 %b %u %~ %^: % %cnK %yX %_e %Cr %sL %&7 % q % e %9Ī %Ҫ %+ %J %t, %F %Y %K, %V[9 %F %CS %` %bo %uC~ %&7 %?| %1 %YN %7s %]ū %&qҫ %+ %O %k} %^ %ID  %68 %E %AR %Qx_ %Dl %X %k %&7ͬ %L %u % %y  %'y %,& %54 %2B %LP %O^ %3Fl %4z %O %z{ %Q[ %P %.r %έ %Eܭ %] %cn %[ %gd %ߐ" %W0 %8g> %%\L %RZ %h %Yv %_ %ؔ %& %eT %Kî %T7Ю %Yݮ %3 %+ %&7 %A %p6 %LB %N %7A[ %D5j %dw %9 %b %1 %xů %Zgү %BF߯ %st %eh %b %br %0, % %l %> %LJ %:g % %6 %+cɱ %lֱ %ז %#} %b %l %Ɖ %[ %8a %a`β %ML۲ %K %44  %R %Fq' %OS5 %\cT %,c %r %9 %y8 %g, %x %Y˳ %9س %\ %k % %+k" %j0 %Fq> %MZ %,j %ąz %E %v %. %] %[ƴ %{Դ %  %z % % %@+ %W9 %WG %݇\ %;^i %IDv %+k %S1 %=]ȵ %dյ %`/ %8 % % F %\( %fj5 %H %|U % Fc %1p %|} % %b %S %A %8l %|Ϻ %R %W %/8 %s %S %8 %" %ID/ %,< %jI %<V %{b} %U %8 %6 % %E_˻ %ކػ %] %c %Ë % %A %, %&7O %ʏ\ %bi %5v %{ %? %\ %N~ %)μ %.ܼ %O %9\ %s %hn %? %4* %F7 %7y %<_ %uw %3p %^ %[ %̽ %ؽ %{ %DL %!C %l %4Q+ %-8 %(E %9\ %!Ci %lv %( %!C %l %1 %n; %@ؾ %M %ւ %)m  %B %C- %C: %hG %ք^ %y|j %5v %T %(b %p % %Ba %GO %yW %{  %9 %& %T5> %ScJ %`V %5b %Ax %] %- %- %K %E %E %8d %o %- %MF %}V  %N %_& %3 %,VA %e[ %th %u %c %Xv %2- %V^ %] %C %c %+k %9 %t` %r5 %<" %/ %Hl< %TI %vV %wc %:p %]} % %s %1S % %3 %` %]o %T %m %o %o  %j. %; %R6H %Q}U %Pb %&7o %/| %O %/ %B %6 %X %/ %"@ %Xt %/ %\C$ %/1 %cn? %b % %ֈ %S %jb %? %cn %? % %HZ %Q %T %. %q %/ %a$ %,@ %jbN %?\ %wVk %y % %b % %} % %r %M %w %|F %ce %l %T# %N1 %l? %sM %0\[ %/dj %[y %GY %i %ko %M %f %q %y %Q %r %\ %• %5! %e/ %.= %K %oTY %4xg %fu %7 %+ %\ %I %| %)P %_6 %zk %,M %4 %0 %Q %m- %TT< %rJ %gX %af %t %x %} %#f %Ab %M %^ %w7 %&U %WW %-K %Hh %b %_* %l8 %wF %gJi %ls %b %/ %X %g %R %x %Έ %T= %tl % % F, %8: %6UH %nV %Ed %sr %qn %r %&7 %2 %mS %wQ %fZ %v %v %iq  %~O %+ %~CG %VMU %.0c %0r %R %;, %>r % %ކ %_ %Q\ %, %q< %" %3G %0:U %ui %eq %M< %a %oy %&C %ND %i] %, % % %`~ %? %<, %l: %VhH %&7V %?3d %9Zr %v %! %~ %F %J %cn %C %C %d}  %}# %8F %:S %` %~s %N@ % % %ג %~ %6 %n %N %J %\ %/ %^) %k`6 %C %3P %y] %Yj %Nbw %<: %Ζ %1 %} %8d % % %.t %: %1+ %Ζ> %}e %Wr %lu %rk %, %&7 %z %5 %z %L % %~ %0? %@z %.  %ff- %R: %6G %.T %_a %gn %Y<{ %Dr %.[ %2 % %&7 %-l %lD %c %6k % %F %z %U5 %F3C %3Q % _ %-m %%{ %0 %\f %d\ %jb %? % %l %wV %h %S %ug# %A1 %h? %J.M %[ %wi %^7w %q %OE %> %k %ue %'r %a %~e %V %̓ %lA %, %- %Tr; %wI %/W %gMe %ɑs %/z %S %7 % %F %D[ %3 %n % %= % . %< % R %lX( %5 %\B %cnO % -\ %Ki %N|v % %+ %f %F %Q %- % %,Y %Nl %9 %)Z %67 %JA %g[ %qFe %Y9o %/y %[ %, %b %MR %: %7 %.g %O %0f %! %  %v %E  %1- %^R: %jG %6T %^a %n %\Y{ %46 %:f %KP % %yP % % N %= %5 %dx %{  %1j& %3 %9@ %M %ь[ %_sh %[u %, %9 % %Zg %d %U %ҏ %S %* %Q" %;; %xH %7U %ayh % =t %Uy %]l %j %b %i %7 %- %v %< %+k" %_/ %PM< %I %QnV %c %[p %Cn} %> %[q % %2 %. %Z %@ %cn %[ %;` % %( %e^4 %3A %lXO %a %$v %} %[5 %e %j %]T %K %F % %D %s %V %@) %n5 %aA %YM %&RZ %cng %9Tu %@ %ʐ % % %9 %f %o %Y]  %. %( %[5 % bB %P,\ %gi %&7 %x %v %3 %Б %cn % %m %l@ %X %>+ %o9 %MH %V %S %3 %cn % % %l@ %&= %+j %nh %g  %& %]F3 %qF %S %S` %Jm %-z %A %cn %dk %{ %m %l@ %B %Z %3< %N %Yu  % %$2# %~0 %K= %7K %{rY %L-g %ou %p %2 %hQ %/ %D % z % %n % z+ %u8 % zO %|[ %ag %{ft %g % %zN %4 %_ %i %G] %R %}. %: %4  %p. %  %|& %jp, %f3 %@ %,M %Z %Th %T{ %U %uX %k> %+ %>/ % %9 % % % %d+ %uE %)N] %52j %y %E %~ %~ %1 %cn %F %- %` %\ % %?7 %&7D %cnQ %J^ %k %)x %v %@ %F9 % % %+k %k %f- %3 %k % %/ %A{, %R9 %BF %6oS %` %'{m %nz %t %Q8 %2 %4C %+} %: % %LX %6$ %v@ %#jS %j %f %V %A. %| %L % %5 %G %[ %?1, %M`8 %d^ %sdu %+} %: % %FP %&7 %#j %6 %d" %<0 %TsN %Cg %u %D= % %4 % %P %J %!p % %L= %K %,* %98 %BUQ %e_ %rm %yn %*p %j % % %3 %׆ %?  %6 %u?) %A7 %uE %mS %qa %[o %q %0k %^1 %E %X %_V %2 %8 %,_  %ā %3' %Zg6 %D %cnS %<a %7o %6} %? %N %c %r %} %s1 %~ %O+ %t? %ÓI %<b %Op %7 %> % %- % %" %,  %Q %J' %.5 %4C %_ %Lm %{ %oU %l %o %1 %8B %z1 % %` %x %u %s %f# %ڋ2 %x>A %P %r_ %&4n %D} %J %` % Q %w %pb %MQ %z3 %0 %+ %:" %1 %.@ %7.O %Q9^ %Om %i| % % %&7 %"> %E % %} %8X %T %o %! %60 %t? %N %E] %H4l %^[{ % % %YU % %`Q %` %Yj %D %B( %]K4 %dv@ %0vL %.eq %3Z~ %*< % %-> %*< % %P^ %-> %0 %Ht %^ %TU' %]6 %7E %^S %a %\ho %{ %F %F %f %M % %h % o %| %y` %r7 %nE %S %9a %?o %} % %v %q] %} % x %u %| %cn  %F# %O5 %4WS %Y| %&8 %j %Zg %*? %n %H^ %ƒ %ـ % f %R. %/, %E9 %ZF %XS %h.` %!Em %Xz %Z %B} %< %p %1 %z< %B7 %Y~ %{ %\W  %g. %E< %cJ %|X %?f %Zt %EE %Y\ %q6 %g %/U % %| %Í %+J %u %0 %5" %X0 %9> %4rL %YZ %ch %E<v %? %k %~ %o= %2 %pC %z %L %|u % %i1 %) %S8 %vpG %WV %se %mt % %C % %z %] %2n %< %\ %r  %<- %7: %fBG %ET %!Fa %qn %r8{ %, %C %s{ %[a %_ %K %M %h %t %2B  %n % O( %y6 %D %DR %5` %Ƅn %C| %r %  %^Z %]_ %jt %/ % %L %(v %@ %T %M1$ %{m2 %VJ@ %^N %e\ %Bpj %`x %s %w} %/ %u %@t %x %i %s %'B %> %| %Z- %< %;K %#|Z %_Xi %Px %M %9 %, %R %0 %T %YD %L %f4 %J %  %-< %5K %Z %4i %Mwy % %9Q %x %,a %o\ %i %]- %7 %K %%z %i %M % f] %cj % %e %AX %" %dS %2 %)3 %| %9u %&7 %lX %! %A. %-G %WT %Zga %&Ln %V %z %S %- %o %mP %n %-  %)- %cn' %^@A %)-T %M %s %E %X %~ %u %77 %t %hQ  %Y %$ %;0 %h= %!oJ %;X %hb %Ćn %zz %o % %xB %֐ %/ %x %Y  %L %d& %(64 %_H %AU %W`a % %y % %[O %o %g %R{ %aO' %G= %YJ %^{W %Ld %dq %(6 %c %` %m %Z %c %8 %x %GS %l %]+ %\8 %ɎR %_ %`0l %`z % % %xU %l %Gz %cn % %GN, %R: %SH %dV %N/d %d>r %ܓ %9L % %ma %2 %Yx %P %Td %w %r  % % %x2 %M:! %)E' %_3- %%w3 %j9 % ha %[n %B{ %p %M %B % %Z % m %f %A %wJ %_ %jb  %? %^' %:4 %1B %8O %y\ %uo %-l| %ff %^^ %TC %4 %\f %>4 %Tr %A %y %N) %l6 %ݕC %]P %Xz_ %:@y %z %= %K %7R %1 %+ %< %fm' %k< %.|H %UU %4 %&7 %4V %i %U %le %s %o& %{g, %^L2 %8 %E> %eD %J %H>Q %{Xb %}h %}n %t %z %+, %6 %i %L %u %9 %d %. %D %&t %w %P % " %[: %tF %\ %qh %/u %ډ % %q| %S %u %c %h~ % %8 %; %U %O+ %m9 %79G %mU %Rc %7q %2 %e %.s % i %( %r % %S %S %g %ގ %m %q %.H %yU %ph %Lv %b %. %C %l %t %p %b %m % % %W %xS %\  %BV- %U: %*5G %YT %ba %sEn %i| %'u %d %O %o %w % %ہ % S %k %` %qZ %@ %|J %c  %a %`z& %e4 %%B %UP %#s^ %:yl %E2z %JB %j %= %eF %; %, %Ku- %}; %xqI % W %Ge % Ds %JB %X % %Q* %>8 %;F %,T %gb % zp % ~ %th %΋ %f % 6 %H0 %Og %^ %\ % %&7  %/ %I' %t5 %mmC %]Q %Bm %{ %w %Kd %g{ %wj %ۏ % %E %=R %Ɗ  %d %' %Qy5 %]D %փR %;` %Un %w| %DA %D % %ca %i %u % % %Xe %&7 %n7 %. %KE %߀R %f` %= %@ %hV %ѓ %[ %qz %o %v % 3 %< %=~ %4D- %j; %߅I %3bW %_e %ls %A %< %p %, %N %[B %Z %B %v$ %qf< %rAI %b %No % %BD %?9 %ł %p %w %Y %6 % ] %1 %c; %b, %P: %ӉH %+V %Nd %or %w %8 %m[ %( %m? %ی %̂ %K %0O %Z %-  %B %?( %=6 %D %0] %g %qq %A{ %D %; %V % %cn %63 %~ %N %x %+ %+k* %|8 %d_F %aT %Otm %z %uu %Z %u %7 %RY %~ %7 %]? %T %֊ %  %> %3* %@8 %0F %g7l %\z %D %&D % %M %< % y %^ %C %J %@w %"_ %?" %xy0 %> %L %JZ %;h %av %B %s %zL %7 %u; %b % %.9 % %Z.# %2 %U< %:P %qZ %3d %En %s[ %mQ %Q %T! %X}! % 9! %ͅ" %,hN# %3# %  $ %k[& %L(' %ҁK' %)xf' %.y' %gw' %";' %+' %^( %/A5) %x?) %e) %) %Zg) %) %_) %U) %.W) %3) %J) %r4* %Y=* %S$* %ƃ>* %J* %KV* %Wd* %us* %Dg* %~* %E,* %i* %4* %D* %* %T* %L* %{* %M* %w_ + %f+ %a%+ %t2+ %!oM+ %6cW+ %3Nd+ %zr+ %++ %F+ %ކ+ %_+ %Zg+ %Y+ %&7+ %b, %֌, %ډ1, %^K, %PX, %+ke, %݄s, %!h, %P, %, %R, %Ha, %, %n, %,, %, %1, %5 - %4- %Q[)- %'yB- %ύa- %om- %m4z- %- %[- %- % - %֌- %o- %m- %d- %-- %x . %. %X). %TF9. %NI/ %qZ/ %p`/ %\f/ %{m/ %?z/ %L/ %/ %{A/ %,/ %ܒ/ %/ %!80 %}z 0 %Zg0 %b10 %?=0 %<J0 %1X0 %m4f0 %+kt0 %0 %u?0 %,0 %;[0 %50 %c0 %'y0 %Q[2 %$2 %J22 %2 %U2 %-2 %c2 %E2 %"K2 %_]2 %2 %2 %43 %d3 %Gy3 %%X3 %yM3 %3 %3 %;=3 %^"4 %W,/4 %{<4 %ZgI4 %O4 %>4 %Zg5 %W5 %J5 %&75 %}}5 %5 %s5 %]b5 %t5 %4L6 %56 %S?6 %L6 %pY6 %_g6 %Wt6 %;6 %X6 %6 %`6 %E6 %H76 %6 %0m 7 %P7 %m4#7 %J07 %=7 %цJ7 %hW7 %L7 %}7 %6h8 %[8 %A 8 %A8 %QV/8 %S?8 %WP8 %mV8 %z\8 %@db8 % h8 %Mn8 %ggt8 %Xz8 %?88 %e8 %d8 %ID8 %D8 %\n8 %+k8 %N8 %8 %<9 %9 %5)9 %Tb9 %,/l9 %Ni9 %9 %9 %9  l9 : % :  c: %h!:  Z?: %QJ:  7[: ">A`: %e: &Ri: &Rm: #`t: %{: %: %f: %k: %': %˝: %: %': %: %]: %: %Ø: %s: %: % ; %ŝ; % ; %n-; %|:; %G; %T; %a; %'q; %w; %}; %; %w; %; %; %; %; %̘; %,; %ޞ; %; % ; %< %2< % < %,< %ߚ9< %sF< %WS< %ѣ`< %Tm< %z< %< %f< %< %i< %ߗ< %=< %W< %A< %< %< %= %ڙ = %= %K%= %A= %M= %]= %Rc= %i= %o= %:u= %"{= %0= %= %z= %ǚ= %= %K= %I= %آ= %ٝ= %K= %ܛ= %,= %6= %{= %w= %= %V> % > %> %"> %(> %.> %Z4> %^:> %,@> %4F> %)L> %b> %h> %ޜn> %ct> %>z> %˜> %> %> %œ> %> %t> %E> %> %{> %ћ> % > %> %> %> %? %? %)? 8? %B? %ٗM? %n? %$z? ? %? %ٗ? %? %-? ? %h?  @ %>@  y" &B& &i* &u. &2 &6 &: &> &B &F &J &#N &9R &NV &eZ &y^ &i &n &s &x &} & & & & & & &% &< &E &V &\ &g &r & & & & & & & & & & & &  & &+ &?  &G &O &` &o &u" &' &, &1 &6 &; &@ &E &J &O &T &Y &^ &c &h &(m &3r &?w &K| &V &a &i &q &| & & & & & & & & & & & & &  &  &0 &? &M &] &n & & & & &  & & & &! && & + &0 &.5 &C: &J? &ZD &iI &oN &|S &X &] &b &g &l &q &v &{ & & & & & & &# &* &2 &= &D &O &Z &f &m &w & & & & & & & & & & & & &  & &  & &#  &*% &4* &C/ &L4 &Q9 &]> &cC &lH &tM &}R &W &\ &a &f &k &p &u &z & & & & & & &  &  &  &/  &>  &E  &N  &^  &p  &w  &  &  &  &  &  &  &  &  &  &  &  &  &  &  &'  &0  &5  &> $ &P ) &W . &b 3 &n 8 &w = & B & G & L & Q & V & [ & ` & e & j & o & t & y && ~ &0  &?  &Q  &Y  &`  &f  &p  &}  &  &  & - & - & - &, - &< - &S - &j - & - & - & - & - & - & - & - &! - &= - &R - &` . &n . &t . & . & . & . & . & $. & ). & .. & 3. & 8. & =. & B. & G. &L. &Q. &"V. &*[. &/`. &8e. &Aj. &Mo. &`t. &py. &{~. &. &. &. &. &. &. &. &. &. &. &. &-. &;. &A. &U. &c. &l. &t. &|. &. &. &. &. &. &. &/ &/ & / &/ &/ &/ & / &#/ &(/ &.-/ &=2/ &K7/ &Y/ &I/ &R/ &d0 &l 0 &x0 &0 &0 &0 &"0 &'0 &,0 &10 &60 &;0 &@0 &E0 &J0 &O0 &T0 &Y0 &'^0 &2c0 &9h0 &Dm0 &Nr0 &_w0 &e|0 &l0 &w0 &|0 &0 &0 &0 &0 &0 &0 &0 &0 &0 &0 &0 &0 &0 &0 &0 &'0 &,0 &50 &;0 &A0 &H0 &R0 &\0 &e1 &m1 &t 1 &1 &1 &1 &!1 &&1 &+1 &01 &51 &:1 &?1 &D1 &I1 &N1 &S1 &$X1 &.]1 &6b1 &?g1 &Il1 &Uq1 &hv1 &t{1 &}1 &1 &1 &1 &1 &1 &1 &1 &1 &1 &1 &1 &1 &1 &1 &!1 &31 &?1 &O1 &^1 &k1 &u1 &1 &1 &1 &1 &2 &2 & 2 &2 &2 &2 & 2 &%2 & *2 &/2 &+92<> &}> &> &> &> &> &> &> &? &4? &O ? &^? &t? &? &!? &&? &+? &0? &5? &:? &?? & D? &I? &'N? &7S? &GX? &\]? &nb? &vg? &~l? &q? &v? &{? &? &? &? &? &? &? &? &? &? &? &(? &6? &<? &P? &^? &g? &o? &w? &? &? &? &? &? &? &? &? &@ &@ & @ &@ &@ & @ & @ &)%@ &8*@ &F/@ &T4@ &c9@ &v>@ &C@ &H@ &M@ &R@ &W@ &\@ &a@ &f@ &k@ &p@ & u@ &z@ &%@ &6@ &T@ &_@ &o@ &@ &@ &@ &@ &@ &@ &@ &@ &@ &@ &@ &@ &@ & @ &@ &"@ &/@ &9@ &D@ &L@ &W@ &dA &kA &r A &A &A &A &A &$A &)A &.A &3A &8A &=A &BA &GA &LA &QA &VA &([A &-`A &:eA &BjA &KoA &VtA &\yA &e~A &rA &yA &A &A &A &A &A &A &A &A &A &A &A &A &A &A &A &A & A &A &A &,A &;A &EA &LA &ZB &aB &m B &wB &B &B &B &#B &(B &-B &2B &7B & dB &G iB &M nB &\ sB &n xB &w }B & B & B & B & B & B & B & B & B & B & B & B &!B &!B &!B &.!B &;!B &E!B &X!B &b!B &l!B &w!B &!B &!B &!B &!B &!CE &!E &!"E &-"E &H"E &^"E &s"E &"E &"F &"F &" F &"F &"F &#F &"#!F &>#&F &N#+F &^#0F &i#5F &t#:F &#?F &#DF &#IF &#NF &#SF &#XF &#]F &#bF &#gF &#lF &#qF &#vF &${F &$F &$F &"$F &.$F &>$F &P$F &`$F &k$F &{$F &$F &$F &$F &$F &$F &$F &$F &$F &$F &%F & %F &%F &%F &%%F &0%F &:%F &B%F &N%G &^%G &g% G &u%G &%G &%G &% G &%%G &%*G &%/G &%4G &%9G &%>G &%CG & &HG &&MG &)&RG &9&WG &J&\G &[&aG &f&fG &s&kG &{&pG &&uG &&zG &&G &&G &&G &&G &&G &&G & 'G &'G &&'G &6'G &E'G &K'G &X'G &_'G &e'G &o'G &x'G &~'G &'G &'G &'G &'G &'G &'G &'G &'G &'H &'H &' H &'H &(H &(H &(H &&($H &.()H &@(.H &L(3H &\(8H &g(=H &n(BH &y(GH &(LH &(QH &(VH &([H &(`H &(eH &(jH &(oH &(tH &(yH &(~H &(H &(H &(H &(H &)H &)H &)H & )H &+)H &6)H &C)H &R)H &\)H &c)H &q)H &x)H &)H &)H &)H &)H &)H &)H &)H &)H &)H &)I &)I &* I &*I &*I & *I &**I &6*#I &I*(I &U*-I &_*2I &h*7I &n*0N &Q0N &a0N &p0N &~0N &0N &0N &0N &0N &0N &0N &0O &0O &0 O &1O &1O &/1O &:1!O &J1&O &_1+O &t10O &{15O &1:O &1?O &1DO &1IO &1NO &1SO &1XO &1]O &1bO &1gO &1lO &1qO &1vO & 2{O &2O &2O &12O &82O &E2O &L2O &T2O &[2O &f2O &s2O &{2O &2O &2O &2O &2O &2O &2O &2O &2O &2O &2O &2O &3O &3O &3O &3O &$3P &-3P &33 P &93P &@3P &I3P &S3 P &]3%P &f3*P &n3/P &u34P &39P &3>P &3CP &3HP &3MP &3RP &3WP &3\P &3aP &3fP &3kP &3pP & 4uP &4zP &4P &,4P &>4P &E4P &O4P &Z4P &d4P &l4P &u4P &4P &4P &4P &4P &4P &4P &4P &4P &4P &4P &4P &5P & 5P &5P &5P &&5P &/5P &85Q &D5Q &M5 Q &^5Q &p5Q &|5Q &5Q &5$Q &5)Q &5.Q &53Q &58Q &5=Q &5BQ &5GQ &5LQ &5QQ &6VQ & 6[Q &6`Q &!6eQ &06jQ &B6oQ &J6tQ &Q6yQ &W6Q7R &6R &6R &6R &6R &7R &7R &-7R &D7R &[7R &v7R &7R &7R &7R &7R &7R &7R &8R &8R &8R &,8R &48S &<8 S &D8S &M8S &Z8S &_8S &h8"S &q8'S &}8,S &81S &86S &8;S &8@S &8ES &8JS &8OS &8TS &8YS & 9^S &9cS &%9hS &:9mS &L9rS &U9wS &e9|S &s9S &y9S &9S &9S &9S &9S &9S &9S &9S &9S &9S &9S &9S &9S &:S &:S &:S &+:S &7:S &=:S &H:S &Y:S &h:S &v:S &:S &:S &:T &:T &: T &:T &:T &:T &;!T &;&T &;+T &%;0T &.;5T &<;:T &F;?T &U;DT &f;IT &;NT &;ST &;XT &;]T &;bT &;gT &;lT &;qT &;vT &<{T & <T &<T &<T &"<T &(<T &/<T &;<T &I<T &R<T &_<T &i<T &t<T &<T &<T &<T &<T &<T &<T &<T &<T &<T &<T &<T &<T &=T &=T &=U &#=U &-= U &>=U &D=U &K=U &V= U &[=%U &h=*U &p=/U &y=4U &=9U &=>U &=CU &=HU &=MU &=RU &=WU &=\U &=aU &=fU &=kU &=pU &=uU &=zU &>U & >U &>U &">U &.>U &8>U &C>U &R>U &a>U &h>U &q>U &>U &>U &>U &>U &>U &>U &>U &>U &>U &>U &>U &>U & ?U &?U &?U &?V &'?V &4? V &C?V &U?V &^?V &j?V &r?$V &{?)V &?.V &?3V &?8V &?=V &?BV &?GV &?LV &?QV &?VV &@[V &@`V &@eV & @jV &&@oV &/@tV &7@yV &I@~V &R@V &W@V &a@V &k@V &v@V &@V &@V &@V &@V &@V0>W &@W &!AW &-AW &HAW &^AW &sAW &AW &AW &AW &AW &AW &AW &BW &"BW &>BW &OBW &`BX &kB X &vBX &BX &BX &BX &B"X &B'X &B,X &B1X &B6X &B;X &B@X &BEX &BJX &COX &CTX &CYX &$C^X &0CcX &@ChX &RCmX &bCrX &mCwX &}C|X &CX &CX &CX &CX &CX &CX &CX &CX &CX &DX & DX &DX &DX &'DX &2DX &Z &GCZ &GHZ &GMZ &GRZ &GWZ &G\Z &GaZ &HfZ & HkZ &HpZ &HuZ &"HzZ &-HZ &8HZ &EHZ &THZ &^HZ &eHZ &sHZ &zHZ &HZ &HZ &HZ &HZ &HZ &HZ &HZ &HZ &HZ &HZ &HZ &IZ &IZ &IZ &"IZ &,IZ &8IZ &KIZ &WI[ &aI[ &jI [ &pI[ &vI[ &I[ &I[ &I$[ &I)[ &I.[ &I3[ &I8[ &I=[ &IB[ &IG[ &IL[ &IQ[ & JV[ &J[[ &)J`[ &8Je[ &EJj[ &XJo[ &gJt[ &lJy[ &xJ~[ &~J[ &J[ &J[ &J[ &J[ &J[ &J[ &J[ &J[ &J[ &J[ &J[ &J[ &K[@E] &OK] &vK] &K] &K] &K] &K] &K] &K] &L] &!L] &0L] &FL] &TL] &_L] &jL] &xL^ &L ^ &L^ &L^ &L^ &L^ &L"^ &L'^ &L,^ &L1^ &L6^ &L;^ &L@^ &LE^ & MJ^ &MO^ &MT^ &)MY^ &9M^^ &KMc^ &[Mh^ &fMm^ &vMr^ &Mw^ &M|^ &M^ &M^ &M^ &M^ &M^ &M^ &M^ &M^ &N^ &N^ &N^ &!N^ &-N^ &=N^ &FN^ &TN^ &`N^ &lN^ &rN^ &}N^ &N^ &N^ &N^ &N^ &N^ &N^ &N_ &N_ &O _ &O_ &)O_ &:O_ &EO!_ &RO&_ &[O+_ &iO0_ &sO5_ &O:_ &O?_ &OD_ &OI_ &ON_ &OS_ &OX_ &O]_ & Pb_ &Pg_ &Pl_ &%Pq_ &+Pv_ &4P{_ &@P_ &IP_ &SP_ &^P_ &pP_ &wP_ &~P_ &P_ &P_ &P_ &P_ &P_ &P_ &P_ &P_ &P_ &P_ &P_ &P_ &Q_ &Q_ &Q_ &*Q_ &0Q_ &6Q_ &?Q_ &IQ` &SQ` &\Q ` &dQ` &kQ` &vQ` &Q ` &Q%` &Q*` &Q/` &Q4` &Q9` &Q>` &QC` &QH` &QM` &QR` &QW` &R\` &Ra` &Rf` &'Rk` &2Rp` &d $0 h C| $0 E $ @E $ K $ K = Mx d!!96Qi=E ti%01SBoN]l{l8}UyaaW     4 0 D Z T  d  v       G  p, ~B T ~_ (i t ( ~  p     ` % `4 A Q f   3   3   3  ? U g r |          I   P %` 7 B@L` W@f s`        & 2G Zt,  E     ! !; ] } 6 >W >6 6 36 Me YUl xUe e e ?U$rGi$*$7GY1dxnyx1h2Xr)I))@)R)b)t!-E\n~T. cBPc@3@3a+3Y00OYL4`Yl````:M`w-@SPjPw 6qQeqqqN  9  9 , 9 = 9 M j \  l   !!;!S!o!(!0!0!0!c!r""""4"H"`"r"""" !~"""" !~""" !~## #4#}N#i#z###P#$ $8$G$X$g$x$$$$$$$%%B%a^%%%4M&z&&a '5'aG'VS'ih'{''''''G'a(G&(a:(GG(`)W(`)a(al(`)}(G(a((a(((()) ')_6)G)Z)@w)@)@)@)W)W))n)n*n*n'*|8*PS*Pn*P*P**3**3+*+3?+^+3z++3+++;,;,;',;7,;I,;Z,;j,;|,;,;,B,;,;,I,I, !>-I-I"-I-- !>6-IE-IP- !>Y-Ih-Iw-I---`-{----.#.>._.@.@.@.@.@/f*/Y/~///$0<0R0c0~00000011.1I1b1z11122.22[2 Z -=yM~]~m}@3q`{0 c.>N^n~Pc}    ( 8 NY hs,     6 > 6 e 'U2=IY$k$}11h 1C)M])mwo0o({7wG{Waql    /( ? R f y3I3{)9DaP`_p3.symtab.strtab.shstrtab.rela.text.rela.text.unlikely.rela__ksymtab_gpl.rela.rodata.rodata.str1.1.rela__mcount_loc.rodata.str1.8.rela.smp_locks.modinfo.rela.retpoline_sites.rela.return_sites.rela.call_sites.rela.ibt_endbr_seal.orc_unwind.rela.orc_unwind_ip.note.gnu.property.note.gnu.build-id.note.Linux__ksymtab_strings.orc_header.rela__bug_table.rela__jump_table.rela__patchable_function_entries.codetag.alloc_tags.comment.note.GNU-stack.rela.data.rela.printk_index.rela__dyndbg.gnu.linkonce.this_module.bss.rela.debug_aranges.rela.debug_info.debug_abbrev.rela.debug_line.rela.debug_frame.debug_str.debug_line_str.rela.debug_loclists.rela.debug_rnglists @M@L=@+ N,&@#@?P^ :@H@R_% M@9@Z20sni@@ {2(@H0@ @x@@P@vx@&@@/0@@6@/!@@%$80D2LVg b@P0@ xs@Q@"@S@$(0($ @X @0X@)@@X @+ظ@b`@-@$@f@18P@ 3@gJ @3Dh BWE laR@ 8@6h c@R!@ @8u0 0VT<@]!8.@<jx@0!` @>9A x)"!