ELF>PM@@KJAWIA׉AV,AUATUSHHt$(H$eH%(H$1H H|$8HIhHD$@($Dȃ!EEM<E1E1EÃD$$H\$(IcHD$0HHE9H2IDE1Eu1E1MtLIIHHLpD9I4$LEt׋~IHtH9*H@HuD\$ MH\$HL|$ALEL4$EH<$H;HT$IcAH5LLT8LH+HG:HHH HDRT$$I L Ҁ=tHKII)LHAHH H f f A E9~bHuHE+HEH\$ID\$ DEL|$9s H@xZ@LpAH2_DH\$D\$ EL|$EE1EE1A9Ht$0HT$(l$ D)DL$E1MHED$ELLDHH9tlH3H~uE9IcHf  FEt'A9rRHt$F(u F(DHAH9uEl$ MD$DL$EvA9mA#H LL$0H=HL$LL$0HIHL$ H HH IFHHIA9IIHu-ff.ff.fHxHPHtHP9r9HxHPHuI~ AFHIF IF(IF0H:LL$LL$AAHLpDDH\$D\$ EL|$EE1DHT$81DL$H$D\$ D$D$D\$ DL$A fILL$H4$LL$@1 Ɖ4$HD$HLL$HHLL$HHLL$H3LL$tAAVHHDLL$LL$HHDD$DL$D\$ H$H$D\$ DL$DD$H2%HHLL$LL$LLL$LL$E1DL4$DD$ DHt$8ELDD$DD$H\$(IcHE9}'D9 HHBHAHBE9uH$eH+%(ueH[]A\A]A^A_DE1H1eDEAzIhB(B(LE@AVLw(AUIATAUSHLHHh@t C#CHH)HHSHHD@L(D`fh CHSCRHKAD$HKA)LD+a A9r)[]A\A]A^C#CH@HHCHD@듋;[]A\A]A^ DAW!AVIAUATUSHeH%(H$1H$L$HH LHH|$HIHfIL$HH$HT$xHDŽ$IHhHH1M IăHEH+HHH HЀ=tH HH)HHcHvHHHDŽHEH tOLHtBH4$LMHIl$AMtILM Iă8 H|$$\$ T$ uQILIHu8Au+H$eH+%(u(H[]A\A]A^A_   H5ff.AWAVAUATLgpUHSHLLu Lk`HHS`LLH$L{`HT$tHT$LrHU Lm(Ls`H4$LM9tH[]A\A]A^A_HH{x1ɺ[]A\A]A^A_AWAVAUATUSH IIML$H1|xtmHIHH<H It4HipH1HHHpH9uHH1HHf.HHH@xHPHHt>t4HipH1HHHpH9uHH1HHf.HHH@xHPHHt>t4HipH1HHHpH9uHH1HHf.HHH@xHPHHt>t4HipH1HHHpH9uHH1HHf.HHH@xHPHHt>t4HipH1HHHpH9uHH1HHf.HHH@xHPHHt>t4HipH1HHHpH9uHH1HHf.HHH@xHPHHt>t4HipH1HHHpH9uHH1HHf.AWIAVAUATUSH HD$D$D$#\$D$D$HD$pA;Ll$MA]LtI}PHt%IEP1IPAEHA}BI}tIG0Iu H8IELI}`D$HHoL`IE`HD$H9tHU HE(HBHHLu0H0HE H"HE(I>IL9uH0HLID$ HL$I|$ D$H H9tIzAuvIIH9IHA(AAt$9urAELHLAE |$uNALJI1ILJALJH []A\A]A^A_     늸DATUSHHfH}@uuH} tH}H} HE HǃH}Ht&HEH8tg[]A\DGHHHHH}@tLcPHLLHHLUHU[@H5]HhA\AUP ATUHH=SIDMI,$ H=LDmHHcfD(HxHHH@8@@HI\$HHChHCpHCpHǃHCxHHu1AHHHuD1HHID$It$1HIHL`0hLMXHuD1HHHÅuT[]A\A]DEHHHHhHID$HHHHHHHqff.UHoSHH&uIH{HtHCHCHxHH{H=HH[] DAWAVAUATUSH0H|$eH%(HD$(1HHD$HD$ HtFt@Ht9H_0H+@t)D$DjHD$HH@0H8HD$(eH+%(cH0[]A\A]A^A_HMHH|$1H|$AąHCL+HH|$D@(IuAL{L+Dt$II}HH$H$H@IuDDHHH<$IuHDAHEG(IuDHHAAAIuEDHHHCL#HH|$D@(It$AHCHuHH|$D@(AAHCHxHu|$HL@HHuHS1|$HzDBHA yHCHxHu|$HH@HDUHCHxHu|$HH@HD[AHMHHHGHHHD$H@0H@Hp1H1HH=HHLt$HHL@Ld$LDALHI~HŅH\$HCHxu!*HǃLkPA;L|$HcAMHipHHIHIH=vHD$ALDHCPHH@0H8HcʼnHipH)HipHD$HH|PHHpH9uZHMHH|$LHHHHMHHHMHH멅uNHHMHHHD$HH@0H8HHAWAVAUATUHSHXLeH%(H\$PfwT,@ufHHHIHv!I|$HHt'HD$PeH+%(4HX[]A\A]A^A_HD$PeH+%(HXH}P[]A\A]A^A_@tI|$zD$I,$Mt$D$ HD$HD$HD$ HD$(HD$0HD$8HD$@HD$HDAFHu1LD$HHÅHH|$eAFAF( 1AF(^AF(H кAF(H}DAD9?HHHD$PeH+%(I|$HX[]A\A]A^A_"HD$PeH+%(rHXHH[]A\A]A^A_HD$PeH+%(5HXH[]A\A]A^A_HD$PeH+%(5HXHH[]A\A]A^A_HMHHHRHH|$AF}H}1HAHip IHHAE1E1ILHAHC(H{0IpHS`HHHS`HShHHHHHHHǃHCpH{xHHHHPHHLhCLHAA9HunspecifHD$Hied, assHD$Huming deHD$ HdefaultHD$&HL$HH)ff.fAWAVAUATUSH HoeH%(H\$HD$D$ HD$fHuLL$ LD$1HHƃ߃t+uss0S4 txL$DD$ 9D9HD$eH+%(AH []A\A]A^A_DEHHHH[HHHu1H1HC8H=iHu1H1IH=HHE1LAH}/1HxHT$H{8T$ D$wHIʼnT$H H HC0LcT$DHL|$AD$ fE|$HAD$11A|$IH=ID$HHxI|$H@ID$ ElAL$I|$H@tAL$LHPHH#BxHuAL$(LH@tAL$(DLmPHLAąLHLkI}HtIEHDHH{8HC8HC0HC8pA $AHHVHLAąuzHLAąuUH{ HC8HHI|$H@HxyE1HLHLHff.@H=Hff.SAHHHHHsH[SAHHHHHsH[HHHff.fHeHSHHHHPPLLHHHH H1HHHH[HDD$DL$D\$ H$H$D\$ DL$DD$H2HLL$LL$HH $H $HLHIht$8HMDd$D@1H$MPH$HH$H$H$H$1HD$pHt$pLIuZMugLH$HHHt$pLfAW1AVAUIATUHSHxMheH%(HD$p1H|$T$LD$H1HIG0HH$tH<$HHAE1Ld$\u  A 1LAtDHLEt HLIc1HLLDHt H<$MHHpAA9o1Me`D$ D$ 9 @IHh M}hHx LH|$LtH|$Mf M~(I}hI?E1H= KD>0H IIuH= I0HHA}w IM Ht$l$MhID$0H8AƅN I} ED$WHHH H AHG@tAAH AlIU1H)HII%CAAtIAt AAEA@AA EAA t AAEAAAEAAtIAt AA{EA@lAA [EALA t AA2EA#AAEAAAtIAt AAEA@A A EAA tA AEA~A ArqEAeAt3AtAA€uMEA@DA A u5EA,A tAAuEA AEDEEI}HAAt@DAt%@AVL%A< 2A tAD%D%ADAt=At%@A%A A t%A%AxnDAAt=At%@A<2%A " A t%A %A At4At@AA  A tAAwmH ApIU1H)HIIAt?t@ y tcVG:t?t@  ttjt6t@ ru t re[ rPFt$tu5ƒ@. u%ƒ tuƒ DAUI}Mt`t/t%@?%+ t %t/t%@ % t(%.%tSt'tG%@| P%k t ]%U f%Dtt r@/ |" t  )A9r2ID$0M1ɉIHH8Aƅx AEID$0Iu H81IEAI"IE`H(HXIE`IH$H H$H{ H9tHS HC(HBHLk E1Lc(J|;0HuH0HtIIuHHHE HhE1L$H<$HD:HD$peH+%(tHxD[]A\A]A^A_HHHHUH}PHI}PHI}PHI}PHI}PHI}PHI|$PHHuHHD$PeH+%(HXH[]A\A]A^A_IAF(uIANHuLD$HHu1HLD$ Hth1AAAHuuwIHD$PeH+%(I|$HX[]A\A]A^A_L$ DA9r HHH Lh LHHupHH1LHD|$LHHMHEIcHHipIuD$D$A;rHHHAt$HI|$Ht1IT$At$HHHH{PHD$D$H{PHD$D$=tI5vH=u u f.H(1ҾeH%(HD$ 1H|$HT$H1H$HHHT$ eH+%(tH(xen_blkif_initprint_statsUpurge_persistent_gntdispatch_discard_ioadd_persistent_gntget_persistent_gntxen_blkbk_mapput_persistent_gnt__end_block_io_opdispatch_rw_block_io__do_block_io_opxen_vbd_resizelog_statsmax_ring_page_ordermax_queuespersistent_grant_unused_secondsmax_persistent_grantsmax_buffer_pagesxen_vbd_createbackend_changedxen_blkbk_probexen_blkbk_discardFMV]connectXconnect_ringfrontend_changedxen_blkbk_removexen_blkbk_barrierixen_blkbk_flush_diskcache1vbdbuffer_squeeze_duration_msfeature_persistent6xen-blkback: (%s): oo %3llu | rd %4llu | wr %4llu | f %4llu | ds %4llu | pg: %4u/%4d 1xen-blkback: requesting a grant already in use drivers/block/xen-blkback/blkback.cxen-blkback: invalid buffer -- could not remap it 1xen-blkback: trying to add a gref that's already in the tree xen-blkback: grant %u added to the tree of persistent grants, using %u/%u xen-blkback: domain %u, device %#x is using maximum number of persistent grants 6xen-blkback: Invalid max_ring_order (%d), will use default max: %d. 1xen-blkback: freeing a grant already unused xen-blkback: flush diskcache op failed, not supported xen-blkback: write barrier op failed, not supported xen-blkback: Buffer not up-to-date at end of operation, error=%d 6xen-blkback: VBD Resize: Domid: %d, Device: (%d, %d) 6xen-blkback: VBD Resize: new size %llu 4xen-blkback: Error starting transaction 4xen-blkback: Error writing new size 4xen-blkback: Error writing the state 4xen-blkback: Error ending transaction 4xen-blkback: Frontend provided bogus ring requests (%d - %d = %d). Halting ring processing on dev=%04x xen-blkback: Invalid indirect operation (%u) xen-blkback: Bad number of segments in request (%d) xen-blkback: access denied: %s of [%llu,%llu] on dev=%04x xen-blkback: Misaligned I/O request from domain %d 4xen-blkback: access denied: DISCARD [%llu->%llu] on dev=%04x xen-blkback: discard op failed, not supported 1xen-blkback: Scheduled work from previous purge is still busy, cannot purge list xen-blkback: Going to purge at least %u persistent grants xen-blkback: Still missing %u purged frames Misaligned I/O request from domain %d access denied: %s of [%llu,%llu] on dev=%04x Bad number of segments in request (%d) Invalid indirect operation (%u) Buffer not up-to-date at end of operation, error=%d write barrier op failed, not supported flush diskcache op failed, not supported discard op failed, not supported domain %u, device %#x is using maximum number of persistent grants grant %u added to the tree of persistent grants, using %u/%u invalid buffer -- could not remap it Still missing %u purged frames Going to purge at least %u persistent grants drivers/block/xen-blkback/xenbus.cwriting %s/feature-max-indirect-segments (%d)4xen-blkback: Error writing multi-queue-max-queues 4xen-blkback: %s write out 'max-ring-page-order' failed writing feature-flush-cache (%d)writing discard-granularity (%d)writing discard-alignment (%d)writing %s/physical-sector-size%s: switching to Connected state6xen-blkback: %s: prepare for reconnect guest requested %u queues, exceeding the maximum of %u.6xen-blkback: %s: using %d queues, protocol %d (%s) %s requested ring page order %d exceed max:%d4xen-blkback: changing physical device (from %x:%x to %x:%x) not supported. 4xen-blkback: xen_vbd_create: device %08x could not be opened 4xen-blkback: xen_vbd_create: device %08x doesn't exist xen-blkback: Successful creation of handle=%04x (dom=%u) Successful creation of handle=%04x (dom=%u) readwrite%llusectors%dstatexen-blkback: Purged %u/%u xen_blkbackPurged %u/%u %x:%x %s %llu %uevent-channelreading %s/event-channelring-ref%uring-refreading %s/%sblkif-backendmapping ring-ref port %uxen-blkback: %s %p %d allocating backend structure&x->waitcreating block interfacefeature-max-indirect-segmentsmulti-queue-max-queues%s/%sphysical-devicemax-ring-page-order4xen-blkback: %s failed xen-blkback: %s %s starting transaction%dfeature-flush-cachediscard-enablediscard-granularitydiscard-alignmentdiscard-securewriting discard-secure (%d)feature-discardwriting feature-discard (%d)feature-barrierwriting feature-barrier (%d)feature-persistentwriting %s/feature-persistent%llusectorswriting %s/sectorsinfowriting %s/info%lusector-sizewriting %s/sector-sizephysical-sector-sizeending transactiondevget blkback dev name/dev/%d.%sblock flush%s-%dstart %s-%d xenblkdpersistent grantsxen-blkback: %s %p %s pending I/O%63sprotocolx86_64-abix86_32-abiunknown fe protocol %smulti-queue-num-queues&ring->wq&ring->pending_free_wq&ring->shutdown_wqring-page-orderreading ring references%s/queue-%usaw state %d at frontend%x:%xreading physical-devicemodereading modedevice-typecdromcreating vbd structurecreating sysfs entriesblkif_cachexen_blkback4%s %s: %s %s %s %p %s %s %p %d physical_devicestatisticswr_sectrd_sectds_reqf_reqwr_reqrd_reqoo_reqalias=xen-backend:vbdlicense=Dual BSD/GPLdescription=Virtual block device back-end driverparmtype=log_stats:intparm=max_ring_page_order:Maximum order of pages to be used for the shared ringparmtype=max_ring_page_order:intparm=max_queues:Maximum number of hardware queues per virtual disk.By default it is the number of online CPUs.parmtype=max_queues:uintparm=persistent_grant_unused_seconds:Time in seconds an unused persistent grant is allowed to remain allocated. Default is 60, 0 means unlimited.parmtype=persistent_grant_unused_seconds:uintparm=max_persistent_grants:Maximum number of grants to map persistentlyparmtype=max_persistent_grants:intparm=max_buffer_pages:Maximum number of free pages to keep in each block backend bufferparmtype=max_buffer_pages:intparm=buffer_squeeze_duration_ms:Duration in ms to squeeze pages buffer when a memory pressure is detectedparmtype=buffer_squeeze_duration_ms:intparm=feature_persistent:Enables the persistent grants featureparmtype=feature_persistent:boolsrcversion=98A42D08E48297E88C919A9depends=intree=Yname=xen_blkbackretpoline=Yvermagic=6.13.0-rc1-MANJARO+ SMP preempt mod_unload $ (0800080( 0 (0( 0( 0 (08880( 8 (08H80( H80(  (08@80( @ ( ( ( (0880(     (08080( 0 (08X80( X   (0( ( (08h80( h (0880( 80( 80( 80( 80( 80(  (08X80( X (0@ (0880( (h80( 80( X00GNUGNUcDŽ&İӲ HEA80^LinuxLinux]2X;,[%$>>Gtp  BCDEFG [ GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910GCC: (GNU) 14.2.1 20240910    <  $$$$$$$$$xiF!le@a-z{ xen_blkbackl)e\S wO+++M+YORO^ vO O O O int ^ ,O *Obs8jbu8}bs16bu16'bs326bu32Ebs64bu64^9  O +  1^ 2^ H I X ] ^ _ `ROO <^  E B     #~O % & *+ 4 = B f h6 l m' nE q^ } T  ^  ^  ^  ^  ^ +(  ( T   ? ??D?RY+, Y%+W;0'   ^+   '( ~*I-@ 3^^  9( ^,!^0( 4)a48*^H++P,X5 `6 d8 h: l; p< t=^xuse?E@Jrt@zF{dlAGBGFIPI 7J+K^OIXI]IP`"qC@dh^k^ l+m nI oI(p (0q Xs`ubx dy2Ihzp{I+    2I rB6(P 7PJmm h pJx    +^ ^, ^, ^, ^- ^- ^- ^- ^- ^- ^- ^- ^- ^ - ^ - ^ - ^ -"^ -+%+Jpid f f+ (0@DKPIKX "K%(+ - ^. ^3 ^4A6B: (=+0>+8A ^@D ^HG+PH+XK?`PN?TLWLZL^Mk ~3mMp:6 q_6(t+8u+@JfsxMH{MP~MXN`Qh Qp :x : :=+ ^Q iA^V9b> ^  ^ 4 " XI k7( 8 Q@  H /RP RX R` 8Sh BSp +x GS )? ^  ^  ^  ^ 9 A  QS   E  E "[S )S    S0  68  ^X S\ S` 6h  S      !^ "^ # $+ & ^ ' ^ ( ^ P)Y 3S C% D+ LS N+ RS SE( TE, Y+0 ] 8 ^ < _ @ ` D PaYH d>X gS i> lS w x z+ } ~S  ^ ^  %  +^TTaVV ^(^,zI0{rcuY09@ DH8P^Wx9  "hW rW|W  ^ >PY !"4$"4P.Y<WPF@@'"@/0pad!+? @'&)'  n !6 key "6" ? A+ B C !! mod!$!F  = >n2"2"2"(l2H# 1# M# # # "#  # (# $0# 8# @# v"H# v"H# v"H# H# v"H# v"H# v"H# v"HI@$O${$$3$P$Ch$$M$M$:$}$ $^$6Jkp$ $^($^,$}0$ 8$~@$~A$~B$^D$ H$#P{mem$@$$+$ ^$$$$'$$ $#($0$^8$@$^H$^L$P$^X$`$^h$p$ x$^$^$$$$^$$^$^$%$$ ^$!%$"^$%$&$9^$:$?$A$D -$F $P ' $Q^($T$0X&1"'e'f+'g'h 'u'v6'w6 key'x  'U'V ['j#key'k'n-#key'o6 (;(<(=(? ^ (@ ^$(A ^((B ^++ )BZ)C')D')E' )E'(Ms)E',Mdpl)E'-Mp)E''/)F'0Mavl)F'4Ml)F'5Md)F'6Mg)F%'7)F+'8 *+ *+ *+ *+ *+(*  pte*Z *"(*  pmd*f *"+%+%%A+%/v+' #pgd+'~A+'"v+p E#pud+prA+p",A+_d,@,H,I+Qll0, 4,+8dI@@--3#sp-+#es- #ds-"-$-&-+(-+0-38-+X-+`#cr2-+h-+p-+x-3-+-^-E-+-+- V3ufpu- 2@^ (.  . '# I@@,I Qs@,w@] c,h!Qq, , q ,~(,,,q0T,q8,X,qh,%rp,+x,p, ,r,:(,S,r,pE;/!//;/!/'/'"/!0val/ /m!/! /!! /,!;0"00")"+"0D"0 /! 0 e")"0! 0D"11  2"2! 2" 3#3"333 33^3+,4{##fmt4M4M4M4^4M4M$#|56#5758,85$5M5M5M5MU5^U5^U54^ key59#(8^5=F$ 85U$5V mod5W$5XM5Y$ 5Z (5[ ,5\$01M 5u$5v$5w%5x^5y^#F$+R%+ 6/\%61^ set63 get6567 4%m#?'#$## # # # (# 0#L8#!e@#" ~H## P#$ X#%`#&h#'p#(x#) #*(#+P#,x#-}#.P#/ #0 #1 t#2#3 "#5 7#9 d#; #> #?#@a% 7!'7% 7+ 7-7/ 8^3'     + (+ . ; ( .?*(:(+ 8 ^:(      0;cD);dM;e;g;i 8;l= F((X2< 2< 8^=)((=)=) val= E=!E ="E=#^=$) E"=**=+&9*=,#f* >9*>> * ?f*?Y? 6>*(='*=(r=)o))=.^( =1*=2*=3=4 =5+=6+ *"(=%+=%)=/k*=7* 8=R+=+ fn= f+* a+a+%+R+X+X+X+ @+@^ end@^ A;+McsA=^MslA?^MwfeAA^ AE,MssAG^MstiAI^AK^MnmiAM^AP^ AS^0AV^8MlmAX^9A]^:Ad^<"A,0csA'0csxA^A+"A,0ssA'0ssxA^A+ Ag- r15Am+ r14An+ r13Ao+ r12Ap+ bpAq+ bxAr+( r11Au+0 r10Av+8 r9Aw+@ r8Ax+H axAy+P cxAz+X dxA{+` siA|+h diA}+pA+x ipA+,A+ spA+, B  .B B  ., pC. cwdCE swdCE twdCE fipCE fcsCE fooCE fosCEC.CElE.+;C*. ripC+^ rdpC,^;C./ fipC/E fcsC0E fooC1E fosC2E "C)//./."0C@=/CA=/CB=/EM/+ hC$/ cwdC%' swdC&' twdC'' fopC('/C5EC6EC9/ C</C>=//E/+E0+? CQ0 cwdCRE swdCSE twdCTE fipCUE fcsCVE fooCWE fosCXECZ.C[lC\mC]nC^o rmC_pC`qCa0xCbE-0+^1+@C:;1C; ^C< ^C= ;1^K1+I@@CO1TCPM/CQ1CR1@1B+@C^15C_.dC`M/5Ca0dCbK1@5Cc11+I@@Cf2Ch^Ck^Cn^Cq^#xfdCt^Cw^Cz^C^C^TC1@@C2C ^C^C^ fpu@CQ3C^C+CQ3CQ3C2 C20TC1@@1 D ~3D ^D^R3+3+33+3 3 E>4E?+E@+EAE cpuECE F84F9:4 F<:4F=:44"G<a4G=^G>  G:4G;4?4 srcGA' dstGA '44"H4H" H44 H4(I 4Ie" I"42 "2 2 2 !2 %2 '2 ,2 /42 32 52 92 <2 A2 D2 H2 L2 Q2 U2 Y8^J56 KU6K Z6 U6 L z6L M 6M  N)6N*:(N+" osqN-z6 N/ (O  7O O O,PA7P+PF7PF7 7 7 P f7P F7K7 P7PK7PF7, Q7RQ  7Q + Q 7Qk78^R 7,@R'k8RR(7R) + R*8(R+80R,8R-9R.:R/; 7z8z87k8,@@S/8S0[S1^S2 r seqS3@S4z8S57 S6[0S7 +88 (TA9T T+T Q9TE L9L98A9 U9UU U9 9(V 9V9+9+ V89 W9W  W9 X+:X,X- xYY:YY:Y^`Y+h maxY+p+i:+ (Z : sigZ9 Zi: [R [S:: [U2 [V::]\:\ \  \ :(\';\(\)(\-Z;\. \/\0 :\1(\5;\6\7\8 :( \<;\=\>\?\@\A(\S<\T %\U\V( \Y+<\Z %\[ (\^\<\_+\` \a "\J<\L\Q \W;\\<\b+<( \E<\F\<(\g<\h _fd\i(\m=\n\o\p^ ] \%v=\*:\2;0_rt\9Z;\B;\d<\j<\q<;0] =] ] ] ] = 0] =v= ]= = ] >]!]" : ]%H>]':](+].:]0 : ]3b> sa]4> ^ >^ #^ + len^ +^ ~ (_>_  `$>`%_`'`( 0`D)?`M#>`P~(`W~) 8a ?a^a^a^a^a^ a#^(a,^0 b)?b*^b+7 Pb8?b9?b:^Hb;^L??+,8bD5@RbEYbF6bG^0, c>@cKcZcpccc endc@R@B+ d!@d" ^ d&@ dD@dD@ dD@ dEAdE@ dE@(dT FAdYAdZ 4 d["A(e iA vale e RA(e A vale  e uASAU ^V ^W"C^[B0hrBi@jkA#cpul^m^n^ o^( B+B+ Ec@@qC ^ ^ ^ E E+ +(+0^8I@E ^ ^ ^ ^ ^  ^( ^0 ^8 T@ ^H ^P TX T` ^h ^p ^x  ^  ^  ^  ^ ^ ^ ^ ^ ^ ^ ^ ^ ^I@kFBT  7! ^(" ^0# ^8%@&P'Q(R)S, ^X- ^`. ^h/ ^p0 Tx1 ^3 ^6 7kF9uF;uF=+uavgGB@E pF0KFLM+N+O^ P$Q&SF(zFA]FG ~GGGc`yHTa 7h ^i ^ j ^(k ^0l ^8s T@t ^Hu^P^^^^^^^^T7XT7#rqHFyHGA^HH HGrqHHN^ N^ N^N^v2IXIwbHwsEuIuIXI II IHI+( ( Ic#J##<#a# O@# D# H#k7P#+`# +h#)p#+x# #4##a# Ipidpf7DKf9 9f:^f; 4f< inof=^f?ٿ f@@fBwZHVrcufCY`fDpJYK+ gKg^gbYK,hoLhp:( uidhq iA gidhr A hs iAht Ahu iAhv Ahw iA hx A$hy ^(hz0h{8h|@h}Hh~PhXhM`hMhhMphMxh h1hwh=h6QKLkeyiMi9iQAi3 semia(i=Pi Xb`i Wh uidi iAp gidi Atixi|i~i i+iBL M M M M NhXj^Qj_9j` jajb jcjewZ jh8jk=@jnXjq`jsdjthjwpjx^tjzxUj^Uj^j^jjRj7j + itjjj?jhj jDKj^ttyjjj FAj^j ^j^j^j^j^jAj+j+j+j'+j+ j+(j"+0j,+8j+@j+Hj"+Pj,+Xj+`j+hj)?pjjjKjj ^jj~jjj j6ja0 Nx jQj4j9jwZj; Q Q Q/R##R@R6 6 ^  (*~,~-04R R Xkc8Skd:(ke kg kk 4km<kn(ko0kqM\8R =S= LS VS lSlylalm`S SS+ S S S+S+5@ S S:T+ T Tx0aV^ ,.<0@(\H PXL`+6 ^^bdi ?(:hpf ^evp^^^%^4uWM\\^cdi^bb"^ @ ((#T,hmyVmzgm|^m}hQgmg(m80m+Xm#h`fV @n4^Wn5^Wn6 n7+n8+n9w n;^(n=^,n>g0n?8V cW mW wW W o o Wo Wo, pXp^p^pMpMpM q6Xq^q^,(q]XVctqWq&]X X qX rXrrr r Xr!#r" -r$^ Hr'RYr(M keyr)r*RYr+ r,(r-0r. WY8 extr/\Y@qXX r3, r8Y tpr9Yr: r;Er<EX ?6sVL7Dtje (uZu^u uZu  u'Z,Z JZJZ^Y u#wZu$4u% u' OZX8^v Z vZ2wDxDxDxh@@Sg[Sh" cpuSi^Sj^Sk^ Sl^Sm^Sn^So^Sp^Sr^SsStSu^S{ + S|z8(S} +0S~z88RS\@@Zl+[}8@\+ y,\y 9 z 8\=\H\H\M\ z\z:(zz,\8^W\n@ Xq\rM\s8 wqv\H cpuwP \y!\ {?]{{ { |hK]P] Zd],@|z^|{?]|| |}|~^|?] |(|^0 irq|^8|^<|+@|+H|MP dir|%^Xd]  ^D|8| ^#irq| ^|\|M\| ^(| ^0^^I7^^^^\^0|2^|3|4^@C^|_ } _#_._._3_h@@~C)a~D~Eh~F~G_~H^~I^~J^~K^~L^~M^~N^~O+~P^~Q ~R~S"~T~U~W~X^~Z(~]+0~^ 8~_wZ@~a^X~b^\~c^`~d^d^dir~g%^hrcu~nYp~o?~q6~r~s$~tM~v ")a"\a4.a a:a^ (0a1:(7:( osq9z6;"<DDDDD +Gb,"- xbbb( len:(HbPpGbb++b+b+h@ccc R4@@ LbH!+"+#~$8%M\&Y ',d0(+8^cpu*@^ssp+sdH:(c+ `6,d748b:b(;+H<,dP=X>\c esdf^ sdageh"ie1dxxDeE,dFeH I6(J4HK6PL+pM+xN+O+P+Q+R+S+T~U+V6WYKY \+]+^\_sdp,de+bxd2"e00("0f#6$%('Tf()(+xf,-"!f&e*0f.Tf fe opsfxf ff 2g4+6^7^ 8^m@:g8^mHcg mpgmq:gmrmsg g;mgmfm+mgRmYm+omh/gg,@mhmcgm+m+m+ m ~(m,mh0VrcumY8mhHhf mhm idmhhB+ mhmh h (,i"T- ( i^& )a ldt*i8.+@96H:h;jp= xC'|D~ i j+ alt+++ +(08@HPX`hpx !ij F,i;,\k,^ ,`^",XAk0lru,Y/j,d,e",ick,j +,k+;(,Rkk,hJAk,s+ ;(,uk,z+ pp,{k,|+,}+,~:( k;,k,+;,"l,l,  l y refo8YKHph^l+p ops sxX"lo(,Ql/ck/k/k/kz,Y",l,^, v, m#val,+A,le,MHm,N ,P^Y,Jemwlru,K/!mY,Wm5,X 5,Yme@,Gm,I+Hm,UJ,V + em(,[ 0,\ 4,^+8p@,Fn/md,jde(,mn,n+,o+,q ,r ,s ,t ,v^ p@,ln/nd,zde0,}n,~+,+, , ,  , (e ,2o,+,+,p@,|Uo/n/nd,dc,DyoQmQn@Q2oA,+yoc# p# # 4# [ # #J#  #(#^0#^4#L8#@P# p#  x##R#$ #% #'WQo,5p#ctx,6p p,=p,>\,@@(,X q,Ya(,\^q,b+,h+,t=,w ,}$e,q,+,+p,q/^qd,YY,q5,o5,yo ,qurb, 7,+p qbrc h jk+qN s(tg0u8w@{H~PX`h p%xrrp q, @ id^` h<pVrcuYx/ 0 ops! h )"B$ `% ~ & (( 02 89~@: H= ًP@XA `0 " 70dirȇ 7  knpo 6 6@`h #x    ~@  ~A %r A) Bo. [o[G ~o[eo # 6ϋϋԋ  X ދ 8^8 0'() z* +,ƌ - 4(8l  l E Z^  ^^ ino)^ dev* N(+ N, uid, iA0 gid- A4. 8/W@0WP1W`2Wp3^4^5E6E7^8^9E:E;E ;F;M; Z";mh;n;o&X;0;1;2 ;3 ;4G ;5 t(;7 0;9 t8;; @;= ɐH;?Ph h Z::? @@AMBC:D E ( sdF0G\8UI^UJ^UK^UL^UM^?! Z: 8:lJB tp: #L p:#y ɐp: p:X ΐ;; :; ] ::#! ]:M? ` 4? Xb 0tu vw!$x*Gy[ z (:)D) ==B. [BLuBuziAA`x }֒~֒^buf #+#+?R+ =Vo QBBQ MjB[j Bt= ~ cnt~^8^" ,N pin-./E@0EA1EB 4567+8 #"RS0uvTN HI JKELEMsNO P (00+++#ack+#eoi+ +(mP _8E@ED )Hx!""#$ % & / ' /((^0)^4*E8+E<,E@-^D. H/+P0+X1z`2h34x EE **CB+C^@s RS^T^U^V^ WCX /#gcY *B+8^ i     ]!"^0ptr#}+( b  +  id cls̘țY^^ n@Rn+R~+Y+~  E #  01M2 3M4z6X7`8h9p:x>+? P?@{AB E͚+ Pe]f{h mapjk ћl q&(s @0u^8v s@wH͚ {zb z z^sћz^ z^%O֛ &z^^@z^^+ ^z~Eszc z%x]s ?@EAEBECE DME z1B+ ;EEE E EE"/=E ʝ ;B E!E"E#E$E%E &E ;()E*E+E,E-E.E "/֝/B Ȟ 1 67E8E 9Ԟ">,? E@Ȟ"BNC ED"FpG EHʝ"mnEoE(qrstuvw x ^"z{| lFpy]x^0ptr Fi" 0pcix^ ijk m ǠPj   Ϣ  ( 0 18 1@ YH sššeʡHe E^#ops^  _( 0M8 @1 zš^seozš^ Ϣz"ezeԢe z"1z"! TzTs6 ~"zzšcA^Df (+++++ ,0)Vrcu1Y2\3)8B+ HIJK LM+Nw  :; <%  5!%"%#% $%(%%0&%8'%@(%H)%P*%X+%`,%h-%p.%x/%0%1%2%3%4%5% %"5"*CUkC^lHxy 4z^|^}6~0@ I8BN ~ N ~!N ~"N ~#N ~$N ~%N ~&N ~'N ~(N ~)E4 YK W@ ~@ ~A ~B ~C ~D ~ET7P^M\wZa  ^ ~ ~ ~ ~ ~ ~ ~  ~  ~  ~  ~ ^k::^^^^f  {(Jqos0 +W,M id-./4 0a(1802+X3 +`4 +h5 +p6 +x7 +8+9+:+;+<+ dev="U> ~U? ~B \{"6k #ops% % 5 5$ "~ $"^ M:NMOMP!$Q!$R!$ T_(Ux0V%8W 5@X 5HY 5P[%X\%`^h_%pa%xc%d 5 pmfh~) S"SZ `ZaM busbd$eMg~ h,$jO(kT0m%8n 5@o%Hp 5PqXr%`s!$ht!$p pmvxw 5 py^X? xd "}: `2I3M5!$6!$8x9 g ; |(< 50>%8@(=@AHC P pmEX #bbZNwwIl uz 0X YMZ!$[x\ ^ 5 pm`( $+ L$ y Q"BаDаEհFG#HuILy  _!^"^ ڰ ;AE~K ":`@$/("NO+PQ  (+ܱ,-~.~/ E` 0#pE#qp#r #s #t #u #v'$(ܱ "j# &'' j;4 oڲz/,Q;34E len4E"2./6^ 1O8."ivjkvwZrstjzuY,RT^UAVjWX. Y0[8_"``Pha+pbxRdڲTmnVd_uv{Ix#{#| Z#}#~ iA# A#^ #j#j#! #P(#J0# 8#+@H# NL# P# WX# W`# Wh#Ep#Et#Ex#E|#4###f# C#E#a#+#+#####'#'### 0#@#H# P# T# X# \`#hP#Ip#8H# P#(X# `#h# pɷ+',@Ѽ ( 0 8 @ <HɽPX`ɷI@#P## N##+#  #(#!H0#!M8#R@#"aH#+P#+X#+`#h#ap## ##&p####$###O# # # p# # ##^ #D(P#i`# #E#W#W#!E#"#/ ^#0 #1#4 #6^#<6 #BM@#D"H#F8P#I:(X#L`#O d#R\h#Sp#Zwx#az#bz{rcu#cY#dM\#f6#k0P#n4@@#oH#q4X#r`8^r ^r . ̼^M̼O ּ   #<## EFGPHI A Ľ mnt   ~Ľν U "T#O nid&-+4+7T,R$SBUBXYZ ^c 9 dYK(VrcueYHgXj` idmpptqMxruG +88=T$:(  " $4,@@- lru/L0:(  f2Կ nrf3 nsf4Կ56+B+(  val^  P"^8^ sD +  i i,ilVrcuimYin9io ~;iv#ix'iy I"iu</0xi+ (irit+#iiiM ] iii + i MM iAi keyiMioibizi 7"ii Wi W;(ii+i+iii # "(ii</e iii Y i.5i/ . 8  9h+0:(8@ uid iAP:(X `$"h hh 9h gidh AB+oh1hrcuhYGH>K+? 8jj j! j"+j#^j#^ j$+(j$+0 j'j(^j)^ j0j1 j2 j3  jC,jD jLTjMjNT, 8jQjR jS,jTYKY+DK+  9+   ,0IwZRY ,` Vrss 08wZ@ X   fn 4 arg   E"kSkTkUiokWkXzkYY,8kIN qkJ iockK8SQ k\^0I + ^(^,90^4<8oHv"X"Xv"X"XX4`daVh:pxJdev"(:0 48@6HJid h+px:8M\   9!."#6&0(44)8*\H-Jfq23566676= >40@4JtdD'8PFY@KwZPP6hR1SUVW[6] ~NN ( 7 val  ( Z val C8 (. 0  4 45^67+  "#C# iA# 7"#e# A# Z P##^# Z!C # #W#W(#W8# pHо()*+ ,0-6@. 4`/ d0Ph1&p2 x3+4G ( val 8^6 B"E&0uidF iA0gidG AH DGJ H      ( 0 W8 W@ HM+ ^(^, 0 8@ !?$M@891:1;1<1=E >E(?E0@c8 1P E6 ^P^&JXDEEF*G :HEIE JE(K10N S8Oq@QHScPh *P:/ NN? llX NvxY~Z[^\^]^^^ _^(`^0aT8cT@dHeLf^Pg^Xh^`iThjp8^^^^ ^^^#ino  C( C0D^D~T+ ^^^ ^^^^X|11 (08@:HP P P^ PT P& P^ 5P5!m8  ^ a 0 HJops! ++?+Y#w5#}5#   E #I#l### # #(#:0# S8# m@# H# P# X#`#h# p# x#7#d# t#" b_bg N pUoq Jb ~J  pJ^a :pJ^^ 7SJ7?mX ~Or EJ JP  ~цц 7J# UUp_Z 7<tpi EJyIY#5#e5#^p#5#d#YY#5#!5# ?' Y#[5#S5#`5# #5# ^ [ eI@#Z#[#\#]1#^O#`m #b(#d0#e8#f@#hH#jP#k:X#mg`#oh#pp#r x#s#u#vC#yf#{#}###+o     (##p# 4#pid#DK#6#uid# iA#iA #$ ## +#^#^ #^#^# Y #5#65# ^p #)Rd#*Y5#+45#,5#-!A#PI0### # T#}I+4#C#c# # # x# #(# 0# 8#1@#H#P#X#`#h##p# x#<#<#<#<# d# ## # # C| W\ fzku   h)* 7+ 7,aV- .@ /+(0 09 N4:J8< @=4D> H? P@XA6`BC:E F6HIK RQS|   R+$A#', ~TTM^^Y## #pos# A# ^ p p#[ pM[ E^ L6~ ) epTQ 6~pϋj p^+ pX  p p\ p (p FpFK - +xp++++UbX Sp[^ p[S^ pa  "p7op' dpp^< pp^i ^  ^ ^ M 1 jO~6 m#T Z~r   M Z :ZN g^? el E^ˌ # ^^   Cp^Z fpZH jk j   # #mt# \a# + &&C^#T cPTxh b} P P0 P   #P# <o( dP#A PMi  P=    Mv"#+(bioa# f R 4$8 @.HP^X8` Bhpr  t Gx * 6 . Ellm     "  BMB (6E6FM mod6G$ ops6H!6I 16J6K G. #B"6L0arg6M 0str6N'0arr6O 6V"6W^6X#" 6\{ max6^^6_^ num6` ops6a!6b,{\%y6&\%y6&\%,0(R)} 7+  + . ^  .2RC+7 `$-$.? mod$/$@$0:H mp$1P$2KX  8$5$6$7 $9 =$; R $<f($= v0 #C =MR$MB f$Wv$kC^$>c8$E#mod$F$T$GcP$p'$q$r$s~$t^umtn$w $n$ n$^$#$#" sx@G ]}+D''  aYsdmY  MM+"#8^-OY YX #buzr "# "M^^+C^9C^c8 0!z" C^1C^B?C^Occd&e2f4?g~ #lidh~ 8   cma   c2D/8^dXA8^E NT Ze_ ww l++;I I+XB+"s+/%e(0#vma1X 2 O3 +4+5+ xY>5? 5@ X  X + +X  NX +++0 wgw^S ww++l +X  X + MX  X S S X +% _%X + JA #ref* #dom !6"C134567X  H"227 JL\MXN`O!hP!pQwxR^ ageS^ 4_^,M$N 7P^R^ T^ 0;# ; CD I NSE eAB C% ` ^  ^"$ ^$ ) 3 =ڰmnoip^u#w x `z { ~^84<R@M\P\pxLڰ+B+C^E     "#$C^g-      9 MO Yi H 4 a (wZ0-M iyqL  @jk lenl wpmn}o}p}q}rs t(}+}+8m t@uvwxyz } ^W   (0 8+@DH P YX` hp$x LW a ki z H? ~@^D&HA  ^A] ^hAijk+l+n^o^p^ q^$r^(s^,t^0u^4v^8w^<x^@y^Dz^H{^L|^P}^T~^X^\^`^d^h^l^p^t^x^|^^^^^^^ANS ll^ P? 7@ 7HqB+           " ,aC^0 #^ aV@aV @^+ ^aV^ !!&   D~0Y+I aV7^A^ #aVb aVq"a  aV_~  )8^u 02 3Mu+96 08:=M?^E & I @( ~!!MM@!MM+hO PMQMRMST VdevUS|PV.@WYKHXM\hY\ ] ^ _ `^E Ϗ? idϑE ^   ѻѼ*ѿѿ oK idW segc+ kK idW K id ?.  idWK. ;*> +|ov 0rw k! p  u>   #id p wreqv wrsp @` ???? ` p @p +/  B+  ??^ X/^X0^ J KR kPL QRK idSTW segU X YZK id[\W ] ` abK idc ?fC gh idijW kKlm. u7|kz{ 0rw{" |'L }% ~(  lx y uC {  o҄ ҅҆K҇ id҈҉W segҊ ҍ\ ҎҏKҐ idґҒWғ Җ җҘKҙ idҚ ?ҝҞҟҠ idҡҢWңKҤҥ. ҭ;|oҲW0rwҳ" Ҵ' ҵ%\ Ҷ(  pҰ}ұ uҷW]Һ0reqҺ 0rspҺ  @ҺҺ?Һ?Һ?Һ? Һ` Һ@B+ ҺZҺ?Һ?Һ^Һ]lҼ0reqҼ{ 0rspҼ  @ҼҼ?Ҽ?Ҽ?Ҽ? Ҽ` Ҽ@ZB+ Ҽ2Ҽ?Ҽ?Ҽ^Ҽ]pҾX0reqҾW0rspҾ  @ҾҾ?Ҿ?Ҿ?Ҿ? Ҿ` Ҿ@2B+X Ҿ Ҿ?Ҿ?Ҿ^Ҿ]H    8^k  KEp 7^^^^^,Hw_ gnt*6 +~R 7 8xp* irq^   4(#wqwZ0 H ~LP ^X `4pwZxK7^ ++"#M\&(M\0*wZP+h.0 1^3H#vbd5k#be708 8:YK@; `=M\h>^? ~A B^C+* wF;G+H^KL_MN6O* m@X_Y #idZ^[\ ]^_ `_0bt0Jsegc8d8e 8 f!88g 78@oo+;o++#++_+ t #devuvWwxW>A Y0+ >B0 EB Yo+_EBo Y+WEC >Q Y+>R ER Y+"ER YA+G1ESA >[^ >\ E\ Y+-E\ Y+E^  f Y+ >g Eg YN+>EgN Yx+nhEhx  p Y+>q Eq Y+ Eq Y+N Er >^ Y[+ K>[ E Y+E ' ' Y+0F Y+ F F  |~{?s+eS ( F7K7H ,F7A7H .F7f7?t^H\E?^@77O?bf77OH5#~SU?f #O?w^Hgo  K+S ' $F7 ? 2IO? 8jiO? ?OHw^HwH3, M"?J ~ \H\Sgv Kf12?҈R%?҅s%fj #St=^f! Rfy#f R?#_^^S5$M~W85US;US=l:fu  JZOZ?9  ?u  JZfu JZZ~?r#!p> ~HuU! ^H`#~k!f ~!S!w^?!2q!%YOe #irc0#_f"'{# '5# .*"+IT -[+ -#U Q4%qcY0#+ #{#q $K2 Zid<^ZopZst$+$$++3G$??  p$- ւ$;U~R$U~  4  &! 8 6req &! &1seg&^1bio#&1i + 4R~&` __&&F!# &!!~a&FF# Q&FF~&Fi# &ii~Fx# &xx~v #o4l'!' !;$Q'1req^1rsp^1req^1rsp^4(!) !=$1reqv &1rc ?1rp?`0 _.('{# '5# ~(~~~Lh })6dsth8&6srci)})1ik^1nk^)m&)tF)x^x^U)++}L3 3*6dst38&6src4)3*1i6^1n6^)8)?)C^C^ *SW+W+W q- bZ.Zbio-)# Z./*.h.u.&.8&V+J+҅h +g  xgG) /,*#/)2/+3/KsXY.h  7zIT QH3l8Fe# a7e3C8e~[u:+ +)~::U T U  U~ T|#$;U|T0Q|R{~!F;U{#Q1k!^;U~%C|;+ _;+ Y;+ ;6Xq C=K4 K0&Znum!' C=}'|;|^iret35=^3<@<U~TvQsR}X|=U}T0Q|R|~!U|T|Q|%S=+ L =6req=&!2 &^q @K6K]2& .8>J+҅h +g  xgG.8?J+҅h +g  xgG..@…kI! [+  ́@߁< - U @~!@Us:#@Uss@UsTv U|^yCK K&Znum^K!Kwii^^ -A- ?aBdLXp[ǀ 1B؀W&G<|-||&[[%Ci+Q+s}ZCU T U |!CK|3 yCUsZ UU#T0*epZarg*, -ivbd.ep/+iret01~2^r\3^F= 3D= ~% 3,Fr= '= Yw= 3E= 3vE= ~%  EUTwQ1 U| EUwT0 EUTw FUTw UTw+Lj= %3HC 3FC ~.hC Fz*% 3MHrC 'C YwC 3GC 3GC ~.hC G-z*%  GU|TwQ1 U~ HUwT0 0HU|Tw U|Tw+LjC %3IT3~IrT'TYwTa(BIT 'IU~TwQ1% %  aIUwT0 U~Tw.Lj TI%% a I^+'^7wJ^+^+4Jd+d+3[Jd+'d7wa Jj+'j7wJj+j+ &P f& '&'&' l'e~''&''w''''' XtMjt&wtt K-.h?L-z*)tZLt HMWj`Lq&}U!U}k̃ك* ւM-;MUw0T~;Uw0T~RUw0 $]-$ %%&$%1%=%J%V%c%m%z%%%w%%%:%:% 0dTR00-00&00 11$1.1;1E1:R1)Z1P_1l1 !P2j P<# [wPgk *1*1*1 Q-[  vQ+ k~gG1QUTwQ1R1;QUQ1;!RUTwQ1;>RUQ1;U)&&S*B&)Q&RR&$!R .X/T[f/s/ ZW$D2=<̆ֆ.Z…kI! [+ .%[-…kI! -[+ -  [W$D2=<̆ֆ[U}T ,% )a&\*}&)&m\& C=}>|;|nF7> 7{az3zU{a&{aE{ f{- ?|dLXp[ǀ {؀W&G1|U}I|U}c|T{%k!|U|!|U{~!|U~TQ{%= T}$7 $7`d} _rs" >{# >5# Yd}+T}@~$I $*99F7`d} }9 _rs" >{# >5# @ ~$6 $"tnew~9 F799`d} ~9 _rs" >{# >5# F7@~~$B4^!I4^86qM84% ]!I4%7}!%=4s#!s:!t6opft%!t0O@^$6^9 ^9 ^ =!$0@?$._=}$4$Gg$$&6=ǀ7map0$Ag$7ref!*$.@$#4!E 4 |.h! |D! |PO ^4 %^! <! ~ 4 z0-́! zCO! zX+4~!6H\4~6wq8\!H\= ;K$ ;1F7$ ;GF7$ <~3~@"~7p"19$~F4s&+6msJe4s+Ȃ6msBeL ! @r5! T+ + +4 D(5;! DCr5S+R5+H +h54s!s6u =$/=̃$7=$2$K=#7new/$F=`7new1$$@j~$jFtretl~9o9p@A~7newA@$B$CtretE~@H7pfnH9+@&+*7xH+ty+R%^4d~V6vdVLNu6vNVL6vV=A7vAV7iA@ͅ7vͅ4~6v#VL 6vVL$6vVLI6vV6i!4g6v!ͅ@ A~7v A@Vtc C ~= :7v :7V= 37v 37V= 7v 7V7i >@ 7v =ͅ#~!#:!$!%!&!'!(mU|UUUUU\·U\އU\U\U\ WW(W7WFWWW\gW\wW\W\W\=Lj$2M$<$^G=^7v^O$^Y=P7vPJ$PT=BA7vBI$BS@ "~t7key "Jy$ "Z (t@\~tc^ ~=M7valM59Oԉ9O9OE9O@,,h91 "91 491 F91 'X91 E91 ^=7ptr<$H$@,~Š7p,;$,K^@(~7p(:$(J^stt!t.t  c- b W#0<HjK̈́&لfU~T}Q@*T.hz*.ւ  ;U|T s vtt&G!tG.t0!UU#xT3Q1R0RU|L+++M+^MLWLc {L L L L int c ,L *L^s8o^u8^s16^u16,^s32;^u32J^s64^u64c2  L +  1c 2c H I X ] ^ _ `W(LL <c  J L     #L % & 4 = B f" h; l m, nJ qc } Y  c  c  c  c  c  c +&  & Y !IIIN!IWc+) c+W;   % *i4H 3 M   "   f( %0 P8 @ #H #H #H ĴH #H #H #H #HE@Q LRZP\h)MM c5Fkp c(c,0 8@ABcD H%Pymem@+ c@ ((0c8@cHcLPcX`chp xcc%c,cc& c!&"c%&&)9c:6?AD /F P @ Qc(T%03; Ics=cIsl?cIwfeAcE, IssGcIstiIcKcInmiMcPc Sc0Vc8IlmXc9]c:dc<Y .cs,.csxc^  .ss,.ssxc g r15m+ r14n+ r13o+ r12p+ bpq+ bxr+( r11u+0 r10v+8 r9w+@ r8x+H axy+P cxz+X dx{+` si|+h di}+p+x ip+, + sp+Y BD C,D,E, E,(IsE,,IdplE,-IpE',/F,0IavlF,4IlF,5IdF,6IgF%,7F+,8 + + + + +& pteD " & pmdP " % %%t ;%/ o' "pgd'h ;'" op /"pudp\ ;p";IN)@HI+MKhth0 4+8 e f+ g h u v; w; key x  U# V  j@"key k n]"key o!;!<"!="!? c !@ c$!A c(!B c+E-@" y"4"c"c"  "8(" c,"!c0"( 4")18"*cH"++P",yX"5 `"6 d"8 h": l"; p"< t"=cxpse"?D@Frt"@xEydl"AF"BF"FHN"I5"J+"Kc"OH"XH"]HN"`"oB@"d"hc"kc "l+"m "nH "oH("p)0"q X"s`"ub"x d"y0Hh"zp"{H"+""" "" "" " "0H""" "pA""5(N"5PFmm"!h"!p"Ix" " " " "+"c" c," c," c," c-" c-" c-" c-" c-" c-" c-" c-" c-" c -" c -" c -" c -""c -"+"3Fpid" p" p"+"y" y"""y("0"@"BJP"GJX" ""J"% "( "+ "- c". c"3 c"4@"6@": ("=+0">+8"A c@"D cH"G+P"H+X"K>`N"N>"TK"WK"ZK"^L"k 0"mL"p4 "q4("t+8"u+@Ffs"xLH"{LP"~LX"M`"Ph" Pp" g9x" g9" g9"<"+" "c""P" P@"c"=8"I=" c " c "W5 "# "VH "R6( "y8 "P@ " H "-QP "QX "Q` "6Rh "@Rp "+x "ER "> "c " c " c " c "8 "? " "OR " " J " J ""YR ")R "  " R0 " 58 " cX "R\ "R` "5h " "R " " " "  "!c ""c "# "$+ "& c "' c "( c N")c "3R "C& "D+ "LR "N+ "RR "SJ( "TJ, "Y+0 "] 8 "^ < "_ @ "` D N"acH "d=X "gR "i= "lR "w "x "z+ "} "~R " c" c" " "&""" " "+"c"S"S"_U"U "c("c,"xH0yrcu"c0"8@" D"yH"7P"\Vx"8" " "fV" pV"zV"" " c" "">N"c" "!"1"$"1N".c"<VN"F@@+?E@@# #0"sp#+"es# "ds#"#$#&#+(#+0#08#+X#+`"cr2#+h#+p#+x#1#+#c#J#+#+# 0pfpu# 0@c ($  $ ) !E@@,!M'o@Ws@   @!_K"M m! >m (,m0Qcm8Xmh%np+x0l n*Rn5l/6%t"%%6%"%,%,%".val% /P"/t"%"" %,"6&"&&" #+&'#& /"& H# #&" &'#' #' ' # (( )#)" )# *($*#*** **c*+,+$"fmt+M+M+M+c+M+M$($z,6$,7#,8@)8,-%,M,M,M,MR,cR,cR,4c key,9$(5c,=V%8,U%,V mod,W%,XM,Y% ,Z (,[ ,,\-%03M,u &,v &,w&,xc,yc$V%+W*&+ -/l&-1c set-3 get-5-7 $2*&jO(%! G j  7( 708!@" %H# CP$ CX%\`&uh'p(ux)*ϭ+,-$./ L0 t1 23 ɮ5 9 ; B>?e@q& .!(.% .+ .-./ / (/!; key/";/?(/A+/B!)/C&)0!)0!) mod0%0&)((/=L)/>(5c3)     +)+ $ ; ) $?) *+ 1 c3*     04c +4dM4e4gϽ4i 4l (*57+5c end5c+6 +6 p7+ cwd7J swd7J twd7J fip7J fcs7J foo7J fos7J7+7JlJ++67* , rip7+c rdp7,c67.H, fip7/J fcs70J foo71J fos72J 7)\,/+/ ,07@~,7A~,7B~,J,+ f7$!- cwd7%, swd7&, twd7', fop7(,H,75J76J79!- 7<1-7>~,\,J1-+JA-+?7Q. cwd7RJ swd7SJ twd7TJ fip7UJ fcs7VJ foo7WJ fos7XJ7Z+7[l7\m7]n7^o rm7_p7`q7a.x7bJY#3.+cC.+@7:|.7; c7< c7= |.c.+E@@7O.Q7P,7QC.7R.@.<+@7^-/07_S+`7`,07aA-`7b.@07c-/?/+E@@7f/7hc7kc7nc7qc"xfd7tc7wc7zc7c7cQ7.@@707 c7c7c fpu@707c7+70707/ 7/0Q7?/@@?/8 08 c8cW0+W0+? 0+00+1  1) 9b19c9c9M9M9M+:+:+:;81;91;<1;=11<<1<=c<> <:$2<;11 srcU?U@UA&US:UT &UUUV& UY;UZ &U[ &U^C;U_+U` Ua UJ;ULUQ UW:U\:Ub;& UE;UFC;&Ug;Uh _fdUi&Um;UnUoUpc \ U%]<U*9U2:._rtU9A:UBr:Ud;Uj;Uq;60V <V V V V ;0V <]< V< <V <V!V" g9 V%/=V'9V(+V.9V0 g9 V3I= saV4< W =W (W + lenW +W (X=X  Y$=Y%IY'Y( 0YD>YM#=YP(YW)8Z y>ZcZcZcZcZc Z#c(Z,c0[)>[*c[+6P[8>[9>[:cH[;cLy>>+)8[D?O[Ec[F5[Gc0) \>?\K\Z\p\\\ end\?W?<+]!?]" c ]&?]D?]D? ]D?]E?]E? ]E?&]T -@]Y?]Z W5 ][ @&^ P@ val^ ^ 9@&^ s@ val^  ^ \@c"1@"S@"U c"V c"W#Gc"[@0"hpA"i?"j"k@"cpu"lc"mc"nc "oc( "A"+""""A"+" J_@@"oB" c" c" c" J" J"+ "+("+0"c8E@"D" c" c" c" c" c " c(" c0" c8" Y@" cH" cP" YX" Y`" ch" cp" cx"  c"  c"  c"  c" c" c" c" c" c" c" c" c" cE@"iE"AQ" 5"! c("" c0"# c8"%@"&P"'Q"(R")S", cX"- c`". ch"/ cp"0 Yx"1 c"3 c"6 "7iE"9sE";sE"=+pavg"GA@D nE0"KE"L"M+"N+"Oc "P$"Q&"SE(xE;"]EF FFF_"`wGQ"a5"h c"i c "j c("k c0"l c8"s Y@"t cH"ucP"c"c"c"c"c"c"c"cQ"6XQ"6"rq"G"E"wG"F;"^GG yGFrqG"GJ"c J"c J"cJ"co"0H"""""VHqb"Gqs"J"sH"sHVH" HH HGH+)) H_I~9w[ M@ D HR6P+` +h)p+x W5[ Hpidp_7BJ_9 8_:c_; W5_<z ino_=c_?v _@@_B [HSrcu_Cc`_DpI!WJ+ J c V\WJ)`oK`p* uid`q P@ gid`r s@ `s P@`t s@`u P@`v s@`w P@ `x s@$`y c(`z0`{8`|@`}H`~P`X`L``Lh`Lp`Lx` ` `>s`<`%MJKkeyaLa8aM0a" sema[(a,Pa XQ`a h uida P@p gida s@taxa|a~a a+a1K L L L L MfXb^Pb_8b` babb bcbe [ bhy8bk<@bnXbq`bsdbtyhbwpbxctbzxRbcRbcbcbbOb6b ) itbbb>bhb bBJb]ttybƍbЍb -@bcb cbcbcbcbcb@b+b+b+b'+b+ b+(b"+0b,+8b+@b+Hb"+Pb,+Xb+`b+hb>pbbՍbYbb cbbbbb!b5b[0 Mr bPbW5b8b [bI P P Pc-QccQ@ Q x x c  ( * , - 02Q QXdc6Rdd*de dg dk W5dm9wdnP(do0dq\8Q ;R< JR TR eRee϶e۶^R RR+ R R R+R+? R R8 S+  S Sr0 _U      , . 9w0 t@ (H KP X ~`  + 5 c]bdi ~  Դ( h p  ]ev  c c c & c W5    \ ]]cdi  ]bb  # c  ((!S)hfyUfzbf|cf} dMcf8c(f70f+Xf#%d`dU@g4\Vg5\Vg6 g7+g8+g9ss g;c(g=c,g>q0g?8U aV kV uV V+h#+h+h+h!+h%+h'+h,+h/W5+h3+h5+h9+h<+hA+hD+hH+hL+hQ+hU+hY WiWiiii Xi!%i" /i$cHi'Xi(M keyi)@i*Xi+ i,(i-0i. X8 exti/X@+)WW i3) i8X tpi9Xi: i;Ji<JX >; jRZjJj djcj  jcjc inoj)c devj* X(j+ X, uidj, P@0 gidj- s@4j. 8j/@j0Pj1`j2pj3cj4cj5Jj6Jj7cj8cj9Jj:Jj;JbZ+ k !nZ(kZkck kZk  kZZ ZZcnZk# [k$W5k% k' Z@lɔ@lʔ@l˔mW[m 8+no o"e[o[oW5oj[o[v[oco(p0\p1*p7* osqp95p;#p<@p@p@p@p@pq+~\q,#q-VL7@ r \\\\\ r\r*rr\5c Y]+5c W]k@ X q] r\ s7 wq v]H cpu wP ]{ !]xsB^ssB^sR^( lens*Hsb^Psp]R^++b^+r^+f@tM_tM_tM_t OtW5@@t ]Ht!+t"+t#t$7t%\t&c t'_0t(+8]cput*@]sspt+ `H*]_+`t6_t7W5t8R^t:R^(t;+Ht<_Pt=Xt>\]_te `tfc sdatg`ath#tiea_rxtDPatE_tFPatH tI5(tJW5HtK5PtL+ptM+xtN+tO+tP+tQ+tR+tS+tTtU+tV5tWWJtY t\+t]+t^]t_ `p_`a+r^`+uvav#.v#.&v"av#;v$v%&v'av(v)&v+bv,v-v!Abv&av*av.a vhbxa opsvrbb hbmbv2bv4+v6cv7c 5cf@b5cfHbfp3cfqbfrfs8c 3c6facfwbf+fcOfcf+lfc/=cac)@f dfbf+f+f+ f (f,f d0Srcufc8fQdHcAbfQdf idf*d`d<+f{dfd {d(wdw#wYww &x `excx& x)[ ldtx*ee8x.+@x95Hx:hx;tfpx= xxC,|xD"~ `ey ofyy+ alty+y+y+ y+(y0y8y@yHyPyXy`yhypyxyy y!jeof xFd6\f^ `cXf.lruY/fdeifj +k+6(R.gfhIfs+ 6(uxgz+ pp{}g|+}+~* xg6g+6gFh zFhzt refz8zWJHzEhzclz+p opsz Hxzz-gl(Qth/f/.g/g/gschc o h"val+;haMhN PcXJiqlruK/hXW%i0X 0Yha@GiI+hUIV + i([ 0\ 4^+8m@Fi/%i`jNa(mjn+o+q r s t vc m@l9j/i`zNa0}j~++     (a j++m@|j/9j/j`N_DkMiMj@Mj;+k_ 0l  W5 e  I  ~(c0c4K8@zP p  x#ߧ$ % 'M&k5Rl"ctx6Wl Rl=l><[@?(XlY[(\lb+h+t=w }$a m++m>m/l`cXcm0!k0k mprb5+l m{bn{c {h {j{k{q# {s({t<0{uZ8{wn@{{H{~P{X{`{h{p{xmn\llnc"cid @@ n o 'o+ S@@sMn@[@+P+X+`+h+p"pgd  ,!x) 5 ?sE+LcS Z#]*_aW5p[r+++++ +(+0+8?@W5D+H+P'+X3+`+hFbrk+p!+x++%+0+ ss@/syf+hW5p9sxy>s0l&Hs++  `d*\Rs++* nn+s+3d*s+ *s 4sX Cs Ms+fs<+; cI}sp{/t{7t("pmd{9 6!0"pud{; K"8@{EIH{FIP"pte{L 1!X"ptl{PV`{T <hGcmt @kkkkk@|6@|9@|<@|G8zuz+z2z2z+z+ z+(z0}v}}M ops}@}  }c(}c,}50}vP}X}` gc}"Eh dev}p}x}v}} }}}c}9w}uivP@s@~]v~~5vv bvBvDvEvF%wG4wHrwI]vv w I!c"c v w *w/w,rw- W5/ M09w6AwvK :w@5v/wwNwO+PQ (++x,-./ ww 0pxq0lr s ,t u v,$(+xw"x#x&x'x' xxx6yW5 l)ys/x)>yMy63by4J len4J2}y/>y6c1yby8}yiyjky [rys!txsuc)RzTcU?VxWzX}y Y~0[~8_"~``ha+pbxOd)yym!nSd_uvyyyEx{~| d}~ P@ s@c !o (I0 8+@$H XL P X ` hJpJtJxJ|W5A AJ[++!y,, I0@H P T X \o`hNHp8H P(X`h pz~+')@~ՂՂ 4 H( X0 X8 m@ HP6XO`~~E@ X+  P(!թ0!ک8ߩ@"H+P+X+`zh[p &# $/4x  t 0l ~ !c (N` J!J"/ 0 14 6c<5 BM@D"~HFPI*XL`O dR]hSpZ>sxabyrcuccd\f5k0NnW5@@oHqW5Xr`~5c Ղzc z}yڂ cMy 4% Hz9XzMmz~] (z(r E҃FzGHIZ  mnt  z҃ 11 zOz; "#M nid&-+4+7S)RsSUXYZ cc 8 dWJ(SrcuecHgXj` idmpptqMxrzu +Ts*034F678  xa99w   " $W5)@@-F lru/0* _2q nr_3 ns_4q4+K<+& valc #c5c   O  ^O@+  a a)alSrcuamcan8ao 6avax,ay Sau+/.xa+(arsat+a}aaM ss\ aaa ˆ+ aΈӈ LLxa0aˆ keyaLa}laQasa5asa a 6(aa+a+a}aa ( (aىa+/sa aaa oX a0a/ى  ' 8d+0*8!@ uid P@P*X `$#h`` 8` gid` s@<+l` `rcu`c6f@@Lg)Lh# cpuLicLjcLkc LlcLmcLncLocLpcLrcLsLtLucL{ ) L|a7(L} )0L~a78OL8@@*i).|k7@I+/=Y+?8bŒb b! b"+b#cb#c b$+(b$+0b'b(cb)cb0b1 b2 b3 bC:bDbLbbMybNb:8bQbR bS:bTWJgŒ+BJ+  ˍ8+  y)0W [Oc )` Srss  08 [@ X ͎ fn $2 arg ݎ+& b͎ ݎ  JdS,dTdUldWMdX!sdYc)8dI qdJK iocdK6R M, d\c0E F      +  c( c, 80 c4 9w8 H #X #X #X #X #X W5` d _Uh p 6xFdev ( 0  4 -8 7@ 5HFid h +p Ax  7 \   K  8 !` " #5 &0 (W54 )8 *]H -UFfq 2_ 3 55 65 75 =  >W50 @4Ftd Di8N Fc@ K [P P5h Rs S Uz Vz Wz [5 ] M U& v val _& val  <in+vY)8_T`*aTbTc d Srcuec reff0& s v + %^ c!c'c=c AM $2GcT4++ {n5 v&. 0  4v 4Ε5c6Ε7ޕޕ+   P@ v@ s@ Pc d  (8 0lHЛ(u)!*+ ,0-5@. W5`/ d0h1p2 x3+4" & val u 5c6Ǘ BE.uidF P@.gidG s@H D"ӗJH Ǘ Ǘ Ǘ Ǘ Ǘ  Ǘ( Ǘ0 8 @H(o+ c(c, Ǘ0 Ǘ8@ o!%o(@89 : ; < = > (? 0@>8t   99%XDE FG H I J (K 0N .8OL@QeHS>PC  ))~Ǘ G~G3 e~)QxYYZ[c\c]c^c _c(`c0aY8cY@dHeLfcPgcXhc`iYhjp8cccc ccc"ino  A( A0cY/+ ccc ccccXWz  (ٞ08ٞ@HP z1\ c / ԞԞj 9Ԟޞ j8 u c [ u0 HFops! ~+++Xwʟ0}0 83456bZʟ ,xX{ ˡ ^ (¢0 ۢ8 @ H P 7XZ`nh p xģ 1 qIqv ] 0lj Iq ˡIۡۡ8D^E0lFI"raGI +Jc Kc$L(M+0С 0lIc[c ¢0lIcc 5ۢI5Ǣ M 7xx# ZI< n_ s ģI 0l 5ɣ0l xxXXI0j0cmo0`cX0!0 O(~X0R00 (0 c  E@Zj[\į]^` bF(dd0e}8f@hðHj}PkXm`o;hphpr xsu̱vy{5}Xܲj t ~   (0l z5"pidBJ4"uid P@P@ $ z +cc cc X 050 cm )ߧ`*c0+10,0-s;PE0?  Q?|WP+6Щ   )B V( 0 f8 @HPX`hԳp fx  =V o o fUЩW      %*f)t* 5+ 5,_U-K.r /+(0 09 X4:I8< @=W5D> H? P@XA5`BCE F5HIK OQ9 y  W+W+$;īɫ Mcc! "pos ; c G0l. j0l(&vL 0lM&vo xc  x   k 0l @0l  C0lc+* \0l;!H u~0la 0lz 0l ϭ0l 0l ԭ +0l++++W LR0l&vc) t0l&vRcQ 0l[ y ɮ0lޮޮ0l ή 0l0lc B0l0lc [[c` G [cj z~zc Mz~ Z~ɯ ~ z( FZ~zd# dz~zK }~zi Z~zM ðZ~zd Z~zdXȰ Z~z~zc 6Zz6@ cZ1cJcX@ z(m ~cc  ̱~ ~z0lcdѱ Z~0ld 5Zz XZz: vZzv{ ] zv Ȳ"mt [ + ײײ~ȲGc ~)~ B~q. V~Gf[ k  z  Գ ( ޮzٳ ( =M QQ~B o[  t  zPM#Դ+@@AMBCDY E( sdF0G<[8RIcRJcRKcRLcRMcԴԴbio϶t A O 44V8 @`HPcXj` thpr  t yxIN * ; . Jee۶    ( 4 ޷+76 rev+ ޷)  MSrb5 ns0c8< d>ݹ@ idc` hpSrcucx  opsι!ع hɹ "$ /% M & b(( 02 89@: H= P@XA ջ`ɹ ӹ  .dir¸  ٺ kn0lޮ 5 5@`h (x    @  A %n ٺ ޮ /ޮ&v Mޮ&v4bޮR (g @ ;! ջ5c0'Y(ڻ) !v* c+, - $2(i^ ww| hi44M4 d4mڼ4nz4o&X40u4142 43 44 45 )(47 V049 )84; V@4= ~H4?Pڼڼu d dϽ ԽiI )0l( V0l(. ~0l[ 0l;!4Ѿ4 4  (־ M`Y W5Դ BX0tu ϿvԿw!ٿx*y z *(^ϿĿѾ޿ + Y *+v0vr }~]buf (+(+?W+=  M 33/8 [M[(-E-FM mod-G% ops-H!-I 6-J -K `G ([-L.arg-M .str-N@.arr-O-V;-Wc-X(; -\ max-^c-_c num-`  ops-a!-bEl&{-&l&{-&l&)0(O)|5+ +G c   G]W\+7`-.Դ mod/%@0H mp1P2JX 8567 39 V; k <(= 0 )).(\ V).M8k%M[ %p%Gc>_8E"modF%QG_Pp@qrstcpmtnw  c(( E`|+T(@  X `X ,MM+1;($5czEtzNzT zZzetI fsxs Fh++z6zzz+-<+zHz+/a({0"vma{1;!{2 M{3 +{4+{5+ MX{>0{? 0{@ ;! ;!+ ;! #;!+++ fs<xsc( fsZxs++A +n;!_ ;!+s M;! ;!R R;!+& I;!+5c '  h?D 'X)@z{3| }~3 y(0 irqc8c<+@+HMP dirXX @8 "irq c<[\ ( 0H*<[023 4c@Gc !!&f@@CDEhFGHIcJcKcLcMcNcO+PcQ RS#TU W XZ)]+0^ 8_ [@acXbc\cc`dcd]dirghrcuncpoԴq5rs%tMv!5c?@/0 ops1" dev456(78?? get, put < Pn P ( 08@HPX'`@hrp'x,EԴ@"pZHMPX"busP`h p x5Q_dn FmsiG(}8=@cHcPX `hx ( XFidJW5 ,!!ٿ# $%'#)+ `, a- b. c/ d9 e< fQRc idScTPfghci3. ,<1 PA iiU s M Mc M% M  ' @M, mMMccmE w  c h7cc ))@h irqcc dev msgg (0 8@ ,HEP78HJ irqc}H+v 0( 0j+MD T T T  T( T0 T8 T@ TH rP X ` h Tp Tx T T T T   T    * C  X! m# $ T&+M cD05T0I r0 Y 0w 0c0ޮ0 = 0 *0 C0/X0cHm0 ] cntcr 5c" ,$ pin-./J@0JA1JB4f567+8 (RS.uvT$HIJKJLJM}N O P (f00Y+++"ack+"eoi+ +(jPM8J@JD 2Hx!"##$ % &  ' ((c0)c4*J8+J<,J@-cD. H/+P0+X1v`2h3 x JJY<+Gc@I RScTcUcVc WX "gcY <+5c ?     \!e"c.ptr# +  id͎e clsqȲ @W+W#+^3+#  J ( D0(1M2 83M4?6X7`8(h9(p:(x>+?P}?b}@}A}Bb Jr+P}e}f }hC map}ja}k v}l }q(}s 0}u8}v @}w;Hr v( >v>-% avc}Hvvcf v(c& T{ vccvcc v0v0 ;v>& I ?@JAJBJCJ DME +Jv0<+ 6@JJJ J JJ[/Jo@ [6 J!J"J#J$J%J &J 6(E)J*J+J,J-J.J Y/{/mE 1Y67J8J 9y>? J@mBC JDFG JHom7nJoJ&qrstuvw x cz{|ly7\c.ptrE?g.pci ijk Km nllP[ < V y  ( 0 8 @ H }ootH Jc"ops+  ( 0M8 @[ <voc}VvocA yv[v~ vv v> } +vvo ;c @f(+++++ )0Srcu1c2<[3Z<+ HIIIJK LM+NWs :i; <N  !"# $(%0&8'@(H)P*X+`,h-p.x/012345u GU GclPHxy W5zc|c}5~0@ E8iJ  J !J "J #J $J %J &J 'J (J )JW5 WJ  @ @ A B C D EQ6Pc\ [  c                c cccc  0(Fqos:0+ ,M id-./W5 0(1702+X3 )`4 )h5 )p6 )x7 )8+9+:+;+<+ dev=R> R?  P0; 5"opsu    cMNMOMP!ٿQ!ٿR!ٿ T(U-0V8W @X HY P[X\`^Fh_paxcd pmfKh `aM busbPd%eMg h$j(k0m8n @oHp PqFXr`s!ٿht!ٿp pmvKxw py  -i3 Fi2`23M5!ٿ6!ٿ8-9  ; 1(< 0>8@(@AEHC _P pmEKXU (id,,! Ei6_i+v0vJ0XYMZ!ٿ[-\ -^ pm`K(d5c-   (-i+v0v K(2 nMPcc+GcGc8G 0r!v"w rGc1GcBGcOcUd&|e2f4g "lidh U? i sx scma   +@/ J;1>3457 HOTddiJL]MXNC`O!>hP!>pQssxRc ageScW5Ic)MVN 5PcRc Tc bm m C D 7 I G N[ S[we A B C~% `c  cV (cV [ e ovjcnIcocpccu#*cw cx `cz c{ c~c8cW5<cQ@c\Pc]pc!x~v]<+ i }M H W5 [ ( [0]}  %@jk lenl wpmnopqrs t(++c V5 m& t u v w x y z } c        1  1( J0  8 m@ H  P  X `  h p %x   "    H  Դ  @ cD &H;  c; ] c h i j) k+ l+ nc oc pc  qc$ rc( sc, tc0 uc4 vc8 wc< xc@ ycD zcH {cL |cP }cT ~cX c\ c` cd ch cl cp ct cx c| c c c    c c c c &;  c/P  Դ  5@  5H<+      ( 2 < F P Z d n  # #Gc b c _U_U 1tc+ cJ_Uc6 ctch O trt+ _U5c (_U _UT#  "_U7t'Gt< [tLk`c+5c02 3M+1608Z:=M?cE x I ( ssMM ZsMM}fOrPMQMRMST  SdevUPV@WWJHX\hY\ ] ^ _ `c ehwl[mM idsn![opqys  u (v0w8x@y Hz{|  tt[`t~t t 3rƏ idƑJ c  ȻHȼȿȿo id seg+    id\  id?  id ; +zo& .rwH  !\ pL  u  "id p qreq& qrspL @    @ +/ / <+ { c/ /c0cJ KWkP QR idST segUXL YZ id[\ ] ` ab idc?f gh idij klm u7zkz- .rw{" |' }%L ~( lxS y u oɄ ɅɆɇ idɈɉ segɊɍ Ɏɏɐ idɑɒɓɖJɗɘə idɚ?ɝɞɟɠ idɡɢɣɤɥ ɭ;zoɲ.rwɳ"S ɴ' ɵ% ɶ(Jpɰ*ɱ uɷ\ɺP.reqɺ .rspɺL @ɺɺɺɺɺ ɺ ɺ@P*<+Pɺɺɺɺcɺ\lɼ-.reqɼ- .rspɼL @ɼɼɼɼɼ ɼ ɼ@<+-ɼɼɼɼcɼ\pɾ.reqɾ.rspɾL @ɾaɾɾɾɾ ɾ ɾa@p<+ɾɾɾɾcɾp\ 4    u5c J0l 5ccccc)H$I gnt +O5 8rp irqc  W5("wq [0 H LyP cX `W5p [x76c ++"#\&(\0* [P+h.0 01c3"vbd5"be7 08 8:WJ@; `=\h>c? ABcC+P  devt  c@ cD (H$F?G+HcKLIMNOj@XcY"idZc[\ ]^_ `c0bx0Fsegc8d8e 8 f!88g i8@ss+?s++++I+b b  ^+b  ^E+ 5E ^p+=`p l l l l l l l 5+% % + l l [c ^+\ Y\ ^+'Y\ ^!+iY^! M+=&M  TƍTqE MV\#Z %ZZ %AMT '0lA4C޿A__A e0lX, Mc,ˬ(M,˶(M,tsxMV,(+MM,ƙPMM A cgt,ƣ,ƢA" yAɂ, y^MV,IA xtA rt50lTRtMVAɁ 'n,*tB3+M,tc[,5#T=#A2#MA8DMA?`MMTZɋ\Tk> MZ8<, (+MV,ƫc2MMc,ˠ MMM,ƧsMMMVZ.,tTtMV,t,+MV, M A J " ]\,`#8 ZɃK ,f tT6} c,k c,X y,  (MVZ _Z4!޿Z!Tƽ)!sT,A! &MVA+X!j,Ƅx!%MT4!iMV,ư!MMMVZ!AP!Mc!Y/"~U #|"X!U Q (! #-be!. Kdev#t%$%%0Kerr&Ki& %'(%( %)%*c%+c[# h#Y-$ X##-'%-#X$ X# #%q #%q '%x^#+ #$r4W .26HdirHMp~ req. n. err i j devtcc~9N%3&9%%U|TDQ R~ &U|T MQ&U0TvQ|R X~ $ &2$"U~T Q RvX|9x' # =Z{ l{ y{={  { {}{t{DU @T 9(#=Z{ y{ l{ y{={  { {}{{$|  ( | '|#T QH9*#=Z{ y{ l{ y{={  { {}{{$|  ) | '|#T QH3"*3@*9j*7{+  DŽgԄ(   cSd+ d p |U~TQ|:79i - Ji Vi bi niBziiiiiiUi:i:iCin,iC j, j~i ,ti,T~QsR} n,TvR0X Y}K 7N . Zgg sc- ," Us g  :MI.U0TvQ R X~|.U~T Q Rv!!!.U~T~Q dt /-bet* KxbtvKerrwKdevxt[/ n}n'Yz$ n/#z'%z^/+/d?40Hdevd2t bef 7:{f0 L{DC}k U}A!<Hdev4t2 be  err[= 31Y$ 90#3J1D Ń уBU݃b1Us)!U T Q Rv1$ # 7:{1 L{7|"7 N; "3+;""""""""# #~C-#Z3:I#CX#$3Y#D- Ń уBU݃)!U T Q $j2U|6 jjCju4jju{ { { { { {B{D{  { {T jjCj4Us0T Q v5 ::Cju5u ::c5 ::~k6UsT Q ~ke6UsT Q Us$~A37  !.;= ǀҀ߀=    BtƁ$p7 ǀҀt߀܇C#\8##D{q { {U}T ~# 8#$x8   UsT0Q}M)9U0Q R X2O9UT s9T Q19UvTsQ 29UT 9T Q0:UvTsQ RMR:U0Q R X~#:UvT Q :UvT Q :UsT}Q X#:Ts!;Us!UsU Xdx;UvT6;Uvws;UU#Pddw;UUT Q RTw<UUT5wC<UUT Q <U w<UUT28k^=+<}G22s2M2&M err c c be  devt+([3 >%3>Y$ 9R>#3>D  Ń уBU݃)!U T Q Rv#?$ # $X? ɂ$? ɂ7? # - 9T0Q7ZUC lU yU U U U U3CUU$@ ɂ$z@ {$yyA y$z C GA z=y C y$yB y=z  z=z  zCKVB:cVCrVBsVD   Ń уBU݃)!U T Q $VC Vd1CU }D$!Q0R0ICU}{CU}CU}CU U 7V E VBVUWU WUWCaDU}T  DU}T CDU}T 'DU}T  DU}T  U}T $VZE V$ւ E MEU0Q R XYEUvQ +FU0Q R0+EFU0Q R02jFU|T !FU|FT/FTwFUvT|Q !!8k)GUvQ UGU UvT Q s :OHdevs2tHidt&[ errv bew [3 3I+w#wDZ{w y{ l{ y{D{  { {{{$|  H | '|#T QP3IY{$ 9QI#{3I{D{ Ń уBU݃)!U T Q Rv"J$ # TJ$ # J$ # J$ # 7{J { ,{7jL /jB;jCUjcKZjfjT :Gjv}L } ~uQ~D _~ j~D~ ~ ~v}pL }}UsT Q CsjLu ::$ M ɂ$ւ >M!vMU0Q R X !MU0Q R MUvT|Q0R X !NU0Q R 2NUvT2]NUvTsQ NU T QNUvNUvTsQ NU T OU x!UvT x`O-xbt`1-bea !a&KdevctKerrd[O 'i$ i# ^O+Od6 #Q-xbt69-be6S Kdev8t%9Kerr:%;%<t[O PF$ F# PM$ M# PV$ V# ']$ ]# x(Q-xbt(9-be) !)'Kdev+tKerr,[Q '1$ 1# ^Q+QZUHdev4t be [= 3SY$ 9cR#3RD  Ń уBU݃)!U T Q Rs7:{*S L{${ lS { ,{$}$T }=3~h E~=~ ~}~t~$V6T V wTU|T  TU|T  U|T 7|$'U |D|  } } U @!?UUv!d( V!-!A!c!c!*! KvbdV%0l[V V$ # KV$ # 'Y $ rV# '% ^V+Vd V-vbd*Vd V-dev6t( W-dev5t%nnnW* X22Hbuf( devt be W%$:{W L{ UQT W,X22Hbuf( devt be X%7:{X L{ UQT WvmZ22Hbuf( devt be  ichoutY%9Y$:{-Z L{ LZT  T Q0Wv[22Hbuf( devt be  ichoutN[%9x[$:{[ L{ [T  T Q0Wvm]22Hbuf( devt be  ichout\%9\$:{-] L{ L]T  T Q0Wv^22Hbuf( devt be  ichoutN^%9x^$:{^ L{ ^T  T Q0Wvm`22Hbuf( devt be  ichout_%9_$:{-` L{ L`T  T Q0Wva22Hbuf( devt be  ichoutNa%9xa$:{a L{ aT  T Q0Wvmc22Hbuf( devt be  ichoutb%9b$:{-c L{ LcT  T Q0p%c!e w`d7m|gRd | | | | |B|P!U TQPR0dY d!Y.'%['%[W  k9i2 3 req . n . jc rc3+i ic3{e53e53e59e#D3fGBG$~"f #~gv~! ~=~ ~$N96g Zgg scUg ," g  :$~B?h #~gv~! ~=~ ~$Ch : } hU}T3Q1R0K 8 hU}!!!iUsof T}!> j*1*D*c*)ceerr11#j1 11cni? i? i1/  j1'1p>j*201Uj?sj1 #1 '1#> 8k*4ercj1#1'1jb# k1#kb# 'b# L wL7errNbO0PiQoutz3Wl__koyco l ɂ#lU}TsQ R X|Yvv.\u .B. //7/U?/CG/pm:_/Cn/:mo/D z Ń уBU݃)!U T Q 7#Qn5Q BQ NQ3m[QhQ!Q R x!U}T 7Oq O O3p PP$P1P>P$ zA.o z=z  z=z  z$yB co yoT Q1!oU~Q R PoU!pU~Q R !DpU~Q R !|pU~Q R X|x!pU}T x!pU}T x!U}T x!U}T 7:OqLO YO eO3qrOO!Q R x!U|T $zq {7nznr z$z "Hr zDz  z7+zr =z$z #r zDKz  ]z5sUvQ g,sT0EsU!qsQ R !sQ R !sQ R !tQ R !HtQ R stUvT|Q tUvQ gtT1tUvQ tUvQ uUvQ ;uUvT4`uUvQ UvQ vw`v w wBww xcւ> v c=Jv ɂ+svU0Q R0vUsT vU|T@Q !Uscւq w 51wTsQ wT}Q R|Xv 5wTvQ >7 x*7+4buf78(19(19(edev:t/ k[y/9\13|x3 u`d4 ndC{dx|dCdxd dUv7V\y V!!KyTv&tybe&= U( Ay! A:t( ;y-q ;@K( cy! 4t( c z! Jt( c+z! Jt( cKz! Jt( ciz-q RizF( cz! It( cz-q Miz( $zz! Et6( %Kz! It( %5{! %=td:{-dev3!>(Z{-dev:i( %{! ;! GM(({-nD!N!ZM% (|.|!|D!|PM'%c(%c@|!<!'#(z0m|!zCM!zX+(U|!U!M!U4c!UGc!VY!V"$2%X( |! 6\( }-wq 8]! \d C}! 4\! >(&+a}-mJj(+}-mBjP T}4x T7J'b W# (hD(V}!hDCV(d}-vd}PA~4vA}4iA>.~4v.~(Q~-v#}dv~-v}-i!(~-v!.~>A~4vA@}'ecC P~4v7}4i>>~4v=.~x(-p--q9R%%%  W#f#u###'#8#8#8#8'#8x!:!!*#9#H#W#f#'w#8#8#8#8'#8x-p9R%Kret# ##(#7#'H#8X#8h#8x#8'#8"4pAR*T11eret  e__p(11'1?&?4?B?P?'`?8o?8~?8?8'?8>3!*3<> A!ւ4ptr A<> 4!4ptr 4=> '#* '0> F4s5M*Ec4resZ&P^i4v^Oi*^YPP4vPJi*PTPB4vBIi*BS> "4key "J* "Z ((s!s6'#u (jN!j8!jVPg*/P*7P*2*K'?PԄ4new4*KP4new1**'?>jS*jFeretl'1o1p>A4newA@*B*CeretEP#ƅ*#5?%'?&P4ptr,4p,;i*,Kc>(G4p(:i*(Jc#Q 5Q BQ NQ[QhQ!ˆQ R XQx!UsT Ql:O LO YO eOrOO!zQ R XQx!UsT Ql unspecified, assuming defaultqH  5A : F ^  q q     Iint F ,  * +s8R+u8e+s16}+u16 +s32+u32+s64+u64P \    1F 2F Hc IP X ] ^P _ `:   <F  '   o   #SB  %{ & 4 = B h n' } 1  ;  ;  F  F   $1  XXX0xx : JKL Wx K  s \x1MH  5  G "V y  ( ;$0 t8 ]@ "H "H "H ~H "H "H "H "H$@    0  RP h  5 5 F @  E F 1/kp J  F( F, @0  E8 B@ BA BB FD  OH sP8mem T@ t   F 0 e j  t ~  ( 0 F8 @ FH FL P FX ` Fh p  x F F @$  F  F F $  F !$ "F % &r' 9F : ?0 A0 D } F  P  QF( TE$0N  ; cs =;sl ?;wfe A; Ex ss G;sti I; K;nmi M; P;  S;0 V;8lm X;9 ];: d;<  cs  csx ;    ss  ssx ;   g r15 mr14 nr13 or12 pbp q bx r(r11 u0r10 v8r9 w@r8 xHax yPcx zXdx {`si |hdi }p xip x  sp   B  C  D  E   E (s E ,dpl E -p E' / F 0avl F 4l F 5d F 6g F% 7 F+ 8  % %% )%/ 9' pgd' )'"  @H? I!_0_0 48em f g h u vwkeyx\m  U V ? j keyk n keyo ;l<=? F @ F$A F(B F+$-@ (y0FF  4( F,!F0( 4)Y.8*FH+P,(X5 `6 d8 h: l; p< t=Fx5se?@@/rt@A8dlABBBFD%I2JKFODXD]D%`"w>@d]hFkF lm nD oD(p'0q Xs`ubx dy/Dhz0p{D 0 0  /D00 x=01(%2P/mmhpEx    F F, F, F, F- F- F- F- F- F- F- F- F- F - F - F - F -"F -30/pid * *( (00((000@>FPCFX 0"{F%v(v+ - ;. ;3 ;4<6=: (=0>8A ;@D ;HGPHXK:`%N;TGWGZG^Hk -mHp0 q1(t8u@/fsxHH{HP~HXI`Lh Lp 5x 5 58 ~FL o<F\4h9 ;  ; u1 2" TD p2( (8 L@  H MP  MX M` Mh Mp x M /: F  ;  ;  ; 4 <  M 0  '  ' "M )M  0  M0  18  FX N\ N` 1h 0  N      !F "F # $ & ; ' ; ( ; %) 3*N C$ D L/N N R?N S'( T', Y0 ] 8 ^ < _ @ ` D %aH d9X gIN i9 lSN w x z } ~XN  ; ;  $  FmNwNNN F(F,vD08rcu04@ D(H4POx4  " O OO  ; >% !"-$"-%.<(O%F-@@l$@@q-spes ds"$&(0-8X`cr2hpx-F' i-5fpu ,@F(  '$@@!d@&i@ , !c c B(,Gd0&d80XQdh%`dpxb ed' Njdb !  >!val   R!! ,>!!! !!  ^! !!R! ! " \ " ?? 2"R! " "2" F, #fmt555F55$O6,# 7 8 8#5555'F'F'4Fkey9 #("F=#   8U;$V0modW;$X5Y@$ Z ([ ,\#05u$v$w$xFyF,## :$ /$1Fset3Cget5\7 .$D&;$ 5 X {  -( -08!@" ߙH# P$ X%`&/h'Hp(/x)k*+,ٚ-ޚ./ 0 .1 2`3 5 9 ϛ; >k?@=$ !'% + -/  :' !key " ?h' A Bm' Cr' h'' =' >:' '  ;{' ! $0"c("d5"e."gL"i j"lo 5('# N# Np$(cwd$'swd$'twd$'fip$' fcs$'foo$'fos$'$($'l '($*(rip$+;rdp$,;$..)fip$/'fcs$0'foo$1'fos$2' $)B)((0$@d) $Ad) $Bd) 't) :$$*cwd$% swd$& twd$' fop$( .)$5'$6'$9* $<*$>d)@B) '* '&*?$Q+cwd$R'swd$S'twd$T'fip$U' fcs$V'foo$W'fos$X'$Z($[l$\m$]n$^orm$_p$`q$a+x$b'! +@$:Q+$; ;$< ;$= Q+ ;a+$@@$O+&$Pt)$Q+$R+@ +2P@$^,$_9(-$`t)$a&*-$ba+@$c, ,E$@@$f,$hF$kF$n;$q;xfd$t;$wF$zF$F$F&$+@@$,$ ;$F$F Qfpu@$d-$F$$d-$d-$, $,0&$,@@,% -% ;%; :- - --- -&N&N&N'8.'92.'<2.'=2..(<Y. (=F (> (:.(;.7.src(A  dst(A .."F).  () /) /val) ')!' )"')#;)$ / ')*G/ )+&G/ ),#t/#*t/*uQ* L/)'/)(6)).%/).; )1/)20)3)4 )5)6 /()30 )%. )/y/ )7/8)`0)fn) t00\o0o030`0+>0+?+@+A'cpu+C'"F,0     - 1- 1  1. 01.0/ K1/ 0a1 0"0u1K1 0a11 11! 1"1 2)12*'2+2"osq2-01 2/0(3 23 3 0304P244P24P224 p24 P2424U24P2 52(5 25 5 25p2"F6 2 @6'q3(6(26)  6*3(6+406,86-96.:6/;2332q3@@7/470~71F72 6 seq73;743752 76077 83(8G48 x88 W48' R4R44G49499 94 4: 4:4 4 :84;4;  ;4<+5<,c<-cx=_5=_5=F`=hmax=p o5 > 5sig>4 >o5 ?RE ?S55 ?U ?V55A@5 @  @  @ 5@'"6@(o@){@-`6@.@/@0 5@1@56@6o@7{@8 5 @<6@=o@>{@?@@@A@S 7@T $@U@V @Y17@Z $@[ @^b7@_@` @a @J7 @L @Q @W6 @\ 7 @b17 @E7@Fb7@g7@h\_fd@i@m8@n@o@pF A @%|8 @*5 @2"6_rt@9`6 @B6 @d7 @j7 @q70A 8A A A A 80A 8|8 A8 8A  9A!0A" 5 A%N9A'5A(A.5A0 5 A3h9saA4 9 B 9B B lenB B B(C9C {D$9D% D'D( 0DD/:DM#9DPB(DWB)8E :E;E;E;E;E; E#;(E,;0F):F*;F+2PF8:F9:F:FHF;FL :;8FD;;(FEFF1FGF0 G>;GKGZGpGGGendG; :;2H!;H" F H&;HD;HD; HD;HE<HE; HE<HT L<HY<HZ u1 H[(<I o<valIZ I X<I <valI f I {<S<U ;V ;W2"6F[=    0hx=i;jk<cpulFm;n; o;( == ',@@w> ; ; ; ' ' (0F8$@@ ; ; ; ; ;  ;( ;0 ;8 1@ ;H ;P 1X 1` ;h ;p ;x  ;  ;  ;  ; ; ; ; ; ; ; ; ; ;$@qA=& 2! ;(" ;0# ;8%0@&qP'qQ(qR)qS, ;X- ;`. ;h/ ;p0 1x1 ;3 ;6 7qA9{A;{A=5avgG=@@ vA0KAL0MNOF P$Q&SA(A)]BBBBBB,`C&a2h ;i ; j ;(k ;0l ;8s 1@t ;HuFPFFFFFFFF&2X&2rqCACB)^CC(CBRrqCC;F ;F ;F;F9/DSTDBbCBs'qDqDTD? ~DD D CD'' D,EqRjS @ D Hp2P` h)px u10S DFpidpJ7>FJ9 4J:FJ; u1J<minoJ=;J?y J@]@JBSH.rcuJC`JDypE xSF K{FKFKZTSFLoGLp'uidLq o<gidLr < Ls o<Lt <Lu o<Lv <Lw o< Lx <$Ly F(Lzy0L{y8L|y@L}yHL~yPLqXLH`LHhLHpLHxL L}L iL8L}!}FGFkeyMHM4Moz!{M| semMS(M|PM X|`M huidM o<pgidM <tM{zxM|M~M M||M|G H H H H H:XN^LN_4N` NaNb Nc0NeS Nh(8Nk8@Nn]XNq`NsdNt(hNwpNxFtNzx'NF'NFNFN]N](N2N itNN4N:NƀhN N>FN\V_eNW_fFsda_gX_h"_iX WCx_DX_EW_FX_H _I1(_Ju1H_K1P_Lp_Mx_N_O_P_Q_R_S_TB_U_V1_WSF_Y _\_]_^T__NWp WXUSW`NaX a+ a+a" Ya#a$a%a'/Ya(a)a+SYa,a-a!Y a&X a* Y a./Y aYXopsaYSY YYa2Ya4a6Fa7F "FQ@Z   "FQH@Z   QpuZQqZQrQszZ uZQZQYQVQZ(QQ3QZZWZ@Q`[Q@ZQQQ Q B(Q,Q`[0.rcuQ8Q[HZYQ[QidQ j[[2Q[Q[ [(b\b2"b1b0b  c \c;c& $c)Sldtc*\8c.@c91Hc:hc;]pc= xcC |cD~ \d ]ddaltddd d(d0d\8d\@d\Hd\Pd\Xd\`d\hd\pd\xd\d \d!\\] cF\\]^ `FX^lruY0] d0 e0i>^ j  k(Rn^]hE^s (u^zpp{^|}~' ^^^_  ^3(Q0_>^n^^^7R_ F  9 k_val)R_0M_N PF*J_BlruK0x_*W_X Yk_0@GL`I_UEV  _([ 0\ 4^84@Fj`_-j 0(m`noq r s t vF 4@l`j`-z 00}Ta~     (0 a04@|a`Ta- ,Da!L`!`@!a)a, b  u1   E  q(F0F4G8w@pP rp  x#Օ$ % 'ڕ!a5cctx6c c=Cc>AS@;(X`cYS(\cbht%w }$0c4cc-*daaX Gd5rb2Cc Ld Vd[dc`cd;cid Y@@ d 9 d0 mNZ@@h!d@S@PX`hppgd  x) 5 ?hELFS Z2"]'_au1pSr0$ (08;@u1DHP'X3`h/brkp!x%0hh@h]hu1pix( ib&i  ['T!i' dod h3 [h h iQ i i 5i2#e6N#e9N#ej gGMj gHj gIii 4j9j CjHjh,jh- u1h/ h0RjgAjigK ~g:j g@~ijgNj gO gP gQ r(g+Dkg,g-Bg.Bg/ ~jj 0pkqbr rs t u v $H(Dkji"ki#ki&ki'ki' kkkj(lju1j 3jBl7jljWl!(lk3{lk4'lenk4'k2lWl k6;k1l{lk8lkil kj0 kklS[krm ksx ktk7kukRmkTFkU<kVkkWmkXl kYq0k[q8k_"q`k`uhkapkbx(kdBllkmxkn].d_ukvlmm$x{q| }~ o< <F !e u(E0 8@H L rP X ` h'p't'x'|u1^ 'Sx0o  000 \?0$@$H P T X \@e`yh%Dp08@H P(X`h pm q-q'@kqkukukvk6vkJv k^v(k nv0k nv8k v@k vHk.wPkLwXkew`-qq$@u0 q r t(!0!8@"HPX`mhSp &!#:D$SXk 0 b b l vxF (%` '!'"/ 0 14 6F<1 B5@D"qHFxPI'XL`O dRUhS]pZ ixaxbx8rcucdTf1k0%nu1@@o0Hqu1Xr0`q"Fku umFuvv vmlu1vvF51vlvJvv;v^vmOvnvmcvvmqsvvmv lEvlFmlGulHlIvvvvwm)wmntm vm mwvGwGwB)w3wmewmuQw n"wn#nidn&n-n4n7mNnRxnSxnUxnX\nYnZ Fnc 4 ndSF(.rcuneHngXnj0`idnmpnptnq5xnrmnuxxxxwjwx'0o3xo4\yo60o7o8 Bxao9Rj  o4yo 0o" \o$u1@@o-\ylruo/xo0' 4yJ2ynrJ3nsJ4y0 ]y ayy2p yvalp; py"Fq y   y r1zrr r#sNteztjzt ez M MMlz.rcuMmMn4Mo BMvzMx My MuzzxM(MrA{MtzMK{MP{M5 A{A{zA M{{ M M {U{ { M{{{H{{HF{{{M{M{keyMHMK{3M| M07M2MA| M  M (M|MMMK{MP{M  (M| MzA|0 M|M0M =z* M|MU{| | |{u}u 4u[u0u'8ux@uidu o<Pu'Xu `u$>"hL}L 4LgidL } <}23L} L]rcuL}}:@@7g~7h2"cpu7iF7jF7kF 7lF7mF7nF7oF7pF7rF7s7t7uF7{  7|3(7} 07~38(7M@@}1~"F7:M        =3@^ N9n?8NN N! \N"N#;N#; N$(N$0N'N(;N);N04N1 $N2 $N3 $NCONDNLwNM(NNwO8NQNR NSONTSF| ƀ >Fր ր  4  v)v(0wlwwwS(w `x .rssx )xq0x8xS@x Xy fny .argy  ez bz z { 'OSA OT0 OUy3OWb OXx7OY8OIqOJiocOKM!A O\F0 b | ҂val|Z || val|f |ނ} v}  }%6F}T^    "q~      . 0 $ 4"F.ۃ   45F679 * % /4`  o<  ҂  <  PF >`  rKK(K8 bHЁ()x*0+0 ,00-1@. u1`/ d0uh1bp2 rx34 { څval ÅGF  "F6(   BEbuidF o<gidG < H څD4JH ( ( ( ( (  (( (0 8 @HЇ0 F(F, (0 (8@ Ї!;$ЇGF        @89:;<=È >È(?È0@8uÈ܈u܈bȈXDEÈFG HÈIÈ JÈ(K0N щ8O@QHSPủ̉q(qڅ։q̉xYZ[;\;];^; _;(`;0a18c1@dHeLf;Pg;Xh;`i1hjp8FFFF FFFino  ( 0‹F‹ ҋ QFFF FFFFX66 Y(|08|@H6PQuGw6uF"TuTҋ;wubw ^u܈wuD8  F S 0 (H/ops!8  q( 8 H*wm}r mwk\Ǐ! : T (0 ѐ8 @ H P -XP`dh p x   ̏ba!E B:E&JJO ?bErFSYbErFFѐE~~֐B -kkPEy2dUB~~iBEؑؑbݑ bkkǏ*?MF4e]-*! &q*ޒIN  F ޒ $@Z`[[\~]^`؜ b(d0e78fZ@h}Hj7PkXmҝ`ohp"pr @xsmuvyў{}:S` j t ~  ( b 1pid>F0uid o<o< $ p FF FF r* 1 ;4 )Օ-*+., -])P^F    $0c  &c=ltΟ    ( 0 8@9HMP9XM`php x Ϡ  ) ) y  +& 05 ? INۃ ] g q { : :$)Bߘߘ5r;F pos r) Fr5brXb~oi:{b5~oi]kF bߘՙbՙڙ \bFb/qbHbߕ4kbrrMbpb ٚb$PINboi~F.boiIN~F QbQSV[ 3\brreb ϛbrbr~FrbrbrrFԛF =F$m[qmFB5ymqy`qqB؜mqmBݜmqm7qm#Zqm5<}qm_qmҝqmqmFmםGw'FQ@m~'cqc;;h EqrqmbFўqbm֞m0m05 Sm0? mt S qX6F   qΟuqӟqq u9u%Mu>fmfk RuvumϠu~ru5~rԠ q\)ux==B . LQmyt5[ "@@AA5B0CFD֪ E<(sdF90GAS8'IF'JF'KF'LF'MF *  . 'PPW     qq  ZU2_rev Z99  95.rb2ns0F8< >Y@id;` hp.rcux opsJ!T r9hEi y"$ % ɦ & ަ(( 02 ~89B@: H= P@3XA Q`E O dir d > Ukn9b 1 1@`0h x  ~  B@  BA %`dddUydn~oiɦoiަΦd~rdՙ3drQdr8"Fz  0'֧(V) ji* +, - .(z1ۧ 1"5"5" "mW "n "o&X"0"1 "2 ~"3 "4y "5 ("7 ө0"9 8"; ө@"= H"?PWW )F) LF3~jFQ)1EtbFr~~өbFr~rbFrةbF"N" l" #lF)SF)5~q`֪0 u1 X0t7u LvQw!Vx*yy z (۪7LFAN[(oot֧A`t~ttiyiC }~(E>F5modG;$opsH!I JKa ܬì\׬HLargM strNarrOVWFX \max^F_Fnum`qopsa!b$0(;();=2L t F v   :7` -  .mod /;$@ 0FHmp 1P 2{FX  8 5r 6  7  9  ; ͯ  <( = 0r5~ͯ;$5;$ү;$6F >   ,8 ELmod F;$& G6 J       _,P p q r sB tF5mtn w  1  1 F   6;"ܬy=e& o y#QNW/Q  "L Aϱ>ϱ `   A > >  AG"7>G a M b L % Kint 1u8? #W   1 <!%',/359<ADHLQUYɲʲ˲  6 9 < GK 1 :@ 1T| 1.111-  g l - - - `J 9   % V9  `/V ,4p ,   : ; 9 I8  : ;9 I8 I !I : ;9 I8( I~1B  : ; 9  'I : ; 9 I8 < : ; 9 I&II : ; 9 I41B : ; 9 I8!I/ 4: ;9 I : ;9  H}' : ;9 I kH}  : ; 9 I k  I8 .?: ;9 '<4:!;9 IB 1RBUX YW !: ;9 I" : ; 9 # : ;9 I8 $: ; 9 I%H}& U'4:!;9 I( : ; 9 ) 1U* 1+1RBX YW ,  : ; 9!-1.1RBX YW / I0 : ; 9 I14:!;9 I24: ;9!I 3 U4.: ;9 'I 5 : ;9 I6: ;9 I7: ; 9 I8>! I: ; 9!94: ; 9 I: 1; : ; 9 <1RBUX YW =.: ; 9 ' >4:!; 9 I?.?: ;9 'I<@.: ; 9 'I A: ;9 IB!IC> !I: ;9!D4: ; 9 I E4:!; 9!I F4:!;9 I G41H.?: ; 9 'I<I  : ;9!J : ;9 I8K:!;9 IBL.: ;9 ' M : ; 9 I k N : ;9 I k O$ > P : ;9 I 8Q I 8 R : ; 9 I 8 S.?: ; 9 '<T : ;9 I 8 U : ; 9 I kV : ; 9 I!8 W1RBUX Y W X4: ; 9 I?<Y : ;9 Z:!;9 IB[1RBX Y W \ ] : ; 9 ^ : ; 9 I8_ :!;9 `4I4a b:!; 9!Ic  : ;9!d : ;9 I e : ;9 f.?: ;9 '<g 1h  : ; 9!i4:!;9 IBj1RBUX Y W k1RBX Y W l'Im : ;9!n(o !: ; 9!p  : ;9!q.:!;9 '@zr :!;9 s 1Ut4: ; 9 Iu : ;9 I 8 v : ;9 w : ;9 Ix : ; 9!y4: ;9 I?<z : ; 9 I!{ : ;9 I 8| : ; 9!}I ~H}.?: ; 9 '<.: ; 9 ' !4: ; 9 I?!< !: ;9! I8 !: ; 9!.?: ;9 '<.?: ;9 'I<.?: ; 9 'I<H}4I441 1 14:!; 9 IB4:!; 9 I5I>! !I: ; 9!!I/< : ;9  !: ; 9 4G:!; 9!.?:!; 9!'<.:!;9 'IU@z4:!;9 I.?:!;9!'@z1RBX Y W  :!;9 .:!;9!' !.: ;9 'I !% U$ >  &4: ; 9 I?'  : ;9   : ;9  : ; 9 I 8 : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9 (   : ; 9  I 8 : ; 9 I  : ; 9 .?: ; 9 '<.: ;9 'I@z41 H} : ;9  .?: ;9 'IU@z1RBUX Y W 1RBX YW .?: ;9 'I@z 1U.: ; 9 '@z: ; 9 IB4: ; 9 IB.: ; 9 'I .?: ;9 'I  : ; 9 .1@z.?<n : ; 9 I8  : ;9 I8 I !I : ;9 I8I~(  : ; 9  'I 1B : ; 9 I8 < : ; 9 I : ; 9 I&IIH} : ; 9 I8!I/  : ;9  41B' : ;9 I k : ; 9 I k  I8 H}4:!;9 I4:!;9 IBH} : ; 9  4:!;9 IB!: ;9 I" : ;9 I8 #.?: ;9 '<$1RBX YW %4: ;9 I& : ; 9 ' (.: ;9 'I )  : ; 9!*: ; 9 I+4: ;9 I ,.?: ; 9 'I<-: ;9 I. : ; 9 I/ I0 : ;9 I14: ; 9 I2:!;9 IB3 U4: ; 9 I5>! I: ; 9!6 : ; 9 71RBUX!YW 8 9 : 1;: ;9 I.: ; 9 'I ?.?: ; 9 '<@4: ; 9!I A.?: ;9 'I<B UC 1UD1RBUX YW E  : ;9!F : ;9 I8G> !I: ;9!H:!;9 IBI : ; 9 I k J : ;9 I k K4: ;9 IL$ > M I 8 N : ;9 I 8O : ; 9 I 8 P.: ; 9 ' !Q : ;9 I 8 R : ; 9 I kS : ; 9 I!8 T.?: ; 9 '<U 1VW.:!;9 'I@zX : ;9 Y4:!;9 I Z.?: ;9 '<[4I4\ : ; 9 ] : ; 9 I8^:!; 9!I_  : ;9!` : ;9 I a : ;9 b4: ; 9 Ic1RBX Y W d.: ;9 ' e4: ; 9 If  : ; 9!g1RBX Y W h :!;9!i'Ij : ;9!k(l !: ; 9!m  : ;9!n :!;9 o : ;9 p : ;9 I 8 q : ;9 Ir : ; 9!s : ; 9 I!t41u1RBUX Y W v1RBUX!Y W wH}x.?: ;9 'I y : ;9 I 8z : ; 9!{4: ;9 I?<|I } 1~ 1411>! !I: ; 9!4: ; 9 I?< !: ;9! I8 !: ; 9!4:!; 9!I H} 1UH}4:!; 9 IB4:!; 9 IB.?<n:!;!5I!I/< : ;9  !: ; 9 .?:!;9!'@z.?:!;9 'I@z :!;9! .:!;9! '@z.:!;9! 'U@z:!; 9 IB.1U@z% U$ >  &4: ; 9 I?'  : ;9   : ;9 > I: ;9 4: ; 9 I? < : ; 9 I 8  : ; 9  I   : ;9   : ;9   : ;9   : ; 9  I 8 : ; 9 I  : ; 9 I 8(  : ; 9 .?: ; 9 n'I<.?: ; 9 '<.?: ; 9 '<.: ;9 'IU@z41 .: ; 9 'U@z : ; 9  1.: ; 9 '@z41.?: ; 9 'I@z: ; 9 I.?: ; 9 'I  : ; 9 .?<n6 : ; 9 I8  : ;9 I8  !II : ;9 I8 : ; 9 'I : ; 9 I8 < ( : ; 9 I : ; 9 I I&I!I/  : ; 9 I8 : ;9  I8  : ;9 I k : ; 9  : ; 9 4: ;9!I '  : ; 9! : ;9 I I : ;9 I8  : ; 9 I k  : ; 9  : ; 9 I k  : ; 9 I $ > ! I 8 ">! I: ; 9 #4: ; 9!I $  : ;9!% : ;9 I 8& : ;9 I 8 ' : ; 9 I k( : ; 9 I 8 ): ;9 I* : ;9 +:!; 9!I,  : ;9!- : ;9 I . : ; 9 I!8 / : ;9 I80 : ;9 1'I2!I3 !: ; 9!4  : ;9!5 : ;9 I 8 6> !I: ;9!7 : ; 9 I!8 : ;9 I 89 : ;9 :  : ; 9!; :!;9!I k < : ; 9 I8=I >4:!; 9!I!? !: ;9!@ I8A : ; 9 B : ;9 IC : ; 9!D : ;9!E!I/F !: ; 9!G>! !I: ; 9!H% I$ > J K&L4: ; 9 I?M'N4: ; 9 I?<O : ; 9 P  : ;9 Q  : ;9 R<S : ;9 T : ; 9 U : ; 9 I 8V  : ; 9 W I X  : ;9 Y  : ;9 Z  : ;9 [  : ; 9 \ I 8] : ; 9 I ^> I: ;9 _( `4G: ; 9 a.?: ; 9 '<b.?: ; 9 'I<( 4: ;9!I $ > 4: ; 9!I &II!I/ 4:!; 9!I  : ; 9 I :!; 9!I!8 >! !I: ; 9  :!;9!I8 > !I: ;9!>! !I: ; 9! !!:!; 9! :!; 9!I8!% $ > : ; 9 I4: ; 9 I?> I: ;9  : ;9 ( =          Y,| =>^yE }XX {X-.Xz{XX<   J XJXX.uXo.XX X/WY/=#J%J<WJ7< ]# <=jJ= <J\ qY{<u Y < F X)  DyX&A zJ tz< W  x<P z JKzJ U \Y q'{X K JZ uJ J x  {./ ..-uX.vXX 0V /  <= tx tq< JYX<J/; <~!J ~~ &~i><IEN}X JfJ J}i =M  K KJ [$ZX J.. uX IY J.-XfYt5h#<.K!; {JtJ{<-> |<=<uuJY <J |huIK wJX|J XX. z.(J ^JJ k>   J n J. = IlX xX9sZ xX7<= q. } t sc Myq pu hX= I wX    Xz x./<= q xX    X X x    X}X /W / Y W<= R? .Y t</Z>:JK  u t<."yt.KKKxJtY0  n J1 n f/ .zX | X+K@ 't ZX'X  Y.X.|< /W / =  W J@.l JJ ~<~XY |#=itz<~  t0m,~J tX.u(<l(</;;j ,J/X"<LJJ6ff XXvf z'c,~n~ tf~ }u{ xX!{%X% {!iYhhX} t N  iu n Xf J X y. ~. ~Yt v   t ~8zXMK~uK!Fh!Gg&XMK~uK!Fv!Gg&X x X}@ t }J=X ~X    . f t$ XXJJ<XXMHu K XfXKu X`X~ J xX   /i.<J< uX$  S xX xt!X2}Y~X,<2XJ~%} uJ < u  t t u   ~ tu% Xt u% Zt3xX xt Yx  {xt xJ x xX  ~ <t   wX<<<KYKu YJqqJqXtu |J JsKW\~XtKuz V/Z I= X} J} tZ}# 'jXw wJ.wfX]zXuKZu | ZX yX    .t <$ XXJ~ J tX m Yz XXXXJ<X }f t i+Jk#JZ /XJ }X  ow  XJgW <f~ fK$eXIY~ Xit =M  ZY UK K KtrJJ<W <f.JxJJJf }<XJ |zXvx | xJx<.x | J L  XxJx | < xJx |X  u    $X| t   XuX< u fX~X.? {f   J . X!f. A X t u    t< J w-sJ Z[X{.< v.]    X X$-wXXsu (}M@ X} }t I7| ~. z uXXXXX x   X >[X  fY%|z | f hYM qXX  KY2             tZ&} fX }J*< |X<|< tJ|fX.<|<tJJX.a<{<JJtXf.< <fXtX.X.tX.Ր<{<JJtXf.< <fXtX.X.tX.Ր<{<JJtXf.< <fXtX.X.tX.Ր<{<JJtXf.< <fXtX.X.tX.Ր<{<JJtXf.< <fXtX.X.tX.Ր<{<JJtXf.< <fXtX.X.tX.Ր<{<JJtXf.< <fXtX.X.tX.~Y d ZJ$nXJY XM JYY{}| JO Ju!J^"tJJp YMg K<";K,W[)fYvX vXJX }| tJ0 tNtttJ<JX`X.t +lX....J Xf|J XK$X=eu-u !R, !C<X0 6L4L .MJXyXKX.yXt ~t~ z.X z   .X <X- J .tDxJR .xfZX J XzH wX  )*$ $wt X$wX Jq1}efX@F\ .bpX<lJ .lfoX%f[J% .[f yX    X   *u x(.J % [ty t<yt 'Yt>$pNstFxXJsJJtttttZtfsuIu$qtX}{"N ,2X8tXX\XY}]vXXzJ   z.%<`]<<g'JX5  z    t   .  <K !zg !z ( <Y(;g\ z -. zJXX I I N Tg  W}Jt }Si<*gFh<HZX? !|Y  J }Z g(J h %|5y gg $~%}yJh |X } Y }J JYY$  hY  zX   }X =M =JU !z ~X .~<Xzf =$NK=JZXX..NK=JZXX. 7  X/]z.$p]Ly/Z./u 1 v =zXK. y 0/X. ./Xo< .2Ft %.~   yJyJ[ =M  YK HK< e<%.~%~ XY+J% .~%~ Xv7v.X yyJ t>K  U=X  "J Xf fXffXffXff"$'X$f&f%,X%f+f#14X1f3f29X2f8f@BDGXDfFfELXEfKfCQTXQfSfRYXRfX.A_fdfafcfibfh`qnfpu|J|J < X   vX v< &v<"&$X$' '+v%X%, ,#v31X14 48v2X29 9Fv<@BFDXDG GKvEXEL LCvSQXQT TXvRXRY YAv_fcfa<ad dhvb<bi i`vpn<nq qovovvvJtt JX fJXftJXfJXf"t$t'J$X&f%,J%X+f#1t4J1X3f29J2X8f@XBXDXGJDXFfELJEXK.CQXTJQXS.RYJRXX.A_JdJaXcJitbXhJ`tqJnXpJut|J|Jttt t"t$t&%+#1t328@XBXDXFEtKCtQXSRtXAt_JaJcbXh`XnJpoXo.X-gMXtX>L L [g XfyJtyJJJyp YMg K<"KtX\tZ(U,+UJ t< <tXJJx. SgX}+.XrXxXEX X Xi X Xd X8.X9<GJ9 .GfXttt.ru t I/ }hf_X X Y/v@ Xy  XK .~   Y=X}XXz* <*< t%FX }X|X~ ^ XYYt v.~X8X  r y Xn 7 Oo AX w         x ,N_G F(el\GJG B(A0A8G 8C0A(B BBBE $U\GFE D(C0 (A BBBE _ (A BBBE e\GGE B(A0A8G 8A0A(B BBBE tGBB B(E0D8RHO 8A0A(B BBBE D8L0F(B BBBT6GBB B(A0A8D@ 8C0A(B BBBE $@TbKBA D(l  DBBE   ABBE \GGE B(A0A8G 8A0A(B BBBE DKAA V ABE ] KBE \ KGB B(A0D8G 8A0A(B BBBE /<JC I BBBBA E $; $!JRx $?Jp,*vvvvvvvT GIB E(A0D8D 8D0A(B BBB\kGEB B(A0A8DX3 8A0A(B BBBE DKAA X ABE cMFD$KLA K(#0L(F  ABBE $D(,kJER AE TGBB B(A0A8Dh 8A0A(B BBBE $h3KBB B(A0D8D 8A0A(B BBBE X 8E0A(B BBBE \ 8A0A(B BBBE X 8M0F(B BBBE X 8I0A(B BBBE X 8P0A(B BBBE dh 8I0A(B BBBE  8A0A(B BBBE TKBB B(A0A8DX 8A0A(B BBBE $dXwM0e%$=JUXA$=JUXA#device_attribute___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersnvec_useddev_tREQ_OP_ZONE_APPENDFREEZE_HOLDER_USERSPACEdup_xol_addrrevmapcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGblkif_common_sring_entryuclamp_sex86_msi_addr_loFORTIFY_FUNC_kmemduppkruElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparameterszone_wplugs_lockd_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnew_sizenetlink_nsneed_qsmax_buffer_pagesblkif_notify_workxenbus_transactionswap_deactivateblkcnt_tput_persistent_gnticq_treesi_codeinit_dev_msi_infothread_nodenr_itemsphys_reqarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargspgrant_timeoutattributes__list_del_entrycached_rqsset_child_tidblk_unique_id_overrunrestrict_linksystem_wqtmpfilercu_read_lock_nestingem_perf_statemin_nrtick_dep_maskst_rd_reqatomic_readlistthrottle_disksi_errnoREQ_OP_WRITE_ZEROESs_inode_lruatomic_setsrcu_size_stateblk_plugREQ_OP_LASTneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcpu_numberd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPreal_parentlockedVTIME_GUESTblkif_x86_32_request_indirectregsslice_maxlast_switch_countqsize_t__compiletime_assert_104msi_desc_datafilesotherend_watchdqb_bhardlimitliveatomic_write_unit_maxrun_listixolbd_mappingsym_vvar_pagemodule_sect_attrsreturn_instancexen_vbdsoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalret_stackfree_disknode_idautosuspend_delayunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjmap_untild_seqbi_crypt_contextia_vfsgidsize_tdevidacpi_device_idprepare_to_wait_eventcap_permittedTT_NATIVEaffinity_hintclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nseccpuhp_deads_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tpreallocpfn_mkwritecallback_heads_vopdiscard_secure__compiletime_assert_220perf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkirq_shutdownfmode_tdevtmsi_parent_opsrequeue_lockrestoredelayed_callmsi_instance_cookiebi_iterprint_statsmax_nr_cidblkif_common_sring_statusmark_deadd_sibkernel_ulong_tX86_IRQ_ALLOC_TYPE_DMARdma_opsioapic_alloc_infobin_attributemin_align_maskpercpu_counterdev_groupsnuma_pages_migratedlimits_lockdl_dev_statexen_blkif_be_intgsindexexpires_nexti_io_listf_epsrcu_barrier_seqblkif_back_ringslinks_countreturn_consumerrelease_dqblkin_thrashinguaddr2int16_t__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasegnttab_unmap_refs_syncscan_objectspid_typewb_errstatus_use_accessorscputimertrace_recursionbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32blkif_x86_64_request_indirectentry_eiptaskstatsblk_protocolhugetlb_usage__dummyratelimit_states_pinsst_wr_reqpersistent_gnt_cattrdmar_subhandle_validget_next_child_nodeFAULT_FLAG_WRITEirq_set_irqchip_statevm_fault_ttty_structUTASK_SSTEP_TRAPPEDblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountpersistent_gnt_in_useforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointrespresvnr_wakeups_idlehost_addrFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAsyscore__s64st_printdqi_bgrace__kernel_pid_tsystemstatic_call_modbus_select_token_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredsum_block_runtimepgmapmin_perf_statedq_oprcu_tasks_nvcswwritetypetabmax_user_sectorsclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatdma_pools_addr_lsb__compiletime_assert_97i_generation_sigpollmxcsrbuffer_squeeze_endX86_IRQ_ALLOC_TYPE_AMDVId_rt_spc_hardlimitbi_end_ioblk_holder_opsREQ_OP_FLUSHnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexirq_affinity_descdriver_datathread_headlowmem_page_addressdev_pm_qospfn_to_kaddrbi_sectormap_typef_oppids_active_resetrandomconfirm_switchseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_size__phys_addr_nodebugdq_sbarch_static_branch__UNIQUE_ID_ddebug811nr_pendingsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entryfree_req___GFP_NOWARN_BITcmin_fltrw_semDEV_DMA_COHERENTprev_sum_exec_runtimenestedpm_devmsi_translatenr_forced_migrationsnum_argsri_timerstack_canarydestid_8_31blksizesiblingmnt_rootnext_scanf_raquota_writefeature_gnt_persistentsrcu_barrier_cpu_cnttranslateiopl_warnrmdirsockbi_write_hinthash_lenget_policy__list_add_valid__UNIQUE_ID_ddebug828HRTIMER_RESTART__bi_nr_segmentsirq_nmi_setupsym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_baserb_insert_colordevice_is_availabledquotdl_runtime__ret_do_oncenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchsemaphoreshutdowndq_lockblk_ring_locki_cdevxen_blkbk_unmap_and_respondldt_structenv_endobj_cgrouprescue_workqueueptrace_messagenum_trace_events_sys_privatealignment_offsetopen_mutexinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoftcrypto_kobject__sifields__end_block_io_opgnttab_map_grant_refirqs_per_chiprcu_read_unlock_specialread_bytesfsverity_operationsfree_pagesx86_64wake_q_noderequest_key_authirq_bus_sync_unlockvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksirq_hw_number_tgnttab_set_map_opstart_stackwatcherskmalloc_cachesredirect_hint__compiletime_assert_218completionblkif_x86_32_requestsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobefail_flushst_oo_req__REQ_POLLEDshow_optionsdiskbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELioapiccore_nodecurr_nrsector_ttrc_blkd_cpuin_memstallpermissionpurge_list_utimepm_subsys_datafinish_waitirq_flow_handler_tirqstatget_dquots_raw_spin_unlock_irqrestorenum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onunmap_pagesst_f_req__warn_printkvm_operations_structcnivcswbin_attrs_newhwirq_maxbio_alloc_cacheruntime_idleiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_children__UNIQUE_ID_persistent_grant_unused_secondstype795IRQCHIP_STATE_LINE_LEVELis_softcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGmore_to_donrpages_refcounti_crypt_inforinglist_emptyblkif_x86_32_request_othererror_remove_folioold_time32_tcore_kallsyms__REQ_NR_BITSsrcu_parentdetachedclock_op_might_sleepXenbusStateConnectedenvp_idxXEN_PV_DOMAIN_head_1_head_2bd_size_lockbackvmemmap_basestate_add_uevent_senti_hashresulthlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumeirq_disablewake_qfileattr_setrcuwaitbio_listwrite_dquotmax_pgrantsclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerunmap_opsNR_KMALLOC_TYPESsect_attrspscr_ret__DOMAIN_BUS_WAKEUPqueue_work_ononlineruntime_resumedup_xol_workqueuecan_maskpercpu_enabled___GFP_WRITE_BITicookiexen_blkbk_unmap_prepareMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignDOMAIN_BUS_NEXUSdelay_worktot_countoublockrecent_cidbdev_get_queuekernel_paramdeferred_resumed_spc_softlimittry_to_freezereported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimedestid_0_7event_channelsi_mmapirq_startupphys_addrd_lrusignal_structDOMAIN_BUS_VMD_MSIperf_event_mutexcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeis_msixki_completevtime_statewakee_flipsgnttab_workset_aclpids_activedrivermsix_ctrlget_hwirqi_opx86_32ldt_usr_semkobj_ns_type_operationsbd_security__REQ_BACKGROUNDseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodemsi_post_freesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__task_fpstatemask__ret_oncewait_queue_head__param_str_log_statsclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodexen_blkif_interface_initis_dirty_writeback__UNIQUE_ID___addressable_cleanup_module859trace_bprintk_fmt_startdisablehuge_faultkstatfssitesxen_blkbk_unmap_purged_grantsDEVICE_VERT_POS_UPPERptraceatomic_write_segments_maxquota_disablekprobe_blacklistcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsblkif_x86_64_request_discardaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsys__REQ_DRVqueue_kobjxen_blkbk_unmapsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDshared_pendingexpiresmulti_ref___GFP_HARDWALL_BITnivcswhandle_irqMODULE_STATE_GOINGDL_DEV_UNBINDINGbus_select_maskmulti_capthreadparam_ops_uintsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tmax_integrity_segmentspgprotsegmentsfalsed_weak_revalidateremoved__compiletime_assert_101show_pathPIDTYPE_TGID__UNIQUE_ID_alias862curr_ret_depthac_utime_dummy_pkeymsi_alloc_info_tiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimit__refrigeratorREQ_OP_READac_flagwrite_msi_msgcoredump_datatasks_pid__UNIQUE_ID_y_837address_spacemm_context_t__num_online_cpus__old__q_size__call_single_nodestartupirq_mask_ackpersistent_gnt_timeoutis_virtualof_device_idseqcount_spinlock_tbio_issuei_wbhas_elevatoruint8_tpanelclass_id__read_overflow2_fieldinactive_timer_pkeyfilenames_export_opfront_pad__mptri_flctxstashedcond_suspend_depthvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddractive_lows_wb_errshm_clistis_child_subreapercall_depthunicode_mapXenbusStateInitWaitgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_name__SCT__might_reschedmmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfounusedalloc_inode__UNIQUE_ID_x_767user_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidfailed_initi_rt_spc_timelimitrseq_sighandleflush_workdev_pm_domainlimit0limit1nr_zonesmigrate_modebio_poolpoweroff_lateftrace_callsitesd_hashis_confidentialdl_bwlimitkobjfsyncmtd_infoi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasksst_wr_sectplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITxenbus_devicereleasedthread_fndep_mapalloc_dquotpm_messagemay_split__q_size_fieldmem_cgrouplast_update_timeirq_suspendrobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrqf_ownergraph_parse_endpointstack_vmusage_count_folio_nr_pagesblkifioctlshowunsigned charumount_beginaffinity_notifyvdso_pad3mmap_legacy_basepipe_inode_infouint16_tsecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopoll__param_max_queuesbi_poolcompat_uptr_tuevent_opspoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPnum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listsrcu_barrier_completiondriver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapxenbus_printfwaitersblkif_request_rwsessionidarch_atomic_readbi_flags_sifields_hugetlb_subpoold_manageicq_hint__UNIQUE_ID_max_buffer_pages792handler_datafiemap_extent_infopadding1llistdebugfs_entryelemnr_retriesIRQCHIP_STATE_PENDINGsigval_talimitundo_listKMALLOC_RANDOM_STARTdelivery_modeirq_datamask_cachemissedreport_zonesbi_idxquota_readrsp_prodst_shndxfreei_wb_frn_avg_timebd_fsfreeze_countfile_ref_ttypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iterothers_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typeatomic_dec_and_testmtimeserver_has_tasksvm_faultzone_wplugs_err_listspurious_eventsoom_score_adj_minx86_msi_datakobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tpathst_sizeREQ_OP_ZONE_RESET_ALLpagefault_disabled_incrmtpf_llistwait_sumnum_tracepointsupidexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkxen_blkif_scheduleclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handleriommu_groupperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockis_preparedproc_dir_entryvm_opsraw_atomic_dec_and_testiopollpagesizedisk_names_blocksizevm_pgoffauprobepto_val____ret__do_block_io_opnuma_workdevice_dma_supportedptrace_dr7_call_addrrescue_lockmax_segmentsWORK_BUSY_RUNNINGloginuidcheckexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkgsector_number__kunmap_atomic__lstate__param_str_max_persistent_grantsbio_alloc_biosetarch_spinlock_tueventlock_countrefcount_tplugchild_countsaved_auxvscan_usedmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenlast_sectunlocked_ioctlrseq_lenparamwake_depthpollfdnr_wakeups_remotedispatch_other_iollist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_awarestate_use_accessorswork_busyclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flags_pincount__compiletime_assert_98rq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockbd_holderend_codeqspinlockblkif_x86_32_request_discardirq_compose_msi_msglru_genirq_set_wakeinsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqlong unsigned intsleep_maxmmap_baserescue_workio_context__condquiesce_depthhctx_tablegpl_symsseq_showswait_queue_headcow_pagesectorblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitssched_shared_tagsrb_firstclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgblkif_responsefull_namenoderesetvm_lockno_cgroup_migrationnextevts_writers_key__countirq_cntxcomp_bvcma_areastatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatnum_pagesexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimereg_writelerrnumstate_remove_uevent_sentdmar_formatfirst_minoria_sizein_hrtirqs_master_keysarch_msi_msg_addr_hi_tpropertywchar_addr_bndkernel_symbolsubsys_databi_statustv_secis_64blk_integrity_checksumpid_ttask_listftrace_sleeptimebdev_logical_block_sizerun_nodeblock_device_operationsblkif_x86_64_sring_entryadd_persistent_gntma_rooturing_cmdX86_IRQ_ALLOC_TYPE_HPET__UNIQUE_ID_max_persistent_grantstype793nr_failed_migrations_affineuser_cpus_ptrpendcntraw_atomic_decpi_top_taskWORK_NR_COLORSaddress_lounlinkblkif_sring_entryactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writeutil_sumreserved_0st_otheri_mutex_keyksethrtimer_clock_basevruntimepersistent_purge_workdisable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITmoduleXenbusStateUnknownpcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespaceget_currentvfsuid_traw_spinlocktimer_autosuspendsnr_ring_pagespudval_t__rcu_headxen_blk_drain_iomce_vaddrquota_offdq_inusecachedqi_flagswait_for_completion_interruptible_timeoutbdev_filekfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskwas_emptyrequest_queue__REQ_NOMERGEindirect_pagesirq_descdqi_dirty_listpurge_gnt_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlen__REQ_METAcodegtimesigactionwake_activedev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_listsched_rt_mutexdummylocked_pendingpao_tmp__nr_deferredfown_structfeatures_lockedtracing_graph_pausepermalloc_reqcompat_robust_listbi_blkgnr_hw_queuesunmapktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagIRQ_GC_MASK_CACHE_PER_TYPEi_uid__wake_uptablesBLKIF_PROTOCOL_X86_32parent_dataspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmfortify_memcpy_chkirq_domain_chip_genericdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_disksp_offsetsrcu_cblist_invokingi_lockdispatch_rw_block_iod_nameget_ownershipgrant_handle_tufdsexe_filereserved_1nr_scannedpcp_listpid_linkss_sysfs_nameq_size_fieldrefcountxen_blkif_ringvaddrrequestrw_hinttimeoutreport_zones_cblast_switch_time__REQ_SWAPnum_classesorc_unwind_ipqc_dqblkBLKIF_PROTOCOL_X86_64mmappedseqcount_raw_spinlockbd_holder_dirirq_pm_shutdown__UNIQUE_ID_y_768kill_sbd_opMIGRATE_ASYNCdevice_dma_parametersi_write_hintfxsaveprocess_keyringlist_op_pendingargv__stack_chk_failllist_headlast_mapfree_persistent_gntsbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalget_dqblk__ret_condshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igracemax_slack_shiftclass_rwsem_write_try_is_conditionalthaw_noirqrcu_syncpreempt_notifiersDOMAIN_BUS_TI_SCI_INTA_MSIsrcu_last_gp_ends_fsnotify_infobio_putDOMAIN_BUS_PCI_DEVICE_MSIXmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEarch_atomic_decstatic_keyremoves_magicdl_overrunallocd_parentpersistent_gntspayloadac_minflti_sbfree_workkmalloc_noprofmatchcommcan_matchlast_timePIDTYPE_PIDeventsthreads_handled_lastis_levelthreads_oneshotget_persistent_gntblkif_x86_32_sringatomic_openbio_end_io_tgnttab_unmap_datastart_prevent_timecondreadahead_controlblk_trace__kernel_gid32_tkernfs_open_filef_credseg_idxMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_devselecthost_dataread_newsignalfd_wqhmmapringspto_tmp__modnamereg_basedomain_free_irqsasync_put_workmknodirq_gc_flagsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapwritepagessched_statisticsirq_alloc_infoheadminors__state_permuprobe_taskdevice_get_dma_attrxen_blkif_finiwriteback_controluclampfreezingsuper_operations__compiletime_assert_328bi_cookiesplice_eofxenblk_max_queuesutil_avg___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regsenablepipe_bufsKOBJ_NS_TYPE_NETctx_idarch_msi_msg_addr_lo_td_rt_spc_warnsq_usage_counteri_verity_infoirq_retriggerxsavetimespec_type__rb_parent_colordevres_lockdomidmodule_attributebitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_inforeq_opREQ_OP_ZONE_RESETblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_ops__REQ_NOUNMAPFORTIFY_FUNC_memscan_cond_reschednsecnsegvm_private_datareq_prodio_bitmap__bi_remaininguprobe_task_statetimerkobj_type__UNIQUE_ID_max_persistent_grants794diskseqdeactivatemsleepi_pagesatomic_write_hw_boundaryhlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitirq_alloc_typepage_fragwrite_bytesiobasechardomainunix_inflightxenbus_watchoperationholders_dirlast_usedfpu_state_permi_fsnotify_maskbio_vecblk_ringsgraph_get_port_parentmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkblkdev_issue_secure_erasepurge_persistent_gntbio_slabd_aliasst_rd_sect__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effective__read_overflow2taintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nr__this_modulebio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_t__padcapacityxen_blkif_xenbus_finirq_countmask_posrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_freeparentirq_set_affinity__dummy2atimecopy_file_rangetask_cputime_atomic__UNIQUE_ID_x_804user_definedkey_typeget_named_child_nodelaunder_foliocurr_targetis_suspendedX86_IRQ_ALLOC_TYPE_IOAPIC__UNIQUE_ID_max_queues798timeout_workburstraw_atomic_setetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_t__UNIQUE_ID_max_ring_page_ordertype799blkif_vdev_treq_eventpage_typercu_data0no_updateIRQCHIP_STATE_ACTIVEcap_bsetopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areakstat_irqskunmap_opssaved_statekernfs_elem_attrbasessrings_bdev_filenuma_faultsrb_link_nodelinux_binfmtpage_table_lock_sigfaultcounterskasan_check_readname_linkchipinvcountcmaxrsstimer_slack_nsblkif_common_back_ring___GFP_MEMALLOC_BITbus_typepao_ID__policysharedpercpu_dev_idwait_queue_entrydismissreq_operationlist_deld_real_typelookahead_bandxen_blkbk_flush_diskcacheseq_startrq_qos_mutexzone_wplugs_wqnum_chipsraw_lockd_dname_pad1_pad2class_rcu_tasks_trace_is_conditionalmax_hang_timeirq_nmi_teardowncpus_maskDOMAIN_BUS_ANYsubdirstask_groupstarttimei_fieldmaskmmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tfwnode_operationsshow_devnamelogical_block_sizerun_delaytailsblk_flags_tlineno__dynamic_pr_debugbi_io_vecbase_pfnget_inode_acl_addr_pkeyblkif_sector_tmigrate_foliocustom_slicethread_keyringXenbusStateClosedkparam_arrayutimestart_codefs_bio_set__UNIQUE_ID_x_844is_managedis_harddest_mode_logicalfsbasecompatibleblk_status_tkthread_should_stop__UNIQUE_ID_x_813clock_listattrscpumask_tswregs_statedqb_isoftlimitdma_iommublk_mode_torig_axgnttab_unmap_refs__REQ_ATOMICbladecompletesched_rt_entitymight_reschedtimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLEnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainparam_ops_int_sigchld__UNIQUE_ID_x_836pi_offset__UNIQUE_ID_x_839discard_granularityfopstotalreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsetsoftirq_pendingtime64_tREQ_OP_ZONE_OPENi_blocks__UNIQUE_ID_x_847new_map_idxnuma_faults_localityhas_child_subreaperirq_chip_regsi_aclwake_enabled___GFP_ZERO_BITwrite_newmsecs_to_jiffieslist_lockpm_domaininstrument_atomic_read_writecpu_bitmapstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statevirt_destid_8_14softirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagshandlerswp_entry_tmsi_descirq_get_irqchip_statebi_inline_vecsuint64_t_mapcountdomain_tagdo_eoiraw_atomic_incarch_atomic_sethang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventIRQCHIP_STATE_MASKEDirq_maskset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memoryotherend_idpi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stampcompat_rmtp_flags_2arsp_prod_pvtdma_cleanupmaple_treeXenbusStateInitialisingKMALLOC_DMAdentry__UNIQUE_ID_max_buffer_pagestype791last_mergecpu_itimerpercpuget_unique_idrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupqueue_logical_block_sizenr_threads__i_nlink__REQ_FAILFAST_DEVbio_add_pagepushdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesfirst_sectrangefutex_exit_mutexpm_onlykernfs_iattrstrc_blkd_nodeIRQ_GC_NO_MASKd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacename__compiletime_assert_769blk_mq_ctxbi_iopriou_flagswait_for_threadsnvcswKMALLOC_NORMALwatchdog_stampgnttab_page_cache_putseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERconst_pcpu_hotblk_start_plugbus_tokeni_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idDOMAIN_BUS_WIRED_TO_MSIkernfs_opsbio_allocWORK_CPU_UNBOUNDMODULE_STATE_LIVExenbus_statenr_migrationsa_opsreq_listxa_flagspercpu_affinityfreezebin_sizeclosedev_dma_attrREQ_OP_SECURE_ERASEgrphi___GFP_RETRY_MAYFAIL_BITX86_IRQ_ALLOC_TYPE_PCI_MSIXnr_sectors_msecs_to_jiffiesd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNirq_baseset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorio_optbvec_integrity_poolassoc_arraymnt_idmapdq_dqbuidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqPIDTYPE_MAXnlinkreq_flag_bitspercpu_refhorizontal_positionpref_node_forkjiffieswait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxDEV_DMA_NON_COHERENTresult_mask__UNIQUE_ID_ddebug852seg_bufstate_syncedpp_magicagaindquot_operationsmappingofflineRPM_INVALIDgrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightcommonvm_file___GFP_COMP_BITs_stateuser_sizedev_pm_opsxsd_errorscdrom_device_infogrant_ref_tscheduledFAULT_FLAG_TRIEDraw_atomic_readclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrtag_sizeset_dqblkkmalloc_typeqstrma_flagsgnttab_unmap_grant_refREQ_OP_WRITEnr_ia_rangesblkif_sringshutdown_wqmax_user_discard_sectorsfutex_state__wq_entryorig_pmdqueue_lockacct_timexpd__rcu_icq_cachepersistent_gntsizeem_perf_tablewakeup_sourcemq_freeze_lockf_posirq_print_chipnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitbd_claimingkernel_param_opsbus_dma_regionio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headxen_blkbk_unmap_and_respond_callbackindirect_grefsschedule_work__REQ_PREFLUSHrcharfutex_pi_statekstat__kernel_uid32_tq_lock_cls_keyDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockget_namefwnode_endpoint__intwq_misc_constsepoll_watchesxen_featuresprealloc_pterb_nextdqb_curspace_entrygp_statebitsetload_avgaccesscstimecore_internal_state__do_not_mess_with_itthiscfs_rqbi_bdev_uidmsi_indexnr_vecsst_spacemm_cid_next_scanns_typewill_handleac_majfltposix_cputimers_work_upperforce_resume_depthmodule_param_attrspending_free_lockshort unsigned intno_suspend_depthi_mutex_dir_keyq_nodespc_warnlimitfreezer_active__compiletime_assert_219valids_encodingqueue_workgpl_crcsorc_entrykeysorig_ptedqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutexnanosleep__already_doneDOMAIN_BUS_FSL_MC_MSIsrcu_gp_seq_neededdirty_foliodq_dqb_lock__kernel_ulong_tvolnameio_mindl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlockrlim_maxslave_dirDOMAIN_BUS_AMDVIruntime_deferred_listd_waitlocal_fwnodequeue_flagslist_lru_onedevice_physical_location_horizontal_positionseq_stopdev_idblkif_x86_32_back_ringxenblkddomain_alloc_irqskiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidflagoverflow_max_grantss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeschedule_timeoutclass_device_is_conditional__UNIQUE_ID_persistent_grant_unused_seconds796shrinker_idbio_setroot__REQ_IDLEoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageIRQ_GC_INIT_MASK_CACHEirq_flags_to_clearpages_to_gntarch_msi_msg_data_tno_callbacks__u16timers_activewait_countsig_ok__SCT__cond_reschedhwirqdelaysirq_safereadaheadkmalloc_cache_typemutexpgd_tnr_cpus_alloweddiscard_alignmentraw_spinlock_tkey_taggetgeofs_flagsworkpgprotval_tkeytypesigpendingmq_freeze_depthfsindexshstknotify_remote_via_irqnum_ctsrcu_ssppage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialxen_blkbk_xenbusHPROBE_GONEactive_timei_sequencepool_datablkif_x86_32_request_rwset_freezabledisk_statsdqb_ihardlimitd_lockrefREQ_OP_ZONE_CLOSErpm_requestnum_bpf_raw_eventsaddrdevice_private_perfi_dir_seqirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjdebug_check_no_locks_heldcore_cookieblkif_x86_64_request_othergrefsrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_info__UNIQUE_ID_y_805block_devicekobj_ns_typeirq_resumeBLK_INTEGRITY_CSUM_CRC64f_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_info__UNIQUE_ID_y_814FORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimerequired_flagsdeadlineend_block_io_opmempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startlog_statsIRQ_GC_BE_IOunused_hctx_lists_flagscpumask_var_tfaultindirect_op__param_str_max_queuesmigration_pendingalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkdispatch_discard_iointegritydq_flags__UNIQUE_ID_y_840__UNIQUE_ID_y_845__UNIQUE_ID_y_848DD_CLASS_TYPE_DISJOINT_NAMEShardirq_stack_inusep_sizetrace_eval_mapmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpdevicetypei_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITbio_max_segsnum_kpin_execvetlb_flush_pendingpage_offset_baseRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionREQ_OP_ZONE_FINISHserialclass_releasealloc_locks_dquotmax_hw_sectorsfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffpending_masksyscall_user_dispatchrcu_tasks_exit_listset_descarchdataia_uid__list_del_entry_valid_or_reportblkif_request_indirectchildrenrb_subtree_lastno_pm_callbacksbuild_iddevice_get_match_datavfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_paddiscardtailia_atimetlb_ubcbi_issuequota_format_typewaiting_reqsseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextio_tlb_memsubmit_bioblk_flush_queuei_mtime_nsecperformanceDOMAIN_BUS_PCI_DEVICE_MSImmlisthd_geometrysuppress_bind_attrsRPM_RESUMINGreg_offsetgsbases_quota_typesblkif_get_x86_64_req__preempt_count_addirqchip_irq_stateDOMAIN_BUS_IPIIRQ_NONEphandlei_nlinkbranchwrite_begingroupspi_blocked_onDOMAIN_BUS_DEVICE_MSIs_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskrsp_eventBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superinstalleds_inode_list_lockelevator_queuesweventfreeze_holderxen_domain_type__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typemaj_fltarch_rwlock_txen_featureclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersindirectrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timergnttab_set_unmap_opclass_write_lock_is_conditionalXEN_HVM_DOMAINbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datagnttab_unmap_refs_asyncmmap_locksysfs_lockrq_qosblkif_x86_64_back_ringfsavekeyring_index_keyqrwlockfile_ra_stateuser_structpci_msi_descon_rq__p_size_fieldfs_contextmempool_alloc_tprealloc_bufDL_DEV_DRIVER_BOUND__UNIQUE_ID_max_queuestype797projiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitpending_freeatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclassaddress_hilast_mm_cidfile_lockmax_open_zonesxen_blkbk_mapcookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structdomid_tcred_guard_mutexmajorreq_conssigcntblkif_request_segmenthrtimer_cpu_base__UNIQUE_ID_ddebug807__UNIQUE_ID_ddebug809cb_headcheck_quota_fileFORTIFY_FUNC_memchrattributeclass_raw_spinlock_is_conditionaldev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsblkif_x86_32_sring_entry__UNIQUE_ID_ddebug816__UNIQUE_ID_ddebug818list_lruusing_gplonly_symbolsflush_supporttarget_knchip_typessival_ptri_opflagsmake_responserobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctl__UNIQUE_ID_ddebug820lockdep_mapbdev_nr_sectors__UNIQUE_ID_ddebug826msi_attribfiltercurr_ret_stackirqreturn_tdockfail_responsedev_links_infoirq_bus_lockloff_tthread_pidsrcu_gp_seqia_rangesprepare_desc__UNIQUE_ID_ddebug832_archipi_send_singlest_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnoirq_calc_maskuintptr_tbatchasync_sizeacct_vm_mem1i_mtime_secDOMAIN_BUS_PLATFORM_MSInum_online_cpusmemory_typerb_rootnr_wakeups_locals_fsnotify_masknr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__UNIQUE_ID_ddebug850__param_log_stats__UNIQUE_ID_ddebug854__UNIQUE_ID_ddebug856__filler__list_addsaved_sigmaskd_timeentriescpu_idmsi_freefop_flags_tirq_fwspecFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_lockinit_wait_entryevent_flagssched_delayedbd_statsbi_sizemsi_initmodule_state__write_overflow_fieldmq_kobjlast_used_atirq_chip_typehardirq_stack_ptrvm_endlast_queuednuma_migrate_retryuser_nsirq_ack__statefirstdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_t__REQ_NOWAITi_modenr_thpsia_ctimeDOMAIN_BUS_WIREDFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexpagefault_disablepersistent_purge_listi_private_dataElf64_Halfuse_autosuspend__UNIQUE_ID___addressable_init_module858FORTIFY_FUNC_memcpynsproxy__param_str_max_buffer_pagescan_wakeupxol_area__param_str_persistent_grant_unused_secondsirq_request_resourcesirq_chip_genericrlockpcpu_hotfl_owner_t_rescls_mskia_rangeeuidwaitbug_tabledirtied_time_whensequential_io_avgcallbacknr_pagesreadonlynum_trace_bprintk_fmtgc_flagssegs_to_mapvm_policyspurious_thresholdperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayirq_flags_to_setRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvpreg_readlbvec_iterctimereleasemax_segment_sizesched_dl_entity__kernel_dev_tatomic_write_lennum_cleanrb_erasereclaim_semdqb_btime_nr_pages_mappedutf8datarevmap_treemm_usersbd_holder_locks_ids_dentry_lrubp_offsetblk_crypto_profilemask_basefolio_queuelast_task_numa_placementpgtable_tblock_start__REQ_FUAcgtimenodenamesymlinkxen_blkbk_barrieroom_flag_origindqio_semcounterorc_unwindxen_blkif_interface_finiWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqbi_iocost_costdonexen_blkbk_parse_indirectfscrypt_operationsdmar_index_0_14release_workparent_irqksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliodebugfs_dir__UNIQUE_ID_license861queuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaDOMAIN_BUS_DMARdl_timeri_dataDL_DEV_NO_DRIVERpropertiesFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameopen_partitionsblkcg_gqia_filesival_intXenbusStateClosingnuma_preferred_nidinstrument_atomic_write_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobegnttab_page_cache_shrinkmsi_mask_Boolsleep_start__p_sizemin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatei_link__outlistxattr_lowertrap_nr__compiletime_assert_802__compiletime_assert_803__REQ_RAHEAD__compiletime_assert_806async_probe_requested__compiletime_assert_808X86_IRQ_ALLOC_TYPE_PCI_MSI__list_add_valid_or_reportcompat_long_tactive_countsegs_to_unmapphys_bases_iflagsprevent_sleep_timemce_kflagssupported_flagstotal_numa_faultss_countdev_msi_infod_revalidateerrstringbus_groupsirq_chippmd_t__compiletime_assert_812__compiletime_assert_815REQ_OP_DISCARD__compiletime_assert_819s_opd_sbsysv_shminstrument_atomic_readdq_countutf8data_tableset_latency_tolerance__func__foliowake_entry__compiletime_assert_821__compiletime_assert_822__compiletime_assert_823__compiletime_assert_824__compiletime_assert_825xa_head__compiletime_assert_829suidnbioirq_domain_opsi_readcountirq_write_msi_msgblk_integritylocked_vmgrant_pagerb_leftseq_next__kmalloc_large_noprofsym___kernel_sigreturnuevent_suppressquotactl_opschunk_sectorss_sync_locktotal_time__compiletime_assert_831iov_len__compiletime_assert_833__compiletime_assert_834__compiletime_assert_835__compiletime_assert_838__kernel_clock_tblkif_get_x86_32_reqclass_rcu_is_conditionalIRQ_GC_INIT_NESTED_LOCKbpf_local_storageactionclockid_txen_blkbk_free_cachesquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countdrain_complete__compiletime_assert_842__compiletime_assert_843arch_addr_hi__compiletime_assert_846blkif_protocolksm_merging_pagesotherendfree_listautosleep_enabledptrace_entryxen_blkifblkg_listrecent_used_cpunum_jump_entriesrequest_mutexs_qcopatomic_tbv_page__compiletime_assert_851alloc_tag_counters__compiletime_assert_853__compiletime_assert_855__compiletime_assert_857_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitshort intmynodepart_tblmsi_domain_infozone_wplugs_hashblk_mq_opsXenbusStateInitialiseddownclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablearch_atomic_incf_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalmapcountem_pdtrace_event_callxenbus_transaction_startis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOthreads_activehwsizeelevatorBLKIF_PROTOCOL_NATIVEcurrent_may_mountarch_addr_loseqlock_tbd_queuenuma_scan_offset___GFP_NO_OBJ_EXT_BITsched_migratedfrozenmlock_countin_lru_faultgrpmask__ret_warn_onregfuncindex_keymemalloc_noioGRPQUOTAi_private_listia_validvertical_positionFORTIFY_FUNC_strncati_rcui_atime_secWORKER_DESC_LENqc_type_statekey_serial_tdev_ueventsetupf_lockmsi_msg___GFP_MOVABLE_BITactivexlatedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsgetattrFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listbackend_infoxarray_start__flagsp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nskcsan_check_accessirq_set_typesource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refabortpmdval_t___GFP_NOFAIL_BIT__REQ_FAILFAST_TRANSPORTgroup_infovdso_imageblk_qc_tnr_segmentsfileWORK_BUSY_PENDINGof_match_tablepercpu_count_ptr__user_state_size__msecs_to_jiffiesdmar_subhandle__UNIQUE_ID_description860mce_kill_mephysical_block_sizeuuid_tproperty_read_int_arraynr_actions___GFP_UNUSED_BITatomic_write_hw_unit_mindev_bus_addrcount_objectserrorq_sizeinflight_stimezone_device_datanr_active_requests_shared_tagsf_wb_errhandler_name___ratelimitdefparamlast_unhandledfred_csq_lockdep_mapfault_flagresend_nodekprojid_tptracer_credtlb_genstoreio_lock_cls_keypage_mkwritekobjectaudit_ttymce_ripvstatfsxen_blkif_inittag_set__UNIQUE_ID_log_statstype801numab_stateremovablefeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistREQ_OP_DRV_OUTclass_groupsnuma_nodeoffsetsi_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedsysfs_registereddebugfs_mutexwatch_listrevmap_size__fortify_sizeaudit_contextpp_ref_countsysfs_opssequential_ioblkif_x86_64_requestipi_send_maskst_ds_req__compiletime_assert_100_large_mapcount__compiletime_assert_102__compiletime_assert_103sda_is_static__compiletime_assert_105__compiletime_assert_106__compiletime_assert_107__compiletime_assert_108__compiletime_assert_109formatftopenclavemask_cache_privbi_privatedefault_irqsp_regcreatewrite_msi_msg_dataiattrpending_free_wqirq_domain_bus_tokenrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_list__compiletime_assert_110__compiletime_assert_111get_reserved_spacenon_seqstack_refcountinvalidate_lockblkif_common_requestbmapnr_ringskey_payloadirqactionblkdev_issue_discardtimer_rand_stated_realexpiry_activedqi_max_spc_limitfreezing_slow_patheval_stringexception_table_entryvirt_boundary_maskevent_countpreempt_countparam_countarch_atomic_dec_and_testfallocatei_spc_warnlimitbuddy_listi_ino_timelimiti_mmap_writablepagefault_disabled_decmems_allowed__preempt_count_dec_and_testtlb_flush_batched_ddebug_infounmap_data__param_max_persistent_grantsis_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tsRING_IDXs_max_linksnr_wakeups_syncpreqkallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tatomic_incxen_blkif_xenbus_initDOMAIN_BUS_PCI_MSIblocksirq_affinity_notify__might_reschedset_infofileattr_getvectorFORTIFY_FUNC_strncpy__compiletime_assert_810FORTIFY_FUNC_strcat__bi_cnttimer_listaffinityXenbusStateReconfiguring__compiletime_assert_817d_ino_warnsXEN_NATIVEhiwater_vmtracepointcompound_headia_vfsuidirq_eoi__kernel_ssize_tpdeviceorig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersthread_maskino_timelimitsplice_writestate_in_sysfs_raw_spin_lock_irqsavesysfs_attrs__list_del_entry_validqf_nextranges__compiletime_assert_92__compiletime_assert_93__compiletime_assert_94__compiletime_assert_95__compiletime_assert_96iommu_mmirq_enable__compiletime_assert_99blk_features_tcutimeem_tablefeature_gnt_persistent_parmpersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprividle_notificationsched_infod_fieldmask__REQ_FAILFAST_DRIVER__REQ_ALLOC_CACHEuprobe_xol_opsseq_filefreeze_noirq__param_max_buffer_pagesrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countxen_blkif_max_ring_orderalloc_tagblk_ring_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssync__param_max_ring_page_orderkmap_atomicsetlease__REQ_INTEGRITYpins__compiletime_assert_841pacct_structmust_resume__REQ_FS_PRIVATE__compiletime_assert_849long intfile_lock_contextusageuv_alloc_infol_yessiglockstatuserror_injection_entrycurrent_taskreal_addressac_stimesync_iofred_ssproperty_presentmsi_domain_ops__kmalloc_index__write_overflownr_iosprintk_index_sizesymtab__REQ_PRIOrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncthreads_handledegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flags__newcodetagatomic_decPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donemark_dirtyrb_linkthread_flagsxen_vbd_resizenum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEirq_common_dataf_inode__kernel_timespecblkif_x86_64_sringcancelled_write_bytesgnttab_unmap_refs_donesrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordfile_bdevmod_kallsymsmnt_iddepthwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldmultiplepending_reqDOMAIN_BUS_GENERIC_MSIcheck_eventsssize_tiopl_emulmax_write_zeroes_sectorswork_structdesc_len__UNIQUE_ID_max_ring_page_order800flocknativetask_io_accountingmremaphprobe__fortify_panictracepoint_funcremove_nodecoherent_dma_maskentryfree_cached_objectsREQ_OP_DRV_INworkqueue_struct__UNIQUE_ID_ddebug830pr_opspi_lockgnttab_map_refs___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whengnttab_page_cacheupdate_timemaxlensuspend_noirqschedulenr_sectsclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argsirq_unmasksrcu_reader_flavortv_nseci_lruiommu_cookieFORTIFY_FUNC_strcpyqueue_depthbiolisteoi_flagsgfp_maskpi_state_listrcu_segcblistsubvolbase_addressspin_unlock_irqrestorefree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infojiffies_eoi_delayeddmar_reserved_0srcu_structrlim_curnofaultmm_countcputime_atomicdrv_groupsstackfunctionki_flagsbvec_poolbd_start_sect___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashmax_sectorssgidinitial_nsFREEZE_MAY_NESTblkif_request_otherbucket_idrb_leftmostthread_infosuspended_timedatastrtabtty_old_pgrpdl_throttledirqs_unhandledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextdmar_base_addressmsi_prepareopc1__int128 unsignedpcountrestore_noirqdma_pad_maskki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_events__vpp_verifyiommubi_opfprivateDEVICE_VERT_POS_LOWERblk_finish_plugst_infomap_countpdeath_signalexit_signalsa_restorerbpf_run_ctxsplice_pipebdeveffective_affinityblk_mq_tag_setspinlock_checkblk_independent_access_rangess_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodstqheadmsi_domain_cookies_activeoperation_flagsMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalnext_lruremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurexen_blkbk_map_segrb_root_cacheds_copblkif_x86_64_request_rwXenbusStateReconfigureddd_key_truedcookiehres_activeDEVICE_PANEL_FRONTbpf_raw_eventsdq_dirtydl_deferbug_listpagefault_enabledirect_completeblk_mq_tagsxa_locklist_addfxregs_statedrainload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countirq_counttop_of_stackblkif_request_discardkey_restrictionnr_rangeexit_stateis_late_suspendedsysvsem__REQ_SYNCbd_nr_sectorsignore_children__param_persistent_grant_unused_secondsrestore_earlyclock_mutexuse_persistent_gntsfs_supersxen_vbd_translatedo_block_io_op__param_str_max_ring_page_ordernotifygntab_unmap_queue_datadqb_bsoftlimitpendingmax_dev_sectorsf_task_work___GFP_NORETRY_BITiowait_countset_read_only__compiletime_assert_827throtl_datadma_io_tlb_memstringread_countxen_irq_lateeoifutex_offsetlong long intx86_msi_addr_hiatomic_flagssysvshmnr_entstimer_expiresirq_set_vcpu_affinitytrace_evalsactive_basesearly_initmprotectsecurityxmm_spaceactivatef_pos_lockgnttab_page_cache_getchip_datatls_arrayownerpfo_val__irq_release_resourcesacct_rss_mem1need_mbX86_IRQ_ALLOC_TYPE_UVvm_flags_trefcount_struct___GFP_FS_BITxenbus_transaction_endblkif_requestdmar_index_15i_bytesdomain_datarelax_countblkif_back_ringdevice_attribute___GFP_THISNODE_BITline_entry_ptrlinkstart_timekernfs_nodeRPM_REQ_IDLEsuppliersnvec_useddev_tFREEZE_HOLDER_USERSPACEdup_xol_addrrevmapcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGblkif_common_sring_entryuclamp_sex86_msi_addr_loElf64_Wordgp_seqkset_uevent_opsIRQ_WAKE_THREADiov_offsetfpregs_statebd_devicesubsys_fmt_prefixmm_mtacquire_dquotcoherent_dma_maskis_vallocparameterszone_wplugs_lockd_releasestates_d_opmce_whole_pagestatsreadclass_cpus_read_lock_is_conditionalnetlink_nsneed_qsxenbus_transactionswap_deactivateblkcnt_txenbus_read_unsignedicq_treework_bitssi_codexspathsizeinit_dev_msi_infothread_nodenr_itemsbi_flagsarch_tlbflush_unmap_batch___GFP_LAST_BITmap_pagesreschedule_countvfsmountextable_basenoinstr_text_sizenargsattributes__list_del_entrycached_rqsset_child_tidblk_unique_id_overrunsystem_wqtmpfilesysfs_remove_grouprcu_read_lock_nestingTASK_COMM_LENmin_nrtick_dep_maskst_rd_reqatomic_readlistthrottle_disksi_errnos_inode_lruatomic_setsrcu_size_stateblk_plugclass_rcu_tasks_trace_is_conditionalxen_blkbk_xenbusneed_tsof_noderefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerfreeze_lated_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedfail1VTIME_GUESTblkif_x86_32_request_indirectregsslice_maxlast_switch_countqsize_tmsi_desc_dataWORK_OFFQ_DISABLE_SHIFT__compiletime_assert_109filesotherend_watchdqb_bhardlimitliveatomic_write_unit_maxrun_listixolbd_mappingsym_vvar_pagemodule_sect_attrsreturn_instancexen_vbdsoftirq_activatedzone_wplugs_workclass_preempt_notrace_is_conditionalis_preparedret_stacknode_id_workingsetautosuspend_delayunsigned intgendisk__compiletime_assert_116spc_timelimits_instancesdescseqcounttokenoom_score_adjd_seqbi_crypt_contextia_vfsgidsize_tdevidacpi_device_idcap_permittedTT_NATIVEaffinity_hintclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idx__compiletime_assert_39rcu_tasks_holdouttarget_listsync_blockdevpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nseccpuhp_deads_remove_countsyscall_workdevice_physical_location_vertical_positionatomic_long_tdev_attr_rd_sectprealloc__init_swait_queue_headpfn_mkwriteclass_raw_spinlock_is_conditionalcallback_heads_vopdiscard_secureperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkirq_shutdownfmode_tcputime_atomicxenbus_switch_staterestoredelayed_callmsi_instance_cookiebi_itermax_nr_cidblkif_common_sring_statusmark_deadd_sibkernel_ulong_tX86_IRQ_ALLOC_TYPE_DMARdma_opsioapic_alloc_infobin_attributemin_align_maskpercpu_counterdev_groupsIRQ_NONExenbus_readnuma_pages_migratedlimits_lockdl_dev_statexen_blkif_be_intgsindexexpires_nexti_io_listf_epsrcu_barrier_seqblkif_back_ringslinks_countdev_attr_modereturn_consumerrelease_dqblkin_thrashinguaddr2int16_t__kernel_timer_tclass_srcu_is_conditionalDEVICE_VERT_POS_CENTERnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errstatus_use_accessorscputimertrace_recursiondevpathbv_lenstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registerdev_pagemap_opss_stack_depthdata_vm__s32blkif_x86_64_request_indirectentry_eiptaskstatsGENHD_FL_NO_PARTblk_protocolhugetlb_usageratelimit_states_pinsst_wr_reqxenbus_device_idpersistent_gnt_cattrdmar_subhandle_validget_next_child_nodeFAULT_FLAG_WRITE__module_getirq_set_irqchip_statestate_in_sysfsIRQCHIP_STATE_LINE_LEVELvm_fault_ttty_structUTASK_SSTEP_TRAPPEDblk_independent_access_rangefind_special_pagebacktrace_entire_mapcountpersistent_gnt_in_usestrrchrforce_atomicmmap_compat_legacy_basedefault_groupspollgraph_get_next_endpointresvnr_wakeups_idlehost_addrFORTIFY_FUNC_memsetio_cqelf64_symlatch_tree_nodepercpu_ref_datacsum_typedestroy_workDEVICE_HORI_POS_RIGHTrequeue_listPROBE_FORCE_SYNCHRONOUSBLK_UID_NAAWORK_OFFQ_FLAG_SHIFTdev_attr_rd_reqsyscore__s64st_printdqi_bgrace__kernel_pid_tsystemstatic_call_modbus_select_token_timerdma_map_opsma_external_lockdevice_physical_location_paneluid_tflush_requiredstrstrsum_block_runtimepgmapmin_perf_statestrnlendq_oprcu_tasks_nvcswwritetypetabmax_user_sectorsirq_release_resourcesclass_read_lock_irqsave_is_conditionalFORTIFY_FUNC_strlcatxenbus_map_ring_vallocdma_pools_addr_lsbi_generation_sigpollmxcsrdevtxenbus_watch_pathfmtX86_IRQ_ALLOC_TYPE_AMDVId_rt_spc_hardlimitbi_end_ioblk_holder_opsnuma_groupdescriptionwakeup_countclass_spinlock_is_conditionalcpu_id_startget_parentnr_wakeups_affinepteval_ti_inodyndbg_infoindexmsi_parent_opsshow_rd_reqdriver_datathread_headdev_pm_qosbi_sectormap_typef_oppids_active_resetrandomconfirm_switchseqcount_tkmem_cache_alloc_noprofnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalportpercpu_sizebdev_discard_alignmentxenbus_dev_fataldq_sbarch_static_branchnr_pendingsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirback_padbug_entry___GFP_NOWARN_BITcmin_fltrw_semdqio_semprev_sum_exec_runtimenestedpm_devmsi_translatenr_forced_migrationsnum_argsri_timerstack_canarydestid_8_31blksizesiblingmnt_rootnext_scanf_raquota_writefeature_gnt_persistentxenbus_unmap_ring_vfreesrcu_barrier_cpu_cnttranslateiopl_warnrmdirsock__UNIQUE_ID_ddebug822bi_write_hinthash_lenget_policy__list_add_valid__UNIQUE_ID_ddebug828HRTIMER_RESTART__bi_nr_segmentsirq_nmi_setupsym_vdso32_sigreturn_landing_padd_initextended_state_areazone_write_granularitycore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxdevnodecpu_basedevice_is_availabledquotdl_runtimenumbersbi_vcnt_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batch__UNIQUE_ID_buffer_squeeze_duration_mstype830semaphore__param_str_buffer_squeeze_duration_msshutdowndq_lockblk_ring_locki_cdevldt_structenv_endobj_cgrouprescue_workqueueptrace_messageGENHD_FL_HIDDENnum_trace_events_sys_privatealignment_offsetopen_mutexinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoftcrypto_kobject__sifieldsirqs_per_chiprcu_read_unlock_specialread_bytes__compiletime_assert_200__compiletime_assert_201__compiletime_assert_202__compiletime_assert_203__compiletime_assert_204__compiletime_assert_205__compiletime_assert_206fsverity_operations__compiletime_assert_208free_pagesx86_64wake_q_noderequest_key_authirq_bus_sync_unlockvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxbadblocksirq_hw_number_tstart_stackwatcherskmalloc_cachesredirect_hintcompletionblkif_x86_32_requestsw_reserveddevice_removablebd_meta_infobio_integrity_poolUTASK_SSTEP_ACKactive_uprobebit_nrst_oo_reqshow_optionsdiskbpf_raw_event_mapsize_is_constantFREEZE_HOLDER_KERNELioapiccore_nodecurr_nrsector_ttrc_blkd_cpuin_memstallpermission_utimepm_subsys_datairq_flow_handler_tirqstatget_dquotsnum_orcsclass_task_lock_is_conditionalFAULT_FLAG_MKWRITEoom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treefrequencyquota_onunmap_pagesst_f_reqvm_operations_structbin_attrs_newhwirq_maxbio_alloc_cachebi_bdevsring_x86_32iov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrendirty_foliois_softxen_vbdstat_groupcntsRPM_SUSPENDEDreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdataRPM_SUSPENDINGnrpages_refcounti_crypt_inforinglist_emptyblkif_x86_32_request_othererror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedclock_op_might_sleepXenbusStateConnectedenvp_idxWORK_STRUCT_INACTIVE_BIT_head_1_head_2bd_size_lockbackstate_add_uevent_sentgrant_pagei_hashresulthlist_nodeblkback_namesprintfio_uringshow_wr_reqcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupresumeirq_disablewake_qfileattr_setkzalloc_noprofrcuwaitbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerunmap_opsNR_KMALLOC_TYPESsect_attrsDOMAIN_BUS_WAKEUPqueue_work_ononlineruntime_resumedup_xol_workqueuecan_maskpercpu_enabled___GFP_WRITE_BITicookieMEMORY_DEVICE_PCI_P2PDMAtotal_vmjobctls_time_maxnode_listdio_offset_alignDOMAIN_BUS_NEXUSdelay_worktot_countoublockrecent_cidbdev_get_queuekernel_paramdeferred_resumed_spc_softlimitreported_split_lockgfp_tswap_slot_free_notifyseccomp_filterstimedestid_0_7list_add_tailxen_blkif_deferred_freeevent_channelsi_mmapirq_startupphys_addrd_lrusignal_structDOMAIN_BUS_VMD_MSIWORK_STRUCT_COLOR_BITSperf_event_mutexcrcspgdval_tsetattrf_mappingnoinstr_text_startpreparebin_attrssas_ss_flagsf_modeis_msixki_completevtime_statewakee_flipsgnttab_workset_aclpids_activedrivermsix_ctrlget_hwirqi_opx86_32ldt_usr_semkobj_ns_type_operationsbd_securityseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodemsi_post_freesrcu_gp_seq_needed_expinterval_expaddress_space_operationsspinlock_t__kmem_cache_create__task_fpstatemaskwait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tfwnodexen_blkif_interface_initis_dirty_writebacktrace_bprintk_fmt_startdisablehuge_faultkstatfssitesxen_blkbk_unmap_purged_grantsDEVICE_VERT_POS_UPPERptracequota_disablekprobe_blacklistbackend_changedcpus_ptrpaccti_dentrydisk_eventsgrab_current_nsblkif_x86_64_request_discardaltmapmax_secure_erase_sectorsdescsfsnotify_mark_connector_sigsysqueue_kobjuse_freeptr_offsetsrcu_cb_mutexstatic_call_sitefortify_funcMODULE_STATE_UNFORMEDkmem_argsexpiresmulti_ref___GFP_HARDWALL_BITnivcswhandle_irqMODULE_STATE_GOINGDL_DEV_UNBINDINGbus_select_maskmulti_capthreadsym_timens_pages_time_mins_devcpus_allowed_lockxenbus_dev_is_onlineget_next_idrwlock_tmax_integrity_segmentspgprotsegmentsfalsed_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeymsi_alloc_info_tiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagwrite_msi_msgsched_rt_mutexcoredump_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupirq_mask_ackis_virtualof_device_idseqcount_spinlock_tbio_issuei_wbshow_oo_reqhas_elevatoruint8_tpanelclass_idinactive_timer_pkeyfilenames_export_opfront_pad__mptri_flctxstashedcond_suspend_depthvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedunused_hctx_lockresume_noirqpagetrc_holdout_listget_inode_usagedevice_nodenormal_priomq_opsdestroy_inoderelease_foliolast_busyi_pipebasehostuaddractive_lows_wb_errshm_clistWORK_STRUCT_PWQ_SHIFTis_child_subreaperunicode_mapXenbusStateInitWaitgraph_get_remote_endpointnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockbd_openersoffslast_siginfounusedalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inamedevres_headi_mappinginblockrmidrseq_sighandledev_pm_domainlimit0limit1nr_zonesread_per_ring_refsmigrate_modeshow_rd_sectbio_poolxen_blkif_mappoweroff_lateftrace_callsitesd_hashis_confidentialbdev_file_open_by_devdl_bwlimit__real_strnlenkobjfsyncmtd_infoi_flagslimitskernel_siginfouprobes_stateFAULT_FLAG_REMOTEkernel_siginfo_trb_nodeblk_queue_statspushable_tasksst_wr_sectplatform_datad_comparesighanditerate_sharedis_visiblesignal___GFP_ZEROTAGS_BITxenbus_devicereleasedthread_fndep_mapalloc_dquotpm_messagemay_splitmem_cgrouplast_update_timeirq_suspendrobust_list_headmultiple_queues__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevel__kmalloc_noprofs_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrgraph_parse_endpointstack_vmusage_count_folio_nr_pagesblkifioctlshowunsigned charumount_beginaffinity_notifyvdso_pad3mmap_legacy_basepipe_inode_infouint16_tsecurebitspartition_meta_infostate_initializedslave_bdevsuring_cmd_iopollbi_poolcompat_uptr_tuevent_opspoll_bioslicesas_ss_spnr_dirtiedBLK_INTEGRITY_CSUM_IPxen_update_blkif_statusnum_kprobe_blacklist___GFP_DMA32_BIT___GFP_DIRECT_RECLAIM_BITclass_local_lock_is_conditionalsuspend_latewakeupcg_listsrcu_barrier_completion__compiletime_assert_58driver_flagselementsrw_semaphoreresume_earlymnt_sb_ddebuginfophysical_locationdma_range_mapfiemapxenbus_printfwaitersblkif_request_rwsessionidarch_atomic_read_sifields_hugetlb_subpoold_manageicq_hinthandler_datafiemap_extent_info__kmalloc_large_noprofpadding1llistdebugfs_entrybdev_max_discard_sectorselemnr_retriesIRQCHIP_STATE_PENDINGxen_blkbk_discardsigval_talimitundo_listKMALLOC_RANDOM_STARTdelivery_modeirq_datamask_cache_dev_warnmissedreport_zonesbi_idxquota_readrsp_prodst_shndxfreei_wb_frn_avg_timebdev_physical_block_sizebd_fsfreeze_countfile_ref_ttypemembarrier_stateIRQ_HANDLEDpage_poolsuspendinitfiles_structwrite_iterothers_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typeatomic_dec_and_testmtimeserver_has_tasksvm_faultzone_wplugs_err_listoom_score_adj_minx86_msi_datakobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_memblk_opf_tpathst_sizermtpwait_sumnum_tracepointsupidexit_codemempool_texec_start___GFP_RECLAIMABLE_BITclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwneed_parent_lockrcu_syncproc_dir_entryvm_opssring_x86_64raw_atomic_dec_and_testiopollpagesizedisk_names_blocksizevm_pgoffauprobe__retnuma_workupdate_timeptrace_dr7_call_addrrescue_lockmax_segmentsWORK_BUSY_RUNNINGloginuidcheckexpiryoptimistic_spin_queuedl_defer_runningbi_bvec_doneroot_blkgsector_number__lstatenot_essentialueventlock_countrefcount_tplugchild_countsaved_auxvmce_addrnum_bugs___GFP_HIGH_BITqf_ops__vm_flagsmod_nameproperty_read_string_arraymm_cidFORTIFY_FUNC_strnlenunlocked_ioctlrseq_lenparammodule_attributepollfdnr_wakeups_remotellist_nodeswappagesclass_spinlock_irq_is_conditionalmemcg_aware__list_del_entry_validstate_use_accessorsclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextDEV_DMA_NOT_SUPPORTEDreadlinkmigration_flagsdev_attr_ds_req_pincountrq_timeoutDEVICE_PANEL_BOTTOMconv_zones_bitmaplist_headtgidwrite_protect_seqcompat_robust_list_head_tidlast_statuss_inode_wblist_lockbd_holderend_codeqspinlockblkif_x86_32_request_discardirq_compose_msi_msglru_genirq_set_wakeinsnfilldir_t__must_check_overflowdl_non_contendingdir_contexttracepoint_ptr_tutasksched_entityd_spc_hardlimitmq_freeze_wqlong unsigned intsleep_maxmmap_baserescue_workio_contextquiesce_depthhctx_tablegpl_symsseq_showswait_queue_headcow_pagexen_vbdstat_attrssectordevnameblocki_spc_timelimitreturn_instanceszone_wplugs_hash_bitsstrchrsched_shared_tagsclass_raw_spinlock_try_is_conditionalcb_listdl_server_pick_fin_eventfddevicebi_integritys_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerinaccessiblequick_threadstime_sliceeval_valueobjcgxen_blkif_alloc_ringsblkif_responsefull_namenoderesetvm_lockno_cgroup_migrationnextevts_writers_key__countirq_cntxcomp_bvcma_areastatic_prioflush_listmay_skip_resumeshrinkerdl_yieldeddqi_formatnum_pagesexec_update_lockatomic_write_hw_maxl1d_flush_killi_versionDEVICE_REMOVABLE_NOT_SUPPORTEDprev_cputimereg_writelerrnumstate_remove_uevent_sentdmar_formatfirst_minordevice_unregisteria_sizein_hrtirqs_master_keysarch_msi_msg_addr_hi_tpropertywchar_addr_bndkernel_symbolsubsys_databi_statustv_secis_64blk_integrity_checksumpid_ttask_listftrace_sleeptimebdev_logical_block_sizerun_nodeblock_device_operationsblkif_x86_64_sring_entryma_rooturing_cmdX86_IRQ_ALLOC_TYPE_HPETnr_failed_migrations_affineIS_ERRstrcmpuser_cpus_ptrpendcntpi_top_taskWORK_NR_COLORSaddress_loblkif_sring_entryactoruprobenotifier_subscriptionss_readonly_remountkasan_check_writeutil_sumreserved_0st_otheri_mutex_keyksethrtimer_clock_basevruntimepersistent_purge_work__builtin_strcpydisable_depth_printki_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_items___GFP_HIGHMEM_BITring_ref_namemoduleXenbusStateUnknownpcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespace__param_str_feature_persistentvfsuid_traw_spinlocktimer_autosuspendsnr_ring_pagesfail2fail3pudval_t__rcu_headmce_vaddrquota_offdq_inusecachedqi_flagsstrcpybdev_filekfreestatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queueindirect_pagesirq_descdqi_dirty_listmax_timemod_tree_nodef_sb_errwritepageFORTIFY_FUNC_strlencodegtimesigactionwake_activedev_iommuclass_rwsem_read_is_conditionalsum_sched_runtimetag_set_list__kernel_timespecdummylocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listbi_blkgnr_hw_queuesunmapktypelockrefin_dpm_listsrcu_struct_ptrsmm_structvlagIRQ_GC_MASK_CACHE_PER_TYPEi_uid__wake_uptablesBLKIF_PROTOCOL_X86_32bi_iocost_costspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesend_pfnvm_mmxenbus_strstate__kmem_cache_create_argsirq_domain_chip_genericdebugfs_idguest_permmem_dqinfotruei_countHRTIMER_NORESTARTpart0bd_disksp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipgrant_handle_tufdsexe_filereserved_1raw_atomic_setnr_scannedpcp_listpid_linkss_sysfs_namerefcountxen_blkif_ringvaddrrequestrw_hinttimeoutreport_zones_cblast_switch_timenum_classesorc_unwind_ipqc_dqblkBLKIF_PROTOCOL_X86_64mmappedseqcount_raw_spinlockbd_holder_dirirq_pm_shutdownkill_sbd_opxenbus_scanfMIGRATE_ASYNCdevice_dma_parametersWORK_OFFQ_FLAG_BITSi_write_hintfxsaveprocess_keyringlist_op_pendingDEVICE_VERT_POS_LOWER__stack_chk_failllist_headbyteswait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixupirq_gethashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalthaw_noirqpreempt_notifiersDOMAIN_BUS_TI_SCI_INTA_MSIsrcu_last_gp_ends_fsnotify_infoDOMAIN_BUS_PCI_DEVICE_MSIXmempolicyadd_linkspm_message_tiovecsecondaryi_private_locksegment_boundary_maskVTIME_IDLEstatic_keyremoves_magicdl_overrunallocd_parentpersistent_gntspayloadac_minflti_sbfree_workkmalloc_noprofd_sbcommcan_matchlast_timePIDTYPE_PIDeventsthreads_handled_lastis_levelatomic_write_segments_maxblkif_x86_32_sringatomic_openbio_end_io_tgnttab_unmap_datastart_prevent_timecondreadahead_controlblk_tracebind_interdomain_evtchn_to_irqhandler_lateeoi__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countoffline_disabled__empty_rangesbd_devselecthost_dataread_newsignalfd_wqhmmapringsmodnamereg_basedomain_free_irqsasync_put_workmknodirq_gc_flagsfsnotify_sb_info__sigrestore_t__kernel_loff_tdetachget_unmapped_areadev_pagemapwritepagessched_statisticsirq_alloc_infoheadminors__state_permuprobe_taskdevice_get_dma_attrwriteback_controluclampsuper_operationsbi_cookiesplice_eofxenblk_max_queuesprotocolutil_avgmemset___GFP_DMA_BITrlimitsched_task_groupthaw_earlyblockedi_securitystats_lockD_REAL_DATAbd_holderspt_regsenablepipe_bufsKOBJ_NS_TYPE_NETctx_idarch_msi_msg_addr_lo_td_rt_spc_warnsq_usage_counteri_verity_infoirq_retriggerxsavetimespec_type__rb_parent_colordevres_lockdomidbitsiopriochildcap_inheritablegp_waitlookupcostdev_pm_infoblk_zoneDD_CLASS_TYPE_LEVEL_NAMESbd_holder_opsFORTIFY_FUNC_memscannsecvm_private_datareq_prodio_bitmap__bi_remaininguprobe_task_statetimerkobj_typediskseqdeactivatei_pagesatomic_write_hw_boundaryWORK_OFFQ_POOL_BITSino_warnlimitfasynci_rt_spc_warnlimitirq_alloc_typepage_fragwrite_bytesiobasechardomainunix_inflightxenbus_watchoperationholders_dirlast_usedxen_blkbk_probefpu_state_permi_fsnotify_maskbio_vecblk_ringsgraph_get_port_parentmax_zone_append_sectors__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkbio_slabd_aliasst_rd_sect__iovcpumaskdumperwakeirqclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodepercpu_ref_func_tlengthmax_hw_discard_sectorsbuflensaved_trap_nr__this_modulebio_crypt_ctxfreeze_fsuserfaultfd_ctxsigset_t__padcapacityxen_blkif_xenbus_finirq_countmask_posrunningrseq_event_masks_rootra_pagesTT_COMPATfwnode_handleElf64_Symd_automountqueue_limitspage_free_nr_pagesparentirq_set_affinityatimecopy_file_rangetask_cputime_atomicuser_definedkey_typeWORK_STRUCT_LINKED_BITkthread_create_on_nodeget_named_child_nodelaunder_foliocurr_targetis_suspendedX86_IRQ_ALLOC_TYPE_IOAPIC__keytimeout_workburstxenvbd_sysfs_delifetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tblkif_vdev_treq_eventpage_typercu_data0no_updateIRQCHIP_STATE_ACTIVEcap_bsetopen_modearchdata_sourcepower_statenr_perf_statesstack_vm_areakstat_irqskunmap_opssaved_statekernfs_elem_attrbasessrings_bdev_filexspathnuma_faultslinux_binfmtpage_table_lock_sigfaultcounterskasan_check_readname_linkchipcmaxrsstimer_slack_nsblkif_common_back_ring___GFP_MEMALLOC_BITbus_typepolicysharedpercpu_dev_idwait_queue_entrydismisslist_deld_real_typelookahead_bandxen_blkbk_flush_diskcacheseq_startrq_qos_mutexzone_wplugs_wqnum_chipsraw_lockd_dname_pad1_pad2get_dqblkmax_hang_timeirq_nmi_teardowncpus_maskDOMAIN_BUS_ANYsubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalxenstore_path_ext_sizemin_sliceargs__poll_tfwnode_operationsshow_devnamelogical_block_sizerun_delaytailsblk_flags_tlineno__dynamic_pr_debugbi_io_vecbase_pfnERR_PTRget_inode_acl_addr_pkeyblkif_sector_tmigrate_foliocustom_slicethread_keyringXenbusStateClosedkparam_arrayutimestart_codeinvalidate_inode_pages2is_managedis_harddest_mode_logicalfsbasecompatibleblk_status_tclock_listattrscpumask_tswregs_stateevtchn_port_tdqb_isoftlimitdma_iommublk_mode_torig_axbd_claimingcompletesched_rt_entitytimerqueue_nodeil_weightmem_dqblkDEVICE_REMOVABLE__builtin_memsetnr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pauseem_perf_domainparam_ops_int_sigchldpi_offsetdiscard_granularityfopsreservedlatency_record_countcgroupsprev_scan_seqprobe_typercu_usersRPM_REQ_AUTOSUSPENDoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperxen_blkbk_driverirq_chip_regsi_aclwake_enabled___GFP_ZERO_BITwrite_newmsecs_to_jiffieslist_lockpm_domaininstrument_atomic_read_writecpu_bitmapstatic_call_keyutil_estucountsBLK_UID_EUI64qc_statevirt_destid_8_14softirq_next_timermax_active_zoneszone_wplugs_poolcheck_flagshandlerswp_entry_tmsi_descirq_get_irqchip_statebi_inline_vecsuint64_t_mapcountdomain_tagarch_atomic_sethang_detecteduuidchild_ns_typeqf_fmt_ids_vfs_rename_keyeventIRQCHIP_STATE_MASKEDirq_maskset_performance_statephys_addr_tclass_preempt_is_conditionalconsumers_cntmodule_memoryotherend_idpi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalreservequota_infoload_sumvfsgid_tcoublockioac__init_worknr_to_scanwake_depthfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlqueue_ctxnode_stamponstackcompat_rmtp_flags_2arsp_prod_pvtdma_cleanupmaple_treeXenbusStateInitialisingKMALLOC_DMAdentrylast_mergecpu_itimerpercpuget_unique_idrel_deadlinezone_capacityclass_spinlock_try_is_conditionalDEVICE_PANEL_LEFTautogroupqueue_logical_block_sizenr_threads__i_nlinkpushirq_domain_bus_tokenDEV_DMA_COHERENTdma_skip_synclinksdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setUSRQUOTAdelayed_workmq_listhiwater_rsskretprobe_instancesfirst_sectrangefutex_exit_mutexblk_queue_write_cachepm_onlykernfs_iattrstrc_blkd_nodeIRQ_GC_NO_MASKd_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameblk_mq_ctxbi_iopriou_flagswait_for_threadsnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_info___GFP_KSWAPD_RECLAIM_BITvmemmap_shiftFAULT_FLAG_USERsring_commonshared_pendingbus_tokenDOMAIN_BUS_IPIi_gidneeds_force_resumemin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idDOMAIN_BUS_WIRED_TO_MSIkernfs_opsWORK_CPU_UNBOUNDMODULE_STATE_LIVExenbus_statenr_migrationsa_opsreq_listxa_flagspercpu_affinityfreezebin_sizeclosedev_dma_attrgrphi___GFP_RETRY_MAYFAIL_BITX86_IRQ_ALLOC_TYPE_PCI_MSIXnr_sectorsirq_affinity_desc_msecs_to_jiffiesd_spc_timerjump_entriesasync_suspendmsi_device_dataalignsuper_blockFORTIFY_FUNC_UNKNOWNirq_baseset_policy_typercu_tasks_holdout_listFORTIFY_FUNC_memcmpcpuset_mem_spread_rotorio_optbvec_integrity_poolWORK_STRUCT_PWQ_BITassoc_arraymnt_idmapdq_dqbuidhash_nodesaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpercpu_refhorizontal_positionpref_node_forkjiffieswait_queue__int128dqi_privrss_statmems_allowed_seqrefcntthawD_REAL_METADATAget_nextdqblks_fs_infocrypto_profilefutexwait_maxDEV_DMA_NON_COHERENTresult_maskseg_bufstate_syncedis_readypp_magicagaindquot_operationsmappingofflineRPM_INVALIDgrplowake_up_processclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightcommonvm_file___GFP_COMP_BITs_stateuser_sizedev_pm_opsxsd_errorsxen_blkif_freecdrom_device_infogrant_ref_tscheduledFAULT_FLAG_TRIEDraw_atomic_readclass_raw_spinlock_nested_is_conditionalworker_privateis_relassoc_array_ptrbackend_watchtag_sizeset_dqblkkmalloc_typeqstrma_flagsgnttab_unmap_grant_refnr_ia_rangesblkif_sringshutdown_wqmax_user_discard_sectorsfutex_stateorig_pmdqueue_lockacct_timexpd__rcu_icq_cachepersistent_gntsizeem_perf_tablewakeup_sourcef_posirq_print_chipnext_posix_timer_id__kernel_long_ttask_fraginit_completionsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lenusersizecinblockextableexitxenvbd_sysfs_addifkernel_param_opsbus_dma_regionem_perf_stateio_uring_cmddirtied_when_batch_count__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headlist_is_headindirect_grefsschedule_workWORK_OFFQ_DISABLE_BITSrcharfutex_pi_statekstat__kernel_uid32_tq_lock_cls_keyconnectDEVICE_FIXEDpte_tdevice_driverdl_server_has_tasks_frunnable_sumreal_credsysfs_dir_lockWORK_STRUCT_FLAG_BITSget_namefwnode_endpointwq_misc_constsepoll_watchesprealloc_pte__compiletime_assert_207dqb_curspace_entrygp_statebitsetload_avgaccesscstimecore_internal_state__do_not_mess_with_itcfs_rq_uidmsi_indexst_spacemm_cid_next_scanns_typewill_handleac_majfltposix_cputimers_work_upperforce_resume_depthmodule_param_attrspending_free_lockshort unsigned intotherend_changedno_suspend_depthread_otherend_detailsi_mutex_dir_keyq_nodespc_warnlimitvalids_encodingqueue_workgpl_crcsorc_entrykeysxenbus_dev_errororig_pteparam_ops_booldqb_curinodesload__s8invalidate_lock_keydma_maskprealloc_mutexnanosleepDOMAIN_BUS_FSL_MC_MSIFORTIFY_FUNC_kmemdupdq_dqb_lock__kernel_ulong_tvolnameio_minsysfs_create_groupdl_periodsym___kernel_vsyscalli_fsnotify_markswakeup_pathdio_mem_alignbtimeprefix__u8is_roxlockrlim_maxslave_dirDOMAIN_BUS_AMDVIruntime_deferred_listd_waitlocal_fwnodequeue_flagslist_lru_onedevice_physical_location_horizontal_positionseq_stopdev_idblkif_x86_32_back_ringxenblkddomain_alloc_irqskiocbbv_offsetclass_rwsem_read_intr_is_conditionalprobefsuidflagoverflow_max_grantss_blocksize_bitsnuma_scan_periodmigration_disablediter_typeclass_device_is_conditionalshrinker_idbio_setrootbuffer_squeeze_duration_msoom_reaper_listshutdown_presym_VDSO32_NOTE_MASKbpf_storageIRQ_GC_INIT_MASK_CACHEirq_flags_to_cleararch_msi_msg_data_tno_callbacks__u16timers_activewait_countsig_okhwirqdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedqueue_physical_block_sizediscard_alignmentraw_spinlock_tkey_tagINIT_LIST_HEADgetgeofs_flagsworkpgprotval_tkeytypefortify_memset_chkxen_blkbk_idssigpendingmq_freeze_depthfsindexshstknum_ctsrcu_ssppage_orderwake_irq__page_1__page_2accounting_timestamp__sighandler_ts_bdev__u32ptracedtrc_reader_specialdevice_get_match_dataHPROBE_GONEGENHD_FL_REMOVABLExenbus_driveractive_timei_sequencepool_datablkif_x86_32_request_rwdisk_statsdqb_ihardlimitd_lockrefrpm_requestnum_bpf_raw_eventsaddrdevice_privatefail_perfi_dir_seqirqreturnkqiddefer_syncKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookieblkif_x86_64_request_othergrefsrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoidle_notificationblock_devicekobj_ns_typeirq_resumeBLK_INTEGRITY_CSUM_CRC64f_iocb_flagspoweroffcmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infoFORTIFY_FUNC_memmovesched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushruntime_suspendi_blkbitsvaluegroup_exit_codetty_audit_bufmax_hw_zone_append_sectorsclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimerequired_flagsdeadlinemempool_spinned_vm_head_2apsi_flagsaddressbd_fsfreeze_mutexstart_boottimeunlock_native_capacityvm_startsrcu_gp_seq_neededmodule_putIRQ_GC_BE_IOunused_hctx_lists_flagscpumask_var_tfaultindirect_opmsi_domain_infoalternative_gpt_sectorshow_statsdl_densityfreeptr_tread_dqblkintegritydq_flagschip_dataDD_CLASS_TYPE_DISJOINT_NAMESp_sizememcg_datatracepoint_extdevice_create_filekprobes_text_startrunnable_avgs_time_grankernel_cap_tnon_rcuwait_listrequest_pendinghrtimerMEMORY_DEVICE_COHERENTperf_event_ctxpdevicetypei_dio_counts_bdiposix_cputimer_base___GFP_NOMEMALLOC_BITnum_kpin_execvetlb_flush_pendingRPM_REQ_SUSPENDs_listFAULT_FLAG_ALLOW_RETRYdqb_rsvspaceversionserialclass_releasealloc_locks_dquotmax_hw_sectorsfolioqprev_posseqcount_spinlockexpire_counts_umountis_bin_visiblepgoffpending_masksyscall_user_dispatchrcu_tasks_exit_listset_descarchdataia_uid__list_del_entry_valid_or_reportblkif_request_indirectchildrenrb_subtree_lastno_pm_callbacksbuild_id__p_lenrequeue_lockvfork_done___GFP_ACCOUNT_BITBLK_UID_T10pud_trt_spc_timelimitsym_int80_landing_paddiscardtailia_atimetlb_ubcshow_wr_sectbi_issuequota_format_typewaiting_reqsseekstask_structrelease_dquotsrcu_n_exp_nodelaysuspend_timerquotalenf_pipei_wb_frn_historylast_wakeenextWORK_OFFQ_LEFTio_tlb_memfreeptr_offsetfeature_persistentarch_spinlock_tsubmit_bioblk_flush_queuei_mtime_nsecperformanceDOMAIN_BUS_PCI_DEVICE_MSImmlisthd_geometry__compiletime_assert_0__compiletime_assert_1__compiletime_assert_2__compiletime_assert_3__compiletime_assert_4suppress_bind_attrsRPM_RESUMINGreg_offsetgsbases_quota_typesirqchip_irq_statef_llistmq_freeze_lockphandlei_nlinkbranchwrite_begingroupspi_blocked_onDOMAIN_BUS_DEVICE_MSIs_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskrsp_eventBLK_INTEGRITY_CSUM_NONEdl_servertrc_reader_nestingin_userestart_blockumode_tshareFORTIFY_FUNC_strscpypagefault_disabledsyscwil_prevget_name_prefixwlockedfreeze_superPTR_ERRinstalleds_inode_list_lockdev_attr_wr_reqelevator_queueruntime_idlesweventfreeze_holder__signalfn_tMEMORY_DEVICE_GENERICquota_enablesched_avgntabdevice_typering_refwatchmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirminornextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersindirectrequeue_workbio_splitint32_toffset_ctxcur_ktimenr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbRPM_REQ_RESUMEsrcu_datammap_locksysfs_lockrq_qosblkif_x86_64_back_ringfsavekeyring_index_keyqrwlockoverflowbuffer_squeeze_endfile_ra_stateuser_structpci_msi_descon_rqfs_contextmempool_alloc_tshow_f_reqprealloc_bufDL_DEV_DRIVER_BOUNDprojiddrop_inodenum_trace_evalsnum_vfllseekDEVICE_HORI_POS_CENTERDL_DEV_PROBINGnext_offsetcommit_dqblknamespacei_ino_warnlimitpending_freeatomic_write_boundary_sectorswritable_sizercu_nodeinit_nameunfreeze_fsintervalclassaddress_hilast_mm_cidfile_lockmax_open_zonescookiebd_stamptargeta_flagstrace_overrunsession_keyringcpusfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagsvm_structdomid_tcred_guard_mutexbusymajorreq_consWORK_OFFQ_POOL_SHIFTsigcntblkif_request_segmenthrtimer_cpu_basecb_headcheck_quota_fileFORTIFY_FUNC_memchrattributerestrict_linkdev_archdatai_deviceskey_perm_tbio_integrity_payloadrescue_listpi_state_cacheclass_disable_irq_is_conditionalanon_vma_chainnum_gpl_symsblkif_x86_32_sring_entrylist_lruusing_gplonly_symbolsflush_supporttarget_knchip_typessival_ptri_opflagsrobust_listxen_blkbk_removesym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctl__UNIQUE_ID_ddebug820lockdep_map__UNIQUE_ID_ddebug824bdev_nr_sectors__UNIQUE_ID_ddebug826msi_attribfiltercurr_ret_stackirqreturn_t__compiletime_assert_451dockdev_links_infoirq_bus_lockloff_tthread_pidsrcu_gp_seqia_rangesprepare_desc__UNIQUE_ID_ddebug832__UNIQUE_ID_ddebug834_archipi_send_singlest_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevcallsi_default_acls_uuid_lenioc_nodeof_node_reusedinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnoirq_calc_maskbatchasync_sizeacct_vm_mem1i_mtime_secDOMAIN_BUS_PLATFORM_MSImatchmemory_typerb_rootnr_wakeups_locals_fsnotify_masknr_requestsHPROBE_STABLErq_listprintk_index_startsched_debugfs_direrror_codeatomic_write_max_sectorsWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__init_waitqueue_head__filler__list_addsaved_sigmaskd_timeentriescpu_idmsi_freefop_flags_tirq_fwspecFAULT_FLAG_KILLABLEinodesclass_namess_mtdkparam_stringpowerma_lockevent_flagssched_delayedbd_statsbi_sizemsi_initmodule_state__write_overflow_fieldmq_kobjlast_used_atirq_chip_typevm_endlast_queuednuma_migrate_retryuser_nsirq_ack__statefirstiommu_groupdma_alignmentmigrate_to_ramwait_pidfdptrace_bpss_umount_keyvm_flagsmempool_free_tmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctime__fortify_strlenDOMAIN_BUS_WIREDFAULT_FLAG_INSTRUCTIONmigrate_from_cpuasync_in_progress__list_delsrcu_barrier_mutexpersistent_purge_listi_private_dataElf64_Halfuse_autosuspendFORTIFY_FUNC_memcpynsproxycan_wakeupevtchnxol_areadev_attr_oo_reqirq_request_resourcesirq_chip_genericrlockfl_owner_t_rescls_mskia_rangeeuidwaitbug_tabledirtied_time_whensequential_io_avgcallbacknr_pagesreadonlynum_trace_bprintk_fmtgc_flagsvm_policyspurious_thresholdperf_rdpmc_allowedrdevprivate_dataDEVICE_PANEL_TOPsignumfscrypt_keyrings_mountsuse_memdelayirq_flags_to_setRPM_ACTIVE__state_sizecallerthread_structcached_requested_keyenvp_indexreg_readlbvec_iterctimereleasemax_segment_size__param_buffer_squeeze_duration_mssched_dl_entity__kernel_dev_tatomic_write_lenreclaim_semdqb_btime_nr_pages_mappedutf8datarevmap_treemm_usersbd_holder_locks_ids_dentry_lrubp_offsetblk_crypto_profilemask_basefolio_queuelast_task_numa_placementpgtable_tblock_startcgtimenodenamesymlinkxen_blkbk_barrieroom_flag_origin__UNIQUE_ID_buffer_squeeze_duration_ms831counterorc_unwinddevice_remove_filexen_blkif_interface_finiWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdone__UNIQUE_ID_feature_persistent815fscrypt_operationsdmar_index_0_14release_workparent_irqksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_foliodebugfs_dirxenbus_unregister_driverxen_blkif_xenbus_initqueuedataMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotaDOMAIN_BUS_DMAR__builtin_strlendl_timeri_dataDL_DEV_NO_DRIVERpropertiesring_page_orderFAULT_FLAG_ORIG_PTE_VALIDsysv_semanon_vma_namefileattrdeadpropslong long unsigned intanon_nameopen_partitionsblkcg_gqia_filesival_intXenbusStateClosingnuma_preferred_nidinstrument_atomic_write_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_highxen_blkif_cacheparch_uprobemsi_mask_Boolsleep_start__p_sizemin_fltfrontend_changedHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionalblkcg_mutexdriver_privatestrleni_linklistxattr_lowertrap_nrasync_probe_requestedX86_IRQ_ALLOC_TYPE_PCI_MSI__list_add_valid_or_reportcompat_long_tactive_countctorspurious_eventss_iflagsprevent_sleep_timemce_kflagssupported_flagstotal_numa_faultss_countdev_msi_infod_revalidateerrstringbus_groupsirq_chippmd_t__compiletime_assert_816__compiletime_assert_817__compiletime_assert_818__compiletime_assert_819s_opdev_attr_wr_sectsysv_shminstrument_atomic_readdq_countutf8data_tableset_latency_tolerancedev_get_drvdata__func__foliowake_entry__compiletime_assert_821__compiletime_assert_823__compiletime_assert_825xa_head__compiletime_assert_829suidirq_domain_opsi_readcountgnttab_page_cache_initirq_write_msi_msgblk_integritylocked_vmthreads_oneshotrb_leftfputseq_nextkmem_cache_freesym___kernel_sigreturnuevent_suppressshow_ds_reqquotactl_opschunk_sectorss_sync_locktotal_timeiov_len__compiletime_assert_833__compiletime_assert_835__kernel_clock_trequested_num_queuesclass_rcu_is_conditionalIRQ_GC_INIT_NESTED_LOCKbpf_local_storageactionclockid_txen_blkbk_free_cachesquota_syncdq_free__bd_flagsparent_exec_idkernfs_elem_dirsrcu_lock_countdrain_completearch_addr_hiblkif_protocolksm_merging_pagesotherendfree_list_devautosleep_enabledptrace_entryxen_blkifblkg_listrecent_used_cpunum_jump_entriesrequest_mutexs_qcopatomic_tbv_pagealloc_tag_counters_flagsrqos_debugfs_dirnotify_nextmax_perf_statebus_dma_limitshort intmynodepart_tblzone_wplugs_hashblk_mq_opsXenbusStateInitialiseddownclass_raw_spinlock_irqsave_is_conditionallockdep_map_pallow_reinitread_iterwritablef_ownerbp_regVTIME_USERsa_flagstestBLK_INTEGRITY_CSUM_CRC__kmalloc_cache_noprofFORTIFY_FUNC_memchr_invcdromDEVICE_PANEL_BACKlast_zone_capacityi_writecounti_wb_frn_winnerprio_listatomic_write_hw_unit_max_flags_1_flags_2last_arrivalmapcountem_pdtrace_event_callxenbus_transaction_startis_guestdevice_physical_locationpm_domain_datapoll_table_structdirect_IOthreads_activewait_queue_entry_televatorBLKIF_PROTOCOL_NATIVEcurrent_may_mountarch_addr_loseqlock_tbd_queuenuma_scan_offset___GFP_NO_OBJ_EXT_BITreclaim_memorysched_migratedfrozenmlock_countin_lru_faultgrpmask__ret_warn_onregfuncdev_attr_f_reqindex_keymemalloc_noioGRPQUOTAi_private_listia_validfrontend_statevertical_positionWORK_OFFQ_FLAG_ENDFORTIFY_FUNC_strncati_rcui_atime_secWORKER_DESC_LENqc_type_statekey_serial_tdev_ueventsetupf_lockmsi_msg___GFP_MOVABLE_BITactivexlatedqb_itimeseg_boundary_maskWRITE_LIFE_MEDIUMsrcu_idxpidsmax_discard_sectorsFAULT_FLAG_UNSHAREDEVICE_HORI_POS_LEFTi_wb_listbackend_infoxarray_start__flagsp_size_fieldfadvisevmem_altmaparg_endsyscall_dispatchthaw_superrevoked_atlast_sum_exec_runtimeiov_iteria_gid__UNIQUE_ID_feature_persistenttype814attribute_groupcontextposix_timersselectorblkcg_polsMEMORY_DEVICE_PRIVATEdev_releasebi_nextdefault_timer_slack_nskcsan_check_accessirq_set_typesource_listRPM_REQ_NONEswap_readahead_info__fpstateactive_refabortpmdval_t___GFP_NOFAIL_BITgroup_infovdso_imageblk_qc_tnr_segmentsfileWORK_BUSY_PENDINGof_match_tablepercpu_count_ptr__user_state_size__msecs_to_jiffiesdmar_subhandlemce_kill_mephysical_block_sizeuuid_tproperty_read_int_arraynr_actions___GFP_UNUSED_BITatomic_write_hw_unit_mindev_bus_addrcount_objectserrorq_sizeinflight_stimezone_device_databdev_write_cachenr_active_requests_shared_tagsf_wb_errhandler_namedefparamlast_unhandledfred_csq_lockdep_mapfault_flagresend_nodekprojid_tptracer_credtlb_genstoreio_lock_cls_keypage_mkwritekobjectaudit_ttyxen_blkif_allocdev_attr_physical_devicemce_ripvstatfshlist_bl_headtag_setnumab_stateremovablexen_vbd_createfeatureson_listkgid_ton_cpuFAULT_FLAG_VMA_LOCKdev_set_drvdataWORK_OFFQ_BH_BITfregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblistclass_groupsnuma_nodei_mmap_rwsemio_lockdep_mapDEVICE_REMOVABLE_UNKNOWNwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedsysfs_registereddebugfs_mutexwatch_listrevmap_size__fortify_sizeaudit_contextpp_ref_countsysfs_opssequential_ioblkif_x86_64_requestipi_send_maskst_ds_req_large_mapcountsda_is_staticformatftopenclavemask_cache_privbi_privatedefault_irqkstrtoulcreatewrite_msi_msg_dataiattrpending_free_wqWORK_STRUCT_PENDING_BITrseqnfdssigvalvma_lockmax_discard_segmentsperf_event_list__compiletime_assert_110__compiletime_assert_111__compiletime_assert_112__compiletime_assert_113__compiletime_assert_114__compiletime_assert_115get_reserved_space__compiletime_assert_117__compiletime_assert_118non_seqstack_refcountinvalidate_lockblkif_common_requestbmapnr_ringskey_payloadirqactiontimer_rand_stated_realexpiry_active__compiletime_assert_40__compiletime_assert_41__compiletime_assert_42__compiletime_assert_43__compiletime_assert_44__compiletime_assert_45__compiletime_assert_46__compiletime_assert_47__compiletime_assert_48__compiletime_assert_49dqi_max_spc_limiteval_stringexception_table_entryvirt_boundary_maskevent_countparam_countWORK_STRUCT_COLOR_SHIFTarch_atomic_dec_and_testfallocatei_spc_warnlimitbuddy_listi_ino_timelimit__compiletime_assert_50__compiletime_assert_51__compiletime_assert_52__compiletime_assert_53__compiletime_assert_54__compiletime_assert_55__compiletime_assert_56__compiletime_assert_57i_mmap_writablemems_allowedtlb_flush_batched_ddebug_infois_noirq_suspendedtracepoints_ptrsleadertimewakee_flip_decay_tsRING_IDXs_max_linksnr_wakeups_synckallsymsprevdma_parmsfs_structclockiduint32_targ_startirq_handler_tuseroffsetDOMAIN_BUS_PCI_MSIblocksirq_affinity_notifyset_infofileattr_getvectorFORTIFY_FUNC_strncpyFORTIFY_FUNC_strcat__bi_cnttimer_listaffinityXenbusStateReconfiguringdevice_dma_supportedd_ino_warnshiwater_vmtracepointcompound_headia_vfsuidirq_eoi__kernel_ssize_tpdeviceorig_ret_vaddrpoweroff_noirqrenamevm_area_structrpm_statussb_writersthread_maskino_timelimitsplice_writei_rt_spc_timelimitsysfs_attrsshow_physical_deviceqf_nextrangesiommu_mmirq_enableblk_features_tcutimeem_tablefeature_gnt_persistent_parmpersonalityget_statetask_sizes_inodes_addrbinfmtirq_domainsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_file__param_feature_persistentfreeze_noirqrcu_tasks_idle_cpuwrite_file_infofilter_countget_aclsring_nativesync_fsparam_locksi_signoenabledfixupsfile_operations__compiletime_assert_199KMALLOC_CGROUPno_pmbi_max_vecsgroup_stop_countxen_blkif_max_ring_orderalloc_tagblk_ring_killktime_tshow_modesymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_datasync_stateki_posexecute_only_pkeyFAULT_FLAG_RETRY_NOWAITbd_writerssyncnr_grefssetleasepinspacct_structmust_resumelast_sectlong intfile_lock_contextusageuv_alloc_infol_yessiglockstatuserror_injection_entrymigration_pendingreal_addressac_stimesync_iofred_ssproperty_presentmsi_domain_ops__kmalloc_index__write_overflowconnect_ringnr_iosprintk_index_sizesymtabfree_diskkmem_cache_destroyrt_mutex_waiterremount_fss_typeruntime_statusin_iowaitunregfuncthreads_handledegidiomapdq_hashput_superfwnode_reference_argspushable_dl_tasksf_flagscodetagPROBE_PREFER_ASYNCHRONOUSmq_sysfs_init_donemark_dirtythread_flagsnum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infodev_nameTT_NONEVTIME_INACTIVEirq_common_dataf_inodeblkif_x86_64_sringcancelled_write_bytesgnttab_unmap_refs_donesrcu_usagebitmapacpi_match_tablememcg_sigvalbvecnameidatalatency_recordfile_bdevmod_kallsymsmnt_iddepthsnprintfwait_queue_func_tcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_coldmultiplepending_reqDOMAIN_BUS_GENERIC_MSIallow_rebindcheck_eventsssize_tbdev_discard_granularityiopl_emulxen_blkif_disconnectmax_write_zeroes_sectorswork_structdesc_lenflocknativetask_io_accountingmremaphprobe__fortify_panictracepoint_funcremove_nodeargventryfree_cached_objectsworkqueue_structxen_blkif_schedulepr_opspi_lock___orig_eipprobestubget_timemm_cid_activebdevelemsizedirty_paused_whengnttab_page_cachemaxlensuspend_noirqclass_spinlock_irq_try_is_conditionaloom_mmFAULT_FLAG_INTERRUPTIBLEget_reference_argsirq_unmasksrcu_reader_flavorirq_safetv_nseci_lruiommu_cookieFORTIFY_FUNC_strcpyqueue_depthbiolistgfp_maskpi_state_listrcu_segcblistsubvolbase_addressfree_inodeprojid_tuserWRITE_LIFE_EXTREMEtuple_sizenr_wakeups_migratedqi_max_ino_limitdqi_fmt_iddev_pin_infojiffies_eoi_delayeddmar_reserved_0srcu_structrlim_curnofaultmm_countdrv_groupsstackfunctionkstrtoullparent_dataki_flagskthread_stopbvec_poolbd_start_sect___GFP_IO_BITsrcu_have_cbsd_in_lookup_hashmax_sectorssgidinitial_nsFREEZE_MAY_NESTblkif_request_otherbucket_idrb_leftmostthread_infop_lensuspended_timedatastrtabtty_old_pgrpunbind_from_irqhandlerdl_throttledirqs_unhandledi_rwsem_oldget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextdmar_base_addressmsi_prepareopc1__int128 unsignedpcountrestore_noirqdma_pad_maskki_filpcap_ambientdma_configureruntime_erroratomic64_tanon_vmaruntime_autoPROBE_DEFAULT_STRATEGYrlimread_folionr_eventsiommubi_opf__xenbus_register_backendprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipebdev_max_secure_erase_sectorsbladeeffective_affinityblk_mq_tag_setspinlock_checkblk_independent_access_rangess_lock_keysrcu_gp_startopenDEVICE_PANEL_UNKNOWNit_real_incrmodert_prioritymm_lock_seqDEVICE_PANEL_RIGHTKMALLOC_RANDOM_ENDmodstqheadmsi_domain_cookies_activeMEMORY_DEVICE_FS_DAXclass_mutex_is_conditionalnext_lruremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksmemory_failurerb_root_cachedunregister_xenbus_watchs_copblkif_x86_64_request_rwXenbusStateReconfigureddd_key_truedcookiekmalloc_array_noprofhres_activeDEVICE_PANEL_FRONTbpf_raw_eventsdq_dirtydl_deferbug_listdirect_completeblk_mq_tagsxa_lockfxregs_statedrainload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countirq_countblkif_request_discardkey_restrictionnr_rangeexit_statexen_vbd_freeis_late_suspendedsysvsembd_nr_sectorsignore_children_pflagsrestore_earlyclock_mutexfs_supersnotifygntab_unmap_queue_datadqb_bsoftlimitpendingmax_dev_sectorsf_task_work___GFP_NORETRY_BITiowait_countset_read_only__compiletime_assert_827throtl_datadma_io_tlb_memstringread_countfutex_offsetlong long inthwsizex86_msi_addr_hiatomic_flagssysvshmslab_flags_tnr_entstimer_expiresirq_set_vcpu_affinitytrace_evalsactive_basesbdev_limitskmem_cache_argsearly_initmprotectsecurityxmm_spaceactivatef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbX86_IRQ_ALLOC_TYPE_UVvm_flags_trefcount_struct___GFP_FS_BITxenbus_transaction_endblkif_requestdmar_index_15i_bytesdomain_datarelax_countblkif_back_ringlinelinkstart_timekernfs_nodedev_tFREEZE_HOLDER_USERSPACEdup_xol_addrcapture_controlnr_wakeupsstartstart_brkstatic_key_modd_ino_softlimitxregs_stateWRITE_LIFE_LONGuclamp_seElf64_Wordgp_seqkset_uevent_opsfpregs_statesubsys_fmt_prefixmm_mtacquire_dquotis_vallocparametersd_releasestates_d_opmce_whole_pagestatsreadnetlink_nsneed_qsswap_deactivateblkcnt_ticq_treesi_codethread_nodenr_itemsarch_tlbflush_unmap_batchreschedule_countvfsmountextable_basenoinstr_text_sizeattributesset_child_tid_overruntmpfilercu_read_lock_nestingtick_dep_masklistthrottle_disksi_errnos_inode_lrusrcu_size_stateblk_plugrefsmmap_compat_basetrace_eventsenv_startdma_addrcnivcswd_flagsxattr_handlerd_inodehprobe_stateUTASK_SSTEPpkrureal_parentlockedVTIME_GUESTregsslice_maxlast_switch_countqsize_tUTF8_NMAXfilesdqb_bhardlimitliveatomic_write_unit_maxrun_listixolsym_vvar_pagemodule_sect_attrsreturn_instancesoftirq_activatedclass_preempt_notrace_is_conditionalret_stacknode_idunsigned intgendiskspc_timelimits_instancesdescseqcountoom_score_adjd_seqia_vfsgidsize_tcap_permittedTT_NATIVEclass_irqsave_is_conditionalserver_pick_taskpgprot_td_rt_spc_softlimitboolnr_watchesrcu_tasks_idxrcu_tasks_holdouttarget_listpasid_activatedpi_seget_offset_ctxcore_forceidle_sumfreeze_ucounti_ctime_nsecs_remove_countsyscall_workatomic_long_tpreallocclass_raw_spinlock_is_conditionalcallback_heads_vopperf_eventf_securityi_sb_listvm_rcupgtables_bytesget_linkfmode_tcputime_atomicdelayed_callmax_nr_cid_statusd_sibbin_attributepercpu_counternuma_pages_migratedgsindexexpires_nexti_io_listf_epsrcu_barrier_seqreturn_consumerrelease_dqblkin_thrashinguaddr2__kernel_timer_tHRTIMER_BASE_BOOTTIMEclass_srcu_is_conditionalnotes_attrs__s16dq_idgroup_exec_taskatomic_write_unit_minsym_vdso32_rt_sigreturn_landing_padwrite_endsrcu_nodefile_leasescan_objectspid_typewb_errcputimertrace_recursionHRTIMER_BASE_REALTIME_SOFTstart_dataposix_cputimerskrefjit_keyringsrcu_unlock_countfile_disprcu_specialclear_child_tidf_refextable_lenbacking_dev_infosaved_scratch_registers_stack_depthdata_vm__s32entry_eiptaskstatshugetlb_usageratelimit_states_pinsattrstate_in_sysfstty_structUTASK_SSTEP_TRAPPEDbacktrace_entire_mapcountmmap_compat_legacy_basedefault_groupspollnr_wakeups_idleio_cqelf64_symlatch_tree_nodedestroy_work__s64dqi_bgrace__kernel_pid_tstatic_call_mod_timerma_external_lockuid_tflush_requiredsum_block_runtimepgmapdq_oprcu_tasks_nvcswwritetypetabclass_read_lock_irqsave_is_conditional_addr_lsbi_generation_sigpollmxcsrd_rt_spc_hardlimitnuma_groupdescriptionclass_spinlock_is_conditionalcpu_id_startnr_wakeups_affinei_inodyndbg_infoindexthread_headmap_typef_oppids_active_resetseqcount_tnuma_scan_seqinode_operationsclass_raw_spinlock_irq_is_conditionalpercpu_sizedq_sbsighand_structflagsi_lock_keykmem_cacheinodedrivers_dirbug_entrycmin_fltrw_semdqio_semprev_sum_exec_runtimenestednr_forced_migrationsnum_argsri_timerstack_canaryblksizesiblingmnt_rootnext_scanf_raquota_writesrcu_barrier_cpu_cntiopl_warnrmdirsockhash_lenHRTIMER_RESTARTMOD_MEM_NUM_TYPESsym_vdso32_sigreturn_landing_padd_initextended_state_areacore_threadclass_migrate_is_conditionalvm_userfaultfd_ctxcpu_basedquotdl_runtimenumbers_softexpireskey_user_hugetlb_cgroup_rsvdfaultableio_comp_batchshutdowndq_locki_cdevldt_structenv_endobj_cgroupptrace_messagenum_trace_events_sys_privateUTF8_NFDIinit_fs_contexts_subtypeheaderfuncperf_event_contexttlbflush_unmap_batchsoft__sifieldsrcu_read_unlock_specialread_bytesfsverity_operationswake_q_noderequest_key_authHRTIMER_BASE_TAIvirtual_dr6kprobes_text_sizestatic_call_sitesthread_group_cputimernuma_scan_period_maxstart_stackwatcherscompletionsw_reservedUTASK_SSTEP_ACKactive_uprobeshow_optionsbpf_raw_event_mapFREEZE_HOLDER_KERNELcore_nodesector_ttrc_blkd_cpuin_memstallpermission_utimeget_dquotsnum_orcsclass_task_lock_is_conditionaloom_reaper_timers_uuiddestroy_dquotd_ino_hardlimitfsverity_infonr_leaves_on_treequota_onvm_operations_structbin_attrs_newiov_basesrcu_size_jiffiesi_statesched_classmultiprocesspi_waitersexp_hintd_childrenis_softcntsreclaim_statevma_numab_staterethooksnum_symtabwrite_inoded_fsdatanrpages_refcounti_crypt_infoerror_remove_folioold_time32_tcore_kallsymssrcu_parentdetachedenvp_idx_head_1_head_2backstate_add_uevent_senti_hashhlist_nodeio_uringcore_occupationftrace_timestampwriterwait_page_queuesched_remote_wakeupwake_qfileattr_setbio_listwrite_dquotclass_read_lock_irq_is_conditionalioctx_lockkveccurrent_stack_pointerNR_KMALLOC_TYPESsect_attrsonlinedup_xol_worktotal_vmjobctls_time_maxnode_listdio_offset_aligndelay_workoublockrecent_cidkernel_paramd_spc_softlimitreported_split_lockgfp_tseccomp_filterstimei_mmapthaw_superd_lrusignal_structperf_event_mutexcrcspgdval_tSB_FREEZE_WRITEsetattrf_mappingnoinstr_text_startbin_attrssas_ss_flagsf_modeki_completevtime_statewakee_flipsset_aclpids_activei_opldt_usr_semkobj_ns_type_operationsDQST_FREE_DQUOTSseqcount_raw_spinlock_tpercpu_rw_semaphorecredjump_entrylist_lru_nodesrcu_gp_seq_needed_expaddress_space_operationsspinlock_t__task_fpstatewait_queue_headclass_rwsem_read_try_is_conditionalfreeze_kcountwork_func_tis_dirty_writebacktrace_bprintk_fmt_startkstatfssitesptracequota_disablekprobe_blacklistcpus_ptrpaccti_dentrygrab_current_nsdescsfsnotify_mark_connector_sigsyssrcu_cb_mutexstatic_call_siteMODULE_STATE_UNFORMEDexpiresrcuwaitnivcswMODULE_STATE_GOINGthreadsym_timens_pages_time_mins_devcpus_allowed_lockget_next_idrwlock_tpgprotd_weak_revalidateremovedshow_pathPIDTYPE_TGIDcurr_ret_depthac_utime_dummy_pkeyiommu_mm_datamce_countswap_info_structsequencert_spc_warnlimitac_flagsched_rt_mutex_datatasks_pidaddress_spacemm_context_t__call_single_nodestartupseqcount_spinlock_ti_wbclass_idinactive_timer_pkeyfilenames_export_opi_flctxstashedvm_page_prottimespec64PIDTYPE_SIDbpf_ctxd_pruneprintedpagetrc_holdout_listget_inode_usagenormal_priodestroy_inoderelease_folioi_pipebasehostuaddrs_wb_errshm_clistis_child_subreaperunicode_mapnum_descsexec_vmrw_copyfscrypt_inode_infost_namemmu_notifier_subscriptionswait_lockoffslast_siginfoalloc_inodeuser_event_mmKMALLOC_RECLAIMd_inameHRTIMER_BASE_MONOTONIC_SOFTi_mappinginblockrmidrseq_siglimit0limit1dqi_max_ino_limitmigrate_modeftrace_callsitesd_hashis_confidentialdl_bwkobjfsyncmtd_infoi_flagskernel_siginfouprobes_statekernel_siginfo_trb_nodepushable_tasksd_comparesighanditerate_sharedis_visiblesignalreleaseddep_mapalloc_dquotmem_cgrouplast_update_timerobust_list_head__ubuf_iovecignored_posix_timerscountGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stacklevels_user_nssrcversioni_atime_nsecrcu_tasks_exit_cpuhlist_heads_encoding_flagsrunnable_weightincrDQST_SYNCSstack_vm_folio_nr_pagesshowunsigned charumount_beginvdsommap_legacy_basepipe_inode_infosecurebitsstate_initializeduring_cmd_iopollcompat_uptr_tuevent_opsslicesas_ss_spnr_dirtiednum_kprobe_blacklistclass_local_lock_is_conditionalcg_listsrcu_barrier_completionrw_semaphoremnt_sb_ddebuginfofiemapwaiterssessionid_sifields_hugetlb_subpoold_manageicq_hintfiemap_extent_infopadding1llistdebugfs_entryelemnr_retriessigval_talimitundo_listKMALLOC_RANDOM_STARTmissedquota_readst_shndxfreei_wb_frn_avg_timefile_ref_ttypeinit_modulemembarrier_statepage_poolinitfiles_structwrite_iters_securitys_dio_done_wq_dummy_bndsas_ss_sizeuser_xfeaturesnr_wakeups_passivefile_system_typemtimeserver_has_tasksoom_score_adj_minkobj_uevent_envfolioq_slotinv_weightdirty_inodesrcu_barrier_headac_mempathst_sizermtpwait_sumnum_tracepointsupidexit_codeexec_startclass_read_lock_is_conditionalconsumerskernfs_elem_symlinkclock_was_set_seqDD_CLASS_TYPE_LEVEL_NUMcid_workarch_uprobe_tasksrcu_n_lock_retriesi_fopsa_handlerunlinkperiod_contribrcu_node_entrystart_scan_seqfsgidswap_rwrcu_syncvm_opsiopolls_blocksizevm_pgoffauprobenuma_workupdate_timeptrace_dr7_call_addrloginuidcheckexpiryoptimistic_spin_queuedl_defer_running__lstateueventlock_countrefcount_tplugsaved_auxvmce_addrnum_bugsqf_ops__vm_flagsmod_namemm_cidunlocked_ioctlrseq_lenmodule_attributepollfdnr_wakeups_remotellist_nodeswapclass_spinlock_irq_is_conditionalmemcg_awareclass_spinlock_irqsave_is_conditionalrseq_csnum_ftrace_callsitessoftirq_expires_nextreadlinkmigration_flags_pincounttableslist_headtgidwrite_protect_seqcompat_robust_list_head_tids_inode_wblist_lockend_codeqspinlocklru_geninsnfilldir_tdl_non_contendingdir_contexttracepoint_ptr_tutask__UNIQUE_ID_srcversion473sched_entityd_spc_hardlimitlong unsigned intsleep_maxmmap_baseio_contextgpl_symsseq_showswait_queue_headblocki_spc_timelimitreturn_instancesclass_raw_spinlock_try_is_conditionaldl_server_pick_fin_eventfds_shrinkhrtimer_restartUTASK_RUNNINGsym_hvclock_pagexstate_headerquick_threadstime_sliceobjcgnodeDQST_READSvm_lockno_cgroup_migrationnextevts_writers_key__countxcomp_bvstatic_prioshrinkerdl_yieldeddqi_formatexec_update_lockDQF_PRIVATEDQF_SYS_FILE_Bl1d_flush_killi_versionprev_cputimestate_remove_uevent_sentia_sizein_hrtirqs_master_keyswchar_addr_bndkernel_symboltv_secpid_ttask_listftrace_sleeptimerun_nodema_rooturing_cmdnr_failed_migrations_affineuser_cpus_ptrpi_top_taskSB_FREEZE_PAGEFAULTactoruprobenotifier_subscriptionss_readonly_remountutil_sumst_otheri_mutex_keyksethrtimer_clock_basevruntimei_sizedl_deadline_hugetlb_hwpoisonubufksm_rmap_itemsmodulepcpu_cidngroupsfree_file_info__kernel_time64_tautaskuser_namespacevfsuid_traw_spinlock__rcu_headmce_vaddrquota_offdq_inusedqi_flagsstatic_call_trampbtrace_seq_pp_mapping_padsa_maskrequest_queuedqi_dirty_listmod_tree_nodef_sb_errwritepagecodegtimesigactionclass_rwsem_read_is_conditionalsum_sched_runtime__kernel_timespeclocked_pendingnr_deferredfown_structfeatures_lockedtracing_graph_pausepermcompat_robust_listktypelockrefsrcu_struct_ptrsmm_structvlagi_uidspinlockpid_namespace_syscallmod_arch_specificnum_static_call_sitesvm_mmmod_mem_typedebugfs_idguest_permmem_dqinfoi_countHRTIMER_NORESTARTsp_offsetsrcu_cblist_invokingi_lockd_nameget_ownershipufdsexe_filenr_scannedpcp_listpid_linkss_sysfs_namerefcountvaddrrw_hinttimeoutlast_switch_timenum_classesorc_unwind_ipMOD_INIT_RODATAqc_dqblkmmappedseqcount_raw_spinlockkill_sbd_opMIGRATE_ASYNCi_write_hintfxsaveprocess_keyringlist_op_pendingllist_headwait_startf_freeptrclass_raw_spinlock_irqsave_try_is_conditionalshow_fdinfofixuphashposix_acldd_key_falsebug_addr_dispdqi_igraceclass_rwsem_write_try_is_conditionalpreempt_notifierssrcu_last_gp_ends_fsnotify_infomempolicyioveci_private_lockVTIME_IDLEstatic_keys_magicdl_overrunDQST_ALLOC_DQUOTSd_parentpayloadac_minflti_sbd_sbcommPIDTYPE_PIDatomic_write_segments_maxatomic_openreadahead_control__kernel_gid32_tkernfs_open_filef_credMODULE_STATE_COMINGnotify_countread_newsignalfd_wqhmmapmodnameasync_put_workmknodfsnotify_sb_info__sigrestore_t__kernel_loff_tget_unmapped_areadev_pagemapwritepagessched_statisticshead__state_permuprobe_taskwriteback_controluclampsuper_operationssplice_eofutil_avgrlimitsched_task_groupblockedi_securitystats_lockD_REAL_DATApt_regspipe_bufsKOBJ_NS_TYPE_NETctx_idd_rt_spc_warnsi_verity_infoxsavetimespec_type__rb_parent_colorbitsiopriocap_inheritablegp_waitlookupDD_CLASS_TYPE_LEVEL_NAMESvm_private_dataio_bitmapuprobe_task_statetimerkobj_typei_pageshlist_bl_headino_warnlimitfasynci_rt_spc_warnlimitpage_fragwrite_bytescharunix_inflightholders_dirfpu_state_permi_fsnotify_maskbio_vec__restorefn_tclass_raw_spinlock_irq_try_is_conditionalthread_shstkd_alias__iovcpumaskdumperclass_mutex_intr_is_conditionalplist_nodexarraycap_effectivetaintsclosidsum_exec_runtimes_rootsd_rt_spc_timerevict_inodekernfs_elem_attrlengthbuflensaved_trap_nr__this_modulefreeze_fsuserfaultfd_ctxsigset_trunningrseq_event_masks_rootra_pagesTT_COMPATElf64_Symd_automountparentatimecopy_file_rangetask_cputime_atomicuser_definedkey_typelaunder_foliocurr_targetburstetypeei_funcsmodule_kobjectactive_memcgdef_flagsbase0base1base2wait_queue_head_tpage_typercu_data0no_updatecap_bsetarchdata_sourcestack_vm_areasaved_statebasess_bdev_filenuma_faultslinux_binfmtpage_table_lock_sigfaultcountersname_linkDQST_CACHE_HITScmaxrsstimer_slack_nspolicysharedd_real_typelookahead_bandseq_startraw_lockd_dnameget_dqblkmax_hang_timecpus_masksubdirstask_groupstarttimemmap_missquota_format_opsclass_rwsem_write_is_conditionalmin_sliceargs__poll_tshow_devnamerun_delaytailslinenoget_inode_acl_addr_pkeymigrate_foliocustom_slicethread_keyringkparam_arrayutimestart_codeis_hardfsbaseattrscpumask_tswregs_statedqb_isoftlimitorig_axsched_rt_entitytimerqueue_nodeil_weightmem_dqblknr_cached_objectsia_mtimetrc_ipi_to_cpushrink_controlmxcsr_maskkernfs_rootnr_dirtied_pause_sigchldreservedlatency_record_countcgroupsprev_scan_seq_DQST_DQSTAT_LASTrcu_usersoffsettime64_ti_blocksnuma_faults_localityhas_child_subreaperi_aclwrite_newlist_lockUTF8_NFDICFcpu_bitmapstatic_call_keyutil_estucountsMOD_RODATAqc_statesoftirq_next_timercheck_flagsswp_entry_t_mapcountdomain_taghang_detectedchild_ns_typeqf_fmt_ids_vfs_rename_keyeventclass_preempt_is_conditionalconsumers_cntmodule_memorypi_entryk_sigactionread_file_infoclass_local_lock_nested_bh_is_conditionalquota_infoload_sumvfsgid_tcoublockioacnr_to_scanfs_parameter_specdesc_structdq_offexec_maxkmap_ctrlnode_stampcompat_rmtp_flags_2aMOD_INVALIDmaple_treeKMALLOC_DMAdentrycpu_itimerpercpurel_deadlinevm_structclass_spinlock_try_is_conditionalautogroupnr_threads__i_nlinkpushdio_completenr_segsd_spc_warnsnr_failed_migrations_hotcss_setdelayed_workhiwater_rsskretprobe_instancespp_magicfutex_exit_mutextrc_blkd_noded_spacegraveyard_linkxol_vaddrsplice_readElf64_Addrd_rt_spacenameu_flagsMOD_INIT_DATAnvcswKMALLOC_NORMALwatchdog_stampseglentask_delay_infoshared_pendingi_gidmin_vruntimefaults_disabled_mappingquota_typei_rdevself_exec_idHRTIMER_MAX_CLOCK_BASESkernfs_opsfile_lockMODULE_STATE_LIVEnr_migrationsa_opsxa_flagsbin_sizegrphid_spc_timerjump_entriesassoc_array_ptrsuper_block_typercu_tasks_holdout_listcpuset_mem_spread_rotorassoc_array__UNIQUE_ID_depends472mnt_idmapdq_dqbsaved_tfElf64_Xwordold_timespec32lock_class_keynum_symsmodule_notes_attrsvm_lock_seqpdeath_signalPIDTYPE_MAXnlinkpref_node_fork__int128dqi_privrss_statmems_allowed_seqrefcntD_REAL_METADATAget_nextdqblks_fs_infofutexwait_maxresult_maskdquot_operationsmappinggrploclass_write_lock_irqsave_is_conditionalkioctx_tablerb_rightvm_files_stateuser_sizescheduledclass_raw_spinlock_nested_is_conditionalworker_privateis_relqstrma_flagsfutex_stateHRTIMER_BASE_TAI_SOFTacct_timexpd__rcu_icq_cacheDQST_WRITESsizef_posnext_posix_timer_id__kernel_long_ttask_fragsrcu_gp_mutexdatalennr_wakeups_affine_attemptsalt_lencinblockextableexitkernel_param_opsio_uring_cmddirtied_when__paddingsem_undo_liststatic_key_falseis_partially_uptodatewriteback_indexcore_statetimerqueue_headrcharfutex_pi_statekstat__kernel_uid32_tdl_server_has_tasks_frunnable_sumreal_credepoll_watchesnon_rcudqb_curspacegp_statebitsetload_avgcstimecfs_rq_uidst_spacemm_cid_next_scanac_majfltposix_cputimers_work_uppermodule_param_attrsshort unsigned inti_mutex_dir_keyq_nodespc_warnlimits_encodinggpl_crcsorc_entrykeysMOD_TEXTdqb_curinodesload__s8invalidate_lock_keyprealloc_mutexsrcu_gp_seq_neededdq_dqb_lock__kernel_ulong_tdl_periodsym___kernel_vsyscalli_fsnotify_marksdio_mem_alignbtime__u8is_roxlockrlim_maxruntime_deferred_listd_waitlist_lru_oneseq_stopkiocbclass_rwsem_read_intr_is_conditionalfsuids_blocksize_bitsnuma_scan_periodmigration_disablediter_typeshrinker_idrootoom_reaper_listsym_VDSO32_NOTE_MASKbpf_storage__u16timers_activewait_countsig_okdelaysqf_ownerreadaheadkmalloc_cache_typemutexpgd_tnr_cpus_allowedraw_spinlock_tkey_tagfs_flagsworkpgprotval_tkeytypesigpendingfsindexshstksrcu_ssp__page_1__page_2__sighandler_ts_bdev__u32ptracedtrc_reader_specialHPROBE_GONEi_sequencedqb_ihardlimitd_lockrefnum_bpf_raw_eventsaddr_perfi_dir_seqkqidKOBJ_NS_TYPE_NONEac_exitcodeswap_activatemkobjcore_cookiesrcu_supd_deletePRJQUOTAbeginddebug_class_mapperf_recursionxfeaturesuclamp_reqchange_cookiedl_defer_armedwrite_infoblock_devicekobj_ns_typef_iocb_flagscmaj_fltvtimemath_emu_infoiowait_sumf_path__u64journal_infosched_contributes_to_loadstatic_key_trueweighti_privatemaxrssflushi_blkbitsvaluegroup_exit_codetty_audit_bufclass_irq_is_conditionalreschedule_jiffiessum_sleep_runtimedeadlinepinned_vm_head_2apsi_flagshrtimer_base_typestart_boottimevm_starts_flagsiov_offsetshow_statsdl_densityfreeptr_tread_dqblkdq_flagsDD_CLASS_TYPE_DISJOINT_NAMESmemcg_datatracepoint_extkprobes_text_startrunnable_avgs_time_grankernel_cap_twait_listhrtimerperf_event_ctxpi_dio_counts_bdiposix_cputimer_basenum_kpin_execvetlb_flush_pendings_listdqb_rsvspaceversionserialalloc_locks_dquotfolioqprev_posseqcount_spinlocks_umountis_bin_visiblesyscall_user_dispatchrcu_tasks_exit_listia_uidchildrenrb_subtree_lastbuild_idvfork_donenanosleeprt_spc_timelimitsym_int80_landing_padtailia_atimetlb_ubcquota_format_typeseekstask_structrelease_dquotsrcu_n_exp_nodelayquotalenf_pipei_wb_frn_historylast_wakeenextarch_spinlock_ti_mtime_nsecmmlistutf8_normalizationset_dqblkreg_offsetgsbases_quota_typesf_llisti_nlinkwrite_beginpi_blocked_ons_xattrclass_local_lock_irqsave_is_conditionalon_dispatchclass_local_lock_irq_is_conditionalsyscrpkey_allocation_mapki_ioprioattributes_maskdl_servertrc_reader_nestingin_userestart_blockumode_tsharepagefault_disabledsyscwil_prevwlockedHRTIMER_BASE_BOOTTIME_SOFTfreeze_supers_inode_list_locksweventfreeze_holder__signalfn_tquota_enablesched_avgntabmaj_fltarch_rwlock_tclock_basecdevmy_qgroup_leadermkdirnextentsreal_blockedarg_locknum_exentrieshlist_bl_nodes_writersint32_toffset_ctxnr_failed_migrations_runningclassesnext_timerclass_write_lock_is_conditionalbpf_funcs_inodes_wbsrcu_datammap_lockfsavekeyring_index_keyqrwlockfile_ra_stateuser_structon_rqfs_contextprealloc_bufprojiddrop_inodenum_trace_evalsllseeknext_offsetcommit_dqblknamespacei_ino_warnlimitwritable_sizercu_nodeunfreeze_fsintervallast_mm_cidcookietargeta_flagstrace_overrunsession_keyringfop_flagstaskkey_restrict_link_func_ts_maxbytesreal_timerd_ino_countlast_cpuilenmnt_flagscred_guard_mutexsigcnthrtimer_cpu_basecb_headcheck_quota_filedirty_folioattributerestrict_linkMOD_DATAi_deviceskey_perm_tpi_state_cacheanon_vma_chainnum_gpl_symslist_lruusing_gplonly_symbolstarget_knsival_ptri_opflagsrobust_listsym___kernel_rt_sigreturnsym_pvclock_pageserial_nodelen_descs_incoredqsd_iputcompat_ioctllockdep_mapfiltercurr_ret_stackloff_tthread_pidsrcu_gp_seq_archst_valueclass_write_lock_irq_is_conditionalKOBJ_NS_TYPESpprevbranchi_default_acls_uuid_lenioc_nodeinsnlenclass_map_typeicq_list__kernel_size_tactive_mmia_mode_trapnobatchasync_sizeacct_vm_mem1i_mtime_secrb_rootnr_wakeups_locals_fsnotify_maskHPROBE_STABLEprintk_index_starterror_codeWRITE_LIFE_NONEWRITE_LIFE_NOT_SETpadding__fillersaved_sigmaskd_timeentriescpu_idfop_flags_tinodesclass_namess_mtdkparam_stringma_locksched_delayedmodule_statelast_used_atvm_endlast_queuednuma_migrate_retryuser_ns__statefirstwait_pidfdptrace_bpss_umount_keyvm_flagsmodinfo_attrshas_timeoutinvalidate_folionodemask_ti_modenr_thpsia_ctimemigrate_from_cpusrcu_barrier_mutexi_private_dataElf64_Halfnsproxyxol_areacleanup_modulerlockfl_owner_teuidwaitbug_tabledirtied_time_whensequential_io_avgnum_trace_bprintk_fmtvm_policyperf_rdpmc_allowedrdevprivate_datasignumfscrypt_keyrings_mountsuse_memdelay__state_sizethread_structcached_requested_keyenvpctimereleasesched_dl_entity__kernel_dev_tatomic_write_lendqb_btime_nr_pages_mappedutf8datamm_userss_ids_dentry_lrubp_offsetfolio_queuelast_task_numa_placementblock_startcgtimesymlinkoom_flag_origincounterorc_unwindWRITE_LIFE_SHORT__mce_reservedclass_mutex_try_is_conditionald_rcuki_waitqtrace_eval_mapdonefscrypt_operationsrelease_workksm_zero_pagesmountDD_CLASS_TYPE_DISJOINT_BITSs_vfs_rename_mutexratelimitfree_folioMIGRATE_SYNCexport_operationsPIDTYPE_PGIDrm_xquotadl_timeri_datasysv_semanon_vma_namefileattrDQST_DROPSlong long unsigned intanon_nameia_filesival_intnuma_preferred_nid_hugetlb_cgroupdentry_operationsmemcg_nr_pages_over_higharch_uprobe_Boolsleep_startmin_fltHPROBE_LEASEDclass_spinlock_irqsave_try_is_conditionali_linklistxattr_lowertrap_nrasync_probe_requestedcompat_long_ts_iflagsmce_kflagstotal_numa_faultss_countd_revalidates_opsysv_shmdq_countutf8data_tablefoliowake_entryxa_headsuidi_readcountlocked_vmrb_leftseq_nextsym___kernel_sigreturnuevent_suppressquotactl_opss_sync_lockiov_len__kernel_clock_tclass_rcu_is_conditionalbpf_local_storageactionclockid_tquota_syncdq_freeparent_exec_idkernfs_elem_dirsrcu_lock_countksm_merging_pagesptrace_entryrecent_used_cpunum_jump_entriess_qcopatomic_t_flagsnotify_nextshort intmynodeclass_raw_spinlock_irqsave_is_conditionallockdep_map_pread_iterwritablef_ownerbp_regVTIME_USERsa_flagstesti_writecounti_wb_frn_winnerprio_list_flags_1_flags_2last_arrivaltrace_event_callis_guestpoll_table_structdirect_IOcurrent_may_mountseqlock_tnuma_scan_offsetkernfs_iattrssched_migratedfrozenmlock_countin_lru_faultgrpmaskregfuncindex_keyGRPQUOTAi_private_listia_validi_rcuHRTIMER_BASE_REALTIMEi_atime_secqc_type_statekey_serial_tsetupf_lockactivedqb_itimeWRITE_LIFE_MEDIUMsrcu_idxpidsi_wb_listxarray_startfadvisearg_endsyscall_dispatchrevoked_atlast_sum_exec_runtimeiov_iteria_gidattribute_groupcontextposix_timersselectordefault_timer_slack_nssource_listswap_readahead_info__fpstateactive_refgroup_infovdso_imagefile__user_state_sizemce_kill_meuuid_tcount_objects_stimezone_device_dataf_wb_errdefparamfred_cskprojid_tptracer_credtlb_genstorekobjectaudit_ttymce_ripvstatfsnumab_statefeatureson_listkgid_ton_cpufregs_statedrop_nsnum_ei_funcsrestore_sigmasksrcu_cblisti_mmap_rwsemwait_chldexiterrseq_tioctx_tableVTIME_SYSchangedwatch_listaudit_contextpp_ref_countsysfs_opssequential_io_large_mapcountsda_is_staticformatftopenclavecreateiattrrseqnfdssigvalvma_lockperf_event_listget_reserved_spacestack_refcountinvalidate_lockbmapkey_payloadd_realexpiry_activedqi_max_spc_limitexception_table_entryfallocateHRTIMER_BASE_MONOTONICi_spc_warnlimitbuddy_listi_ino_timelimitSB_FREEZE_FSi_mmap_writablemems_allowedtlb_flush_batched_ddebug_infotracepoints_ptrsleadertimewakee_flip_decay_tss_max_linksnr_wakeups_synckallsymsprevfs_structclockiduint32_targ_startblocksset_infofileattr_getvectortimer_listd_ino_warnshiwater_vmtracepointcompound_headia_vfsuid__kernel_ssize_torig_ret_vaddrrenamevm_area_structsb_writersino_timelimitsplice_writei_rt_spc_timelimitqf_nextiommu_mmcutimepersonalityget_statetask_sizes_inodes_addrbinfmtsigned charprioprivgetattrsched_infod_fieldmaskuprobe_xol_opsseq_filercu_tasks_idle_cpuwrite_file_infofilter_countget_aclsync_fsparam_locksi_signoenabledfixupsfile_operationsKMALLOC_CGROUPgroup_stop_count_killktime_tsymsgroup_nodei_ctime_seckernfs_open_nodesrcu_data_have_cbsmax_allowed_capacityi387d_ino_timeravx512_timestampfuncsend_dataki_posexecute_only_pkeysetleasepacct_structlong intfile_lock_contextusagesiglockstatuserror_injection_entrymigration_pendingac_stimeuidhash_nodefred_ssUSRQUOTAprintk_index_sizesymtabrt_mutex_waiterremount_fss_typein_iowaitunregfuncegiddq_hashput_superMOD_INIT_TEXTpushable_dl_tasksf_flagsf_inodemark_dirtynum_srcu_structsbdi_writebackkobj_completion__kernel_clockid_tseccompiteratorqc_infoTT_NONEVTIME_INACTIVEcancelled_write_bytessrcu_usagebitmapmemcg_sigvalbvecnameidatalatency_recordmod_kallsymsmnt_iddepthcnvcswnuma_next_scanMIGRATE_SYNC_LIGHTnr_migrations_cold__UNIQUE_ID_name470ssize_tiopl_emulwork_structdesc_lenflocktask_io_accountinghprobetracepoint_funcargventryfree_cached_objectsworkqueue_structpi_lock___orig_eipprobestubget_timemm_cid_activeelemsizedirty_paused_whenmaxlenDQST_LOOKUPSclass_spinlock_irq_try_is_conditionaloom_mmsrcu_reader_flavortv_nseci_lrugfp_maskpi_state_listrcu_segcblistsubvolfree_inodeprojid_tuserWRITE_LIFE_EXTREMEnr_wakeups_migratedqi_fmt_idsrcu_structrlim_curnofaultmm_countSB_FREEZE_COMPLETEstackfunctionki_flagssrcu_have_cbsd_in_lookup_hashsgidinitial_nsFREEZE_MAY_NESTbucket_idrb_leftmostthread_infodatastrtabtty_old_pgrpdl_throttledi_rwsemget_projidsched_reset_on_forkHPROBE_CONSUMEDbpf_net_contextopc1__int128 unsignedpcountki_filpcap_ambientatomic64_tanon_vmarlimread_folionr_eventsprivatest_infomap_countsp_regexit_signalsa_restorerbpf_run_ctxsplice_pipes_lock_keysrcu_gp_startopenit_real_incrmodert_prioritymm_lock_seq__UNIQUE_ID_intree471KMALLOC_RANDOM_ENDmodstqheads_activeclass_mutex_is_conditionalremap_file_rangenr_hangssym_vvar_startgid_twake_cpuchainedio_uring_tasktask_worksrb_root_cacheds_copdd_key_truehres_activebpf_raw_eventsdq_dirtydl_deferbug_listxa_lockfxregs_stateload_weightkuid_tarch_datafpstateblock_maxrcu_blocked_nodegp_countkey_restrictionexit_statesysvsemMOD_RO_AFTER_INITDQF_ROOT_SQUASH_Bfs_supersSB_UNFROZENdqb_bsoftlimitpendingf_task_workiowait_countstringread_countfutex_offsetlong long intatomic_flagssysvshmtrace_evalsactive_basessecurityxmm_spacef_pos_locki_fieldmasktls_arrayowneracct_rss_mem1need_mbvm_flags_trefcount_structi_bytesclass_rwsem_read_intr_is_conditionalclass_mutex_is_conditionalclass_preempt_notrace_is_conditionalMOD_INIT_RODATAMOD_TEXTclass_srcu_is_conditional_nameclass_rcu_is_conditionalclass_migrate_is_conditionallong long unsigned intNR_KMALLOC_TYPESclass_rwsem_read_is_conditionallong long intsigned charPIDTYPE_SIDclass_preempt_is_conditionalElf32_Wordorc_headerPIDTYPE_TGIDlong intclass_raw_spinlock_irq_is_conditional_descclass_local_lock_nested_bh_is_conditionalHRTIMER_BASE_MONOTONIC_SOFT__UNIQUE_ID_retpoline471class_rwsem_read_try_is_conditionalUTF8_NFDIDQST_LOOKUPSclass_spinlock_irqsave_is_conditionalclass_spinlock_try_is_conditionalclass_local_lock_is_conditionalhrtimer_base_typeMOD_RO_AFTER_INITn_descsz__u8DQST_ALLOC_DQUOTSSB_FREEZE_FSKMALLOC_NORMALDQST_WRITESunsigned int__int128class_irqsave_is_conditionalHRTIMER_BASE_REALTIMElong unsigned int__u32HRTIMER_MAX_CLOCK_BASESclass_spinlock_irqsave_try_is_conditionalclass_spinlock_is_conditionalshort unsigned intHRTIMER_BASE_TAIclass_local_lock_irqsave_is_conditionalclass_read_lock_is_conditionalelf32_noteboolDQST_DROPSclass_local_lock_irq_is_conditionalMOD_RODATAKMALLOC_CGROUPclass_rwsem_write_is_conditionalclass_spinlock_irq_try_is_conditionalclass_spinlock_irq_is_conditionalclass_write_lock_is_conditionaln_typeMOD_DATAclass_write_lock_irqsave_is_conditionalHRTIMER_BASE_BOOTTIMEn_nameszSB_FREEZE_COMPLETESB_FREEZE_WRITEclass_raw_spinlock_nested_is_conditionalMOD_MEM_NUM_TYPESDQST_SYNCSDQST_FREE_DQUOTSmod_mem_typeHRTIMER_BASE_MONOTONICclass_mutex_intr_is_conditionalclass_task_lock_is_conditionalUTF8_NMAX_nhdrPIDTYPE_PGID_Boolunsigned charKMALLOC_RECLAIMHRTIMER_BASE_BOOTTIME_SOFTcurrent_stack_pointershort int_note_18_note_19utf8_normalizationKMALLOC_RANDOM_STARTDQST_CACHE_HITSclass_irq_is_conditionalDQF_PRIVATEPIDTYPE_PIDDQST_READSMOD_INIT_DATAclass_raw_spinlock_try_is_conditionalclass_raw_spinlock_irqsave_is_conditionalPIDTYPE_MAXcharGNU C11 14.2.1 20240910 -mno-sse -mno-mmx -mno-sse2 -mno-3dnow -mno-avx -m64 -mno-80387 -mno-fp-ret-in-387 -mpreferred-stack-boundary=3 -mskip-rax-setup -mtune=generic -mno-red-zone -mcmodel=kernel -mindirect-branch=thunk-extern -mindirect-branch-register -mindirect-branch-cs-prefix -mfunction-return=thunk-extern -mrecord-mcount -mfentry -march=x86-64 -g -gdwarf-5 -O2 -std=gnu11 -p -fshort-wchar -funsigned-char -fno-common -fno-PIE -fno-strict-aliasing -fcf-protection=branch -falign-jumps=1 -falign-loops=1 -fno-asynchronous-unwind-tables -fno-jump-tables -fpatchable-function-entry=16,16 -fno-delete-null-pointer-checks -fno-allow-store-data-races -fstack-protector-strong -ftrivial-auto-var-init=zero -fno-stack-clash-protection -fmin-function-alignment=16 -fstrict-flex-arrays=3 -fno-strict-overflow -fstack-check=no -fconserve-stackSB_FREEZE_PAGEFAULTUTF8_NFDICFclass_mutex_try_is_conditional_DQST_DQSTAT_LASTclass_write_lock_irq_is_conditionalKMALLOC_RANDOM_ENDMOD_INIT_TEXTclass_raw_spinlock_irqsave_try_is_conditionalpid_typeHRTIMER_BASE_REALTIME_SOFTKMALLOC_DMAclass_read_lock_irq_is_conditionalHRTIMER_BASE_TAI_SOFTSB_UNFROZENclass_raw_spinlock_is_conditionalkmalloc_cache_typeclass_read_lock_irqsave_is_conditionalclass_rwsem_write_try_is_conditionalDQF_SYS_FILE_Bclass_raw_spinlock_irq_try_is_conditionalDQF_ROOT_SQUASH_B__UNIQUE_ID_vermagic470__int128 unsignedMOD_INVALID/home/thomas/Documents/kernels/stagingdrivers/block/xen-blkback/blkback.c/home/thomas/Documents/kernels/stagingdrivers/block/xen-blkback./arch/x86/include/asm./include/xen./include/linux/atomic./include/linux./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/vdso./arch/x86/include/asm/fpu./include/linux/sched./include/xen/interface./include/linux/device./include/xen/interface/ioblkback.cblkback.ccurrent.hpage.hgrant_table.hfeatures.hpage_64.hatomic-instrumented.hatomic-arch-fallback.hatomic.hjump_label.hslab.hrbtree.hspinlock.hcpumask.hlist.hworkqueue.hfreezer.hkernel.hblkdev.hfortify-string.hhighmem-internal.hpreempt.huaccess.hmm.hsched.hbio.hint-ll64.hint-ll64.hposix_types.htypes.htypes.hstatic_call_types.hstatic_call.hpreempt.hfs.hmodule.hasm.hinit.hjump_label.horc_types.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hatomic-long.hstddef.hgfp_types.hsysfs.hirqflags.hrestart_block.htime_types.htime32.hrange.hptrace.hmath_emu.htypes.hshstk.hthread_info.hllist.hsmp_types.hspinlock_types.hrwlock_types.hpid_types.hsem_types.hshm.hosq_lock.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hvmalloc.htime64.hcodetag.halloc_tag.htracepoint-defs.hjiffies.hdelay.hwait.hirqreturn.hrcupdate.hmutex.hkref.hworkqueue_types.hextable.hinterrupt.hirqhandler.hirqdesc.hmaple_tree.hrwsem.hswait.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hlocal_lock.hirqdomain.hfwnode.hdevice.hpercpu-refcount.hirq.hmsi.hxarray.hlist_lru.hkernfs.hkobject_ns.hstat.hkobject.hhw_irq.hirqdomain_defs.hmsi_api.huuid.hmod_devicetable.hof.hmsi.hxen.hrcupdate_trace.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.huio.huio.hbvec.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hcapability.hsemaphore.hmigrate_mode.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.herrseq.hmnt_idmapping.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hblk_types.hcompat.helf.hrbtree_latch.herror-injection.hmodule.htracepoint.hdevice.hcpuhplock.hxen.hgrant_table.hmempool.hblkzoned.hxenbus.hxs_wire.hxenbus.hring.hblkif.hcommon.hevents.hkthread.hdebug_locks.hspinlock_api_smp.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/block/xen-blkback/xenbus.c/home/thomas/Documents/kernels/stagingdrivers/block/xen-blkback./include/linux./include/linux/atomic./arch/x86/include/asm./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./arch/x86/include/asm/fpu./include/vdso./include/linux/sched./include/xen/interface./include/linux/device./include/xen./include/xen/interface/ioxenbus.cxenbus.cdevice.hjiffies.hslab.hlist.hatomic-instrumented.hatomic-arch-fallback.hatomic.hjump_label.hworkqueue.hcompletion.herr.hblkdev.hfortify-string.hkstrtox.hint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hstatic_call.hatomic-long.hstddef.hgfp_types.hsysfs.hrange.hirqflags.htypes.hshstk.hcodetag.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.halloc_tag.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcred.hkey.hsignal.hbio.hiocontext.hcompat.huprobes.hvmalloc.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hmemremap.hmm.hlocal_lock.hirqdomain.huio.huio.hbvec.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hsemaphore.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hpercpu-refcount.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hpagemap.hblk_types.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.htracepoint.hirqreturn.hinterrupt.hirqhandler.hirqdesc.hfwnode.hirq.hmsi.hhw_irq.hirqdomain_defs.hmsi_api.hmod_devicetable.hof.hmsi.hxen.hevent_channel.hrcupdate_trace.henergy_model.hpm.hpm_wakeup.hbus.hdriver.hclass.hdevice.hcpuhplock.hgrant_table.hgrant_table.hmempool.hblkzoned.hxenbus.hxs_wire.hxenbus.hring.hblkif.hcommon.hfile.hstring.hkthread.hevents.hsprintf.hdev_printk.hoverflow.hinstrumented.hkcsan-checks.hkasan-checks.h/home/thomas/Documents/kernels/stagingdrivers/block/xen-blkback/xen-blkback.mod.c/home/thomas/Documents/kernels/stagingdrivers/block/xen-blkback./include/uapi/asm-generic./include/asm-generic./include/uapi/linux./include/linux./arch/x86/include/asm./include/linux/atomic./arch/x86/include/asm/fpu./include/vdso./include/linux/schedxen-blkback.mod.cint-ll64.hint-ll64.hposix_types.htypes.htypes.htime64.htime_types.hfs.hmodule.hasm.hinit.hptrace.hdesc_defs.hpgtable_64_types.hpgtable_types.hmm_types.hjump_label.horc_types.hsched.hprocessor.hcpumask_types.hqspinlock_types.hqrwlock_types.hmath_emu.hlockdep_types.hspinlock_types_raw.hratelimit_types.hprintk.hdynamic_debug.hmoduleparam.hbug.hstatic_call_types.hatomic-long.hsysfs.hirqflags.htypes.hshstk.hpreempt.hllist.hsmp_types.hrestart_block.htime32.hthread_info.hpid_types.hsem_types.hshm.hosq_lock.hspinlock_types.hrwlock_types.hmutex_types.hplist_types.hrbtree_types.htimerqueue_types.hhrtimer_types.hhrtimer_defs.htimer_types.hseccomp_types.hnodemask_types.hrefcount_types.hresource.hlatencytop.hsignal.hsignal-defs.hsiginfo.hsignal_types.hsyscall_user_dispatch_types.htlbbatch.hmm_types_task.htask_io_accounting.hposix-timers_types.hrseq.hseqlock_types.huidgid_types.hpid.hcompletion.hcred.hkey.hsignal.hiocontext.hcompat.huprobes.hspinlock.htracepoint-defs.hstat.hwait.hmutex.hkref.hrcupdate.hmaple_tree.hrwsem.hswait.hworkqueue_types.hworkqueue.hrcu_segcblist.hsrcutree.hsrcu.huprobes.hpercpu_counter.hmmu.hvdso.hlocal_lock.huio.huio.hxarray.hlist_bl.hlockref.hdcache.hmount.hpath.hshrinker.hlist_lru.hcapability.hmigrate_mode.hextable.htask.hassoc_array.huser.hrcuwait.hrcu_sync.hpercpu-rwsem.hdelayed_call.huuid.herrseq.hmnt_idmapping.hslab.hrw_hint.hfile_ref.hunicode.hquota.hprojid.hquota.hkobject.hcompat.helf.hkernfs.hkobject_ns.hrbtree_latch.herror-injection.hmodule.hxen-blkback.mod.c/home/thomas/Documents/kernels/stagingscripts/module-common.c/home/thomas/Documents/kernels/stagingscripts./include/uapi/asm-generic./include/linux./include/linux/sched./include/uapi/linux./arch/x86/include/asm./include/asm-genericmodule-common.cint-ll64.htypes.hirqflags.hpreempt.hspinlock.hmutex.hrcupdate.hrwsem.hsrcu.hlocal_lock.htask.hpid_types.hhrtimer_defs.hslab.hunicode.hquota.hquota.hfs.helf.hmodule.hasm.hmodule-common.cint-ll64.h'MI0IQPRW0US~XUS~XUS#T#]T]T]#Q#\Q#R#VRVRVPkmPPTTTs~`U#s~`U#s| p - | v -37| v -#QP\  u(s(T7U7BVBJUJKUKcUcVUUUVUVUVUV'S5SSQ1IQQQQQss s1    001    00`S1s1_U_dsdi}"ss0"T"`s0<P    000U0ZUUUT{U{Q~_~YQUQRQRURB0Bx^p^00^P^ ^ ^ ^ 0 ^ ^ ^06^B0Ppx pxV_V_V V=0=\\\\\\\s0^^0^R { 0 0 ^0 0 P pt! T 0 0   0 0 0:0B0V VB0V_V_V_ V V V Y ]_]_] _ ] _ ] ] _ ] _ ]:]:U_P6z6 { { {U{2s{{{ { __ _ __ UU Up`p`p` p`0 PP PPPP PP'px pxX{ {s#XU U2PpxP px1  i|  0i|0000000P^^^^^^H 111111 H 141     001    00Y|Y|YY|^^^^^!0!+RKSQjQR0+0SS000yyyyUQyyy>U>^U^dTdVVdQdk_knsn_s__0P$REYPY}||PLNP S$eSS _ c__ ; e;;1U1UU*T*TTSVZVVNSVsSSJ\Oy\y}q~\ss s|8|8 |8||| | Q | Q6U6]U]U]]6T6TTTT4Q4QQQQ6R6^R^R^^6X6_X_X__606 sT3% sT3%# sT83%# sT3% sT3%# sT83%# sT3%0 sT3% sT3%606VvVV0VV0220UU P0TT2PPR;QRQd@tt@ @}}}US u} !UJUJb\b/UU U !\!.UUPw pw #NN^##1##N))N))1--0--N--01  | $0.10 S 0000!"0##0$%S%(w((0()0))w)*0**S*+S+,0,,S,,0,,S,-0--w--0..0..w..SSRSSNN^##N))N))1--N--00 000 N 4\DI^ \ P10P ^%*^ ^^1^1 0101P 000 0w(1P 0P_z_ _"0 0 006000P_cz_]_ __]__ !_""_''_'(_()_**_++_++_,,_--_#_  !""'''(()**++++,,--#}} } !""'(()**++++,,--55}}0-tx pq"x -( $0.=b5"  t  -( $0. 0 1 _ __]__ !_""_''_'(_()_)*_++_++_,,_,-_#_  !""'''(())*++++,,,-#} } !""'(())*++++,,,-55}}w}` w }` w }`}`0ww}`}` !}`%%}`%&w &&}`''}`((}`()}`))w)*}`++w++}`)X)wPw w w P wPwwPwwwwww""w&&w''w'' ((w))w*+w++w++ ,,wX"Q%T T #w80 00100 !0""0&&0&(0((0)*0*+0++0,,0,,0#0g__,0,0P0gw0PZ^^ G]6]]]1PPQT^w wwwwww$$w$$w%&w''w()w}` }`}`}`}`##}`##w #$}`$%}`%&}`&&}`''}`()}`&0&; 0P;X 0wXd Swdm Swm Sw 0 0w 0w 0 [ [ Sw wwwPwwww 0w0Pww## 0w##w## ww$% 0w'([} }}}}}}$$}$$}%&}''}()}TZTs}pU P wZ##w%%Z%%}p0 00^P^00P0#$0$%0%&0''0((0()0}0 }0}0}0}0}0}0$$}0$$}0%&}0''}0()}0202;p3%;>px3%Gp3%0p}4% p}4%# p}@4%#p}4%00100$$00 00SsS0010#$0$%0%&0''0((0()010 w0111##w  F0F[  0 w<00@>$0@>$0 $$w<''0[0 0001S00$$0$$0''0((0+P+w P w }PwwPwPwPw#$w$$}%%w''P''w''}((};|; w | w| w w| w||%% w''|''z''|wwwww}`}`}`}`}`  T 0w0}w}}}  U _____11111 P ^ P0 ?0]kUU 0ww0^1^dUduU1uU \0\T0TTT Q@iQQPDiPPT11111T1    00,1   0[[^P^P5Z5[w^w^~p~p[ [[0 0  P!1   0Pp8p8p8 wJwJ  &w &w & S1S1S1"w"0 w@>$!!Q!" w@>$!" }` C^ ~ 1 ~ 1 ~ 1~~~ ~ 0 ~ 0 ~ 051     00pp pp 0 p   8w w w5U5rp"#@1w 74$r"#@ U U 50 0 1 Q !tut u ,("'wuw u ,("*w;w ;,(>;t. w1w w w wNUNrq"#@31w 31w 33$"2$r"#@ U U U 5001 P !tut u ,("'wuw u ,("*w;w ;,(D;t4 w1____wwww0SS0PS0 0R000]]]]>P>\\\P\}8}8}8==]]=11}}}}= ==0 Q#wP}8}8 }81    00 } Q} } Q}U_w}`tx t % tx#%) t  pq"x% t %"  1 00Pw ^^w #~~P4bPcxPyP PPPPP\\\&^&+w # PP]ww]w]]]w w ]]p`X_s`P_s`P P SPSrd5qp"%P%*Q*wwQwww w707\00^0000 00 P wwwwQ}}qp"PP1    00RP)] _D]Dw0]0w Q 0w ] w Q w 1 PS%]4@S1     00QwTQw1    00OUOSUU/U T $uP$/T T $uP$%T@U@V{#V\!\\R0RSsSSSSv~{v~]]]P-1{6]]]1PPRM22*s $ &H" H*Ms $ &H" Hs $ &H" HP$pxpxMTT2PpxPpxDUD^U^uE~EiPi{~U#{~p`VUVVV P \P\\\i0iSsS{{SP&]]\]M22*s $ &H" H*Ms $ &H" Hs $ &H" HP$pxpxMRR2PpxPpxUxSx}}}USuU,T,yVy~`TV~`T P n t) > })>B U#`)Ga })ae uh) \ U #^ T #] U #^ T #] Q #@ U ^ T ] Q @ 1 .PT s V~`#TS"u"#UE6<U<]p~`]UfTfVT P ^^SUStVtxs  xzVP P ^0^^VvVV0'3%'+3%#+4x3%#4Z0Za103%013%3%#x3%#_P ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~~~SS SSS1   ~ $0.  00 P ^^ @  @ ^00P H H ^5 H 1-0P H H -5 H 1 P pV s U(~(\U(~(_(\U~_\1+P]~-T-~zS SS-~-VP^ P^-}-\U} TRPUUUUUUUUUUUUUUU UUU#s Us Us 1PPQU?U)Su 8U8`V`bUbVUVuUVUVUUVUUVU U V U V2V2>U>UVU8T8STSTSTSRTSTSTS T S T S1S1TST\\\\\\ \4\?\\fPf~ ڟP~P~~ ڟ~~P0~P00'1  00u\\\\\\\VVVVVVV^^^^^^^PSSPSS PmPP PP P b~gt~PS(S)]3]];;;;;0R0R00#1  00^0,_,_000 P p  ~  p ~  p ~  p  S SQQQ<<<@<N<N NAM  NNAMv )030PS(S ]  M]gt]]GUGSUSdSGTGTTTdTGQGQQQdQPTTP\P00P  up |sp|U@spdsp}VVdVc00~^0^0^00d^P\\P&1    00PPpU0  Q\\\:\___:_U4]'Q':0p0)^^^:^|||S|P]]])])9P9:]PPPPpPPP1    00|-VVVP\P\P\PP\}P"U"VUVDVTTDTP(0PabPbSPPSPP#P)>PP\P\D\P\P\D\+ +P+ +P+ P 1&1  00|#P\p]]1P1S ,S000D01P1hS p81p81p81 p sP S U eSemUmSUOVVV!1    00u s 0p8p8p81Sv#hqQv#hqQUP*UT*TQ"U"*QupUPupPUUP,UT,T Q $U$,Qup UP PUPUPvUUTUaTajTjvTQYUYaQanUnvQupjUPupPMU#xUbU#x%Q%BU#x#JLQLWU#x#0 pU#x##+ p+(0)BQJL0LWQW_0 p~ p{UUPvUUTUaTajTjvTQYUYaQanUnvQupjUPupPMU#xUbU#x%Q%BU#x#JLQLWU#x#0 pU#x##+ p+(0)BQJL0LWQW_0 p~ p{UUPvUUTUaTajTjvTQYUYaQanUnvQupjUPupPMU#xUbU#x%Q%BU#x#JLQLWU#x#0 pU#x##+ p+(0)BQJL0LWQW_0 p~ p{UUPvUUTUaTajTjvTQYUYaQanUnvQupjUPupPMU#xUbU#x%Q%BU#x#JLQLWU#x#0 pU#x##+ p+(0)BQJL0LWQW_0 p~ p{UUPvUUTUaTajTjvTQYUYaQanUnvQupjUPupPMU#xUbU#x%Q%BU#x#JLQLWU#x#0 pU#x##+ p+(0)BQJL0LWQW_0 p~ p{UUPvUUTUaTajTjvTQYUYaQanUnvQupjUPupPMU#xUbU#x%Q%BU#x#JLQLWU#x#0 pU#x##+ p+(0)BQJL0LWQW_0 p~ p{UUPvUUTUaTajTjvTQYUYaQanUnvQupjUPupPMU#xUbU#x%Q%BU#x#JLQLWU#x#0 pU#x##+ p+(0)BQJL0LWQW_0 p~ p{U   0<U<_U_rVrwsowVVV\P00M1<0    !""'(())*++,,--  ((()++,,--  gKKKK, #&"            R)    ,   ##))-- ##))--##))##))    ? 44  dddrSe  0  $Xb    #<_# rvVwVVD "  ]b % %*RT]Y]IM P  /\0 $*1DK^ /V//'. $) 'N d:- <==7w    !#%'()*,.024689;=>@BCDF * 28028I208b o*@ w * U @+e@ @ p  0 6 P*` 9  b282P8e 28O 6*82822p8J28b28{*28288 * 282h8; & ,1 P > `,I ,T a ,l `,w ,  , p   ,  , `, , , , `,0G+1b,.00000 0( 0008%0@30HA0PO0X]0`k0hy\(  sO!(($ Do^R|P(  k.x(0  \+Hs#( X .(G d i *? * `*, ** *v p+v ,v,v -v+-v=@.v` O.kjP1r2(8  0* * P2$28884k@ +D5#2H8< 0Ho0;3e28~ 28 * p 88828  2`8 d2 @Q _h *y  @  `,  ,  ,  ,  `,  ,  ,    @,  ,  ,  ,  @,  ,    ,!  P -  ,7  @E 0pS  j} v( (   0x 0 0 0- 0; 0I 0W 0e 0s 0 0 0 0 0 *@ * * * * *`  *@ + *  < >^ ! (  P    0 0 `   3 p I  _  * P* * * `+ +,-%-70.I.d@1{@245 ;p@ P%:Oa#{  ) 2C O5 18OjyE=6E!9KSkwzD%'32FZdqDe');JR_8wY/):Q[nvD?TatDyE-E#BX_isEe ")@S[h*%)!QPE=(?Sjw |D,DK@Ecxblkback.cmax_pgrants__UNIQUE_ID_ddebug820.12__UNIQUE_ID_ddebug818.13__UNIQUE_ID_ddebug816.14__func__.153_rs.152__func__.156_rs.155xen_blkbk_map.cold__func__.149_rs.148xen_blkbk_unmap_prepare.cold__UNIQUE_ID_ddebug832.7__UNIQUE_ID_ddebug828.9__UNIQUE_ID_ddebug830.8__UNIQUE_ID_ddebug826.10__UNIQUE_ID_ddebug852.3__UNIQUE_ID_ddebug856.1__UNIQUE_ID_ddebug807.24pgrant_timeout__UNIQUE_ID_ddebug809.23__UNIQUE_ID_ddebug854.2__func__.161_rs.160__UNIQUE_ID_ddebug850.4__UNIQUE_ID_ddebug811.22xen_blkif_schedule.cold__func__.166_entry.165__func__.164_entry.163_entry.162__func__.159_entry.158_entry.157_entry.154__func__.151_entry.150__func__.147__func__.146__func__.145_entry.144__func__.143_entry.142_entry.141_entry.140_entry.139_entry.138_entry.137__UNIQUE_ID_alias862__UNIQUE_ID_license861__UNIQUE_ID_description860__UNIQUE_ID___addressable_cleanup_module859__UNIQUE_ID___addressable_init_module858_entry_ptr.0_entry_ptr.6_entry_ptr.11_entry_ptr.15_entry_ptr.16_entry_ptr.17_entry_ptr.18_entry_ptr.19_entry_ptr.20_entry_ptr.21_entry_ptr.25_entry_ptr.26_entry_ptr.27_entry_ptr.28__UNIQUE_ID_log_statstype801__param_log_stats__param_str_log_stats__UNIQUE_ID_max_ring_page_order800__UNIQUE_ID_max_ring_page_ordertype799__param_max_ring_page_order__param_str_max_ring_page_order__UNIQUE_ID_max_queues798__UNIQUE_ID_max_queuestype797__param_max_queues__param_str_max_queues__UNIQUE_ID_persistent_grant_unused_seconds796__UNIQUE_ID_persistent_grant_unused_secondstype795__param_persistent_grant_unused_seconds__param_str_persistent_grant_unused_seconds__UNIQUE_ID_max_persistent_grants794__UNIQUE_ID_max_persistent_grantstype793__param_max_persistent_grants__param_str_max_persistent_grants__UNIQUE_ID_max_buffer_pages792__UNIQUE_ID_max_buffer_pagestype791__param_max_buffer_pages__param_str_max_buffer_pages.LC2xenbus.c__UNIQUE_ID_ddebug822.47__func__.24xen_vbdstat_groupdev_attr_modedev_attr_physical_device__UNIQUE_ID_ddebug824.40xen_blkif_cachep__key.0__func__.10xen_blkbk_probe.cold__UNIQUE_ID_ddebug832.31__func__.16xen_update_blkif_status.cold__UNIQUE_ID_ddebug828.33__func__.23__UNIQUE_ID_ddebug834.30__func__.21__key.19__key.18__key.17frontend_changed.cold__UNIQUE_ID_ddebug826.35__func__.5__UNIQUE_ID_ddebug820.48backend_changed.coldxen_blkbk_flush_diskcache.coldxen_blkbk_barrier.coldxen_blkbk_driver__func__.1_entry.2_entry.3_entry.4_entry.6_entry.7_entry.8_entry.9__func__.11_entry.12_entry.13_entry.14_entry.15_entry.20_entry.22__func__.25_entry.26__func__.27_entry.28xen_blkbk_ids_entry_ptr.29__UNIQUE_ID_buffer_squeeze_duration_ms831__UNIQUE_ID_buffer_squeeze_duration_mstype830__param_buffer_squeeze_duration_ms__param_str_buffer_squeeze_duration_ms_entry_ptr.32_entry_ptr.34_entry_ptr.36_entry_ptr.37_entry_ptr.38_entry_ptr.39_entry_ptr.41_entry_ptr.42_entry_ptr.43_entry_ptr.44_entry_ptr.45_entry_ptr.46_entry_ptr.49_entry_ptr.50xen_vbdstat_attrsdev_attr_oo_reqdev_attr_rd_reqdev_attr_wr_reqdev_attr_f_reqdev_attr_ds_reqdev_attr_rd_sectdev_attr_wr_sect__UNIQUE_ID_feature_persistent815__UNIQUE_ID_feature_persistenttype814__param_feature_persistent__param_str_feature_persistent.LC6__pfx_xen_blkbk_map__pfx_make_response__pfx_free_persistent_gnts__pfx_free_req__pfx_xen_blkbk_unmap_prepare__pfx_end_block_io_op__pfx_xen_blkbk_unmap__pfx_xen_blkbk_unmap_and_respond_callback__pfx_reclaim_memory__pfx_show_physical_device__pfx_show_mode__pfx_show_wr_sect__pfx_show_rd_sect__pfx_show_ds_req__pfx_show_f_req__pfx_show_wr_req__pfx_show_rd_req__pfx_show_oo_req__pfx_xen_blkif_disconnect__pfx_xen_blkbk_remove__pfx_xen_blkbk_probe__pfx_xen_blkif_deferred_free__pfx_xen_update_blkif_status__pfx_frontend_changed__pfx_backend_changed__pfx_print_stats__pfx_read_per_ring_refs__pfx_xen_blkif_init__pfx_xen_blkif_finixen-blkback.mod.c__UNIQUE_ID_srcversion473__UNIQUE_ID_depends472__UNIQUE_ID_intree471__UNIQUE_ID_name470module-common.c__UNIQUE_ID_retpoline471__UNIQUE_ID_vermagic470_note_19_note_18orc_headerunbind_from_irqhandlerstrcpygnttab_page_cache_init__list_add_valid_or_reportblk_start_plugparam_ops_uint__num_online_cpus__msecs_to_jiffies__kmalloc_noprof__this_module__pfx_xen_blkif_xenbus_initsnprintfcompletequeue_work_on__pfx_xen_blkif_schedule__SCT__preempt_scheduledevice_unregisterrb_next__init_swait_queue_headfinish_waitxenbus_dev_fatalxenbus_read_unsigned__stop_alloc_tagsgnttab_page_cache_shrinkgnttab_page_cache_putxen_domain_typeset_freezablexenbus_readkfreexenbus_printfprepare_to_wait_eventkthread_should_stopxenbus_switch_state__wake_up__module_getrb_insert_color_raw_spin_lock_irqsave__pfx_xen_blkbk_flush_diskcache__fentry__wake_up_process__start_alloc_tags__refrigeratorwait_for_completion_interruptible_timeout__pfx_xen_blkbk_free_cachesfreezer_active_printk___ratelimit__pfx_xen_blkbk_unmap_purged_grantsschedule_timeoutxenblk_max_queues__stack_chk_fail__kmalloc_large_noprofsync_blockdevconst_pcpu_hotstrrchrblk_finish_plugsubmit_biomodule_putxenbus_strstatepage_offset_basebdev_discard_alignmentwork_busydevice_create_filebio_put__pfx_xen_blkbk_xenbusinit_wait_entryfput__pfx_init_modulestrstrxenbus_transaction_endkmem_cache_freexen_irq_lateeoirb_erasexenbus_unregister_driverphys_base__list_del_entry_valid_or_reportxenbus_watch_pathfmtbio_add_pagesysfs_create_group__pfx_xen_blkif_interface_finikthread_stopbdev_file_open_by_devbind_interdomain_evtchn_to_irqhandler_lateeoifreezing_slow_path__xenbus_register_backend_raw_spin_unlock_irqrestore__pfx_cleanup_modulegnttab_page_cache_getmemset_dev_warnkstrtoull__pfx_xen_blkif_xenbus_fini__x86_return_thunkkmem_cache_alloc_noprof__init_waitqueue_headrb_first__kmem_cache_create_argsnotify_remote_via_irqblkdev_issue_secure_erasestrcmpkthread_create_on_nodesysfs_remove_groupsprintfvmemmap_basexenbus_unmap_ring_vfreexen_blkif_max_ring_ordergnttab_unmap_refs_asyncxenbus_scanfxenbus_transaction_startparam_ops_boolinvalidate_inode_pages2__dynamic_pr_debug__kmalloc_cache_noprofgnttab_unmap_refs_sync__SCT__cond_resched__pfx_xen_blkif_be_intxen_featuresgnttab_unmap_refsxenbus_dev_is_onlinefile_bdev__pfx_xen_blkif_interface_initstrlenparam_ops_intxenbus_dev_errorstrchrgnttab_map_refsxenbus_map_ring_vallocbio_alloc_biosetunregister_xenbus_watchmsleep__pfx_xen_blkbk_barrier__SCT__might_reschedkmalloc_cachesdevice_remove_filefs_bio_setkmem_cache_destroysystem_wqflush_workblkdev_issue_discardMUsf#uJ =: F Rc j 0t 8   @V    V#0Ba=u [AM`K$AM5  f#  5 s B 5  =: G uQ [q M K &   H1 M f   ) 0 P7 `@ VR ] u M j ,I _ m jt {    X P    M=[MB=w01MiBvf:V==u[MH %Mg@F1>RFfKvZr 38<>"YfkF" eCm_{f_C_&_Q1F"l4E\7  - @9 A  A! O!n!  !x!'!c!bN"Z"i" }"U" H"U""""" " "D"" " #D ##p/#-e# p##  #'#F$l$E5$7c$<m$F$X$F$X$h$k%%5%%%s%&8&5&R&F& ' p'G' N' V''7' ' 'V''' @' '"( )( 5( A( 8](( x(U( ( ((3!)*)1h)7z)7) !) h))[)M)<*M(*-**;*K*e*Mr* V***M* ]***M1+ a6+=+F+ aK+R+u+M+ a+++ a++,MQ, aV,],f, ak,r,,M, a,,, a,-%-Mq- av-}-- a---M. a. .. a.".E.M. a... a...MN/{n/H///v0B(0B30B0#0B$1U1M|11B11 1 1 (11  11 2 2 2(2421U2Mn2t22"22 "2 262 -2I 3 403 g73 0<3DD3PO3ZX3 g_3 Nd3Dl3?3 e3 @3 k3w33 g3 {3D3'3G33 4 4 4+4 548<4 C4 H4UY4 k484M4m4B4B4"4q4 -4d5M5 \555 P 55p5 6 6 (6D06E6U6 ^696 g6 6D66g6 g6 6D66 6 6D7k7 7 I$7D,7:7 A7 vX7D`7o7 gv7 7D77 7 7D7 g7 7D88 *8 68DK8Z8 ge8 0q8D8 08 8 H88 888 X8A8 q8o9 w*9/29B;9C9]_9y9O9 9 99 98*:{I: S:8a:pp: z:8: :8: :8:G: p :8: }:; E ;8;[5;M;;e; ; ; ;;G;<?<4< < << <=A= X=9_=Zt=  ~=8= =8>G8> G>8R> pY> `> e>q> {>> >9>+>5> + ? "!?s? ?%? "? 5?? "? L???5+@[0@[5@[:@[F@ P@8Z@[_@[@M@ @ k@AABAPA WA ^A cAoA wA8A AAA AAA AABAaA1BuB}BBBBBB C-C 5CiJC OCaCmpC {C8CBCBC @ C `CC CiC  CyD D8.DTD  \DcD kDuD[DMDDMD"DD"DEME E 'ED/E<9EUEM`E gE vwEDE[EEME (E -E EEME EtM_8[ `Ug `U# U# (U  U '-4 9U>P (aUfkFslEFY~ Up  U) x.U3@7EJaM j g x8! ./> F$R gb| 8\&$3$B ` ~% w v B B B 8['. 5  :U?3F h KUPl3a 8 fkD3x -},7 Y,7  ,7 0 ,7  06 `7  U5G< J ^  cUp g| _ 5[ @ 8 ~=(9+H oU8Z~=_~=d[q /BB~= p UA  U m  #U* 78<{CI  R[/Eh qzEM?$5 :U@JZS)YZ^^gqM "[|: (0`hPp x(0`hp` ((P0( (0`Hhpx (0`hp` h@p  @ p  8 (0 < 4D 7`h hp     @ H P \ 4d 70    4 7 -   4 7 Y   4$ 7@ HpP    ( 0  <  4D  7  P   4  7  j@ @ @(p 00 8 @HPX`$h)p*xd***t+,,$--D.`.T1T2454;@DDE TE(E0Eg  djf !$!(1- "(0-8HPX-`(pZx-(- - -P -(89  ( v  $(J*,*0*4<+8Q+<+@+D\,Hq,L,P-T|-X-\ .`!.d.h.l#1p1t3x5|<AADD8EE&pT t Qs $(,/0`48@<_@D@HLP T X \ ` d hP lp p t x |0 ?   ! ^     AT_h9U$fQe BOY $7(j,0>4'8N<^@DHLPTTnX\`dhl!p3t[x|@   N!!!!!M"Y"|"""""##o###$$4$b$l$$$$$j%%%% 7&&&'1' U'$z'(','0'4\(8(<(@))DF)Hg)Ly)P)T)X)\)`*d,*hd*l*p*t*x*|5+J+t+++,U,j,,,,$-u---..D....M/m////0'02000T1{1111 122T2s2 2$2(2,;30c34383<3@4D44HG4LO4Pj4T4X4\4`4d4h4l5p5t5x5|5'6D6]66666#7W77777858J8p88888)919:9B9^9x999):R:`:y::: ::: ;; 4;$;(;,;0;4;8Q<<<@<DW=H}=Ld>Pz>T>X>\ ?`~?d?h?l*@p/@t4@x9@|O@Y@^@@@bAvAAAAAAA0BtBBBBBC4CNC`CzCCCCCCDD-D[DjDtDD DDE&ETE vE$E(E,0_48<@D'H8L`PjTX\`dhlpt-x?|`-EaA $ v     9Je|b' 8Tcp $(,048"<6@QDpHL9P]TX\`)DD EPEEE! (*+,3 $(, 048<@DHLP,T0XG\M`RdVhYlptx|!#(*0GNSUVW^/ 0 1 3 5 7 9 > U ` w y { }            $ ( , 0 4 8 < @ D H7 L9 P; T= X> \? `C d h l p" t$ x& |( - f p          g h j l q    s t$v({,048<@DHLPTX\`}d~hlptx|*- )))))**J*O*P*****V+`+++v,,----&. 0..... .$.(.,.0.4181<1@1D1H!1L#1P(1T;1X@1\[1`\1d]1h1l1p1t1x 2|-23282@2[2g2h2s23333333t444444445555555#555555 555; ; ;;$=;(?;,A;0B;4F;8J;< <@ <D <H <L<P<T<X<\0<`5<d6<h8<l:<p<<t><xC<|=================>> > >>>>->=>>>@>B>D>F>K>c@p@@@ @@@@@ 7A$8A(9A,;A0=A4?A8AA<FA@yDDDHDLDPDTDX E\E`7Ed8Eh=El@EpZEtoExE|EEEEEE=DJoNPgprwx| "$&+o" +,.02 4$9(,048<@DHL@P~TXu\`dhlp ( $> (0@ 4<B @HLTX`dlpxJ&|((])9 0(1*1,1.101 4C2" $`(Z0 4q 8 @ D HzP T XB`dhTptx;& # *)%'|&@''(b((.))g11R{23{58r a;$;(0<4K>8:@@DFAHP!CTCXP0 0(` 0 8p @ HPX`h)p*xP***`++,--0..@1@245 ;p@DDD@EE E(08 P20;P1* * Z`*`@   u0*@ }Pp+` p, ,  - - @.>N  ` `( 08@`H PX `h`p@x`  @ ` <8 <@HPp <x <0 <pX < p(0P <Xp`h < < <X0 <8@Hh <px H < < (p  ( ?H (P0X ` ? (  F (  P (  P( (08 @ P` (h@p x  % ($3(e,PN> $ 0@Pv $*+` $ $ % (U. )' ) +C ' &. (>U (Ta (k (qy (~ (r (p2 ( ( (8u (p (` (v ( ( (Vy (u ('{ ('I (cm ( (*r ( (n (N ( ( (O (E (`  (p  (̶+ (i2 (7 ([C ("O (r[ (g (wBs (М ( ({ ( (b (% ( (d (| (h  (5 () (2 (  (Ra, (8 (D (P (1!\ ( h ( bt ( (j (A (j ( (x= (F ( (1  ( (% (F2 (Z ( g (Ft ( (r ( ( (  (* ( (̎  (_ (<|( (7 (E (S (OYa (2o (} ( ($ ( (W (J" ( (; (  (h (  ( (@% (**3 (l (O{ (` (v (x ( (Q (x (P (0 (L (F (JZ" (Y1 (u@ ( %O (lC^ (][m (n{| (t (= (  (< (:9 ( ( ($ ( (: (h! (10 (~? (YN (g^] (vl (){ (be ( ( (2( (- ( ( (f (5 (08 (¾/ (> (m M (T\ (Ml (y| (ڡ ( (PG (e} ( (4 ( (@ ( (z (, (?< (BL (!\ (T l (${ (s (= ( ([ (W (~ ( ( (v ( (/ (I> (M (<\ (k ( z (k (\ (\! (F (A (0y (7 (f (@& (: (z (. (= ( L (p\ (<k (Loz ( # (Œ (M ( (R (1 ( (JJ ( ( (͐- (p-< (N-K (1QZ (كi (x (Q (a3 (6 (" ( (- (i: (4 (߶ (٣ ( (g, (}; (J (Y (yh (Cw (u (\y ( (D; ( (> ( (Q (o+ (b  (z ( + (@: (lI (X (jg (hv (>_ (4 (U (+ ( (G ( ( (;e (l  (ux (|* (!9 ()H (LW (f ('^u (i ( (s ( ( ( (+c ( ( ( :  ( (Y* (>9 (_H ( W (f (;u ( , (V (; ( ( (ع (8 ( ( (sm  (xu (k3* (^9 (H ()_W (·f (Yu ( ( (z' ( ( (B (A (G (  (4  (@X (d@) (`8 (w>G (RV (e (c (__ ( (t (_ (+Y ( ( (t ()  (q (E) (#8 (j;G (W (!g (w ( (' (e ( (WA (+ (& (_. (_; (fG (%T (wx (C6 (ɿ ($ ( (F ($ (` ( (b  ( (5 (6C (eQ (u_ (m ({ ([ (J ( (F ( (F (U (a (@ ( (6D (q# (q2 (DA (O ([] (ek (y (w (z (} (1 (@T ( (! (qi (z (^} (.$ (?3 (kqB (Q (Wu` (oo (~ (m (w6 (X (U (s; (L ( ( ( ($ ( 3 ([B (cQ (Q` (!o (y~ (8 ( ( (H (zw (+ (Jh ( (ܑ (`$ (# (`2 (eA (P (<_ (m,n (|} ( ($ (3 (H ( (b (، ( (6 (m (&j" ((X1 ('@ (TP (:Ve (C6q (ɍ} (F (# (F (2 ( (iM ( (y (*n3 (tq@ (TIM (Z (h (ܟv (C6 (p- (b (2, (WX (]X (C6  (9,L (cX[ (Eg (s (E (! (u (o ( (' (' (  (uF (fS (e ()r ( (h (f| ( ( (.v (  (2] (( (J6 (D ((:` (n (| (S ( ( (e ( (G (6v (KU (2R$ ("H: ({`^ (ѯs (H () ( (i (@ (QZ ( ( (9 (9! (Kk! (R"! (0! (٤>! (L! (ʧZ! (w! (g! (Q! (eG! (! (=! (;! (Ղ " (:3" (E" (VX" (U+f" (x" (bi" (f" (RE" (Z" (u" ( " (r" (Ն" ( X" ()" (5" ( # (^x# (]b5# (C# (gQ# (%_# (1m# (# (# (L# (W4# (wO# (8# (U)# (s# (A\# ( )$ ($ (Ջ.$ (a4$ (8:$ (|@$ (RG$ (dxT$ (5n$ (;{$ ($ (V$ (j*$ ($ (J$ (~%$ (o$ (*$ (fJ% (m(% (O% (6b% (p% (~% (d% (% (6% (% (% (6% (9% (V-% (% (; & (C& (bO&& (_4& (yB& (P& (,^& (Sl& (rz& (O& (a& (߸& (& (e& (P& (& (& (K& (DW' (9' ("' (C0' ( 3E' (R' (%L_' ( l' (%y' (' (%' (' (;' (F' (' (' (' (r' (A' (' ({y' (R' (h' (k' (*' (P' (غ' (h( (]( (7{;( (S( (PY( (D_( (3e( (k( (O8q( (|;w( (b}( (P( (`( (7( (3( (_f( ( ( (( (g( (( (u( ($Z( (Sk( (;}( (,&( (( (G( (w-( (ġ( (8( (&( (e ) (e-) (W~$) (g1) (]J) (j(V) (1zc) (p) (Q) () () (V) (t*) () (o) () (a ) (8* (6c* (0* (SB,* (?* (SiL* (SBY* (u* (* (C6* (&* (I* (* (* (SB* (* (<+ (ij + (q+ (&+ (s3+ (l+ (x+ (}+ (^+ (5e+ (+ (+ (, (2, (@, (C6N, (i, (Mw, (͋, (, (, (fQ- (]- (- (6y- (. (. ({. (Rp. (ʴ%/ (C51/ (N/ (/ (n/ (^/ (Rp/ (/ (D0 (]i0 (Rpv0 (z0 (0 (Z0 (X0 (50 (_40 ( 1 (%@1 (x1 (@-1 ( _L1 ([1 (nj1 (y1 (1 (1 (>1 (+K1 (1 (Q1 (n1 (2 ( m2 (kk*2 (x82 (6T2 (d2 (t2 (,2 (l2 (2 (VT2 (GP2 (2 (2 (2 ( 3 (3 (~#&3 (G43 (IB3 (W3 (Td3 (j*q3 ( m3 (F 3 (S3 (3 (3 (3 (ʴ4 (hK4 ( 4 (<<-4 (FI4 (eU4 (9b4 ((o4 (L54 (Y4 (H4 (s#4 (Z4 (&5 (5 (?%5 (k25 (&?5 (TL5 (lY5 (Kf5 (x5 (d5 (R<5 (F5 (<5 (5 (f85 (?5 (5 (5 (^5 (k6 (W 6 (M6 (X'#6 ()6 ()/6 (i66 (H;6 (^H6 (5V6 (n`6 (m6 (*{6 (:6 (6 (u6 (6 (U+6 (|6 (U6 (6 (6 ( 7 (-7 (Q'7 (;k47 (ZL7 (Y7 (-l7 (y7 (7 (ټ7 (^7 (@7 (&7 (ln7 (7 (?7 (4I7 (q7 (|8 (@8 (8 (8*8 (j*78 (D8 ( lQ8 (^8 (]8 (GD8 (78 (`8 (8 (V8 (8 (Ϲ8 (}_9 ( 9 (K9 (&'9 (849 (W9 (߶d9 (q9 (]~9 (9 (M!9 (2R9 (9 (@9 (9 (9;9 (Q9 ( : (r: (·%: (2: (O.?: (: (pV: (;: (v: (T: (O: (: (ʖ: (‰: (5; (8(; (;p&; (=3; (@; (M; (qd; (8(q; (;p~; (; (8(; (;p; ( ; (; (; (6; (; (p< ('< (O)5< (,(B< (hO< (ɞf< (r< (6~< (%B< (|\< (w< (}< (Z< (3:< (H= (?= ("= ( .= (<F= (^R= (Y^= (ej= (%= (= (n= (= (4= (,= (,= (`= (v= ([= (p-> (F> (9!> (.> (ξ;> (9FI> (fbc> (y~p> (K}> (}_> (Ɂ> (> (KU> (S> ()> (}_> ( m> (? (X? (? (*? (7? (nD? (BQ? (^? (k? (Tx? (S? (U? ('}? (@? (ο? ( ? (lY? (>u? ( @ (p @ (u@ (u(@ (k6@ (C@ (P@ (э]@ (<j@ (w@ (@ (;@ ("@ ('@ (@ (J@ ("@ ("@ (/~ A ("A ((,A ("9A (rGA (jA (A (A (AA (\A (\!A (rA (>"A ( A (NMA (֨A (A (nB (0yB ("B ([,B (HB (\VB (\!dB (FsB (B (B (%\B (B (B (B (yB (7B (kB (-C (bC (?oC (D+C (+99C (oGC (|UC (PcC (`rC (PC (KC (ojC (LuC (8C (C (DyC (C (>C (]zC ( D (D ()D (c7D (ED (0SD (PCaD (RoD (d}D (iD (D (٭D (D (D (<D (3D (mD (6D (' E (gE (}>'E (q5E (BDE (~zRE (f`E ([nE (|E (E (]E (cE (\E (D8E (UE (7E (ZDE (,HE ([3F (ygF ($F (W2F (,p@F (NF (2qF (,p{F (]F ('F (2JF (#fF (N@F (F (F (YF ()oG (%G (-4G (jBG (DPG (Jr^G (,lG ({zG (rG (~zG (G (G (AG (H>G (MG (OG (CH (xH (:$H (3H (@)OH (7]H (kH (RzH (?H (6H (yH (ϼH (H (zWH (1QI (sI ($I (4I ( YI (gI (F|I (cI (`I (~[I (I (O(I (o*I (SI (I ( J (J (ď#J (|!1J (`?J (QnMJ (g[J (iJ (` wJ ()MJ (HJ (~J (fJ (O.J (1J (rJ ()K (2(K ( K (?7K (ZK (gK (tK (K ( #K (K (K (K (K (۵K (sK (X9 L (2L (DR#L (0L (U=L (XJL (WL ( dL (OqL (2K~L (\L (L (L (nL (L (`L (<L (M (}M (I3M (n@M (SM (zM (GM (M (mM (M (M (M (M (M (|6M (yN (͐ N (!N ((N ( 5N (\dBN (@@ON (\N (iN (WvN ( &N (lN (yN (ON ( N (βN (N (anN (*N (_N (Om O (>O (:.#O (1O (yJO (| XO ( fO (;tO (7O ( O (O (9dO (DQO (\O (\!O ((O (oP (FP ('P (A*P (f8P (@&FP (TP (bP (pP (~P (P ('yP (+P ( P (mP (bP (yP (YP (bP (1G Q (@Q (%&Q (04Q (|BQ (zPQ (Q^Q (+lQ (V7zQ (lQ (؇Q (2AQ (Q (´Q (O.Q (UOQ (ɜQ (-Q (R (R (;P!R (5R (CR (eQR (_R (HmR ([{R (VR (.R ()R (?R (R (>R (JR (R (7RR (rS (S (4S (+S (4>S (MS (dWS ( .aS (=oS ([}S (S (BKS (nS (S (LS (S (2S (OfT (-T (5$T (1T (>T (AKT (@PXT (9eT (NrT (QT (T (FIT (_T (T (<T (+T (T (T (T (U (%!U (r/U (3=U (KU ( fU (@,tU (cU (TU (f=U (^?U (U (`U (4U (17U (U (ZV ()V (f7V (rSEV (XSV (gV (TPtV (V (V (M?V (V (V (eV (9V (ƇV (FV (wW ( mW (W (L<*W (bv7W (ʑDW (!QW (dW (nW (ھxW (qW (+W (_W ()W (SBW (W (.W (W (A\W (wOW (8X (U)X (kX (K)X (7X (PX (YrX (X (X (X (X (q|X (X (X (X (hX (eY (`Y ( FY (+Y (Ź8Y (bY (f>nY (7Y (ńY (~Y (Y (Y (iY (>LY (fZY (Y (tZ (Z (KZ (PZ (#]Z (rjZ (;PxZ (iXZ ('qZ (wZ (BZ (Y6Z (Z (Z (Z (Z (Z (bUZ ([ (r[ (q([ (85[ ( C[ (AQ[ (a_[ (xm[ ({[ (P[ (e5[ (J[ (>[[ ( [ (w[ (<[ (`[ (\ ( \ (J-\ (#N\ ([\ (h\ (Ku\ (\ (o\ (C\ (Ig\ (l\ (W:\ (\ (d\ (u\ (=S\ (s\ ( ] (J] (9>%] (K2] (@] (+e] (ԫr] (a] (Qs] (XZ] (F] (-] (&] (M] (] (] (^ (e!^ (9+^ (8^ (tT^ ( b^ (up^ ($~^ (^ (f^ (#^ ( ]^ (!^ (p5_ (X_ (a _ (_ (4_ (vFB_ (O_ (5\_ (9Yi_ (G&v_ (ɜ_ (g _ (o_ (_ (<_ ( _ (_ (_ (&_ (˵_ (N` (r` ( ` (g,` (9` (2G` (l~U` (-Nc` (Lq` (e` (,` (p` ()` (p` (,` (,` (A` ( a (ea (&/a (Da (9Pa (O]a (ecpa (Hl}a (Ba (64a (O.a (a (U+a (|a (Ga (#a (sb ([b (NL b (?-b (r:b (}BMb (!Zb (;Pgb (/\tb (ub (Hfb (b (b (-b ( c (c (rc (D)c (q6c (6#Cc (^IPc ( ]c (ulc (7{c (c ( c ( c (rc (pc (Fc (6#d (d (kd (g2d (?d (2Yd (-fd (Cxyd (d (@d (1d (d (%d (rd (}md (d (qd (6#d (Qe (Le (F"e (8/e (e (0 f (j+f (#f (:f (Gf (^f (؀kf (f ([f (f (df (Mf (f (8f (# f (,Vg (>ig (+S"g (@(g (O.g (4g (X;g (BKg (Qg (ŒWg (v]g (adg (qg (~g (2g (Cg (Cg ('Eg (Jg (g (h (`h (h (*h (27h (Dh (qQh (5b^h (Fxh (8h (6 h ("h (,h (h (h ( h (ri (O.i ([i (Y6i (QCi (IPi ("ji (wi (ri (2i (Gi ($i (i (i ("i (Gi (i ( mj (mj (lj ( +j (m8j (SEj (@Rj ( _j (@lj (&yj (tj (j (j (Trj (}j (j ( j (](j (k ()k (̬5k (IKk (`Wk (sk (jk (tk (jk ()Fk (k (;k (e6k (sl (l (#l (P0l (^%Jl (Wl (C6dl (ql (yfl (l (,l ( l (Xl ([am (a,m (:m (pm (t}m (G<m (m (jm (`m ([am (hm (f|n ()n (,n (<:n (Hn (Vn (kdn (%=rn (O2n (vvn (n (Dn (4n (n (n (Do (Bco (z$o (rGo (vVo (Qzo (5o (go ( o (բo (#"o (o (!o (<o ((o ( p (yp (N&p (Oy:p (:mHp (Q Vp (ԟdp (ʦrp (Fp ( p (p (`Vp (gp ( p (ep ( p (r q ( q (&q (4q (j"Bq (I9Pq (F_iq (zwq (ގq (f q (bq (;q (~q (r (r (_r (g+r (-9r (Gr (Ur (E{cr ($qr (Hr (9r (gr (r (or (er (hr (?r (s (;s (.s ( Is (bs ([ps (~s (s (s (>s (2s (s (s (jt (H6t (t (D-t ([p;t (uIt ( Wt (&et (m st (t (Yt ( t (t (t ( et (]t (d t (Et (zu (X u (*!u (:20u (MX?u (=Nu (]u (\lu (={u ( u (u (u (=u (!u (ѣu (u (-v (U;v ( j v (/v (6>v (Mv (b\v (ʨkv (zv (v (Iv (Cv (v (v (v (o}v (8v (,w ( w (Ow (.w (=w (DLw (L[w ($>w (Yw (.kw (.Ew (:+w ('w (Bw ((7w (,x ('?:x ()dx (osx (x (x (Lx (}x (óx (x (kx (fx (,x (x (sx (\x (Dx (x (3x (Ձx (x (b y (ţy (e\&y (H3y (b@y (6My (uhZy (Mgy (3@uy (y (5y (ey (BOy (y (Ơy (uy (ty ($y (fz (T*z (W7z ( Dz (mQz (^z (kz (xz (z (gz (<z (xjz (&z (Vz (Mz (^z (8{ ({ ([E{ (PR{ (&_{ (:l{ (`Py{ ({ ({ (;{ (eo{ (ł{ (({ ({ (W{ ({ ({ (*| (T| (%2"| (/| (L<| (MT| (?c| (,q| (W| (| (C6| (v"| (6-| (x| (u| (d| (3 } (T`} (Ϡ(} (,F} (U U} (qd} (9s} (} (v4} (} (,} (@} (} (~} (} ($} (l ~ ( &~ (R5~ (+D~ (ކS~ (nb~ (q~ (9~ (g~ (d4~ (֧~ (O~ (j~ (~ (j~ (M~ (d  (]( (no5 (LN (ra (n (${ ( ([T (Up (i} ( ( (u (O. ( (́ (ځ (" ({. (u? (fE (5K (Q (+W (c] (c (o ( (R ( (< (@ (#5˂ ($a؂ ( ( ($a (h4 ( A (˺N (C[ ((h (u (@p (5 (# (ruƒ (Dkσ (Y܃ (T (yH ( ( (e% (!3 ( A (O (] ( k (ay (( ( ( ($W (Q (̈́ (,>ۄ ( ( (. (x (J! (/ (@m= (2K (Y (>g (%u (-a (, (O (E (u (Ʌ (L[ׅ (u ( (ܢ= (UK (Y (gg (ߚ{ ( (@ ([ (~t (t<ɇ (և (v[ (~ (t (^ (8" (0 (E= (O.J (W (Wd (e ( L ( (ˆ (ψ (Ϫ ([Y (_ ( m# (1 (4g? (_M ([ ( ?i (Zw (b (Hs (6 (1 ( (ˉ (ى (bO ( (5 (7+ ( 8 (TeB (N[ (gh ( u ( (u (q (a ([ (Ɋ (1׊ (J (- (9Ջ (0 (x& (w, (Q2 (9 ("F (C6S (` (1%m (hz ( ( (#̌ (nٌ (j ( (i ( ( (A (7h ( mu (>W (7 ( (r (m (Í (rЍ ( ݍ (x (/ (  ( ($ (, (e9 (P ( "\ (i (o w ( ( m (t (! (6 (LOˎ (َ (/` ( (bO@ (tM (eZ (Kg (Wt (BD (G ( (2 (ŏ (kԏ (A ( (H (k2 (Qc (BDp ([} (J` (, (G3 (CS (đ (Hё (ޑ (a (c (I (u7 (RK (ڒ (%Ȓ (%V (| (# (e0 ('; (“ (Sғ (Wؓ (Cޓ ( (h (= ( ( (]  (@$ ($N2 (z*@ (OqO (\ (,i (]v (}_ (e (o (,P (C6̔ (ٔ (k (ru (# ( (! (_/ (nQ= (x$K (#u (C6 ( (Y ( (a (C6͕ (ܕ (5 (H (r (O (ߒ$ (A2 (o6@ (N (h\ (@j (5x (` (F (Rv (t ( (|+̖ (Tږ ([ (D (OU (t[ (a (1Hg (pem ({t (H (. (Z (t ( (ȗ (m ( (g[ (Տ (X (Z (Y! ( ' (3- (q3 (L9 (? (!E (K (LQ (W (r] (c (gj ( w (y ( (. ͘ (q (x (x ((! (e/ (C6= (9]K ( (K (B (e (VǙ (yԙ (F (* (e (K (y@ ($( (95 (~B (WO (>R\ (i (ɞv ( ( ($ ( (<Κ ( ۚ (M (;O (G ( (M) (66 (C (zSP (  ( (.œ (ozМ (+ޜ (v& (r (2 ('G (U (5c ( ]q ( _ (z* ($N (å (h7˝ (u ("D ( ] (a (I (`& (b!4 (6L (Z (h ( v (A ($ ( (@ɞ (Q՞ ( ( _ ( (A (C (6 (B (~X (d (z (r (}" (*" (C (&Ɵ ( ԟ (ZB (( ( (V (ؓ (x3 (G (տT (yl (Ty ( ( (+ (Ƞ (ՠ ( (k2 (Q (+% ("3 (|A (؍O (] (k (~y (ws (O ((# ([ˡ ($١ ( (f ([ (Y (- (a; (#5I (ӦW ( (Ї ([ (" (~ (ͣ (3ڣ (cR ( (m (  (9 (^F (/S (Y` (m (z ( (_ (- (a ( M (ukϤ ("ݤ (] (o6 ( (g (-j# (y1 ( ? (3M (C4[ (.i (&Qw (_, ( (& () ( (sL˥ (٥ ( (y ( (0; (M (jS (Y (ˀ_ (e (Fl (nw} (̤ (Q (} (i_ (ڄ ( (r (JƦ (Ԧ ( (w] ( (! (hR (Y& (5 (WhD (HS (w9b (Wq ( (@ ( (~ (f ( 4ʧ (rا (K ( (3 ({r (" ( 2 (B (WR (@b ( q (A (u (i (ZU (C2 (I;Ũ (yDը ( (| (  (f (% (s5 (+uE (uU (e (_Eu (1 (* ("J ( (= (˩ (٩ (Y* (v ( (v (=B$ (2C (mP (ei (Kv (r (ZU (=S (A (Л (FĪ (MѪ (Nު ( (s ( ( (A~ (9 (H (؝] (mv ( ($, ( (Oë (ѫ (߫ (wZ (a* (8Z7 (eD (Q (|^ ( k ('x (M ('; (s ( (tM (Ƭ (Ӭ (j (o6 ( ( ( (Yc- (f9Y (of (e ( (; ( (T_ (~ (έ (sۭ ( (tM ( (o6 ( (n) ( B (#( (ކ (e (_Ȯ ( ծ (Ģ (/ (} (u (t (lp# (c0 (I (z (eʯ (nׯ ('; (/ (% (M2 (=? (R (m_ (=l ( (EU (m ( (~ (Uİ (D۰ (uT (J (  (s (8 (O.O (-.j (dv (7 ( ( (t ( (Yñ (ݱ (s (ؽ ( (2" (t# (A1 (P (S] (k (x (F ( (r (O.ɲ (.;۲ (G ( L" (6/ (ClB (e^ (!j (r (2U (~ (Ք (c (Ƴ (Cӳ (~, (M (I (: (+ (J! (. (; (=H (Rw\ (( i ( ( ( (̉ (LHǴ (fմ (, ( ` ( (" (M (+) (9Q7 (NK (gY (Dg (u (M () (1 (q ( (Xɵ (sI׵ ( (y (K (_ (X (5+ (n9 (G (U ( c ()q (t (6 (* (ź (\ (Ѷ (fA (v (,I (} (g (3 ({)B (!R (i (eTx (jr (r (Q (yʷ ("׷ (e (' (~, (D- (Lx (% ( 2 ()? (<L ([Y (Vf (4s ( ({h (} (& (sĸ (9Ҹ ( ( ( ( (: (^)& (/{4 (B ({MP (V^ (N~l (Pz ( (6 ( ( (A ( ι (Uqܹ (1 (U (q (v (xY" (!}1 (@ (O (^ (~m ( } (Pj (| (& (t (Ⱥ (L׺ ( (p ( (I (ͭ" (}1 (@ (O (?^ (m (C| (* (6 ( (1 (ǻ ( ( (ě (J  (# (t2 (=A (΄V (Zf (OQl (2jB (cO (\ (P4i (v ( i (7 (c (v^ ( - (b: (IG (U ( Ab (oo (J | (/ ( ( (J (ʾ (<׾ ([ (I (e (R5 (~GM (sZ ([g ( t (r (# (  (+8 (| () (r6 (O.C (|Q (I,a (Jg (m (ҕt (- (i (t ( (l ( (ˆ (u ( (-' ( (= (DJ ( L] (C6j (eaw ( (W (ȫ (X ( (s ( (r:4 ( vJ (eV (l (x:x ( ( L (' (C6 (ea ( (' (Y (~q (M/ (9 (H (lU (@b (oo (T| (uQ (1i (E (  ( (< ( (D (|L (JY ( (f (ws (7 (' ( (M (p (c (& (2 (TW (\ (\! (U ( (- (: (nG (FZ (ang (\dt (SU (( (M (9d ( (z ( (n (~L (o! (. (TR; (RJ ("d (q (~ (4 (7? ( ( (q (l ( (E (UA (O (KF^ (ȕl (bz (6* (!c (s (G= ( ( (G (> (Q (W ( (n" ( 0 (c> (lL (>Z (2h (v (, ( (Le (0 ( (Z ( (Zj ( (2J( (X7 (F (t?U (d (Ts (: ( (֗ (@ ( ( ( (N (@ ( (Vo& ( 5 ({D ()S (vp ( (> (+m ( (CG ( ( (О ( ([ ( i8 (IE[ (bg (*Jw (1} (! ( ( (  (s (&j (86 (* (} (u (\H (| (#+ (~7 (M (Y (Zf (Ϫs (W ( (A ( (^^ (̏ (– (d ( (E ( (:* (8 (rF (T (qb ( p (c~ ({ (*i (e (2 (f (d (? (Ux ( (' (w: (C6H (1^U (b (Bo (o| (} (Cw (] (q (a ( (I (A ( (F (E ( (3L& (3 (@ (jN (\ (aj (;x (2 (f ([ (Z (rb (M (E ({ (V (F (&i (jw (' (- (w ( ( (n (x (k (B (* (& (J (ȱ (> ( ( ( (e ( (s (>h (F* (d8 (F (T (eb (Up (Q ( ( ( ( (l (q (S (' (m (Ѓ (`( (06 (ckU (c ([q (, (=? (׬ (+ ( (m (S ( ( (E (^ ($ (( (6 (KD (BjR (,l` (`n (E (bS (a (ao (} (_4 (۔ (d (# (Z#1 (F? (EM (P[ (ri (uw (b ( ( ( (K* ( (B (\ (W (;n (!$ ( (w- (; (^9h (P (N[ (' (S (gd (% ( (9 (Z' (c*4 (A (N (w\ (f (Lp ( (\R (| ( (n\ ( = ( (5 (C (7 (ʃ ( (O' (ʯ5 (!C (TQ (_ (4m ({ (cN ( (j (b" (  ( (X ( ( (% ( + ( (G( (g6 (rR (W n (| (Z (^ ( ( m (5 (V ([ (&~ ( (# (i+ ( 88 (E (K] (hj (y ( (# (z ( (P (+ (=* (Z (7 (1 (+ (U9 (G (rU (݂c (VVq ( (Ɇ ( ( (~2 (% (\ (N' ({ (5 ( ( (L^' (Q5 (X (ߕg (  ( (a (_ (x (T (e (LI ( (k () ( (4O# (50 (_+= (LJ (mW (=d (Rq (~ ([Q (J (&6 (z ( (۳ (" ( ( (, (O (>>Z (Z>h (C ( (" (g0 (> (]L ( (( (m (05 (u (= (J1 (B (ZH (N ( ($ ( (b6 (C (3pP (m] (4j (ew (( (IB (S ( ( ( (G ( ( (I (? ( (²) (7 ([\E (13S (Cab (Ԙn (93z (G (F (e (u (j (Gi ([ (+ ( (-D (6 (U (7# (VH ( U (e| (G (1 ( (% ( (- (\G (n (`5 (^ (& (e (@ (Ѵ (w ("X (H ($ (rJ! (rD (1XQ (,k ( ( (p (!R ( (k2 (Q (Ϣ ( (6| ( (Zg (N (R& (% (F (@ (Cb (j* (+ (r ( m( (۷6 (tD (&R (` (t (/B (N (zi (ՠ (W| ( (> (Y@- (T_= ()C (AI (Z (j ( (K ( (}  (8M ( ! ((' (;- (…3 (e&: (K (pAQ (W (o] (;^d (؊r (^ (8 (w (ʴ (X (T ( (eh (` (I (R= ('d ( ( (B (d (- ($3 ( 9 (|@ (sQ (oW ($] (d (r () (` (i (Ŋ (w ( (C (m (K (9 (G( (3t5 (;B (+R (RX (.^ (e (+q ( (_ (| ( (H (K (: (W (0 (/ (%O< (nb (5e ( (f~ (z ( (q (l+ (k7 (ID (R (7` ( (ʴ (, (b (Ql (7 (b (, (ʴ (o (k8 (+E (V"R (_ (l (y (DY (L< (O. ( (r (L< ((A ( ( (t (5 (:% (oN< (8wF (T ( b (p (g~ (-j (2 (a (;r (D] (( (y (7 (R (P (* (4 (HV> (͈M (t[ ()Ui (j)w (E (V, (J ( (i ( (>: ( (> (@ (, (tR= ((C (hlI (O (șU (g[ (xa (wg (_m (\ws (}y ({R (7 (e (P ( (i (qd (# (Ա (Z (F ({ (YF (t ( ( (n (I (" ( ( ( ([J (% (c (]! (R' (. (N (kj (zw (r (0 ( (-4 (w (M (6 ( (:8 (\ (  (R (@ (C6M (NZ (~g (@t (" (V ( _ (`B (7 (v3 ( (x (7 ( ( ( (^& (M#3 (#lA (]M (B[ (Vi (R3w (_ ( (e2 (C (o (z (u ( ( (7! (5 (/ (c- (; (I ({b (l (%%{ (k ( (( (, ( (ul ( ( (5\ (W ( ( (- (`; (~I (YW (e (s ( ( ( (\ (~ (Cr (h (@ (V (l (e%  ( (z) (T7 (_E (uS (a (CAo (} (S ( (I (  ( ( (J: (& ( (  (` ("% (˽3 ({B (:Jr (l (, (0? (!h ( (E (e ("J ( - (  (œ (v (N (a# (- ( 7 (ЌE (;PS (b (s (Zy (` (' ( (/ (lg? (DE (pcK (*Q (PW (] (Ԗc (\i (o (v (k (A (r (k ()T ([ (@ ( (tp (F (-T ( }a (.n (ŝ{ (Qb ( ( (g (u (U (m! (N (F7 (λ (& (@ (ĭL (XX (\d (q (>x~ (*e (; (4 ([ (, ( [ (: ( (s ( [+ ([D (:Q (!h^ (2l (y ( [ ([ (2 (~ (K{ ([ ( [ (: (,  ([  (n!  (2R  (^  (6j  (w  (u  (6T  (j@  (6T  (ʴ  (C  (l  ( S  (X(  (56  (-D  (yVR  (  (  (Lc  (  (9  (rY  (߲  (P  (  (_G  (w  ([  (,2  (:M  (=Z  (sg  ( [  (:  (!h  (  ( [  ([  (z  (K{  ([  (:  (,  ( [)  (n6  ([W  (c  (6o  (|  (  (6T  (  ([  (,  ( [  (:  (A%  (s  ( [)  ([B  (:O  (!h]  (#xj  ( [w  ([  (2  (f  (K{  ([  ( [  (:  (,  ([ (n (23 (? (6K (X (`e (6T ( (  ( S (X (5 (- (yV ( ( Z& (Lc3 (@ (9M (rY[ (; (PN ( S (X (5 (- (yV ( (Xs (Lc  ( (9% (rY3 (BY (Bf ( Ss (X (5 (- (yV ( (' (Lc ( (9 (rY  (  ($ (Dk0 ("< (~I (Y (k_ (cHe (Jl (py (, (ӑ (C6 ( (E ( m ( (  (8 ( (s (l ()5 (,B (LTO (\ (@j (-x ( J (}T ( ( ( ( (os ( (} (p (ժ* (M8 ( F (T (0b (p (E~ (  ( ( ( (:U (+- (P (cD (s (M  (l (_2+ (9 (RG (,U ( ~ (&j (= ( (M (rE ("& (gO ( (t ( (j (}_- (R< (OJ ()X (lf (,t (>x (L ( (d (zC (6T (ʴ (Ν ( ' (gF# (2 (GA (P (|N ( (= ( (:  ({6 (ՐB K (!W u (c  (5  (3 (: (b  ('C) sG (MSS +\ (hq (} ( x (  (Ot kZ (W{!* (36 PT (օ` R~ (W  ( ( ( ({X " (. s7 ({C"a (#mv (b  ( \ ( (4$ (ҥ +" (0 9 (e'G Q (}[ (Ve (Ds ($ ( (L (o (? (< (%+ (^u (ޫA (Tg ( ("#b#k;# (։B#@Y# (d# *=h# *-w# *{# *# *# *# *# *# (# *5# *1# (# *Q# *I# (}T# *# *t# ($# *# *# ( $ (5W$ +$ (|(*$ *-.$ *+3$ ((>$ *>B$ *:L$EV$ +g$ *Tk$ *Ru$$ +$ *e$ *c$ *v$ *t$$d$($ (zI$ (% (L%% (>% (RW% (n% ({% (6T% (% (D;% (% (L<% (Z% (H%% (ʊ% (% (L% & (R& ([,& (j:&pH& (~S& ([g& (tu&8& (& ([& (&& (& ([& (' ( ' (' (}T'' (Um' (9' (' (' (}T' (L' (U' (H'' (( (o(( (*%(0( (=( (J( ((W( (d( (-r( (u( (q( (K( (#( (( (( () (L) (e,) (\9) ({L) (W) (_d) ( |r) (t) (q) () (.) (^) (=(* (G * (^* ({(* (19* (z@* b* *f* *o* y* +%* ** ** *F* *:* +%* * * *x* *v* * + *+ * + + 0+ *4+ *=+ [+ +;h+ }+ +M+ *+ *+ + +M+ *+ *+ *+ *+ +M+q + ++, +_, (, +q5, * 9, *B, L, +qY, *], *f, *Jj, *Fo, +qx, , ,P,X, , , *g, *e, *|, *t, *, *, *- * - *- *-& 9-c T- +a- v- +- - +- *- *- *- *- +- - --- . ,. E.q [. (i. (Lv. (}. (H.p. ([.P. (. ([. (.. (ۛ. ([ / ()/)/ (4/ ([Y/ (Eg/ (t/ (_2/ (*</ (/ (L/ ({/ (/ (ʴ0 (_20 (0 ((0 (H20;0 (ʊH0 (oU0 ^0 (*k0v0 (00 (0 ([0 (0 (L0 (0 (L<1 ( 1 (n/1 (RF1 ( 'S1 (G`1 (*em1 (;1 ({1 (1 (1 (ƚ1 (1 (L1 (1 + 1 (2 *> 2 *62 (L<2 *r2 *l/2 *32 *B2 *F2 *\2 ( ul2 (lw2 *0{2 * 2 (w2 *2 *2 *2 *2 (N2 (_2 *F2 *62 (2 *2 *2 * 2 *2 (sK2 *2 *3 (93 *3 *3 ("3 *( &3 * +3 (_263 * :3 * ?3 (jF3X3ob3 (Hk3 (Fr3H{3 +"3 (3 * 3 * 33 +T3 *; 3 *1 3 *q 3 *k 3 +T3 * 3 * 3 * 3 * 3 +z3 * 4 * 4g4g14 * 54 * >4gH4ga4 *- e4 *+ n4gx4g4 *? 4 *= 4 +44@444`4z4 +55 +55 *U 95 *O B5 * F5 *| O5 * S5 * \5 * `5 * i5s55 * 5 * 55 +5 * 5 * 5 +5Y5e5 +6 (T60646 (->6 +G6 ([R6 * V6 * _6i6 +v6 * z6 * 6 *I 6 *E 6 +6`6x6066 +6 (=6 *k 6 *_ 6 (s6 * 6 * 6 7 +7 * 7 * #7 * '7 * 07 +97 *# =7 * F7P7m7 *c q7 *a z7 *t ~7 *r 77 +x7 (j777 (י7 +7 ([7 * 7 * 8 8 +8 * 8 * &8 * *8 * /8 +88D8U8b88m8 +v8 (P88C8 (b8 +8 ([8 * 8 * 8C8 +8 * 8 * 8 * 8 *8 +929V 9-9<9F9 +W9 *F[9 *8d9 *h9 *m9 +v9 *z9 *9 * 9 *9 *79 */9 +>9t9 +N9 *f9 *d9 *u9 *s99: *: *":,:E: *I: *R:\:u: *y: *: +^:: ::::y:%;G;4_;$; (%;; (; *; *; (L<; *; *; *; *< (G< (!< (Y,< *`0< *T@< *D< *I< +R< (/]< *a< *f< +o< (e]z< *~< *< (iy< *< *<p< (<<=6=T= (o= (u|= (= (L<= (Y= (|n== (= *= * = (= *8= *2= (L= *]= *W= ( > * > *y> (_2> *!> **>d4>dQ> *U> *^>dh>d> *> *>d>d> *> *>d>j>j? *? *?j?j3? * 7? * @?jJ?jc? *g? *p?j?{?{? */? *-?{?{? *A? *??{?{@ *S@ *Q$@.@ +?@ *gC@ *cL@V@ +h@ *l@ *~q@@F@Y@d@@ (3 @ +A (A *A *A (L<#A *'A *7A *3;A *)@A (KA *yOA *kTA (_A *cA *qA *uA *zA (YA *A *A A +A A +A *(A *$A *DA *@A *\A *ZA *mA *iB B (B *,B *6B @B +LB *PB *UB +fB pB +B *B *B +B B B *B *B B B *B *B C C * C * *C + /CD DC`QCP[ClC({C (ڜC)C (C *%C *C)C)C (8C +D *Q D *ID (D *D *~"D (_2-D *1D *AD *ED *JD (2JUD *YD *iD *\mD *VrD (pa}D *D *D (D *D *D (FDD + D (9D *D *D +0 D (>D *-D *%DD +B D (E E (lE (9&E *d*E *V/E +c 8E (~oCE *GE *LE + UE (>`E *dE *iEq$wE8E$E&E`E'F~)1F;FPF_F +hF (9sF *wF *|F +F (>F *;F *5FFF *^F *\FF#F +F (G G (lG (9%G *r)G *l.G +7G (~oBG *FG *KG + TG (>_G *cG *lG!$vG!$G!$G$G$G$G $H9$1Hl)RH\HqHH + H (9H *H *H +1 H (HIH (lH (9H *H *HH (~oH *H *I(I5ICIbIDIeIeIjIoII ( I (5WI ( J (5WJ ( 'J (5W5J + >J ( KJ (5W\JJqJ ( ~J (5WJ ( J (5WJJ +J *\J *8J *J *J +J *J *J *J *KK +y"K *&K *a/K *(3K *8K +yAK * EK *XK *!\K * eK *"iK *!rK *,#vK *&#K *o#K *M#K`K +K * $K *$K +K *'$K *$K *Q$K *K$K`K +K *n$K *l$Lm Lm.LmDL +QL *$UL *~$_LiL +zL *$~L *$LL +1L *$L *$LL +AL *$L *$L +AL *$L *$LLMM *$M *$(M *$,M *$5MMMWM +QmM *$qM *$vMMMjMM +fM *!%M * %M *%M *%N +f N *o&N *?&N *!(N * (%N *()N *(2N *)6N *(?N *)CN *)LN *[*PN *=*YN *+]N **fN *+jN *+sN *,wN *+N *,N *,N *6-N * -N * .N *-N5NC)N9N +N *.N *.N *&/N */O *f/ O *\/O +O */O */$O * 0(O */1O *F05O *<0>O *0BO *w0KO *0OO *0XO *0\O *0eO * 1iO *0rO *W1vO *K1O_'O +O *1O *1O *1O *1ObO +O *1O *1OiO ++OiO += PiP +O%Pb/PbKP *1OP *1XPbmP *1qP *1|PxPxP *2P *2PPPPP +a QQ3Q=QWQaQ{QQQQCQ,Q6'"R'?RK)YR +sfR;{R +R *-2R *+2R;R +R *?2R *;2R *k2R *g2R +R&R 'RpR S +S(0S(IS *2MS *2VS(`S(yS *2}S *2S *2S *2S(S(SSSgS +S *2S *2S *3T *2 T *13 T *'3T +T *d3T *\3(T *3,T *3U *3BU *3KU UU +bU *3fU *3oU *4sU *4xU +U# U UE UU@U U U * 4U *4V V!)V!FV */4JV *-4SV!]V!vV *@4zV *>4V!V!V *Q4V *O4V!V!V *b4V *`4V!V! W *t4W *r4W!$W!=W *4AW *4MW5!WW5!tW *4xW *4W5!W *4W *4W *4W *4W5!W5!W +W *4W *4W *4W *4X *4X *4 XS!=X!GX + ]X *5aX *4jX!tX + X *5X *5X!X + X *85X *45XR#X +2X *Q5X *O5X *b5X *`5X *v5X *p5Y *5Y *5 Yt#7] *<7] *P7] *N7] *b7] *`7] *t7] *r7]^ *7^ *7^^2^ *76^ *7?^ *7C^ *7L^ *7P^ *7Y^ *7]^ *7f^ *7j^ *7s^ *7w^ *7^^ +^ *7^ *7^ *7^ *7^ +^ *P8^ *J8^ *x8^ *p8^^_ +_ *8_ *8_ *9_ * 9)_>_ +G_ *19K_ */9Y_q_{_ +_ *G9_ *?9_ *9_ *x9_ +_ *9_ *9_ *:_ *:___ +_ *:` *: ` *: ` *:`S,` + 5` *:9` *:G`~_`Si` + z` *:~` *:` *;` *;` + ` *Y;` *I;` *;` *;` *;` *;` *<` *<``f`fa *E< a *C<afaf6a *V<:a *T<CafMaffa *g<ja *e<vaa +1 a *z<a *v<a *<a *<a *<a *<a +1 a *<a *<a * =a *=a(a +F a */=a *+=ab%b *G=)b *E=/b=bPbZbwb *V={b *T=bbb *g=b *e=bbb *x=b *v=bc +X c$c +j 1c *=5c *=>cHc +j Uc *=Yc *=bc *=fc *=kc +j tcc cccc +| c *=c *=cc + c *>c * >cdc%dPdhdd(dxd%d%d*dTd + e *3>e */>e *I>e *G>e *[>"e *Y>'eYGesneV{eSeee(e + e *r>e *j>e *>e *>e + e *>e *>f *>f *>ff + -f7fOfbflfff + f + f *?f *>ff + f *?f *?f + ffgg&gCg */?Gg *-?Qg,"[g + lg *B?pg *l *CBl *CKl *COl *CXl%bl + rl *Cvl *Cl *Cl *Cl *Cl *Cl + l * Dl * Dl%l&l + l *(Dl *"Dm + m|&%m + 2m *CD6m *AD?m|&Im + Vm *UDZm *QDcm *Dgm *Dlm + um@'mZ'mmm + m'mmm))m + n *Dn *Dn))"n + /n *D3n *DyZyyyy (|Kz@z (%z *8H)z *0H/z (t9z *nH=z *^HBz (GQz (L<az (lkz *Hoz *H~z * Iz *Hz (z *IIz *;Iz (Wzz (z +z (t)z *Iz *Izz { (t){ *I!{ *I'{ <{ (0J{ T{ +k{! u{ +{ *I{ *I{ *I{ *I{ *5J{ */J{ *`J{ *\J{! {! { *xJ{ *vJ{* { +%| *J| *J | +%|2| J| d| q| | | |U | (| (| (l| (H}P}`(} (o4} =} (*I}Xj} (=N{} (} (>x} (} (@} (H}} (t)}@} (o}} (* ~`~ (B&~ (2~ (lJ~ (WV~ ('pb~ (_2n~ (Hx~~ (t)~ ~ (o~`~ (*~h~ ((~ (l~ (B  ( (Cd> ( P (^ (rp (~ (?g ( (Jp (  (Q} (d (+ (J (e (: (w" (3 ()@ (M (GY (we (q (,~ (+ (w ( (RȀ (ـ (s ( ()  (U (> (% (7- (M? ( mL (Z (`i (:{ ( m (I (P (6l ( (΁ (n (u (`q  (u (Y' (@3 (W? (yM (!Z (Pv ([ (w (9` (,hʂ (Rׂ (C (r ( (  (5W (. (r< (S (,i ({ (;P (-  (Z (K ( (K̓ ( ڃ ( (F (6q ( (;P$ (= (I (FW (oa (Or (K ( (F (J„ (΄ (F ( (], (q9 (6\ (6v (9 ( (OӅ (9 (C  (wa% (XJ (kh ( (YM (ğ (a (4 (H ( m (P|+ (8 (E (IR (d (us ( ( ( (հ (@ć (/=ԇ ( ( (5' ( (ϩ (. (= (M ((] (Am (Z} (9 (R ( (g (% (vɈ ( ^ш (^` ( m ( ( m (5 ( mB (w_ ([l ( ( (  (AZȉ (tG։ (9 (mO (=E ( (Z( (: (L (Z (i ( ( m (C6 (D ( mÊ (Yފ ( mp  *J *J *K *K% *XK) *TK2 *xK6 *nK? I +7Z *K^ *Kh r +G *K *K *K *K  +W * L *L *!Lċ *L͋ *9Lы *5Lڋ  +g *RL *NL *jL *fL *L *~L +g  *L$ *L) P g q  *L *L   ، *L܌ *L *L *L   +w* *L. *L7 * M; *M@ +wO w  (WK (WK %  ( )  )_  + &=č (h ( ( (5 (s (~6' (1 (? (`D (8R (4W (p (r:| ( (ׄ (= (zY ( (( (06 (!v; (5G (S (2_ (k (BOw (4r (! (  (^ ( (\xˏ (-ҏ (׏ (  (U (3 (F (q ("_ (2 (eZ7 ("C (O (3N[ (Dl (zx ( (G (] ( (q (% (u̐ (ؐ (; ( ( ( (% () (W7 (M`Q (W_ (yk (#x (ZC (p ( (Q (|ő (ZCґ (N (E (ZC (H (` (c#l ( y (M (| ( (M (|͒ (nے (t) (9 ( ( (X! (S/ (Ѕ= (ZCK (Y (g (BRu (\% ( ( (  (5 (4ʓ ( ٓ ( ( (t) (%B (; (gR- (@; (I (W (ue (s ( - (St (@ (uL (˔ (-5ڔ (L (8 ([ (G (i1% (D (iS (7b (/q (ǂ (T (p ( ( (˕ ( ڕ (k' ( ( (  (X% (p4 (-xC ( R (?;a (p (+ ('` (WT (3 ( (gʖ (Jٖ (I ( ( (? (j$ (3 (B (7Q (|` (wo (P~ (f ( (q1 (- (ɗ (*jؗ ( ( (h+ (vS (Fo (wq} ( (k ( ("O (h (v ( (! (y# (&0 ( = (J (X ( ('̚ (ۚ ( (g (t  (  (9. (2Q (\] (k (z ( (69ƛ (mBӛ (V (, (y  (Z (?0 (< (PH (ZCU (b (t o (J ( ( (gt (H=ל (1 (65 ( (AV ( ) (da7 (E (T (Bc (9~q (Q ( (c} (< ( (! (0 ( ? (N (Uu] (<9l ({ (8  ( ({v (7 (Ɵ (՟ ( (_ (6 (s (  (/ (t> (:,M ( \ (Ak (Ez (p" (: (1 () (Š (sԠ ( (] (w (RO (u*. (= (mL ([ (1-j ([y (Ps (~ (.= (c (ȡ (ء (@ (ow (7j (c (~( (c8 (TH ( X (h (2x ( ( ( (FŢ (-Ԣ (> ( ( (A (_ (sG. (x:= (_L (:N[ (pj (y (CB (I ( (/ (!ģ (<ӣ (y  (w (< ( () (- (< (f>K (ZZ (HGi (x (M4 (i (3 ( (4UĤ (Ӥ (6y ( (  (L (, (; (J (SY (h (w (V (G (P (2 (w¥ (@ѥ (3 ( (k (t  ( (ox+ (e: (`_I (*X (Ag ("{v ( ( (N  (E ( = (;Ц ( ߦ ( ( (e  (H (* (t&9 (B>H (օW (Of (~0u (Hp (- (e, (# (. (>ϧ (ާ (L (F  (j|  (6L (() (^08 (%<G (3@V (e (Rlt (< ([F (" (p- ( (7Ψ (ݨ (Y (Q (&  (tV (e( (8 (G (V ([e (u#t ( (#l ( ( (< (~Ω (jJݩ (R (I{ (  (B (7) (18 (9G (V ("e (e{t (# (@y (Y (f (M (Ϊ (ݪ ( ( (J  (-  (( (&Z7 (F (6U (d (8s (>k (*T (& (># (BFΫ (N8ݫ ( ( (Em  ( (8( (7 (~F ( U ([d (&s (wi ( (WW (g (R¬ ((Ѭ ( (? ( (M% (&U4 (ƅi (:w ( (i! (D (7R (^ (3٭ ( [ (>P ( (1z (! (/ (i= ( K ( :x ( (F (  (,$׮ (rr (U ( ( (%-* (v8 (G (fLU (c (q ( (. ( (Y (f (vTů (iӯ ( ( (2 ( ! (BO (c (Cx (sF ( ( (HѰ (߰ (PG (< (*{  (= (,' (M/ (: < (@J (x9V (c (6p (PJ} ( ( (@ (y (< (%۱ ( (Fg ( ( (R/ (^; (}H (U (b (i}o (| (k (u  (k (yIJ (*OԲ (Xڲ ( (h? ( (< ( (Z! (Q. (; (H (o` (gpm (Gz (+H (/ ( (1γ (y (x (vt (Ѕ$ (J2 (I@ (N (\ (Iaj ( x ( ( ( ( (aM (̴ (πڴ (p= (oU ( (} (6  (8. ($< (~zJ (rX (R)f (t (u (Co (T ( ( (eȵ (ֵ (6 ( ( ( ( (y- (: (R;^ (j (9v (f ( (ZC (f¶ (7$϶ ( ( (~q ( (`  (-F  ( (q (Ld (# (oS) (=/ (5 (Q,; (KA (aG (5M (9|S ( ,j (!{ (> ( ($ (  ( (dǷ (ͷ (8ӷ (}ٷ (߷ (# (g ( () (  ( (^+  ( g (V ( (.! (t@' (- (3 (NB9 (? (^cE (L (fY (t)f (s (_A (<+ (! (( (θ (=ܸ ( (jR (4_ (^v (w (%% (m (5z (" (4 ( (Pغ (!@ (4M (kZ (jg (t (7 ( ( (ڻ ( (4< ( ("# (2 (juA (P (p (; (H ( ( ( (1ּ ($ (0 (/ (4< (L+ (; (bK ([ ( Fk (={ ( ( (U (}gŽ (Kӽ ({u ($ ( (A   ( (f. (; (H (0 (h ( (w (yľ (u Ѿ (޾ (i} ( (% (X (# (0 (Q> (K (ZCg ()s (J ( (˿ (ۿ (x (n (\ ( (y (3+ (p8 (T (J` (&r (, (M (| (p ( ( (4 ((l (uR (M (|! (4 (.@ (5L (Y (Ff ( (9~ (y ( (^v (^` (  (N  (t" ((5 ({E (/K (Q (XW (] (?-d (i (PYv ( (1 (\ ( ( (B (S ( ( (@ ( (09* (Ѕ7 (Q (?_ (l (sy (b (m (E (" (. (] (O (E ( (O (-~ (" (k, (: (82G (OU (e (k (Mr (@ (k (Q (i} ( ( (/ ( (O! (  ( (!) (pC (4P (d] (@{j (\#} (q (z ( (i} (y (ox ( ()t (M  (- (F: (RF ( S (ta (m (3z (>} (6 (@y ( ( (p (  (F (\:' (y3 (D (-lQ (Y] (Lj ( ( (4 (\ (e ()y (x ( (4 ()y ( (4, (.9 (!F (Wh] (5j ([w (b4 (' ( ( (4, (q` (dO ( ( (  (k;) (ysF (j (>w ( (N ( (t ( (" ( (, (e (^t  ( (l$ (2 (F (4R (P$\ (9i (v ( (  (> (va ( (  (& (A (Cf (\# (gE" (/ (= (J (,W (\#d (0r ( (i (( (Sa (z (2 ( (E (UF (4 ( (x (`@ (* (>8 (E (R (8_ (m} (M4 (9 (09 (S/ (#l ( (P (w (y ( (~+ (8 (mF (R (_ (m (y (7A ( (! ( (6 (:c (  (i& (- (w; (!I (<W (6f ([w (x} ( (j (ka ( (< ( ( ( (! (< (y  (s ('# (Y 1 (Gb? (QN (\ (X=j (y (G (! (Y& (3 (  (P (3 (? ( (G$ (a (# (.1 (8? (OM (i[ (<i (kZw (z (= (V (, (> (& (B (y (  (H (g( ( (u- (p; (|I (OW (e (s (41 ([ ( (W (> (|5 ( (> (h* (  (u ("I (PQ, (': ( H (V (Ed (r (  (  (q (* (my ( (3 (nG (9 (3 (! (+ (9 ()G ( U ("Ic (iq (H (2 (U (E (6 (]  (&6 ( (+? (6 (>* (y8 (~H (X ( h (x (E ( (W< ( (X (t ( ( (B (9 (G (=V (#~e (dt ( (V ( ( ( ( (- (ZC (& (' (K (1JU (c (q (: (Tm (a| (8p (R ( (R (2 ( + (y (  (m (d' (jj5 (ESV (c (p (6} ( ( (Q (,R (A ( (W ( T (( ( (K (tX (ye (-2r ( (# (0 (6f (l (K ( ( ( (e ( (f~$ (p@ ('N (i\ (!j (<x ($s (3 (y  (V (w () ( (y ( (Z (HG (  (<. (< (J (`1X (k&f (i=t (Q (t& (  ( ( ( (Di (= (V ( ( ({ (EK* (> (jK (VvX (e (r (_ (k (>w (; ( (B (% (( (> (H (w (" (O+ (P9 (M (W (d (q (f~ (K (6 (Y (7 (9O (W (e (( (> (D ( (ʄ (3 (2M (W (<a ( ( () ( (, ( ([K ( ( ( (; (DQ (`  (- (": (G (TT (Ga (yo (} ( (Y (m (6 (* ( (v (. (' (a$ (2 (2@ (N ($\ (`j (x (G (' ( (M (' (_ (QN ( ( (my" (!6 (rC (5P (H)] (p (3K} (ZC (R; (0 (y ( (!: (ET ( (U ( _ (+  (~ (  (#3 (aA (~/O (] (k (ay (& ( (' ( ({ (Q (Z ( (P (  (>H (N& (.C (zP (] (Z~j (sx (? (c (yw (| ( r (t) (7$ (  (wx (6{  (u3 ('? (X (^He (,r (#J ( (  (2 (%. ( (K- (W (" (E  (T2 (0? (L (Y (iUf (q6s (Fq (fy (c6 (w (I< (| ( ( (` (b ( (y (, (9 (zG (|y{ ( (6 ( ( (u (fW ( ( ( (^ (.a ( (6L (GjY (>f (Bs ( ( (9 ( (` (c (Y (6 (} (Bu( (B5 (B (.O (X+b (2}o ( e ( (; (y (k ( ( ( (6 (1 (EN (> (B+ (8 (E (qR ($_ ( Cl (ky (5 (S (6 ( (= ( (9 (: ( ($ (: (G ($KT (k (otx ($K (D ($K (D (h (( (PZ (s ( (O( (5 (,C (S (Y (_ (be (l (| (Z (P (: (~ (z ( ( e (  (  (  ( ( (Q4 (A (zN ([ (c}h (Mru (с (% (ZC ( (q (J ( (S (S () (66 (C (P ((g (t (i ( (y (6 ( (&g (T (E (u ( (&g (Z~ (05 (O1B (O (2\ (i1i (v ( ((M ( (T (k8 (^ (M (06 (B (| (+ (% (P2 (cZ (]of (g| (! ('F (o. ( (O. (  ( ('k (" (r9 (PF (^hT (Ja ('{ (W ( (y () (Ѕ ( (E (#  ( %F ($] (Pk (c ( ( (y (o. (! ( %  (Z (?6 (,O (5b] (+k (yky (  (U ( (x (5: (>b (3 ( (Z (g  (i 9 (&G (9>U (6x (>: (\ ( (Fg (, (d (@ (x ( (T (x- (w; (<I (<W (<k (0y (s (\a (h (M  (0 ( ( (YY ( (t) (4l, (6; ( I (pW (}e (s (n (%# (> (Q ( (OR (O (B( (2 (@ (πN (E+\ ( j (zx ( (> (S ( ( (/i ( (3 (t) (), ( (5 (~C (p_ (z (O} ( ( y (#y (d ( ( (y  (\ (fs4 (B (VP ( ^ (4l (<9z ( (u ( ( ( (H (C ( (( (q (R (]% (/>4 (C (9R (ca (p (2 (G (!! ( ( (u ( ( (q (e ($ ($3 (B (-Q (s` (.fo (y~ (s (j (Ѕ (Q (9 (  (y (Mc ( (@ (Up# (2 (A (P (s_ (_n ( } (X ( ( (. (d (D ( (( (yX (f (, (u3 (h (a ( (@ (u (P (]/ ( * (" (R ({ (.e (6Y (i ( (sE (?E( (&4 (eA ( N (M[ (F&h (xu (+ ( ( (s ( (t) ( (y (Tb (09 (.8 ( (6*E (R (_ ('l (q1y (9 (j ( V (^ (] (h (x^ (~ (h (x^/ (; (~G (1yS ('A_ ("k ({  (9 (V` ( (k7 (hV (" ( (+ ([] (4 (_O (S([ (g (met (e (7 (G} (n (0 (e7 (I (u (O ( (} (E5 (iB (QP (G] (ZCj (N (6 ( ( (z  (n ( (/' (t)C (O (6l (x (} (W (N' ( (# ( ( ( ( ( ([ ( (P  (:- ();A (@N (s ( (R (L (  (O* ( (# (N ( (  (  (^  (0  (*>  (V L  (gdZ  (Oh  (%uv  (  (C  (x  (  (   (^  (=  (  (l#  (  (~  (1  (T,  (n:  (&H  (?V  (bd  (}r  (>C  (&|  (~  (Ve  (N  (:  (  (N@  (a  (]  ('  (Y7  (KN  ()]  (F6l  (d{  (  (_=  (Z  ([  (  (  (  (;  (  (  ($  (ZM1  (I>  (~K  (.X  (mp  (+  (@  (o  (7  (  (J  (Yw  (\  (m  (F`  (  (>  (['  (5  (LC  (VAQ  ([_  (Wm  ({  (7E  ((  (  (S  (5  ((  (V  (T  (k:  ( (Z@ ("Q% (4 (DC (AR (Gb (-q (? (d (b (O ( (/V ( (N (z (p (6X (% (4 (C (R ( a (p (' ( ( (4V ( (  (a^ (v (F (ps (m& (gH; (K (tQ (-' (4 (gA (N ()K[ (, (= (N' (" (a| (& (\, (#y: (G (3hT (na (zOn (B{ (y ( (W (T ( ( (t) ( ( 2 (L? (kL (Y (8f ( (6 ( ( (6 (& ( (hC (?O (\ (6i (v (? (J (m (y (X ( (n ( (` (Z~ (f (, (.8  (. (/8 (dD ( LP (9j ( (K (C4Y (`'f (s (I ( (! (< (E ( ( ( (J (ZC (-2  (' (% (X (b ('| ( (= (3 (J ( (3 (G (h (K ( ( (" (/ ( = ( (g (j (4 (0 ( O (}  ( (y$ ( 3 (XA (bO (j] (&k (6y ( (M| (t (a  ( ( (i (wj (2 (h (U' (s0! (/ (= (QK (h (rw (( ( (H ( (O (- ( ( (  (h (O* (9O9 (LfH (W ( `f (Zu (k (6B (0 (G ( ( (H (3 (  (>  ((  (9E  (EU  ([d  (Ds  (i  (   (^X  (,P  (x`  (j  (x  (, ! (1 0! (b&x4 (*v4 (M)4 (I34 (=4 ( K4 (FgY4 (6u4 ({4 (T4 (T4 (H4 (4 (04 (O4 (S4 (5 (.A5 ((5 (7C@5 (JN5 (D[5 (zh5 (5 (S5 (r5 (c5 (5 (j5 (5 (5 (6 (q6 (|$6 (26 (.@6 (vIN6 (m\6 (wj6 (Ktx6 ({F6 (6 (e6 (DJ6 (i6 (Nw6 (6 (6 (9 6 (7 ( ?7 ([ 7 (.7 (R<7 (U"J7 (zX7 ({7 (X7 (7 (W7 (T7 (7 (<7 (}7 (7 (8 (Dc8 (^Q8 (J,8 (U_98 (F8 (S8 (`8 (;m8 (!z8 (8 (8 ( V8 (8 (58 (8 (T>8 (B8 (u8 (8 (H9 (>9 ($9 (N9 (9 (9 ( 9 (PG: (U: (+c: (dq: (!: (b; (vJ8< (cz< (s< (1E? (M@ (gY5@ (GP@ (Ix@ (F@ (@ (9@ (}HA (^B ((I)B (&kB (&U (vDU (V5QU (j0V ({;V (V (V ( V (MV (qV (mV ($ W (-7W (#W (ZC0W (=W (MJW (cdW (yqW ( x~W (rW (t)W (W (ELW (MqW (W (9W (X (oUEX (+SX (aX (D!rX (DX (X (AX (s%X (X (7X ( X (xX ("X (X (X (_ Y (Y (3&Y (my3Y (&@Y (MY (PZY (hgY (~tY (wY (BY (6Y (Y (%+Y (xY (Y (tAY (]Y (bY ()Z (gZ (4$Z (2Z (i4^Z (lZ (8`zZ (WZ (ЅZ (t)Z (hZ (K+Z (Z (.Z (!(Z (fZ (c [ ([ ($[ (y<[ (' c[ (p[ (:}[ (q[ ([ (v[ (g[ (c[ (?3[ (cF[ ([ (M[ (1[ ({ \ (\ (&\ (K3\ (N@\ (wM\ (fZ\ (Fr\ (\ (\ (\ (:J\ (\ (\ (w\ (B\ (09 ] (@(] (6Q(] ($7] (]bF] (ud] (ms] (5] (x] (`] (] (p] ( ] (] (] (A] (l ^ (^ (`j'^ (;D^ (4S^ (b^ (YJq^ ( E^ (oU^ (R^ (^ (^ (i^ (d^ (w.^ (O^ (9. _ (_ (2(+_ (!F_ (H3S_ ( l_ (6_ (w_ (_ (_ ( ra (xa (=a (ka (@a ($a (qa (ga ($a ()b (qb (,|)b (r6b (Cb (kPb ( 4ib ("vb (b (8b (.b (Lb (b (|}b (^?b (\b (t)c (c (c ( s*c (8c (QFc (%Tc (bc ({pc (,r~c (c (c (fc (c (&Nc (Jc (2c (<c (Cc (lO d (0d (S&d (4d (Bd (]Pd ($^d (ld (4zd (Nd (akd (nd (ud (yee (d f (J.f (>f (mDf (Jf ()[Pf (w+Vf (U\f (Ubf (if (uf (kf (Wf (f (5f (Bvf (f (af (\#f (t)g (g (r+g (8g (yEg (KRg (8_g (lg (yg (Z~g (#g (g (Kg (g (g (Qg (L h (=h ($*h (9h (kHh (+Xh (Sfh (6th (h (UUh (h (h (h ( ,h (h (+h (#h ( i (:i (i (F*i (8i (Fi (Ti (Li (i (8i (^i ( i (")i (>i (i (i (6 j (8j (T&j (mT4j (q1_j ( (oj (uj (R{j (yj (3qj (Oj (j (@*j (5j (j (j (j (Cj (!j (Xj (6j (!Ej (*j (j (=j (Fk (Q!k (B;k (SNk (\k (t)jk (xk (p!k (Z~k (Dk (k (t)k (l (=l (ZC"l (R/l (t) o (o (3'o (w65o (mo (3o (wqo (o (W!o ("o (o (Wo (go (p (8p ( )p (W!7p (Ep (BSp (o$ap (Bop (|p ("}p (Pp (8p (p (Wp (~p (q (q (q ("+q (K:q (Oq (i [q (-cqq (_J}q (_q (Z~q (q (\Zq (q (Gq (yq (Cr (r (Tr ( +r (kBr (+Nr (^V[r (Inr (Mr (Er (=r (r (fr (jr (1r (Z~s (s (3s (*s (iWs (ves (ss (oQs (Ps (s ([Ns (As (S7s (s (4s ( t (>t (y't (6*5t (Qt (L_t (^?mt (${t (@t (ht (Z~u (=Ku (!u (.u (1u (C v (v (6Q%v (w2v (y@v (0Zv (gv (v ("v (+sv (v (Vv (`v (yv (Jv (v (m%w (P w (/w (!(w (!6w (Dw (Rw (5+`w (-nw (<|w (w (w (w (w (Kw ({w (w ({w (w (sx (x (\r$x (.2x (v=@x (Nx (Fx (rx (.x (Ux (Dx (x (Cx (3;x (fx (x (@x (H#x (sHx ((x (6y (y (y (-y (!;y (fJy (bTy (|cy (zqy (Sy (+y ( y (}y (`y (tpy (y (ty (y (Ђz (fz (6#z (z1z (?z ('Mz (W6]z (mz (B}z (Rz ( vz (z ( Cz (&z (9z (-z (z (l{ ({ (@  { (q<0{ (@@{ (P{ (U*`{ (p{ (Ƀ{ (8{ (|{ (_S{ (G { (c{ (W{ ({ (`w{ (a| (k| ($| (3| (:B| (K~Q| (G:`| (7o| (\| (0| (t)| (z| (6| (| (| (&| (m^} (6 } (%} ()} ([6} (nC} (m[P} (r]} (IAj} (} (d} (_} (,:} (Z} (} (~ (1~ (~ (u*~ (8~ (%u~ (~ (t)~ (x~ (\~ (~ (X}~ (O~ (~ (7~ (u~ ( ( ( (w.+ (8 (E (IR (]_ ('x ( (2 (t) (Ѕ (Z (D (3# (]g  (y (7& (u3 (@ (M (Z (g ( Et ( ( (YJ (t) (Sj (  (d- ( : (@G (mfT (^8a (/4n (I{ ( (-G (t) ( E" (/ ( < (oU` (3#p (v (w| (= (Z (K  ({ (wU& (4 (|C (T ( YZ (I` ([If ("m (1~ (X (j (2 (3" (N ( ( (;σ (^vރ ([ ( (Z~  (+ ($ (T* (0 ('6 (< (B (aH (ԀO (` (f (l (s (6 (Ae (I ( (b (e ('d (\-τ (N (W; (}  ( (18 (nCB (RL ( [ (7i (u (G/ (% ( 0 ( (&h ( ƅ (^vڅ (x (   (s (Z~' (W4 (A (N ([ (v (w{ (6 ( ( (_U (eņ (gQ҆ (T߆ ( ( (; ( (6* (u8 (5+F (-_ (l (?%y (6 ({! (5 (= (3 (1gԇ ( (] (Y ( (L (&8# (1 (? ( M (d[ (}i (Ow (, ( (I (*L ( (7Ј ( (3I (XR0 (%>= (6J (W (d (sq (:~ ( (x ( T (w (CƉ (Ӊ ( ( ( (=m  (p- (: (G (" (: (W ( (Z (E ( (a (< (]ʊ (y׊ ( (| (" (Y  (/ (!% (3 (CA (hO (π] (oUk (y (aM (z (u> (9 (v (!w͋ (ۋ (G (  (r' (Ѕ ({! ( ?: (mD (S (5/] (g (u ( (j ( 0 (S (s (i ͌ (ی (i (y (d (n (A! (:/ (S^= (}K (Y (wUg (gu (F  ( ( 6 (}, (e (ɍ (E0׍ (. (Pz (= (a (" (f9+ (9 (+G (IPU (Bc (Jq ( h ( (b ( (U (Ŏ (=lӎ (J ($ (R (<  (K? (J (X (f (t (+ (F (` (y) ( (Mɏ (Hӏ (KVݏ ( ( (C ( (z (P (+ (B: (WK (aBQ (X$W (U (D ({ (*' ( - (*'3 (9 (`? (E (YK ( Q (qW (F^ (/k (x ([ (/ ( ( (kɒ (_֒ (74 (  (:g (Q3 (@ ( M (WZ (U2g ( (B ( (G (Bʗ ( (R (  (^v (t D (-0R (` (n (f| (E ( (q˘ (~٘ (' (aK ( ( (t  (, (dm9 ( G (:T (:ga ( z ( ( (7 (Qș (ՙ (+ ( (Q (W ($ (>1 (:gJ (W ( d (Qq (U2~ (W (B ( (GĚ (њ ( (. (:g (  (Q* (E ( R (7_ (Ql (W ( (+ (; (Q (WǛ ( ( (> (:g (Q! (. ( ; (WH (U2U (v (B ( (G (Lk ( ( ( ( ( (f (E( (5 (q\ (hi ('v (aK ( ( (Lĝ (zѝ (ޝ ( (f (E ( (q4 (47A ('N (aK[ (h (v ( (x ( (Þ (fО (Eݞ ( (q  (H ('& (aK3 (@ (N (F[ (zg (.s ( (& (_ (c (  ( (- ( ɟ (NT֟ ( (Er (  (0  (L (Y& (4s4 (B (7Q (0^ (,x (  ( (d (k (z (ՠ (A (t (  (Nh (d' (K75 (BC (IQ (4_ (km ({ (" (1 ( ( ( (ϡ (ݡ (  (ok ( (l (/S# ( 1 (@ (O (90^ (n (`| (@ (  ( (-Ϣ (_ݢ ( ( (Z  ( (# (~m1 (HE (`e_ (l (/y ([K (G ( (1. (\#ǣ (֣ (c (, (0 (  (;" (y0 (qK (S(Y (F g (u (^v (_ ( (  (Y|̤ (n ۤ ( (_ (?Zl"u (C ( P  (så  (e   (W " (S/8 (vEN (F[d (cqz (` (@ (\ ̦ (٦ (  (^i (c$ (381O (\ e (Us  ( v (V˧  (9  (#  (jX, (R (>e (^} (r ( (] (6ڨ (? (! (r}F (Ha (G| (@ (7© ( ( (+ (tb4 (.K ({b ( (,! ($ (Oy̪ (E5 ( (4 (^ (D[~ (Q (M ( (a۫ (` ( (e (]. (lA (Pc (z (v (sy (Dɬ (1  (`  ( (3 (5P (k (N  ([ ( (Aϭ (,_ ( (s~ ( 9 (}O (k (W ( (  ( (| خ (g ( (6' (M (+w` (k ( EEǯ (XүEE ( (v> (K ( p (} (t ( (^ (&Y (\pɰ (~Nװ (^ (D (3@ ('p6 (~C (SR ( k (7` (q *CM *7M *Mű *Mʱ (9G *M *M *M *M  *N *N *\N! *RN/ *N3 *N8 (C *)OG *'OW *_O[ *7O` (uk *"Po *Pt (S (f;:  (c *NP *LPϲ (zeڲ *^P޲ *\P +  ( 4 (c *pP" *nP(99 (zeD *PH *PO2o J fʳ g 3 (~> *PB *PG (SR *PV *P_i *P *P *P *P *Pô *P̴ *Qд *Qٴ$ (~/ *"Q3 * Q8 (SC *2QG *0QPZs *AQw *?Q *SQ *QQ *cQ *aQ *uQ *sQʵ *Qε *Q׵ *Q *Q  *Q$ *Q- *Q1 *Q7U0j (~u *Qy *Q~ (S *Q *Q00 *Q *Qƶ *Qʶ *QӶ *R׶ *R00 *R *R **R *(R02 *i> p>> *B\  *@\) *X\- *P\6 +jC *\G *|\P *\T *\]>g +js *\w *\ *\ *\ *\ *\ *\ *\ * ] *] +j *] *]> +z *:] *8] *X] *V]> + *l] *h]' +0%?G +T"c)?m +| *] *])?>? +e? + *] *]e?l?I?I?6 *]: *]CI?XP?n?? 5"?? L"??!?> *]B *]K *]O *]X *]\ *]e *]i *]r *]v *]?? *^ *^ *^ *^ *+^ *)^?? *;^ *9^ *O^ *M^ +  *_^ *]^ *o^ *m^.$8$U *^Y *}^b *^f *^p, + *^ *^ *^ *^5 + *^ *^ *^ *^=h *^ *^h'hD *_H *_Q *_U *_^ *_b *_hu<  = \=  =+ 5>Q [>p T@  _ g@ !YB oLm }g ;;;'C<BV<P=]= >K> /@4@9@>@^@c@( = G9fsh ( + (BG *+_ *!_ (= *g_ *]_ ( *_ *_ *_ *_ ([K (G/ *T`3 *J`C *`G *`L (aW *`[ *`` ( p (-G{ *9a *1a (\ ( + (M@ ( +/ (D *^a *\a @ +/! *pa% *la. *a2 *a7 +/@FALgA]j w (3 (AA *a *aAA *a *a(A2 +AB *aF *aO *aS *a\ *b` *beBHB +Q */b *'b *ab *Yb *b *b *b *b *b *b *c *b +Q *4c *,c *tc *fc|B|B6 *c: *cDBNBk *co *cyBB *c *cBB *c *cBB *c  *c C C; *c? *cH CR Ck * do * dx C C *d *d +v!C + **d *(d!C + *3d@q e{3 { g394 L4   T48o4Y c>x Oh j8  (V (# (\-7 (3D M (Zz ( ( ( (W{ (\  (3@ (, (39B (O^ (3kt ( (3 ( ( (  (\P  (3- 6 (Cd (LjP1 *h *h *h *h (\ +@ ((g1 ()] +P (D *i *ig1% +P2 *i6 *i? *EiC *AiH +PQ1]1n({ Y1 +0 *bi *`i11 *ti *ri *i *i11. *i2 *i;1E1^ *ib *ik1u1 *i *i111 *i *i1 2)32JY2c +`s *iw *i2 +s *j *i82111 (i ( (  ([K* (G7 (NTD (a^ ( k (\u@ (3` ( (3 ( (nM` (]  (D4 (P (l (v1 (Ah (  (h  (n  ( u* (_ **j *$j (3 *Jj *Fj *gj  *aj *j *j- *j1 *j; (M*W*t *jx *j~* ] (r`* (_ *j *j (3 *k *k *#k *k  *Ek *?k *lk! *jk+ (=l*G + W *}k[ *yka*y V (B* (_ *k *k (3 *k *k *k *k *l *l *Gl *=l  ( *~l *vl& *l* *l/ (u: *l> *lI.+W (e +z (q *m *m** *0m *.m:+ aO+ a (Wp+& (_1 *Cm5 *=m: (3E *gmI *_mY *m] *mm *mq *m *m *m ( **n *"n *Zn *Vn (u *n *n+ (+ (q *n  *n|+|+: *n> *nD+Y ac+t a (:^, (_ *n *n (3 *o * o *Ao *7o *po *jo *o *o  ( *o *o& *p* *p/ (u: *Bp> *8pIN,W (e@,z (q *lp *hp , , *p *pZ, ao, a (CI,& (_1 *p5 *p: (3E *pI *pY *p] *pm *qq *q *Kq *Aq ( *q *zq *q *q (u *q *q, (, (q *r  *r,,: *4r> *2rD,Y ac,t a ( - (_ *Gr *Ar (3 *kr *cr *r *r *r *r *r *r  ( *.s *&s& *^s* *Zs/ (u: *s> *sIn-W (e`-z (q *s *s,-,- *s *sz- a- a (6-& (_1 *s5 *s: (3E *tI *tY *Et] *;tm *ttq *nt *t *t ( *t *t * u *u (u *Fu * *uD .Y ac.t a (D@. (_ *u *u (3 *u *u *u *u * v *v *Ov *Ev  ( *v *~v& *v* *v/ (u: *v> *vI.W (e.z (q *w *wL.L. *8w *6w. a. a (-W D"D1 (<Wa +q *Gwu *Ew~ *_w *]w *pw *nw *pw *nw *pw *nw +  (&/ ( (c! (ze1 (;z<.S (^ *wb *~wr *wv *w *w *w *x *w *.x *x (VK *px *nx +  (q *x *~x *x *x +  ( *x  *x +  (& *x* *x0 + 9 (D * yH *yN~0c (i\m +v (c *(y *$y +  (ze *iy *gyr/r/ *{y *yyr/r/ *y *y r/r// *y3 *y?/I/f *yj *ys/}/ *y *y// *y *y *y *y/// *y *y *z# *z,/D\0N\0k *zo *zx\0\0 *'z *%z\0\0 *9z *7zg0g0 *Kz *Izg0 R/-r/U/b/z0,07000 (m (q (; (u (S () (*5 (fA (M (0Y (f;f (7\t (P\ (>t ([ ( (Ni (@ ( (\ (~ (S  ( (<* (E (~Q (S_ (qp (}" ( (" (" ( + ( *ez *[z *z *z  (t) (q% *z) *z7 *{; *{H9Q +e *V{i *N{r9|9 *w{ *u{}99 s5 +  *{ *{ +& *{* *{3 *|7 *|FW:S +`{5u + *| *|{5 + *| *| *} *} +88H 0 6 ++ *1}/ *-}8 *N}< *J}A +N *j}R *f}[ *}_ *}d,6u   @6 +0 *} *} *} *} +0 *~ *~ *E~ *?~  *z~ *h~ *~ *~% *) *2j6<j6Y *!] *fj6pj6 *2 *0j6j6 *C *A66 *T *RI6b6 +6F S g]6w6  g6  (7 I / -9U _w0  YN7 +F *g *c * * +F * * * *\7 v  +C R7\7y *} *8 +` * *88 * *8 +p * * O8 +# *' *0O8:O8W *$[ *"eO8o +| *3 *15P 557  g77* 7 A7V c gm8z:8  O8u8 0 g8  W:% /e:F~:a k: : ::p ; E8( +7 *E; *AD *eH *_M +V *Z *c *g *p *ŀt *À}55 *Ԁ *Ҁ88 * *8 X 9% q/.9O wY69s9}9 * *5 \?9G9c99   .:-:H }R;` (q ( ( ( ([4 (9 *  * ( *8 *2 +_ (  *a  *W4! +o- *1 *: +G *K *T +f44 + *݁ *ہ44444 (SD$ (oh6 (W{D ((b (Ct (W{ (z (W{ ( (W{ ( (W{ (L9 ( (W{% ('C (cU (W{h (z (W{ (M (W{ (i (Z~ (\ ($  (0  (y  (r;  (0H  (yU  ( c  (u  (0  (y  (!  (v  (0  (  (M  (/  (y  (U  (  (t)#  (00  (+=  (yJ  (z[W  (e  (d2w  (9  ("5  (9  (y&  (9  (&  (#  (+  (1-  (: "E  (W  (6e  (  (  (  (  (M  (n/+  (*oS  (!%t  (  (   (?  (Gh  (0  (t  (?  (X  (q  (0  (@  (P  (`  (3l  (y  (9  (0  (?  (e  (  (bl  ({l  (l  (l (l (l# (3 ( m? ($mL (Ri (? (n (xo (o (o (o (o (o (p ( p (N (e9 ({E (?Q (E~z ( (wZ (.B ( (m (m (m ( n (#n (;n  (Sn (kn% (n1 (B (HO (* m (F (  (Ah (k ( ($ (0 (Y (0( (\> (0K (Lh (Du (Pv (v ( (hD (H2 ( ( ( (z (-  (z (S# (p/ (ZC< (QDF (M^ (k (P (p (ZC (:D (& (z (p (ZC (& (p (ZC, (98 (I ( DS (#D] (fu (0 ( (  (0 (1 (0 + * * * *  */ *' *` *Z& ** */+ED Q bVz  + * * *ł * * * *$ * *L *D{E v u) = ( A (/ G (K (t (Zx (X~ ( (D" %0 (ˡ ) ) &o ( (θ ( ( ( (h ( ( (  (h& (T+ (3C (ZO ()] (b (p ( ([ ( ( (: (t ( (h' ((3 (? (K (W (lc (v (} ( ( ( ( ( (D (Z (` ( (q (! ( ( ( (2* (6 (B (FN (Z (f ({ ( ( ( ( (  ( ( (P ( ({  ( (B (DO (\ ( (7 (ľ (ʱ (= ( (ʞ (= (  (P (k' (5 (C (Q (K_ (m ("{ ( (M (W ( (˿ (J (1 ( ( (g (y (% (؈3 (kA (O (] (4k (7y (% ( ( (T (V (r ( ( (%  ( (' (6 (E ( T (c ( ( ( (ߪ ( ( ( ( (^ (  ( (-' ( 6 (E (xT (c (?r ( (M ( (~ ( ( () ( (/ (x ( ((& (5 (D (S (ob (Wq (M ( ( ( ( ( ( ( ( (  ( (|& (%2 (h ( (p ( ( ( ( (H  (M  (Z  (!! (ǽ@! (+`! (m! (jz! (:! (@! (! (q " (F" (Y$" (0" (d>" (dM" (Ds" (" (" (+" (" (e" (" (Z" (" (X# (# (/# (9# (dF# (Z# (w# (# (# ( # (M# ( # (m# (# (R# (P$ (-$ ($ (-$ (;$ (I$ (+W$ (Be$ (s$ ($ (͚$ (\$ ($ ($ ('$ ($ ($ (i$ ($ (8% (G% (RV% (<f% ( u% (% (Q% (a% (% (ڇ% (% ("% (/% (% ( & (h& (*& (9& (H& ( W& (f& (u& (& (ש& (& (& (~& (p& (2& (& (=& ( ' (' ()' (h8' (G' (V' (Oe' (t' ( ' (' ({' (x' (' (' (' ('' (~ ( (( ((( (r8( (H( (DX( (ǘh( ( x( (( (B( (%( (f( (.( (S( (( (\( () () (() (X8) (G) (e) (t) () () () () (Ւ) () (`) () () (f * ("* ((* (7* (ӎF* (U* ({d* (s* (* (ٮ* (* (ʈ* (* (* (* (* (* ( + (+ (%(+ (7+ (F+ (SU+ (d+ (s+ (U+ (!+ (+ (+ (+ (+ (+ (+ (R, (0, (b&, (5, (ED, (rS, (8b, ("q, (, (F, (, (c, (Ҧ, (, (V, (w, ( , (F- (_- (ۘ%- (k4- (C- (+R- (a- (p- (ƪ- (- (- (چ- (i- (- (- (- ((- (. (. ($. (3. (B. (Q. (`. (o. (\~. (,. (,. (. (. ( . (. (H. (. (C/ (/ (:#/ (&2/ (A/ (P/ (ő_/ (n/ (}/ (9/ (/ (/ (c/ (r/ (7/ ("/ (»/ (=0 (־0 (#0 (20 (A0 (aP0 (^_0 (n0 (}0 (0 (0 (0 (00 (K0 (k0 (0 (B0 (S1 (1 (v#1 (_21 ( A1 (P1 (_1 (n1 (}1 (1 (T1 (1 (1 (T1 (n1 (#1 (1 (݈2 (2 ("2 (12 (P2 (_2 ( n2 (7}2 (2 (2 (=2 (2 (\2 (2 (2 (2 (23 (֪3 (#3 (ˇ33 (C3 (?S3 (Νb3 (q3 (3 (3 (3 (3 (3 (3 (4 (4 (#4 (14 (?4 (cM4 (Mi4 (w4 (4 (N4 (4 (4 (4 (4 (4 (#5 (g5 (#5 (^95 (%S5 (Oh5 (v5 (5 (75 (r5 (&5 (65 (5 (5 ( 5 (&5 ( 6 (>6 (%6 (36 (?A6 (O6 (g6 (t6 (r6 (ܱ6 ("6 (g6 (6 (.6 (#7 (57 (H7 (V7 (b7 (o7 (g|7 (7 (G7 (7 (Ѱ7 (c7 (7 ([7 (t7 (7 (7 (8 (x8 (+!8 (1/8 (K8 (Y8 ((g8 (u8 (8 (y8 (f8 (8 (8 (g8 (8 (8 (8 ($9 (z9 (+09 (PA9 (QG9 (jM9 (HS9 ($Z9 (7g9 (9 (9 (|9 ( 9 (N9 (9 (29 (9 (b9 (: (.: (;: (+b: (u: (: (": (: (8: (: (: (R: (: (: (8; (; ( ; (+; (b9; (pG; (?U; (c; (ʠq; (; (t; (; (x; (; (w; (I; (6; (r; (; ( < (< ('< (F5< (vC< (X< (Ye< (ɴr< (< (< (+< (Ĝ< (< (< (< (<< (I< (0 = (0= (A= ( M= (Z= (kg= (Gt= (= (v= (= (s= (= ()> (6> (> (> (ޕ> (D? ( Q? (<^? (k? (x? (4? (@ (#@ (0@ ({=@ (IJ@ (rc@ (Rp@ (}@ (9@ (@ (W@ (`@ (m@ ($@ ((A (A (~5A (lEA (RA (&`A (mA (ӷ{A (A (A (<A (A (WA (.A (A (B (B (/B (?B (MB ([B (iB (-B ((B (9B (B (B ('B (ٲB (B (LB (N C (<NC (XSC (N]C (jC (ewC (C (MC (C (LC (C (pC (C (FC (%,D (ٷ=D (CD ( ID (~YD (XsD (+D (D (WD (eD (D (D (8D (=D ( E (E (*E (AE (DNE ([E (BhE (=uE (E (3E (E (E (E (E (F (-F (+F ((F (CF (;TF (ZF (`F (fF (՞lF (sF (|xF (F (YF (F (iF (gF (yF ("F (F (sF (G (c G ([,G (9G ("FG (`G (nG ({G (G (G (G (G (G (wG (G (G (G (QH (H (! H (߽-H (;H (IH (IVH (dH (uH ({H (4H (H (H (H (H (NH (H (H (H (I ($I (Γ,I (9I (SI (V`I (mI (}zI (I (I (4I (I (I (+I (I (I (U J (J (,J (JJ (_VJ (IcJ (qJ (}J (JJ (J (yJ (_J (J (šJ (WK (MK (&K (D7K (CK (TK ( aK (/mK (zK (IK (&K (K (EK (K (HK (K (&K ( L (H"L (&/L (^_ (qm_ (|_ (G_ (_ (_ (_ (u_ (K_ (_ (*_ (ʈ` (E` (P,` (m:` (uH` ({V` (d` (r` (` (` (` (ٮ` (` (` (` (O` (` (` (c a (a (T(a (6a (Da (Ra (8`a (na (|a (a (a (qa (ڇa (a (ea (a (يa (xa (b (@b (*b (7b (Db (šQb (U^b (Sqb ({b ( b (b (b (b (b (}b (b (b (tb (b (b (_ c (/c (چ-c (7c (Ac (-Oc (؈]c (kc (=c (_c (Ɣc (:c ("c (ۥc (c (vc (^d (d (d ((d (5d (^Id (Vd (cd (?pd (/d (Ad (Ad (?d (d (d ("d (od (d (d ("d (e (me (9e (K*e (\7e (De (Qe (^e (ke (xe (e (ue (e (Be (e (e (9e (e (pe ({ f (Lf (&f (3f (kMf (0Zf (gf (tf (sf (Jf (f (f (f (f (rf ( g (g (ng ((g (5g (Bg (͒Og (\g (g (\g (<g (g (ag (g (bg (g ({h (Th (h (l,h (69h (ՍFh (Sh (ʵqh (~h (th (h (Lh (h (h (vh (h (}h ((h (D i (i (`$i (7i (Di (nWi (di (šqi ("i (i (i (i (˛i (i (μi (i (7i (ti (J j (+j (8j (9Ej (4Rj (`j (mj (zj (jj (Nj ((j (j (j (Uj (j (+jw ((xw (w (w (w (w (zw (aw (w (w (w ($x (x (A&x (c4x (eBx (xPx (p^x ($yx (x (=x (x (x (kx (x (tx (x (y (y ( y (.y (Gy (Uy (sy (xy (+y (y (y (y ( y (z (W!z (ƙ;z (Tz (؈bz (;pz (Bz (z (z (ʥz (z (z (z (Ƨ{ (2{ ({ ( ,{ (:{ (H{ (=V{ (d{ (r{ (ۻ{ ({ ({ ({ ({ ({ (}{ ({ ({ (+| (| (!| (00| (?| (N| (]| (^l| ({| (P| (| (| (| (N| (<| (V| (˪} (} ( } (/} (+>} ('M} (e\} ("k} (z} (I} (ׯ} (} (%} (ő} (} ( } (} (M~ (o~ (~ (.~ (j=~ (<L~ (q~ (λ~ (j~ (ş~ (~ (b~ (u~ (A~ (? (D (/  (3 (2@ (/M (i (au (2 (P (Y ( (e (  (W ( ( (m (' (š> (Y (e (q (9~ ( ( ( ( ( ̀ (ڀ ( (Y ( ( (  (? (L (Z (g (t ( (t (š (ʁ (E ( (+ (1 (kM (/Y (u (Y ( ( ( (W ( (΂ (ۂ (/ (m (& ( ( (S) (՗6 (J (ΌW (| (G (j (" (m (à (٠у (߃ (& ( (  (J (j% (v9 (G (@U (c (q ( (0 ( ( ( ((ń (Yӄ (E ( (; (J  (_ (' (5 (tC (Q (u_ (m ({ ( (  (n (/ (Ϯͅ (܅ ( ( (  ( (. (> (T (c (Cr ( (ŷ (. (\† (Wφ (k܆ ( (& ( (w ( (* (7 (lD (Q (^ (mv ( (# (7 ( ( (ˇ (;ه (d ( ( ( ( ()- (o; (nI ({W (Oe (s ( (9 (` ( (R (Lj ([Ո (չ ( (S (  ( (+ (: (I (QX ((h (w ( (, ( ( (*‰ (;щ ( (4 (p (p  (m (+ (ć: (I (X (g (^v (  (k ( (@ (ъ ( ( ( (^ ( (J, (A (=R (X (. (b; (ݒH (U (6b ( (֨ ( (- ( (& (R3 (BA (uN (R[ (.h (u (J (+ (} ( (aÍ (؈܍ (β (k (+ (9 (F (S (؈` (&m (~ ( (؈ (. (t (c֎ (. (J (V (g ( m (s (z (< ( (y ( (9 (ŏ (ҏ (2ߏ ( ( ( ( () (6 (}M (Z (ˊ ( ( ( ( (-ɐ (ܺݐ (a (h (9 (Q (^ (lx ( (0 (c (r (gґ (ߑ (o ( ( (- (9 (G (` (s (} ( ( (X ( (Ӹ (͒ ( ( (e ( ( () ([ ( (X (t ( (X (rϓ (ݓ ( (S (i ( (>! ( . (~; ( H (jU (ͫb (eo ( ( ( ( (} (R (. (d” (6Ȕ (Δ ( ({ ( ( (Ϩ* (7 (D (Q (_ ("l (y (| ( ({ ( (Ĺ (ɕ (ו ( ( ( (> (w (o+ (Y^ (h (m (C (e ( ( ( (˖ (ؖ ( (i (? ( (( (ʦ5 (HC ( (K (\ (w ( ї (?ݗ (ް ( (+* (E9 (Z (Ȱ} (} (* ( ( (cǘ (͘ (Ә (٘ (ߘ (M ( (! ( (  ( (0 (V% (3 (? (P (V (\ (ۉc (p (7} ( ( () ({ϙ (ۙ ( ( (  ( ($ (= (J ('X (f (yt (' (ד ([ ( (o (Κ (<ܚ ( (r ( ( (" (?0 (? (Hb (y (; ( ( ( ( ( (( (Ӊݛ ( ( (  ( (% (c2 (? (*L (Y (f (s ( ( ( ( (| (Sœ (Ϝ (/ܜ (״ ( (x ( (8 (- (; (I (h (n (t (z (0 ( ( ( ( ( ( (q (0ɝ (Eם ( (4 (K (J (On (#| ( (j (Ŗ ( (\ž (О (ޞ (* (g ( (O (׳ ( ( (ޙ͟ (Ӗ۟ ( (( ( (- (! (/ (= (K (MY (`g (ݹu ( ( (+ ( (i (ʠ (~ؠ ( ( ( ( (\- (x; (Z (h ( v (٠ (N ( ( ( (bʡ (١ ( ( ( ( (I (d- (; (tI (W (e (s (J (iX (+f (st ( (ڣ ( ( (( (6 (yD (R (Ҷ` (n (| ( ( (\ (N (9¤ (Ф (ޤ (D ( ( (  ($ (2 (@ (m ( ץ (e (؝ ( (ѧ (wާ ( ( (=1 (G> (DK (X (f (p (z (ӑ ( ( (h (+ (Ϩ (ݨ ( ( ( ( ( # (~1 (H? (rM ([ (i (æw (A ( ( (b (ٚ (˩ (٩ ( ( ( ( ( ($ (2 ((@ (t\ (;x ( (n ( ( (< (ͪ (u۪ ( (` ( (' (z5 (B (O (cg ( (W (b ( ( ( (^ (S (ͫ (ԋ۫ (l (% ( (++ (=9 (G (ɗU (c (q (c (j (Q (3 ($ (Ŭ (Ӭ (0 ( ( (  ( (' (5 (C (zQ (_ (:m (3 ( (_ (ǭ (uѭ (! ( ( (Р (- (~l (z (ʯ (i& (%b (4 (= (#% () ( (  ( (: (?# (x4 (': (@ ( (4ʶ (Զ ( (# (k0 (4= (J (W (?p (} ( (w (^ ( (ӷ (߷ ( (, ( (U (  (J, (,8 (E (R (_ ( l (y ( (ۨ ( ( ( (Ǹ (2 (G (D ( ( (š! (. (; (k` (m (+z ( ( (ƹ ( (p (< ( (2 (p$ (2 (.@ (YN (\ (j (x ( ( ( ( (b (8׺ ( ( (r (6 (2 ((? ()L (Z (h (v (ܿ (؈ (  ( ( (Yλ ( ޼ ( ( ( (  ( ( ( ) (6 (C (P ( (& ( (k (ƽ (ҽ (!߽ (Ԍ (r (<  ( (z% (3 (LA (O (] (8k (b ( (ǿ ( () (؈6 (C (ŠP ('c (pp (} ( (؏ ( (X (64 (A (/N ([ (@w ( (\ ( (k (d (љq (k (' ( (+ ($ (1 (I (nc ( (9 (  ( ( ( ( (  ( (# (F (S (Šm (M ( (A (" (r ( ( ( ( (~ ( (G (+ ( (՜ (b ( ( ( ( (Q () (m (x  (dz (D ( ( * (N8 (F (mT (<r (n ( ( (> ( (/ (1 (_ () (\ (g 2y- ( ) (  (  ( ( %O  (9 )} )V &r ($ (40 (7 (< (GJ (Q (:X (Gd (r (}y (5 ( ( ( ( ( ($ ( ( ( ( (  (G (  (& (, (2 ((9 (F (S (` (m (Lz ( ( () ( (R (, ( ( ( (w (  (t (# (0 (< (H (T (a (]m (wy (a (  ( ( ( ( (k ( ( ( (r  ( ( (Z (B$ (P* ( 0 (6 (= (N (kT (iZ (` (f (kl (r (Ly (V ( ( ( (v (= ( ( ( ( (z (~ (L (T (I (  ( ( ( (^# (* (6 (D (P (>\ (i (ez ( ( ( (, (  ( ( (7 ( ( ( ( ( (D#2 (< (G (X (Md ( O (^ C" )K& )r* ). )2 )6 ): )> )B ) F )J )-N )HR )^V )vZ )e )j )o )t )y )~ ) ) ) ) ) )& )3 ): )C )N )X )_ )k )u )~ ) ) ) ) ) ) ) ) ) ) ) ) )  ) )( )2 )7 )@# )F( )M- )Z2 )f7 )r< )A )F )K )P )U )Z )_ )d )i )n )s ).x )<} )B )P )Y )e )m )x ) ) ) ) ) ) ) ) ) ) ) ) )  ) )$ )* )5 )C )Q )` )s )  ) ) ) ) )" )' ), )1 )6 ) ; )@ )8E )CJ )SO )hT )}Y )^ )c )h )m )r )w )| ) ) ) ) ) ) ) ) )& )0 )8 )? )K )V )^ )e )w ) ) ) ) ) ) ) ) ) ) ) )  ) )  ) )#! )/& )8+ )A0 )S5 )Y: )_? )hD )sI )|N )S )X )] )b )g )l )q )v ){ ) ) ) )  )  )  )  )(  )0  )6  )<  )C  )M  )W  )`  )h  )o  )z  )  )  )  )  )  )  )  )  )  )  )  )  )  )  ))  )1 % ): * )F / )O 4 )U 9 )d > )v C ) H ) M ) R ) W ) \ ) a ) f ) k ) p ) u ) z )  )  )  )  )  )  )2  )A  )P G<<'= ) += ) /= ) 3= ) 7= ) ;= )( ?= )C C= )Y G= )n K= ) O= ) S= ) W= ) [= ) _= ) j= ) o= ) t= ) y= )! ~= )+ = )2 = )9 = )O = )f = )o = )| = ) = ) = ) = ) = ) = ) = ) = ) = ) = ) = ) = ) = ) = )= )= )= )$= )-= )9> )L> )\ > )g> )t> )> )> )#> )(> )-> )2> )7> )<> )A> )F> )K> )!P> )/U> )5Z> )I_> )Wd> )ei> )nn> )zs> )x> )}> )> )> )> )> )> )> )> )> )> )> )> ) > )> )> ))> ):> )I> )W> )e> )t> )> )> )> )> )> )> )? ) ? )? )? )? )? )."? )L'? )W,? )g1? )|6? );? )@? )E? )J? )O? )T? )Y? )^? )c? )h? )m? )r? )w? ) |? )? )&? )-? )5? )<? )G? )T? )\? )d? )v? )? )? )? )? )? )? )? )? )? )? )? )? )? )? )? )? )@ )"@ )* @ )1@ )<@ )G@ )T!@ )`&@ )o+@ )y0@ )5@ ):@ )?@ )D@ )I@ )N@ )S@ )X@ )]@ )b@ )g@ )l@ )q@ )v@ )!{@ )*@ )4@ )@@ )J@ )S@ )Y@ )b@ )o@ )~@ )@ )@ )@ )@ )@ )@ )@ )@ )@ )@ )@ )@ )@ ) @ )%@ )+@ )1@ )AA )RA )a A )fA )rA )xA ) A )%A )*A )/A )4A )9A )>A )CA )HA )MA )RA )WA )\A )aA ) fA )kA )pA )&uA )0zA )=A )HA )WA )fA )uA*_`doo )o )o )o )/o )Eo )Zo )jp )p ) p )p )p )p )#p )(p )-p )2p )7p )@@@@6Rgg.?U@fw  G y   q  q  q   'x1 <xK X h }   &  @ @ ) ?]s1ccGc crcc)   o  < _ r     g. g@ gV       s - X; XJ l      $ T d u           C C!CG} 8gtvtaLddd9^!%,dddjjj0{B{T{h0 0 40 \z0 0 0 0 ) E ] n        &)R naff]jef.e;G9$<#_s9$!$$e ]B $D! $D- $D9 $DE $DQ $D] $Di $Du $D $D $D $D $D $D $DB $DB^SeB)7 $DC $DO $D[ $Dg $Ds $D $D $D $D $D $D $D $D $D $DB $D  B!"#B-#9#Bp##B $`($`R$mo$`$$$$$$$$"%%p&"((n ))\*++K,,7-% .%.9'/9g/9u/ $N/ $N/ $N/ $N/ $N/9 09G090R0X09 19X19111b1b1b2x.2'@2;M2]2l2;2(2(22(2g2 $N2 $N2 $N2 $N3g23ge3g3g336 3 4(4 !4 04!A4!R4!c4!u4!4!45!45!45!45!45!45!5!5!95!R5R#c5R#w5R#5R#5&5&5&5&5&6&6&)6&96&K6&]6&o6&6&6&6&6&6&6>(6'6`7`7'-7?7Q7c7u7777777Q8Zy8Z8V9V29H999::::~:S;SZ;S;S;Z<fF<fW<fh<f{<< $`< $`<<< =0=H=W=h=y=========>4>TJ>T\>Ts>n>n>>?? ?0?C?,"Q?1m?,"?1?"?1?Y"@1!@q";@^"J@"o@$@@o%;A%tA%A.%B$MBeB[%B%B%B'B)%C C'C%C)%2C'BC<%SCo%iC%xC%C%C%C%C%C%C%C%D%)D%&DD@'VD|&aDkD@'vDD|&D@'D))D))D))D)D.)E E)E&E.)3E)GEjEEEEFe*FkFFeF@FFFGG)G:GXGGGGH9H@oHqH IJIII I! I! 6J! aJ! yJ! J* Jp Kp YK yK K K K L "L :L SL kL L L L L L L M DM`M`MMe N]NN*O`O#POP_PqP4P9PPPPPQ#Q3QBQTQdQvQQQQQQ0QFQ0Q0 R0R0+R0=R0MR0]R0oRH RO R RRRRRS S/S@SWS]kS]S]S]ST]T8THTXT TUm Uv ,Uv FUv `Uv wU U U*U!*U*U&*UV0;V,W0;W Xa;EXXZ<X9 Y;2Ya;=YGY;RYaYa;nY;~Ya;Yk<Y9Yk< Z9[<\8 \K>\8&\<3\K>C\>Y\>\>\9\>\>\>\>\> ]>]>;]>Y]>m]>])?]e?]I?]?]?] $O]?]?]?^?^ $O^?,^?<^?G^ $OP^?`^?p^?^$^$^5^@^5^5^h_h,_@Q_h_@__@__@<`'U`@``@``@a:aA_aFAqa@|aaFAaa@aFAaAaAaAaA bA0b9BMbbbHBbbHBbHBbbHBcHB c5cHBXcuc|Bcc|BcBcBcBcBc C d Cd C+dC=d!CHdRdC]dld!CydCdd&Cd}O}6k}6w}},6}}@6}o}5 ~o~@63~oF~@6\~o{~6~o~@6~oI6"j63j6Dj6U6h07tN7N7\77888O8%O84O8F5f559ƀ8Հ589 494b444ށ4EE@0EK@a"Et@+E@PEƂPE܂_PE_%rE8_M{E`_ #JUp{pCC4?-OX_nyE ! &* 8} H X h x 0 |     - & < N ` r   Pp@@M.>N{^q kk# $ !$xoBzxBxx|2BRg,>Pbt;;H[  5!!!3R#F&Y&i&y'';  k S2 kG Y k }   G ^     1 C d    ," 1 ^" $  %. )%@ )%R .%b e%r % % %& |& |& '  ) ) .) .) e2 wD O Z e o  * &* l*   ] <  : : H  / / / 700!01Y1Ag1Qg1a2t2P2+Y2{2{22222 202@2P3`4p44445os5o{5{56&1@6<oG47Va8q8O8O85r90;J;a;a;k<*9G<Y<k>{>>>)?0?e??,@@0@BAR9Blw!C!C&CE@PE_*+` .symtab.strtab.shstrtab.rela.text.rela.text.unlikely.rela.init.text.rela.exit.text.rela.rodata.rodata.str1.8.rela__mcount_loc.rela.smp_locks.rodata.str1.1.modinfo.rela__param.rela.return_sites.rela.call_sites.rela.ibt_endbr_seal.orc_unwind.rela.orc_unwind_ip.note.gnu.property.note.gnu.build-id.note.Linux.orc_header.rela__bug_table.rela__jump_table.rela__patchable_function_entries.codetag.alloc_tags.comment.note.GNU-stack.rela.data.rela.exit.data.rela.init.data.rela.printk_index.rela__dyndbg.rela.static_call_sites.rela.gnu.linkonce.this_module.bss.rela.debug_aranges.rela.debug_info.debug_abbrev.rela.debug_line.rela.debug_frame.debug_str.debug_line_str.rela.debug_loclists.rela.debug_rnglists @E@@@;H+@F~&@K@H?W:@XYHOXJ@[0H_Yc Z@8[ H g2hc {p8v@dH Pq,@hH2|q#w{@@iH|@lH}d@hpX&H @H t@&H8@)x$<0H̔Y T@8H!j`e@0H#|``@w@H%0p  @H*(@xH,0@H.8@H0  @`H20@@ H4/@*@`0H6ISN@8H9gb@H;sQv s@ =H>  @0 H@00^1 5t@X_HD@020HF )I# `J