ELF>P0@@IHG<w@1H4G<w@Hff.G<w@1H4G<w@Hff.F<w[H@UHSH<HH=t+HEHt HH(HH=u1[]ff.HH׈B H+0ș@G fGH8 HFpH@D@z HH+0Hщ@A fAHFp8xH7Wff.fHW7fDfG0@wO@fG2@wHOHHH=u(4ff.@H(HHt9:uH1ҸHff.HGp%Df.ATLX USHLa H\ uvH`HtF\ u`ǃ\ ƃ` ǀ\ H`ƀ` L[]A\ǃ\ Lƃ` []A\f.UHX SHHƃ` ǃ\ HH`Htǀ\ H`ƀ` H[]ATHHUHպSfDH8tHH9u[]A\HcˆH<H42HHHHLHHH2t HH)H9HL[]A\ATUHSH։ىWH AԉHH H tDe][]A\A@AWHE1HAVHE1AUE1ATE1U1SHHHHD$$Hu'EAff.ff.@HHt9H-t닕tX~t_uEHAHuH1[]A\A]A^A_D$tUD$뗋$tt$EtXAzEtiAlAHHHKD$HHAHA$HHAff.fHtHHt 1Ht1USH`HHt*HHtHHH1[]HHHcE1 HHHff.HHtDUE1SHHHcHHH)Hǃ[]fDAVAUATUSHHHHHHAąLLH tHL ALLLLL 11E1HHE1@tu>HxL(HuH@H9t2@uuHxL0HuvH@H9t@ttH@H9uLHHDHCpDLkx[D]A\A]A^HOH@D)H9WHwH@D)H9AHLIff.HHGpʁ@HwHff.G<w.@HHff.fG<wgHATU@SHL$H=t,ID$Ht HH(HH=uH[]A\@uHH HHt15ff.fDH(rdHHutUHSHHt5HHHt HH [MDBDBG]D[]ff.AUATUSH(H_peH,%(Hl$ HHH$IHD$HHD$HD$HSHHHK(HHLHHsHHHHHHHHHHHHHHH(H0HH@<HHADEAHHHHHHHHADEHHHHDE1HHttMcAHHDuFKDuxKDHHIDEHLPDTDXA9|HD$ eH+%(uTH(1[]A\A]HHhHHHmHHyff.AWAVIHAUIATLcUSHH(eL<%(L|$ EHHH$HD$HD$HD$<HK(HSK<&IHPPUDHEt HcSHLLt:Hcй LfA AEHD$ eH+%(uXH([]A\A]A^A_H (disablHcЃ LLH Bed)HcHHLL]DSHt"t [Ƈ` [u+8 t̓HX 8 [H8ff.@ATUSHH(eH,%(Hl$ HHHIH$HD$HD$HD$<HK(HSIHHPPATDLuFSHHtB HHD$ eH+%(u6H([]A\HHHHHUHSHpHtH1[]HHH=tHHH(HH=u1[]UHS1ۃtAXAHEpH0y#uHuH[]HEpH0yuff.AUATUSHHGp0PA:DDHCp0tGE1$XAHCp0tAE9uʿȀtƃ1[]A\A]AUATUSHL@HHff.@H4t3tutu HHtfAWAVAUATLUSHI9LHII"LHH+HI9u8HtHHCHBHL3HLkHHEHI9u[L]A\A]A^A_[]A\A]A^A_AWAVAULDATUHLSH{It9CLHLHHLLtI^L3L{HH[L]LA\A]A^A_ff.AWAVAUATUSHxeH%(HD$pHFpPDH1p@AHcH0I1<HcHHLHBHEpPD>sD$ED+LEnD@EVE~ McL0fEDfBfUAAAHcHHLLHH}pDgDLLHbH$IL; $D<HT$E1DDH ED@EIcHIHH1HMcHD$<LLMHLDDHD$L0H(8Hc@HM,HHIHT$LLLHLEtSM1LLLLtLMuMeM,$Hc@ID9uH(L0HD$HDLHHHD$<LHHLP~KME1LPLLLtLPM,$M|$M'Hc@AID9<H|$HD<E1 HH`AIcHHXHH`DhHHD$AA)iHc29O)хH$cGęAB H HHH< ,HcHHH HHHHHHu3HHHHuL$$HMbHHHHHHsHfAVAUE1ATUSLDHALHHHHHH9tmLHLtIUIEHBHHAEIEH"IELEu H+0@fAEH HL[L]A\A]A^ff.AWAVAUATIUHSHB<t<<A$EI$X9HOdt EA$XA$1 D*ZfE I$xHA$lstIc$pHHiQH$)k2)HHI$xA$pLI$xHfEBI$xD A$pHHHt HLHHu}]} H[]A\A]A^A_ < EA< HMI$`HI$XHt Ht H)H H)։HA$zI$8A$A$V<=LHHHEHΉA EAA I+$0A$@A fAI$A$8 4ID$pp@MJI$xH fA\E A YBMA$XLLbfAWHAVAUIATEUSHHI+0Ic@T$HH ~x A9<IEp1҉P0D$IUphI BE1AtEIEpDp0Au^XAAAuDIuH IEpDp0AuAAu빋1҉P0DLE1|$ WID9~NBDBT B BT IUpDL.ufC@{ 1At=IEpX0uTXA'uIuٺ'HIEpX0u'u11҉P0H[]A\A]A^A_DAWIAVAAUMATUSHƇHGpH$l$P1҉L$ DL$LJP0AHWpD B1ۃtgIGpD`0Au~XAuIwDẇHIGpH[]A\A]A^A_IGpD`0Auu뗋t1҉P0LhH$McN$ HL9CS  S IWpLut$ A9O1҅6ff.ff.ff.ff.DAWfADUAH9O9Did$1E1ALJfA*AtJIGpHP0X0udXAAAuIwDHH4$IGpH4$IGpHP0X0AAuIwEfA1E1IGpX0XAAAuIwٺHH4$IGpH4$IwEfA1E1IGpX0uAAu땋fA1҉P0I AH$AD9E1tYIGpX0urXAAAuIwٺHHt$IGpA?Ht$IGpX0uAAu륋A?H $1fIGpp0AHAH $D9?t\IGpX0usXAuIwٺHH4$IGpH4$1ɉH0H$AIGpX0uu1҉P0A1AAUATUSHH DeH%(HD$1H$D$EHLJLHHLAAHG@HH)PHD$H߹PV _AŅ<fw" % Љf%f=Df?1D At @utQHD$eH+%(mH D[]A\A]ƃdǃPHT$ 9D$HD$ OA9DO@9OD<L(AHHǃ I@I@I@I@ D$ATYunfE9NЉ=Nщǃ9O‰Aff.fAVAUATAUSHHpeH%(HD$h1Hl$8D$ HD$HHD$HD$8D$;fD$=ƋD$>n @ŋ1fD$D1 u dT$HA ,H߉HfD$LATLD$ZAŅHT$HD$HD$$HD$,D$4D$ D$u ATA,LD$, HAXEA`PFDHCp%= t#tAt XAѿǃHD$heH+%(HpD[]A\A]A^D$`t(HHT$TT$\jATA)HptHDxDHH|$THTHD$TL$=HD$\DALHDE1L HHpHu$AuHsHADDx@ff.@AVAUIATUHSHHGpeL$%(Ld$AԺPHGpP HGpPHGpPHGpP HGpPHGpPA XAHEpHE1HEpPtedAtDXAHuAAuϸHT$eH+%(H[]A\A]A^dAAuPHEpP HEpPHEpPHEpP HEpPHEpPAE,XH}xAE4DODC_ItLHHAH9uAE0t:ItDʋFHFAtLDHHAL9uF uAED$@ŅoD$bL$HHT$E1A HLIH.HD$Ht$(HD$>HD$0ADž LLHHHHD$HHD$PHD$XHD$`D$HD$ HHǃHD$Ht$HD$HD$HHD$PD$XfDl$^D$`Dl$EHAE1HT$ IcHHƹ H$HHD$HD$ HL$HHD$^HHD$PHT$u=H<$ HT$Ht%AAEt HHHL$ E1H4$HA~t%IcHAAT At _AFD9HE1LLHL$H&DAHHt AHtDHH[ EBL*BL(1AWAVAUD-ATUHSE/LX ALa H~c H`ƅa Htƀa L1AHHH<t/EHA)DH`Ht DHHuDHHAŅ?H Ht HH LDb Dž\ H1f` H`Ht&ƀa H`ƀ` H`ǀ\ L1AHHH<t/EHA)DH`Ht DHHu[D]A\A]A^A_Lƅc a tDb ƅc []DA\A]A^A_LH[D]A\A]A^A_HEpHUDH%fDAUATUHSH8)eH%(H\$0Hu?ht5H8%d==@HtkH(HHDLX LH0 HHtH8 ,@HD$0eH+%(-H8HL[]A\A]tLd$HD$HD$ LD$D$ H$HD$HD$ HD$(D$ D$HD$(D$ fH4HE1 HPHIHH$LHD$&HD$t$ H $HPHcu5EeE1HLAEƃ}HE1Laff.AW AVAUATUSHeH,%(Hl$HH=D$ HHHLkBL5sdHHmAH  HHHH(L( HH Hǃ ǃ@ǃPǃX HPǃHHHHHHH@ǃ8HHH8 HHH` ǃX HH1E1HHǃHǃlH׺ HǃpHǃxHǃHH HǃP HX H H HH8 H@ L(L0H@ HH 1ҾHH0 Hf}Bf=!mNfTpf2fPf0]HHHEHC(HT$ jHD$ jHЈD$ ƃƃ|ǃDHCpP4ǃHCp1҉P0HL5HLH@LtL%Hǃ(L0M&Du8H}EAAAwD IHHHHu:kff.ff.@H(HH6L9uH`HH`HH`H`f}>bH&H AHHD$eH+%( HD[]A\A]A^A_f=(wDf=$,f=&f="HC(ƃf=Bf=F0f=@HC(ǃfXefbfVHHC(ƃHf=F6HC(fbof16f0e0HC(HT$ jHD$ оjHD$ ƃHHC(&tXHC(HHC(ƃǃƃE1HHT$fDD$T$HfT$GHC(fbSHPHθHH\H@H\<wdLHx 1ҾHxHHǃHpHǃcAwH}D IH끄lHC(HC(HT$ jHD$ f=(f=&f='f="^f= hHHHEHC(tHHHHHC(DwHHC(HC(]HC( wcHHC(HC(gHC(MHC(SHC(3HC(&HC(,HC(HC(qHHHEHC(PHC((HC(HC(HC(BHC(f1*2HH HC(f=@HHHEHC(HHHEHC(eHC(XHC(KHC(lHC(_HC(Rf=$t1HHUHwSHHHs(Ht HH1tHt HtHHtHtHH[H]HsHHHtIHsHAHHHsHAHHsHAHsHAHwHT$ H4$T$ H4$HC1H C [MDfCBGtEk AE,HHHމHMl$HHAL@LtLHID$pP411A$ID$pP0A|$LA$t I$AD$HHA$HH1[]A\A]%='=&=%r=$a=#P="?= %H=!AHuDT$HADT$%= PV= E= z4= #=======H=|HuHDT$DT$HHDAHk2DT$AHAHuHEHPZDT$LDAHk2HMtDT$HuQHHYDT$HUHH1AljDHk2DH@?Nf=v@mIcLMYDT$HuMQHH^DT$LDAHHuH`HTHUHHH5H HHHHHHHHHHHHHHxHsHHHt>HHcE1HHI1D)HH0HXHt2<HE1H`HHc1HXHH9$HHHHHHHsHIt$HMUIt$D}$L$HыT$HHt$Ht$DA A AA&A6AFAVAmAEH [HHt$Ht$\T$HM!U HIAuIAHuHtJ=tLtay1HHHHHHHHHH돋T$HHnIAuIIAuIAHuHt)t-HtHHHHHHHHIEpH$fIGp1҉P0IGp1҉P0HA1҉P0Hs1HAHsHAHw1AHHsHAHsDHHsHAWAVAUAATUSHQu0@Au XAIuHCp1҉P0HHCpfz>bE:u  XAE1I$Ht 1HIIuA<HCp%=Au XAIuAuPACdtH`HtHIpIEu AAAĀDpHCpP HCpPHCpPHCpP HCpPAdu dXAIuAuHsDHA;HCpD``CdtH`HtHRpRDPXAAHCpD`E1AIkHt)EH1E)DH`Ht 1DIIuLMuH`HtuLA<MtiAHCp@u%LH…t\HsHJAu XAIuAuA<HCpD AAuA@Au XAIuAuHsDHHCpHHPCdtH`HtHRpRD!AAAĀDxHCpP HCpPHCpPHCpP HCpPdu dXAH$H$HuAuHsDH HCpD`bHCpAD`HCpH tHsHHCpPHCpPFtHsHAH`Cdt HtHHpQƃHtƀAuAXE1HCp%-t2A u XAIuAE9uAZD[]A\A]A^A_AWAVAAUAATUSHQHGp(AADrE1Au1HwHAA@u-LcHLLHAHA u?vE tAD@Hue1E DH@Ņ/D$AuD$E1HCpDADEAA u.D@HtMHsHEu.DAHtHsHL$AE$9u(AE,HsHDSAu  XAD,$At(AHuHHsHZ[]A\A]A^A_HLHLHHLHLHHSpHH=HIHuHHHP1HHLAm=AEH8 HumHHuGHuBHCpHsHH%HLHfft4hHHHHHH1IvHAƆHLLLD$&IET$'HEEHt$HD$&D$&D$&ŐAUATUSHH8eH%(HD$01Ld$D$LL1HHD$HD$HD$HD$D$L,HHT$E1A HLHHtxHD$LHD$&HD$u9Et3}v-ELHfD$&uLHD$&HE1HLHL$HHD$0eH+%(tH8[]A\A]AWAAVAUIATUSHpeH,%(Hl$hHtHIEHHHD$IEpP4I`1E1AHt1u AuH@pP4I`1A1AL@OÅyaHt$uD$IE1LIc HHHEIEHD$(HD$(HLD$FHD$8HL$(uIIE-IE1IcHHE1E)MH\$01D$ HHl$ H1Hl$0H|$(LHD$8L$!ID4HT$(E1Mc HLIHtT1DLHLD$FHD$(HD$8u AGAhIE1LLHL$(HHT$@11HHt$(HLD$"fD$ D$# Hl$0HD$8D$H HD$0xt$!HT$(E1 ID$FHcHHHtrHD$(HLHD$8u0HEIE0HE$IE8HE,IE@HE4IEHHEbHuHHHH  HCpHHLHu4fE>Vfu'H*yLHDLHH$L…tH H[D]A\A]LHHAHHHHAHpHJHL$HL$HJLLL$HL$H6AƅLHHp1HpLtH(H0HBHHH(H"H0H`Ht 1H`HH~HAtHH0 1HH0 E1JHtHHtHIIuH5LHHtraid_data.inactive_list_mutex4mptbase: WARNING - (%d) Cannot recover %s, doorbell=0x%08x 6mptbase: %s: %s: IOC is non-operational !!!! 4mptbase: %s: WARNING - %s: Running mpt_dead_ioc thread success ! 4mptbase: %s: WARNING - IOC is in FAULT state (%04xh)!!! 4mptbase: %s: WARNING - Issuing HardReset from %s!! 4mptbase: %s: WARNING - %s: HardReset: %s 4mptbase: %s: WARNING - IOC is in FAULT state after reset (%04xh) 3mptbase: %s: ERROR - %s: Running mpt_dead_ioc thread failed ! 6mptbase: %s: pci-resume: pdev=0x%p, slot=%s, Previous operating state [D%d] 6mptbase: %s: pci-resume: ioc-state=0x%x,doorbell=0x%x 4mptbase: %s: WARNING - pci-resume: Cannot recover 6mptbase: %s: Sending mpt_do_ioc_recovery 4mptbase: %s: WARNING - pci-resume: Cannot recover, error:[%x] 6mptbase: %s: pci-resume: success 3mptbase: ERROR - Insufficient memory to add adapter! 3mptbase: %s: ERROR - Insufficient memory to add adapter! 4mptbase: %s: WARNING - Oops, already bound (%s <==> %s)! 3mptbase: %s: ERROR - didn't initialize properly! (%d) 6mptbase: %s: Domain Validation needed for PhysDisk %d 3mptbase: %s: ERROR - Wait IOC_OP state timeout(%d)! Volume Creation Failed: Data Passed too LargeVolume Creation Failed: Duplicate Volumes AttemptedVolume Creation Failed: Max Number Supported Volumes ExceededVolume Creation Failed: DMA ErrorVolume Creation Failed: Invalid Volume TypeVolume Creation Failed: Error Reading MFG Page 4Volume Creation Failed: Creating Internal StructuresActivation failed: Already Active VolumeActivation failed: Unsupported Volume TypeActivation failed: Too Many Active VolumesActivation failed: Volume ID in UseActivation failed: Reported FailureActivation failed: Importing a VolumePhys Disk failed: Too Many Phys DisksPhys Disk failed: Data Passed too LargePhys Disk failed: Invalid Phys Disk failed: Creating Phys Disk Config PageCompatibility Error: IR DisabledCompatibility Error: Inquiry Command FailedCompatibility Error: Device not Direct Access Device Compatibility Error: Removable Device FoundCompatibility Error: Device SCSI Version not 2 or HigherCompatibility Error: SATA Device, 48 BIT LBA not SupportedCompatibility Error: Device doesn't have 512 Byte Block SizesCompatibility Error: Volume Type Check FailedCompatibility Error: Volume Type is Unsupported by FWCompatibility Error: Disk Drive too Small for use in VolumeCompatibility Error: Phys Disk for Create Volume not FoundCompatibility Error: Too Many or too Few Disks for Volume TypeCompatibility Error: Disk stripe Sizes Must be 64KBCompatibility Error: IME Size Limited to < 2TBWrong Relative Offset or Frame LengthSATA Read Log Receive Data ErrorSATA NCQ Fail All Commands After ErrorSATA Error in Receive Set Device Bit FISReceive Context Message Valid ErrorReceive Frame Current Frame ErrorPersistent Reservation Out Not Affiliation OwnerIO Cancelled Due to Receive Error,6%s: c%s: cCapabilities={cInitiatorc%sTargetc%sLANc} SPI hostioctlSCSI targetLANSAS hostFC host3.04.20mptlinux%s-%s Fusion MPT base driver Fusion MPT %s driver mptversionsummary%s: IOC Fault (%04xh)!!! (Exp %02d%02d)%s: ProductID = 0x%04x (%s) FWVersion = 0x%08x%s (fw_size=%d) MsgVersion = 0x%04x FirstWhoInit = 0x%02x EventState = 0x%02x MaxDevices = %d MaxBuses = %d PortNumber = %d (of %d) LanAddr = %pMR WWN = %08X%08X:%08X%08X FwRev=, LanAddr=%pMR, IRQ=%d (disabled)Fusion MPT base driver6%s %s mptbase_replyunknownFCP InitiatorFCP TargetMPI Message LayerFC LinkContext ManagerInvalid Field OffsetState Change Infobug! MID not foundParity ErrorASYNC Outbound OverrunSYNC Offset ErrorBM ChangeMsg In OverflowDMA ErrorOutbound DMA OverrunTask ManagementDevice ProblemInvalid Phase ChangeUntagged Table Size, resync in progress, quiesced, enabledoptimaldegradedfailedstate unknown, out of synconlinemissingnot compatibleinitializingoffline requestedfailed requestedofflinestuck handshakeIOC FAULTmpt/%s/summarympt/%s/infompt/%s7%s: persist_opcode=%x 7%s: no msg frames! 7%s: failed 7%s: success bringuprecovery6mptbase: %s: Initiating %s successmpt_dead_ioc_%dioc%d6mpt_debug_level=%xh &ioc->internal_cmds.mutex&x->wait&ioc->mptbase_cmds.mutex&ioc->taskmgmt_cmds.mutexmpt_poll_%dBRE040 A0BRE040 A1BRE040LSI53C1030LSISAS1078LSISAS1068ELSISAS1068LSISAS1064ELSISAS1064LSI53C1035LSI53C1035 B0LSI53C1035 A2LSI53C1020A A1LSI53C1030T A3LSI53C1030T A2LSI53C1030T A0LSI53C1030 C0LSI53C1030 B2LSI53C1030 B1LSI53C1030 B0LSI53C1030 A0LSIFC949ELSIFC949E A1LSIFC949E A0LSIFC949X A1LSIFC939X A1LSIFC929XL A1LSIFC929X A0LSIFC919XL A1LSIFC919X A0LSIFC929 B0LSIFC919 B0LSIFC909 B1mpt/%dinfoLSISAS1078 A0LSISAS1078 B0LSISAS1078 C0LSISAS1078 C1LSISAS1078 C2LSISAS1068E A0LSISAS1068E B0LSISAS1068E B1LSISAS1068E B2LSISAS1068E B3LSISAS1068 A0LSISAS1068 B0LSISAS1068 B1LSISAS1064E A0LSISAS1064E B0LSISAS1064E B1LSISAS1064E B2LSISAS1064E B3LSISAS1064 A1LSISAS1064 A2LSISAS1064 A3LSISAS1064 A4Phys Disk failed: DMA ErrorRaid Action ErrorOpen FailureInvalid Scatter Gather ListFrame Transfer ErrorTransmit Frame Connected LowSATA Non-NCQ RW Error Bit SetReceive Frame Invalid MessageSATA Link DownDiscovery SATA Init W IOSConfig Invalid PageDiscovery SATA Init TimeoutResetAbortIO Not Yet ExecutedIO ExecutedOpen Transmit DMA AbortIO Device Missing Delay RetryEnclosure ManagementInvalid SAS AddressInvalid PageDiag Message ErrorTask TerminatedTarget ModeIOPPLIRmptbase_raid_process_event_data14:@EJ\afkpmptbase_replyfusion_init! !mpt_HardResetHandlermpt_halt_firmwareNo|mpt_config mptbase_sas_persist_operationmpt_alloc_fw_memory mpt_resumempt_suspend_e mpt_adapter_disablempt_host_page_alloc?SendIocInit> J ] PrimeIocFifoskMptDisplayIocCapabilities+ - . 1 6 ; I GetPortFacts WaitForDoorbellReply'GetIocFacts o SendIocResetmpt_diag_reset @gq}MakeIocReadyp mpt_turbo_replympt_sas_log_infompt_spi_log_infompt_fc_log_info+mpt_replympt_do_ioc_recovery . j q mpt_detect_bound_portsc h mpt_mapresourcesrwmpt_add_sge_64bit_1078Qumpt_fault_reset_workmpt_attachFWaitForDoorbellIntWaitForDoorbellAckmpt_fwfault_debugmpt_debug_levelmpt_channel_mappingmpt_msi_enable_sasmpt_msi_enable_fcmpt_msi_enable_spiparm=mpt_fwfault_debug:Enable detection of Firmware fault and halt Firmware on fault - (default=0)parmtype=mpt_fwfault_debug:intparm=mpt_debug_level: debug level - refer to mptdebug.h - (default=0)parm=mpt_channel_mapping: Mapping id's to channels (default=0)parmtype=mpt_channel_mapping:intparm=mpt_msi_enable_sas: Enable MSI Support for SAS controllers (default=0)parmtype=mpt_msi_enable_sas:intparm=mpt_msi_enable_fc: Enable MSI Support for FC controllers (default=0)parmtype=mpt_msi_enable_fc:intparm=mpt_msi_enable_spi: Enable MSI Support for SPI controllers (default=0)parmtype=mpt_msi_enable_spi:intversion=3.04.20license=GPLdescription=Fusion MPT base driverauthor=LSI Corporationsrcversion=A9A75BA26A33B1F6BDD06DCdepends=intree=Yname=mptbaseretpoline=Yvermagic=6.13.0-rc1-MANJARO+ SMP preempt mod_unload         (08@80( @ (0( 0  (P( P (08`hpx`80( ` HPX`H H (  ( (080( 80(  (080(  (0880(  (08X80( X (0(  (08H80( H (08@80( @ (08P80( P (HPH( HPH (00(  (0@0( @ (0x0( x0800 (08@80( @80( @ (  (08`80( ` (0h0( h (0h0( h (0h0( h (0880(  (0880(  (080( 80( 80( 8 (`( ` (08PP80( P 0( XH@PH (08@80(  (08@80( x(` (`(  (0880( `( ` ( P0GNUGNU("O2.jh;(LinuxLinuxmpt_fwfault_debugmpt_raid_phys_disk_get_num_pathsmpt_raid_phys_disk_pg1mpt_set_taskmgmt_in_progress_flagmpt_clear_taskmgmt_in_progress_flagmpt_halt_firmwarempt_Soft_Hard_ResetHandlermpt_attachmpt_detachmpt_resumempt_suspendioc_listmpt_registermpt_deregistermpt_event_registermpt_event_deregistermpt_reset_registermpt_reset_deregistermpt_device_driver_registermpt_device_driver_deregistermpt_get_msg_framempt_put_msg_framempt_put_msg_frame_hi_primpt_free_msg_framempt_send_handshake_requestmpt_verify_adaptermpt_GetIocStatempt_print_ioc_summarympt_HardResetHandlermpt_configmpt_findImVolumesmpt_alloc_fw_memorympt_free_fw_memorymptbase_sas_persist_operationmpt_raid_phys_disk_pg0]2X;,[%$mptbaseZ+++M+^MZWZc~ZZZZintc,Z*Z]s8r]u8]s16]u165]s32F]u32]s64]u64c9  'Z+1c2cHIX]^_`W7ZZ$&(<c W +#Z%&*+4=B\^+gWhFnWqo\} c o o o c c o7 7 c@EEeeW+8 '+WFH  M  > "M p  ( W0 \8 J@ N H N H N H uH N H N H N H N HG@= ?&ZPhMM=B Gc5HkpL c(c,B0 G8@ABcD QHPmemV@+ chmw 7(o0c8o@cHcLPcX`chp  xcc\ccco c!"c%&R9c:?AD F P Qc(Ta0 J!n !!J! !5!55! Vval! =J =n ! . !, J" ""  +5"! " = " B . " "! ## ${ $ $`  % %{ %%% %%c%+,&S )fmt&M&M&M&c&M&M$ 5'e 'f+'g 'h 'u 'vF'wFkey'x  'U 'V .X 'j )key'k 'n% )key'o (6H (7 (8 88( (M(M(M(M^(c^(c^(4ckey(9% (@c(=   8(UW(Vmod(WW(XM(Y\ (Z (([ ,(\ 0M(u(v(w(xc(ycH  +cW+ )/ )1cset)3}get)5)7 2mW. T w  @( @08!@" 2H# PP$ PX%i`&h'p(x)*ܫ+,,-1./ Y0 1 23 ֬5 9 ƭ; >?@4* *!Fkey*"F5*?H*A+*BM*CRH*=x*>o.+,,, + + x+-; Wcs-=oWsl-?oWwfe-Ao-EWss-GoWsti-IoB-KoWnmi-MoB-Po B-So0B-Vo8Wlm-Xo9B-]o:B-do<5-Vcs-5Vcsx-o-5-Vss-5Vssx-o- -gr15-m+r14-n+r13-o+r12-p+bp-q+ bx-r+(r11-u+0r10-v+8r9-w+@r8-x+Hax-y+Pcx-z+Xdx-{+`si-|+hdi-}+p-+xip-+.-+sp-+..B.C5.D5B.E5 B.E5(Ws.E5,Wdpl.E5-Wp.E'5/B.F50Wavl.F54Wl.F55Wd.F56Wg.F%57B.F+58/+/+/+/+/+7/ pte//"7/ 0pmd//"0%Y0%%0%/<g0' )pgd0'0'"fg0p )pud0p0p"08@1H1I+Sh.h01 41+82;f2<)2=)B2? c B2@ c$B2A c(B2B c+G-@3 %&3i43c3c3 o 3-9(3 c,3!c03( 43)I283*cH3++P3,%&X35 `36 d38 h3: l3; p3< t3=cxse3?cD@Hrt3@Edl3AcF3B^F3FHQ3I_63J+3Kc3OH3XH3]HQ3`"B@3dJ3hc3kc 3l+3m 3nH 3oH(3p)03q oX3s`3ub3x d3yHh3zp3{I3+333 33 33 3 3H333 3A33*6(Q3_6PHmm3'h3'p3Ix3 3 3 3 3+3c3 c,3 c,3 c,3 c-3 c-3 c-3 c-3 c-3 c-3 c-3 c-3 c-3 c -3 c -3 c -3 c -3"c -3+3#4Hpid3 3 3+3%&3 %&333%&(303@3JP3JX3 3"J3%'3('3+ o3- o3. o33 o34@36MA3: (3=+03>+83A o@3D oH3G+P3H+X3K?`Q3NK?3T2L3W2L3Z2L3^"M3k 03m,M3p45 3qY5(3t+83u+@Hfs3x6MH3{@MP3~JMX3TM`3Ph3 :Qp3 9x3 93 93*=3+3 3c33DQ3 @3c383=3 o 3 o 35 3{  3H 36( 3%&8 3NQ@ 3 oH 3~QP 3RX 3 R` 3Rh 3Rp 3+x 3R 3u> 3c 3 o 3 o 3 o 39 3b@ 3 3R 3 3 W 3 W 3"R 3)R 3  3 R0 3 58 3 cX 3R\ 3 S` 35h 3 3S 3 3 3 3  3!c 3"c 3# 3$+ 3& o 3' o 3( o Q3) 33 S 3C 3D+ 3L%S 3N+ 3R5S 3SW( 3TW, 3Y+0 3] 8 3^ < 3_ @ 3` D Q3aH 3d@>X 3g?S 3i > 3lIS 3w 3x 3z+ 3} 3~NS 3 o3 o3 3 3333 3 3+3c3cS3mS3U3&V 3c(3c,3H0rcu303-9@3 D3%&H3I8P30Vx3-93 o3 ":V3 DV3NV3o3 3 o3 33>Q33 3!"13$"1Q3.3<XVQ3F:&@@f:&+?G@@4'4?1)sp4+)es4 )ds4"4$4&4+(4+04O184+X4+`)cr24+h4+p4+x4n14+4c4W4+4+4 0fpu4 60@(5 '5 )'G@@1'Svo@1s@ 0'n1(Smm1'1 Y.m 1(1,1m0_1m81X1mh1%np1+x1}l1 o1n1*1S1n1l6 )6 6 ) 7!b)7% 7+ 7-7/ @c3)           +)+5 ;')5?*'*+8  c:*                    0;c"+;dM;ee;g;i ;l .l(*<O+<oend<o3= 3= p>+cwd>Wswd>Wtwd>Wfip>W fcs>Wfoo>Wfos>W>+>WlW++J>*",rip>+ordp>,oJ>.`,fip>/Wfcs>0Wfoo>1Wfos>2W 5>)t,=+=",50>@,>A,>B,W,+ >$:-cwd>%5swd>&5twd>'5fop>(5.`,>5W>6W>9:- ><J-">>,t,WJ-+WZ-+?>Q7.cwd>RWswd>SWtwd>TWfip>UW fcs>VWfoo>WWfos>XW>Z+>[l>\m>]n>^orm>_p>`q>a7.x>bW(L.+o\.+@>:.>; o>< o>= .o.+G@@>O._>P,>Q\.>R.@.M+@>^F/,>_k+o>`,,>aZ-o>b.@,>cF/X/+G@@>f/>hc>kc>no>qo)xfd>to>wc>zc>c>c_>.@@>60> o>c>c fpu@>0>c>+>0>0>/ >/0_>X/@@X/? 0? o?oW0+W0+? @:1@ @! @" @#ǹ0O1+_1_1+d1i18 A1AcAcAMAMAM3B3B3BC82C9"2C<"2C="225D<I2D=cD> D:2D;2.'2srcDA5 dstDA 52'2o@cE2  7(E3E3valE WE!W E"WE#oE$3 W5E*73E+&73E,#d3Fd3FXF F<37E'3E(E)2.3E.o7 E13E23E3E4 E5+E6+35(E#4E%2E/i3E738EP4E+fnE d4.3_4_4#4P4G>4G?+G@+GAWcpuGCWH4HoHo8(H4cctHs1H&4 4@cI/5    JO5J T5O5K t5KL 5L 5M5M` M5.5M57N 5NB N"5 O)*6O**O+{ osqO-t5 O/(P _6P P P8Q6Q+Q6Q6_6Q 6Q 6Q6Q6Q68 R7[R _6R mR  7R6@cS >7 8@S'7[S(6S) m S*7(S+D80S,8S-9S.:S/; 777>778@@T/D8T0@T1cT2  seqT3;@T47T57 T6K0T7 m87(U8U eU+U 8UW '88I88V8VV V887W 8W8+9+W88X-9X X9Y+a9Y,Y-xZ9Z9Zc`Z+hmaxZ+p+9+ 7[ 9sig[8[9\R\S99\U\V :9]7:] ] o] :7]'g:](])7]-:].]/]0 7:]17]5:]6]7]8 7:7 ]<!;]=]>]?]@]A7]SR;]T ]Uo]Vo7 ]Yv;]Z ][ 7]^;]_+]` ]a 5]J;]L]Q ]W!;]\R;]bv;7 ]E <]Fo.;7]g.<]h_fd]i7]m_<]no]o]pc  ]%<]*C:]2g:V_rt]9:]B:]d;]j <]q.<J0^ =^ ^ ^ ^ _<0^ =.<^= =^ R=^!^" 9 ^%=^'9^(+^.9^0 9 ^3=sa^4R= _ =_ 7_ +len_ +_ (` >` 'a$@>a%a'a( 0aDu>aM#=aP(aW)8b >bobobobobo b#o(b,o0c)?c*oc+7Pc8;?c9;?c:cHc;cL>K?+88cD?[cEcF5cGc08 d>?dKdZdpdddendd?W?M+e!@e" ce&?eD;@eD@eD @eEb@eE@eEG@7eT @eYb@eZ 5e[n@7f @valff @7f @valf f @3SA3U o3V o3W{ Nc3[MA    03hA3i@3j3kA)cpu3lc3mo3no 3oo( 3B3+33330B3+3 Wn@@3B3 o3 o3 o3 W3 W3+ 3+(3+03c8G@3cD3 o3 o3 o3 o3 o 3 o(3 o03 o83 c@3 oH3 oP3 cX3 c`3 oh3 op3 ox3  o3  o3  o3  o3 o3 o3 o3 o3 o3 o3 o3 o3 oG@3E3B_3 _63! o(3" o03# o83%@3&P3'Q3(R3)S3, oX3- o`3. oh3/ op30 cx31 o33 o36 37E39E3;E3=+avg3G0B@cDE03K8F3L3M+3N+3Oc 3P$3Q&3S8F(E3]JFOF^F^FcFn3`G_3a_63h o3i o 3j o(3k o03l o83s c@3t oH3ucP3c3c3c3c3c3c3c3c_3>7X_3>7)rq3G3=F3G3^F3^GG%&G^FrqG37j mitj"j8"j?"jʌh"j "jJ"jpttyjߌ"j"j @"jo"j o"jo"jo"jo"jo"j@"j+"j+"j+"j'+"j+ "j+("j"+0"j,+8"j+@"j+H"j"+P"j,+X"j+`"j+h"ju>p"j"j"jr"j"j c"j "j"j"j"j'"j5"j[0YM j:Qj5j-9jZjb P?QIQk~QkBkBSQ@lRl[l [l o l (l*l,l-l0QRXmcRmd*me mg mk 5mm|vmne(moJ0mq\8RR=RR nRnnnRRS+SSS+5S+?:SDSa9^S+^ShS0lUllll l,l.l|v0l@l(fHl`PloXl+`"l"l+"l5"l cpbdil "l("l=h"lp"lp"l pevlz"lc"lc"lc"l"lc"l5"l"l"l"l\"l]pcdil"lpbbl"lW "lo"l J "l((rS8hoy&Vozbo|co}ddSco|c(oI80o+Xo#id`U+V5V?VIVSV3{ 333!3%3'3,3/53335393<3A3D3H3L3Q3U3YWpWpopopp Wp!p" Bp$cHp'aXp(Mkeyp) p*aXp+o p,o(p-o0p. fX8extp/kX@WWWp38 p8Xtpp9Xp: op;Wp<WWFFq&ZqWq qcq P qoqoinoq)o devq* (q+ ,uidq, @0gidq- @4q. 8q/@q0Pq1`q2pq3oq4oq5Wq6Wq7oq8oq9Wq:Wq;W6Z+r !BZ(rZrcr orZr rZZZZcoBZr#Zr$5r%r' ZTs5TsTst3[t -93uv v"A[5vt[v5vF[v[.R[vcvoo(w0[w1*w7*osqw9t5w;{ w<TwTwTwTwTwx+_\x,{ x-VL7@y y\~\'\\\ y\y*yym\@c;]               + @cWl] z@   Xq]r\sI8 wqv]HcpuwP]Ncq!^      @ z/// xz^zz^z^(lenz*Hz^Pzp!^^++^+^+@{_{_{_{ [{5@@{ &^H{!+{"+{#{$I8"{%\{& "{'`0"{(+8pcpu{*@pssp{+N`H*_+`{6`{75{8^{:^({;+H{<`P{=X{>\_{eN`{fcsda{ga{hW {ia `x{Da{E`{Fa{H {I5({J5H{K5P{L+p{M+x{N+{O+{P+{Q+{R+{S+{T{U+{V5{WJ"{Y "{\+"{]+"{^l]"{_N`p`a+^S`3|5}a}<.}<.7}" b}#F}$}%7}'1b}(})7}+Ub},}-5}!b}&a}* b}.1b }b.aops}b.Ubbb}2b}4+}6c}7c @co@c   @coHBc   opwcoqcoros|cwcJocobo+oc[oo+{oc=cc8@oddoBco+o+o+ o (o,odd0crcuo8odHcbodoidonddM+ododd(~ e~{ ~c~~ 7 eo& )[ldt*e8.+@95H:oh;fp= xC5|D)~e fo+alt+++ +(08@HPX`hpx !efF eJ1\f1^ o1`c51X gVlru1Y=f1d1e51iBg1j +1k+J(1Rrg.f1hI. g1s+ J(1ug1z+pp1{g1|+1}+1~* gJ1g1+J1h1h1 ohtref֒8JHhcl+pops xo.h{(1Qh=Bg=rg=g=g151h1c1 g1 h)val1+1hq1M(i1N o1Pcd1JEiylru1K=id1Wji,1X o,1Yhq@1Gi1I+.(i1UI1V + .Ei(1[ 01\ 41^+8@1Fi=jio1jq(1maj1n+1o+1q 1r 1s 1t 1vc @1lj=io1zq01}j1~+1+1 o1 o1 o 1 o(q 1k1+1+1@1|8k=j=jo1n1D\kSiSaj@Sk1+\kn xl A 5   I o H}(c0c42L82@.P p  ox#$ % 'Snknk15l)ctx16ll1=l1>[1@?(1Xl1Y[(1\Fm1b+1h+1t=1w 1}$q1mm1+1+1m=Fmo1d1m,1ik,1\k 1mrb1_61+lmbnc h jkq s(t0u8w"@{H~PJX^`whpxmnll1&o1o)cid11 @@1 Ao1 g 1vo11+1 cS@@1TsS&o@1t[@1+P1+X1+`1+h1+p)pgd1  'x1) 15 1?Ts1E+1Lc1S 1Z{ 1]*1_1a51p[1r11+1+1+1+1 1+ 1+(1+01+81@@15D1+H1+P1'+X13+`1+hHbrk1+p1!+x1+1+1%+10+1Ys1is@1~s1f1+h15p1sx1%&1s1}l1&s1+1+11 1 1d1*1\1s1+1+1*1 Aon+is+3dys+yssXss+sM+1 csp/Rt.R7Rt()pmd9 '0)pud; (8.W@EHFP)pteL 'X)ptlPV`T hNc1t      @ zzzzzT6T9T<TG8Tu+22++ +(0Tu^u@@uoxuuo u5B$vD$vE)vFhvGwvHvIouucv !c"c .vcvmvrv,v- 5/ 0o|vJAv.uK 5:v@xu=v5N wO+PQ (+nw,-./ .v.v 0pwq}lr s t ou v5$.[(nw w"w#$x&$x'$x' )xw$xJRx5 {mx=.x8xSRxJ3x4Wlen4W52x=x6o1x.x8 x5i yjk yZr?ysetwu8RzTcUb@VwWzXx YH}0[M}8_"~``ha+pbox[dmx.xmenJcd_uvy?y?yGx{H}| }~ @ @c !y (I0 o8+@.-H L P xX x` xhWpWtWxW|5 W[++e55 R0 @ H P T X \y`hQ Ip8H P(X`h op!z]}+'8@~?g{ ( 0 8 @ ҂H_P}X`]}~G@ +  \(!0!8@"H+P+X+`zh[p o& #",$;@w   }l  ec ԝ(Q` oWxx!W"/ 0 14 6c<5 BM@D"~HF΄PI*XL`O dR]hSJpZsxabrcucd\f5k0Qn5@@oHq5Xr`~@c zc55:zx!b5cMbxD{5lz'z'zH}7҂z7 EFzGHIo((-ׂ2Zmnt ( z2xxZdzz "#nid&-+4+7cS8RS؄U؄XYZ cc -9 dJ(crcueHgoXj`idmpptqMxrzu݄+΄΄ӄ*0304678 xa9|v  e " $58@@-lru/00* eg2nrg3nsg4/5Jͅ+܅M+7 valo܅@c #  # b qobT+iDiP8ilcrcuimin-9io Jiv&ix5iy 5iu?=Vxi+(irit+.&iiiM ͆ i‡ioi LJoׇ+i"M "M‡iEiׇkeyi"Mi{igii_65ii xi xJ(iԈi+i+iii 7 5(ii?=q iii d i3,i=3=ω -9d+0*8e@uid @P*X `$ hhh -9hgidh @M+{h6hrcuhLω@@Tg@Th{ cpuTicTjcTkc BTlcBTmcBTncBTocBTpcTrcTsTtTucT{ m T|7(T} m0T~78[TP@@@mE7@b+=r+?8jۋj j! j"+j#oj#o j$+(j$+0j'j(oj)oj08j1 j2 j3 jCSjDjL{jM%&jN{S8jQjR jSSjTJۋʌ+Jڌ+ڌ99+-%&80pZ[ 8` crss -08Z@ X fn 2arg o+7 b W5mSEmTmU({mWgmXemY88mIqmJ`iocmKR.#SE m\c0Gl`l ollll+ lc(lc,l-90lc4l|v8l֒HlN XlW XlN XlW XlXl5`ldlUhl=plxHdevl(l0l 4l8l@l5HHidl hl+plxl=lI8l\l lDll 8l! l"l#5l&0l(54l)8l*l]Hl-NHfql2Xl3l55l65l75l= l>50l@4HtdlDb8QlF@lKZPlP5hlRVlSlUzlVzlWzl[5l] gj7 valt7 val<ƒ'ђђ֒in+vn88_i`*aibiBc Bd crcue reffђ07 v +%sNcTГ    (++ nГ@ *     7. A0 4* 45c67+5Ҕ @ 5 @ Pmc ..Ҕ  (8 }lHrР())e*+ ,0-5@. 5`/ d0h1p2 x3+4ז7 Lval )5@c6|  B5EVuidF @VgidG @H LDז.JXHZ | | | | |  |( |0 x8 x@Hݗ$+ c(c, |0 |8o@ $!ϝW$ݗ@89:;<=՘ >՘(?՘0@8)՘mƘژXDE՘FG ʙH՘I՘ J՘(K0N 8O@QHSPm'ʙmޙޙH}|ϙH}LH}ޙxYZ[o\o]o^o _o(`o0ac8cc@dHeLfoPgoXho`ichjp8cccc ccc)ino  ( 0ԛcԛ+ cccc ccccX /HH k(08@ʝHHPc/xHc4ffMpŝŝm8 + c [ +0 ;HHops!K H};+ZK+ϝ[+dw,}, o'wڟ4 M g (ˠ0 8 @ H 'P @Xc`wh p x͡ #ߟ}l8k4I MI9']]bR}lIc[lˠ}lIccoyIyР'''@ww,cIEwh|'͡I}lyҡ' }l#wwڟdR,j,cy,Jod,!, 'H}d,?S,, 7, cG@Zt[R\u]^`Ϯ b(d0e.8fQ@htHj.PkXmɯ`ohppr 7xsdu}vyȰ{} 1Jt~(!}l 5)pidJ4)uid @@ $  +cc cc d ,5, o )o*,+2,,!,-JPoG0J  _Jp\+!ܧű   ڱ ( 0 8@0HDP0XD`ghp x Ʋ    aܧ '16M)* y+ y,U-`. /+(0 09 4:I8< @=5D> oH? oP@pXA5`BC=E F5HIK o[QEW+Wĩ+$ѩ֩Moc. ĩ)pos  cT}l;w}l7iuY}lMiu|wc ll[ll N}ls(}l(-P}lc+7i}l'UH}}ln}l}lܫ}lë}l+,}l++++ qWY?S}liuc6}liu?Sc^}l[֬}l'}lx@buf@7@ @ @ @  @ (@ 0@58op@X@`@h@op۬ƭ}l}lc}l}lc˭  c4 czRH}zc9MpzH}pWoH}zH}Ϯz7oH}zԮzH}z.H}zQoH}zM3toH}zVoH}zyɯoH}zH}zcozίoxWcX7z7ZH}Zoo_<}H}iH}z}lcȰoH}}lozͰ oz'oz',Jz'6 y)mt t[ +H}OyNc   H}ű'ڱH}ʱH}߱H}' 0D5]z]bI'7lzƲ7M˲H}m ӄ 449%CHzp\MoRN +@ @8 AM B C= D  Et(sd Fn0 G[8^ Ic^ Jc^ Kc^ Lc^ McGbioրB  [ .48 o@ HPoX` !hpr  t &x* F. WnnA͵ٵ +6rev+n8n  nMcrb_6ns0c8< >.@ido` ohpcrcux ops! nhz "ǹ$ % & (( 602 89@: 6H= OP@hXA `z5 VdirMsknn}l o5 5@`h 7x    @  A %nƸ'ǹooiu̹ooiu'o67sO(;h'Tm@c  0' () du* +4,? - 2(o**/9;l;M; 5;m;n.;o&8X;0);1D;2 ;3 o;4 ;5 ޼(;7 0;9 ޼8;; @;= 3H;?VP3B)=`=`DG==j==`I޼}l=37 }l==73}l==V}l=='8;; ; ǽ[=`7ǽ=`M`   5  X̽0 to u  v w! x* yž  z ߾(o'=y"+ 8ž'߾nusuʾ }7 ~7 G" pbuf W"  7G+7W+?Wi+   п iM˿˿տMx()Ex)FMmod)GWops)H!T)I A)J)K. 75)LVarg)M oVstr)NVarr)OO)V)Wc)X7 )\Jmax)^c)_cnum)`ops)a!T)boJ )& 80([)_6+ + c ' W+7`-U.mod/W@0=Hmp1ZP2JXU856D7 9 ;  <*(= :07_M'WM*W':W/Nc>i   n8E)modFW_GgnPpqorostcmtnwi 3 3c77A8=R-h+ )r|pXN`|X :1xl+(,N--.. //01  idclsSȪ @W+^+^+ @endM++ (0&8W+/(+++++ 808crcu12[38GM+ HIJK LM+Ns G w  @)p MH MP X)bus ` 4h  op  ox 5 _  R W a Hmsi :( p8 u@ oH oP X  ` h x  9     Hid W 5  _ !! #  $ %" '#' ) + ` , a - b . c / d 9 e < f:;<|  !"# $(%0&8'@(H)P*X+`,h-p.x/012345' NUN   Ncl~    Hxy 5zc|c}5~0@G8%K  K !K "K #K $K %K &K 'K (K )W5 J :@ @ A B C D E_>7Po\ZD  c                cNooooI  ^(Hqosh0+:,Mid-./5 0D(1I802+X3 m`4 mh5 mp6 mx7 m8+9+:+;+<+dev=^> ^? %?~'^FNc)ops   'cMNMOMP!Q!R! TB(U`0V8W @X HY P[X\`^yh_paxcd pmf~h 66=`=aMbusbdWeMg h$j (k%0m8n @oHp PqyXr`s!ht!ppmv~xw py/;"[[wGye`213M5!6!8`9 O ; d(< 0>8@(@AxHC PpmE~X7J[J6'__1Tx[i'[nusu}0 X YM Z! [` \ a ^  pm `~(@c-  *;7a[JnusuC  c c +Nc    Nc    8 :     0 e !Yu "jeNc 1      Nc B  Nc O   cH d&o e2 f4 g )lid h HmG\fkozfcma@/ 0ops1"dev456(783 @c ^  :hv{^oT@c  get}put   ( 082@FHFPZXs`hpsxZ}"Q4RcidScT4 PfnghciL.}n'44[44M4Mco24M\MF47Z4Ks4_4Mx4MMcc94o4c"hLvbusMNOP Q(G (8@Pp)ops o gdev33c c vc`C       c""(565)len7c )cap8$d,,G` JK)busLMO o P(Q"0Sc8T<U>V@WBXcDYHZI\5J],P`6Xa`cWhdlemfngxhp)piniqj5rkxm,notfvCyzc(|c-}c.~c/c0c1c2c3c4c5c6c7c8c9c:c;c<cc56cccOădevHirqc;@cBc Bc Bc Bc Bc BcBcBcBcBcBcBcBcBcBcBcBcBcBcBcBcBcBc Bc!Bc"Bc#Bc$Bc%Bc&Bc'Bc(Bc)Bc*Bc+Bc,Bc-Bc.Bc/B[F H 5LKPJ[[ c@M5 c`McaM o { Hvpds 5 cPO p  5  5 W c`P 5  5 z |v 50 2 Hrom8  @ MH  +P #X ''1m,M{  v  ( v0 8 @ H#P!X!`;h;1K+W[+3k+ku+(  ! ";#c$ + 'o;c"cc3@cWh;<5=H c8_9aRefhfk vl v o v(r v0RO>fW'vkN{W9@cE(     N]T mZe('mbssrh++J'+M+5'+=]q(0R)vma1'2 3 +4+5+ d>|,? ,@ 0''|'+''+++sscss+++"'J'+o'M^'Ow'ScS'+|'+3G8MN yPcRc Tc'B lCklD lI *lN>lS>$kelAlBlC*&%u`oc5 c.vmknko(kpcku#kw kx `kz k{ k~c8k5<kSQ@k\Pk]pkex+.v M+2$o8oD'TooH 5 [o (Z08T@jyklenlwpmnopqrys t(++8@!+[&+@@+{ H 4+8c=cBcG mapL+T8@@]KaZ@msbqwc | $ws( 0c4 8 <0@lm   ltJlulvlwlxlylzl} clal lll l l(l-0l 8lP@liHl Pl ~Xl`l hlplWxll VakuTHlll @lcDl&Hl  cl] clhKliljlk+ll+lncloclpc lqc$lrc(lsc,ltc0luc4lvc8lwc<lxc@lycDlzcHl{cLl|cPl}cTl~cXlc\lc`lcdlchlcllcplctlcxlc|lclclcllllclclclcllX]vvcoPlll y@l yH{M+,0y: B JO  T (X0]8b@g -HnKPr `X{` h -p x  fqg`hiPk ltagn o$qc(tc,u y0biowB8xB@.HXo`ohopxz|~Zref +.Selv4ho"oDcccKKP)rqs 5IS]V)ops)mapc8 c< c@ cD cH LcPcT oX,`Dh5pN`glllNcl   BcUJ'UJc+c-UcFFK2iU'~+nUycKo7UJU(U' '*>/'NCTjj@c~ `@cZ  5z{|5e2{4_6.v7Xicqe Xoh+7seqc~G@6PS}@Ll]@N)SX[+a oe`)fqgXm osyc 5(6Z0 XD`Dhcpct xeezzUNc&} @@795AF+cc Nc   ,+D![)rq"#1tPt[`'P~'[`'`'_P '-"KPoc2'`PcPVcce'Vc`'V'+@c$  h*M3cW a cWdM m (t 0 8 @ H P X ` h p  x &    6  T  d   }  " * 4 ; E N 6 WX-aAg UqnyM "c$c(c,+0+8@D c@  cA  cC  cD  cE  cF  cG cL!P!Xo`ff kG8 &') +50,V8.5@0`1p2%&3J5Z6#7"9[:J<g> @cBcDcGH+QcRcSo\ceghijklcmcncocp+q+z c{ c| c c c c c c c c c c c c]]cc+ +(01Hirqc4s8Q@Q0o (0Qs8 R' f5 M f   co        !  !  '6  + J J O ; 'd J Y } f+i ' f     fc     y' f -f7A 2U FnfZNc       M]U80]U162]U3268> Low@A]U64Be@ghj lxno qMrv,x,y  su)uz{' { 4r,,  )uM++.+>+N+r,,,.,>)uNr  ,, ;)u rz,!,!, !)u H z dfghijk+%+mtvwxyz{| }~2, (* 6DevBP  $&' ( , . / 048<>@L FHIJKLMNP(RRTUVWXYZ[ \]^_`abcde f"g#h$j _ N  [ -+ H)ASC$!#$%&'())SGL* ,U;R=>?@ABC EHJKLMNOPQ RSTV_YJ[\]^ _`abc d"e$f(g,h0i4j8k<l@mJDndoJhZ+q gS: UVWXYZd +e ghijklmnd od (! : ; j"  !"#: %!LO"Q: R"ST"U",V"<"+Yw"m0#o p q r" x#z: {|}# ~0##+=#$:   #$!!!!!!!$ %!: !!! ! ! !% $%M+$q%!!!! *%#%%!: &!'!(!)!%q%%M++~%0(&2!3!4!5%8&:!: ;!<!=!)SEP>!&(&&M+@5& &: &%'   &&L': ' %''+?'L(:        $(, 0 8@DHIJK' ):        ()!!!)(*!!!)n*!!!5*(x+: (*n*  $%&'x+()+M+{*"+  &,     ! " #  $  % +<( z,* !+ !", !T - !J. 3,1 ,3 4 5 6 7 ,: -< %= %> %? ,xS -U %: V %W %X %Y %Z %,[ % \ %] %"^ %z,(_ %-d` %ha %&,l!-c !-c $-h .j %k %l %m % n %  o %p %q %r . z .| %: } %~ % % % %. ./M+. . $/ i/ G     "/0 I0 G              $ ( , v/ 0           V0 S1 %  % %  %  %  % %S10b1M+ 0KDcK Ae Ag  Ag Dgx ^&L+ELDi&L >Gl Amo An&J Dnx DnfJ ^L+bLDoL WL++1Ar L 0G F M+AM FM+A6M 2FlM+A\M ]FM+AM MM+5A M A A  A   o  9o  o  o  (o  o  7 7N+ N 7N+ N 7 O+ N 71O+= !O  o  o  o  o  o  o  o  o  o  !o  !o  !o  !o  !o  !o  !o  !o  !o  !o  !o  !o  !o  !o  !o  !o  !o  !o  !o  K!o  L!o Ev QJ RMsEo2R9Ok+VRJ+jiR>RC>RC>R> CREs RZEs RZE ScE~ &SM>` =S=Sl]>N hS]=S+>+SjWUE;S:E7]SMsOScjj+MoyO T7+MsO8Tcoj?KTju^T>zuT>#TjT>Tc>T5>TT5E=UExE 5U5UM:U7\N OoZU+OuUoOUoOoU>UM>$U>sU+>2oV>8o@V(>?o\VEvVo+OtoVV+jV>3 V%&O %&WqoMsM&W7ME@w=WWE@vUWMsOdWMǹoOVWMjWjWj<WE WWWjB X]>%X>FX(>]hXMcsEyzX8EFX88cM:UEsY XZM:UO X7MsE X+E  X+ O&YMsE=.YcO 5#NYEEEO `#dYEYM8Y$<Y7M>) YM>) Z7F UZ#ioc !-F  *W#mf EE  W  7FZ#ioc(-F 1W#mfLE  Z Z 7 W !WZ+cFzd\#iocz-F z(W z5|>[,}Wydw>[g~[KWKWKWKW [ 7 7 7It\ ***** \ S  y\  5\ S  y\ ! S  y\ ^t\+d\S F]#ioc-F (W W 7It\ ! S  y\ Fzy]#iocz-F z'W |7I ! S  y\ 0 -^#ioc '-F  FXF  X' 5 W-ii -r   ^ *!-idxAeZb1ioc#-F+,$rc+ +8Ub ^ + + "_ S  y\  B_ $+ $+k_)Ҋ_7U|Ҋ._7U|ҊU`7U|+ `8YU Ҋ`7U|a&  NaU| aUTvQ2 aUQ2 ^bUvTQ~ NbU| @bU|TvQ1 ]bU|Q1 YbU T}Qv%j^b+beR&i1ioc)-F+2$ret&i i8iEi&Ri^ijiwii6iP|i D+d& V`d)Ҋ\d7U}Ҋie7U}rkBeye :iCf2iE RXU XAҊf 7fU} 7fU}7U}rfҊfUg7U} NmgU} gU~sTvQ2 NgU} ngUvT@Q| gUsTvQ0 hUvT|Q N1hU} WhU}sTvQ1 \|hUvT|h1 NhU} .hUv NhU} YhUd hUvT|%j}-^UUTT08j#ioc8#-F 8,-rc:-ii; < =+ >W ?+~out i V+ V+ i c+ c+ i +! + +k1ioc -FWU&J j S  y\ !k& r#ck QkU TU# YkU ThQtQU ThQt_l1ioc2-F+ Jl + + sl)Ҋ l}7UU#NUven1ioc0-F+`out cm + + m)Ҋm 7mU|7U|NU|F Qn#ioc4-F#mJ Q !-a([o1ioc$-F+/7+<'1lenF+O $y;#Qo$a(XUv $ &~"|"T Qs oooUvTs XoU~|"T QsX  XoUv $ &~"|"T %gF{p#buf{7#ioc{,-Ft( E]t1m(31v(CPc. uVUvT :^ O_484FS`qTQv?    o ^ .  . o! 80#ioc-F # 3-r W   I+ ! S  y\ ^++ 0s_#iocs-F s& s2 uW vW w x yW z_ {It   +  + / S  y\  B + t S  y\   ;+  @S  @y\   b+  gS  gy\  0 qS  qy\ ! }S  }y\ Z^t+dt0)1ioc0-F+0!+0,23W$cnt44 ; @+E @RXU XA; V+E VRXU XA0DBO\4ivr~r 'E sRXU XA:2E RXU XA ^2rrr:rprr:C2E RXU XA 2rEARXU XArw:/ 24E RXU XA,b:t2yE ;RXU XAF 2I=2Q rWrXrY!rZWr[r\:2 S  > y\  a J S  J y\   ] S  ] y\ I &6~6,9ER?_yd4 FS`?rs4 FS`UsT<RDXT  EY RXU XAb .26PT" MU U&U'U4U+ ΆۆVT} Q~R X0u*UT}EJ$!YU Ts UsT,QvRDX~Y: YU1%g YU TsQ}YU TsQ}0 #ioc -F  $  1    -ii    I+   S  y\    !  R 1ioc -F+ #+ 2 6 $r   $sz $vv W UKXefr2s Ɍ֌_mz\VT|Q~X0 gvU}Ts gvU}Ts gvU}TsgvU}Ts m &6&636@~MYf:r&wfc uf  VT Q@ !ΆۆVQ|R X0:kH_Umz\VQvX0m !ΆۆVQ|R X0_mz\VQvX0:V2ţңߣ:? gvU}Ts gv3U}Ts gvQU}TsgvU}Tse Ţ6Ң6ߢ gvU}TsgvU}Tsm+ {66~6 ΆۆVT| $ &Q~R X0_Smz\VT| $ &QvX0 gvqU}TsgvU}Ts#0 56B~6O\6ivyΆۆVT|QR X0?4FS`_Nmz\VT|QX0 gvlU}TsgvU}Ts1  66%~62?|L?TVY4_FS`?gl4`FS`o -ΆۆVQR X0:zf2yɌ֌: -:GTfa2bzɌ֌:ʁׁf2{Ɍ֌_Nmz\VQvX0 gvlU}TsgvU}Ts | $<c Y U T~ F U}T .Qv Ym U T~ Y U   T0Qv Y U   U}TvQ |!U} "!TvQ%| M!TvQ%W Us!T %uT U!Q %^T Y!U T~ Y!U T~%KT T"T}%KT .D"U} b"U}Tv%. Y"U Q "Tv Y"U Q~ Y"U T~ \ #U}Tvh1 \?#Tvh1 W#U} _o#U} #U}T1 #U} _#U}%8T%g0$ #ioc)-F 2e(+$ioc-FW$errUC~out $ S  y\  % S  y\  =% S  y\  o% S  y\  % S  y\  % S  y\ 2!&D<^ ʈ &<؈ h  v )&&p'&  Y'U T|Qv R'UvT0 iR'UvT0Q0 VR'Uv TO (Us Y/(U T| yQ(UsT1Q1 Yv(U T| Y(U T| ^(UsTQ1 Y(U T|YU Y/,+Y+Y0[W$ioc\-FU{$ioc-F$r   UC 4>3o<6HUVT Q /? S  y\  a? S  y\ 4? N XUsT Q ; @ !N XUsT Q ;f@ #N XUsT Q 4@646FS`4AA AN  A((Ȗ sA FS  Fy\  A S  y\  A S  y\ $ FBUUsT Q $"BUUsT Q $$$CUUsT Q :wC((Ȗ=C((ȖSO-D TT$T&1T|>TroDrD E$<cFߕ_Fp|&.YU|T~Q (Y~Ggt&:F:NFO?9G YGU YU T}Q} TVGT7~!%TTT7~!=G6 TGUvT4QTUvT4LH((Ȗ/=XI<\I! Vw I,8NYU|\c p|(RJdd4 u\!  J"/BSU @QsR ,/=K<\I! Vw =K,8NYU|\c p|( XKU}T  TOKUs zXKUsQ@A$R0X0 FX!LU T8Q0 %XFLUvTjQ XdLUvTj W|LUs %XLUvTjQ XLUvTj FXLU T8Q0 %X MUvTjQ%g Y?MU T}%W WdMUv W|MUv YMU  YMU  ^MUsTQ1 YNU T}Q~%W%W W:NUv WRNUv%W WwNUsuNUv WNU} UWNU T $QvR Xs UW!OU T $QvR Xs YFOU T}%WdS1iocd-F$memf($iighi+jWkW$rlmUt\ xP rS  ry\  P wS  wy\ 4*R}h P S  y\ xQ<؈ h  v ) UQU~ uUQU~T uUQU~T} ZUQU~T} ZURU~T YU Ts \R S  y\  R S  y\  RC  RC  USUvT  USUv UDSUvQ  ?U\SU~ WtSUv WSUv YSU Ts YSU TsYU Ts0yMGT y5 y&5 y1 {7~outZe_dTL_UL_-TT$ioca-F;Tcovco-F0U#ioc"-F 2 7  WI;K ! ?S  ?y\ 0U#ioc+-F 3 Mb[+1ioc4-F+=1reqL3+U$r ($ii; V$mfE;AWWrVU}T|hf5r`WrW YİѰ&ްJX2EXRXU XAX2 YXU T}Q R~YU1MYrYhZİѰް>Z2E~ZRXU XAZ2 YZU T}Q 'RsYU1r@[U}T|hf5kz[LzoULz%TLz/5QLzBR|[$tmp}W{kfO\LfoULfTLf)5QLf<RhO\'@0]+@o+@)W+@AB0]$tmpCWUH ] QS  Qy\ YU Q T xk+]L+oU++$WL+<Q-0]k]LoULWTL6Q]@`1ioc!-F1mf5E+`out  ^ + + ^)_ƕҕ\ߕ$ w_ _p|.YUsTQ~(Ҋ `}7UU#NU}=`+ioc2-FT1mfFEW5rGa #ioc+-F#mf?E W  5euEd+u1iocu+-F$mfwEx+y5 a + +;m;c;>bo{ S  y\  ^{ + +s{ -|)|C"/BSU @QsR ,Ҋ|C7%gM&6́6ف6| |?0}14#FS`?~"4"FS`/ ~ΆۆVQR X0_?mz \V~Q}X0\VQ}X0 gv1UvT|gvUvT| v  N(U| YZU T|Q Y YU T| YU T|Q  -^܀UvT1 YU T|Q  Y3U T|%gtM 01argM+o$iocO-FP%V0@#ioc(-F-hdr -cfg#G @  -rc ~outA> 0 "! #b10 r  !5  a ӂPval,MPkpLxretxioc-F Ăbo!boR9&b5R9'b5kA!QeD!qe v4G! SU  S҃U }SU T0t! !Uo0 o؈#dev :[0 pM#dev p9[0#resDa WM69 W>0 %oc  ;  G0|.o |D |P! c0%c׉ < !0z0 zC zX+0=#wq@]  =S +F f  4\  >0&+#mJj0+#mBjRTҊPxT7J!AWN F @V T+! + +0D(kV7 DCVE+NkV+O +dkVaPv0#v!aPv=lo#p? I#gfpU   ! 0 ? N! _* o* * *!*l#4 #: $ % & ' ($ U U *U 9U HU  ]U* mU* }U* U*!U* W W ǍW ֍W W! W* W* W* &W*!W*l :   |    ! Ɏ* َ* * *!*l7#p<#q.M   X g v  ! * * ŏ* Տ*!*lg#pg!<#qg;R gE i j k  k l  l u| | | | |  Ɛ|* ֐|* |* |*!|*  ! 0 ? N! _* o* * *!*lϒ#p9<#qSR ]  -len  5-__p) 7 )  ) ! )  DB SB bB qB B! B* B* B* B*!B*l#p9R -ret  $ 3 B Q! b* r* * *!*"PpAR9Tbbxret  $x__p7bb!b 2X @X NX \X jX! zX* X* X* X*!X*aA!ҔPptrA<0 s s6! u @0 j/ j8 jVR I9 /ER c9 7ER 9 2E9 KE!X R Pnew 4E9 KER ߕPnew /E9 FER Pnew 1E9 E9 E!X a j_9 jFExret l!b oEb pEa APnew A@E9 BE9 CExret ER #Ӗ9 #5E ȖX %!X &GRBPvBI‡9BSR3Pptr<‡9H9a([Pp(:‡9(JcY(e-:eUGeTYe%eY`KS`aTaa,a9arY&טUT Y^b<_ CmzC\VTvX0Y6 HU@d]hFkF lm nD oD(p'0q Xs`ubx dy/Dhz0p{D 0 0  /D00 x=01(%2P/mmhpEx    F F, F, F, F- F- F- F- F- F- F- F- F- F - F - F - F -"F -30/pid * *( (00((000@>FPCFX 0"{F%v(v+ - ;. ;3 ;4<6=: (=0>8A ;@D ;HGPHXK:`%N;TGWGZG^Hk -mHp0 q1(t8u@/fsxHH{HP~HXI`Lh Lp 5x 5 58 ~FL o<F\4h9 ;  ; u1 2" TD p2( (8 L@  H MP  MX M` Mh Mp x M /: F  ;  ;  ; 4 <  M 0  '  ' "M )M  0  M0  18  FX N\ N` 1h 0  N      !F "F # $ & ; ' ; ( ; %) 3*N C$ D L/N N R?N S'( T', Y0 ] 8 ^ < _ @ ` D %aH d9X gIN i9 lSN w x z } ~XN  ; ;  $  FmNwNNN F(F,vD08rcu04@ D(H4POx4  " O OO  ; >% !"-$"-%.<(O%F-@@l$@@q-spes ds"$&(0-8X`cr2hpx-F' i-5fpu ,@F(  '$@@!d@&i@ , !c c B(,Gd0&d80XQdh%`dpxb ed' Njdb !  >!val   R!! ,>!!! !!  ^! !!R! ! " \ " ?? 2"R! " "2" F, #fmt555F55$O6,# 7 8 8#5555'F'F'4Fkey9 #("F=#   8U;$V0modW;$X5Y@$ Z ([ ,\#05u$v$w$xFyF,## :$ /$1Fset3Cget5\7 .$D&;$ 5 X {  -( -08!@" ߙH# P$ X%`&/h'Hp(/x)k*+,ٚ-ޚ./ 0 .1 2`3 5 9 ϛ; >k?@=$ !'% + -/  :' !key " ?h' A Bm' Cr' h'' =' >:' '  ;{' ! $0"c("d5"e."gL"i j"lo 5('# N# Np$(cwd$'swd$'twd$'fip$' fcs$'foo$'fos$'$($'l '($*(rip$+;rdp$,;$..)fip$/'fcs$0'foo$1'fos$2' $)B)((0$@d) $Ad) $Bd) 't) :$$*cwd$% swd$& twd$' fop$( .)$5'$6'$9* $<*$>d)@B) '* '&*?$Q+cwd$R'swd$S'twd$T'fip$U' fcs$V'foo$W'fos$X'$Z($[l$\m$]n$^orm$_p$`q$a+x$b'! +@$:Q+$; ;$< ;$= Q+ ;a+$@@$O+&$Pt)$Q+$R+@ +2P@$^,$_9(-$`t)$a&*-$ba+@$c, ,E$@@$f,$hF$kF$n;$q;xfd$t;$wF$zF$F$F&$+@@$,$ ;$F$F Qfpu@$d-$F$$d-$d-$, $,0&$,@@,% -% ;%; :- - --- -&N&N&N'8.'92.'<2.'=2..(<Y. (=F (> (:.(;.7.src(A  dst(A .."F).  () /) /val) ')!' )"')#;)$ / ')*G/ )+&G/ ),#t/#*t/*uQ* L/)'/)(6)).%/).; )1/)20)3)4 )5)6 /()30 )%. )/y/ )7/8)`0)fn) t00\o0o030`0+>0+?+@+A'cpu+C'"F,0     - 1- 1  1. 01.0/ K1/ 0a1 0"0u1K1 0a11 11! 1"1 2)12*'2+2"osq2-01 2/0(3 23 3 0304P244P24P224 p24 P2424U24P2 52(5 25 5 25p2"F6 2 @6'q3(6(26)  6*3(6+406,86-96.:6/;2332q3@@7/470~71F72 6 seq73;743752 76077 83(8G48 x88 W48' R4R44G49499 94 4: 4:4 4 :84;4;  ;4<+5<,c<-cx=_5=_5=F`=hmax=p o5 > 5sig>4 >o5 ?RE ?S55 ?U ?V55A@5 @  @  @ 5@'"6@(o@){@-`6@.@/@0 5@1@56@6o@7{@8 5 @<6@=o@>{@?@@@A@S 7@T $@U@V @Y17@Z $@[ @^b7@_@` @a @J7 @L @Q @W6 @\ 7 @b17 @E7@Fb7@g7@h\_fd@i@m8@n@o@pF A @%|8 @*5 @2"6_rt@9`6 @B6 @d7 @j7 @q70A 8A A A A 80A 8|8 A8 8A  9A!0A" 5 A%N9A'5A(A.5A0 5 A3h9saA4 9 B 9B B lenB B B(C9C {D$9D% D'D( 0DD/:DM#9DPB(DWB)8E :E;E;E;E;E; E#;(E,;0F):F*;F+2PF8:F9:F:FHF;FL :;8FD;;(FEFF1FGF0 G>;GKGZGpGGGendG; :;2H!;H" F H&;HD;HD; HD;HE<HE; HE<HT L<HY<HZ u1 H[(<I o<valIZ I X<I <valI f I {<S<U ;V ;W2"6F[=    0hx=i;jk<cpulFm;n; o;( == ',@@w> ; ; ; ' ' (0F8$@@ ; ; ; ; ;  ;( ;0 ;8 1@ ;H ;P 1X 1` ;h ;p ;x  ;  ;  ;  ; ; ; ; ; ; ; ; ; ;$@qA=& 2! ;(" ;0# ;8%0@&qP'qQ(qR)qS, ;X- ;`. ;h/ ;p0 1x1 ;3 ;6 7qA9{A;{A=5avgG=@@ vA0KAL0MNOF P$Q&SA(A)]BBBBBB,`C&a2h ;i ; j ;(k ;0l ;8s 1@t ;HuFPFFFFFFFF&2X&2rqCACB)^CC(CBRrqCC;F ;F ;F;F9/DSTDBbCBs'qDqDTD? ~DD D CD'' D,EqRjS @ D Hp2P` h)px u10S DFpidpJ7>FJ9 4J:FJ; u1J<minoJ=;J?y J@]@JBSH.rcuJC`JDypE xSF K{FKFKZTSFLoGLp'uidLq o<gidLr < Ls o<Lt <Lu o<Lv <Lw o< Lx <$Ly F(Lzy0L{y8L|y@L}yHL~yPLqXLH`LHhLHpLHxL L}L iL8L}!}FGFkeyMHM4Moz!{M| semMS(M|PM X|`M huidM o<pgidM <tM{zxM|M~M M||M|G H H H H H:XN^LN_4N` NaNb Nc0NeS Nh(8Nk8@Nn]XNq`NsdNt(hNwpNxFtNzx'NF'NFNFN]N](N2N itNN4N:NƀhN N>FN\V_eNW_fFsda_gX_h"_iX WCx_DX_EW_FX_H _I1(_Ju1H_K1P_Lp_Mx_N_O_P_Q_R_S_TB_U_V1_WSF_Y _\_]_^T__NWp WXUSW`NaX a+ a+a" Ya#a$a%a'/Ya(a)a+SYa,a-a!Y a&X a* Y a./Y aYXopsaYSY YYa2Ya4a6Fa7F "FQ@Z   "FQH@Z   QpuZQqZQrQszZ uZQZQYQVQZ(QQ3QZZWZ@Q`[Q@ZQQQ Q B(Q,Q`[0.rcuQ8Q[HZYQ[QidQ j[[2Q[Q[ [(b\b2"b1b0b  c \c;c& $c)Sldtc*\8c.@c91Hc:hc;]pc= xcC |cD~ \d ]ddaltddd d(d0d\8d\@d\Hd\Pd\Xd\`d\hd\pd\xd\d \d!\\] cF\\]^ `FX^lruY0] d0 e0i>^ j  k(Rn^]hE^s (u^zpp{^|}~' ^^^_  ^3(Q0_>^n^^^7R_ F  9 k_val)R_0M_N PF*J_BlruK0x_*W_X Yk_0@GL`I_UEV  _([ 0\ 4^84@Fj`_-j 0(m`noq r s t vF 4@l`j`-z 00}Ta~     (0 a04@|a`Ta- ,Da!L`!`@!a)a, b  u1   E  q(F0F4G8w@pP rp  x#Օ$ % 'ڕ!a5cctx6c c=Cc>AS@;(X`cYS(\cbht%w }$0c4cc-*daaX Gd5rb2Cc Ld Vd[dc`cd;cid Y@@ d 9 d0 mNZ@@h!d@S@PX`hppgd  x) 5 ?hELFS Z2"]'_au1pSr0$ (08;@u1DHP'X3`h/brkp!x%0hh@h]hu1pix( ib&i  ['T!i' dod h3 [h h iQ i i 5i2#e6N#e9N#ej gGMj gHj gIii 4j9j CjHjh,jh- u1h/ h0RjgAjigK ~g:j g@~ijgNj gO gP gQ r(g+Dkg,g-Bg.Bg/ ~jj 0pkqbr rs t u v $H(Dkji"ki#ki&ki'ki' kkkj(lju1j 3jBl7jljWl!(lk3{lk4'lenk4'k2lWl k6;k1l{lk8lkil kj0 kklS[krm ksx ktk7kukRmkTFkU<kVkkWmkXl kYq0k[q8k_"q`k`uhkapkbx(kdBllkmxkn].d_ukvlmm$x{q| }~ o< <F !e u(E0 8@H L rP X ` h'p't'x'|u1^ 'Sx0o  000 \?0$@$H P T X \@e`yh%Dp08@H P(X`h pm q-q'@kqkukukvk6vkJv k^v(k nv0k nv8k v@k vHk.wPkLwXkew`-qq$@u0 q r t(!0!8@"HPX`mhSp &!#:D$SXk 0 b b l vxF (%` '!'"/ 0 14 6F<1 B5@D"qHFxPI'XL`O dRUhS]pZ ixaxbx8rcucdTf1k0%nu1@@o0Hqu1Xr0`q"Fku umFuvv vmlu1vvF51vlvJvv;v^vmOvnvmcvvmqsvvmv lEvlFmlGulHlIvvvvwm)wmntm vm mwvGwGwB)w3wmewmuQw n"wn#nidn&n-n4n7mNnRxnSxnUxnX\nYnZ Fnc 4 ndSF(.rcuneHngXnj0`idnmpnptnq5xnrmnuxxxxwjwx'0o3xo4\yo60o7o8 Bxao9Rj  o4yo 0o" \o$u1@@o-\ylruo/xo0' 4yJ2ynrJ3nsJ4y0 ]y ayy2p yvalp; py"Fq y   y r1zrr r#sNteztjzt ez M MMlz.rcuMmMn4Mo BMvzMx My MuzzxM(MrA{MtzMK{MP{M5 A{A{zA M{{ M M {U{ { M{{{H{{HF{{{M{M{keyMHMK{3M| M07M2MA| M  M (M|MMMK{MP{M  (M| MzA|0 M|M0M =z* M|MU{| | |{u}u 4u[u0u'8ux@uidu o<Pu'Xu `u$>"hL}L 4LgidL } <}23L} L]rcuL}}:@@7g~7h2"cpu7iF7jF7kF 7lF7mF7nF7oF7pF7rF7s7t7uF7{  7|3(7} 07~38(7M@@}1~"F7:M        =3@^ N9n?8NN N! \N"N#;N#; N$(N$0N'N(;N);N04N1 $N2 $N3 $NCONDNLwNM(NNwO8NQNR NSONTSF| ƀ >Fր ր  4  v)v(0wlwwwS(w `x .rssx )xq0x8xS@x Xy fny .argy  ez bz z { 'OSA OT0 OUy3OWb OXx7OY8OIqOJiocOKM!A O\F0 b | ҂val|Z || val|f |ނ} v}  }%6F}T^    "q~      . 0 $ 4"F.ۃ   45F679 * % /4`  o<  ҂  <  PF >`  rKK(K8 bHЁ()x*0+0 ,00-1@. u1`/ d0uh1bp2 rx34 { څval ÅGF  "F6(   BEbuidF o<gidG < H څD4JH ( ( ( ( (  (( (0 8 @HЇ0 F(F, (0 (8@ Ї!;$ЇGF        @89:;<=È >È(?È0@8uÈ܈u܈bȈXDEÈFG HÈIÈ JÈ(K0N щ8O@QHSPủ̉q(qڅ։q̉xYZ[;\;];^; _;(`;0a18c1@dHeLf;Pg;Xh;`i1hjp8FFFF FFFino  ( 0‹F‹ ҋ QFFF FFFFX66 Y(|08|@H6PQuGw6uF"TuTҋ;wubw ^u܈wuD8  F S 0 (H/ops!8  q( 8 H*wm}r mwk\Ǐ! : T (0 ѐ8 @ H P -XP`dh p x   ̏ba!E B:E&JJO ?bErFSYbErFFѐE~~֐B -kkPEy2dUB~~iBEؑؑbݑ bkkǏ*?MF4e]-*! &q*ޒIN  F ޒ $@Z`[[\~]^`؜ b(d0e78fZ@h}Hj7PkXmҝ`ohp"pr @xsmuvyў{}:S` j t ~  ( b 1pid>F0uid o<o< $ p FF FF r* 1 ;4 )Օ-*+., -])P^F    $0c  &c=ltΟ    ( 0 8@9HMP9XM`php x Ϡ  ) ) y  +& 05 ? INۃ ] g q { : :$)Bߘߘ5r;F pos r) Fr5brXb~oi:{b5~oi]kF bߘՙbՙڙ \bFb/qbHbߕ4kbrrMbpb ٚb$PINboi~F.boiIN~F QbQSV[ 3\brreb ϛbrbr~FrbrbrrFԛF =F$m[qmFB5ymqy`qqB؜mqmBݜmqm7qm#Zqm5<}qm_qmҝqmqmFmםGw'FQ@m~'cqc;;h EqrqmbFўqbm֞m0m05 Sm0? mt S qX6F   qΟuqӟqq u9u%Mu>fmfk RuvumϠu~ru5~rԠ q\)ux==B . LQmyt5[ "@@AA5B0CFD֪ E<(sdF90GAS8'IF'JF'KF'LF'MF *  . 'PPW     qq  ZU2_rev Z99  95.rb2ns0F8< >Y@id;` hp.rcux opsJ!T r9hEi y"$ % ɦ & ަ(( 02 ~89B@: H= P@3XA Q`E O dir d > Ukn9b 1 1@`0h x  ~  B@  BA %`dddUydn~oiɦoiަΦd~rdՙ3drQdr8"Fz  0'֧(V) ji* +, - .(z1ۧ 1"5"5" "mW "n "o&X"0"1 "2 ~"3 "4y "5 ("7 ө0"9 8"; ө@"= H"?PWW )F) LF3~jFQ)1EtbFr~~өbFr~rbFrةbF"N" l" #lF)SF)5~q`֪0 u1 X0t7u LvQw!Vx*yy z (۪7LFAN[(oot֧A`t~ttiyiC }~(E>F5modG;$opsH!I JKa ܬì\׬HLargM strNarrOVWFX \max^F_Fnum`qopsa!b$0(;();=2L t F v   :7` -  .mod /;$@ 0FHmp 1P 2{FX  8 5r 6  7  9  ; ͯ  <( = 0r5~ͯ;$5;$ү;$6F >   ,8 ELmod F;$& G6 J       _,P p q r sB tF5mtn w  1  1 F   6;"ܬy=e& o y#QNW/Q  "L Aϱ >ϱ `   A > >7  AG"7>:G a M b L % Kint 1u8? #W   1 <!%',/359<ADHLQUYɲʲ˲  6 9 < GK 1 :@ 1T| 1.111-  g l - - - `J 9   % V9  `/V ,4p ,   : ;9 I8  : ; 9 I8 I~1BI !I : ;9 I841B 4: ;9 I H} 4:!;9 I  ( 'IH}1RBUX YW  : ; 9  : ; 9 I8 4:!;9 IB<1RBX YW  : ;9 I kI: ; 9 I : ;9 !I/ &I: ;9 I.?: ;9 '<1RBX YW  : ; 9 I : ;9 I! " : ; 9 I8#: ;9 I$4:!;9 IB%H}& U''( 1) : ;9 I8 * +:!;9 IB, : ;9 I-4: ;9 I. I8 /(0.: ;9 'I 1:!;9 IB24134: ;9 I 4 U5 : ; 9 6417 : ; 9 8  : ; 9!9: ; 9 I: 1; <1RBUX YW = I>.?: ;9 'I<? 1U@>! I: ; 9 A4: ; 9 IB : ; 9 I k C1D4:!; 9!I E.?: ; 9 '<F.: ;9 ' G  : ;9!H : ;9 I8I4I4J : ; 9 K : ;9 I k L:!;9 IM!IN> !I: ;9!O.?: ; 9 'I<P: ; 9 IQ : ;9 I 8R.: ; 9 ' S I 8 T4: ; 9 I U4I4V : ; 9 IW : ; 9 I k X.?: ; 9 '<Y.1@zZ$ > [ : ; 9 I 8 \1RBX Y W ]: ; 9 I^ : ; 9 I k_ : ;9 I 8 ` :!;9 a.: ; 9 'I b4: ; 9 Ic : ; 9 I!8 d : ;9 e.?:!;9!'I@zf 1g : ;9 hI~i4:!;9 Ij.?: ;9 '<k.:!;9!'@zl.?: ;9 'I m : ;9 n  : ;9!o : ;9 I p : ; 9 I8q : ;9 r : ;9 st.:!;9 'I@zuH}v w1RBX Y W x4: ; 9 Iy : ;9 Iz({ !: ; 9!| 1}H}~ :!;9 .?:!;9!'IU@z :!;9 .:!;9!'IU@z'I : ;9 I 8   : ; 9! : ; 9 I!  : ;9! : ;9 I 8 : ; 9!.?:!;9!'@z.?:!;9!' ! 1U1>! !I: ; 9  I8 : ; 9 I 4: ;9 I?<.?: ; 9 '<5I !: ;9!!I/ : ;9  !: ; 9!( .?:!;9 n'I<1RBUX! Y W!1RBUX! Y W! 1U1 < !: ; 9   : ;9 4G:!; 9 .?: ; 9!'< :!;9 41 H}.1U@z% U $ > &4: ; 9 I?'4: ; 9 I?< : ; 9   : ;9   : ;9 4: ; 9 I? < : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ; 9  I 8 : ; 9 I (  : ; 9 > I: ;9 .?: ; 9 'I<5.?: ; 9 n'I<.?: ;9 'U@z.: ;9 ' .: ;9 'I .?: ;9 'U@z.: ;9 'U@z: ;9 I.?: ;9 'I@|41 H}1X YW 1UX YW .: ;9 'U@|.?: ; 9 'I .: ; 9 ' .1@|H}.?<n.?<n: ; 6 : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 'I : ; 9 I8 < ( : ; 9 I : ; 9 I I&I!I/  : ; 9 I8 : ;9  I8  : ;9 I k : ; 9  : ; 9 4: ;9!I '  : ; 9! : ;9 I I : ;9 I8  : ; 9 I k  : ; 9  : ; 9 I k  : ; 9 I $ > ! I 8 ">! I: ; 9 #4: ; 9!I $  : ;9!% : ;9 I 8& : ;9 I 8 ' : ; 9 I k( : ; 9 I 8 ): ;9 I* : ;9 +:!; 9!I,  : ;9!- : ;9 I . : ; 9 I!8 / : ;9 I80 : ;9 1'I2!I3 !: ; 9!4  : ;9!5 : ;9 I 8 6> !I: ;9!7 : ; 9 I!8 : ;9 I 89 : ;9 :  : ; 9!; :!;9!I k < : ; 9 I8=I >4:!; 9!I!? !: ;9!@ I8A : ; 9 B : ;9 IC : ; 9!D : ;9!E!I/F !: ; 9!G>! !I: ; 9!H% I$ > J K&L4: ; 9 I?M'N4: ; 9 I?<O : ; 9 P  : ;9 Q  : ;9 R<S : ;9 T : ; 9 U : ; 9 I 8V  : ; 9 W I X  : ;9 Y  : ;9 Z  : ;9 [  : ; 9 \ I 8] : ; 9 I ^> I: ;9 _( `4G: ; 9 a.?: ; 9 '<b.?: ; 9 'I<( 4: ;9!I $ > 4: ; 9!I &II!I/ 4:!; 9!I  : ; 9 I :!; 9!I!8 >! !I: ; 9  :!;9!I8 > !I: ;9!>! !I: ; 9! !!:!; 9! :!; 9!I8!% $ > : ; 9 I4: ; 9 I?> I: ;9  : ;9 ( 23U3VUV|iUV|iUVUV7T7^T^T^T^TTP]P0P]?@?s@D>sD?s??s>s?s?sP<TPTPP uvTvTvP 1vP!V!0Rr@H$PPRcUcVUVUUVUVgTg\T\TT\TT ^  NUNVVVUVRTR\\\TTPR^Rf0f}P}DPP0PDP^PDPP~____?#?s#'>s'i?s??s>s?s??s>s?s?sP\lPPTPPP2QPQ  U  0GPPp@H$QPuPu]PvP p4V0PPPvP  vvvTPP1p4vP?U?CtxCDUDDUUtx/h8"R##RR!U!00R11RRQPRPUYSYZviZ^ui^_UP-T usV U U# TUS|iUS|iUSPVTbzTT)0)5V5<P|?|0p0 7 p!  PsP  pQr s#p#p4p;p2p7p=p  p\q s#p#Qp \pps#P  P\  Rq s#p#R\p4p;p2p7p=p p\\pPs#P ppQrS1PPPsPUVUVUVT]T]T]T]T]T1Q1\Q\5TS/PZ^R^jPSPQQQQ09^^g^gl~l^0^/]/>RZjTjyR]]Pp@J$!r@J$!PP:BP5t 00P0PP00      p4p;p2p7p=p p  PQQPpQp4p;p2p7p=pBpPur|v#tQr|v#}<v#}8v#PQQP  PQQPpV0$PPPp@H$QPvP6S6^ F$ v#v#PF$v# r@J$! P v#V0Pp@H$PPvP-U-QSQWUWSSNTNRVRWTWhThVV0DF0  s# $U t $ &$T$% v $ &s$Q$%s% LULSUS/ST\T\/\P'P*4PqPqu]v]P]])P)/]0VvEV , Dn00nSSn\\P]<<<< DDDD DDDDD<<<< <S1PPPsP  S1MSRSSMVRVV U <TEJ$}EJ$! T A}EJ$!0RR0R` s `]}`]]s# U }  T ! } !s! `U`SUSxST\T\T\8\8<TQ>UQUxVBXBsss8sUxsP]R s] s0P s s .]Us]<<<8<Ux<PPP8PUxP.R.0r1&0@RRRR' ?r2$#3'@?s2$#3?s2$#3?s2$#3?s2$#31P1[1PPP8PUxP P  <<<8<Ux< <"s t 2$ s 2$ s 2$ s 2$   000SSS\\\IXIsP<(@P@Ksss2.( ( (   P< <BUBSUBTBI]IMTM]TBQBI^I^Q^^QVqVqwQX_X_X_B0II0I_1h2\\\rp r@ , D@,;rp;> D@>GrpGQ D@0PVVVVP P~PP0]P@P@P@]vH%7 qH%74U40#V*VQ _PVS1XXPX  USUW0JUJ] UMTM_T_ T _ T_ T0Q0VQVQVQVQV Q0PSPSPP0SSS010 SS1 .T . . T .  . T . .T .00PP0PPPPP0PP 0PQ~ _ _0 P0^^^^^^0~~0   0 0 P0~~~b0b1\\\0\0 \\\0~0~010}  p4 p41p4'}#( ((~(]]V^^UddhXh~  U h~T/ F$!P%___HH  }#t#&T0P 0PHH H  1p41p4P] P _ P r^03PauP P~P P^V~ $< $-(v $0 $-( p UVQ~ yVV <^~ $< $-( $ &  <  ~ $< $-( $ &  < 8}# U!V!_ ~ p U\Q i\\ 0Vv $0 $-( $ &  0  v $0 $-( $ &  0 8}# U!\!^ 0]PVPV0p2%p2%#"p|2%#r2%r2%#r|2%#0p2%p2%#p|2%# v@$ P  v@$ v &P0p Pp:!Pv`PJp2% $ &2$v"# @$p2% $ &2$v"# 8$!p2% $ &2$v"# !010&@P&0P@ &6 @ 1'}#'+Up2$ +~2$ /\/ kV$}#$(U(~2$ )V(|'}#'+Up2$ +~2$ /\/ $}#$(U(~2$ )V(|Gr2% $ &2$v"# #Q#Bvr"#?V"0"4p2% $ &2$v"# 4?p|2% $ &2$v"# e0e]]1V1CPCV6\I\}# U | $ & T $ | $ &$^$ }#U | $ & T | $ &V~]PY_r2$- ~2$Po owP p U\Q T\\ }# U!\!_ ]{0{PV   4 4 p U~2$ Q 0@0 0 0@0@@ 8 @     @ @@ 8@  @@@ 8$}#$(U(~2$ )V(P]p]AUAVUS|x!XPP0P02]2BPB]P U u  U  uuPRS1QQPQU5SSUTP P V\\}xUuSS sss p40p0>U> ] U ]d] S ~x SdS0v3%v3%#v3%#v3%#v3%# P@KP/^@S^SWUUu \\ U s P \\ U s  P p40p0q0S S SdSssSS S SdS,VRrV~ V PRP S 1PPQP p40p0Ps#0U v $ &QRpU v $ & T v $ &QRDSVU v $ &QRU v $ &QR]3]0]SQP0q0 0DQ656S60    v v" v"600"V"6 0R"5R  p0R%s#%)U s )T)s)s P 0 p 0BStSSB@t@@B1t11  Q'-q@H$-hQ~~QQ.Q 0KVV  @J$ Q6556SS611    v" v"600v"V"6 05RmmRp0RS1CS11C1Q5;QQ5;QP57PQQ S 1PPPPs  U As s  U %s s  U s  1 PPQ9U9 V U VUVVUVTTT"P" S SSMSM^PdS\!|!\   ^    < < P^P^  "P"qV"P" S SSMSM^PdS     18888<8d8 8  P$s$s$s P&\v<v<v<v<v<v<v<v<v< v< v< v< v< v< v< v< v< v< v< v< v< v<v<v<v<v<v<v<v<v<v<v<v<v<v<tPtv>PPPPPPPP P P P P v> P v> P P P P P P P P P PPPPv>PPPPPPPv>Pv>PPPPP{Q{vQQQQQQQQ Q Q Q Q v Q v Q Q Q Q Q Q Q Q Q QQQQvQQQQQQQvQvQQQQQ00 0 0q3$"00 0q3$"0 0q3$" 0 0  0  0 q3$" 0  0  0 q3$" 0      0  0   0000 0 0 0 0  p40p0PSpSU(\( U(\(^( U\^ 1LPSSSGSVVVGV(0(?P?XPPX$$=X=G~3%O3%O v83%O___G_|PP$=PQ  $= Q7pp$=p8VP=\!\\1PPQVvvvssQs ,=\!\\ 1PPQUSUSS0.PP00HM^^0).]]0"TM`0`iTTT0"R.=0`iRRR  " "=\=  VVVP VU^V  vU^vv@Q@PELPLO RUUUUUT]T]]9Q9TDTDD3R3SRSRRX\X\X\\0PP0R0PP 0^~^P SPPQ0p0PQF]Nu]F5Nu5 X F\Nu\     % %. .F0Ne ej ju  0 _ %%._.F Ne_ejju_0.F^NV0p0 p0PQ0p0@]Ej]@:Ej:@\Ej\ ' 'v! 'v!) 'v)E0EY 'vY^ 'v^h 'v0V!v!)V)E 'EYVY^v^hV0)ESEL0p0  p00p0URr %U6U6EVELULhU U VT<SLhSSQ6T6LQLhT T Q6U6EVELULhU U VQ \ %U#%2Q2A\\TTUUUrVry}}yu}U'T'nSnT$P$E\EOT u$S$_$S$_$^S_^1$Pv ] UU# \ TUq =r Q=RUU utUp2U2^U6T6STq]PVP} }sf]9]]] 1PPQ t s s V7U7fVfkUkuU7T7kTkuT6SPP U %pgUgp3$"UUsTsp2$"TT"Q"IVIPQPVQVV? Q q2Q2a >\CC\\<V |CC s sT sPQ Q  VCCVV  2CC22  CC   P@@PP@U@\U\UU\U\U\UU\LUL\U\@T@TTTTTTTTTTTT+T+T@Q@VQVQQVQVQVQQV&Q&VQVQVQQVv@1@S1S1S1S11 ;!v2$ $ $-( !v2$ $ $-( !v2$ $ $-(  [   [   [[   [; v2$ v2$ v2$!v2$ $ $-(  8U\U\U.U.\U\QVQVQQV]]]]00qq0,1,5201? 0000 0000 qSqSqSq7v7SvS+ |2U.U.\U\qqv qq7vv P7P7^P^ qq7vv q$q$7v$v$ q$q$7v$v$ q$8& q$8&7 v$8& v$8&y\yVPgRC C\CRT&TP&rTpq?U?UUUU?T?VTVTVTVV7Q7ARQQQQQQpQ$Q$.RQQQQA0ACQCr\0\00q v $ &v"0\C0CiQ0Q0Q000Q0+Q000Q0RRR0R r R R rRRpQVVVVVVQ\\\\\\s]]]]]]^^^^^^+~~~~~~~~~~1_1}______P0\\\\\\ ZZZZZZZZZZhQQQQQQQQQPQFQRQQQP___#0#PU7U7FRRURURUP00RZ0ZbX0X0XP00Rb00[0QQQQQQQ R      QQQQQQPPPPPP R     \u]]Eq q 00Eq q ]] ]]\00IPPMRRsUszSzvUSUSS|tUSOVO]vVVV|xtxU 8 VQQQQQP'PP;V;CTVsj#UP!UAUAHSHhvhUSUSS|tUSPPUPV0,QQQQQPPQv#T , V (TVVV P n]s]0 |0)0    88 8'sj#'+Up 2$ + 2$   +Q+// U&p&0U 2$ 0 2$ ]1]R0sjV0+PQPshPU0UU0U UP0 P #p#2PP   U %pUPKUQKU R!RP'uRpQ P uPQ9U9SSSYUY^UV v $ &Q U UT T U Ut ! T T !>U>Cp.U6U6pVpwUw|U&U&^V@\@SPP U _U T _TQPHUHT:QRA R>U>~S~US!S4T4VTV!V5V<<V!V5S<<S!S5S<<S!S5<<!5 << ! pp 5S<<SS5<<5 <<  5 <<  58<<88&P--P P7--77p--pp&p--p p S   5 << ! P8&7--7!78 8&7--7!7US"U"/S/4U4eSejUjST"T"?T?jTj~T~T+16M1+S6MS'U'SUS$T$VTVs Qs U#V#(U(cVchUT(T(>T>hT U,UT7T7V)SPPUMVMRURtVTtT ) s)) s)1 s1I0Rj sjj sjt s01S1I RtS"01HRRc0  p0p0USUSS6sx T T6TQVVVPT#t@H$#LTOaTllT%T%+Q\CC|}CG} |"GP|}~~|} |}101s]]6]TPS);S1);1T)/TT)/TP)+PTT  FUFKUK^UTJRJKTK^RJQJKQK^QmUmUdTdmHmT D\b,Q  ', y #+2e #+222e #+2? #+222?h %&+ __w"U^ U^D/ ^ !5!5!5!5+6M6);)+5    3MPT 2|   #4? , ,$)  $)   %-9; t OOTFNu   8Bn MO ._gkrQQ.  ! momqEm  Ga ;=;E ~Sf x $*B*-28J > /,1BENSVVn/(0  7< !                 NQ      w}       $(/ d   d d       %*Bt;mm 1C57A%        7 % 2ADc"&!-2=Bcc!$),FIRg"%.#*2%**/;@RR-")1$)/ **")1$)!3;;")1 !#'/48` #'/48` #'/48=$)& #!(   "  ! !) !!&JL '/$) '/$. $   " !  &.$)    !$$$)-H (('/ 007B4! '.38"(/W\$$$ -0VY   8FT&x              @ 9 G9G "YQU               <M K-  U\ t<MJ<M K-  U\ t<MJ <P"qzJPz"&tJYtt /  uX Xz5y<'B=v. g%(IK(G)f=xJ<'K<uwD<%h HL(Ggx<*t/= "bN03=KK= =MLMttttt K=4wX 6 zXC hJ.w,h=(L3 L.t3.@<Ys<'f!f K>sYu&%twM2< .vXM2<uMX2< . sX(L3 L t3 ?<Zs< tY&%tvM2< M X>V"z,g:e,t Xe ut?|<u|XJ|JX<|t  " =P< u .XftX2>JfA.5<J feK>..sXhu+' 3%w9o3wx<6x<6x<&z.Y, f J:l,f,oJ:oJ,ft<...jX <ct<^ XJ[ XJ^fy o< tfz. tfz.t  tfN[u[Y  yt`J.eXCy' 'XtYu$tuy. rXh h< htXvg. tU h <  httq=h Xg Xlf.~  ~fXJYv .uX fuu <<Y ;gXt"J/   }tat gM  I= -zXmM  I= -tXg-Hhuu MuL Jt J P-z<t J  J-t<`)/aaJhJ.hJt5ItXO <HNp"<Ewt CyJ  rXYtt".t{ Y Ettfu;t2XY =!fX%-e%:w NG"~ "N ,j Z1 XI 8@ 8!ZJufYYZLMY?t" fhuutZs fgutZsX]7Z[tKt#Xw7tXf 7< uXQ:<!x8.9&] 8<<d0M<X<<ZMJ<...S<<<yrhXfpX>rhX X<:&]I ("J vtu.~YLY<_J sXttttJqZx[3 X [$[J<$L  7  :XJgX[J<$L  7|&Yy5ytYZ.Y-xX.wX XfY Vt )  V.t) U*<Yt<> Up YMgt K<"=* Up~,u<Y :z,H".6  ku\t"=[i7t wV<)<=<>U'%(IK(G)=xX<0VX4!<:!<_zXH q.q<qJ.= wJXw.@ fZJJ%h Z %X ZJX%  v cZJJ%h YIY cv. vX  "JYge=%;-Y0f%;0vJ.  X+K(,2 fZJ<%Z Z %X Z e   J . X n.K*5H.8<*4 UwJ XZ<%Z Z %X ZJX% J .<ZhZ<% YIY JJ(JZ.%ZJ%<ZJ<% Z %X ZJX%  XZ5C(JZ.%ZJ%BZJ<%Z YIY 0Z.%ZX%Zt3%).@ XZJ<%Z Z %X ZJX%  fZ8 ZJ.%<ZJ<%Z YIY Z.% ZJ %.@ZJ<G%3GJJ)J. 8\ .ZJ<%Z Z %X Z  txu{2  ;=W fNof u t <<  XJL= .3g^ X<#[X%.[=Ug,VfVuh wjXppXjY.Z^7.v:YwX7z.Xg:m/fX  XX6xXntiY<[XfJ/nfgiL   fv.Z  w.g"$xgz<z(yg> /hsthY.f<$ 1}hJ.[h,t</i e} h..< 9/ o+st=sgY"XpXSXy y ytXy Xot. pf[nXuuXXX rJcX<cXcJ<cXcJ<cXcJ<cXcJ<cXcJ<cXcJ< cXX c.c<. =cJ<<4Xi c$ufJ fX.~$wX J$wXccXcJ<cXcJ<cXcJ<cXcJ<cXcJ<cXcJ<!z zf= bJJ bJJ  <rt bJf \ K K Z b"<< b< <= b   < zC bJf [  q<J bJJ bt b.b<. b b. gb.bXbJ<  fyhJ.kXi b"jf bedt0VZY=;YYX"l  tdt0VZY=;YYXXXX b bX bf  b b.. bX XyhJ.X yk X$r"0V  w<t v r< t=(r rt <<r tX (r rt <<rtX I>HZgggJ$Y&IZ;J`pJoJXoJ<~ tYJ}h.[h}!kJkJXk. tYq ntq=n Xc tYg nt=nt n>X I6wfJ fK4<<.uKX4-//ff=/;V-Jf.I tgIJ6K.4<r<KX4`.If/r<K4 Hh..dX XRXuL3.XpxRxtJD<[\#F*9w8Xu< .t  N1 P/tNJX1(P/Q.<<lQX.ehJ.[vq X[#քQ. y7׆ Y]z=x -tK,K,K+6JtLJ QyXNu\J"L/V</ tJJY) LsT'u';Kv%(WY(G)t=xJ<1 YZ* ~XtZV)J</ hX IYYKWK:fguJ%LK#?1<!/0< =0< =.<@yX<XYPXP/<< fPX/dhJ..dXyʮlb<XYRXPX/i rQX. {6x. JwJJY:Z;X r<V(:V(V(Lz<YYYX XV@)  VX )< Vf )X VtX<)ZLdVY YW (w<@V+) VX)7< VX)t<qj f / 62tXYSV)w<W!V)YYXk XK..gV@)  VtX )< Vf )X VtX<)]H\ 9YL8YXO[V+) VX)7t< VX) Y$.qXY. Xv<yXU*!U*YYX XU@*  UtX *< Uf *X UtX<*\ cWY& h-KV=K0;<2!JK3"JK&ILJKU/) JU )YU/) XU )0tXJJJU+* UX*7t< UX*t fcXj %f /}X  Xy<zX XsJ .s<  .s./\ CNr<!S=W(W(zz<YYYXM X5Jt.NXW@(  WtX (< Wf (X WtX<([[ dWYK=q;.Z%~ %\  T+<  Tt+X T+t  T.+JA!  TX!+XL T[ Y=M  ZW Iu = K<)+)XJW+( WX(7t< WX(X  u.Xyt$9.)L&t1! Y = ;KZu  dvqJqJXt v z t t q[ =M u  u<K xJ!DxtK! t=ttXtt t tut.y[qjVXf{* * fu{X|u kf~X|-|! v KZu >Bf}X|X  |:rfs gvr>hYYX 9 t  z pt pt pttXuc aX" J"J <=v  { ! g (|t|t}0X|X|X |X|X }~X~X~X~X|X } |tt| } }~X~X~tt~-|X-|X-|X-|X-SXX     X tY#G ?tY JYo3ZuWYtJtu-YtJt uXq v tX_!fZ;؃Xu fZ y. y t  . dZ XdX(.L< Jc  X</ Lt  e y t KoXfo..oX<< ..sX8tqv.G9uv3Xg,Z:&JXa XXDh :t)yfQ*st Jpt/Xh}PFJ0X9ve tYs _t s=_ X /s tY_ g _t =t _XatftJt. t 0))i X  ]v Xq Xl XZtfttf t J t . tJXtXtqX &UX + Ja xJZ.<G% LZX% vHZ X~[X$[X ^"fX \]X dZ XJ. c Xx fX/Xt Yz4XY a\/aJX|xJaY a-=Y;-aJ. y_fY0 a%oXafg tYaJ< X<af%daJaXaJ<`X`J<`X`J<`X`J<`X`J<fY `[Y dZ \`JJXg tY`J<`f< `X `JX`JJ -`<fJ=W= tY;-< f tZ t(Xxf`Xf`J< JK.vfY0 `&tXtf`J<vfY _&pXXJ _< g tY_J< _< _ff$ _J _ X_J< _ X_J< _ X_J< _ X_J< _ X_J< XY _  _X Y00_JJX  IK_J  _. K_Jf  _J< Y dX [ sgY_J< vY"t}1fXg =yhJ.[hXyfY0 avX< XKX x$Y~<hJ.Jv~5j< vtJsgX 0 v  /Wf<2X1f/>7hJ<wq?/ K WX  Z ] K WX \I tKJX U 1g0 h1'g<t.t. R3 H< f  tfK   J s 0N;..5Z:r rvX KfY J sXn nt  .fJ~ PYetye <JsK+X7` KtI;0R vt' t'J/Y [gX tu<.MgyJKZvY1 ztEyCXX? \' ZvY  t[ vdZ fX<   t$.ZlJ"tZlJt A ltttt rX >!8/  _ofY X X J r ^: >v< ZZ XW s \#\< #X \t<#\".j8/:WXL]* "Y=;K.N\ # \t#< \tX# X = \#\ #< \tX<#\#. \8/ :W XL]* "Yt;K;K.\# \t# \tX oX=/-xY/K/ .]%~ X "t i.*Jl:^vfYY vYX Y&  Yt &f Yf &X YtX<&YdYYXK!4gU//$<u$g2"") t5fxE.M Y#Y& YX&u; YX&wf YX JX'  Xt 'f Xf 'X XtX<'YdYYxp=JX' XX'u; XXX ' YZ  Y=  Y<=  Y= < />%X.<</ s<-n<J |fu0-Jhq</^v<YXMQbXMh <^qfYYX XtYS , St ,f S< ,X StX<, u sYZ eWYZVKuuS, St,< S<,< StX,=sudy < _n</ .wXY z< X X r Z%Z< X% Zt<%YZ%. k7/ 9W XKJvZ% Zt% ZtX19YR,w</R,x<ZvYYZXX2 RX- sYR>- <RX<-[ZdZXMS ,S ,S ,R+- RX-7t< RX-btfJX KY}t v  tt XfX"n } }#!}X*%X .R.X ZtJtXht.hk Xg. Y v   u 9tt u^ v[ y tu[q/w.moJtot.h.iyhy &si K3#90K1 J..}XvdY}.q ueX X. z J rp Mg K<"  tYzu| fKgػ0:vYXB$Y&;Z;J f !Yu   utXX 7 qp Mg K<" tY LCt<[<q// &J<<i_y.=s/zt4C<<kC[<<qu=["        ___GFP_THISNODE_BITlineget_budgetlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersLANPage1_tdev_tFREEZE_HOLDER_USERSPACEmsi_caphost_blockeddup_xol_addrshared_tagscapture_controlnr_wakeupsstartput_budgetwait_for_completion_timeoutstart_brkstatic_key_modreq_flags_td_ino_softlimitxregs_stateWRITE_LIFE_LONGProcessEventNotificationuclamp_setag_listElf64_WordConfig_tgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparametersrq_end_io_retzone_wplugs_lockbridge__ret_warn_ond_releaseMPT_FRAME_TRACKERstates_d_op__UNIQUE_ID___addressable_mpt_halt_firmware628mce_whole_pagestatsreadblk_mq_queue_datanetlink_nsneed_qsswap_deactivateblkcnt_ticq_treework_bitssi_code__UNIQUE_ID_version594thread_nodedata_szMptEvHandlersNumPhysDiskPathsnr_itemsbi_flagsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributesWQ_HIGHPRIsbitmap_wordpci_set_mastercached_rqsset_child_tidblk_unique_id_overrunirq_allocatedtmpfileactualrcu_read_lock_nestingem_perf_statemin_nrtick_dep_masksbitmap_queueatomic_readfifo_timedentlistthrottle_disksi_errnoromlenMaxVolumess_inode_lrusrcu_size_stateblk_plugmpt_readScsiDevicePageHeadersVolumeSettingsscsi_host_stateSenseBufferLowAddrneed_tsof_nodeWriteSequencerefsmmap_compat_basestrlcattrace_eventsenv_startsleepFlagdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateexpVerUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTBucketsRemainingeh_should_retry_cmddevfnregsslice_maxlast_switch_countpci_set_drvdataqsize_tWORK_OFFQ_DISABLE_SHIFTMPI_IOCLOGINFO_FC_LINK_CRC_ERRORHostPageBufferSGEfilesboard_tracerdevicesdqb_bhardlimitliveatomic_write_unit_maxwake_up_processrun_listixolpci_stop_and_remove_bus_device_lockedbd_mappingsym_vvar_pagemodule_sect_attrsreturn_instanceoriginator_desclog_infoptrFwsoftirq_activatedSHOST_RECOVERYpdevzone_wplugs_workpci_power_tclass_preempt_notrace_is_conditionalis_preparedret_stackmpt_downloadbootnode_idautosuspend_delayunsigned int__UNIQUE_ID___addressable_ioc_list634gendisk__compiletime_assert_116mpt_idsspc_timelimits_instancesevnpMPT_EVHANDLERdescseqcountremove_busoom_score_adjd_seqbi_crypt_contextinit_requestia_vfsgidprot_capabilitieswq_flagssize_tacpi_device_idptm_enabledcap_permitted__UNIQUE_ID___addressable_mpt_Soft_Hard_ResetHandler629ChainBufferDMATT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesloginfo_typercu_tasks_idxMpiExtImageHeader_terror_statercu_tasks_holdouttarget_listno_64bit_msipasid_activatedpi_se__compiletime_assert_121originator_strPCI_ROM_RESOURCEget_offset_ctxcore_forceidle_sumPortSettingsexit_requestfreeze_ucounti_ctime_nsecalloc_workqueuecpuhp_deadneeds_fresets_remove_count_CONFIG_PAGE_FC_PORT_0_CONFIG_PAGE_FC_PORT_1syscall_workdevice_physical_location_vertical_position__UNIQUE_ID___addressable_mpt_register635atomic_long_tprealloc__init_swait_queue_headPCI_IOV_RESOURCE_ENDpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_head_msecs_to_jiffiess_vopperf_eventf_securityi_sb_listvm_rcupci_read_config_bytepgtables_bytesMaxPhysDisks__compiletime_assert_45target_destroyget_link__compiletime_assert_47__UNIQUE_ID_mpt_msi_enable_spitype595__compiletime_assert_48fmode_t__compiletime_assert_49cputime_atomicSGESimple32_tpci_channel_state_thost_lockrestoredelayed_callbi_iter__compiletime_assert_134max_nr_cid__compiletime_assert_137__compiletime_assert_138_statusmark_deadd_sibkernel_ulong_tdma_opsbin_attributemin_align_maskpercpu_counterHardwareAddressLowCurrentDeviceStatedev_groupsnuma_pages_migratedhdr_typelimits_lockdl_dev_stateUnitgsindexexpires_nexti_io_listemulatedf_eppci_restore_statesrcu_barrier_seq__compiletime_assert_54__compiletime_assert_55msi_lock__compiletime_assert_56__compiletime_assert_57links_countreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tdpc_rp_extensionsclass_srcu_is_conditionalHostMfaHighAddrflags_lengthenable_cntDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskno_highmemIOUnitPage2_tatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodews_activefile_leasescan_objectspid_typewb_errcputimervolumeBusTargetIDtrace_recursionbv_len_mpt_ioctl_eventshotplug_user_indicatorsstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disppci_irq__compiletime_assert_69rcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerPCI_STD_RESOURCESremove_proc_entrydev_pagemap_opss_stack_depthchange_queue_depthdata_vm__s32SasIoUnitControlReply_tentry_eiptaskstatshugetlb_usage__dummyratelimit_states_pinsattr_entry_ptrget_next_child_nodeFAULT_FLAG_WRITEstate_in_sysfsvm_fault_t_x_config_parmstty_structUTASK_SSTEP_TRAPPEDsas_topology_mutexblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountMPI_IOCLOGINFO_FC_LINK_ALREADY_INITIALIZEDforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointresvPortFactsReply_tnr_wakeups_idleFORTIFY_FUNC_memsetio_cqUnused2maxwaitres_attr_wcelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAPortSCSIIDWORK_OFFQ_FLAG_SHIFTp2pdmablk_mq_req_flags_t_SGE_SIMPLE_UNIONsyscoreprot_guard_type__s64mpt_handshake_req_reply_wait__UNIQUE_ID_y_611__UNIQUE_ID_y_614dqi_bgrace__UNIQUE_ID_y_618Capabilities__compiletime_assert_87__kernel_pid_t__compiletime_assert_88static_call_modreset_statusmax_cmd_lenpersist_opcode_timerdma_map_opsma_external_lockdevice_physical_location_panelhost_resetFabricWWPNuid_tnetdev_MSG_PORT_ENABLEflush_requiredGetLanConfigPagesMPI_IOCLOGINFO_FC_INIT_ERROR_RX_OTHERpcie_flags_regfw_event_qsum_block_runtimehctx_listpgmapmin_perf_state__UNIQUE_ID_y_621__UNIQUE_ID_y_623strnlendq_opadd_chainWordrcu_tasks_nvcswMPTSAS_DRIVERcrypt_keyslotwritetypetabmax_user_sectorsPageAddressclass_read_lock_irqsave_is_conditionallan_cnfg_page0lan_cnfg_page1FORTIFY_FUNC_strlcatdma_pools_addr_lsbPortNumber__compiletime_assert_97i_generation_sigpollprocentmxcsrdevtDeviceSettingssas_addressfc_rescan_work_qd_rt_spc_hardlimitbi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countinstrument_atomic_readclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexdriver_datathread_headRAID_VOL0_STATUSend_iodev_pm_qosMaxLanBucketsbi_sectormap_typef_oppids_active_resetrandomextend_descconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportdiag1valpercpu_size__compiletime_assert_190PageVersion__compiletime_assert_195ptm_granularityshost_groupsid_tabledq_sb_CONFIG_PAGE_HEADERptm_roothost_norun_worksighand_structflagsSCSIPortPage2_ti_lock_keykmem_cacheinodedrivers_dirback_padbug_entry__readl___GFP_NOWARN_BITInactiveStatuscmin_fltrw_semdqio_semprev_sum_exec_runtimeErrorDatanestedalloc_time_nsalt_ioc_readynr_forced_migrationsseq_operationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writeout_failSpiCfgDatasrcu_barrier_cpu_cntiopl_warnrmdirinit_hctxpcie_link_statesockSCSI_EH_NOT_HANDLEDbi_write_hinthash_lenget_policy__list_add_validtmf_work_qHRTIMER_RESTARTpci_dev_putexternal_facing__msmpt_add_sge_64bitout_free_ioc__bi_nr_segmentssym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimeRAID_PHYS_DISK0_STATUS__ret_do_once_RAID_PHYS_DISK0_ERROR_DATAnumbersbi_vcnt_softexpiresrq_flagskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchspi_pendingNBShiftFactorshutdowndq_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueptrace_messagenum_trace_eventsptm_cap_sys_privatealignment_offsetopen_mutexscan_finishedImageSizeinit_fs_contexts_subtypeheaderfuncperf_event_contextCurrentSpeedtlbflush_unmap_batchsoftHardALPAcrypto_kobject__UNIQUE_ID___addressable_mpt_get_msg_frame643__sifieldsrcu_read_unlock_special__param_ops_mpt_debug_levelread_bytesMPI_IOCLOGINFO_FC_STATE_CHANGEfsverity_operationswake_q_nodeMPI_IOCLOGINFO_FC_TARGET_NO_LOGINrequest_key_authdispatch_busyvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimer_MSG_REQUEST_HEADERnuma_scan_period_maxbadblocksstart_stackwatcherskmalloc_cachespage1_dmacompletionrequired_maskreason_MSG_DEFAULT_REPLYsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobeshow_optionsdiskreq_offsetAdapterFlagsbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELcore_node_CONFIG_PAGE_IOC_2_RAID_VOLin_rescanpri_capcurr_nrsector_ttrc_blkd_cpuin_memstallReplyFifoHostSignalingAddrpermission_utimepm_subsys_datahost_failed_MSG_EVENT_NOTIFY_REPLYpasid_featuresget_dquots_raw_spin_unlock_irqrestorenum_orcsPageBufferSGEclass_task_lock_is_conditionalshow_rqFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotpRaidEventDatahost_eh_scheduledMPT_RESETHANDLERd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onRequestHiPriFifoSGE_CHAIN_UNIONvm_operations_structbin_attrs_newhs_replybio_alloc_cachebi_bdevconfig_rrs_sviov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_children_ATTO_DEVICE_INFOdirty_folioblk_status_tis_softcntsRPM_SUSPENDEDkmemdup_noprofreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_info_IOC_4_SEPStatesaved_cap_spacelist_emptystats_sectorserror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepout_pci_release_regionenvp_idxWORK_STRUCT_INACTIVE_BIT_head_1_head_2bd_size_lockbackstate_add_uevent_sentblock_cfg_accessSasCfgDataMPIPortNumberi_hashpci_release_selected_regionshlist_nodesprintfio_uringmax_idWQ_MEM_RECLAIMcore_occupationIocPg4Szwritelftrace_timestampwriterwait_page_queuesched_remote_wakeupresumesensewake_qcmd_per_lunfileattr_setkzalloc_noprofrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditional_RAID_PHYS_DISK0_SETTINGSioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsproc_nameonlinebusTyperuntime_resumedup_xol_workqueuestart_time_ns_SGE_CHAIN64mpt_summary_proc_show___GFP_WRITE_BITmpt_channel_mappingMEMORY_DEVICE_PCI_P2PDMABoardAssemblytotal_vmSendEventAckjobctls_time_maxnode_list__UNIQUE_ID_description592dio_offset_aligndelay_workoublockrecent_cid__param_str_mpt_channel_mappingkernel_paramdeferred_resumed_spc_softlimitFreeChainQreported_split_lockSettingsStatusgfp_tswap_slot_free_notifyseccomp_filterstimelist_add_taili_mmapMptDeviceDriverHandlersthaw_supersynchronize_irqd_lrusignal_structWORK_STRUCT_COLOR_BITSperf_event_mutexpri_enabledreset_donecan_queuecrcspgdval_tiocpage2szCONFIG_EXTENDED_PAGE_HEADERsetattrf_mappingnoinstr_text_startprepareBLK_EH_RESET_TIMERbin_attrs__UNIQUE_ID___addressable_mpt_config652sas_ss_flagsf_modeki_completeDevHandlevtime_stateSenseBufferHighAddrwakee_flipsset_aclScsi_Hostrom_attr_enabledbiosVersionpids_activeMPI_IOCLOGINFO_FC_INIT_ERROR_LINK_FAILUREdriverHeaderi_opskip_bus_pmldt_usr_semFreeQlockPhysDiskStatuskobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphoreConfigReply_tscan_mutexpci_disable_msicredjump_entryno_write_samemax_host_blockedlist_lru_nodeminSyncFactortagset_refcnt_RAID_VOL0_SETTINGSsrcu_gp_seq_needed_expinterval_expMPI_IOCLOGINFO_FC_INVALID_FIELD_MAX_OFFSETargp1address_space_operationsRQ_END_IO_FREEspinlock_tSmartASCQraid_datashow_infoRaidCfgData__task_fpstate__UNIQUE_ID___addressable_cleanup_module659MsgVersionIOCPage1_t__ret_oncewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tChipRevisionfwnodeis_dirty_writeback_CONFIG_PAGE_IOC_2_CONFIG_PAGE_IOC_3_CONFIG_PAGE_IOC_4trace_bprintk_fmt_starthuge_faultthis_idkstatfssiteshword_MPI_SAS_IO_UNIT0_PHY_DATADEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsExtPageTypegrab_current_nsmpt_suspendaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connectorMPI_IOCLOGINFO_FC_TARGET_FROM_OUTBOUND_sigsysqueue_kobj__param_mpt_channel_mapping__UNIQUE_ID_mpt_debug_level603srcu_cb_mutexstatic_call_sitefortify_func_CONFIG_PAGE_SCSI_PORT_0MODULE_STATE_UNFORMED_CONFIG_PAGE_SCSI_PORT_2page_listexpiresMPI_IOCLOGINFO_FC_TARGET_NO_PDISCVolumeBus___GFP_HARDWALL_BITiocidnivcswMODULE_STATE_GOINGDL_DEV_UNBINDINGvendor_idthreadsym_timens_pagereset_phasesriov_configuremaxSyncOffsets_time_minbusn_ress_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotfalsed_weak_revalidateremovedpad0pad1show_pathget_pfactsPIDTYPE_TGID__bad_udelaypriv_flagsMQ_RQ_IDLEcurr_ret_depthac_utimebus_list_dummy_pkeyNumCurrentAliasesIOCFactsReply_tiommu_mm_datamce_countmpt_SoftResetHandlerswap_info_structmpt_spi_log_infohost_waitsequencert_spc_warnlimitnr_reserved_tagsac_flagMaxLBAsched_rt_mutexFWUploadTCSGE_tcoredump_datatasksPeriod_pid_RAID_VOL0_PHYS_DISKscsi_cmndaddress_spacemm_context_treq_depthis_probed__call_single_nodenumSGEstartupof_device_idseqcount_spinlock_tretry_countbio_issuehowlongi_wbhas_elevatordma_alloc_coherentpanelclass_id__read_overflow2_fieldqueuecommand_may_blockinactive_timer_pkeyfilenames_export_opLinkConfigfront_padMPI_IOCLOGINFO_FC_TARGET_DIAR_KILLED_BY_LIP__mptri_flctxstashed_CONFIG_PAGE_RAID_PHYS_DISK_1vm_page_prot__udelaytimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedbarsunused_hctx_lockresume_noirqpagemutex_unlocktrc_holdout_listflagsLengthget_inode_usagedevice_nodepcidevnormal_priomq_opsdestroy_inoderelease_foliotaskmgmt_quiesce_iolast_busyi_pipebasehostuaddrmaxBusWidthcached_fws_wb_errPacketPrePadshm_clistWORK_STRUCT_PWQ_SHIFTis_child_subreaperunicode_mapgraph_get_remote_endpointnum_descsskip_settle_delaySwitchexec_vmrw_copyevDataLenfscrypt_inode_infost_name__SCT__might_reschedmmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfoirq_managedqueuecommandalloc_inodeexit_cmd_privlast_stateuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappingretry_configiocppinblockrmidNoSEEPROMWWNN__compiletime_assert_612__compiletime_assert_619rseq_sig__compiletime_assert_39__compiletime_assert_127mpt_proc_root_dirdev_pm_domainSenseBufferLengthlimit0limit1nr_zonespanicInitiatorIoPendTimeoutmigrate_modebio_poolwakeup_preparedpoweroff_lateWaitForDoorbellIntftrace_callsitesd_hashis_confidentialdl_bw__real_strnlenkobjfsyncmtd_infoVolumeStatusi_flagsblk_crypto_keyslotblk_eh_timer_returnlimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_tpl_code_strrb_node__UNIQUE_ID___addressable_mpt_fwfault_debug604blk_queue_statspushable_tasksplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITreleaseddep_mapalloc_dquottaskmgmt_in_progressppage0_allocpm_messageMPT_ADAPTERmay_split__q_size_fieldmem_cgrouplast_update_timesas_indexrobust_list_headmultiple_queuescurrent_statehard_reset_done__ubuf_iovecinit_timer_keyignored_posix_timers__compiletime_assert_42countVersionName__compiletime_assert_44GNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackPCI_BRIDGE_RESOURCESlevel__compiletime_assert_46__kmalloc_noprofhwhdrs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpupoll_eventpci_enable_io_accessulonghlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesioctlshowreset_typepExtHdrpci_sriovignore_hotplugd3hot_delayunsigned charptClearumount_beginnum_chainvdsommap_legacy_baseMPI_IOCLOGINFO_FC_INIT_ERROR_RX_OVERRUNmem_physmpt_set_taskmgmt_in_progress_flagpipe_inode_infoFCPortPage0_tcur_bus_speedsecurebitsRaidPhysDiskPage1_tpartition_meta_infostate_initializedChipNameslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opsCurrentHostMfaHighAddrsg_tablesizepref_windowNegWireSpeedLowRAID_VOL0_SETTINGSpoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BIT__UNIQUE_ID___addressable_mpt_HardResetHandler651class_local_lock_is_conditionalrequest_irqsuspend_latewakeupeh_abort_listcg_listlink_bwctrlpci_choose_statesrcu_barrier_completiondma_set_coherent_masksaved_config_spacempt_add_chain__compiletime_assert_58__compiletime_assert_59driver_flagselementsrw_semaphore_pcidevresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapIOC_4_SEPmptbase_cmdsfiemapMPT_ADD_CHAINboard_assemblywaiters__list_addsubdeviceNB_for_64_byte_framesessionidarch_atomic_readdefault_lockioc_dentryushort_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryacs_capelemnr_retriesmpt_read_ioc_pg_1mpt_read_ioc_pg_3biotailCoalescingTimeout__UNIQUE_ID_mpt_msi_enable_sas600sigval_talimitundo_listKMALLOC_RANDOM_STARTStructlinkageTimeoutmissedPciDeviceAndFunctionNumberreport_zonescopy_szbi_idxquota_readst_shndx__compiletime_assert_63cmd_flagsio_start_time_nsfreeparti_wb_frn_avg_timeswap_lockMPI_IOCLOGINFO_FC_TARGET_NO_CLASS_3bd_fsfreeze_countfile_ref_ttypemembarrier_stateIRQ_HANDLEDreply_szFabricWWNNpage_poolsuspendinitfiles_structwrite_iterdelays_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksvm_faultzone_wplugs_err_list__param_mpt_msi_enable_fcrequest_threaded_irqoom_score_adj_min__UNIQUE_ID_mpt_msi_enable_sastype599kobj_uevent_env__UNIQUE_ID___addressable_mpt_clear_taskmgmt_in_progress_flag627folioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_thotplug_slotpathmpt_print_ioc_summaryudelayMaxLBAHighst_sizermtppio_chipwait_summsi_enablenum_tracepointsupidreq_frames_low_dmaexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalmpt_Soft_Hard_ResetHandlerconsumers__compiletime_assert_70shost_datakernfs_elem_symlinkmpt_msi_enable_sasclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_taskOffsetsrcu_n_lock_retriesi_fopsa_handlerbreserved_tagssasIoUnitCntrRequnlinkperiod_contribHostPageBufferrcu_node_entrystart_scan_seqnr_ctxfsgidswap_rwneed_parent_lockrcu_syncNegWireSpeedHighextend_pageproc_dir_entrympt_detachvm_opsinit_nameschedule_dead_ioc_flush_running_cmds_SasCfgDatampt_HardResetHandleriopollactive_queuesMPI_IOCLOGINFO_FC_INVALID_FIELD_BYTE_OFFSETpagesizeHCTX_TYPE_READdisk_namedclasss_blocksizevm_pgoffRQ_END_IO_NONEauprobeDiskIdentifier__retnuma_workhard_resetsupdate_timeptrace_dr7no_d1d2shost_dev_call_addrrescue_lockmax_segmentsWORK_BUSY_RUNNINGResponseInfologinuidcheckLoadStartAddressWhoInithba_port_num_physubcodeexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneVendorNameWhatroot_blkgcmdStatus__compiletime_assert_80strcat__lstate__compiletime_assert_84mptsas_portinfobroken_cmd_complueventlock_countrefcount_tplugchild_countsaved_auxvioc_initASCQmpt_turbo_replyframemce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsATTO_SCSIPortPage2_tIOCNumbernr_mapsIOCPage2_tmod_namesdev_groupsproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlsched_tagsrseq_lenmodule_attributepollfdnr_wakeups_remote__UNIQUE_ID___addressable_mpt_raid_phys_disk_get_num_paths624pci_busllist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareIopResetRegAddrclass_spinlock_irqsave_is_conditionalrseq_csprimarynum_ftrace_callsitesCoalescingDepthsoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDMPI_IOCLOGINFO_FC_TARGET_DONR_KILLED_BY_LIPreadlinkmigration_flags_MPT_FRAME_TRACKERnon_compliant_bars_pincount_SGE_TRANSACTION_UNIONrq_timeoutdd_cbfunc__UNIQUE_ID___addressable_mpt_event_deregister638DEVICE_PANEL_BOTTOMIntStatusconv_zones_bitmaptime_countFirstWhoInitlist_head__UNIQUE_ID___addressable_mpt_device_driver_register641tgidwrite_protect_seqReplyQueueDepthltr_pathcompat_robust_list_head_tidlast_statuss_inode_wblist_lockfrombd_holderInquiryData_MSG_PORT_FACTS_REPLYend_codeaccess_control_valueqspinlock__kmalloc_large_noprof__outllru_geninsnfilldir_tportnumdl_non_contendingdir_contextMPT_DRIVER_CLASS_RaidCfgDatatracepoint_ptr_tutaskfailcntget_factssched_entityd_spc_hardlimitmq_freeze_wqErrorASClong unsigned intsleep_maxmmap_base_MSG_FW_UPLOAD_REPLYrescue_workio_contextehdrSendIocResetrevisionquiesce_depthhctx_tablegpl_symsSmartCountseq_showmpt_findImVolumesfc_lsc_workswait_queue_head__compiletime_assert_198cow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fnvdata_version_defaultioc_raw_statein_eventfddevicebi_integritySmartASCs_shrinkChainOffsethrtimer_restartUTASK_RUNNINGpsgeSignature0Signature1sym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceobjcgIOCParameterValuepci_device_id_FWUploadTCSGEFWImageSizenoderesetmpt_base_indexvm_lockHardwareAddressHighno_cgroup_migrationnextevts_writers_key__countdma_free_attrsxcomp_bvpg_szcma_areadma_set_maskmpt_detect_bound_portsstatic_priosas_topologyflush_listmay_skip_resumempt_resumeshrinkerdl_yieldeddqi_formatlink_active_reportingMsgContextexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimestate_remove_uevent_sentlegacy_mem_MPT_FRAME_HDRfirst_minoria_sizein_hrtirqs_master_keysmpt_clear_taskmgmt_in_progress_flagwchar_addr_bndkernel_symbolmpt_add_sge_64bit_1078subsys_databi_statustv_secCONFIG_PAGE_HEADERblk_integrity_checksumpid_tpReqtask_listftrace_sleeptimerun_nodeblock_device_operationsbroadcast_aen_busynr_phys_segmentsma_rooturing_cmd_MSG_CONFIG_REPLYnr_failed_migrations_affineIS_ERRir_firmware__UNIQUE_ID_mpt_channel_mapping602mpt_host_page_access_controluser_cpus_ptrpi_top_taskWORK_NR_COLORSSasIoUnitControlRequest_tTestBasesense_buf_poolioc1_dmaEvSwitchmpt_do_ioc_recoveryslotioc_srchactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyWWIDksethrtimer_clock_basevruntimehctx_typedisable_depthRequestFifoasync_scan_printki_sizedl_deadline_hugetlb_hwpoisonPhysDiskubufksm_rmap_itemsMPI_IOCLOGINFO_FC_INIT_ERROR_BAD_START_OF_FRAMEnr_integrity_segments___GFP_HIGHMEM_BITpChainmodulepcpu_cidngroupsfree_file_info__kernel_time64_tmsizeautaskuser_namespaceHCTX_TYPE_POLLvfsuid_traw_spinlocktimer_autosuspendsChainpudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flagssdp1lengthnum_sgeReplyFifol1sssriov_set_msix_vec_countfc_rescan_workErrorCountkfreeread_posstatic_call_trampbtrace_seq_pp_mapping_padprod_namesa_maskMPT_FLUSH_RUNNING_CMDSPhyNumrequest_queueConfigPageHeader_tdqi_dirty_listMaxAliasesSupportedinactive_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlenpci_disable_io_accessmptbase_raid_process_event_datastatic_rqscodegtime__UNIQUE_ID_x_610__UNIQUE_ID___addressable_init_module658sigactiondev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listshiftFactor__kernel_timespecphysAddrlocked_pendingparam_set_intreset_preparenr_deferredfown_structfeatures_lockedDiscoveredPortsCounttracing_graph_pausequeue_numperm__warn_printkMPI_IOCLOGINFO_FC_TARGET_DINR_MISSING_DATAcompat_robust_listbi_blkgCapabilitiesFlags__UNIQUE_ID___addressable_mpt_detach631nr_hw_queuesmpt_put_msg_frameis_msi_managedktypelockrefin_dpm_listdevice_missing_delaysrcu_struct_ptrsmm_structWWNNvlagi_uid__UNIQUE_ID___addressable_mptbase_sas_persist_operation656tablesNextChainOffsetbi_iocost_costspinlockPhysDiskNumpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mm__UNIQUE_ID_mpt_fwfault_debug606TaskTagfortify_memcpy_chkdebugfs_idguest_permsas_device_info_lisths_reqNumPhysmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_diskignorerq_nextsp_offsetsrcu_cblist_invokinginactive_list_mutex_MPT_ADAPTERi_lockpnameOwnerIdentifierd_namecpuhp_onlineget_ownershipWWPNufds_FcCfgDatacrypt_ctxexe_filedevices_per_busnr_scannedpcp_listpid_linkss_sysfs_nameMQ_RQ_IN_FLIGHTq_size_fieldrefcountnr_activevaddrrequestrw_hintspi_datatimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipInternalCtxFlagsLengthqc_dqblkwantedMaxWireSpeedHighmmappedseqcount_raw_spinlockpci_save_statebd_holder_dirbroken_intx_maskingfault_reset_workproduct_strkill_sbd_opclear_retrain_linkMIGRATE_ASYNCdevice_dma_parameterseh_timed_outWORK_OFFQ_FLAG_BITSi_write_hintfxsaveprocess_keyringMPI_FW_VERSION_STRUCTlist_op_pendinghardDetailsLengthDEVICE_VERT_POS_LOWER__stack_chk_failpci_opsMptCallbacksNamellist_headbyteswait_startreply_buffw_event_lockf_freeptrpSgeno_scsi2_lun_in_cdbclass_raw_spinlock_irqsave_try_is_conditionalSepBus__ret_condshow_fdinfompt_version_proc_showfixupirq_get__q_sizehashposix_acldd_key_falsebug_addr_dispdqi_igrace_MSG_SCSI_IO_REQUESTmax_slack_shiftHeaderVersionstarved_listclass_rwsem_write_try_is_conditionalthaw_noirqpio_mem_physpreempt_notifiersbuf_dmasrcu_last_gp_endSGE_MPI_UNIONSendIocInitmax_channels_fsnotify_infocb_idxmempolicyadd_linkspm_message_tiovecsecondaryi_private_lockshowlanWQ_BHsegment_boundary_maskVTIME_IDLEmpt_reset_deregisterstatic_keyscsi_timeout_actionremove__param_mpt_fwfault_debugs_magicfusion_initdl_overrunallocsubvendord_parentMPI_IOCLOGINFO_FC_LINK_BASE__WQ_DRAININGtransparentpayloadac_minflti_sbblk_mq_hw_ctxkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsoffline_CONFIG_PAGE_SAS_IO_UNIT_0atomic_write_segments_maxatomic_openbio_end_io_tstart_prevent_timereply_depthprocmpt_createcondreadahead_controlblk_tracesubordinatehs_reply_idx__kernel_gid32_tPciBusNumberkernfs_open_fileeventContextf_credmpt_add_chain_64bitMODULE_STATE_COMINGpci_slotnotify_countoffline_disabled__empty_rangesbd_devhandlersslave_destroyread_newmpt_raid_phys_disk_pg0mpt_raid_phys_disk_pg1signalfd_wqhmmapGetIocFactsmodnameasync_put_workmknod__compiletime_assert_6pri_reqs_allocctxsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapdma_alias_maskwritepagessched_statisticsheadminors__state_permuprobe_taskdevice_get_dma_attrselfwriteback_controlsdp0versionuclampAttachedDeviceHandlesuper_operationsbi_cookie_MSG_FW_UPLOADDatasplice_eoffreerequtil_avgssleep___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAtimeleftConfigExtendedPageHeader_tMPI_SAS_IO_UNIT0_PHY_DATAFunctionbd_holderspt_regsPCI_BRIDGE_RESOURCE_ENDpipe_bufsControlKOBJ_NS_TYPE_NETctx_idmap_nrioc_listd_rt_spc_warnspci_write_config_wordq_usage_counteri_verity_infoxsavetimespec_type__rb_parent_colordevres_lock_MSG_SAS_IOUNIT_CONTROL_REQUESTActiveSEPpsizePrimitivebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoinactive_raid_component_infoats_capblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsFORTIFY_FUNC_memscandev_flagsvm_private_dataio_bitmap__bi_remaininguprobe_task_statetimerkobj_typebroken_parity_statusdiskseqPortTypeoriginatormsleepi_pagesatomic_write_hw_boundaryWORK_OFFQ_POOL_BITSino_warnlimitfasynclegacy_ioi_rt_spc_warnlimitdoe_mbspage_fragwrite_bytesmpt_do_uploadSGE_IO_UNIONchardomainunix_inflightholders_dirinit_cmd_privfpu_state_permmpt_fc_log_infoi_fsnotify_maskbio_vecis_addedpIoc2ari_enabledgraph_get_port_parent__WQ_LEGACYmax_zone_append_sectorsmpt_read_ioc_pg_4__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstk__UNIQUE_ID_mpt_msi_enable_fc598bio_slabd_alias__UNIQUE_ID___addressable_mpt_event_register637__iovHotSparePoolpAckcpumaskmq_hctxdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimes_rootsreq_szd_rt_spc_timerPhyDataevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nr__this_modulebio_crypt_ctxfreeze_fsuserfaultfd_ctxMPTFC_DRIVERsigset_tcapacityrq_countrunningrseq_event_masks_rootra_pagesTT_COMPATMaxBusesfwnode_handleElf64_SympRaidPhysDiskPage0_td_automountSyncFactorqueue_limitsfreemepage_freebridge_d3parentspecial_vecMPT_SCSI_HOST__dummy2atimecopy_file_rangetask_cputime_atomicSEPTargetIDcommit_rqsmpt_set_debug_levelreply_framesuser_definedkey_typeWORK_STRUCT_LINKED_BITkthread_create_on_node_MPI_FW_VERSION_STRUCTget_named_child_nodelaunder_foliocurr_targetnumberis_suspended_MPI_DEVICE_INFOhotplug__keympt_debug_levelVolumeIDtimeout_workMPI_IOCLOGINFO_FC_INIT_ERROR_RX_UNEXPECTED_FRAMEtaskmgmt_lockburstTopologyConfigetypeei_funcsiocpage3szmodule_kobjectactive_memcgdef_flagsd2_supportbase0base1base2wait_queue_head_tpage_typercu_data0no_updatevendorRAID_PHYS_DISK1_PATHcap_bsetmutex_lockopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areaEventDataLengthsaved_statekernfs_elem_attrbasespcie_mpsss_bdev_filenuma_faultswork_qlinux_binfmtATTOFlagspage_table_lock_sigfaultcounterskasan_check_readname_linkchipmpt_iocstatus_infocmaxrssno_d3coldtimer_slack_ns___GFP_MEMALLOC_BITbus_typesriov__compiletime_assert_62policysharedAltConnectornet_devicewait_queue_entrydismisspPP0list_delpPP2d_real_type_MSG_SAS_IOUNIT_CONTROL_REPLYlookaheadFWUpload_t_bandio_portseq_start__targetsrq_qos_mutex__UNIQUE_ID___addressable_mpt_free_fw_memory655zone_wplugs_wqraw_lockd_dnameget_dqblkWQ_CPU_INTENSIVE__UNIQUE_ID___addressable_mpt_raid_phys_disk_pg0657EventAck_targ1__param_str_mpt_msi_enable_fcwait_indexMPI_IOCLOGINFO_FC_TARGET_DINR_KILLED_BY_LIPmax_hang_timecpus_maskNumPhysDiskssubdirstask_groupstarttimeiounmapmmap_missquota_format_opsclass_rwsem_write_is_conditionalpci_ers_result_trcecmin_sliceargs__poll_tfwnode_operationstarget_allocImageTypeshow_devnamempt_is_discovery_completelogical_block_sizerun_delaytailsblk_flags_tlinenobi_io_vecbase_pfnsas_discovery_quiesce_io__UNIQUE_ID___addressable_mpt_verify_adapter648delayed_work_timer_fnget_inode_acl_addr_pkeymigrate_foliocustom_sliceaer_capLinkTypethread_keyringhosttkparam_arrayutimeSimplestart_codeis_managedreq_idxis_hardfsbasecompatiblesubsystem_devicesas_mgmtfc_link_speedSignature2SHOST_CANCEL_RECOVERYclock_listattrsfc_rportsdynidsAdapterOrdereh_deadlinecpumask_tswregs_statedqb_isoftlimitdma_iommuErrorSenseKey_IOC_3_PHYS_DISKblk_mode_torig_axpReplybd_claimingcompletesched_rt_entitymight_reschedtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootErrorASCQnr_dirtied_pauseem_perf_domainbios_paramparam_ops_int_sigchldpi_offsetdiscard_granularityfopsmpt_host_page_allocreservedmpt_event_registerlatency_record_countcgroupsprev_scan_seqprobe_typeSGE_SIMPLE_UNIONrcu_usersRPM_REQ_AUTOSUSPENDoffsetmax_lunnext_cpuioc2_dmatime64_tmpi_hdri_blocksnuma_faults_localityhas_child_subreaperrom_bar_overlappref_64_windowi_aclmemset___GFP_ZERO_BITwrite_newmsecs_to_jiffieslist_lockLengthpm_domaincpu_bitmapipi_listformRequestFrameSizestatic_call_keyutil_estucountsBLK_UID_EUI64qc_stateset_rq_budget_tokensoftirq_next_timerkobject_namemax_active_zoneszone_wplugs_poolcheck_flagshandler_RAID_PHYS_DISK_INQUIRY_DATAswp_entry_t__param_mpt_msi_enable_sasbi_inline_vecsuint64_tMPI_IOCLOGINFO_FC_INIT_ERROR_OUT_OF_ORDER_FRAME_mapcountdomain_tagpasid_requiredHostPageBuffer_szhang_detecteduuidchild_ns_typeqf_fmt_id_MSG_IOC_INITs_vfs_rename_keyeventmpt_add_sgePortStateNoSEEPROMWWPNsg_prot_tablesizeKickStartget_unique_idset_performance_statephys_addr_tATTO_DEVICE_INFOSHOST_CREATEDMaxSEPclass_preempt_is_conditionalmpt_fault_reset_workloginfodma_get_required_maskcfg_sizeconsumers_cntmodule_memoryMPT_CALLBACKpi_entrypme_pollk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacSettings__init_worknr_to_scancached_fw_dmasz_firstfs_parameter_specNumberOfPortsdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stamponstackcompat_rmtpdoorbell_flags_2amax_bus_speedpci_driverd3cold_delaydma_cleanupmaple_treeKMALLOC_DMAdentrylast_mergecpu_itimerpercpusriov_get_vf_total_msixrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupsaved_end_ionr_threads__i_nlinkReserved1Reserved2Reserved3Reserved4Reserved5pushMPI_IOCLOGINFO_FC_LAN_TRANS_RES_BITS_SETDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesshostrangecpu_addrMaxFrameSizeupload_fwioctl_cmdsfutex_exit_mutexpm_onlykernfs_iattrstag_alloc_policytrc_blkd_nodebus_resetNumActiveVolumes__sectord_spacegraveyard_linkxol_vaddrsplice_readElf64_Addr__UNIQUE_ID___addressable_mpt_attach630d_rt_spacenameblk_mq_ctxFcCfgDatabi_iopriou_flagsMpiDeviceInfo_tnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERshared_pendingPCI_STD_RESOURCE_ENDAddressis_physfni_gidmpt_get_cb_idxneeds_force_resumempt_fwfault_debugmin_vruntimefaults_disabled_mappingquota_typeMaxHardAliasesSupportedstate_savedmpt_signal_reseti_rdevirq_reroute_variantself_exec_idmpt_adapter_disposereplydebug_levelcbfunckernfs_opsHighPriorityQueueDepthWORK_CPU_UNBOUND__UNIQUE_ID___addressable_mpt_findImVolumes653MODULE_STATE_LIVEclearedclass_maskReplyFrameSizeStripeSizestop_CONFIG_PAGE_IOC_1nr_migrationsa_opsreq_listxa_flagsfreezempt_halt_firmwarebin_sizemap_buscloseExtPageLengthdev_dma_attrgrphiSCSIIOReply_t___GFP_RETRY_MAYFAIL_BITfunc_name__compiletime_assert_4nr_sectorsscsi_lookup_lockPhysDiskIDd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNBLK_EH_DONEset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpsas_discovery_ignore_eventscpuset_mem_spread_rotorio_optbvec_integrity_poolWORK_STRUCT_PWQ_BITassoc_arrayDeviceFlagsmnt_idmapdq_dqblast_resetuidhash_nodesaved_tfblk_mq_queue_mapElf64_Xwordold_timespec32device_configureSGE_TRANSACTION_UNIONlock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXMptDriverClassnlinkqueue_delayed_work_onis_virtfnMaxDevicespercpu_refproc_create_single_datahorizontal_positionMPI_IOCLOGINFO_FC_TARGET_DIAR_MISSING_DATAport_enablepref_node_forkjiffieswait_queue__int128mpt_msi_enable_fcdqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblk__UNIQUE_ID_mpt_channel_mappingtype601s_fs_infosas_discovery_mutexcrypto_profileu16replyfutexwait_maxDoorbellDEV_DMA_NON_COHERENTresult_maskstate_syncedpp_magicpbufdquot_operationsmappingresource_sizeRPM_INVALIDgrploMsgFlagsclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_file___GFP_COMP_BITpfactss_statempt_get_product_nameuser_sizedev_pm_opscdrom_device_info_CONFIG_PAGE_MANUFACTURING_0scheduledFAULT_FLAG_TRIEDraw_atomic_readclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkdestroy_workqueueSaf_Tekmalloc_typen_io_portdispatch_wait_lockqstrma_flagsnr_ia_rangesControllerPhyDeviceInfofc_port_page0fc_port_page1max_user_discard_sectorsno_msifutex_stateorig_pmdqueue_lockshpc_managednvram__param_mpt_msi_enable_spiacct_timexpdSHOST_DEL_RECOVERY__rcu_icq_cachePortIdentifierMakeIocReadysizeem_perf_tablewakeup_sourceReasonCodef_posu_int32_tnext_posix_timer_id__kernel_long_ttask_fraginit_completionmpt_event_deregistersrcu_gp_mutexRAID_PHYS_DISK0_INQUIRY_DATAdatalennr_wakeups_affine_attemptscntdn__le16alt_lenRequestNBcinblockextableexitrpm_autosuspend_delayRaidVolumePortkernel_param_opsbus_dma_regiondpc_capio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headlist_is_headWORK_OFFQ_DISABLE_BITSrcharalloc_dmafutex_pi_statekstatMPI_IOCLOGINFO_FC_INIT_ERROR_RX_BAD_STATUS__kernel_uid32_t__le32dispatchq_lock_cls_keyDEVICE_FIXEDpte_tmpt_inactive_raid_list_freepEventReplypci_namedevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockwake_batch__inlWORK_STRUCT_FLAG_BITSget_namefwnode_endpointwq_misc_constsopt_sectorsepoll_watches_MSG_IOC_FACTSadd_sgeprealloc_ptebus_iddqb_curspace_entrygp_statebitsetload_avgsched_dataaccesscstimepcie_capcompletion_cntpage_dmalast_drv_idxcfs_rqrq_end_io_fn_uidcopy_lenst_spacemm_cid_next_scanns_typescan_startmsix_enabledac_majfltpasid_enabledposix_cputimers_work_upperhost_page_buffer_szWaitForDoorbellAckmodule_param_attrsshort unsigned intpci_get_slotDiagRwDatabus_flags__le64MsgLengthi_mutex_dir_keymq_pollq_nodespc_warnlimits_encodingFreeQgpl_crcsorc_entrykeysMPI_IOCLOGINFO_FC_TARGET_MRSP_KILLED_BY_LIPdma_handleorig_ptepasid_capdqb_curinodesmpt_iocstatus_info_configload__s8pci_enable_msiPortFlagsinvalidate_lock_keydma_maskprealloc_mutexnanosleep__already_donestatefaultmptbase_replyTransactionDetailseh_host_reset_handlermpt_send_handshake_requestFORTIFY_FUNC_kmemdupsbq_wait_statemptReplydq_dqb_lock__kernel_ulong_tvolname__UNIQUE_ID___addressable_mpt_send_handshake_request647io_mindl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathHCTX_MAX_TYPESdio_mem_alignbtime__u8is_roxlockfc_rescan_work_lockrlim_maxslave_dirDEVICE_PANEL_FRONTeventLogSize_U64runtime_deferred_listd_waitlocal_fwnodequeue_flagslist_lru_onedevice_physical_location_horizontal_positiondevice_stateseq_stoppci_dev_flags_tpFwHeaderkiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidmem_sizeMPI_DEVICE_INFOMPI_IOCLOGINFO_FC_TARGET_LOGIN_NOT_VALIDaer_statss_blocksize_bitsnuma_scan_periodcfghdrmigration_disablediter_typeclass_device_is_conditionalqueue_rqsold_sas_discovery_protocalshrinker_idbio_setrootoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKscsi_devicebpf_storagepci_enable_device__data_lenmq_mapno_callbacksMPT_SCHEDULE_TARGET_RESET__u16timers_activewait_countalloc_hintsig_okmf_dma_addrmpt_device_driver_registerdelaysqf_ownerreadaheadkmalloc_cache_type_CONFIG_PAGE_LAN_1mutexpgd_tnr_cpus_allowedeh_abort_handlerdiscard_alignmentraw_spinlock_tkey_tagINIT_LIST_HEADsysdatafs_flagswordErrorCdbByteworkpgprotval_tkeytypefortify_memset_chksigpendingmq_freeze_depthMPIHeader_tfsindexshstkslave_configurereserved_tagssrcu_sspalloc_totalwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdevsas_data__u32ptracedtrc_reader_specialdevice_get_match_datapci_disable_deviceSenseCountmpt_free_fw_memoryHPROBE_GONEmpt_diag_resetactive_timei_sequencepool_datapci_vpdMptResetHandlersMPI_IOCLOGINFO_FC_INIT_BASEpci_read_config_worddisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_private_perfSendEventNotificationsubsystem_vendori_dir_seqVolumeTypeirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookie_MSG_SCSI_IO_REPLYsrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturespci_p2pdmauclamp_reqSeqCodeVersionchange_cookiedl_defer_armedlast_queue_fullwrite_infoidle_notificationblock_devicekobj_ns_typedpc_rp_log_sizeimm_readyBLK_INTEGRITY_CSUM_CRC64WQ_POWER_EFFICIENTf_iocb_flagsMaxPacketSizepoweroffcmaj_fltvtimemath_emu_infoiowait_sum_MSG_EVENT_NOTIFYf_path__u64journal_infooverride_onlypeerMaxInitiatorsFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_truesense_buf_low_dmaweighti_privatemaxrssFWUploadReply_tflushReqToChainruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_buf_MPI_FW_HEADERmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtime_MPI_ADAPTER_INFONvdataVersionDefaultdeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startshost_gendevsrcu_gp_seq_neededtag_list_lockunused_hctx_listPrimFlagss_flagsget_rq_budget_tokenPrimeIocFifosSGEChain32_tcpumask_var_tfaultalternative_gpt_sectorshow_statsdl_densityfreeptr_t__UNIQUE_ID___addressable_mpt_resume632sz_lastread_dqblkintegrityioc3_dmadq_flagsvolumeIDnext_cpu_batchDD_CLASS_TYPE_DISJOINT_NAMESpci_devp_sizememcg_datatracepoint_exthba_port_sas_addrkprobes_text_startrunnable_avgdma_boundarys_time_granmpt_iocinfo_proc_showMPTBASE_DRIVERkernel_cap_tnon_rcuwait_listrequest_pendingpinneddworkhrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpi_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITSCSIIORequest_tnum_kpin_execvehost_tagsettlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionreset_alt_ioc_activeserialclass_releasealloc_locks_dquotmax_hw_sectorsfolioqtagsprev_posseqcount_spinlockMPI_IOCLOGINFO_FC_INIT_ERROR_BAD_END_OF_FRAMEexpire_countpci_write_config_bytes_umountis_bin_visiblepgoffsyscall_user_dispatchrcu_tasks_exit_listarchdataia_uid__list_del_entry_valid_or_reportIOCFacts_t_RAID_PHYS_DISK1_PATHchildren_CONFIG_PAGE_RAID_PHYS_DISK_0rb_subtree_lastno_pm_callbacksbuild_id__p_lenrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_padpci_set_power_statetailia_atimelasttaskmgmt_cmdstlb_ubcmpt_get_manufacturing_pg_0bi_issuequota_format_typemsi_enabled_CONFIG_PAGE_RAID_VOL_0seekstask_structsoft_resets__list_add_valid_or_reportrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextWORK_OFFQ_LEFTio_tlb_memhost_self_blockedarch_spinlock_tsubmit_bioblk_flush_queueDiagRwAddressi_mtime_nsecperformancePortEnable_tmmlisthd_geometry__compiletime_assert_2__compiletime_assert_3devcap__compiletime_assert_5suppress_bind_attrsRPM_RESUMINGreg_offsetgsbasedispatch_waits_quota_typesinternal_tagf_llistmq_freeze_lockDiagnosticMPTCTL_DRIVERi_nlinkbranchcode_descwrite_begingroups__const_udelay__UNIQUE_ID_mpt_fwfault_debugtype605req_frames_dmaerr_handlerno_vf_scanpi_blocked_onSCSIPortPage0_ts_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrinfo_kbufpkey_allocation_mapki_ioprioattributes_maskBLK_INTEGRITY_CSUM_NONEdl_serverPhysicalInterfaceSCSI_EH_RESET_TIMERtrc_reader_nestingin_userestart_blockumode_tIOCLogInfoshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixMPI_IOCLOGINFO_FC_LAN_TRANS_SGL_MISSINGwlockedEventStatefreeze_superNumActivePhysDiskss_inode_list_lockSepIDelevator_queueMaxPersistentIDsruntime_idlesweventppage1_allocfreeze_holderdriver_override__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avg_MPT_MGMTntab__param_mpt_debug_leveldevice_typeBoardTracerNumbermaj_fltarch_rwlock_tSGESimple64_tSHOST_DELclock_basecdevmy_qgroup_leadermkdir_SYSIF_REGSdma_free_coherentcookedMPI_IOCLOGINFO_FC_INIT_ERROR_SUBPROC_DEADnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writershba_port_inforequeue_work__UNIQUE_ID___addressable_mpt_put_msg_frame_hi_pri645bio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerphys_diskclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_dataPhyFlagsVolumePageNumberActionmmap_locksysfs_lockrq_qosfsavekeyring_index_key__WQ_ORDEREDfusion_exitqrwlockfile_ra_stateuser_structnextImagefc_setup_reset_workon_rq__p_size_fieldfs_contextmempool_alloc_tMPTUNKNOWN_DRIVERprealloc_bufDL_DEV_DRIVER_BOUNDCDBLengthpIocPg4projiddrop_inodenum_trace_evalsnum_vfWaitForDoorbellReplyfree_irqunsafe_warnllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitatomic_write_boundary_sectorswritable_sizercu_nodeWQ_SYSFStargunfreeze_fsintervalclasslast_mm_cidfile_lockNumRequestedAliasesuntrustedManufacturingPage0_tmax_open_zonesMaxWireSpeedLowcookiebd_stampDoneCtxtargetsas_discovery_runtime__UNIQUE_ID_mpt_msi_enable_spi596a_flagstrace_overrunChainToChainsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpumpt_adapter_disableilenmnt_flagscompletion_codevm_structcred_guard_mutexbusymajorWORK_OFFQ_POOL_SHIFTsigcnthrtimer_cpu_baseresourcesseq_printfcb_headcheck_quota_fileFORTIFY_FUNC_memchrmpt_GetScsiPortSettingsTransactionContext128attributerestrict_linkdev_archdatai_deviceskey_perm_tCurrentSenseBufferHighAddrbio_integrity_payloadrescue_listpi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflags_SGE_SIMPLE32robust_listsym___kernel_rt_sigreturnsym_pvclock_pagemmio_enabledserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapMPI_IOCLOGINFO_FC_TARGET_WAITING_FOR_DATA_INfiltercurr_ret_stackirqreturn_t__compiletime_assert_451dockdev_links_inforeset_work_qloff_tthread_pidSGE_sizesrcu_gp_seqia_rangespRaidPhysDiskPage1_tno_command_memory_archst_valueclass_write_lock_irq_is_conditional__UNIQUE_ID___addressable_mpt_set_taskmgmt_in_progress_flag626KOBJ_NS_TYPESpprevdiagRwDatacallseh_actioni_default_acleh_target_reset_handlers_uuid_lenioc_nodeInfoof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnouintptr_tbatchasync_sizeacct_vm_mem1i_mtime_sec_MSG_EVENT_ACKmatchmemory_type_SGE_SIMPLE64rb_rootnr_wakeups_locals_fsnotify_masknr_requestsHPROBE_STABLEsas_loginfoIOCStatusrq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsiocpage4szpci_error_handlersWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpaddingphys_disk_num__fillerpIocPg2__UNIQUE_ID___addressable_mpt_free_msg_frame646LANPage0_tsaved_sigmaskd_timeentriesAddress32cpu_id_MPI_FW_VERSIONfop_flags_tFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_lockcleanup_rqcancel_delayed_workevent_flagssched_delayedbd_statsbi_sizesupported_modemodule_state__write_overflow_fieldmq_kobjlast_used_at__mutex_init_ATTO_CONFIG_PAGE_SCSI_PORT_2number_of_busesvm_endlast_queuednuma_migrate_retryuser_ns__statedrvnamefirstu16cntiommu_groupdispatch_fromdma_alignmentmigrate_to_ramsas_device_info_mutexwait_pidfdptrace_bpsFubars_umount_keyptcsgevm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folioout_unmap_resourcesnodemask_ti_modenr_thpsis_hotplug_bridge__UNIQUE_ID___addressable_mpt_suspend633ia_ctime__fortify_strlenIOCPage3_tFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexPathi_private_dataElf64_Halfuse_autosuspendmpt_mapresourcesFORTIFY_FUNC_memcpyAddress64nsproxySASAddresscan_wakeupxol_areatransporttrlockdiag0valfactsfl_owner_tpci_is_enabledMPI_IOCLOGINFO_FC_TARGET_BASE_rescls_mskia_rangeeuidwaitbug_tabledirtied_time_whensequential_io_avgOperationnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayIOCInit_tRPM_ACTIVEio_window__state_sizecallerthread_structcached_requested_keyenvpdev_set_drvdatabvec_iterctime_CONFIG_PAGE_IO_UNIT_2releasefw_events_offmax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lenpme_supportdqb_btime_nr_pages_mappedutf8datamm_usersbd_holder_lock_RAID_VOL0_STATUSs_ids_dentry_lrubp_offsetSHOST_RUNNINGblk_crypto_profilepExtImage__param_str_mpt_debug_levelfolio_queuelast_task_numa_placementmpt_deregisterMPIDefaultReply_tpgtable_tblock_startioc_reset_in_progresscgtimePhysDiskSettingssymlinkoom_flag_origintmf_in_progresscounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqfc_datatrace_eval_mappIocPg3donePhysDiskIOCMPI_IOCLOGINFO_FC_LAN_TRANS_WRONG_PLACEfscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexioc_statusmpt_interruptratelimitfree_foliodebugfs_dirdriver_managed_dmaqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_dataDL_DEV_NO_DRIVERFAULT_FLAG_ORIG_PTE_VALIDretvalsysv_semanon_vma_namefileattr__write_overflowreqByteslong long unsigned intanon_nameopen_partitionsend_io_datablkcg_gqmap_queuesia_filesival_intTransferCountnuma_preferred_niddma_need_drain_hugetlb_cgroupdentry_operationschannelmemcg_nr_pages_over_highd1_supportqueue_offsetarch_uprobe_Boolsleep_start__p_sizeioremap__compiletime_assert_609min_fltdvScheduledHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatereverse_orderingi_linklistxattr_lowertrap_nr_SGE_MPI_UNION_SpiCfgDataasync_probe_requestedpRaidVolumePage0_tcompat_long_tactive_counts_iflagsclass_pci_dev_is_conditionalprevent_sleep_timemce_kflagstotal_numa_faultss_countdev_msi_infod_revalidatepci_enable_device_membus_groupsVendorIDwakeup_cnt__UNIQUE_ID___addressable_mpt_device_driver_deregister642pmd_tmpt_reply__UNIQUE_ID___addressable_mpt_alloc_fw_memory654s_oppreplysysv_shmIOCCapabilitiesVendorIddma_channeldq_countutf8data_tableset_latency_tolerancedev_get_drvdata__func__resource_size_tnr_tagsfoliowake_entryMPTSTM_DRIVERxa_headsuidi_readcount__real_strlcatblk_integritylocked_vmalt_iocevData0MPI_IOCLOGINFO_FC_LAN_BASErb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_timeiov_lenRAID_PHYS_DISK0_ERROR_DATA__kernel_clock_tBlockSizeclass_rcu_is_conditionalPortFacts_tbpf_local_storageactionclockid_tFCPortPage1_tevStatequota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countWQ_UNBOUNDwait_on_reset_completionMPI_FW_VERSIONksm_merging_pages__UNIQUE_ID_mpt_msi_enable_fctype597autosleep_enabledptrace_entryblkg_listrecent_used_cpunum_jump_entriesout_remove_iocs_qcopatomic_tbv_pagealloc_tag_counters_flagsrqos_debugfs_dirnotify_nextmax_perf_staterequest_sizeControllerDevHandlebus_dma_limitPCISlotNumbuffershort intmynodesnprintfpart_tblzone_wplugs_hashblk_mq_opsctx_mapbridge_ctl__hdrioc4_dma__UNIQUE_ID_x_620__UNIQUE_ID_x_622class_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerreset_methodsbp_regprocdirVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invsense_buf_pool_dma_CONFIG_PAGE_LAN_0pad_untilDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2IocPg4_dmaeh_device_reset_handlersbitmaplast_arrivalsupported_speedsem_pdtrace_event_callis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOMPTSPI_DRIVERCONFIG_PAGE_IOC_2_RAID_VOLfw_event_listmpt_verify_adapterwait_queue_entry_t__UNIQUE_ID_y_608elevatorcurrent_may_mountseqlock_tbd_queuenuma_scan_offset___GFP_NO_OBJ_EXT_BITeventTypessched_migratedfrozenDataLengthmlock_countin_lru_faultgrpmaskSCSIStateregfuncindex_keymemalloc_noioGRPQUOTApci_dynids__UNIQUE_ID___addressable_mpt_GetIocState649i_private_listia_validvertical_positionWORK_OFFQ_FLAG_ENDFORTIFY_FUNC_strncatir_code_strreply_dma_lowpageAddri_rcu__UNIQUE_ID_y_616mpt_ioc_reseti_atime_secWORKER_DESC_LENFlagsqc_type_statekey_serial_tdev_ueventsetupf_lock___GFP_MOVABLE_BIT__read_overflowseq_putcpcie_bwctrl_dataactiveReserved_0101_FWVersionExtDiskIdentifierdqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listEventEventNotification_tMinorxarray_start__flagsp_size_fieldfadviseMinPacketSizepm_capslot_resetvmem_altmaparg_endsyscall_dispatchrevoked_atscsi_host_templatelast_sum_exec_runtimeiov_iteria_gidattribute_groupMQ_RQ_COMPLETEcontextposix_timersMPI_IOCLOGINFO_FC_LINK_LOOP_INIT_TIMEOUTdriver_exclusive_resourceselectorblkcg_polsMEMORY_DEVICE_PRIVATEcor_error_detecteddev_releasebi_nextdefault_timer_slack_nskcsan_check_accesssource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refpIoc1pmdval_tpIoc3pIoc4prequest___GFP_NOFAIL_BITgroup_infovdso_imageAckRequiredmpt_get_fw_exp_verconfigreplyblk_qc_tNvdataVersionPersistentfileWORK_BUSY_PENDINGof_match_tablepercpu_count_ptr__user_state_size__msecs_to_jiffiesmpt_get_msg_frameforce__WQ_BH_ALLOWSpcie_cap_lockSupportedSpeedsmptbase_sas_persist_operation_MPT_SCSI_HOSTmce_kill_mealloc_szphysical_block_sizeuuid_teh_noresumeproperty_read_int_arraySCSI_EH_DONE___GFP_UNUSED_BITatomic_write_hw_unit_minmemmapVersionNameWhatcount_objectsq_sizereplyBytes_stimeiop_code_strzone_device_dataev_cbfuncnr_active_requests_shared_tagsMPT_ADD_SGEf_wb_errqueuelistphysfndefparamtarget_reset_listfred_csq_lockdep_mapfault_flagMajorkprojid_tptracer_credtlb_genstoreio_lock_cls_keypage_mkwritekobjectaudit_ttyGetIoUnitPage2queue_delayed_workmce_ripvstatfshlist_bl_headmsg_contexttag_set__WQ_DESTROYINGBiosVersionats_enablednumab_stateremovablempt_remove_dead_ioc_funcEventContextfeatureson_listResyncRatekgid_tout_free_consistenton_cpureq_framesFAULT_FLAG_VMA_LOCKTxRxModesWORK_OFFQ_BH_BITfregs_statedrop_nsnum_ei_funcsmpt_free_msg_framerestore_sigmasksrcu_cblist__UNIQUE_ID___addressable_mpt_put_msg_frame644mpt_configInitiatorDeviceTimeoutDiscoveryStatusActualImageSizeeetlp_prefix_pathclass_groupsnuma_nodeIOCParameteri_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNscale__UNIQUE_ID___addressable_mpt_reset_register639wait_chldexiterrseq_tioctx_tableVTIME_SYSchangedsysfs_registeredEventNotificationReply_tSYSIF_REGSdebugfs_mutexwatch_listintstat__fortify_sizeaudit_contextpp_ref_countsysfs_opserror_detectedsequential_iorecovery_stateis_busmasterSHOST_CANCEL_large_mapcountMPTLAN_DRIVERsda_is_static__compiletime_assert_109formatftopenclavebi_privateexit_hctxrsvdhandle_inactive_volumescreateiattrTransactionContext32WORK_STRUCT_PENDING_BIT_MSG_CONFIGrseqnfdspcixcmdsigvalvma_lockmax_discard_segmentsperf_event_listgetgeo__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115get_reserved_space__compiletime_assert_117__compiletime_assert_118__compiletime_assert_119non_seqstack_refcountinvalidate_lockbmapkey_payloadtimer_rand_stated_realPCI_NUM_RESOURCESlink_stateIopResetVectorValueexpiry_activesasIoUnitCntrReply__compiletime_assert_40__compiletime_assert_41mpt_GetIocState__compiletime_assert_43__compiletime_assert_120oldv__compiletime_assert_122__compiletime_assert_123__compiletime_assert_124__compiletime_assert_125__compiletime_assert_126dqi_max_spc_limit__compiletime_assert_128__compiletime_assert_129param_get_intIRQ_NONEexception_table_entryvirt_boundary_maskevent_countinit_replympt_inactive_raid_volumesprocmpt_destroyProtocolFlagsWORK_STRUCT_COLOR_SHIFTfallocatei_spc_warnlimitbuddy_listi_ino_timelimit__compiletime_assert_50__compiletime_assert_51__compiletime_assert_52__compiletime_assert_53__compiletime_assert_130__compiletime_assert_131__compiletime_assert_132__compiletime_assert_133i_mmap_writable__compiletime_assert_135__compiletime_assert_136mems_allowedevHandlerstlb_flush_batched_ddebug_infoslave_allocis_noirq_suspendedtracepoints_ptrsleaderTransactionContext64RAID_PHYS_DISK0_SETTINGStimewakee_flip_decay_ts__compiletime_assert_60__compiletime_assert_61s_max_linksnr_wakeups_sync__compiletime_assert_64__compiletime_assert_65__compiletime_assert_66__compiletime_assert_67__compiletime_assert_68MPI_IOCLOGINFO_FC_TARGET_WRSP_KILLED_BY_LIPkallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tmpt_reset_registerblockscomponent_infoset_infofileattr_getvectorraid_sub_code_strFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcat__devices__bi_cnttimer_list__compiletime_assert_71__compiletime_assert_72__compiletime_assert_73__compiletime_assert_74__compiletime_assert_75__compiletime_assert_76__compiletime_assert_77__compiletime_assert_78__compiletime_assert_79device_dma_supportedd_ino_warnshiwater_vmtracepointPageLengthcompound_headia_vfsuid__kernel_ssize_tGlobalCreditspdeviceorig_ret_vaddrpoweroff_noirqsrcuunique_idrenamevm_area_structrpm_statussb_writers__compiletime_assert_81__compiletime_assert_82__compiletime_assert_83ino_timelimit__compiletime_assert_85__compiletime_assert_86pci_bus_flags_tsplice_write__compiletime_assert_89msix_cap_RAID_PHYS_DISK0_STATUSi_rt_spc_timelimit_raw_spin_lock_irqsavetotal_size__list_del_entry_validrom_base_regioc_stat_MPI_EXT_IMAGE_HEADERqf_nextTransactionContext96io_window_1kranges__compiletime_assert_90__compiletime_assert_91__compiletime_assert_92__compiletime_assert_93__compiletime_assert_94__compiletime_assert_95__compiletime_assert_96iommu_mm__compiletime_assert_98ats_stublk_features_tcutimeMpiEventDataRaid_tem_tableMPI_IOCLOGINFO_FC_LAN_WRONG_SGL_FLAGpersonalityget_stateIOCExceptions_CONFIG_EXTENDED_PAGE_HEADERtask_sizes_inodes_addrbinfmtirq_domainnr_queuessigned char__UNIQUE_ID___addressable_mpt_print_ioc_summary650prio__compiletime_assert_189privgetattrsched_infod_fieldmaskreply_frames_low_dmaChecksumuprobe_xol_opsseq_filefreeze_noirqscsircu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabled__compiletime_assert_191__compiletime_assert_192__compiletime_assert_193__compiletime_assert_194fixups__compiletime_assert_196__compiletime_assert_197file_operationsqueue_rqTransactionmsgctxuKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countalloc_taginitChainBuffers_killktime_tSCSIStatussymsgroup_nodePageNumberi_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datareadlsync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncsetleasepinspacct_structmust_resumeboard_namelong intfile_lock_contextusageImageOffsetIOC_3_PHYS_DISKsiglockload_addrstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ssproperty_presentiocpage1sz__kmalloc_indexvolumeHostPageBuffer_dmanr_iosmpt_raid_phys_disk_get_num_pathsprintk_index_sizesymtabschedule_target_resetsized_strscpyfree_diskaen_event_read_flagrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncegidsreplySGEChain64_tiomapIntMaskdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagsNextImageHeaderOffsetsdp0lengthcodetagPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donePhysDiskMapreset_funcinternal_cmdsis_thunderbolt__UNIQUE_ID___addressable_mpt_deregister636CONFIGPARMSmark_dirtyshost_priveh_cmd_qMaxPostedCmdBuffersnum_srcu_structsbdi_writebackProductRevLevelkobj_completion__kernel_clockid_tseccompiteratorsel_timeoutqc_infoDataScrubRatedev_nameTT_NONEio_missing_delayVTIME_INACTIVEf_inode_SGE_IO_UNIONout_pci_disable_devicecancelled_write_bytessrcu_usagebitmapacpi_match_tablememcg_sigvalScsiLookupFWVersionbvecmpt_registernameidataRAID_VOL0_PHYS_DISKlatency_recordBoardNamemod_kallsymsmnt_idproc_mkdirmultifunctiondepth_MSG_IOC_FACTS_REPLYwait_queue_func_tcnvcswnuma_next_scanGetPortFactsMIGRATE_SYNC_LIGHTnr_migrations_coldmpt_alloc_fw_memoryMPI_ADAPTER_INFOdma_addr_tshiftmpt_sas_log_infocheck_eventsseq_mpt_print_ioc_summaryssize_tProductIDiopl_emulFreeChainQlockmax_write_zeroes_sectorswork_structdesc_lenflocktrack_queue_depthProductIdtask_io_accountingmremaphprobe__fortify_panictracepoint_funcargvArmBranchInstruction0ArmBranchInstruction1ArmBranchInstruction2entryfree_cached_objectspci_get_drvdataworkqueue_struct__UNIQUE_ID_x_607Unused1__list_del_entrypr_opssecondspi_lock___orig_eipprobestubnvdata_version_persistentget_timemm_cid_activescsireqelemsizedirty_paused_when__UNIQUE_ID_x_613__UNIQUE_ID_x_615maxlen__UNIQUE_ID_x_617suspend_noirqPageTypeioc_stateclass_spinlock_irq_try_is_conditionaloom_mmehandlerFAULT_FLAG_INTERRUPTIBLEwhoinitget_reference_argsNegotiatedLinkRatesrcu_reader_flavorirq_safetv_nseci_lrusub_code_descTaskCtxd3cold_allowedFORTIFY_FUNC_strcpypAddrppage_allocMPT_FRAME_HDRqueue_depth__UNIQUE_ID___addressable_mpt_raid_phys_disk_pg1625gfp_maskpi_state_listrcu_segcblistsubvolflagslengthtimeoutsusecspin_unlock_irqrestorefree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infoHostIndexmq_rq_statesrcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionki_flagsbvec_poolbd_start_sect___GFP_IO_BITMptDisplayIocCapabilitiessdp1versionsrcu_have_cbsSupportedServiceClassd_in_lookup_hash__real_kmemdupmax_sectorssgidissue_hard_resetinitial_nsFREEZE_MAY_NESTscsi_transport_templatebucket_idrb_leftmostthread_infop_lensuspended_timedatastrtabtty_old_pgrpdl_throttledMPI_IOCLOGINFO_FC_CTX_BASEi_rwsem_oldget_projidsched_reset_on_forkmq_ctxHPROBE_CONSUMEDbpf_net_contextmpt_put_msg_frame_hi_priopc1Reset_1078__int128 unsignedpcountwake_indexrestore_noirqdma_pad_maskki_filpbitmap_tagscap_ambient__UNIQUE_ID_license593dma_configureruntime_erroractive_modeRR_TOVatomic64_tanon_vmaHCTX_TYPE_DEFAULTruntime_autoPROBE_DEFAULT_STRATEGYmpt_msi_enable_spirlimMaxReplySizeread_folionr_eventsiommubi_opf__param_str_mpt_fwfault_debugprivatest_info__UNIQUE_ID___addressable_mpt_reset_deregister640map_countavailsp_reg__UNIQUE_ID_author591exit_signalsa_restorerbpf_run_ctxVolumeIOCtph_enabledsplice_pipehostdatashort_inquiryblk_mq_tag_setpasid_no_tlpspinlock_checkblk_independent_access_rangess_lock_keyReservedPCI_IOV_RESOURCESsrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqres_attrDEVICE_PANEL_RIGHTpIOCInit_tKMALLOC_RANDOM_ENDmodsslotstqheadeh_bus_reset_handlerpci_request_selected_regionss_activeMPI_IOCLOGINFO_FC_INIT_ERROR_OVER_RUNMEMORY_DEVICE_FS_DAXChainBufferclass_mutex_is_conditionalreq_as_bytesremap_file_rangemin_shallow_depthATTODeviceInfo_tnr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksMPI_IOCLOGINFO_FC_TARGET_DOAR_KILLED_BY_LIPmemory_failurerb_root_cacheds_cop__real_strscpy__param_str_mpt_msi_enable_saspci_enable_wakedd_key_truepage0_dmahres_activeMPI_IOCLOGINFO_FC_MSG_BASEbpf_raw_eventsdma_alloc_attrserrata_flag_1064dq_dirtydl_defercommand_reground_robinbug_listdirect_completeblk_mq_tagswbt_flagsmpt_device_driver_deregisterxa_locklist_addfxregs_stateload_weightkuid_tRaidPhysDiskPage0_tarch_datafpstatempt_attachblock_maxrcu_blocked_nodegp_countIOCPage4_tkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsemadd_busshost_statebd_nr_sectorsMaxChainDepthignore_childrenpNextPhysDiskBusresourcerestore_early_MSG_PORT_FACTSMpiFwHeader_tclock_mutexfs_supersMPI_IOCLOGINFO_FC_LINK_LINK_NOT_ESTABLISHEDMPT_MGMTSEPBusdqb_bsoftlimitpendingmax_dev_sectorsf_task_work___GFP_NORETRY_BITiowait_countmatch_driverVendorNameset_read_only__param_str_mpt_msi_enable_spithrotl_datapci_select_barsdma_io_tlb_mem_MpiIocLogInfoFcstringread_countMPI_IOCLOGINFO_FC_INIT_ERROR_TX_TIMEOUT_SGE_CHAIN_UNIONfutex_offsetlong long intDEVICE_COUNT_RESOURCEmmio_always_onatomic_flagssysvshm_EVENT_DATA_RAIDtimer_expiresmpt_pci_drivertrace_evalsactive_basesearly_initrcec_eacmd_sizemprotectsecurityxmm_spaceactivatescsi_targetOwnerWWIDmsix_baseSendPortEnablef_pos_lockHighContextSizeCurReplyFrameSizeSasIOUnitPage0_ti_fieldmasktls_arrayownersg_addr_sizeacct_rss_mem1need_mbpCfgvm_flags_tnoQasrefcount_structWQ_FREEZABLE___GFP_FS_BIT_SGE_CHAIN32i_bytesMptCallbacksfwSizedomain_datarelax_countdma_devtagset_freedlinelinkstart_timekernfs_nodedev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchreschedule_countvfsmountextable_basenoinstr_text_sizeattributesset_child_tid_overruntmpfilercu_read_lock_nestingtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugrefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tUTF8_NMAXfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqia_vfsgidsize_tcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workatomic_long_tpreallocclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicdelayed_callmax_nr_cid_statusd_sibbin_attributepercpu_counternuma_pages_migratedgsindexexpires_nexti_io_listf_epsrcu_barrier_seqreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tHRTIMER_BASE_BOOTTIMEclass_srcu_is_conditionalnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionHRTIMER_BASE_REALTIME_SOFTstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registers_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrstate_in_sysfstty_structUTASK_SSTEP_TRAPPEDbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollnr_wakeups_idleio_cqelf64_symlatch_tree_nodedestroy_work__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerma_external_lockuid_tflush_requiredsum_block_runtimepgmapdq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditional_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitnuma_groupdescriptionclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinei_inodyndbg_infoindexthread_headmap_typef_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenHRTIMER_RESTARTMOD_MEM_NUM_TYPESsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxcpu_basedquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_events_sys_privateUTF8_NFDIinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authHRTIMER_BASE_TAIvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherscompletionsw_reservedUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treequota_onvm_operations_structbin_attrs_newiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdatanrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupwake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlinedup_xol_worktotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramd_spc_softlimitreported_split_lockgfp_tseccomp_filterstimei_mmapthaw_superd_lrusignal_structperf_event_mutexcrcspgdval_tSB_FREEZE_WRITEsetattrf_mappingnoinstr_text_startbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activei_opldt_usr_semkobj_ns_type_operationsDQST_FREE_DQUOTSseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tis_dirty_writebacktrace_bprintk_fmt_startkstatfssitesptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutex_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupseqcount_spinlock_ti_wbclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedpagetrc_holdout_listget_inode_usagenormal_priodestroy_inoderelease_folioi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inameHRTIMER_BASE_MONOTONIC_SOFTi_mappinginblockrmidrseq_siglimit0limit1dqi_max_ino_limitmigrate_modeftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksd_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrDQST_SYNCSstack_vm_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalcg_listsrcu_barrier_completionrw_semaphoremnt_sb_ddebuginfofiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypeinit_modulemembarrier_statepage_poolinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_mempathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwrcu_syncvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstateueventlock_countrefcount_tplugsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttableslist_headtgidwrite_protect_seqcompat_robust_list_head_tids_inode_wblist_lockend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutask__UNIQUE_ID_srcversion473sched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextgpl_symsseq_showswait_queue_headblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfds_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceobjcgnodeDQST_READSvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvstatic_prioshrinkerdl_yieldeddqi_formatexec_update_lockDQF_PRIVATEDQF_SYS_FILE_Bl1d_flush_killi_versionprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symboltv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskSB_FREEZE_PAGEFAULTactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlock__rcu_headmce_vaddrquota_offdq_inusedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmod_tree_nodef_sb_errwritepagecodegtimesigactionclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listktypelockrefsrcu_struct_ptrsmm_structvlagi_uidspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesvm_mmmod_mem_typedebugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipMOD_INIT_RODATAqc_dqblkmmappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCi_write_hintfxsaveprocess_keyringlist_op_pendingllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyioveci_private_lockVTIME_IDLEstatic_keys_magicdl_overrunDQST_ALLOC_DQUOTSd_parentpayloadac_minflti_sbd_sbcommPIDTYPE_PIDatomic_write_segments_maxatomic_openreadahead_control__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupblockedi_securitystats_lockD_REAL_DATApt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colorbitsiopriocap_inheritablegp_waitlookupDD_CLASS_TYPE_LEVEL_NAMESvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vec__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATElf64_Symd_automountparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcestack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkDQST_CACHE_HITScmaxrsstimer_slack_nspolicysharedd_real_typelookahead_bandseq_startraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamerun_delaytailslinenoget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseattrscpumask_tswregs_statedqb_isoftlimitorig_axsched_rt_entitytimerqueue_nodeil_weightmem_dqblknr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pause_sigchldreservedlatency_record_countcgroupsprev_scan_seq_DQST_DQSTAT_LASTrcu_usersoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockUTF8_NFDICFcpu_bitmapstatic_call_keyutil_estucountsMOD_RODATAqc_statesoftirq_next_timercheck_flagsswp_entry_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aMOD_INVALIDmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalautogroupnr_threads__i_nlinkpushdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magicfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsMOD_INIT_DATAnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_infoshared_pendingi_gidmin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idHRTIMER_MAX_CLOCK_BASESkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsxa_flagsbin_sizegrphid_spc_timerjump_entriesassoc_array_ptrsuper_block_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_array__UNIQUE_ID_depends472mnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpref_node_fork__int128dqi_privrss_statmems_allowed_seqrefcntD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxresult_maskdquot_operationsmappinggrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizescheduledclass_raw_spinlock_nested_is_conditionalworker_privateis_relqstrma_flagsfutex_stateHRTIMER_BASE_TAI_SOFTacct_timexpd__rcu_icq_cacheDQST_WRITESsizef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tdl_server_has_tasks_frunnable_sumreal_credepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgcstimecfs_rq_uidst_spacemm_cid_next_scanac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysMOD_TEXTdqb_curinodesload__s8invalidate_lock_keyprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_marksdio_mem_alignbtime__u8is_roxlockrlim_maxruntime_deferred_listd_waitlist_lru_oneseq_stopkiocbclass_rwsem_read_intr_is_conditionalfsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeshrinker_idrootoom_reaper_listsym_VDSO32_NOTE_MASKbpf_storage__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingfsindexshstksrcu_ssp__page_1__page_2__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEi_sequencedqb_ihardlimitd_lockrefnum_bpf_raw_eventsaddr_perfi_dir_seqkqidKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typef_iocb_flagscmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagshrtimer_base_typestart_boottimevm_starts_flagsiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listhrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendings_listdqb_rsvspaceversionserialalloc_locks_dquotfolioqprev_posseqcount_spinlocks_umountis_bin_visiblesyscall_user_dispatchrcu_tasks_exit_listia_uidchildrenrb_subtree_lastbuild_idvfork_donenanosleeprt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelayquotalenf_pipei_wb_frn_historylast_wakeenextarch_spinlock_ti_mtime_nsecmmlistutf8_normalizationset_dqblkreg_offsetgsbases_quota_typesf_llisti_nlinkwrite_beginpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedHRTIMER_BASE_BOOTTIME_SOFTfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tquota_enablesched_avgntabmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextprealloc_bufprojiddrop_inodenum_trace_evalsllseeknext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeunfreeze_fsintervallast_mm_cidcookietargeta_flagstrace_overrunsession_keyringfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributerestrict_linkMOD_DATAi_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackloff_tthread_pidsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringma_locksched_delayedmodule_statelast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimemigrate_from_cpusrcu_barrier_mutexi_private_dataElf64_Halfnsproxyxol_areacleanup_modulerlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_datasignumfscrypt_keyrings_mountsuse_memdelay__state_sizethread_structcached_requested_keyenvpctimereleasesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_datasysv_semanon_vma_namefileattrDQST_DROPSlong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionali_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_ts_iflagsmce_kflagstotal_numa_faultss_countd_revalidates_opsysv_shmdq_countutf8data_tablefoliowake_entryxa_headsuidi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_lockiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_t_flagsnotify_nextshort intmynodeclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_ownerbp_regVTIME_USERsa_flagstesti_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivaltrace_event_callis_guestpoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keyGRPQUOTAi_private_listia_validi_rcuHRTIMER_BASE_REALTIMEi_atime_secqc_type_statekey_serial_tsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsi_wb_listxarray_startfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectordefault_timer_slack_nssource_listswap_readahead_info__fpstateactive_refgroup_infovdso_imagefile__user_state_sizemce_kill_meuuid_tcount_objects_stimezone_device_dataf_wb_errdefparamfred_cskprojid_tptracer_credtlb_genstorekobjectaudit_ttymce_ripvstatfsnumab_statefeatureson_listkgid_ton_cpufregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisti_mmap_rwsemwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadd_realexpiry_activedqi_max_spc_limitexception_table_entryfallocateHRTIMER_BASE_MONOTONICi_spc_warnlimitbuddy_listi_ino_timelimitSB_FREEZE_FSi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infotracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevfs_structclockiduint32_targ_startblocksset_infofileattr_getvectortimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrrenamevm_area_structsb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextiommu_mmcutimepersonalityget_statetask_sizes_inodes_addrbinfmtsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filercu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataki_posexecute_only_pkeysetleasepacct_structlong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typein_iowaitunregfuncegiddq_hashput_superMOD_INIT_TEXTpushable_dl_tasksf_flagsf_inodemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infoTT_NONEVTIME_INACTIVEcancelled_write_bytessrcu_usagebitmapmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_cold__UNIQUE_ID_name470ssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenDQST_LOOKUPSclass_spinlock_irq_try_is_conditionaloom_mmsrcu_reader_flavortv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idsrcu_structrlim_curnofaultmm_countSB_FREEZE_COMPLETEstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infodatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountki_filpcap_ambientatomic64_tanon_vmarlimread_folionr_eventsprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keysrcu_gp_startopenit_real_incrmodert_prioritymm_lock_seq__UNIQUE_ID_intree471KMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksrb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionexit_statesysvsemMOD_RO_AFTER_INITDQF_ROOT_SQUASH_Bfs_supersSB_UNFROZENdqb_bsoftlimitpendingf_task_workiowait_countstringread_countfutex_offsetlong long intatomic_flagssysvshmtrace_evalsactive_basessecurityxmm_spacef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesclass_rwsem_read_intr_is_conditionalclass_mutex_is_conditionalclass_preempt_notrace_is_conditionalMOD_INIT_RODATAMOD_TEXTclass_srcu_is_conditional_nameclass_rcu_is_conditionalclass_migrate_is_conditionallong long unsigned intNR_KMALLOC_TYPESclass_rwsem_read_is_conditionallong long intsigned charPIDTYPE_SIDclass_preempt_is_conditionalElf32_Wordorc_headerPIDTYPE_TGIDlong intclass_raw_spinlock_irq_is_conditional_descclass_local_lock_nested_bh_is_conditionalHRTIMER_BASE_MONOTONIC_SOFT__UNIQUE_ID_retpoline471class_rwsem_read_try_is_conditionalUTF8_NFDIDQST_LOOKUPSclass_spinlock_irqsave_is_conditionalclass_spinlock_try_is_conditionalclass_local_lock_is_conditionalhrtimer_base_typeMOD_RO_AFTER_INITn_descsz__u8DQST_ALLOC_DQUOTSSB_FREEZE_FSKMALLOC_NORMALDQST_WRITESunsigned int__int128class_irqsave_is_conditionalHRTIMER_BASE_REALTIMElong unsigned int__u32HRTIMER_MAX_CLOCK_BASESclass_spinlock_irqsave_try_is_conditionalclass_spinlock_is_conditionalshort unsigned intHRTIMER_BASE_TAIclass_local_lock_irqsave_is_conditionalclass_read_lock_is_conditionalelf32_noteboolDQST_DROPSclass_local_lock_irq_is_conditionalMOD_RODATAKMALLOC_CGROUPclass_rwsem_write_is_conditionalclass_spinlock_irq_try_is_conditionalclass_spinlock_irq_is_conditionalclass_write_lock_is_conditionaln_typeMOD_DATAclass_write_lock_irqsave_is_conditionalHRTIMER_BASE_BOOTTIMEn_nameszSB_FREEZE_COMPLETESB_FREEZE_WRITEclass_raw_spinlock_nested_is_conditionalMOD_MEM_NUM_TYPESDQST_SYNCSDQST_FREE_DQUOTSmod_mem_typeHRTIMER_BASE_MONOTONICclass_mutex_intr_is_conditionalclass_task_lock_is_conditionalUTF8_NMAX_nhdrPIDTYPE_PGID_Boolunsigned charKMALLOC_RECLAIMHRTIMER_BASE_BOOTTIME_SOFTcurrent_stack_pointershort int_note_18_note_19utf8_normalizationKMALLOC_RANDOM_STARTDQST_CACHE_HITSclass_irq_is_conditionalDQF_PRIVATEPIDTYPE_PIDDQST_READSMOD_INIT_DATAclass_raw_spinlock_try_is_conditionalclass_raw_spinlock_irqsave_is_conditionalPIDTYPE_MAXcharGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackSB_FREEZE_PAGEFAULTUTF8_NFDICFclass_mutex_try_is_conditional_DQST_DQSTAT_LASTclass_write_lock_irq_is_conditionalKMALLOC_RANDOM_ENDMOD_INIT_TEXTclass_raw_spinlock_irqsave_try_is_conditionalpid_typeHRTIMER_BASE_REALTIME_SOFTKMALLOC_DMAclass_read_lock_irq_is_conditionalHRTIMER_BASE_TAI_SOFTSB_UNFROZENclass_raw_spinlock_is_conditionalkmalloc_cache_typeclass_read_lock_irqsave_is_conditionalclass_rwsem_write_try_is_conditionalDQF_SYS_FILE_Bclass_raw_spinlock_irq_try_is_conditionalDQF_ROOT_SQUASH_B__UNIQUE_ID_vermagic470__int128 unsignedMOD_INVALID/home/thomas/Documents/kernels/stagingdrivers/message/fusion/mptbase.c/home/thomas/Documents/kernels/stagingdrivers/message/fusion./arch/x86/include/asm./include/linux./include/asm-generic./arch/x86/include/asm/shared./include/scsi./include/linux/atomic./include/uapi/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/linux/devicedrivers/message/fusion/lsimptbase.cmptbase.cio.hspinlock.hfortify-string.hdma-mapping.hslab.hioport.hpci.hdevice.hkobject.hdelay.hlist.hio.hkernel.hinterrupt.hdelay.hworkqueue.hscsi_host.herr.hcompletion.hatomic-instrumented.hatomic-arch-fallback.hatomic.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hfs.hmodule.hasm.hinit.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hjump_label.hdynamic_debug.hmoduleparam.hstatic_call_types.htime64.htime_types.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.horc_types.hsched.hprocessor.hcpumask_types.hmath_emu.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hseq_file.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcred.hkey.hsignal.hbio.hblkdev.hiocontext.hcompat.huprobes.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hmod_devicetable.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hfwnode.hirqreturn.hmempool.hblkzoned.hsbitmap.hblk-mq.hmpi_type.hmpi.hmpi_ioc.hmpi_cnfg.hmpi_init.hmpi_sas.hmptbase.hmpi_log_fc.hpanic.hhardirq.hproc_fs.hjiffies.hsprintf.hkthread.htimer.hspinlock_api_smp.hinstrumented.hkcsan-checks.hkasan-checks.hdrivers/message/fusion/mptbase.mod.c/home/thomas/Documents/kernels/staging/home/thomas/Documents/kernels/stagingdrivers/message/fusion./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/schedmptbase.mod.cint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hirqflags.htypes.hshstk.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hquota.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hmptbase.mod.c/home/thomas/Documents/kernels/stagingscripts/module-common.c/home/thomas/Documents/kernels/stagingscripts./include/uapi/asm-generic./include/linux./include/linux/sched./include/uapi/linux./arch/x86/include/asm./include/asm-genericmodule-common.cint-ll64.htypes.hirqflags.hpreempt.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hpid_types.hhrtimer_defs.hslab.hunicode.hquota.hquota.hfs.helf.hmodule.hasm.hmodule-common.cint-ll64.hGCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910x -%-%,u\DEAK=d&DKHA o ABE \ ABE ,_JHGADKOI ` FBE AB 4hKAD t ABE  ,FEHTKSL E(D0C8G@ 8C0A(B BBBE 0,[Cs AE ,^VDyA LGGB A(A0E (D BBBE $0QDM/C4|YAE PAB_,^IWA!DEKBA A(DP (C ABBE d[KBH E(D0A8G``hHpAxR`a 8A0A(B BBBE 4JS E M E q E LGAA GHbPHXB`OHF  AABE 4hJDT AE zA,tFDB AE <GEA C( ABB$6(,5KBA A(4( ABB^lGBB B(H0A8 0D(B BBBE A0A(B BBBLKBB I(A0G8N0D(E BBBd{KBB B(A0A8DU^ 8A0A(B BBBE D FtPPTGBB B(A0A8DX 8A0A(B BBBE $XDKBE A(A0(D BBB\'KBB B(D0D8DH| 8C0A(B BBBE $H\ KEB G(D0A8G@ 8C0A(B BBBE $@TGEE E(A0A8DP 8C0A(B BBBE $8PTGBA A(GHPKH (D ABBE PFH$xHlGGB D(A0GKXaw 0D(A BBBE j K $/LGBE A(D0D@ 0A(A BBBE T)GBB E(A0C8D@8D0A(B BBBT?GBE E(A0A8D@8C0A(B BBBLgKGE A(H0Dx4 0A(A BBBE $dx$I0V8P0T E tRKBB B(A0D8D@ 8C0A(B BBBE  8G0A(B BBBE <KBH C(l ABB$[(\`KEE B(A0A8K`; 8C0A(B BBBE $`DHGGA A(G`&(A ABBL KDE D(A0Oh 0D(A BBBE LAKIB A(D0Dh 0C(A BBBE LKJB A(A0Gh} 0D(A BBBE \|GMI E(C0A8J 8A0A(B BBBE \KBB B(A0C8Df 8C0A(B BBBE dGEB E(A0A8D\ 8D0A(B BBBZKBB I(A0D8 0D(B BBBE r 0A(E BBBE P 0D(B BBBE DKBA H(D` (G ABBE <h` (A ABBE <KBA D(n DBB\# KLB B(A0A8DP 8D0A(B BBBE $P    !"#%'(*,.024578:<>@ABCD 4 4*4 PB4O4\4@k4` |h4@.J@0i ~  *Q(4/ _P ! E`$h@te)6;$<0#'x^ {L#[ n`"zP "H #@  ( 8p-4' x)08 /;3 )?I VOdR`>f[ P HzL|4U'h4444444H4#(.  9@HDO *_@ l`,w,, ,`,,, ,`,,, ,`,,, + ,6`,AN,Yf ,q`,|,, ,`,,, ,`,,,0 ` ,  , ,% ,0` ,; ,F ,Q ^ ,i` ,t , , ,` ,  ,  ,` , ,  , , `,!,,,7@,B,M,X,c@,np {,,  ,`,, , ,`,,, ,(`,3 @,K,V ,a`,l,w, ,`,,,@,p,, ,`,,$,/@,:,E,P,[@,f,q~, ,P,,,@,,, ,`, , ,  ,' `,2 ,=  J ,U @,` ,k ,v , 0 `,  , * , . . .- .: . G .(T .0a .8n .@{ .H .P .X .` .h .p .x . . . . ." .0 .> .L .Z .h .v . . . . . . . . . .  .( .0 .8, .@: .HH .PV .Xd .`r .h .p .x . . . . . . . . . .( .6 .D .R .` .n .| . . . . .  .( .0 .8 .@ .H.P.X$.`2.h@.pN.x\.j.x............%.4.C.R.a.p.. .(.0.8.@.H.P.X.`.h.p$.x3.B.Qcrc(#F(($" $ >?a!P(@$(Lt x('`$FJg($LI ('$Fi]y t# 8@p (pD0c x  @  Pp:_r #(`-#053LP>tLU0  $6HV!r! !!4 /!5P!Ls ,!M!o t!pH!x H!! !!!H $m!! <!! l!! \0!F!^ t!! !!  8! !* `C!`!0 !1!F !G!Z7 PT![s!p D!q! $!K!t x!! ! !+ G!j! !! !0 !W h| ! !.  !/ !? ! %!!@E!!Vg! !!W!!l! !!m!!x" T'"!yC"!a" }"!"!" 0"!"!# 2#!Z#!# #!#!# $#+$ B$ X$ l$|$ $ 5$ $ $"=$4 C_$7g$%h`5%%6%7G%W%"C`~P |j%%%%%%%2&&!&*&6&^&v&p(&&')Q&q!P[&0"&}K&&#pB&6(!&R?R'' .''A'Z'y''''%(5K''P%''("!(k"pO0(B(W(Sr(W(((pG4#0 ^(I(( ))`O-)*)K)S)`&a p& #G t))))))) uIA))@ *>>*pX*g*z**** d***+ +@6+ D>+@Z+`B~+P+++++++ ,,2,@"D,[,f,|,W# ,,JA-,,C,-! SZ- +-C-X-f-t-(---mptbase.cMptEvHandlersMptResetHandlersMptDeviceDriverHandlersMptCallbackslast_drv_idxMptDriverClassMptCallbacksNamempt_register.coldmpt_add_sge_64bit_1078.coldmpt_alloc_fw_memory.coldmpt_mapresources.coldmpt_base_indexmpt_proc_root_dirmpt_halt_firmware.coldmpt_get_fw_exp_ver.coldSendIocReset.coldmpt_suspend.coldoriginator_strmpt_interrupt.coldpl_code_str__func__.203ir_code_strraid_sub_code_striop_code_str__func__.213PrimeIocFifos.coldmptbase_reply.coldmpt_send_handshake_request.coldmpt_handshake_req_reply_wait.coldGetIocFacts.coldSendIocInit.cold__func__.258mpt_detach.coldmptbase_sas_persist_operation.cold__func__.275__func__.283mpt_config.cold__key.192mpt_fault_reset_work.cold__func__.172mpt_ids.161__key.162__key.188__key.163__key.164CSWTCH.252CSWTCH.255CSWTCH.251CSWTCH.254CSWTCH.253mpt_attach.cold__func__.311_entry.310_entry.309_entry.308_entry.307_entry.306_entry.305_entry.304_entry.303_entry.302_entry.301_entry.300_entry.299_entry.298_entry.297__func__.296_entry.295__func__.294_entry.293_entry.292__func__.291_entry.290__func__.289_entry.288_entry.287_entry.286_entry.285_entry.284_entry.282_entry.281_entry.280_entry.279_entry.278_entry.277_entry.276__func__.274_entry.273__func__.272_entry.271_entry.270_entry.269_entry.268_entry.267_entry.266__func__.265_entry.264_entry.263_entry.262_entry.261_entry.260_entry.259__func__.257_entry.256__func__.255_entry.254_entry.253_entry.252__func__.251_entry.250_entry.249_entry.248__func__.247_entry.246_entry.245_entry.244_entry.243_entry.242_entry.241_entry.240__func__.239_entry.238__func__.237_entry.236__func__.235_entry.234_entry.233_entry.232__func__.231_entry.230__func__.229_entry.228_entry.227_entry.226_entry.225_entry.224_entry.223__func__.222_entry.221_entry.220_entry.219_entry.218_entry.217_entry.216_entry.215_entry.214__func__.212_entry.211_entry.210_entry.209__func__.208_entry.207__func__.206_entry.205_entry.204__func__.202_entry.201_entry.200_entry.199_entry.198_entry.197_entry.196_entry.195_entry.194_entry.193__func__.191_entry.190_entry.189__func__.187_entry.186_entry.185_entry.184_entry.183_entry.182__func__.181_entry.180_entry.179_entry.178_entry.177_entry.176_entry.175_entry.174_entry.173__func__.171_entry.170_entry.169_entry.167_entry.166_entry.165__func__.160_entry.159__func__.158_entry.157__UNIQUE_ID___addressable_cleanup_module659__UNIQUE_ID___addressable_init_module658_entry_ptr.0_entry_ptr.1_entry_ptr.2_entry_ptr.3_entry_ptr.4_entry_ptr.5_entry_ptr.6_entry_ptr.7_entry_ptr.8_entry_ptr.9_entry_ptr.10_entry_ptr.11_entry_ptr.12_entry_ptr.22_entry_ptr.23_entry_ptr.24_entry_ptr.25_entry_ptr.26_entry_ptr.27_entry_ptr.28_entry_ptr.29_entry_ptr.30_entry_ptr.31_entry_ptr.32_entry_ptr.33_entry_ptr.34_entry_ptr.35_entry_ptr.36_entry_ptr.37_entry_ptr.38_entry_ptr.39_entry_ptr.40_entry_ptr.41_entry_ptr.42_entry_ptr.45_entry_ptr.46_entry_ptr.47_entry_ptr.48_entry_ptr.49_entry_ptr.50_entry_ptr.51_entry_ptr.52_entry_ptr.53_entry_ptr.54_entry_ptr.55_entry_ptr.56_entry_ptr.57_entry_ptr.58_entry_ptr.59_entry_ptr.60_entry_ptr.61_entry_ptr.62_entry_ptr.63_entry_ptr.64_entry_ptr.65_entry_ptr.66_entry_ptr.67_entry_ptr.68_entry_ptr.69_entry_ptr.70_entry_ptr.71_entry_ptr.72_entry_ptr.73_entry_ptr.74_entry_ptr.75_entry_ptr.76_entry_ptr.77_entry_ptr.78_entry_ptr.79_entry_ptr.80_entry_ptr.81_entry_ptr.82_entry_ptr.83_entry_ptr.84_entry_ptr.85_entry_ptr.86_entry_ptr.87_entry_ptr.88_entry_ptr.89_entry_ptr.90_entry_ptr.91_entry_ptr.92_entry_ptr.93_entry_ptr.94_entry_ptr.95_entry_ptr.96_entry_ptr.97_entry_ptr.98_entry_ptr.99_entry_ptr.100_entry_ptr.101_entry_ptr.102_entry_ptr.103_entry_ptr.104_entry_ptr.105_entry_ptr.106_entry_ptr.107_entry_ptr.108_entry_ptr.109_entry_ptr.110_entry_ptr.111_entry_ptr.112_entry_ptr.113_entry_ptr.114_entry_ptr.115_entry_ptr.117_entry_ptr.118_entry_ptr.119_entry_ptr.120_entry_ptr.121_entry_ptr.122_entry_ptr.123_entry_ptr.124_entry_ptr.125__UNIQUE_ID_mpt_fwfault_debug606__UNIQUE_ID_mpt_fwfault_debugtype605__param_mpt_fwfault_debug__param_str_mpt_fwfault_debug__UNIQUE_ID_mpt_debug_level603__param_mpt_debug_level__param_str_mpt_debug_level__param_ops_mpt_debug_level__UNIQUE_ID_mpt_channel_mapping602__UNIQUE_ID_mpt_channel_mappingtype601__param_mpt_channel_mapping__param_str_mpt_channel_mapping__UNIQUE_ID_mpt_msi_enable_sas600__UNIQUE_ID_mpt_msi_enable_sastype599__param_mpt_msi_enable_sas__param_str_mpt_msi_enable_sas__UNIQUE_ID_mpt_msi_enable_fc598__UNIQUE_ID_mpt_msi_enable_fctype597__param_mpt_msi_enable_fc__param_str_mpt_msi_enable_fc__UNIQUE_ID_mpt_msi_enable_spi596__UNIQUE_ID_mpt_msi_enable_spitype595__param_mpt_msi_enable_spi__param_str_mpt_msi_enable_spi__UNIQUE_ID_version594__UNIQUE_ID_license593__UNIQUE_ID_description592__UNIQUE_ID_author591.LC150.LC104__pfx_mpt_add_sge__pfx_mpt_add_sge_64bit__pfx_mpt_add_chain__pfx_mpt_add_chain_64bit__pfx_mpt_add_sge_64bit_1078__pfx_mpt_version_proc_show__pfx_mpt_remove_dead_ioc_func__pfx_kzalloc_noprof__pfx_mpt_mapresources__pfx_mpt_set_debug_level__pfx_mpt_get_fw_exp_ver__pfx_mpt_iocinfo_proc_show__pfx_mpt_ioc_reset__pfx_seq_mpt_print_ioc_summary.constprop.0__pfx_mpt_summary_proc_show__pfx_WaitForDoorbellAck.constprop.0__pfx_SendIocReset__pfx_mpt_signal_reset.isra.0__pfx_mpt_inactive_raid_list_free__pfx_mpt_interrupt__pfx_PrimeIocFifos__pfx_mptbase_reply__pfx_mpt_handshake_req_reply_wait__pfx_GetIocFacts__pfx_SendIocInit__pfx_mpt_downloadboot__pfx_SendEventNotification.constprop.0__pfx_mpt_inactive_raid_volumes__pfx_mpt_fault_reset_work__pfx_MptDisplayIocCapabilities__pfx_KickStart__pfx_MakeIocReady__pfx_mpt_read_ioc_pg_1__pfx_mpt_do_ioc_recovery__pfx_fusion_exit__pfx_fusion_initmptbase.mod.c__kstrtab_mpt_fwfault_debug__kstrtabns_mpt_fwfault_debug__ksymtab_mpt_fwfault_debug__kstrtab_mpt_raid_phys_disk_get_num_paths__kstrtabns_mpt_raid_phys_disk_get_num_paths__ksymtab_mpt_raid_phys_disk_get_num_paths__kstrtab_mpt_raid_phys_disk_pg1__kstrtabns_mpt_raid_phys_disk_pg1__ksymtab_mpt_raid_phys_disk_pg1__kstrtab_mpt_set_taskmgmt_in_progress_flag__kstrtabns_mpt_set_taskmgmt_in_progress_flag__ksymtab_mpt_set_taskmgmt_in_progress_flag__kstrtab_mpt_clear_taskmgmt_in_progress_flag__kstrtabns_mpt_clear_taskmgmt_in_progress_flag__ksymtab_mpt_clear_taskmgmt_in_progress_flag__kstrtab_mpt_halt_firmware__kstrtabns_mpt_halt_firmware__ksymtab_mpt_halt_firmware__kstrtab_mpt_Soft_Hard_ResetHandler__kstrtabns_mpt_Soft_Hard_ResetHandler__ksymtab_mpt_Soft_Hard_ResetHandler__kstrtab_mpt_attach__kstrtabns_mpt_attach__ksymtab_mpt_attach__kstrtab_mpt_detach__kstrtabns_mpt_detach__ksymtab_mpt_detach__kstrtab_mpt_resume__kstrtabns_mpt_resume__ksymtab_mpt_resume__kstrtab_mpt_suspend__kstrtabns_mpt_suspend__ksymtab_mpt_suspend__kstrtab_ioc_list__kstrtabns_ioc_list__ksymtab_ioc_list__kstrtab_mpt_register__kstrtabns_mpt_register__ksymtab_mpt_register__kstrtab_mpt_deregister__kstrtabns_mpt_deregister__ksymtab_mpt_deregister__kstrtab_mpt_event_register__kstrtabns_mpt_event_register__ksymtab_mpt_event_register__kstrtab_mpt_event_deregister__kstrtabns_mpt_event_deregister__ksymtab_mpt_event_deregister__kstrtab_mpt_reset_register__kstrtabns_mpt_reset_register__ksymtab_mpt_reset_register__kstrtab_mpt_reset_deregister__kstrtabns_mpt_reset_deregister__ksymtab_mpt_reset_deregister__kstrtab_mpt_device_driver_register__kstrtabns_mpt_device_driver_register__ksymtab_mpt_device_driver_register__kstrtab_mpt_device_driver_deregister__kstrtabns_mpt_device_driver_deregister__ksymtab_mpt_device_driver_deregister__kstrtab_mpt_get_msg_frame__kstrtabns_mpt_get_msg_frame__ksymtab_mpt_get_msg_frame__kstrtab_mpt_put_msg_frame__kstrtabns_mpt_put_msg_frame__ksymtab_mpt_put_msg_frame__kstrtab_mpt_put_msg_frame_hi_pri__kstrtabns_mpt_put_msg_frame_hi_pri__ksymtab_mpt_put_msg_frame_hi_pri__kstrtab_mpt_free_msg_frame__kstrtabns_mpt_free_msg_frame__ksymtab_mpt_free_msg_frame__kstrtab_mpt_send_handshake_request__kstrtabns_mpt_send_handshake_request__ksymtab_mpt_send_handshake_request__kstrtab_mpt_verify_adapter__kstrtabns_mpt_verify_adapter__ksymtab_mpt_verify_adapter__kstrtab_mpt_GetIocState__kstrtabns_mpt_GetIocState__ksymtab_mpt_GetIocState__kstrtab_mpt_print_ioc_summary__kstrtabns_mpt_print_ioc_summary__ksymtab_mpt_print_ioc_summary__kstrtab_mpt_HardResetHandler__kstrtabns_mpt_HardResetHandler__ksymtab_mpt_HardResetHandler__kstrtab_mpt_config__kstrtabns_mpt_config__ksymtab_mpt_config__kstrtab_mpt_findImVolumes__kstrtabns_mpt_findImVolumes__ksymtab_mpt_findImVolumes__kstrtab_mpt_alloc_fw_memory__kstrtabns_mpt_alloc_fw_memory__ksymtab_mpt_alloc_fw_memory__kstrtab_mpt_free_fw_memory__kstrtabns_mpt_free_fw_memory__ksymtab_mpt_free_fw_memory__kstrtab_mptbase_sas_persist_operation__kstrtabns_mptbase_sas_persist_operation__ksymtab_mptbase_sas_persist_operation__kstrtab_mpt_raid_phys_disk_pg0__kstrtabns_mpt_raid_phys_disk_pg0__ksymtab_mpt_raid_phys_disk_pg0__UNIQUE_ID_srcversion473__UNIQUE_ID_depends472__UNIQUE_ID_intree471__UNIQUE_ID_name470module-common.c__UNIQUE_ID_retpoline471__UNIQUE_ID_vermagic470_note_19_note_18orc_header__pfx_mpt_device_driver_registerpci_save_statefree_irq__pfx_mpt_put_msg_frame__list_add_valid_or_report__pfx_mpt_detachalloc_workqueue__pfx_mpt_registerpci_request_selected_regionspci_release_selected_regionswait_for_completion_timeoutpci_enable_device__kmalloc_noprofpci_enable_device_mem__this_modulepci_choose_statesnprintfcompletepci_dev_put__pfx_mpt_set_taskmgmt_in_progress_flag__init_swait_queue_head__pfx_mpt_resumeiounmap__stop_alloc_tagspci_disable_msi__pfx_mpt_get_msg_framekfreepci_set_power_state_raw_spin_lock_irqsave__fentry__wake_up_process__pfx_mpt_free_fw_memory__start_alloc_tags__x86_indirect_thunk_rax__pfx_mpt_put_msg_frame_hi_pri_printk__stack_chk_failqueue_delayed_work_onstrnlen__pfx_mpt_event_registerpci_select_barssized_strscpy__pfx_mpt_clear_taskmgmt_in_progress_flagsynchronize_irqpci_enable_msi__pfx_init_modulerequest_threaded_irq__pfx_mpt_HardResetHandler__pfx_mpt_attachdestroy_workqueuemutex_lock__pfx_mpt_raid_phys_disk_pg0__pfx_mpt_raid_phys_disk_get_num_pathsdma_alloc_attrspci_read_config_wordseq_putc__pfx_mpt_findImVolumes__list_del_entry_valid_or_reportioremap__pfx_mpt_send_handshake_request__mutex_init__fortify_panic_raw_spin_unlock_irqrestorepci_restore_state__pfx_cleanup_moduleproc_mkdircancel_delayed_workmemset__pfx_mpt_device_driver_deregister__pfx_mpt_Soft_Hard_ResetHandler__pfx_mpt_alloc_fw_memorypci_set_master__x86_return_thunk__pfx_mpt_verify_adapterkmemdup_noprofdma_get_required_mask__pfx_mpt_reset_registerjiffieskthread_create_on_nodedma_set_coherent_mask__pfx_mpt_deregister__pfx_mpt_event_deregistersprintf__pfx_mpt_print_ioc_summary__pfx_mptbase_sas_persist_operation__pfx_mpt_suspendparam_set_intdma_free_attrspci_enable_wakemutex_unlock__pfx_mpt_free_msg_frameinit_timer_key__pfx_mpt_reset_deregister__const_udelaypci_write_config_byteremove_proc_entry__kmalloc_cache_noprofseq_printfdelayed_work_timer_fn__pfx_mpt_GetIocStatepci_disable_device__pfx_mpt_raid_phys_disk_pg1pci_get_slot__pfx_mpt_configpci_stop_and_remove_bus_device_lockeddma_set_mask__pfx_mpt_halt_firmwareproc_create_single_datapci_read_config_byteparam_ops_intparam_get_intpci_write_config_wordmsleep__SCT__might_reschedkmalloc_cachesk* /9Ukh qk k k#4 A Xrl wkk9Uk_kkkk) Q apkkiLWp{kik X% 5 \e p z  w ` ~ kH[ }bk v ~  . X7 t O  n U e F aEk[blk 5 km    U k { V g  Q F% : S [  f n    " ]  k    k    & / U kc z  r    k     |4 ; Q ki    w   kP Xw   C [ t   @ h'5 @X ]s   @ `  & 3A Ib m     5'1uUk    ] uk[&;[ak   6D LU ]duk  k= EtNXk&EekzY' k  r !khfkiCKnk! *5r8 8rW P W #V{ ZWu!k 2Ki KT   )!U^!U{!U!!! "" `"t*"uE"ks"i"##5#k_#$ $r$ $$ _%[z%%%%S&u&k ''' p ,'tP'' ( ( p %(t*( C(i((k )%) p *)t<) V)q)** p *t* *+ A+\+ p e+tr+ + + ,%, p /,tD, I, c,,, p ,t, (-q-k-F #.c .+ // ;0 o0u0k+11 2 R2^222rU3u3  3t3u3kL44445a66666*7G7V77u7k7 ,8iP8\8d8l8i8 888 ^8Z88 m8Z88 y8Z89rD9~99:d::f::f:f ;fT;v;f;f;f;; <t< < %<tO<<`<<R<=fA=T=y= ~=t=z=G=f=->K9>cC>ua>kl>>>u?k#?d?i?? ?i?@!@ @@i@@ 6AAiAAiABGBNBuBkBBBBCk5C=CiVCCDDDrD7ESbE|EOF _FyFFiFFF PF PFtF1FGWG*G4G;G FG PKGtSGbGGkHOcHHODIhIIuIkJOIJwJJOJJuKktKOKKOLLLuLk}MOMMNOMNwNN$NNK%ONOXOuuOkOPf+PaPOPPOP>QfQOQQO RU[RR Su%Sk2STSiSS SS'TiTT TTT%U-U4UFU\U xlUtvUUkU'U'ViAVvjVVOW6WOmWWuWWkW\WXV*X X *X /X5X |@XE*lX P}X X 0X XX X JY^Y Y SY6Y =Y JBY^PY WY l\YtY {Y JY^Y Y U9ZIZ NZM^Z *Z ~Z [[*[ |[[ [K[[ [[[ 1\ P\*`\m*|\ \ \f\] ] F] ] ] ] ^ ^8^[^ }^ ^ ^ ^^u_\_ 2_M_*_J,_ `  ` 2`` ` ` ` ` @` ` & a a 8a Ea Ra _a la ya a a 6a a a a  Xb _b vb b}b b b pb Tb Eb 'bu  $t)2AkQ Vtf  ktr yt "t   .t   9t At 8t   +t9RAF Q \tr }t  Ht t  8t :6 AtSa ftGcERhi T Ht` Tv t  T h `t `" `( -t8C PJ OtVr ` "  t #   | T" ) .t3=: F gR X^ uj Hv a 3 \ j )       t6""" t  t $; XEt`#  t# t  t #   t ## 0 ; D   p t #  < 8 t # +  t #   t #    t #   ' . ; F O _ k r h w t| #    0 t #   t # O(  t :- J- p & t+ .6 0 A tF .Y  ^ tc .v  { t .  t j2 H t j2 k   _ k v  r  s    t  ,}3  t  %t  t 8"tC xNtk` kt 8t pt^m wt t 8t T$ D/ 4tKR \ atf9u 8zt  xt9 8t9   t   tBy-SB  I Nto  v PtnWBB   t   tB   t B t,1gE>nPW` @stCkO@bOOOuk, ; F St t tT ]tol-l-l-6RG{ZT~ Q 0t  Pt3c_Gyc0 t0 tp  r(GOf t\>\>a h Pmj6ON|OO+sO ,"  O  O!!O!"OS")#OL#Op##O#>$Oz$$O %8%Oh%%O%&Op&&&u'' ' 't9'rM' @T' Y'm'o' ' 't' 0't' ' p't'' ' ' ( (t((U5( :(t?(UV( `(  j(u(k( h(t(h((( ) ) #) .) P5) l) z)t) )t) 0)t) `)t) )t ** *t**`2*@*RE*\L* Q*tV*@X]* h*tm*\|* H*t*m_* H*t*m_* *t**U+`g+{+R++f+\+ +r+ ++  + 9+, , ,(,\E,vJ,\Q, Y,ta,,) 0 7 <C J OX ]k v# &* =/t6 ;tB W k ~ F 0#|        m" #$n(,04+8,<@DHDLPTOX%\&`CdhlFptxP|}()./W  d y A  $4(5,g048|<@DJHLPTX\x`dhlptx|Ij12T (08T@HPX`hpx@D4    T  P  T`d (0 8@H PD"X4#`t&h(pp-x03 7`>?tBCGIKLtO$SU(W>LZh v@HPX`hpx&5 D(R0`8n`Xh @p8 @8 @8  ( @08`0 h @p8h  @8  @8  ( @08` h @p88  @8p  @8 ( @08` h @p8  @8  8 =( 08`h p8x 8 ( 08`h Pp8 P8P P8 @( P08`h  p8  8  8 P(  08`h  p8  8  8` 8h  0 p 8 h  8   8 (  0 8` 0h  p 8 `  8   8 (   0 8` h   p 8 8  8   8 x(  0 8` h  p 8   8 H (   0 8`  h   p 8    8 `  8 ( 08`h p8 8  8@H P8" 8. 89 8@AH P8p  p8  8  ( 08`0 h p8  88 8  ( 08` h p8 8  8 8( 08`xh p8 88 8 p( 08`h p8 88 8 ( 08`h p8 8 8@hH P8 p8H 8 ( P08 `8 `8 `8@H `P80 `8P `8 `8@H `P8 `8H 8 H( 08 P8 P8 P8@H PP8H P8 8 ( 08` h p8 80 8 p( 08`h p8 8 8@H P8 8 8 8`p h 0p8 8 @ p  ( 0 @8 x    @ h !!!|! !0!h!!!!(!h!!!!P!!!!H"h"p"x"x""" """"# " "H "A "P "j "~ " " " # #p # # # `# # #% #2 #E # #U #a #e #h ($ 0$ #X ( $0X8 $H P @$XX`p x `$X  $X  $X W 4$29 D$ (,8'0+.8p v $8(^,048`<o@DVHzL[PTGXs\a`kdhl p t! x. |  : h  \%5MD #$h(U)/24@=>5AB{EgIHJL MOT$UEU \$(,J04'8*<T T $(,048<K@oDHLPTX\`dhlDpZtx|4 l     $ 9 R e  \    T   P    DW~&?\ 2H l$(,0&408T<@DHLPTX:\``dhlpKt\xc|DW%dy gB  1 S  (!]!z! !$!(!, "0"4)"8D"<r"@"D#H4#L^%P%Tt&X '\+'`O'dx'h'l(p$(tB(x(| )))p)))***@+d++ ,.,b,,,'-p-./n0012Q2]2T3333K4~445`66 6666)7 F7$U7(7,7074+88O8<[8@c8Dk8H8L8P8T8X8\8`8d8hC9lu9p9t:xc:|::::: ;S;u;;;;<$<N<<<<<=S=}===8>B>`>>>?c?????@2@ t@@@@ A @A$~A(A,A0A4A8B<*B@FBDMBHtBLBPBTCX=@=E=G>P>i>>>>>>> ? ??????)A,A-A/A 1A3A5A:AB B$B( B, B0B4B8B<RB@`BD{BH}BLBPBTBXB\B`BdBhClCp Ct%Cx'C|(C)C4CoErEsEuEwEyE{EEpGGGGGGG\I`IaIcIeIgIlIIIIIIIII>JAJBJ DJFJHJMJJ J$ K(K,K0K4K8 K<L@LDLHLLLPLTLXL\L`LdLhLlMpMtMxM|MMMMMMMM\O`O{O}OOOOOOOOOOOOOP SS+S-S/S8S9S=S T T T T T T T U U$ U(  U, "U0 $U4 )U8 9U< =U@ ?UD AUH CUL EUP JUT zUX U\ U` Ud Uh Ul Up ]Vt dVx eV| gV iV nV W W W W W W W W W \  \ \ \ \ \ \ \ \ \ b  - 0 F K               $ "( 2, 0 4 8 <  @  D  H  L  P  T  X  \  `  d  h  l  p t x |          # $ % ) > A B D F H J O                      $ ( , 0 "4 &8 &< &@ &D &H &L 'P 'T 'X '\ '` 'd 'h 'l n(p p(t (x (| ( ( * * * *  * ,  a  @ (08@@pHPX`hpx0p0p     @  @  @Pp (P08@HPX`0"h #p`&x(`-03 7P>>`BCpGIJL`OSUp( Wbl `  @   ( 0 8 @ H P X ` `h p `x    `    `    `   `    `  `  ( `0 8 @ H `P X ` h `p x `   `     `     `    @    @   ( ` 0 8 @ H P X ` @h p x  @      `     `      @   @   ( 0 8 @ H P `X ` `h p x  ` 4CPlb " '= (' ( %' &. '"UZ ' qf 's 'Ǘ 'o 'x 'MB ' '[ '8 ' ' '; ' ' '  '. '3 'Sc ' ' ' 'k '$ 'j '͸ ' 'el 'o] '3  '/, '(D 'ڍK 'P '\ '5h 't '{ 'y 'b '; 'gZ ' 'J  '( '# '6 ' 'f '  '! 'F- 'A9 'E '1Q '] 'pn 'z '# ' '9 '5+ '  ' ' ' ' '  ' 'ES& '3 'K 'AX 'Ef ' (s ' '> '  ' 'l  'T)" 'cI0 '> '=L 'K Z 'h 'v 'e ' ' '9 '| ' ' 'X ' '=\ ' ' 'H]. 'm< 'J 'X 'nf 't ' ' 'NA ':q ' ' , 'Ȍ 'x 'W ' 'U  '8/ '> 'bM '\ 'k 'ђz 'H 'Fw '!s 'P ' ' ' ')' '{) '! '{0 '? 'N 'R,] 'l ' K{ 'a ' 'a 'Y '1 ' ' '- 'S0 ' ' '!/ ' > 'QM ':\ 'Bk '!z '0 '(D 'b '! ' ' '1 ' 'ْ ' 'v '. '? 'sT '8a 'x 'n` ' 'CT '? '­ 'rO '8&" 'D5 '8C 'P 'Y 'Ѷa ']n 'y| ' ', ' ' 'jv '7 'G ' 'H 'G 'l  ' ) '7 'AE 'b 'Hn 'z ' '/. '_ ' ' 'i ' ' '^0 '< 'gI 'EV 'kc '(p '@6} ' '{ '5 ' ' ' ' L ' 'o 'N '$ 'wP# ' 0 's= '7J 'tb '5o 'U1| 'k 'n8 'd ' ' '?H '1 ', ': 'LH 'V '@d '%r 'I 'M '4< '} 'P 'Ķ 'k ' 'Y 'B ' ;  'p '( '|l6 ' D 'R '` 'Qn 'lm| ' ' 'Ag 't ' ' 'Z 'iC '1 'l$ 'H0 '.< '0I 'X '{e 'l y ' 'S` '6Z 'c '6 '6Z 'c '+  'u3 ':O ':] 'Hk ' 'z ' '+ 'u '=n '} ' '( 'c: 'v* 'v8 'Hl 'j: 'v ' 'y '] ', '] 'a1 'B= '3K '3Z '.  '֜ ' ' '37 ' '& ' 'A 'c! '. '< 'NJ 'HX 'N<g 'v '5 '5 'w '" ' ' '0 ' '" ', ' ' ', '<: 'H 'V 'Xd '7r ' ' '% 'S# ' 'R( 'm ' '!m& '6 ',hE '^T 'xc 'r 'ܜ '0 'e[ 'wz 'E ', '_R 'j '  'L 'C '& ' 5 'g D '8S 'b 'fAq ' ' 'B~ 'I 'E7 ' '# ' '5 '< '% 'ݸ4 'LjC 'R '3Ka 'p ' 'T* ' ' ' ' '( '4 '^ 'w  '  ' - 'X= 'M '] '#m 'V} '  '+ ' ' '- 'S ' ', 't ''% '4 '/C 'AR 'ua 'mp 'Zd '3 ' '( '= 'G '|| '`+ '_ '[Y 't '$ 'ׇ3 '2B ')Q '` 'do '~ ' '^ '\ 'ɔ '*. ' 'i ': ' ' '$ 'dA 'P '3(_ 'Vn 'N<} ',< 'm ' ' ' 'C '5I ', '[ ' 'N" 'eF1 ';@ 'O '^ ':m '| ' '( '% 's[ ' ' '( 'O 'Z& 'iU '! '0 '9? '̃N ']] 'l '{ ' ' ' 'Ջ '+ 'D '(s '9 'X! '2a! ' ! '/! 'Ɔ>! '2M! '_\! 'k! '+z! 'E! 'h! '! '}! '! '! '! '"! '" '" 'X" 'b." '=" '2NM" '}\" 'wk" 'z" '" '" '" 'P" '9" 't" 'P" ' " '# ';# '!L # '/# '># ',M# '\# 'Dk# '~z# 'Z# '# 'X# '[x# '# '# '3# 'Q# 'r($ '|Z$ 'ѳ$ '`.$ '=$ 'L$ 'v[$ 'Wj$ 'y$ 'T$ '$ '$ 'D$ ']$ 'i$ '$ '$% 'rw% 'X % '_/% '>% '6M% '\% ']k% 'z% 'P% '% '% ',% '% 'U4% '{% 'x&% '#Y& '[9& '2;& 'J& '& '& '8& '|& ')& '& '!& 'TN& '& ' ' ' p' ''' '=7' ''E' '^S' '`a' '' 'r' 'Fo' 'a' 'Q' ''' 'b( '6( 'C'$( '2( 'W@( 'xO( ']( 'k( '0My( 'M( 's( 'o( 'E( 'J( 'C( '"( '( 'z) ') 'v!) '.) 'g;) 'H) 'U) 'c) '2t) 'Sz) 'P) 'Y_) 'T) ') 'h) ') ') '8) ') 'o) ') ') ') ') ') '\) 'E}) '0* '- 1* 'm7* '.]=* '=DC* '|I* 'RKO* '#PU* 'R[* '[a* ' g* ':m* 'NDs* 'y* ')* ' * '* '* '* 'jx* '{* '1* '2* '* '* 'U<* '* '* '?* '* 'C<* '+ 'l+ '}(+ '5+ 'P+ 'Ң^+ ' l+ '+ ' + '(~, 'F, '", ', ', '`~ - ' - 'h$- 'E[- 'O}- ' - '- 'e- '!y- 'w. '}G. 'E*. ']. 'WWk. 'ny. 'CX. '~. '+. '$. 'e . 'G. '/ '/ 'f/ ' +/ 'n9/ 'FY/ '&h/ '̑v/ '/ 'n/ 'AI/ '/ '/ ':/ '&/ 'v/ 'Tq 0 'l0 'Ͽ(0 'BH0 'KV0 '5d0 '&r0 'I/0 '`0 'c0 '^0 '*r0 '70 '̑0 '1 '1 ' 1 '-1 'Be1 ' j1 ' pt1 '1 '1 '{1 'k1 '(1 '@61 'ł1 ' 1 '~1 'f1 'E2 'VQ2 '12 '=2 'ɳJ2 'h5W2 'F2 'n2 'w2 ' 2 '=t2 '72 '2 '2 '3 '(3 'J+3 'k=3 'J3 '6ZW3 'cs3 '3 'H3 'f23 'd3 '3 '3 '6Z3 'c3 'P3 ' 4 '4 '}$4 '-14 'j4 '5w4 '4 ' 4 '(4 '4 'f4 'O4 '4 ' x5 '\5 'j5 '35 '#5 '6)5 '05 'b55 'B5 'GP5 'PZ5 'g5 '8u5 'N5 '5 '5 'pb5 '/5 'y5 'b35 'М5 '6 '86 '+6 'r86 'E6 '.R6 'f*`6 ';m6 'nz6 'j6 '6 'Z6 ';6 '6 'Z6 ')6 '}6 'W6 'f27 '7 'Z!7 ' W27 '`c87 '?7 'ܥL7 'WZ7 '5g7 '(t7 '77 'm7 'V7 '0&7 '|7 'S\7 '7 '7 '8 't8 '*8 '278 '{J8 'W8 'd8 'f2q8 '(~8 '8 ';8 '8 '[8 ' 8 'Q+8 'Fo9 '&9 '> 9 '.9 'O:9 'mG9 'T9 'b9 'Xo9 '|9 '=9 '9 's9 'm9 '9 'q: 'Vl: ' : '+: '68: 'tGM: '5Z: 'q: 'S~: 'D: ' : ' : '5: ': ' : '5: ': 'q; '#; '+; '*I8; 'E; 's\; '4i; ':6; '5; '; '; '; '; 'Y; '#|; '; 'M< '6y8< 'qNE< 'bR< 'a< ' n< 'z< '< '~< 'x< ' < '1< '< '< '< 'F= 'r;= ';!= '+= '8= 'E= 'N<S= '_`= '\Lm= 'hz= '= '^= 'Y= '= '= '{= ']= 'x= 'r > 'p> '37&> '{3> '̑A> ' N> 'Fw[> 'Ah> '/v> '> 'ԓ> 'Y> '> '|> '1!> 'p> '> '> 'X> '9? '? 'w!? '>.? 'L? '^Y? 'Xg? 'Мt? '? '? '? 'κ? 'Q? '? 'l? 'P? ' @ '4@ '!@ 'De.@ ' <@ '-H@ '*U@ ' c@ '5x@ ' @ '@ '@ '@ 'z@ '[Y@ '||A '`+A 'A ',/A '5A 'h;A '[AA ']GA '?NA 't\A ' jA 'zxA 'mA '||A '`+A '_A 'A '%A '{A 'A 'B 'B '1"B 'mJ1B '?B '<MB '[B 'iB '+\wB 'LB 'B 'UB 'mB 'B 'lB 'fB 'B 'LB 'JC 'C '!C './C '4U=C 'KC 'YC '9gC 'uC ';C '{C 'C 'ZC 'NC '0C 'C 'C 'C 'D 'bD 'PD '+D '9D 'PIGD 'UD ' dD 'TsD '—D 'ZD '7D 'D '{D 'D 'D 'eD 'D '<|E 'GKE '/sE 'Z*E 'f\8E 'bFE 'CTE '-bE 'pE 't~E 'E '*E 'AE 'E '}E 'OE 'dE 'F 'WF 'F 'g*F ''>F 'dF 'irF ';F 'F '\F 'F ';F 'fF 'ՙF '7F 'F 'oG 'XG 'T!G 'li1G 'AG 'jQG 'aG 'OqG 'G '+6G 'zIG ' G ' G 'VG '`H 'H 'H '-H 'HuGH 'mUH 'cH '%qH ' H '1H 'o!H 'H 'DH '%H 'zI 'زI '95I '7*I 'p8I 'gFI ' TI 'bI '8pI 't+~I '&I 'I ';I 'I 'eI 'hI 'I 'I 'J '=J 'A)J '6J '6PJ '5]J 'jJ 'J '%J 'c"J 'J 'J '*.J 'K 'CK '"K '/K 'f 'FWKf '2Xf 'ef 'rf 'df '"f 'ͨf 'f 'f 'G5f '[f 'g 'g 'Qd*g '6g 'NRg 'eg 'g|g 'g '^g 'g 'g 'Hg 'g 'g 'h 'lh '51)h '6h 'HCh 'Ph ',jh 'wh 'xh ' h 'vh 'h ': i '[i 'Pi 'g]i 'aQui 'i 'i 'i 'i '&i 'i '37i 'Q j ''j '=)j ' 7j 'Ej 'RSj 'Arj 'j 'Zj ''j 'Fj 'j 'Tj '\j 'j 'Tk 'ݙ*k '9k ']k '-ok ' }k 'Mk 'uk ',k '}k 'H,k 'ek 'k 'k 'Gk '%k l 'l '+l ' 9l '8Gl 'Ul 'F_cl '`l 'l 'sl 'l 'l 'l ''l 'l 'h&m 'm 'm '7-*m 'L8m '3Qm '_m '~m ' m 'ϼm ':Pm 'Nm 'm 'X%m 'n '}n '<#n '1n 'V?n '>Mn 'k0[n 'in 'Mwn 'n 'q n 'n 'n '}n 'n 'n 'Pn 'o '*3o 'Lo 'Zo 'ho 'o 'o '>Uo 'Bo 'o 'Vo ':o 'Ho ' p 'O]p '%p 'ܜ3p '4Ap 'D3Op ' ]p 'kp 'wyp 'p 'p 'p 'op 'p '>*p 'qp 'Jp 'p '8 q 'Aq 'v)q 'S8q 'Gq '|Vq '%Teq 'tq 'Lq 'q '5"q 'q 'q 'q 'q 'Oq ' r 'Sr '^(r '7r 'D)Fr 'OUr 'dr '-sr '-dr '\r 'r 'r 'r 'tr '#r ';r 'r 'l s 'ys ','s '\6s 'Es 'kTzs 'ws ']s '8s 'G4s 's 'Is ' t ' Vt '37Dt 'bSt 'Adt 'gjt '$pt 'vt '|t 't 't ':t ';t 't 't ':t 't 't 'Dt 'it '5t 'tt 't '{u 'bu ' u '?H-u 'J:u 'wiGu 'eWUu 'Zyu 'hu '%u 'u 'O)u '%u 'u 'ru 'O)u '(v ' v 'rv '\/v 'q8x 'Ex '=\x 'Onx 'ax 'zgx 'x 'Ðx 'x '+x 'y 'ar&y '3y 'Z@y 'ӄMy 'Zy '6 gy ':ty 'iy 'cy 'y 'y9y 'ey 'iy 'y '&y 'Cy 'y '%"z '1z '1?z '@Mz ' b[z 'iz '<;wz 'z '_z '{-z 'iz '9z 'mz ' z 'z '\z '' { '{ '%{ 'YA3{ 'xA{ 'Y O{ ']{ 'ck{ 'vy{ 'z{ ' f{ '{ '%{ '{ '9{ '{ ''{ 'M{ '5| '| 'IH!| '/| 'k>| ' M| 'be| '2Yt| 'ʞ| 'Xc| ' | '| 'H| '6| '| 'o| 'sq } '8} '&*} 'n9} '8^} 'k} 'x} '3} ':} '"<} '6} '@} 'Q} '7} '} 'y} '}t} 'F~ '~ 'P.~ '<~ '>3J~ 'X~ 'Mf~ ')t~ 'a~ '~ '~ '~ 'I6~ '~ '[~ 'Xi~ '-t~ ' ' 'r 'I* '-8 'F 'YT ' b ''p 'A~ '@s ' '+ 'w ' ' ' '> ' '̯ 'i 'o/ '*3> '[*M 's\ '}hk 'z '$ ' 'dd ' 'ŀ '[ Ԁ 's 'V '  '\ '7 'I. '<= 'DAL '[ '{ '* ' ' ' 'Dǁ 'Sց ' 'x 'm '$؂ ' ' 'E 'm '43 'JM 'ӄ 'Q~ ' à 'Ѓ 'Fd݃ ' 'X '| 'O ' 'z, '9 'dF '` 'em ' 'c ' 'F '` ' 'W ' ' 'Q1 ' > 'K 'fX 'f 'Y. 'f 'K ' ': 'e ' '|$ '. '@; 'sTH 'cgU 'Vw 'b$ ' ' '% '] 'W† 'yΆ ' ' '3 ' ' @ 'M 'zg` 'Hm 'z ' 'Uu '| 'v 'V؇ ' 'h 'N8 'iN '8[ 'q 'N} ' 'zg ' 'H 'Lj 'ވ '3 ''x 'K! 'i4 '> 'KM 'ZZ ',Xg '=t ',q ']n 'P 'q 'O ‰ '>Љ '݉ ' 'X] 'B 'ɴP 'j '-w 'K ' 'Y '߁ ' ')ʊ '2׊ ' G ' 'iz '@ 's 'Q% 'ǀ2 's ' '4 ' 'J '4 'd 'i΋ 'F܋ ' 'f2 'A 't '|| '`++ '/s9 '!F ' T 'ra ' n ' ' 'u 'r '5ی ' '^ '  ' '( ' . 'L; 'H 'TU 'hob 'q '- 'Z '( '3F 'V ' ' 'F- '9 'N '[ ']h ' ' '^ 'rŎ 'ӎ '7 'N ' 'R ' '' 'a5 'UC 'nQ 'w_ 'm 'E{ '3 'ڄ 'G 'U '" 'Ϗ 'k; '6 '׆ ' ' ( 'XyE 'T 'c ' r 'd 'v ' 'ZV 'ĸ '̐ '?Oې ' ' 'W ' 'M& '5 'jR 'Xa 'p 'Ӕ ' 'ޣ '7 'ɑ ' ّ ' U 'a ' ':` 'S$ 'ι3 'B 'Q '7k '4 '] ' 'rsג 'J '1 'V ' '= 'B& '3 'IA ' 'q ' '݇ 'G ' 'i9 'DŽē '^ʓ 'j) 'J" 'd '2 '" ' ' '7$ '4 'B 'HN 'H8[ 'h 'u 'Jb ' ' 'ާƔ 'ܔ '8 'Z ' ' '( 'Y5 'C '9~Q '{_ 's ' ' '^ ' 'a 'Ǖ 'Օ ' ' ' '4 'ɤ '>* 'rM 'RY '߈j 'Qp 'Kv '?} ' ' '̟ʖ 'Hؖ '} ' ' 'v ' '4& '\}3 '@ 'M '[ 'Hch 'Xu ' '^ '^ ') 'g '× 'З 'ޗ 'D ' '3P ' '* 'z8 'F 'eT 'Kb '`]p '~ ' '  'V3 ' '( 'z<# '$1 '? 'M '[ 'ʠi 'w ' 'b7 'V3 'e. '< 'TJ '*X '$f 't '0 '? ') ' ' '$Ț 'Q֚ '7 ' 'Os 'n 'I '+ '9 'G 'U 'c 'pq '4 ' ' ' 'ƛ ' 'X ' '<; '#V '+ '(9 'G 'U 'pd 'r '.% '] ' '0 ' '$Ɯ 'yԜ '4 'v ' '՝ ' ' 'Q ' 'Ef '`s ' '( '.ž 'O_О ''ޞ 'l '& ' ' '&$ 'w2 '@ '7N 'H\ 'j '.|x 'u 'o '0 ' ' ' '̟ 'L 'mc 'j 't48 'E '^ '0k ' 'VL 'g '7ˢ 'آ ' ' '% 'g ' 'po$ 'D 2 '#@ '|N 'VR\ 'j '$x 'L ' '< 'G 'l ' ̣ '@,ڣ ' ' 'F 'HN 'hj '[. 'h< '-J '(X '-f '  ' ' '[1 '8 '% '` ' ͤ ' '\ ' '" 'L0 '> '̑L 'Z '4th 'zv '! ' ' 'å 'YХ 'ݥ 'f ' 'A ' '/- 'K ; 'Jb '=mp '69~ '7 'g 'xJ '& 'Ħ 'fsҦ ' 'p 'խ 's '+ '& '4 'VB 'cBP '"^ 'F{l '3z '[ 'G ' '$$ ''~ 'Χ ' ' ' '( '2 '[!G 'U 'Db 'o 'xc| ' 's 'y ' 'k 'ʨ '9ר '' '} 'S 'o ' '2n% 'ie2 'H? 'oL '"Y 'f '-s ' '_ '&; 'Elũ 'xT 'T '[/ ' 's̪ 'Aڪ 'o '}. ' ' 'D ' '̑ 'S% '=2 '? 'L 'w^Y 'r 'yA ' 'g ',` 'F- ' P '9k 'y 'O '># 'h 'c '~0: 'D ' ' ' ' 't 'N\dz 'a ' 'BC 'x '' 'hY) 'U 'b '%o 'B| 'o ' ' ',Z 'p 'Ѵ 'd޴ ' 'Ea '; 'ab '<  'V, '-: 'sH 'V '{d 'zCr 'a '@ 'C '2a ' ']µ ' ε 'sڵ 'w ' '8 'o '4\ 'H' 'ķ4 'JB '^tN '[ 'zh ''u ' 'k~ 'K ', '4¶ '=϶ 'ܶ 't ' 'zg '( 'G 'T 't 'w ' '̑ ' 'tķ 'ҷ 'B 'U 'Dy ' 'S '& '4 '; B '@P '}^ 'kl 'L ' ' 'C '߆Ǹ 'k ' ' ' 'М '$ ')2 '@ 'ƱN '\ 'p! 'B. '; 'nH 'U 'b 'd 'J '> ' 'x') 'sj 'w ' ' 'O '*$ 'K '`X 'Ae ' ' ' 'S 'o| 'Q= 'G[ '~h 'u 'W '/ 'l 'v 'b 'K$ 'd ' 'v ';/ 'H 'V '` 'Pm 'Cz 'B 'q 'o 'q '?H@ 'Q '։W '@k] '2c '-2j '8_ 'W ', '7 '8 '} '̑ 'q ' '& '[% 'F9 'Ys '} 'ь ' 'q ' 'W ' w 'V '}i 'FF '' '4 '!A 'T ' m '! 'ھ '5 ' 'H '| 'V '- 'G 'T 'a ' n 't{ ' 'Ro ' ' '$% ', 'wo ' 'ё '+ 'mH '~U 'b 'cwo '| ' ' ' 'V '; 't '7M 'H 'm- '<+ '!9 'МG ' U ',d 'Gs ' ' ' ' ' '; 'E ' ' 'RX '3' 'է6 'wE '0T 'c '  'o '9 ' ' 'B 'R '< 'E '. 'jk '+j' '7 '؎G 'jW 'g 'k}} '< ') 'h ' 'e, '} 'H '( 'S ' 'b ' " 'D0 'E> 'L 'mZ ':h 'v ' '&7 '& 'h ' '7 'j ') '- '60 '6 '< 'B '=&H '&O 'M` '=f '@l 'r 'gx ' '# ' 'd 'L' '- ' } ' ' '|o 'Ww 'i ',' 'a6 'EE 'uT 'Nc 'r 'm ': ' 'E ' ' 'c" 'D 'I ' '^ 'Ƚ% '5 'XE 'ԩT 'b 'Xp 'ύ~ 'r 'A 'O 'y\ 'ՠ ' '* ' ' ' '( 'Z8 'H ']X '=h 'v 'd 'h 'S ' 't '7 ' 'G ' ' Z '& 'ߑ3 'L 'Y 'f 'rs '8p ' ' '/_ 'j 'j ' 'i 'N ' 'j ' '+ 'c@ 'd 'Qn 'C: ' 'ul 'r ' 'x '} '~x '' 'n4 'A 'N '[ ':h 'Ou ' '[ '7i ' ') '+j 'H '( ' ' ' 'L< 'I 'c 'p 'wP} ' 'A '" ' ' '[ '7i ' 'H '( ' '% '4 ' ' ' ' 'd ' ' ' ' '& ' 'd 'ή ' ' 'O ' 'B 'A ' ' 'Z+ '; 'bg 'eu 'X ' 'h '& ' 'j 'ӱ '2 '" ' 'VN '9^ 'qn '~ 'P '+ ' '| 'a ' ' 'v '5 '@ 'R. 'o> '4N '^ 'wen '~ '9 'R '^5 'X ' ' ' '- 'o ' '+ ';E: '&I 'X 'g 'Ow ' ' ' '^ ' ' '$ '@ ' 'D' 'o6 'E '#T '1lc 's ' '$ ' 'p 'F ' ' '] '3 '@( '2 'E< 'K 'Y '{g 'u '7i 'H '( ' ' 3 '>^ ' ' ' ' 'm- '%} '_2 'Wl 'v 'x 'f ' ' 'u ' '@ 'T ' ' 'z ' ' ' ' '` '+ '(+ ' '@ ' ' ' 'z" '*) '6 'tC 'zP ' '{k ' ' ' ( '6 'gD 'Wb 'o '> 'd ' 'j '| 'G '#O 'tj ')% 'n3 'yA 'O 'S] 'v '.C ' 'ј '#& '5 ' 'J ' 'Nm ' 'k 's ', '; 'XrI '`6W ' ^e ':s ': '" ' ' '|N ' ']U ' 'v ' '9 'ؼU '@b 'o '| '# 'E '՞ 'wi '?H ' '=K '% 'o ' 'H+ 'j8 'PE 'WR '_ 'tl '~ ' 'F ' '[H ' ' 'D 'n ' 'W1 '> 'L 'e 'r ', ': ' 'ŕ ' 'PZ 'ˬ 'D 'v ' 'c ' '  '# '~0 '.= 'mK '}W 'Ze 'Os 'C ' 'B ' B 'Ķ '[ ' 'U ' '( ';+ 'G ') 'o7 'E 'S 'Dl 'v '1 'ď '+" '^ '; 'm 'ѐ ' ' '{ 't '^ ') '7 'VE 'S 'a 'o '} 'N 'X ' 'm{ ' ' ' '& 's ' '<1 '% '3 'qA '~O '] '[k 'Yy ' 'p ' 'L ' '8 ') 'N 'k3 '0 'S '! 'l/ 'E= 'L 'd| ' '; 'V ' ' ' 'A 'u 'e ' '" '0 '> 'dL '}Z '}h 'Mv ' 'M '> ': ' 't '$ ' 'd ' 'r! '$H. 'BH 'LU 'db 'o '' '8G 'DH ' ') '.H ' '& 'Z '] '#d '2 'm8 '7_ 'Yl 'y 'J '_ '; ' ' ' ' '4 'M 'Z 'gL '_( '\26 'J 'jT 'Z^ 'h '3 'dP 'a ' 'ɝ 'M ' 'd ' '! ' ', 'У: 'jH '\ 'j 'lx ' '6 ' ' 'rL ' 'T 'ga 'r 'Nx '/ ' ' ' '3 'qd 'O ' 'c 'zg '\ ';( 'tK ' 'h 'i ' 'r ' 'ۤ ' ' ') '!% '3 '^B '!Q 'H` 'Lo '@l~ ' '0 '2z ' 'P ' '` 'd 'c 'v  ';# 'S2 'ιA 'V 'D;` 'W;q 'qw 'm, ' '< 'm 'f '  'e ' 'o\ '  'M '] 'U2 'M ' '#i '- ' 'l '# 'M0 ')9= 'uJ 'H]W 'd 'Eq ' B~ 'Ķ 'Fq 'B9 ' 'n 'm '@ 'V 'B ' '  'k '/{' '5 5 '3 C '.Q '_ 'tm ' { ' '~ ' '3/ 'ʠ 'e '\ '  ') ',  'v0 'C) 'S8 'G 'XV 'le 'bt 'V '( ' ' ' 'W 'x8 ':. 'h '6 'H.  'n/ 'P> '2l '-{ '| 'Ny 'g 'F '  '. 'D ' ' 'U  '4  'i|#  '}1  'u.?  'M  '[  'j  '#y  '$  '  '9}  'E  'qh  '<(  '  '  '  'v0  ',  '(-  'C<  'SK  'Z  '1i  'Xx  'l  'b  'V  'a  'dP  '  '-  '  '  '\  ' #  ':.3  'hC  '6S  '%c  'fs  '  'w  '  'H.  'd  '  '7  ' 'L 'Z 'h 'v ' '# '74 ' ' 'W ')n ' ' ', 'X 'g 'T, ': 'H ')nV 'd 'r ', 'X ' ' 'C ' 'ep '? '~ ' '  ' '\( 'ҡ6 'D 'S '` '0n '| 'W ')n ' ' ', 'X ' ' '8 ' 'W ')n$ '2 ',@ 'XO 'r\ '#j 'wx ' ')n ' ' ', 'X ' ' 'C 'l 'Q 'gm! '~. '+< 'J 'WX ')nf 't ', 'X 'l 'Q 'z ' 'v '2 ' 'yb 'O, ': '&+I 'V 'Xmd '<{r ' 'W ')n ' ', 'X '+y 'W ' '  '\f 'C( '6 'D 'A S '4` 'HUn '<{| ' ' ')n ' ', 'X ' ' 'C '  'I '$ 'C2 '0W@ ';WN '|\ 'Yj 'ox ' ' ' ' ' ' 'A  ' 'N ' 'Q 'l  '=. '0O< '[ 'h 'v '<{ ' ' ' 'A  ' 'N ' 'u  '  '9  '  ',  ';  '=ZH  '^e  's  '9  '  '  '  '  ' 1  '  '$,  'm  '  ' ! '! 'W(! ')n6! 'D! ' 1R! ',`! 'Xn! '|! 't-! '_! 'T$! '~! 'Z! '! '! '! ')n! '" ' 1" ',$" 'X2" '@" 'N" 'C\" 't-k" '.x" '֏" 't-" 'TC" '/" 'g" '0*" 'ڮ" '>" '# 'j# 'G"# '#1# '(># '+L# 't-Z# 'Ch# ' v# ',}# '# '# '# 't-# 'C# '@G# 'Q# 'I$ '$ '/ $ ']#.$ 'v<$ '2J$ 'X$ '߰f$ 't$ 'C$ '$ '$ '0$ 't-$ 'Ma$ '$ '$ '$ ' % '% 'lP+% '}9% 'G% 'U% 'c% 'ybr% '% '-0% 't-% 'z% '% '% '\% '% '&% 'u & 'x& ')& 'E6& '@0D& 't-R& ',o`& 'n& '& ']& '2& 't-& 'F& '& '& 'u& 'G ' 't' '(&' '3' 'LJ@' 'C2N' 't-\' 'ۗj' '1 x' '%' '' ' ' 't-' 'C' ''' 'Q|' ';' '( '( 'a"( 'd0( '>( 'L( ' Z( 'h( 'Hv( '( '`( 'ҡ( ' _( '( '%4( '( 'B( ' ( 't-) 'C) '9) 'E,) ' :) 'U6H) 'pvV) 'xd) ' r) ') '`) ':) ') '5) ') 'J) 'yb) 'D) ') 'C * '&* ')* '96* '.D* 'уR* 'r`* 'o* 'C|* 'b* 't-* 'v* '2* '* '* '/;* '=* '4* 'J+ ' + '$+ '2+ 'z@+ '`N+ 'o\+ '2j+ '\+ '-+ ' + 'K+ 'u}+ '+ 'f^+ 'U+ 'w~+ 'U , 'V, '/', '4, 'B, 'P, '^, 'l, '{, 'i, '*), ', '/g, 'r, ', ', ', 'C, '&- '- '"- '00- 't->- 'L- 'Z- 'h- 'ybv- '- '- '- 'N- 'T- '-- '4- 'p- '- 'ht. '. '". '0. '>. 'I\L. 'Z. 'ch. 'v. 'C. 'w. '6. 't-. 'U. 'yb. '. '. ' / 'C/ '#/ '1/ 't-?/ 'M/ '[/ '8j/ 'w/ '/ 't-/ '/ '/ '/ '/ 'T/ '/ 'W/ 'b0 '+e0 'K0 '-0 'C;0 'LJ0 'WW0 '0e0 's0 'ۗ0 'ְ0 '40 'ސ0 '(m0 ''0 'w0 'n0 '3j0 't-0 '" 1 '1 '@c)1 '71 'E1 '^sc1 'p1 'g}1 '1 'W1 ')n1 '1 'Q:1 '1 ',1 'X1 'gn2 '&2 '\A2 'GM2 'Z2 't2 '2 ')n2 '2 'Q:2 '2 ',2 'X2 '2 '!2 '2 'C3 '3 '3 'N*3 'b73 'E3 'Q3 ' o^3 '#k3 'x3 'W3 ')n3 ',3 '3 ',3 'X3 '3 '^3 '3 '5 't-K5 'ۗX5 'e5 'r5 '%5 'EP5 '5 '{5 '5 's5 '$5 'M5 '-5 '5 'T5 '5 '6 '7i6 '*6 'zF6 '._6 '|m6 'h{6 '6 'X6 '6 'V6 'oR6 'G7 '>A7 '[47 'IA7 'N7 '[7 '[h7 ' Pv7 'Y7 '7 'B7 '7 '7 'p7 '[7 'Ԗ7 'j8 '8 'S8 '+8 '98 '\G8 '/^U8 '7%c8 'q8 '8 '8 '8 '8 '8 '8 '9 'М9 '#9 '[19 '(?9 '(N9 'w]9 '}9 'o9 '9 ')9 'k9 'V9 ' 9 'ۗ9 '_9 '9 'c : 'b(: 'g.%: '33: '7A: ')O: 'z]: '^k: 'my: ' : 'l: '8: ': ' : ': ': 'fM: '[B ; ''; 'o(; '6; 'ҤD; 'u_; 'Tm; 'd{; '; 'c; '!_; '=/; 'V; 'LX; 'd< '$< 'V< 's< 'L< '< '< '< '< 'c< '< '< '^= '= '$F = '.= '<= 'VJ= 'aX= 'f= 'at= '1x= 'J= '~x= 'B= 'h= '= '= '6d= '= 'P9> '> 'wi> 'ړ*> '8> ';uF> 'T> 'jb> 'Hp> 'pB~> 'Z> '> '_> '> '߳> '> ' > '+> '? '? '? ' K-? 'T5xJ J '7rJ J 'KJ J 'J `$J 'FJ xJ 'IJ tK 'RG K (K '*#K AK '*NK @$WK '1cK PK 'BK K '%[K K 'vK K '!K $K ':K $L 'L (,L '18L JLSL ';iL 'IvL #L '>iL L 'īL cL 'bL L 'fL `M!M '~.M GM ' TM mM 'GzM M 'M M '{+M M '1:M M 'WMN 'ݕ N N 'Q,N 'BN 'XN ' JnN 'zN ' N ' N #N 'N #N ';N `" O 'O "2O 'A?O HO 'h^O '_atO '{O 'RO 'O ' O '~O 'irO 'RP '$P 'w:P 'OSPP 'fP ' |P '&P 'P 'lP '٘P '{P '_Q '{Q 'hD,Q ',BQ 'XQ 'RnQ 'eyQ 'bQ 'yQ '_QQ 'X/QQ '}Q 'z:R '8R 'R 'K&4R 'W 'VW 'UW 'W 'q^W '(W 'rW 'zW 'X 'w&X ' GX 'f iX '{{X 'J=X '̻X '+(X '6X 'X '3Y '\Y 'yp/Y 'OY 'fY ' ;mY 'Y 'Y 'Y 'Y 'Y '}`Y ')Z '6x"Z '%;Z '(HZ ' VZ 'qZ '%Z 'mZZ 'Z ' Z 'eZ 'vZ 'JZ ' [ 'h[ 'Z %[ 'I[ 'NX[ '_g[ 'npv[ '~x[ '[ '[ '[ 'q[ '[ [ '[ [ 'H[ \ '\ \ 'H,\7\ 'D\ @M\ 'HZ\\ '4\ '\ 'E\ ' \ '\ p\ '\ \ 'H\(] 'cq] '+] ' 8] 'B] L] 'Y] b] 'Ho]0z] 'G] '] '] '8] '] 'h] 'k] ')^ '.^ 'rM8^ SZ^ #$^^ # c^ 'n^ #r^ #^ #^ #^ 'h^ #K^ #9^ '^ #^ #^ '-S^ 'ْ^ '^ '$^ 't^ '_  _ 'H_8(_ '$5_ 'tG_PSQ_ %Vb_ #f_ #p_Sz_ %f_ #_ #_ # _ # _S_zT_ %v_ #_ #_ #._ #,_T`T`T+` #=/` #;8` #O<` #MA`TZ`Td`T` #^` #\`T`)U`)U` #n` #l` #` #~`1U`JUa %a #a #"a #&a #+a %4a #8a #Aa #Ea #NaNUXaNUqa #ua #~a #a #aXSaSaSaTb+TbTAbT^bpUsbxbzUb 'Kb?b # b #b 'b #hb #Vc #c # c?c %L(c #,c #5c #39c #'>c %LGc #Kc #gTc #Xc #ac #Cec #)nc #rc #{c #c #c@c?c %lc #5c #3c #Dc #Bc %lc #Vc #Rc #pc #lc?c?d #d # d #$d #0dY?:dY?Wd #[d #ed?od %d #d #d #d #d?d?d?d #d #d #d #d?e?e?,e # 0e # 9e #=e #GeJ@QeJ@ne #.re #,{e #=e #;e #Me #Ke #\e #ZeN@eN@e #me #ie #e #e@e@ f@"f #&f #+f@Hf@Rf %cf #gf #pf #tf #yf@fAfAfsAfsAf #f #f # f #gCBgCB+g #/g #8g #- m '+m #r /m #f ;mHIm '$Vm 'thmrm %m # m # mHm %,m # m # m # m # mPmtmn 'h*n 'h7n 'Sn 'JYnP{n # n # n 'Tn # n # n '̑n #H n #@ n #t n #n n 'hn # n # n 'n # n # no # o # o@oRopooooooo 'p '{p >p #; Bp #3 Pp #e Tp #a dp # hp #} mp 'p # p # p # p # pp # p # pppIq\+q;qVq`q{qqqCqq[qqtqrr:r@Dr+_rhirDrrarrrrrrs@"s=s`Gsbsls7ssMssqssst!t+t+Ft5Pt5^t 'Mgitt #3 t #+ t #] t #Y t 'ht #w t #u t '3t # t # t # t # t #Ut #Ct #u #u #u #u '&u #I*u #7/u '=:u #>u #Cu^uku~xuvuuuuu ')v '6v '6"v '-v 'j;v 'Zv '3hv 'Urv %v #v #v '(v # v #v 'mZv #kv #_v '}v #v #v ' Bv #v #v #v #v #Fw #Dw 'V7w #Xw #Tw 'd3w #7w #nh@ 'Z 'm ' ' ': 'qg ' '<€ 'Ԁ ' '6g '/ 'C  '! '. ':; 'qgH 'U '<c 'u ' '6g '/ 'C ' 'ˁ ':؁ 'qg ' '< ' ' '6g, '/; 'CI '` 'Gf # # 's # # 'e ł '[Ղ ' # # #  #0  %v #?  #;) #X- #V6 #i: #eC #G #LDx % # # # # # # # #Ãf=[n 'q ' 'e  ' '˄ '&G ' 'e  '+ 'v= 'J 'վY 'f ':s 'qg ' '< ' ' '6gDž '/օ 'C ' 'UpO' #+ #0 'q; #"? #O #IS #EX 'x 'e  #g #_ ', # # # #ȆRцP ' # # 'վ #   #PP5 #"9 # B #1F #/O #@S #>\ #R` #PePP % #e #a #~ #| #Ň #· #҇ #ׇPQ  % #" #' %0 #4 #= #A # e #5i #/rQ| % #e #a # # # # # #QR # # # #R(RA #E #N ##R #!WRz % #9 #3 #b #\ # # # # # #ȉRRR #  # # # ## #, #0 #9 #= #F #$J #"V@R` %q #6u #2~ #S #Q #d #b #s #q_RBQʊQQ R %% #) #2 #6 #? #C #L #P #URuP'PePP؋R S 'kK* #. #3 'M> #B #G '~R #+V ##{ '| 'T #] #Q # # # #Č '4ό #ӌ #ߌ`L %Y 'NK NK& # * #3 # 7 #@ # D #K %iT 'f`Kp`K # # # # # # % ' #+ƍ #)ˍ ':֍ #;ڍ #9ߍ 'qg #K #I ' #\ #Z '< #l #j %  '+ #|/ #z9 'F '6gS '/f 'Ct 'ALAL # # # #Ď #Ȏ #ю #Վ #ގ # # # #EL  ' # #  ':+ #/ #4 'qg? #C #H 'S #W #\ '<g #k #pEL ' ' '6g '/ 'CΏ 'ELEL # # # #  #" #+ #/ #8 #< #E #I #Q %Z 'e #i #n ':y #/} #- 'qg #? #= ' #P #N '< #` #^ %Ð 'ΐ #pҐ #nܐ ' '6g '/  'C '*JL4JLM #Q #~Z #^ #~g #k #t #x #~ # #~ # #~OL ' # #Ñ ':Α #ґ #ב 'qg # # ' # # '<  # #OL$ '6 'C '6gP '/c 'Cq 'OLOL # # # # #Œ #Β #Ғ #ے #ߒ # # #K %| # #  #4$ #0- #k1 #e: #> #CKi`Ls % # # # # # # # #LΓxKK L ''II # M #R 'M] #. a #(  '| 'T #U  #M  #|  #z ĔJ͔ %֔ 'II  #  #  #  # % # ) # 0 %9 'KIUIn # r # { #  #  #  # MJ %0 #  #  # Õ # ̕ #!Е # ٕ #%!ݕ ##!{JJ %F# #9!' #5!0 #V!4 #T!= #u!A #s!J #!N #!SJmJJJ 'kG #! #! 'M #! #! '~  #! #!4 '|D 'TO # "S #"b #Y"f #U"rI{ % 'GG #q" #o"Ɨ #q"ʗ #o"ӗ #q"ח #o"ޗ % 'GG #"  #") #"- #"6 #": #"A %J '\GfG #" #" #" #" #" #"H 'Ę #"Ș #"͘ ':ؘ #"ܘ #" 'qg #" #" ' #" #"  '< #" #"H. '@ 'M '6gZ '/m 'C{ 'HH # # ## ##™ ##˙ ##ϙ ##ؙ ##ܙ ## ## ## #+# #)#8H  % #=#! #9#* #\#. #X#7 ##; ##D ##H ##MgHsI} % ## ## ## ## #$ #$ #$ #$HIؚ#HHI' '-LO #*$S #"$X 'c #X$g #P$v #$z #~$ '| 'T #$ #$̛ #$Л #$՛ '~ ' #$ #$ ' )O % '1cM;cMT #%X #%a #%e #%n #%r #%y % 'cMcM #'% #%%Ĝ #'%Ȝ #%%ќ #'%՜ #%%ܜN ' #7% #5% 'վ #L% #F%N'N@ #i%D #g%M #y%Q #w%ZNo #%s #%|NN #% #% #% #%N۝M % #% #% #% #% #& #& #5&! #3&&MLNV %$g #I&k #E&t #c&x #_&N %@ #}& #y& #& #& #& #&NȞ %Y֞ #&ڞ #& #& #& #& #& %Y #' #' N7 ON)OX %ri #2'm #.'v #O'z #M' #n' #l' #}' #{'ROMџ NQN {N')OA\OT 'gZ | #' #' ' #' #' ' #' #'l  '6͠ #(Ѡ #(נs '6 #-( #+( '6! #>(% #:(/49 %RJ #T(N #R(W4mw %b #c( #a( #r( #p(ġΡ #( #( #( #(#; #(? #(H #(L #(Uil 'Ƣ 'T 'e  '  'T '' '>hA 'e Z 'V ' 'վ 'xƣ 'xӣ ' 'w 'x '$ '] 'j 'ԕw '? ' '_ '$ͤ 'ڤ '|" '" '( ' 'm '% @3 '@ `I 'HVe 'r { 'H '  'Hɥ '֥ ߥ 'H ' ` 'H- ': C 'HP_ 'l u 'H '  'Hæ 'Ц `٦ 'H '   'H' '4 = 'HJY 'f o 'H|x ' ` 'Hp 'Ƨ ϧ 'Hܧh ' %  #( #( '  #)$ #)) 'vL4 #G)8 #C)= 'H #^)L #\)[ #|)_ #n)d 'o #)s #) #) #) 'm #Q* #K*B '  è %̨ 'ިBB #m* #k* #~* #|* #m* #k*+ '8 `A 'HN] 'j s 'H % 'ȩ #*̩ #*թ #*٩ #* #* #* '  'H$ '1 : 'HGV 'c `l 'Hy '  'H 'Ǫ Ъ 'Hݪ` % #*  #* #* #* %% #*) #*2 #*6 #*?dIdb #*f #*o # +s # +{BBͫ  ׫   91YRn{  P  Ԭ  3@  J [h   'PЭ '<ݭ ' 'B 'Y" '? 'G/ 'B 'O 'b 'o ':| 'qg ' '< ' 'î '6gЮ '/߮ 'C ' ' '# '2 '? ':L 'qgY 'f '<t ' ' '6g '/ 'C 'ٯ '" '5 ' 'K 'T7 '{%D 'Q '0^ 'h s '  'H ':Ű '5Ұ '߰ ' '= ' ' 0 '' `0 'H=H 'g '5t ' ' '= ' '  'ɱ ұ 'H߱  ' %7  #$+ #+ '% #\+# #V+3 #+7 #+< 'G #?,K #9,P '[ #n,_ #d,d 'o #,s #,x ' ' #C- #9- 'T #- #- #*. #. %Բ #}.ز #k.ݲ ') 'F  #. #.)!)> # /B #/K #/O #/U)w % ' #'/ #%/ '4 #@/ #4/ % '9k*Ƴ %ӳ #/׳ #/ #/ #/ #/ #/ % #:0 #&0  #0 #0 # 1 #0& #a1* #[13 #17 #1@ #1D #1M*W %h #1l #1u #2y #2 #D2 #>2 % #t2 #`2 #2 #2 # 3 #2*ɴ* #33 #13 #B3 #@3*  % #Q3  #O3%*A*K*h #c3l #a3u #r3y #p3+*p ǵ+ѵ %* #3 #3 %* #3 #3 +  %: #3" #3+ #3/ #39$+C %JT #3X #3a #4e #4n #04r #,4w %J #W4 #E4 #4 #4 #5 #5++++ζ #85Ҷ #657+ %[ #I5 #G5E+!+++H #[5L #Y5Wi+lp +++˷ #l5Ϸ #j5ط #{5ܷ #y5+ %k #5 #5 #5 #5+& %{< #5@ #5I #5M #5R %{[ #5_ #5h #X6l #H6u #6y #6++ #6 #6,Ƹ %׸ #6۸ #6,Q,Q,# #6' #623,Gp eg,~7, % #6 #6 % #7 #7 %Ĺ,ι %߹ ##7 #7 #L7 #F7, % #v7 #r7" #7& #7/ #73 #78 %A #7E #7N #C8R #38[ #8_ #~8h,r, #8 #8, % #8 #8ƺ,--  #8  #8,-p L,-e6-o %  #8 #8 #8 #8  (û %MԻ #9ػ #9 #%9 ##9(( #69 #49# #E9' #C91(; %]L #X9P #R9Y #v9] #r9f #9j #9o %]x #9| #9 #%: #: #j: #d:((Ƽ #:ʼ #:ټ) %n #: #:)^)#^)@ #:D #:O.)dp u)2) %~ #: #: %~ǽ #:˽ #:ֽ) % #: #: #; # ;)0 ': %P #8;T #.;c #o;g #k;l 'w #;{ #; 'ړ #; #; #8< #< 'H #<ž #<Ծ #<ؾ #<ݾ 'R #P= #@= 'pB #= #= ' #= #= '# '*8 'E N 'H[8j 'w  'H0 % ' #B> #<>¿߿ #m> #k> #|> #z> #|> #z>( '$5 'tH 'U `^ 'Hk(y #> #> #> #> % #> #> % #> #> #? #> #6? #.? #c? #W? #?  #?) #?- #?6 #?: #?C %5P #@T #@] #@a #@j !t ! #%@ ##@ #>@ #<@-!) #P@ #N@)) #i@ #g@ #@" #@+ #@/ #@56T %La #@e #@n #@r #@{Z! %_ #@ #@ #@ #@b!r! #@ #@ #@ #@r!r! #@ #@( #A, #@1!T^ %ot #Ax #A #$A # A #=A #;Af % #OA #MAff  %1 #^A5 #\A> #mAB #kAKUm #|Aq #zA #A #A #A #A #A #A #A #A  %1 #A5 #A?I %Z #A^ #Ag|  % #A #A # B #B   #B #B #(B #&B  . #7B2 #5B@ #FBD #DBM #WBQ #SBV {1 K K  #nB #lB #B #~BX y  %  #B #B #B #B% #B) #B2 #B6 #B; m5w % #C #C #C #C #,C #*C #;C #9C:] % #LC #HC #kC #gC  #C #C #C #C!5BOi!!!""`." 8Pa ' 'pB ' ''^ '{5 ' 'վ$ '1 'վD 'Q 'վ` 'o 'yU 'B ' 'm ' '= '  '  'H@1 'P 'c] 'j 'w 'w '-= '= '  '7 'h '  ' ' '  'H&p5 'H 'U `^ 'Hkhz ' '  'H` ' '  'HX '  'H'P2 '? `H 'HUHz 'e  #C #C 'y #C #C ' #C #C '-= #D #D ' #=D #7D  #bD #^D ' #yD# #wD( = 'N X q #Du #Dz  ' #D #D!  %|  #D! #D* #D. #D7 #D; #D@ %| M #DQ #DZ #UE^ #IEg #Ek #Et #Ex #E #E #E #E #E #F #F% %  #MF #KF #]F #[FI I  #nF #lF #~F" #|F,e 6e S #FW #F\o x   #F #F #F #F    #F #F ! + H #FL #FU #FY #Fc m  #G #G"  %  #*G #(G #;G #9G/  %  #LG #JG #\G #ZG ;  % $ #mG( #kG1 #}G5 #{G?G I % Z #G^ #Gg #Gk #GuS  %  #G #G #G #G_  %  #G #G #G #Gy y y " #G& #G+ H R o #Hs #H| #H #H   #%H #!H   #KH #IH #ZH #XH  % ! #kH% #iH* F P % a #}He #{Hn #Hr #H|mm #H #H #H #H #H #H%/L #HP #HY #H] #Hg #I #H 33 #I #ILL/ #$I3 # IBOLOi #JIm #HIv #YIz #WIh %  #hI #fI #yI #wIu %  #I #I #I #I %0  #I #I #I #I&0 %@ A #IE #IN #IR #I\f %P w #I{ #I #I #I %`  #J # J #J #J %p  #/J #-J#-J #AJN #?JW #RJ[ #PJeo #aJ #_J #pJ #nJ #J #J #J #J** #J #J #J! #J+454R #JV #J_ #Jc #Jmmwm #J #Jc   w   /R0oRx $)9Od z&8 #K #K #K #K #%K ##K #4K #2K #EK" #AK+ #bK/ #`K6 Z s '[3 #{K #oK 'l #K #K ' #1L #)L '0 #YL #WL ' #rL #fL  ' #L #L! '=, #L0 #L5 '@ #MD # MI 'DT #LMX #DM] 'fh #zMl #vMq '| #M #M ' #M #My4 'y4y4 #M #M4[6 '*[64[6M #NQ #NVe6s3}3 #N #N #+N #)N3 %f  #QG5Q5n #OQr #MQ{ #^Q #\Q55 #mQ #kQ566 #Q #}Q  #Q  #Q6!6> #QB #QK #QO #QY6c %I t #Qx #Q #Q #Q1616 #Q #Q #Q #Q #R #Q #!R #R5656  #@R #xLV %;g #STk #OTt #tTx #nT #T #T #T #T8 ' 'T '  '- 'fF 'HsS 'He 't ' 'eh %  #T #T ' #U #U 'O 'u 'm #TU #NU #}U #mU '= #U #U '& #U* #U/ '8 % A 'S0]0v #Uz #U #U #U #U #U %  '11 #V #U #V #U #V #U '  'H&5 'B ` K 'HXg 't } 'H1 %  #V #V #/V #+V #IV #EV %  #cV #_V #V #|V  #V #V % % #V) #V21<1U # WY #Wb # Wf #Wo # Ws #W~ %  #6W #.W11 #fW #dW #fW #dW #fW #dW 2 )2)22 #vW6 #tW? #WC #WL #WP #WY #W] #Wf-2p-2 #W #W #W #WL2 %(  #W #WV2V2V2  #W #W #X #X32= %8 N #XR #X[ #8X_ #2Xd %8 m #ZXq #TXz #X~ #yX #X #X83 %S  # Y # Y #.Y #(Y #YY #WY #kY #iYY3 2+3< N1b23   H  ' 'T& '3 '3@ 'Y 'Hsf 'Hs '<( ' p '  'H ' ' 'k %  #Y #{Y '" #Y& #Y+ '|"6 #8Z: #$Z? 'TO 'Z #Z^ #Zl #Zp #Zu 'Hs #[ #[ 'H #[ #[ #\ #\ #R\ #H\ 'G` #\ #\ ' '  'H %0  '& #]* #]3-=-V #K]Z #I]c #\]g #Z]p #K]t #I]{- ' #u] #k]-- #] #] #] #] #] #]L. 'c #] #] ', `5 'HBL %C U '_` #]d #]i 't #^x #]}>/ '9 %  'l #Z^ #T^ ' %  '~ #^ #^ ' '   'H%// %V @ #^D #^M #^Q #^Z #_^ # _c %V t #7_x #3_ #Q_ #O_ #`_ #^_ #q_ #o_ #_ #_ %|  #_ #_// #_ #_ #_ #_  #_ #_/4 #_8 #_A/K/d # `h # `q # `u # `~ # ` # `/* p  .s0)E >0 Nb c x   '" '` ' #` #` 'y) #H`- #>`2 '= #{`A #q`F 'Q #`U #`Z '*e #ai #`n 'y #Ma} #?a '-= #a #a #a #a #(b #b ' #vb #rb ' '  'H ' % 'H2A 'N W 'Hds ' ` 'H '  'H '  'H  '  'H,:D % U #bY #bb #bf #bk % t #bx #b #b #b-- #b #b #b #b$$ #c #c #c #c #%c ##c #4c  #2c)(3(L #CcP #AcY #Rc] #Pchr #ac #_co8p)M}b{$8D[8l} '`@ #wc #qc #c #c ' '  'H  '   'H#2 '? @H 'HUd 'q z 'H '  'H '  'H ' @ 'H'Z<Loa k}".9A 'G3 '@ 'N 'T '  '  'H@ '  'H8 '   'H!0, '9 ` B 'HO(Z 'hXu ' '͡ '[ 'l  '[ '  '6 'E '   'HP! '. 7 'HDHP '6_ '[j #c #c '|" #c #c ' #Ed #/d '-= #d #d ' #e #d 'Wf #ae #Oe #Jf #f #g #g* #_g. #Gg3 'ɦ> #gB #gG 'MR #IhV #;hd #hh #hm '}C '  'H '  'H '  'H! '. @7 'HDS '` i 'Hvx '  'Hp '  'Hh ' @ 'H ` '( 1 'H>XHW] 'uj sqP [[ #h #h #h #h #h #h #h! #h+5R #hV #h_ #hc #hmw % #i #i #i #i #2i #0i #Ci #Ai #Ti #Ri J  %  #ci  #ai)  #si-  #qi2  %D  #iH  #iQ  #iU  #i^  #ib  #ik  #jo  #jx  #&j|  #"j  #>j  #:j  #Yj  #Uj  #tj  #rj  #j  #j  %(  #j  #j  #j  #j    #j  #j  #j  #j% ?  %8L  #jP  #jY c |  #k  #k  #k  #k  #k  #k '  # k  #k t   N Kf S    #$ #NzB$ #HzR$ #qzV$ #mz[$ 'Ff$ #zj$ #zo$ 'z$ #z~$ #z$ #z$ #z$ '$ '$ $ 'H$$ '$ $ 'H%% '% '% 'H4%C% 'P% ` Y% 'Hf%u% '% % 'H%% '% % 'H%%(% %v% #z% #z&( & %v& #z& #z&&(0& %A& #{E& #{N&(X& %e& #{i& #{r&(|&(& #%{& ##{&N)& %& #7{& #5{& %& #F{& #D{&^)& %& #U{' #S{ ' #d{ ' #b{' %' #t{' #r{(' #{,' #{5'^)?'^)X' #{\' #{e' #{i' #{q'('h'('('('( (~) (0()R()g(w()(0()()(`()() ')1 ) %) ' ) #{$) #{)) 'm4) #{8) #{=) 'FH) #{L) #{\) #|`) #|e) 's) ') ) 'H)) ') ` ) 'H))i) %) #F|) #D|)i* %* #U|* #S|$*.* %?* #i|C* #e|L*V* %c* #|g* #|p*$z*$* #|* #|*o*o* #|* #|* #|* #|** %2+ #|+ #| + #|+ #|+~/+ED+`+W+j++++++,1, '%M9, % D, 'O, #}S, #|c, #>}g, #6}l, 'c|, 'h, #v}, #j}, ', #}, #}, #~, #~, '$, 't, '$, 't,8- % - #0~- #.~#-8-- % :- #?~>- #=~I-(8S- % d- #Q~h- #O~r-H8|- % - #d~- #^~- #~- #~-T8-h8- % - #~- #~-8- % . #~. #~. #~. #~.81.*9;.*9X. #~\. #~e. #~i. #~s.L9}.L9. #~. #~. #. #.U9.U9. #. #.X9. % / #+/ ##/ % / #W / #U)/ #h-/ #f6/a9@/ % Q/ #U/ #wZ/ % g/ #k/ #t/ #x/ #/9/ %; / #/ #/ #/ #/ %; / #'/ #%/ #6/ #4/9/9/ #E/ #C0 #T 0 #R0909<0 #c@0 #aI0 #tM0 #rW09a09~0 #0 #0 #0 #09090 #0 #0:0 %U 0 #ɀ0 #ǀ0 #؀0 #ր1 # 1 #1 #1 #1 :<1Y:F1 %e W1 #[1 # d1 #,h1 #&q1 #Wu1 #U~1 #f1 #d1h:1:1:1 #u1 #s1 #1 #1:1 %x 2 #2 #2 #2 #2 #!2 #*2 #ȁ.2 #Ɓ32:R2S;\2 % m2 #ׁq2 #Ձz2 #~2 #2 #2 #2 # 2 # 2X;2;2;2 #2 #2 #+2 #)2 #;3 #9 3;3;03 #J43 #H=3 #YA3 #WK3;U3;r3 #hv3 #f3 #x3 #v3;3 % 3 #3 #3 #3 #3;3;3 #3 #3 #3 #4 #˂4 #ɂ 4 #4 #ق4 #,4 #&'4 #O+4 #I44;>4;[4 #k_4 #id4;4;4;4 #}4 #{4 #4 #4<44)<4 % 5 # 5 #5 #5 #!5 #߃%5 #݃.5 #25 #75S<O5o<Y5o<v5 #z5 #5 #5 #5o<5o<5 # 5 #5 #25 #05E=5 % 5 #F5 #@5 #m5 #g6 #6 # 6 % 6 #6 #'6 #ۄ+6 #τ46 #86 #A6 #-E6 #%N6E=X6E=u6 #Zy6 #X6 #l6 #j6L=6 % 6 #}6 #y6 #6 #6 #6 #6 % 6 #ޅ6 #ԅ6 #6 #6 #F6 #@6\=7\=%7 #b)7 #`27 #s67 #q<7X=S7=d77=7 % 7 #7 #7 #7 #7 % 7 #7 #7 #Ά7 #ʆ7=7 % 7 #7 #7 % 7 #8 # 8=8~088J8>T8>q8 #u8 #~8 #(8 #&8 #88 #68 #G8 #E8>8>8 #V8 #T8 #e8 #c8z989 9:9:$9:<9;I9;V9z;c9;p9;}9)<99 9e99 99x: :!:86:<@: % Q: #xU: #r_:<i: %s: #w: #:<: %): #‡: #: %): #: #:<:<:<: #: #: # ; # ;<;<,;<9;<F; =^;=v;=>;08;`8;h8;p8;8;8<^%<8C<8e<mu<8<8<y<9<9<H9=G>= '.= %'= '2= #*6= #E= #I= #Y= #]= #b= 'hm= #q= #= #5= #= '= '= = '= #= #= '= '=\= '=*= '=],= %> '> 'վ > #Ӊ$> #ʼn->W7> %D> #H> #Q> ##U> #!^>Wh> %u> #5y> #3> #G> #E> %>W>W> #Y> #W> #k> #i>X? '? ? 'H&?5? 'B? @K? 'HX?b? %k? 'ux? ?X?0? ?Y? 'u? ?"Y?S@  @FY!@ 'u.@ 7@`YO@l\@ g@ %&p@ '{@ #@ #y@Y@Y@ #̊@ #ʊ@ #݊@ #ۊ@ #̊@ #ʊ@ %L@ 'u@*Z@*Z A #A #A*Z/A1ZGA 'TA ]A 'HjAyA 'A A 'HAA 'A A 'HAAXAXB #B #B %BY.BJ;B KB"YUB"YrB #vB #B %BFYBJB B`YB`YB #"B # B %BY CJC )CY3C %<DC #4HC #2QCYfCY|CZC %_C #CC #ACZC#ZCpZC %oC #C #PC #C #D #D #b D %oD #D ##D]2DW[P/LP 'YP bP 'HoP(~P 'P P 'HP P %P 'n"P #P #P 'P P 'HPP Q %Q #Q #&Q 0Q %=Q #AQ #JQbTQbmQ #˙qQ #əyQ) Q> QW Qj Qa R/R0R '=R @FR 'HSRbR 'oR xR 'HRR& R& R< R< R S S ;SES ]S=uSES`SSSSSHS ' T ' wT 'V%T 'U2T 'eHT 'GRTiT '2wT '9T #ݙT #ۙTT '6T #T #T@T '6T #T #T '~U 'OU '+W(U '|5U 'zBU 'LU VU 'cU lU 'HyU0U 'H[U '.TU 'U 'lU %U 'hU #*U # U #nU #dU '%V # V #V #V ##V '.V #>2V #0@V #DV #IV '`V #ٛdV #˛iV'V #V #V'V 'FV #(V #&V'V'V #7V #5V #FV #DV'#W&-W&JW #UNW #SWW #e[W #ceW&oW&W #vW #tW #W #W&W %W #W #W #W #W #ʜW #ĜW %W #W #W #]W #MX # X #X&X&^ 'I^ #M^ #Y^]g^ '$t^ 't^^ %u^ #^ #^9^ %^ #ѡ^ #ϡ^ #^ #ޡ^9^9_ # _ #_ #_ # _ # $_ # -_97_9S_ #W_ #`_ #+d_ #)m_ #:q_ #8z_ #K~_ #G_G_V_]_ %_ #h_ #`_ #_ #_r `` '%`<` 'hG` #K` #j` #̢n` #Ȣs` 'i~` #` #` '#` #` #` '|` #` #`5`5` #` #` #&` #$` 'a` 'h a 'i-a '#:a '|Ha 'gRa@"ia 'hta #<xa #6a #aa #[a #a #a 'a #a #a '|a #a #a '$a 'ta"b '# b #ãb #b"*b '65b #ڣ9b #أCb"Mb %8Zb #^b #gb"qb"b #b #b"b"b #b #b #b #b"b"b" c #/c #-c #>c #<'c"@cl"Jc %[c #M_c #Kic"sc %(c #_c #]c"c"c"c #qc #oc #c #c#cw"d ' d 'h-d 'RLd '6[d '6kd 'uwdd 'Rd #d #d 'hd #d #d #ݤd #ۤd % d '6d #d #d\d '6e #e #e 'ie 'h)e ';e 'hHe 'VWe 'F]ePte 'he # e #e 'ee 'he 'e '{e 'he '-e %_e 'mf #*f #" f 'Mf #mf #ef 'ˊ)f #-f #2f 'h=f #Af #Ff %uOfYf %ff #3jf #-sf #[wf #Sf %f #f #f #f #ff %f #$f #f #Jf #Df %f #vf #pf #f #gg0gEgZgoggggggg h0hEhZhohhhhhhhii6iNi '5Xi %Hni #ri #§i #i #pi '[i #5i #i 'i #i #i ')i #i #i 'i 'wmi #!i # i 'iFi %_j 'j #j #zj ':#j #'j #,j 'qg7j #,;j #&@j 'Kj #UOj #OTj '<_j #~cj #xhj %qj '|j #j #j 'mj #Ыj #ʫjy#j 'Kjy#j 'j 'j '6gj '/k 'Ck '&ky#0ky#Ik # Mk #Vk #9Zk #7ck #9gk #7pk #Jtk #H}k #9k #7k #[k #Yk 'k k 'Hk@k#k %k #{k #ik #լk #Ǭl #l # l %l #bl #Z l #$l #-l #ǭ1l #:l #>l #Gl # Kl #Tl #BXl #:al #el #qnl %{l #l #l$l %l # l #l #?l #9l %l #nl #fl #l #l #l #l #=l #5l #pl #hm # m #m&m 0mEmVm km ~m m m mp m m8 m m m n n .n An{ Vnh `n un0 n nnInXn~%n~%n #n #n #o # o #(o #$o%#o %4o #>8o #<Ao #UEo #SNo #dRo #bWo %`o #sdo #qmo #qo #zo #~o #o%o%o #o #o #o #o%o&o #˱o #ɱp$pc%1pBp Tp '0^p %tp #xp #ٱ}p 'op #.p #p #p #ppp #вp #βp #p #pq %q #q # q %)q #?-q #+6q #:q #Cq ##Gq #Pq #gTq #_]qAkq q #q #q %q %q #q #q9qqr2#r0r FrHPrHmr #ٴqr #״zr #~r #r\r %r #r #r #Mr #?r %r #r #r #ߵr #ӵr #.r #r #r #r #r #s # s #s #js #V!s.s %,;s #ҷ?s #HsRs %Uhs #+ls #!us #`ys #Z~s %Us #s #s #s #߸s #As #5ss %ys %svstht1't7tHt^tht %~t #t #{t %t #ӹt #ùttHtt %t #_t #St %t #t #t #ߺt #Ѻuu,u6uSu #QWu #O`u #`du #^nuxu %u #tu #pu %u #u #u #u #uu %u #һu #λu #u #u %u #u #v #.v #*v #J!v #F*v #d.v #`3vQv_vvvSvv Pv v 'Hw '|#w 'h0w 't=w 'Jw 'Ww 'aw Pww 'w 'w w 'HwHw 'Ox '|x 'h"x ',x >x 'Kx `Tx 'HaxPmx 'ux %x 'Xx #x #zx #x #x 'Vx #}x #qx #x #x 'x #ͽx #Žx #x #x #y # yVy '"y +y %4y '6?y #<Cy #$Ny '[y dy 'Hqy{y %dy #y #y`'y`'y #Ҿy #оy]'y@yzq'z '%z `.z 'H;zJz 'Wz `z 'Hmzx|z 'z z 'Hzpz 'z z 'Hzhz 'z `z 'H{`{ '{ ({ 'H5{XD{ '$Q{ 'tc{Um{U{ #{ #߾{ #{ #{ #{ #{ #<{ #:{U{U{ #K{ #I{ #Z{ #X{V|V$| #i(| #g2|/V<| %M| #Q| #}_| #c| #h|EV|EV| %| #| #|nV|W|wV| %| #ÿ| #| %} #} #ڿ.} #2} #;}qWH}lWU} %b} #.f} #*o}Vy}V} #K} #I} #K} #I} #K} #I} %} #^} #Z}V}V} #y} #w~ #y ~ #w~ #y~ #w!~V+~ %(<~ #@~ #I~ #M~ #V~ #Z~ #c~ #g~ #l~W~lW~ %;~ #~ #~ #:~ #6~ #t~ #p~ #~ #~qW~WV2:WR#'\ %Tm #q #{ ( ( # # # # # # # #(( # # #  # V)#'>Q \'i'~0'p '݀ ( >($4n(B '8M@o #"s # #= #9 ' #V #T_ 'S{ 'T '| '# '2 'F 'X 'Me 'hs ''u '6Ƃ '6Ԃ 'A ' 's 'm_ ' 's  '8&AKh #el #cv--@SɃӃa '`i 'h" #z& #r+ '9 'F O 'H\k 'x ` 'H %B # #Ą #Ȅ #҄܄ .BQbv3=&v?ԅޅ0#F  ' ', 'm9 'F 'JS 'K` 'N{ '̑ ' '| '5† '̑φ '| ' '  ' '% 'V3 'E 'S 'e 's 'k( 'l ' 'lȇ 'Uه 'l ' ' ' 'dT) '5 'B 'D_ 'k 'w ' '  'V 'و 'n '  'ڀ* ';7 '(I '̑V 'd 'iv '̑ ' ' ' '̑ '-#͉ ',؉ ' ' 'ܿ '# '֥0 ' I> 'ڃL 'XY 'cg '% '  '6 'uȊ ӊ 'P ' ' '$  't 'O* '8 '/$O ';e ' ' 'oF 'K&݋ '̑ '  ' ' ' '6 'E 'U 'e 'Eu ' ' 'U 'b '̑ 'ʌ '׌ ' 'd 'l  '7 'J! ' 0 'h? 'S 'c 's ' ': ' ' 'e '~͍ '܍ ' ' '  ' '?( 'X5 'qG '̑T 'a 's 'i '\ 'u ' ' 'ώ 'ߎ ' ' ' 'kO0 '= '$eO '^ 'm '| ' ' '1 'I 'aˏ '׏ ' '  ' '& '3 'A@ 'M 'cZ '$el '{ 'K ' ' ' '̐ 'ܐ ' '* 'B  'Z 'SO' 'L6 'dE '|U '{Oe 'u ' 'S 'z 'Ƒ '̑ӑ ' '  ',N ':' 'w; 'tEJ 'Y 'h 'xw ' H '  '$ '< 'TÒ 'lВ ' '  '  '* '9 '5H 'MX 'h 'x ' ' '\E ' 'ɓ 'Փ 'A ',N  ': 'w* ':8 'F ' T 'n=b '2q '= '  'A 'M  '  '[Ӕ '& 'l 'l ' '" 'l0 'x= 'J 'W 'd 'ڽq '} ' ' 'f+ 'l 'ӕ 'l ';F ' ' 'Պ ']- 'F 'R '` '} ' ' '& ' 'ʖ 'ȪՖ '}ޖ ' '̑ ' '̑' 'H4 'xO '̑` # #З #ԗ # # # #) #' #8 #6  #I #E#< #`@ #^I #oM #mX # # # # #Ę #͘ #ј #ܘ0  # # # #l  %N- #1 #: #> #Hq g  #( #$ #C #?  %a #^ #Z #{ę #uə   # # ! : #> #JP e #i #|`  % # # % #  #  # # %̚ #+К #)ښ  #: #8  #K #G( #f, #b5 #9 #}G Q m #q #z #~ # # #  # # % ʛ #Λ #՛  % #  # #2 #(  * %3; #h? #bH #L #U _ %Hl #p #y #} # %] # #  #; #5  %r #gĜ #a͜ #ќ #ڜ #ޜ # %r # # # # #C  #= #i #c  #$ #- #1 #: D a #e #n #r #w % # # # # #C #A Ý ͝  #R #P #f #d #z #t   0 #4 #= #A #F %O #S #\ #` #sǞܞ 4I[|  #  #ʟ #OΟ #Cן % # # # #?8`S #W #` #d #}: # #PȠ9C`a{h #> #4 #oá #g̡ #С #١ # #  # # # #'@ #D #Ng #k #q΢ # Ң #ۢ #/ߢ #+ #V #F # # # # = #A #Fbl # # ``ã # ǣ #ңI\ %& #;* #/3 #|7 #v@ #D #M #Q #Z #^ #g #9k #-t #x # # # # #äͤ %ޤ # # # # % # #  # #! %. #62 #27 %@ #ND #JQ[x #i| #g*ե8  #$ #y- #1 #: #> #Da`>| # # # #{>ʦ %9ަ>> #( #& #( #& #( #&&>Z>i 'fm 'fs 'w '~ "  ' (  (  & '%(ȧ '3ԧ 'ާ 'C 'c 'D '   ' ':[ 'E* 'C/ 'd G 'FS 'Z a 'lf 'Ht '7Xܨ 'A 'd 'CD 'k  'B '31 'R+ 'Yb7 '1C '+O 'HZ[ 'g 'fz '? 'i '/8 'V ' '0M 'u*© 'ZΩ ' 'X '  'Rk 'Q  '( ' g" 'cN. 'a: 'cF 'wR '9^ '3j ' 'V '[ 'V ' j '='ɪ 'K֪ 'a '  '3T ' 'K 'JRF 'uS 'K` ' 'h '9 ', 'n*ɫ '4h׫ ' 'n* '4h '# '=+ 'F9 'G 'U '|Wc '//q 'Sm 'K '~l 'j 'OT ':Ŭ '{)Ӭ 'b  'D+ 'D 'C  '+ ') ' 7 '=E 'KS '5Ga 'eTo 'hJ} 'V  '4 'd ' '?í 'c '1J 'Q 'V(  'C ')Q+ 'E: '6YI '=NX 'Ag '# '6 '4 '& 'k® ',UѮ 'a 'N ' '  '*8 '^<+ '; : 'I 'X '"$g 'pav 'e '~- 'F 'k '> '[Я 'ZU߯ 'M '` '  'm 'YO* '&9 'H 'IW 'f 'u '~! '- ' '8e '$S '^ϰ 'ް 'A ' @ '<6  'I_ ' * 'V56 '^l ''e 'M ' b '"̱ '` '  'yR$ '^Q ''e^ '2% '8D '\ d ';q '~ 'k6 'q6 '"ͳ '  'w6 '( '-F4 'B 'Q 'uw 'E '* '\  ' 'IԴ '" 'S 'K ' ', 'O3 '6= '0J 'c^ 'HH{ '8B 'C ':. '~V 'Qj͵ '[۵ '" ' 'K '^i '+T# '61 'h? 'dM '\ [ 'si '._w 'Y ' 'a 'K 'Z 'Xk˶ ')Oٶ '"c ') 'P 'j< 'LK 'Z 'mj ';Gy ' '2 'G 'O2 ' ŷ '80Է 'S, '`7 'Dd 'E ' '*. '7= 'dL ':E[ ''j 'y '/ '% 'l '  'ĸ 'Ӹ 'cc '> 'n  'J 'M 'O9- 'F< '/K 'K=Z 'i '4cx 'Q 'H 'e 'Rù '>ҹ 'Gl '7$ 'Xj '? ' 'b, 'i< '.HL 'u\\ 'l '<| '8J 'se 'V_ '\ '_)̺ '\ܺ 'U ' '(  ' ', '< 'lK '"Mi 'G'x '  ' '5 'J 'û ' Nһ 'F 'Z 'Q '. 'S 'K, '; ' J '@Y '8h 'Hw ', ' * 'G ' '=¼ ',Ѽ ' 'I 'X 'M  '  'VC, '^; 'BJ 'Y 'Uh '0w 'f 'Rl 'l ' '.н '߽ ' 'T '  'a '2* ''N9 'vSH 'lW 'i!f 'S#u ' 'wk '_ '% '" 'fϾ ']޾ 'Z '>> 'wJ  'g ' ) '8 '*G '\LV '!He ' t '% ' 'K( '  ' ' ο ';ݿ 'H 'Ym 'R  'DA 'Da( '?7 '?F '9U '!d '4s ' ']Q ']- 'Kh 'P ':= '"A 'yG 'I 't  'K` 'k0' 'WM6 ' 9E '?T ' c ')Er ' 'jX 'T '< 'V '] 'h% 'S  '6 'nY  ': '"' '1`6 'J&E 'T '5c '4&r 'O 'T 'g '$ 'aK '|j 'A 'E 's! '9  'g '9' 'f6 'Q7E ']T 'Qc 'r ' ' '* 'O 'D- '  'X 'T6 'A) ' '' '_& 'HU5 ';T '9c '>Mr 'hE ' '6 'n` 'm 'E ' 'i ', 'cY '& '^' '7 'VG 'p^W 'f '=u ' ') '9 'F 'U 'Im 'LF  '6 '8' '+L5 'DTC 'Q '~%m '.Y{ '7S '3 'g 'G ' '_ '4- 'TF '4 '*3' '-= 'V:W 'bl '-z ' 'h '? 'W) 'g7 'Q 'j '=% 'W% '@  'o3 'NX) '^7 'pUE ' _S 'k 'x 'l ' - 'SK '' 'K '_M '%' '9 'OL 'Z 'Mf 'Gs 'g ' 'x? 'Q ', '7 'F '  'D 'O '06 '"  '" '\ % 'bG3 'L;O '] 'Y^k 'y 'F  ' 'k '/ '! '1 'h ' '` 'U8 ' '\ 4 'RE 'WK '$Q 'yIW 'U3^ 'hGk ' '+& 'S ':5 ' '  'ca ' 'N ' '.2 'A? '\ f '"y 'c 'Sm 'P 'iO ' '  '[ '$# 'D% 'i '  ';&! 'Q/ '1= 'jK 'pHY 'Vg 'u '3 'D '1 ': '0g 'b 'z= 'g2 'd '` '/ '5 ')k+ 'w]9 '*G '9!\ ' i '/v '  ' '\  ' 'F '" 'j 'm 'z  'a: '4 '8E '<Q ']^ '=k 'xx 'J '> '8 'H 'G '5_- '2C: 'd 'M" ' 'kH ': U 'm9b '2Co '(m| 'eS '8 '2C' '`4 '_A 'z7N '6g '"t '! 'j  ') 'G ') '9 'U 'Yd  ' '9 'I 'NV 'W/d 'q '3 ' B ' l 'mA '@ 'G '_# ' '\ '# 'M3 'C '4Q '$2_ 'Um '^^ 'YP 'jd ' l ' 'X- ' . '.^ '}4 ' 'mAR 'W '3a ';n '{ ' '~/ '3T '}& 'K '= 'O 'w 'V"0 ' 3A '4fG '=M '5] 'w '\  'C 'a ' '$ '< 'i? 'n* '4h 'a '". 'E 'u.R '6`_ 'sTl 'n*y '4h 'd& '9@ '"K '  '"M 'l '^i '\  '/, 'dG 'l X '0^ 'd 'Wj 'p '?w '-| ' X '" '*B 'Y ' '% 'SK 'U '- ' '7$ '0 'E= 'SmJ 'd 'Ir '4 '"c '[ ' '@ '3 '@ 'Y 'R '@ 'k  'R 'Ri$ '91 'G)? 'M 'zBZ 'Rh '(y '(. 'e 'I 'G) '! 'h ' ' ' A ' '8 'U+# '0 ' = 'aW '5d '/]q 'g~ '9 'b 'eg ' 'h '\  'f 'j 'c 'Q '90 '*3N 'TZ 'zmg 'Ju '% '{2 'h 'D 'f '  ' 'a '~5 'M* 'uF; 'E4G '1X ';`e '`Xq 'IQ~ 'z" 'W '-C 'v' ' 'yf ' 'W '-C 'yf& 'W3 '-C@ 'M 'Z '^q 'H#~ ''Y 'kC ' ' 'K '> ''[ 'R '  'V* 'j8' 'F= ' cZ '7~ '% '- ' R '$ 'c '  '9 '7 '1  ' 'c '+ 'K8 ' "F 'Z '/f 'z:p 'AF} '  ' ', '$ '[ 'dj 'n, 'U; 'J '] '9( 'L6 'hC '4Q '3^ '*k '9x 'mA '  '6 '  '[ '6g 'B 'P* 'L 'QM 'G  '3 'Kf$ 'J1 's)> 'jL ' Y '6f 'Es '` 'VC '(F 'E '@ '1` '  'S '& '\  ' '4&? 'L 'Z ' f '/s ' 'X 'J ' ' ' 'D 'L\ 'k ''_* ' *8 '8F 'HT 'Dc 't ' ' 8 ' d  ')O 'S) 'e<7 '8E 'A$S '4a ' o 'h+} '- 'c! '> 'f '5 '&C 'N '  '&C  '9 'F( '.6 '=D '6)R ')O` '_n ' 'B 'V '@ ' 'x+ 'TD ' 'PI  'D 'H' '\ 5 'iE ')U ''e '0u 'L 'k 'G '% 'W ' '# 'd '  '(5 'qC 'HP 'Hi] '/]j '6 '2 '! ' 'gm '  'f 'K ';  ' '7= 'OG '\U 'c '3q '}` 'Bh '4a 'T 'N ' '_B '> '\  'u  '{0  '\ 'r_' 'TG 'T 'F a 'Dn ' 'Q 'S '9T ' ' 'HW ''U  ' 'd@ 'YM '(iZ '"Ug 'et 'E '&% '! '63 '/ '4 '6 'i '  'O '^/ '8 'r 'm* 'h7 '#TD 'z:Q 'C^| 'd 'pJ ' 'h 'm 'S 'X-  'K 'A% '2 '\ K 'P_ 'fi 'as '#} 'ik 'T 'f 'P '+ '< '() '  '_ '$6 '= ' 'H! 'p1. '; 'cH '\ U 'oBb 'q ': 'xA '] ' 'BP 'j '|  '  '[] ' 'vi 'a0 '<> '2L '8Z 'Hh 'bv 'C ', 'V ' * '= ', 'f ' 'X 'M '  'G ', ': 'AH ';V 'iHd 'I7r '; ', 'j ' '  '^ 'H 'V '  '# 'h  'qP '). 'M ; 'dH 'U '1b 'Zu '_ 'Qe '  'A ' 'K( '. '8^ '/3 'D 'B '1" 'R '`W" ' 1 '<; 'E '^'S ' a 'lo 'n/ 'B ' 'k0 'S  ' ! '= ' ' ' '12 ', 'f9 '(M '+Z ' g 'p=t '`% 'r< 'rZ 'pj 'i '9 'S '( '@ '  'S4 'K[ '/ 'j ! '|<. '&; 'gH '&U 'Xb 'L$o '5| '  'N 'R 's@ 'Pg ' 'ji '"c 'I '\ '}e 'L* '6b7 '=Q 'a:^ 'A,k '#fx 'g '{d '' 'F 'N '  'O 'A  '+ 'B 'H@, 'j9 '?F ' S '` 'L 'U 'mA '5 '# 'V 'D 'a 'f  'D '# 'G0 'gh= ' J '0W '0u ' 'D '2 '}6 'k ' W '4 '  '. 'YZ 'u[ 'S ' ( '5<; 'AH '*[ '!h 'u 'Sm ' 'I ', ' 'D '7 '0 'h( 'D '{* './ 'g< 'jiI 'egV 'd '=q '(F~ '3 'g 'Yh '2 'O8 ' '= '\ @ 'NN 'Z[ ' h '!hu 'D 'f_ '$D ' 'D. ' '(F '# 'D[ '\* 'J 7 'DD ' iQ '1d^ 'k '\x 'm@ '> 'h 'R] ' 'GG 'af 'G) 'F  '1 '  'D- 'A: 'QG '$DT 'a 'jn 'J0{ 'i '$ 'K '` 'Z 'T '! '2 'H ' '(F 'ZF7 'M ''Y 'Oo '| 'bP 'i 'c 'bP ' L 'bP 'PR '^ '<  'X4 'KcC '$P '7 ] 'H5j 'T?x '3 '( ' ' '  ' 'X 'S 'F 'i 'Ig ' 'R] '+ '+ '+! '.9 'G 'i 'tv 'Ig ' 'h 'jb 'ak '0; 'K 'k$ 'k 'O, '!9 'TG 'TQ '^ 'Dk 'x '  '&7 '2 '^ '# '\  'D '  'N^ 'zU 'L 'd, '|6 'N^C 'jiP 'mAj 'Aw ' '  'A 'Ck 'T 'Q ' ) 'M 'xE 'Z 'iQ '^D '=K  '- ' E 'jZ 'mSg '\ ' a '. '  '8M 'e@ '7j '1= '^,) 'w6 '_D '#W 'Abn ' { '^ '1 'u '6 ': ': 'mS '\R '7j_ '&w '\  'e@ '  ': ' 'I '* '[ 'z '_* ' 8 'IVF ','T ' r 'cF '[ ' '" '}X '7 '+ '< 'H  'D)  'lF8  'Y\  'omn  'Y^|  '   '(]  '  '   '  'U  'e  'e  'G  'U1  'H  'rA*  '8  '[F  '^T  ',b  'U}  '  'n5  'X  '   '=  'B`  'D  '  '  '   '$  '%2  '9K  ')IY  'Sw  '  '\T  ' &  'J  'j  '=  '4&  'a%  '?  'hX  ' f  'lft  'sf  '  'A(  '   'O  '   'b  '"  'cV  '+"  ';C0  'E>  'L  'nZ  'h  'Gjv  ' 7  'N  'K  'j  '=  '+b  '  'Y  'H  '\  ' ' % 'a64 'L'C '4NR '8a ''p '  'd ', ' 'a '] 'm ' '% '? 'c$ ']3 '\ B 'XQ '_` 'Smo '#T~ 'z. '+ 'f 'V\ '  'BJ 'Qa '! '~  '1 'b# 'Z2 '+A 'mWP '' '6 '@ ' ' '! 'L 'rL 'p;  'u0 '`$ '@Z7 'cD '`Q '@Zm '4y 'c 'f 'J '4 '+ '=4 'V '4 'k '> 'Y+ 'B '] '<i '#u 'j] '] 'ME 'h '6 ':I 'D 'i 'd ' '7j 'i$ 'LC '3P '3T^ 'KNk 'Kx 'JR 'D ' '% 'v- '/ '\" 'A5 '=Q '`] 'Dy '4 'i '*W 'L< ' ' ' '0 '`. ' 'W '7/ '0  'S- ': 'FN '[ ' 'x  'T 'SQ '- '> '  '0: 'WR ' '0  '{ '2) ' = '7>K 'q+Y '\g 'Ru 'd 'a  'K ' '$  'Y. 'm 'vH 'J/ '9 '{ 'i 'B+ '6U9 'G 'KU 'c '[q '" 'K ' 'TJ 'h 'E 'K% '7P 'le 'Y '  '[ ' '2I# 'ZY1 '0? '5M 'J[ 'Yi 'kw '/# 'jL 'k 'B* ' 'C '  '5 'U 'F '6 'J  'S/ '> '2LM 'J\ 'YNl '/@{ 'I '] ' 'S '[0 'lV ' 'eR '. 'a 'W  '/ '> '(M ' \ '+k 'z ':# '  'L  'qV '% 'M  '4Z 'N  'M 'c! '{'0 'NE 'n7V '2\ '@2 '? 'L '!Y 'gPf 'C? '$ 'L< '^9 'Bh ';* '.7 'sfE ')R '^_ '_ l 'Ry '{K '\  '. 'HW 'U '  '- '= '\"  '-=  ' QJ  'G)W  ' d  'WEq  '&  'D  '   '_  'D  '  '_  '2$N! 'IZ! 'k! '! ']" 'P" 'F-" 'd:" 'Q" ''g^" '" 'N" '/" '"" ':" '^ " ' 6" '`" '6" 'ji# 'PU# '7lb# '%|# '9F# 'a=# 'Q# '%# ']# '/# 'Q# '"# ': $ '^ !$ '\=$ '/7K$ 'Cd$ '0w$ '_$ '.$ 'O$ ')$ 'B$ '4$ '2$ 'e$ 'Y$ '% 'W% 'C^ % 'd-% '+_% 'B% 'P% 'D% 'm% '$% 'k% '8*% ':% '% ' & '-j& 'o"%& ':k2& '7?& '>L& 'NY& '&f& ':s& 'M& 'I& '`& '\& '& '& '_& ' & 'gM& '.A& 'K>& 'd' '4' 'G!' '$.' ';' 'eH' '0U' 'LCc' 'S<p' '}' ' ' '5' '8' 'H' '4' '' '' '' 'P' 'K( 'oB( '<"( '4/( 'b( ' l( '<( 't ( 'H( '$( 'P( '4%( 'C( '.l( 'F3( 'P( 'p) 'l) ',) '!9) 'y(G) ') '|^) '_) 'C) 'QA) 'pR) ',) '-  * '\ .* 'v,=* 'C?^* '+* ';* '[I* 'E* '=* '"* 'j* 'G* '@<* 'c* '~* '.* 'RS+ 'BS+ 'V + '@]+ 'a+ 'h)+ ' @7+ '"C+ 'LT+ 'Z+ 'J:`+ ' g+ 't+ 'hJ+ 'M+ '6'+ 'ZV+ 'Y+ 'J+ 'Ob+ '], ', '+`, '\(, 'RA, '0*N, 'XK\, 'F9j, 'Tx, 'XX, ', 'e, '.,, 'Z, 'k, 'm, '7D, 'Y, 'G  - '- ';&- 'pI4- 'M?C- 'yhf- '^}- 'll- ')- ')- ',>- '/e- '\- 'YG- '- 'GO- 'G. '". '*9. '). 'l6. 'BC. '[JP. 'F]. '8j. 'Cw. '?V. '6]. '.. '). 'h. ',. '7,. '` . '0. '`. '/ '?/ 'iK#/ ':1/ '&?/ 'EM/ 'bl/ 'gr/ ',Xx/ 'L)~/ 'aA/ '97/ '0/ 'G/ ' / '9/ '7/ 'P/ 'a;/ 'vc/ '+/ 'eI/ '|O0 '{0 'r0 'T@0 ')0 '0 '0 '0 'K0 'e0 'G0 '[`0 'i0 '@ 1 '1 '/1 '?c1 '(1 '1 '1 'E1 'Y=1 'MP 2 '^d2 '>%2 'b32 '<A2 '@ O2 '~]2 '=k2 '5y2 '22 ']2 '\ 2 '2 'b2 ',K2 'C2 '32 '#3 'a3 'N#3 ':13 'Q?3 '@^3 ',fl3 '=mz3 ' 3 '(3 'a3 'b3 '`3 'O3 '33 ''Z3 '43 '$,4 'M4 'z#4 'Z14 'a?4 '7M4 '!@[4 'Li4 'bw4 'WN5 ';\5 '\ j5 ' x5 '5 '!5 '0W5 '<5 ',6 ':6 ',H6 '"jV6 '2d6 'Pr6 'E6 'PL6 '@ 6 '`6 'T6 'j6 'W6 '0\6 'u86 '66 'IB 7 ':7 '.(7 ''G67 ')D7 ',%q7 '=27 '!1i9 ' 9 'HL9 '<9 '9 '\9 '$: 'nh5: 'xB: 'uO: 'Y\: 'Fj: 'Nt: '/~: ' : 'N3: ': ': '\8: '': '$`: ': '$: 'V ; 'N; 'Q'; '15; 'ybC; 'Q; ',c_; 'Ym; '!{; 'r%; '1; '; 'c; ' ; '; 'b; '; 'e< 'd < '< '< '(< '(-6< 'Y^D< 'D`< 'l |< '"U< 'U< 'O< '&< 'mA< 'R< '5< '7< 'J= '2m= 'K+= 'l9= '@LF= '!S= '/k= 'U= 'l= '= '*= ''a= 'h= 'b= '\= ' = '= ' > 'V2> '-!> '\/> 'nh=> '#K> 'Y> 'NOg> '5u> 'e> 'c> 'M> 'd5> 'U> 'O> '_> 'ae> ' > '9? '88? '? 'EI+? '"9? '&G? 'U? '49c? 'kgq? 'd? 'W? '? 'MW? 'U? 'R? 'G? '& ? '@ '11@ ''p@ ''~@ '*@ 'S*A 'VfA '\8B 'n>B 'T )C 'ZcC 'BE ':"F '#XF 'kNF 'pO'G 'M8G 'X>G 'DG '8iG 'eH '/OH ';I '^'I '=4I 'egAI '5NI 'P+[I 'p-tI ' I ''!I ' I 'I '*I 'ZI 'LYI 'J!I ']-I 'K J '=J 'T$J '{0J ']?L 'j(L 'V6L '_(DL '7RL 'Y`L 'DnL '|L '.VL 'JL ' L ' L '1L 'iOL ' dL 'VM ' M 'g\M 'D16M 'Y^CM 'ZcPM ''c^M 'ElM 'DzM ' ;M ' M ':OM '.VM '/M 'M '=%N 'GN ' GN '2N 'W '\1W '3W 'W ',W 'G)W '-W 'CW 'PW ':W 'ZlX 'eX '= X '.X 'uX ')< X '>;.X 'TPT_To)U)UJUJUPUPUNUPU ?i???4?@i@D?r?5?6?E?W ?q ?? ? ?Y????? ??/J@>J@NP@]U@nN@zP@P@@@@sA sACB.CBI k         %  9  P      G s   H H P PI Pu P P  <  f   ~ M 4 ^ x   VJCCRlD5EC D85G*DYDHEC2CE_;EOCCC8BaCCC9CaGaGUCUC iCiC+oC:tCKmCWoChoCwDDD(EE E,E,E3G3G%F7FFFUFeFvFFFG!j@0Y0j00pO#PJPhO|P_RP P#P2PAPSPfPPPPQQR6=QfQQQQRRR$R:RcRRRRRR%R7@RT@Re@Rt@RRRRRKK,K^NK`KLEL NK`K,AL<ALLAL]ALmAL}ALALALELELELELELELEL JL0JL@JLQJLaJLqJLJLJLOLOLOLOLOLOLOLK5KlKK`L`L`L`L I/ IV I} J I I MJ MJ!MJ&!MJ:!JW!Jv!J!J!G!G!G!"GZ"Hr"G"G"G"G"H"H"H"H"H #H#H,#H>#8H]#8H#8H#8H#I#I$I$I+$LY$L$L$IM$QN$N%cM(%cM8%NM%Nj%Nz%N%N%N%N%M%M&M6&MJ&Nd&N~&N&N&N&N&N'N'N3')OP')Oo')O~')O' 's'v(s.(v?(U(4d(s((((((pB))pB3)H)_)})pB)))pB *R*4n*B*B***`*`*f*f*d+f%+(J+ ]+(t+ +(!, @,(V, o,(, ,("- D-(u- -(. +..)]. ~.).) /)/)(/)A/)/k*/ /k*/k*0 ;0k*0k*0 1*M1 b1k*~1 1k*1 19,1 1* 2*E2*u2*2* 3*43*C3*R3*d3*s3*3+3+3+3 +3 +3$+4$+14$+X4$+4$+5$+95++J57+\5+m5+|5+5+5+5+5+5+Y6+6+6+6,6Q,67,79,7t,$7,97 M7,d7 w7,7,7,7,D8,8,8,8,8-86-8 86-9 9(&9(79(F9(Y9(w9(9(9(&:(k:(:(:):^):2):4):):); ;) ; 9; ^;p;;;;<9<v<<<=5Q===6==U->C>n>}>>>>>)? 7?!d??t??@ !@0!&@ !?@ !Q@)j@)@)@E!@b!@Z!@Z!@r!@!@r!Ar!A%A>APAf_AnA}AAAAAAAA B B )B 8B GB XB oBK BK By By By By C5C5-C5D cDzDD DD! D! D! D VE E! E! E! EXFo NF% ^F% oFI FI Fe F F F F F F G G +G" /] ^>/=^ [^/w^ ^/^ ^/^ ^/^ _/'_ 8_/R_/a_/r_/_0_/_/_/_/_/ `/ `I`|``DaNaaa)b wbbbb/b9b-b/c$c$&c+5c<Dc(Sc+bcxc@c@ccFdd)e)beKf)gc`g)g)Jh)hh[h[hhhhii&i3iDiUidiJtiJiiij'j!?j`Zjuj!jjjjjjk!k'=kMk^k*nk*kxkkkzk-lHllllllll mm*mQmbmsmmmmmmm nn)n)>9>H>W>f>y<<Ç<<< <+Wa *W *X *+6W` *+ԉX *W$W6WHWZWlWY *͊YފY*ZX"Y#`Y5YDZpZpZpZpZِ  0O o @֑& -=M]u pT5EM'ZW[kW[|m[m[y[y[y[͓y[ޓ[[[$[3[>M[c[r[}[[Ɣq*۔[q*[?q*g[[q*̕[ؕq*[q**6'\I;\Wq*q^_****Ֆ++Y+Y+Y+&Y+8,,M,,n,,],],],],Ɨw,՗w,  % 9Hy \y ~y y y  4 a w )   ̙bޙ' G+p&U op& p&ؚ p&! ?p&t p&ڛ&')'8'G'V&f&w&&&&˜&&^&&&̝'ޝ<'_'a' m'm'0'H'b'''0'M'^'p2(S(S(Ο#;Ttנ''6PM"ҡ999999,9;9L9i]]͢55'5=@"b@""""ģ"ۣ"""""0"?"Nl"`"r""ޤ?8c P+B Vn :$ 4G\w Ԧ%8Kbw0#D0#60##$"0#ly#y#-y#Vy#y#y#ѫy# y#:y#Ky#\y#|#֬##* !i6 !iB !iHT !ic##ȭL$$ #,C#c# $ $@$No$$ȯ$>$Kq$$Ѱ ~%~%)%?%JV%e%t%%%%%̱& /sѲ@ $h `ڴHK\)N\wq/qN˶S`@kӷ,8amBOԹTT TT)T9TIT`TTT%T5TETRauӻ/0KBe>UѼ'U;'~U''ν*V#'C(=Uy'`'Ӿ`'UU U%'=ULU[UjV/V/VEVĿwVWV/VLV_VzVVVVVlW;lWulWlW#' ( ((((((#@>@WUf{?*9Jap0 l l l ) D _ |   P ` ~ ~ ,~ ; L g      * P 3P Vi |   !} !} !} '< Jh { !} !} !}   0D Wj       3D S ^ !}g {  !}    P``:?p 0W!`<a}:q7O[j`> `>)> ! 0@f ! !Z  -H@P`kv`tttt&1<OF b r }      ` `  P )4 >I S^ hs }  `$ i~($3wCS4cPv+]`\->Vgz 6ME!`K!pwXy _ !]b")w"9"I0#T`y#vy## $$%p& &'('8(C N(^(o)2)) ) ))k* k**++; +K$+\7+l+|+,7,9, , ,, 6-   p-&  1 -D >/W P/m  } / k/ w/ 0  0 0 1 1 1) L29 2T 83g 3w 4  4 4 $4 04 4 4 4 4  5 5' ?57 ~5J 6Z x7m 7} !  & 2 > J V    X! l1 xA Q a q   7 O 8 8 78 H8 w8 X9 O a91 O< 9K V 9f L:y : ?; ; )< E= j L= = = <<*<:>M?m??@pBB`CC )C0ICBCUFgFw!GGG8HIII1MJGJZ1Kj6K}KALALJLJL`L(M[MM%NANZNs)OPQQR@RRJ)|9I\oQ #4 Jq!]!s."#b$$%K%l%%%$K&7&G&WFSgSwzTJUU'U/VEVwV'wV|V)V<[WU#'e='w((N)^)W *WXX"Y`Y'Y=YMY`ZpbZ9y[Iy[Y[i[y[q*;\q*_,," (H& (o* (. (2 (6 (: (> (B (F ("J (7N (RR (aV (wZ (e (j (o (t (y (~ ( ( ( ( ( (  ( ( ($ () (2 (> (F (R (^ (d (q ( ( ( ( ( ( ( ( ( ( (  ( ( ( (( (=# (O( (X- (e2 (u7 (< (A (F (K (P (U (Z (_ (d (i (n (s ( x (+} (1 (? (H (T (\ (d (o (w ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (. (< (J (Y (l  (| ( ( ( (" (' (, (1 (6 (; (@ (E (1J (<O (LT (aY (v^ (}c (h (m (r (w (| ( ( ( ( ( ( ( ( ( ( ( (  (- (5 (= (O (_ (j (q ({ ( ( ( ( ( ( ( ( (  ( ( ( (! (& (+ ( 0 (5 (!: (0? (:D (AI (ON (VS (`X (k] (zb (g (l (q (v ({ ( ( ( ( ( ( (  (  (  (  (+  (=  (F  (X  (g  (l  (x  (~  (  (  (  (  (  (  (  (  (  (  (  (  (  (  (  ( % (' * (/ / (9 4 (C 9 (M > (W C (a H (i M (| R ( W ( \ ( f.{C ( (' (> (Y ¶ (o ƶ ( ʶ ( ζ ( Ҷ ( ֶ ( ڶ ( ( ( ( (& (4 (<  (D  (M (Z  (_  (h  (n ! (u & (~ + ( 0 ( 5 ( : ( ? ( D ( I ( N ( S ( X ( ] ( b (" g (2 l (G q (Y v (b { (r ( ( ( ( ( ( ( ( ( ( ( ( ( (Ʒ (˷ ((з (.շ (9ڷ (J߷ (Y (g (u ( ( ( ( ( ( ( ( ( ( (% (%* (// (>4 (\9 (g> (wC (H (M (R (W (\ (a (f (k (p (u (z ( ( ( (, (3 (: (B (I (T (a (i (q ( ( (Ÿ (ʸ (ϸ (Ը (ٸ (޸ ( ( ( ( ( ( ( ( (  (' (2 (= (J (Y$ (c) (j. (x3 (8 (= (B (G (L (Q (V ([ (` (e (j (o (t ( y (~ ( ($ (* (3 (@ (O (a (jȹ (̹ (й (Թ (ع (ܹ (' (< (S (i (y ( ( ( ( ( ( ( ( (% (* (/ (4 (9 (> (C (H (M (#R ()W (2\ (8a (H + 4 +8PL +Pd +h| + + + +P +  +$ +(< +@T +Xl +p + +, +0L +P + +@ +, +0@D +Ht +x +0  +  + , +0 T +Xl +p  + +  +P  +  +P D +Hd +h  +P +L +P` + + +D +Hl +p` +$ + + + t +x +, +0 t +x   +  + @"< +@ 0# +  + p&$ +(  L +P ( +  + p-$ +(  L +P 0 +  + 34 +8  +  + 74 +8O\ +``> +? +pB< +@d +hC + +4 +8G +I +K$ +(L +pO +L +P S +U$ +('d +h( +W + *.symtab.strtab.shstrtab.rela.text.rela.text.unlikely.rela.exit.text.rela.init.text.rela__ksymtab.rela__mcount_loc.rodata.str1.8.rodata.str1.1.rela.rodata.modinfo.rela__param.rodata.cst2.rela.retpoline_sites.rela.return_sites.rela.call_sites.orc_unwind.rela.orc_unwind_ip.note.gnu.property.note.gnu.build-id.note.Linux__ksymtab_strings.orc_header.rela__bug_table.rela__patchable_function_entries.codetag.alloc_tags.rela.data.rela.exit.data.rela.init.data.rela.printk_index.rela.static_call_sites.rela.gnu.linkonce.this_module.bss.rela.debug_info.debug_abbrev.rela.debug_loclists.rela.debug_aranges.rela.debug_rnglists.rela.debug_line.debug_str.debug_line_str.comment.note.GNU-stack.rela.debug_frame @b@@OCF+0c,&@ 1F?a:@FOpJ@F_Z@h F n4i@@HF {2P 2k $ @X)FSB@ @F4@  8F@@X FP @ =FN @J FF#@6$I0U2gx s@ 0F#((@ xF%P@P @h 0F(p@ F*x@ F,@ȗ F.@x 0F0@@@ 0F2/! 9!_4@آ F5EX6S@h" F8mfh@F:rg|@0`!F<qf@(&F>09z0ƴS0Tmp(@FDpDGA "-h-